Worcester High School of Commerce - Caduceus Yearbook (Worcester, MA)

Text from Pages 1 - 232 of the 1931 volume:

:Sv gli: Q ,- M ni 'H ww.1z,.L N .. ydlxf' Aiix! -:W 1 u .4 - ,452 '4' 1-.5 1' -Q- ,.f. . .. , 3 , way, v .N ,r N w -.. mf he x N rw. L 1 4' -...A fx ,Q -1, M. . , ..G-,f,f ff 314' 'V V ,pg ' fx' r Y-m:..:.V - , A 1. 1 'Y . ' L . ,J , grrfw, .ma A af, rf , k ,AJ S... 4-ef I 5 N A.. x. .f Q t,,.i. X v ' -N S 1. Q Q gi 25 2 35 J' If ,.. 42 'F 11 ' N ge mon 501100 ' common X-fm 95, 5? Vs 63' YE .ag A 'J ' , - - HI 3 QU 691 QQ X - 'A' M-mum Q X W 05453 1 To Zahn wi. wakes Beloved Teacher In rzpprfciation ana' yratitude for his sinrere and Pnfrgefic efforts, whirl: have made possible llze successful prorlurtinns of the Blzlrkfriflrs. Twin, the 62111355 nf 1931 rledimte this Caduceus. Ez S K, 32 55 T Q , Q Sb K' Q LE 9 5 Q . Q5 K' QQ CD J I SE 1 3 Q PQ si Q J ? Q 52 9 SC Q 'Q 2 S .5 T Q E 9 SE S ? 'CQ 52 2 S 2 S 2 5 5 Calvin H. Andrews, Prinfipal 2 5 5 C S 2 fa 4? ff fx-N fig 6 T ' n1Wm'lh 'W QM Q' f J if ff W I' . J WLM' ' 5 4 Z 5 I , 6? -jf-9 . - 5 5 :' 7' 'Z ' ' I - 'LL f- C , f' K A J ? oo XG LJ if- ,MW 0.8033 f .5 ' si - 'Q NWA 'WM f Z . f ,wa ws, 494 L. ' . A . Z Q 'IW '09 72 fifw 5 fy iw? f?f M ,f 96 if 6 2 O 4, f mfg f' f ,,,,4 7 an Z Z f 4 Z 1 I f,f 09 I v' 1 4 4 9 ff f' Z g Z f 5 if 5 Q 44Ff6?9f 1 1,424 19,1 I f 1 Q 7 f ff , 1 f 1 J f' I 1 f' 4 ff P' I f I ff f f , ' I 9110 Z 4 W' Z M9 5 fu ' 1 01 I f CLQBSVQMA CURSE 0319313 EHDHZHJN CHDIRVIDD RULQND EQIZKSON Him PQTTER DOROTHY 2m f 4 A WS SQWEESESS W UWM WW mm Qosi Jcmus W X Qgmq Nggpgmgm VWRY PRENDERCW r1nRmRs1 PHKLUPS ROSE RILEY PDUL RIVERS EDGHR W W HNDER EVELYN BTULIKER WH SCDNLON NURD WWE KNHERWE CROHIH IEE QQQD EIQITORS 1 W W .. f Am A M NL E fix Ag K - - - - l A -' : - yy , I .-Iif 5 h Ni ff 4 '28 abfif ' A. Ti ff . K 'ff :A-1 ' - ' , ' Cf 1 .Q 1 b ' 1 1' v, .- l, ie. N hs . - A .ig-Z, K --.. If XL N . k ,, 2-fy P W Q f X LS - T ., .A Q --L ' 'fF2jQf:QQ.'L Y - ' W Q V ,Lv V ' Haw 7 ,H Vg' f,,' f XE 'AV W 4 ll M E I ,NX X - W ff, XR -A Y , g y V A x 1' ' X f ' 3 WTV'-. M' ' 1-7 , f 1 ,f xl N I W , X W X XA I N, 1 13 QT if A N21 ' , J ,M 2 ,, Q ' 'f Jw ,ff 4 g q ' 'xv Auf- L Y fx 1 ff Nz X T 13 ik X ' - Q Q L F f 12' inf ' fx fx X 1 N' I Y - ' : ' E f T ' ' 5 L- , ,f wxxwmxx ww xxgxxwxwxwwww -fx mggwwxwxwt' , - X Q L Q-I BEM JACOE:-JSQICL'-19 - IDILASSSILA ROSE JONAS- CHAIRMAN SARAH ADEESTEN CHESTER CANNON FRANCIS EAGAN MTLDRED EARREEL PEARL KEN? CARL NORD GREN BARBARA MO ODY EDWIN SMTTET DOROTELYMTALKEQ lllll ASS 33v1llBv ANNE EGAG ON-CEATEMAN PAUL LVXQTNTYREI EUGENE CASEY CHESTER CASPEESON' JOHN COLLINS DORIS I-TAGG EVELYN M. HANNUS BERNTCE DOWNKNO STEVEN SAVAGE HIGH SCHOOL OF COMMERCE ,LO AX L e to filli Y! ' i2'!!'5ifi'f'i!'f 'E ,gzwfff-g'1'1g! ':1 1X' 5?f!'E 2'T g,H':g:g1+f2f'f1g' wi Andrews, Calvin H. Boyden, George H. Casey, VVilliam J. Barnes, Nora lVI. Colegrove, Louise Dorsey, Mary . Burdette, Alice . Leahy, Margaret T. Ryan, Blanch M. Werner, Ruth A. Woods, Ethel W. Anderson, Ethel E. Beal, Wyman L. BosWorth,, Isabelle Bousha, William L. Bowen, Mildred Bowman, A. Clair, Boyden, Ruth L. . Boyle, Thomas E. Bradley, Mary M. Brierly, John E. Brooks, Bernard F. Brown, Margaret T. Burnell, Floyd W. Buxton, Grace A. Cahill, Harry Carlton, Louise E. Faculty Matheiizatics Page Nine . -. Principal . Assistant Principal . Assistant Principal . . Librarian Head Clerk . Clerk Clerk Clerk Clerk Clerk . . . Clerk Assistant to Miss Carrigan . . Science . Physical Instructor . . . Science Bookkeeping-Typewriting . English-Botany . . Latin Science . French Economics . ' . . English Stenography-Type-writing . . Bookkeeping . .lournalisnz-English . Science English -A Oi D f i 1 - Vfizsiilziggwftfi i Efillilgwil Carrigan, Laura E. Christenson, Mildred E. . Cheney, Grace . Cole, Pauline A. Coney, Harriet M. . Craighead, Elizabeth M. Creamer, John F. Crommett, William G. Curley, Francis X. . Curtis, YVilliam E. Darrah, Frank . Dempsey, Margaret E. Dexter, Arthur L. Dexter, Burt L. . Dickie, H. Allen . Disney, Charles E. Dolan, Edward . Donallan, Margaret M. Doran, Francis J. . Duguid, Sadie J. Dymond, lvl. Emily . Eastman, Alice B. Elfstrom, Gunhild Ellis, Grace M. Erwin, Mary E. . Flagg, Florence M. Friel, Mary ,. Gleason, Francis G. Greenlay, Ruth P. . . Greenwood, Helen E. Gunn, Mary I. . Page Ten Office Practice-l ollow-Up Work . . . Drawing Typewriting . French U. S. History . French Matlzenzatics . . . English Stelzograplzy-Typewriting . . lllathematics Drawing . Bookkeeping Fren ch--Spanish History-Economics . Erzglish-History' . Economics . . Typewriting lllatheinatics-Science Physiology?-Botany . . English--Economics . Stenograplzy--Ujjfice Practice . . . Typefwriting . . . Latin S pmzislz-ZW athematics . French-German . . English Mathernatics . Bookkeeping- . . ' . English BOOEECCPHZQ-Tj'PEZL'I'lflHg . Qi , L Higgins, Marion L. . Horne, Mildred . . Hussey, ,Francis P. Hutchins, Charles E. Jagodnik, lklartha H. Johnstone, Oliver Jordan, Charles H. . Kane, Thomas F. . Kavanaugh, Helena T. Legg, Marion C. . Libby, Margaret A. . Lombard, Grace M. . Lowell, Charlotte R. Lundstrom, Edna' O. Matthews, Olive Moran, lVIary A. Moreau, Elsie G. . 'Moriarty, George F. Morrill, Walter A. McCabe, Evelyn lVI. McCann, lllatthew R. Mclver, Jean B. . McKenna, William T. Newton, Anjennette Oakes, John W. . . O'Donnell, Margaret H. . O Leary, John B. . Olin, Paul A. . Osborn, Willard L. . Peterson, Clara . . Raynes, Mildred R. . S Page Eleiwn Latin . . Bookkeeping Typewriting+Penmanslzip . . Peizmanslzip Co mmercial Law fllathematics . . French Bookkeeping-Law . . English . . . Stenography Stelzogr1lphy4TypewriZing . . , . English . .. . English Stenograplzy-Typewriting Office Practice--Typewriting . . . English . .N ' .' English Typewriting-Q-Stenography . English-French . . . Sten ography -Physiology-General Scienfe . . . Physics World History-Zoology . . lllaflzematics Salesmanship . . . Spanish Sfenogmpliy-Ty pewritin 51 . . . English Spanish-Englislz . . History s taut Physical Director . Drawing 3.0 is - 1 as ,-V v-9-fe-i g-Q . . . N Hi: 5: wg uf' m fggfsz' VQETHII ' ffffQYlf! ,,Q ' 453155, e:.1e.i.,.JxF:54giQ5ev 0325? Richardson, Carlton E. Richmond, Etta M. Rogers, Marguerite Ruane, Edward E. Sampson, George G. . Savage, Helen V. Schofield, Jennie E. Sexton, Mary M. Smith, Laura G. Smith, Pauline A. Smith, Ruth A. . Snitseler, Ruth . Stickney, Myron W. Stimpson, Helen Sullivan, Thomas F. . Sweet, Frederick A. Treat, Ethel E. VVall, Roy H. VVaite, Jane G. . Walsh, Henry C. . Ward, Ralph W. Wilson, Edgar VVOodWard, Ruth L. . Page T fwelve English . English . . Mathematics Salesmanship-Economics-Law . U. S. History-Law . . English . . . English Stenography-Typewriting . . . English . History . Bookkeeping . French . 'Chemistry . .llflathematics . Latin-Mathematics . Mathematics . Journalism-English . . Science . . French Law-Economics Physical Instructor . . . Harmony . Stenogrezphy-Typewriting ,W - J ,,-gggg,,9QggQg,i'5f--,.,k 5x,,,.,,, ' N f 1 v 17 if ff ,Q 'Liz' A 3 'ff ii:-Life 5355? 1 fxxfh. W ffm ii QW 1 an i gy i? 39' f I M522 31-A 19 OF CLASS gotta f f A 41---liig' .iiifbz T Class Officers and Committees,-1931-A President, Maurice Krinsky Serrefary, Beatrice Greene Vice-Prexidezzf, Grace Peterson Treasurer. Kenneth Stewart PHOTOGRAPH COMMITTEE Dorothea Jenkins, Chairman John Higgins Julia Levinsky CADUCEUS COMMITTEE - Roland Erickson, Chairman ' Dorothy Bell Rose Jonas A Paul Rivers Stella Burns Rena Nordstrom Evelyn ,Stoliker Jean Ducharme Margaret Philips Nora VVerme CLASS DAY COMMITTEE I Virginia Fair, Chairman Evelyn Bedig Leon Ranchynoski William Garrepy V Helen O'Sheasy P SOCIAL COMMITTEE Roland Tannebring, Chairman Violet Ahl Charlotte Grant Gertrude Gaumond Kenneth Stewart CADUCEUS ADVERTISING COMMITTEE Roberta Yvelch, Chairman Sonia Epstein Ethel Forsman Elizabeth Golub CLASS GIFT COMMITTEE A' 'Ethel Davis, Chairman Edith Almgren Leo Hehir Herman Eurenius Alice llflorrisex ' DECORATING COMMITTEE I Marie Beck, Chairman Wyman Allard Grace' Bergeson Ruth Lipson Ralph Anderson Henry Fitzmaurice Grace Peterson . CLASS MOTTO COMMITTEE I Viking Anderson, Chairman lVIary Goldberg Bessie Mina Eba Larson Vera Polini CAIDUCEUS EDITORIAL COMMITTEE I by - - kRose1Jonas, Chairman I Q T. Sarah Adelstein Mildred Farrell Barbara IVIoody Chester Cannon Pearl Kemp Edwin Smith Francis Fagan Carl Nordgren ' Dorothy Walker ' ' Page Fourtefn lr R' s JEs' ' XXQ 4,31 wg 1,4, jx 1,1 HU' il s-1 'urailelfolz ffuall :elf :vinls l's Ilfv alll 'Iv ' lv 11: sv 14I l H: l'HH1I uw - fl 71 New T HM :ff W sw T fczivfni Wm' H 'g 4HfI1'TX Class Officers, 1931-A President . .. ..... MAURICE KRINSKY l7ice-Preisdenr . GRACE PETERSON Secretary . . . .... BEATRICE GREEN Treasurer .... KENNETH STEWART Page Fifteen ' 7 W vii O 5,--.:i'-' ' ff-as-'ff' ,:.a, if ,, 5.,, S 5 'yi H Isiwgaig H Y XIX I I I - L 53.5 MQQL-:i3c.,1M'ss,..,.s1j' M- 039 am Sigh Class Day Speakers, 1931-A MAURICE KRINSKY . . . IRENE VVERNER .. VIRGINIA FAIR CHARLOTTE GRANT IEAN DUCHARNIE . MILDRED RICE ..... MARGARET PHILLIPS Page Sixteen . Address . . . Vovalist Historian . . . .Pianist . Uralor ...Prophet ....WiIl , A AMX, L.-..',-,' .72 711112myiyfip'limgf:12igz2f'w2is1i girfwwgfi, i1 i, do CHEF Class Day Program, 1931-A OVERTURE-- Sradella ...... . Flotow High School of Commerce Orchestra PRESIDENT'S ADDRESS Maurice Krinsky VOCAL SOLO-'iFiddle and I Irene Werner VIOLIN OBLIGATO-- Voices Calling Dorothea Wilder CLASS HISTORY Virginia Fair PIANO SOLO-- Deuxieme Balladeu Charlotte Grant CLASS ORATION AND PRESENTATION OF GIFT Jean Ducharme ACCEPTANCE OF GIFT Principal Calvin H. Andrews CELLO SOLO- The Minuet in G . . Beethoven The Cradle Song . . . Shubert Rena Nordstrom CLASS SONG- The Blue and Goldu Roland Tannebring, Kenneth Stewart CLASS PROPHECY Mildred Rice CLASS SONG Words by Beatrice Green, Music by Roland Tannebring and Kenneth Stewart READING OF THE WILL Margaret Phillips SCHOOL SONG Class of 1931-A CONTRA DANCE High School of Commerce Orchestra Page Se-vente W-v l:1V2i S-1:-1-ffl ' ' fly' if Q-re f V t MJTTTL W.. ,.- ,.,..,,,. T tift'-' K ' s , f,,f tags Address of Welcome MAURICE KRINSKY R. ANDREWS, members of the faculty, parents, guests, and fellow classmates: This is the last meeting of our class within the portals of our beloved school, Commerce High, and in behalf of the class of 1931-A, I welcome you all as our guests to this more intimate gathering. We cannot let the occasion pass without expressing our deepest gratitude for all that has been done to aid us in our school life. We are grateful to our ever understanding and kindly principal, Mr. Andrews. to our teachers, who possess in great measure the chief attribute of a teacher-patience--and to our parents and relatives who have aided us in innumerable ways and ever generously. Eager as we are to enter into the professional and business world, yet, there is a feeling of regret on this, our last day together as a class, for we have been happy together, we have many pleasant memories and like all good Americans we like each other and so we do not like to part. We will try to-day, to express in our little program and in such other ways as we can, the sentiments proper to the occasion and that we sincerely experience in our hearts. 'i' Cp ftf' J l ,cc .c 4, xg K2 Page Eighteen OZ li ml lfmwl . fm .la HU IM 2. ' Class Song Beatrice Greene Cheer our blithe young Mercury Cheer him to the skyg Ever wave the Blue and Gold, Sign of Commerce High. Winged feet of Mercury, Take our heart with you, As we sing this last farewell To the Gold and Blue. Blend your voices now in song, Hail the Gold and Blue, Let the melody ring forth, Loyal hearts and true, Rise now and salute them, Sing with all your heart, Pay them one last tribute Ere We all must part. Grateful thanks for happy days, Valued as pure gold, Days of fervent, youthful joy Spent within thy fold 3 Shout for all those classmates dear For friendships tried and true, Made beneath the banner folds Of Commerce Gold and Blue. Class Motto Class Colors Frez From Froplzch Frzsh Nzle Green and Wllzte Page Nineteen LO, ..s...1 1 T li 3. Class History, 1931-A VIRGINIA FAIR X NCE upon a time, as stories begin, herds of. bashful boys, deeply aware of their first long trousers, and girls,-self-conscious, yet secretly proud of their en- trance, came from all directions to attend the High School of is Commerce. Qi M To-day in the dignified and sophisticated demeanor of the Seniors one finds little resemblance to those young hope- fulls who assembled in the hall that February of 1927, yet I must admit that they compose the class of 1931A of the High School of Commerce. Although we realize that our position in the school demands an attitude of aloofness, the members of our class have been noted for their merciful and charitable : Ili A 1 'L A , feelings toward those unfortunates-the freshmen. Little did we think during those first few weeks of our high school life, that there were in our midst such star athletes as Tony Ambrose, better known as Wayne, shy Bill Garrepy, little John Clark, and Leon Ranchynoski. The efforts of our girl athletes, Bea Greene, Ethel Forsman, Gladys Wester- lind, Evelyn Stolliker, and Mirilda Dube, were also a source of pride to our young element. When the Freshmen Orchestra C was organized by Mr. Wilson many of our musical geniuses were on display. This group included Rena Nordstrom, Roland Tannebring, Kenneth Stewart, and Roland Erickson. Then came the big event of the year, the class games at Beaver Brook. The day which had been intended for the great event came with rain, so the games were postponed until the following day. We, little Freshmen, were all thrilled at being able to witness our first Class Day. Dreszed in our ciass colors we gathered together and cheered and applauded from the grandstands. Socn after our entrance to the school we elected class officers as follows, Presi- dent, Roland Ericksong Vice-President, Evelyn Stollikerg Secretary, Roxie Erickson, Treasurer, Kenneth Stewart. So, quietly for the most part, our Freshman year passed. Our firstlyear served rather to weld our members together, so that by our Sophomore year we were a more unified and distinct group. At the beginning of our Sophomore year our class was nearly doubled by the Page Twenty aQaxe Y I7 iflwgva 1.1:' :align:H'flI lfiZ115YiT2l '4'f 'i? l -w fiil 1f 1f I f wfig' Ill! 1I1 VV' -!l5ii'P lill lvilfjwi 1 432 entrance of the studentsfrom the Junior High School. Some of these newcomers were Maurice Krinsky, Beatrice Bagusinskus, and Wyfman Allard. Class officers were again elected as follows: President. Maurice Krinskyg Vice- President, Frances De Longg Secretary, Angella DlErricog Treasurer, Kenneth Stewart. The different organizations soon claimed many worthy new members. The French Club could now boast of having as members, Roland Erickson, Irene Lamothe, Jean Ducharme, Mildred Rice, and Marie Harbor. Grace Peterson, because of her eloquence in public speaking, was a very welcome addition to the Girls' Debating Society. The Britomart Literary Society added to its list Bernice O'Connor, Edith Almgren, Alice lVIorrissey, and Edna O'Neil. Charlotte Grant, Elizabeth Clifford, Evelyn Bedig. and Ruth Davis then joined the Bumble Bees and have been buzzing ever since. V Our boys continued their fine work in Sophomore athletics and our girls who had played hockey and basketball during their Freshmen year were again on the field. That year our Second Cross Country victory and Baseball Championship were won. Four members of our class who were instrumental in winning these victories were John Higgins, Stanley Lind, John Hanigian, and Edward Everard. Leo Hehir achieved distinction on the links by his skillful manipulation of a left handed niblick. , During one of our Sophomore assemblies llflaurice Krinsky delivered one of his fiery speeches. One could easily see that this lad was seeking laurels for his class. Five boys left for Cuba with the Drum Corps. This Drum Corps secured the championship of the East. Our class representative was the worthy Henry Fitz- maurice. The Blackfriars Society staged their annual play, Quality Street, in which Roland Tannebring played the lead. As expected, the play was a huge success. Then there gathered once more at the famous athletic held, all the happy and excited groups who waited for the games to start that would be the talk of the year. Through the courtesy of the Worcester Evening Post, we were invited one Saturday afternoon to attend the Holy Cross Game. The game was won by Holy Cross and was enjoyed by all who attended it. The spirit of co-operation during our Sophomore year showed conclusively that we had now developed a strong spirit which enabled us, both individually and as a group, to strive for the good of the class and of the school during the next two years. We swarmed into our Junior year and it seemed that inspection must have been getting pretty rigid, for many of our fellow students dropped their school work. During this year our school made a wonderful showing in athletics. The winning Page Tfwenty-one ...ffQ,ff? E 17' 'Nw LIMIEQilp.4e?Sgll'liViiLlL5il'lllliiilI.LT7i. 'fl QV of the Inter-High Cross Country and Indoor Track Championships were surely incentives for the boys of l93lA. We received the Inter-High Baseball title and obtained permanent possession of the Telegram Cup for winning three consecutive years. Our Varsity Basketball squad received gold rings for winning laurels for their school. Beatrice Greene was again chosen captain of the girls' hockey team and under her guidance the team had a very successful season. The Varsity Basketball Championship was won by the girls' basketball team that year. Tony Ambrose and Leon Ranchynoski were the shining lights in athletics, Tony proving his prowess as a football player and Leon as a strong man. Our long vigil of the seemingly very slow erection of the new annex was rewarded soon after the Christmas holidays. At first we missed the close order formation of the old building. However, we found our new, palatial surroundings very pleasant. Christmas was celebrated by the beautifully staged and admirably acted play The Holy Grail? Nor should we pass without mentioning the thing that was not the least source of pride to us, the scholarship of Roland Erickson, Esther Katz, Evelyn Stolliker Ebba Larson, Rose Jonas, Frederica Donley, Sarah Adelstein, and Sonia Epstein, and of other quiet souls whose achievements we have not time to mention. On April 5 the Junior Prom was held in the Bancroft Hotel. It turned out to be a very gala affair and everyone enjoyed themselves immensely. Fine judgement was displayed in the election of our class officers, MRUYICC Krinsky, President, Frances De Long, Vice-Presidentg Angella D'Errico, Secretary, Kenneth Stewart, Treasurer. Some of the fortunate ones to be chosen this year as members of the Blackfriars Dramatic Society were Dorothy Bell, Agnes Lovejoy, Marie Beck, Mildred Rice Irene Lamothe, Jean Ducharme, and Roland Erickson. This honor comes only in the Junior year and is looked forward to, by many, from their Freshman year, on Class Day soon arrived and as usual it rained. We hope that at some future date our successors will have the pleasure of attending a sunny Class Day. However, the rain did not hinder Commerce from winning its share of victories. Two boys who achieved distinction in winning victories were Pete Sackalowsky and'Leon Ranchynoski. Nothing could have delighted us more than the beautiful staging of the Black friars' play, The SWan,'y which completely captivated the audience. Roland Tannebring again played the lead, and other members of the cast who helped to make the play such a great success were Mildred Rice, Jean Ducharme, Leon Ranchynoski Maurice Krinsky, and Roland Erickson. Thus ended our Junior year. Page Tlwenly-t-wo D Jig J,f . f 7 wi Ji A fi TETTWQUZWMTTXXI 1 4 1 Cfwcggzv VVe were now prepared to take up the arduous duties of Senior life and we were determined to make this year, our last, the best of our high school career. Conscious of our position in the school we now squared our shoulders and lifted our heads in order to show our superiority over all under classmen. Surely, had we been given a physical examination at that time we should all have received A in posture. The officers elected to guide the class for the final part of our school career were: Maurice Krinsky, Presidentg Grace Peterson, Vice-Presidentg Beatrice Greene, Secretary, Kenneth Stewart, Treasurer. This year Commerce and South tied for lnter-High Football series and Com- merce clinched the Inter-High Basketball Championship. VVhile the boys were covering themselves with glory in football and track, our girls, not to be outdone, were practicing steadily on the hockey field and achieving many victories. An outstanding member of our class, who is known as the girl with the golden voice, is Irene VVerner. During her Senior year Irene was selected to go to Chicago to sing at the National Supervisors Convention there. Dorothy VValker and Alvin Goodwin were honored by being chosen captains of of the girls' and boys' tennis teams. At the beginning of the term a new Mercury staff was chosen and it was com- posed mainly of members of our class. Mildred Rice was appointed Editor-in-Chief and was ably assisted by Dorothy Bell and Roland Tannebring. Our class members have been prominent in the clubs of the school and many held offices. Maurice Krinsky is serving his second successful year as President of the Blackfriars Society, with Dorothy Bell as Treasurer. Jean Ducharme was elected President of the French Club. Charlotte Grant was elected President of the Bumble Bees, with Marie Beck as Secretray. Ruth Davis and Helen Cronin are oiiicers of the Britomart Society. An event that was a memorable affair was the Senior Prom, which was held at the Bancroft Hotel, November 7. The dance was very successful, the only difficulty being that the girls could not keep track of their boy friends, as the boys seemed to be so much in demand. Chester Cannon received the distinction of having his poetic ability recognized by having one of his poems printed in a local newspaper. An unusual event that took place during our Senior year was the celebration of the Tercentenary of Massachusetts. Many of the students attended the celebration in very unique costumes worn by our forefathers. Jean Ducharme and Roland Erickson represented our class in the Armistice Day celebration, both making speeches in their own inimitable ways. The play chosen by the Blackfriars for the year is Mary Rosef' by Sir James Page Twenty-three . Q0 ax --- af of , HQ - V A'A' G?i1kw2'! U i :':1 '? si'fy:es22f'i1i'fe25, X ' 1.15 ' ' Barrie. VVe know that this play will be as successful as their performances have been in the past. The days passed speedily and soon we Were ready to elect our class day speakers. The following were elected: Class Orator, Jean Ducharmeg Class Pianist, Charlotte Grant, Class Musician, Rena Nordstromg Class Will, Margaret Phillipsg Class Vocalist, Irene Werner, Class Prophet, Mildred Rice, Class History, Virgina Fair. Thus the four years of happy high school life have passed, and it is with heavy hearts and the deepest regrets that we come to the end of our high school career. But, with high hopes to realize fully the expectations of those who have led and directed us during these four years, and with sincere wishes for each others continued happiness and success in life, we, the members 'of the Class of 1931A of the High School of Commerce, bid farewell to our esteemed principal, Mr. Andrews, our ever helpful teachers, and to our beloved classmates. lv jo Page Tfwenly-four L05 V ,.!.,:, , ,,,,,,f' X ' -'W 'M' M . W Class Oration JEAN C. DUCHARME Mr. President: N a wretched frontier hut, was born on the 12th of Febru- ary, 1809, a boy who fifty-four years later was to sign the grand decree of emancipation that gave liberty to the slaves of the United States. An offspring of the wilderness, a child of poverty, he had to win his way by the sternest labor. He gained an education against the severest obstacles, and thus he developed qualities sure to make him a great man-a high sense of honor, noble instincts, an earnest devotion to life's duties, and a practical ability and unusual powers of expression, which enabled him to win his way with men. Lincoln had a line mind and a splendid physique, both developed to great perfec- tion. He was a natural student, trained largely by his contact with men, but not neglecting every opportunity to master the books that he had at hand. At the age of eight, Abe Lincoln swung an ax and helped his father erect a crude cabin on their farm in lndiana. He early manifested a desire for knowledge that nothing could check and that forced its way through all obstacles. His scanty schocl education taught him little more than how to read and write, and he had to depend upon himself for the rest. His stepmother helped him all she could and taught him all she was able, and on this slender foundation the ambitious student built nobly. He borrowed books, read in the evening by the light of the log fire, wrote on a shingle when paper was not to be had, and worked out problems in arithmetic on the back of a wooden shovel. The first book he owned he paid for by three days labor on a farm. This book was the Life of VVashington.,' He was a man who grew according to his needs, his mind mastered the problems of the day, and as the prob- lem grew harder, so did his apprehension of it. It is sometimes commented upon as remarkable that a man like Lincoln should have risen from conditions such as marked his youth and early career. Americans then, and Americans now, have been among those who raise the question. It may be excusable for men brought up in the other countries to wonder at the possibility, but for an American to do so is to doubt his own institutions. and to question the power of democracy. Pagf Twenty-16-ve ,JMR t. 7 VV! '-1:' 11' 1 !Sa:!g'H1: !!l'lElfil' f' llgzvviiisvri v '-11'f1: 'v1v1v11 ii111:11vcrfyv:::41lsmI::f YQ 1 ig .,........ r 3, A 61343 VVhile a young man on a Southern trip, he witnessed for the first time a human auction of negroesf' The scene stirred his feelings deeply and on leaving he said in stern accents, If I ever get a chance to hit that institution, Illl hit it hardf' In a debate with Stephen A. Douglas, his words set the country to thinking He said: A house divided against itself cannot stand. I believe this government can not endure permanently half slave, half free. I do not expect the Union to be dis- solved, I do not expect the house to fall, but I expect it will cease to be divided. It will become all one thing or all the other. On January 1, 1863, he issued the Emancipation Proclamation, freeing all the slaves within the boundaries of the United States. By his courage, his justice, his even temper, his fertile council, his humanity, he stood a heroic figure in the center of a heroic epoch. He was the true spirit of the American people in his time, the pulse of twenty million people throbbed in his heart, and the thoughts of their minds were uttered by his tongue. W To the South, his death was a calamity, the direst misfortune that ever darkened the calendar of her woes. The people of the South have always felt that his untimely and tragic ending was one of the severest tragedies of the war period. They believed that Mr. Lincoln would in his second administration, bend all his energies toward reconciliation and binding up the nation's wounds. All his utterances respecting the South were broadly patriotic, sympathetic, and expressive of a desire to restore peace, prosperity, and self-government. In the Republic's oneness the Americans of all sections shared in the heritage he bequeathed to the nation and Americans of all sections honor and revere his memory. Not only, then, has Lincoln come to be a truly national figure and to represent, in his hopes and ideals for Americans and American institutions, the North and South, the East and West, alike, but wherever thoughtful men, or hopeful men, turn to American institutions as the hope of democracy, he stands forth as the heroic figure on the horizon of time. It is more than a half century since his death, yet today he is one of the great historical figures of the world. As did Lincoln, as God gives us to see the right, let us strive on to finish the work we are in, with malice toward none, with charity for all, and with firmness in the Right. Page Twenty-.fix a O - e A4A,, r Xa M' V i..Q.f:...........................,.,........... Class Prophecy, 1931 -A MILDRED RICE T was just the other day, fellow classmates, that I rocketed to the moon in one of Prof. Goddard's perfected rocket ships! The atmosphere about the moon has a strange quality which enables one to penetrate the future. As I stepped from my rocket to a high, rugged promontory of Moonland, I was amazed to see before me the record of the things fore- ordained for you and me. With the aid of the lVIunson Sys- tem, I took down a few notes which will be here directly. CMessenger boy struggles in with huge valise, which he opens, disclosing quantities of copy. Prophetess extracts desired notes which she prepares to read while the messenger takes valise off-stage with great diffi- culty.l With the deftness born of experience in the picture-talking business, Dot Jen- kins was manipulating the Moon control of the television, and called my attention to the various planets to which inhabitants of Earth had migrated thirty years before, in 1931, during the great panic. Hilding Anderson and Victor Sepavich, it seemed, had discovered that bits of flying planet could be brought under human control and be used for air taxies, and it was in one of these vehicles that I was taken to Mars. Gleaming red beacons warned us that we were nearing that planet and as we drew close, the beacons proved to be the members of the Planetary Guard dressed in red phosphorescent uniforms. Although it was dusk when I landed, Everett Mars, as Captain of the Planetary Guard, greeted me. A squad approached to relieve their captain and in the lead I saw William Piloponis, followed by Alberta Buchinsky, Ada Lubin, Eleanor Scola, and Ruth Barsky. Ruth informed me that the members of the Guard lived in a little Earth village governed by Falvey the Conqueror, while Edith Almgren, Valberg Carlson, Rose Goldman, Eunice Nelson, Edwin Smith, Elizabeth Clifford, Vivian Smith, and Sonia Cotton were all prominent citizens, making a prosperous living from an invention to make life work-less. I remembered how smoothly they worked their way through Commerce. While we were chatting, I was delighted to see approaching the renowned lawyer, Margaret Phillips, now an eminent pleader for longer skirts for women. accompanied by her partner, Grace Scott, who as clerk of the local court had in her possession a legal looking document. The document proved to be the will of the famous explorer, Tom Rogers, who in view of immediate departure on a hazardous Page Tfwenly-.rfwefz E01 Y-:V ,.,-ff -5 et A ' its W- jeg- E Y 7 Q expedition to Planet X, in his sturdy old Ford, had made out his final will and testa- ment. Suddenly the mellow tones of a flute floated over the village. This, Ruth told me, was the fire alarm, sounded by Chief Henry Fitzmaurice. Harsh sounds, such as the clanging of bells, she explained, were things of the past. Soon Firemen Mary Kaprielian, Zara Krasnow, Emma Gravlin, Olive Wright, and Vivian Westerberg got the apparatus out and I wondered why Agnes Anderson and Anna Kalagher ran in answer to the call but it seemed that Agnes's singing took the place of the sirens of yore while Anna played her accompaniment. At the scene of the excitement, Ruth Johnson, who had sounded a false alarm, was making feeble explanation to police officer Merilda Dube. As the excitement subsided the resonant voice of the town crier, .Midgey Mac- Kinnon, intoned the following news item: Hear Ye! Hear Ye! Ruth Johnson will be arraigned in Mars District Court to-morrow, on a charge of breaking the peace, with Judge Aurore Frappier on the bench. Arline Cote, assistant crier, was busy preparing the next news item, adding the humorous touches of Commerce fame. just then Margaret Keough rushed up and invited me to accompany her to the office of the Moon Beam Transportation Company where she cashiered. Enroute I learned that Ebba Larson was president of the firm while Rose Jonas acted as busi- ness manager, and just as we reached the ofllce Esther Katz, who was employed to pick up the stenographic messages from other planets, referred notes from Venus to Meredith Simpson on the subject of Time Clocks and Why. The notes explained that Bill Garrepy had just been made the official clock of Venus because of his twelve year school sitting record at Commerce. Keenly interested in the new plan I boarded a Flying Atom and arrived at Venus in less thanitwenty minutes. I soon encountered two traflic ollicers, Valeria Rawkeskus, and Bertha Plotkin, chosen because of their skill, developed at Com- merce, in dodging rain drops while crossing Walnut Street. During a lull in the traflic they told me that Bea Greene held the championship as best all-round athlete in the planets, and that the junior League, with Beatrice Bagasinskus as president, was presenting an entertainment that night, featuring Wyman Allard, professional clog dancer. As a sudden rush of traffic took up their attention, I strolled off toward a near-by park where I spied Bill Dugard emersed in the realm of the Idylls of the Kingf' My curiosity was piqued however by the plaintive tones of a guitar mingled with those of a mellow base emerging from the center of an admiring group of girls in which I recognized Margaret Krukonis, Ruth Lipson, Adeline Saltzman, Agnes Steelman, Margaret Hoyen, Marie Harbor, and Edna Lawrence. I asked Edna the cause of the excitement and she said, You mean to say you haven't heard the only known singing salesman, Charles Tagman ? A Page Tfwenty-eight l-'-'i2Di'T - T i 71 'ilf' mv il few: K. r-'mf' wiffd 1 'lnilllll lgl silflkifdialiiili llllliillrl irllr --A-- Graf He's a great asset to the Flemming-Davis Guitar Corporation. Dot Flemming and Ruth Davis have a flourishing business. Mortified by my ignorance I eagerly changed the subject to a distinctive looking display in a gift shop window. Said Edna, with a withering glance in my direction, Yes! Ida Zieper is the window decorator for the firm, while' Pearl Kemp and Mary Corbett, the owners, keep a plentiful stock of Romantic Perfume with which to ensnare their masculine clien- tele. With that as a final shot Edna departed and a huge sign in the entrance of the village auditorium impressed upon me the fact that a troup of Drama Dancers, composed of Violet Ahl, Evelyn Bedig, Edna O'Neill, Gertrude Gaumond, Julia Alevitch, and Alice Morrissey were to favor the people of Venus with a display of their art at a performance in the near future. They were to be assisted by Helen Saltus, pianist, and by Edward Everard, Charles Ezen, Joseph Kelleher, Adolph Chestney, and Alfred Verick, who were members of the orchestra. I wondered who the accomplished designer of the sign could be and finally discovered in small letters- Marie Beck. 'Twas then I spied in gold print on an office door opposite, Roland A. Erick- son, Justice of the Peace, and there waiting solemnly before Roland was Charlott Grant. I missed the groom by a Hehir and beat a hasty retreat just as Leo Hehir, walked in. In my mad dash I nearly collided with a young lady whom I greeted as Mabel Logan but she corrected me laughingly, Madam Mabel Logan, please, proprietress of the new miniature star course on Venusf, She invited me to her home where I chanced upon two facts of pecu.liar interest, the first in the form of an in- tellectual offering entitled History of Venusu recently completed by Prof. Hilda Gafiin, the second item came as a surprise. The door bell rang and in walked the renowned scientist, Jacob Lipschitz, who was visiting Venus, the planet of Romance, with the intention of penetrating the mystery of its romantic spell. From him I gathered that Viking Anderson, because of his ability to speak every language of Earth, had been sent as a representative from the World to Mercury and that many of the Class of 31A had located on Mercury feeling more at home on the planet of Commerce. Bright and early the following morning I boarded an 'KAtom,' and crossed to Mercury. The ride was an enjoyable one and as I neared Mercury the Etha High- way was crowded with joy riders. Prominent among them was smiling Paul Rivers. Mary Reynolds, too, was enjoying a ride, while Ulive Lawrence was piloting a class of students around to learn their physical geography at first hand. As I landed, the lights of the Nordgren Hotel beckoned. It was thus I found myself in the lobby of Carl Nordgren's Hotel, lighted by a contact with the moon, so arranged that Carl could sit back comfortably, as in his school days, and by merely pressing a lever, low and behold! the place was illuminated. Even though I carried no luggage the bell boys, Alphonse Rasimus and Angelo Page Tfwenly-mnf Q -.--Oasfzafi Y. V7 illllil 'lliillfiwii J' ,.,' l!ff 'I.'1'. ?'f?fQl'llf' 'lllllllflii if ! '1?l!'liE?! xl Y 795' I t.2. Q vii H - Setaro allowed me entrance. At the desk, Elizabeth Golub did not wait to read my name upside-down but greeted me with the announcement that The Advertising Club with Della Bisko president, was to hold its annual banquet there that night. The banquet was wonderfull At the head of the table sat Dorothy, the Bell of 3lA. She was the belle of the banquet that night, while Marcia Boyer sparkled as toast master, and when the orchestra selected an old time jazz tune Ken Stewart leaned too and fiddled to his heart's content. Others from the class of 31A were Virginia Fair, Ralph Anderson, Phyllis Stokes, Robert Allen, Elvira Poloni, Mil- dred Morrissey, Charles Freeman, Isabel Papaseen, and Dorothy Rosenberg. In the foyer of the Hotel Nordgren I discovered Thomas Healy, now Editor of the Mercury Times. Minnie Jaffee and Bessie Mina were Managing editors. It seemed fine to see his genial smile and he had a superior manner as he handed me a copy of his paper. On the third page a column entitled HWh0's Who interested me particularly. Mary Bartkus-Profession, nursing-uniform, gold and blue. Grace Bergeson-Birthplace, Earth-occupation, 'lsomebody's stenogf' Evelyn Brunell-Earthling also--occupation, everything in general, nothing in particular-master of all. Anna Coblentz-Champion swimmer of the Ether Waves. Helen Cronin-Slinging soda on the Ether Highway, drawing trade by sheer attraction. Charles Dennehy-Former Flaming Youth of Commerce, now official greeter for all visitors. Sonia Epstein-Dramatic critic of romantic novels. . Francis Fagan-Prof. of French, new accent method. Katherine Foley-Age, won't tell-Trade, reporting. Lillian Forsberg-Aviatrix in charge of planet to planet transportation. Ethel Forsman-Perfect 36,--Occupation, physical director in the Mercury gym. Catherine Green-Professional star gazing from roof gardens. Catherine Lane-In charge of the Botanical gardens, featuring plants which thrive in quicksilver. Emma Legere-Keeper of the light that never fails. Dorothy Lees-Up to her neck in bookkeeping for Planets Incorporated. Sylvia Levine-Administering first aid to the romantically affected. Josephine Pacevicz-Struggling with the History of the Future. Grace Palm-Tall, lithe, and displaying her grace as a model. Edith Safer-Happily living on the lblilky Way. A hasty scan of the succeeding pages resulted in the discovery that Saturn, the Broadway of the planets, was celebrating the 30th anniversary of the arrival Page Thirty -ilg 01 gf N ' ' L .sas-,P i WY W of the Earthlings. On the impulse I hailed an L'Atom'l taxi and found festivities at their height when I arrived on Saturn. The board walk was aglow with brillant lights. One sign radiated the glad tidings that the Mary Goldberg Theater would hold its opening that night. When I entered, a flock of ushers, among whom were Araksea Kolligian, Edith O'Dell, Margaret Drohan, Violet Batstone, and Julia Levinsky, came forward and it was several minutes after stumbling into the seat before I recognized the person at my right as none other than the inimitable Irene Lamothe. As the Saturnian Symphony Orchestra launched into a complicated selection I craned my neck in its direction and there, his face still dirty from playing with the Coal Miners, sat Roland Tannebring manipulating his pet saxophone. Rena Nord- strom and Ethel Baumgarten were likewise numbered among its members. Suddenly a retinue of attendants, including Dorothy Gallagher, Lottie Leavitt, Bernice O'Connor, Rose Simisky, Caroline Mason and Marion Murphy, bore a huge iron box onto the stage, which Agnes Lovejoy bolted and locked securely. A sudden splintering of sides and out burst the strong man, Leon Ranchynoski. At the conclusion of the act we pounced upon our programs and discovered that a play was to follow, the authors of which were none other than Chester Cannon and Stella Burns. The program likewise featured a clog duo by the Shapiros, Sara and Sydney, an aria by the Rudy Vallee of the sixties, Jean Ducharme, and a tragic sketch by Gladys Westerlind portraying the fate of the golf bug that trailed Walter Hmura's name through the sands of fame. With a sudden nudge in the ribs, gentle reminder of Commerce Corridors, Irene directed my attention to the box where sat the beloved Saturnian soprano Irene Werner, her every thought jealously anticipated by the ideal secretary, Helen O'Sheasy, and at a discreet distance Abraham Solod stood guard over the prima donna's jewels. My roving eye, attracted by Sunny Adelstein's smile, came to rest on a group in which I recognized Ethel Davis-the professional Wit of the party, Elsie Jacobson, Poet Laureate of Saturn, Barbara Moody, president of the women voters' league of Mars, and Mildred Farrell, famous equestrian. The last member of the party was Nelson Medoff, a historian of renown. As the hour grew late we left the theater and strolled up the star walk 'midst a dazzling array of advertisements, most of which were the products of the Welch and Werme Corporation to which Roberta Welch contributed the ad getting skill, developed way back at Commerce, and Nora her ability to wield the pencil. Suddenly a huge building with a multitude of windows attracted our attention -it was the Capitol of Saturn. We stood fascinated as the president's messenger, John Higgins, descended from his private Atom on a ladder of moonbeams with Page Thirty-one - S Osg- H -, - ' I .1 2-D - M -ig W I il K 'f 2 ' A UUE illif l!f.1?.'V?'!!'? 'T ?f5'?lT: lH1Z'?'ii'1f5fi 3 lllhi 1 xx -.1-2 P eeeee A A M A gsffv the agility born of experience in stair climbing at Commerce High, particularly if there was a girl at the top. We entered the main office and were greeted by Irene Siff who informed us that the president and his stenographer, Dorothy Walker, were in conference with Evelyn Stoliker, who was perpetuating the Horace Mann scholarship on Saturn, and that the president's secretary, Grace Peterson, would see us in his stead. Suddenly the president's voice, like the roar in the corridors at recess, boomed through the oiiice, and we recognized Saturn's president as Maurice Krinsky. Moe's lusty bass awakened me to the fact that the television plate into which I had been gazing had become a milky blank-so gathering up my notes I rocketed back to Earth where our own Mr. Andrews welcomed me with an eager interest in your A future. Class Superlatives Gladys Westerlind . Rena Nordstrom Grace Peterson Virginia Fair . .. Agnes Anderson . . . Beatrice Greene . .. Mildred Rice . .. Ebba Larson ....... Marjorie MacKinnon Nora Werme ...... Margaret Krukonis . Peggy Phillips ..... Adeline Saltzman .. Sylvia Levine . .. Elsie Jacobson .... Aurore' Frappier . . . Irene Werner . . . Pearl Kemp .... Charlotte Grant . . . Roberta Welsh Class VVit . . . Best Dresser . Most Popular Best Looking Class Angel . Class Athlete . Class Actor . Teacher's Pet Best Dancer . Cleverest .... Bluffer ..... Personality .. Argumentative Talkative .... Brute ...... Industrious .. Heart Breaker Fun-loving . . . Best Pals . . . Most Shy .. Page Thirty-two Chester Cannon Kenneth Stewart Maurice Krinsky Wyman Allard Henry Fitzmaurice Leon Ranchynoski Jean Ducharme Charles Tagman Paul Rivers Victor Sepavich Duke Kelliher Bill Dugard Hilding Anderson Manuel Silver Charles Ezen Roland Erickson Roland Tannebring William Garrepy Leo Hehir Walter Hmura me .01 as V ww ' ' !f ltilijfl llllillsggillflliw .pl LQ:fzEw4lll3'4 rl,e:,,,,g,Qv2lr35- .mlfiiszlin3..,.:,.-.1.rl,r5f23 - W 1 9 635255 Last VVill and Testament of the 1931-A Class MARGARET PHILLIPS E, the class of 1931 A, realizing that in the near fu- ture we shall depart from this high school life, and being fully possessed of sound mind, memory, and understanding. do make, publish, and declare this our last will and testament, hereby revoking and making void all wills at any time heretofore made by us. After the just settlement of all lawful debts and depart- ing expenses we bequeath our real, personal, and imaginary property in the following manner: 1. To Mr. Andrews we leave our deep and sincere ap- preciation, together with the good will and high esteem of the class of 1931 A. 2. To Mr. Boyden and Mr. Casey we leave a book written by a famous psy- chologist on The Art of Detecting Forged Handwritingf' so that they may readily know the true value of all excuses for absence brought to them by students desirous of avoiding P. M. sessions. 3. To Mr. Morrill we generously leave our hats, bonnets, berets, etc. Our generosity in this instance is prompted by his admiration of their effect in class- rooms. 4. To Miss Lundstrom we leave two carefully chosen dance records so that her pupils may train their deft fingers to tap rhythmically. 5. To Mr. Sampson we leave an able assistant to keep watch for students interested in classroom demonstrations of facial art. 6. To the juniors we leave the privilege of donning the mantle of dignity which we have worn for the past year and which, in all probability, will be similarly worn for an infinite number of years to come. 7. To the sophomores who are about to study bookkeeping we leave many alarm clocks to awaken on time for school after they have burned the midnight oil the preceding night. ' 8. To the freshmen, whose inclinations toward student bags seem to be on the wane, we leave the anticipated joy of three more years at this school, and an accurate pen and ink sketch of our diplomas. 9. Prominent seniors, for little or no reason except the manifestation of their good will and sympathy, bequeath as follows: Maurice Krinsky leaves to all future orators friendly advice and encouragement. Page Thirty-three 105- f , T-T i , 7 Q-52 - Q-its X F .1 l'5 '5'5 l 'flliil'?il' 53553 l l i f is El !-,-, 'l'3 : T 'ii...t?'Z5f7,l !- ,Qi Q 2 l i U Hi Eu wg..-to it L 'E XT-L-.-Lim,---15 v 1' ' Mildred Rice leaves sweet memories of her grace and charm to all the under- graduates. Kenneth Stewart and Roland Tannebring, regarded by the girls as potential Rudy Vallees, leave their own arrangement of 'KSweet Adeline to the deserving members of the High School of Commerce 'Novelty Orchestra. Bea Greene leaves her remarkable versatility to all future athletes. Rena Nordstrom bequeaths her sweet smile to a lucky sophomore. 'We hope the favored sophomore will use it as well as Rena has. Irene Werner leaves to all aspiring songbirds instructions in which she advises them as to the most effective way of thrilling their audiences. Evelyn Stoliker leaves her popularity with the teachers to some deserving junior. Roland Erickson leaves a book to the freshmen on The Art of Acquiring Knowledge. lt is hoped that the book will help them to reach the scholastic heights to which he has soared. Q ' Grayce Peterson leaves her good disposition to any one who may be interested , in acquiring one. ' Helen Saltus leaves her favorite recipe for contagious giggling to the first person who applies for it. A long list of applicants is predicted. Edna O'Neil leaves, for all future debators, a speech entitled, How to Extri- cate Oneself from an Embarrassing Position by the Use of Sugar Tongs. Bessie Mina and Ebba Larson leave their vast knowledge of 'Kpot-hooks and curls to the junior girls who study stenography. There will be a considerable E amount for each one. MISCELLANEOUS BEQUESTS Plans for a tunnel connecting the old building with the newg in the event of their failure to materialize we leave a specially designed pair of spiked golf shoes for every pupil to use on stormy days. 4 For the annex locker rooms we leave plans to be used in widening the aisles so that the traffic congestion will not be felt in the future. In testimony whereof we hereunto set our hand and seal on this twenty-fourth day of November, in the year of our Lord one thousand nine hundred and thirty. The 1931 A Class. Page Thirty-four T 'H'fiif:1is2:, 0 fialzrzff --- -f - ----V-Mk' ' QQQ 'ji.iiZ3i7?'.l ii3?555E1fl:ig9'-Y-7'f 'M'- ff V , , ' ' ' -, ' ' x AXN 74 sw 1 W :A .1 gi if e Ki ,N 11:2 fi P Ui ..A 1.3 Q JJ 1T,i3'fiJ ' U Yfdff fl 3252 73' If 31.33 1931-B CLASS OF -.NXQ,Ik-L, f gg ! ,fig 0 ex - C Y f-, !,,,,- ,- i - I7 52- 'uses' XJ H lla' '5'E if' 3 il!'i!!' l ITE! ill is l ll fill l 1 it ,Hi V. Vlillf i 'iw ' if Z li' ' is ,. f' 'E if Class Officers and Committees, 1931-B President, Thomas Powers Vice-President, Linnea Stenman Secretary Ann Gagan Treasurer, Russell Hemenway I soc1AL COMMITTEE Russell Hemenway, Chairman Evelyn Kennedy Germain Leclerc Seymour Cohen Rita Johnson CADUCEUS COMMITTEE Helen Potter, Chairman i Abraham Plotkin Olive Burgoyne Esther Grogan Mary IMI. Prendergast Rose Riley Edgar Rylander Rita Scanlon Bernard Yanofsky DECORATING COM MITTEE Linnea Stenman, Chairman Chester Johnson Estelle Spinney Agnes Rantamaki Mary Murphy Dorothy Fleming Francis Mahoney Gabriel Namen Stella Burns Raymond Mahoney CLASS DAY COMMITTEE Benjamin Snider, Chairman Helen Hehir Leo Garrepy Helen Bass Wayne Ambrose PHOTOGRAPH COMMITTEE Rosalind Fine, Chairman Martha Bearse Victoria Aslanian Walter Coakley Bernard Sutherland CLASS GIFT COMMITTEE Marjorie Chamberlain, Chairman Miriam Bloom James Zarr Ruth Johnson Mary Kenney CLASS MOTTEO COMMITTEE Helmar Stenquist, Chairman Leo Glennon William Italiano Doris Anderson Ida Jacobson Page Thirty-.fix n ,, , D iigvwmn il 1, My-V'-wrjy H X iY,: X. Xfj-'Nl lm' . X1-A-ini X f N fr w l-4 31-1 xx - ss r L ..::.:ihT1:4,1,:::::i: ' ' ':::':11':' ' l'4Z i j Gxzgx Q jk X, ,N V , qw l Class Officers, 1931-B Presidrnt . . . . . . 'IQHOMAS POWERS Vice-President .. .... LINNEAA STENIVIAN Sevrftary .. ...,.... ANN G.AGAN Treasurer .. .... RUSSELL HEMENWAY Paar Thirty-Jmwn O , f fu' ...l,.,... - -- , A Y' W5 . V '- --M -' f -' -A 1- H- -V - NNN li ,Il Lfflg:'SVI' -fx.'v:'s1:'v :' w2,11w,k.'m ,uf gfll- '-W--W :J 4' V wa- 11 1, X 5 W ' W 1 fw1+Hs-:rv f a3K1IIN,.7i'1H.l1iIWW' A 'T' 'WTF W ' ,171 -91' 1 I-XM A fu Miw:+M A ml! wffiffil im. fi A A wfrwlm W11I 'TV: 1,lf1l'i'-'Ig-:E'T-Ygvlrfll j AA ..i-,M,. ..f- --- 'ES------733 k 'TiP,Ei2-T., 5 -- . SSSSSS ,WS W.-.553 J .::,A .. M ca Q, Class Day Speakers, 1931-B THOMAS POWERS . JULlA ROGLIS' '. .. EVA SKIBINSKY .. HELEN BASS .... XVALTER COAKLEY SYLVIA SHERMAN . . . RUTH GURLEV .. STEPHEN SAVAGE . Pagz Thirty-eight Address Vocalist Historian . Pianist Oration fllusiriazz . . . Prophft Will LOLX. E a - , 577 .,,A, . ,, . 7. ,T X4 G SEV Class Day Program, 1931-B I April 22, 1931 ' OVERTURE- Lohengrinl' ..... . R. Pfagner High School of Commerce Orchestra PRESIDENT'S ADDRESS Thomas Powers VOCAL SOLO-nAd0rati0nI' . . . Maurice Telma The Gypsy Trail . . . Tod B. Galloway Julia Roglis V CLASS HISTORY Eva Slcibinsky PIANO SOLO-'iPollaCca Brillanteu . . Ufeber Helen Bass - CLASS ORATION AND PRESENTATION OF GIFT Walter Coakley ACCEPTANCE OF GIFT Principal Calvin I-I. Andrews VIOLIN SOLO- Der Sohn Der Haiden Sylvia Sherman CLASS PROPHECY Ruth Gurley CLASS SONG Words by Doris Anderson - Music by Albert Yodzonis READING OF WILL Stephen Savage SCHOOL SONG Class of 1931-B INTERMEZZO- Martha'l ...... F. V. Flotow ' High School of Commerce Orchestra Pave Thirty-nine 2611? j l P 1-... ii T of N I ,ff:w'K2fjff5Hef '2'H2zzfav'E': -- ' 1'f 'v:i,rwrw 1:'s+r,egif1rfwffi ,X og' Address of Welconie THOMAS P. POVVERS T is my great privilege this afternoon to bid all you friends of the Senior Class a hearty welcome. This gathering here today is a very choice assemblage. It is made up of our good friends of long standing, who are here because they are interested in us and wish us well. YVe hope to be worthy of this interest. We are glad to greet you-our teachers--who are here to give us your Godspeed. It seems fitting that you should be present at this, our final effort, after guiding us along the way. ' We thank you for your patient helpfulness during our four year progress. We realize that without your friendly interest our journey would have been far less pleasantg and we want you to know that we :appreciate your labors. Our feelings for you lVIr. Andrews are not easily expressed. From our freshman days you have been a very real friend to us-helpful and inspiring. You have en- couraged us and sympathized with us. Your interest has been a personal one. It has helped us over difficulties and made failure impossible. We love and honor you for the large share you have had in making our high school years such happy ones. l wish to extend a very special welcome to our parents, who have long awaited this day. We hope that you will be pleased with us and that you will feel repaid in some measure for whatever sacrifices you have made to give us this high school educa- tion. We are deeply grateful to you and rejoice at this opportunity to demonstrate a few of our achievements. - YVe offer you now a varied program, which we hope you will enjoy. There will be an account of our High School activities to acquaint you with our accomplishments up to this day. After looking into our past you will want to know what the future holds for us. Our class prophet has been impowered to glance ahead into the years to come and impart to us what she finds there. We have a class will for your entertainment, a class gift for the school, music, and a talented orator. YVe appreciate your being here and we are proud and glad to welcome you. Page Forty ,EUS- V7 , f- Q., A .41.,--::..,fg,,e r . N Qfw Nab g Class Song, 1931-B Words by Doris Anderson Music by Albert Yodzonis FOR COMMERCE HIGH Dear Commerce High, though short the years That now are left behind us, How strong hath grown sweet friendship's chain, The golden links that bind us. How dear these old familiar halls With friendly voices sounding, With light and shadow, grief and joy, And youthful hope abounding. At last we reach the open door, To join the world outside us, And stand prepared, with eager hearts, And true ideals to guide us. Dear school, beneath the gold and blue, We part perhaps foreverg But ne'er can time, while mem'ry last, Our chain of friendship sever. Class Motto Class Colors Insta Et Praesta Purple and White Page Forty-one Ot D- '2'2 f21if1s?5il'i:3!ii':1 iw + f 'A 'f E 1' is A ge Class History, 1931-13 EVA SKIBINSKY l ' OW well we remember that beautiful sunny day in September, 1927 when we trudged up the hill, for the first time, with hope in our hearts and awe in our eyes, about to enter a new life, to meet new people and to accustom ourselves to strange surroundings. Is it any wonder then that we trembled with excitement and anticipation? Is it strange that we looked dazed and frightened? Is it surprising that we clung to our grammar school friends as a shipwrecked man clings to a piece of wood? ' We shall never forget this dear old Assembly Hall where we first gathered on that memorable day. With its cheery, homelike, comfortable atmosphere, it seemed to welcome us with open arms and made us feel less strange and uncomfortable. It was with a sinking heart, however, when home rooms were assigned, that we left our grammar school chums and joined a strange group of young people in a strange room. We were truly justified for feeling awed and frightened on that first day of high school. The strange faces, the new surroundings, the teachers, the different routine all became more familiar to us as the days rolled by and soon we were ready to settle down to serious study. But within a short while the realization came to us that Hall work and no play makes Jack a dull boy and so accordingly we cast our eyes about in search of means in which to spend our time besides studying. The Assembly Debating Society and the Girls' Debating Society soon claimed many of our class and in a surprisingly short time some of our classmates lost their shyness and bashfulness Cexcept before the higher classmenj and soon appeared before their English classes presenting personal experience stories and oral compostions such as, A Day in the Country, HI-Iow Much Smarter I Am Now Then I Was Before, f'My First Visit to the Zoo, and etc., in an amazingly fine manner. Many of the girls were initiated into the art of buzzing upon entering the Bumble Bees Club, where they were shown how to dispense sweetness among the sick and kindness and thoughtfulness to strangers. The Britomart also received our girls with open arms. Iklany of our class became ardent athletes and we certainly were proud, October 6, 1927, when the Boys' Freshman Basketball Team defeated the Sophomore Team in our first game, 9-1. But, we are told, pride always comes before a fall. And what Page Forty-tiwa ,LU A X ' I T - Ifflfl - 'A1 1 'f rr ' VFX a fall there was when the Girls' Sophomore Debating Team defeated the Freshmen in a debate, the subject of which was, A'Resolved-That a certain amount of slang is justifiable. However, the Freshmen were good losers and held their ground admir- ably. Our musically inclined classmates found Orchestra C much to their liking and during their rehearsals reveled in the art of making noise fas those who were impelled to listen can testify, and when the annual School Concert was held in the Assembly Hall, we found many of our classmates among the chief noise makers. Then the long awaited for day arrived-Field Day! The Freshmen turned out in grand array, bravely Haunting their purple and white before the scornful eyes of the upper classmen. That was a day long to be remembered! We were part of the High School of Commerce, at last! We could cheer for our teams with the same pride and abandonment as the Seniors! As usual, it rained that day, and although most of us were soaking wet when we reached home, our spirits remained undampened. It was with an entirely different outlook on high school life that we came back to school the following September, after the summer vacation. We were now upper classmen and in our turn, we felt justified in feeling superior to the Freshmen. At this time our forces were strengthened by the Sophomores coming in from Junior High. As soon as classes and schedules were all settled, elections were held for our class officers. The pleasing results were: William Italiano, President, Linnea Stenman, Vice-President, Ann Gagan, Secretaryg and Stephen Savage, Treasurer, and with this well chosen group at the helm, our class steered safely and surely through the Sophomore year. On November 16, 1928, the High School of Commerce Band went to Spring- field, where the 100th anniversary of secondary schools was celebrated. Among those of our class that went were: Morris Griff, Leo Leavitt, Bernard Yanofsky, and Albert Yodzonis. , At last we were beginning to get the recognition due us. Ann Gagan, on Janu- ary 17, 1929, was elected Secretary of the Girls' Debating Society, and a little later Eva Skibinsky became Secretary of the Bumble Bees. ' On the evening of January 17, 1930, in Tuckerman Hall, the Blackfriars Dramatic Society presented Quality Streetf, George Chan and George Zakarian of our class Were chosen, because of their size, no doubt, to portray the parts of school children, and the manner in which they tripped through the Minuet, unabashed, before a large audience, was certainly a credit to our class. During all this year most of our recitations were held in the Assembly Hall, the gymnasium, and the corridors, because of the crowded condition of the school. We were eagerly awaiting the completion of the new annex, which was progressing rapid- ly. Of course, the riveting and the steam shovels across the street caused a terrific racket during our recitation hours and because of this some of the teachers, much to the delight and amusement of the pupils, in desperation tried to conduct the class Page Forty-three ,lavag- 7 ,f 1 W as Vfiiiiiiili53l'gf1fi'l.Iflly1!lli.T3, ,1 flfiiffl3!'l QVll!'3ji?!l'lHE''i'El'il2illlEfEEl Nrersljiiggpwl.. r. .lli52. f 5 - ':: ' 3? through the means of megaphones. But teachers and pupils took the noise and dis- turbances cheerfully because they knew that they would be fully recompensed in a short while with a brand new building. When Class Day rolled around that year, it was with a firmer tread and heads held high that we made our way to the Fair Grounds. This time the wearers of the purple and white did not cringe under the superior glances of the upper classmen, but made themselves very evident before the Freshmen with scathing remarks about the nerve of such children daring to appear out in the open like that when they should be in bed getting their afternoon naps. The Sophomore year closed with the new annex very near completion and we eagerly awaited the coming of our Junior year with anticipation of a still more success- ful and happier year. When we came back to school at the beginning of our Junior year it was with a feeling that at last we should be able really to enjoy school. No more were we to be hampered by the upper classmen. It was our turn now to avenge ourselves for all the abuses and snubbings that we had to stand in the first two years of our high school life, and this time revenge was certainly sweet. Since the new annex gave us more room, the Freshmen were allowed to come to school in the morning, instead of the afternoon, as they had previously done, and so we had the opportunity of teasing them between periods and at recess. This year we came in for our full share of school activities. Hardly had the term begun when Wayne Ambrose, one of our football heroes, was elected President of the Lettermen's Club. And how proud we were when Mary Kenney won first place in the posture tests conducted by our physical directors. Mary received a beautiful silver loving cup for having the best posture of all the girls in the school. When election time came around, the following were chosen as class officers: William Italiano, President, Linnea Stenman, Vice-President, Thomas Powers, Treasurer, and Ann Gagan, Secretary. In the Girls' Debating Society, Eva Skibinsky was elected Vice-President, and Lillian Kunin, Treasurer, and in the Blackfriars, Evelyn Kennedy was elected Vice-President. In February, the Blackfriars presented their annual play. The Swan, by Franz Molnar, was the choice this time, and with Evelyn Kennedy as leading lady it couldn't help but be the success it was. Eva Skibinsky, Leo Garrepy, Howard Lee, and Her- man Euranius also took part in the successful production. In May, Field Day once more was celebrated, but oh! with what a difference. This time some of the wearers of the purple and white arrived at the Fair Grounds in purple bedecked carts and Wagons, drawn by disreputable looking beasts, and some in tin cans which loudly heralded their coming. Once there they did their part in the cheering stands, partook of the ice cream and popcorn at the refreshment counters, generously distributed condescending glances at the Freshmen and Sophomores and went home Hsingin' in the rain, with purple streaks running down their faces and Page .Tarty-four LO -E .. I7 Y '..sfiIXDf,.f so 51 ! 'l3 lff'5 'Fill 51375 'EEE l5i5Ill!'l?'!u 3.31l'fVV ?i7f'f'5iiE3,'3 ll1'f'?'i2Z1 i'?E1lili 1 if , 51 - if sr, 5 EEF over their clothes, as the inevitable Class Day rain came pouring down unmercifully on their holiday bedecked clothes. Thus passed a pleasant year and it was with undisguised eagerness that we looked forward to our Senior Year at Commerce High. Seniorhood reached at last! Now we were rulers in our domain and we held sway with a firm hand. Our good judgement came to the fore once more when elections were held with the splendid result of the following: Thomas Powers, Presidentg Linnea Sten- man, Vice-Presidentg Ann Gagan, Secretary, and Russell Hemenway, Treasurer. On December 2, 1930, the Girls' Debating Society sponsored, for the first time, a Declamation Contest, in which Eva Skibinsky won first prize for the best story, Bernard Burns, third prize, and Rebecca Chervinsky and Sylvia Coppersmith received subscription prizes. Lawrence Young won the editorial prize and Harry Sackstein received first honors for his cartoons. When the selections were made for the new Mercury ' staff, Ruth Gurley was chosen the Editor-in-Chief, with Mary Pierce as her assistant. lV1ary Rosef' by James Barre, was the selection for the annual Blackfriar presentation which was held in Tuckerman Hall on February ll, 1931. Evelyn Kennedy, Eva Skibinsky, Wyman Allard, and Helmar Stenquist had leading parts in the successful production. Sylvia Sherman, because of her excellent musical ability, was selected to represent the Worcester High Schools at the Eastern Music Supervisor's Conference in Syra- cuse. The following list have attained the honor of being called Horace Mann Stu- dents: Doris Anderson, Helen Bass, Celia Bretholtz, Frederica Donley, Rosalind Fine, Norma Finkel, Ann Gagan, Russell Hemenway, Anne Hovenesian, Ida Jacob- son, Rosc Jonas, janet McPherson, and Linnea Stenman. These foregoing facts are merely the important events of our Senior year until the present time, and this Class History closes with the sincerest wishes that the remainder of our last year at the High School of Commerce and the years to come may be as successful and happy as our life here at this, our beloved school. Page F orly-five 6 . li bij L.. W at f vm - , Class Oration WVALTER COAKLEY THE TREND OF DEMOCRACY EMOCRACYl Vvhat is Democracy? It does not mean equality. It does not mean rule by a bare majority nor does it mean unlimited freedom. Democracy means that every element in a group should participate in that group's control. Using Lincoln's immortal words, A Democracy is a government of the people, by the people, and for the people. The history of the struggle for individual representation is almost as old as civilization itself, for away back in the early records of the Hebrew we find it reaching out for and attaining to a certain degree of individual participation in government. During that period in any nation's life when the main body of the people is doing its own thinking, then Democracy has taken great strides, but when such a period is succeeded by one of indifference to education on the part of the larger groups of people, then Democracy fails in that land. VVhat is necessary for the growth and development of a true Democracy? It requires that the individual submit willingly to all measures judged necessary by the group in furthering the general good in which he participates, even though many measures are not for his immediate selfish benefit. Democracy, a form of government in which the supreme power is held by the people and delegated by majority vote, to function properly must require universal education of all persons. This requires mental ability of a fairly high order. No class is exclusively privileged or competent to rule. The practical consent of all is necessary for any essential measure. The spirit of co-operation is necessary for all group action. Reasonable conformity is the price of its advantages. Increasing civilization means increasing cofoperation. In a Democracy we create government as an instrument with which to carry out the wishes of the people, as the people themselves are the best guardians of their own liberty and happiness. A Democracy is much more likely to endure than any other type of government as thepeople, in selecting their officials, in choosing between im- portant issues and by holding office are developing the initiative to meet any emergency. Page Forty-:ix ,Jax ----M Q-sfki x-1 f's'-:--XJ 'f'!' CHEF' Wars are less probable. When people have control of their own matters they are less likely to rush into wars as they are the ones to bear the brunt of conflicts. This tends towards international peace. Democracy develops true patriotism because people cherish very 'much those things which they have helped to create and for which they feel personal responsibility. V The individual in promoting the existence of a government which safeguards the welfare of the individual, values education. With better' education of masses comes the desire for and the attainment of higher standards of living. Progress is not a blessing confered from without. Thus we may pride ourselves for the way we are emerging from the present business depression, the worst in all our historyg and we can rest assured that our's will be among the first nations to return to normalcy. ' Democracy acts as a stimulation incentive to the individual. It offers equailty of opportunity and a just liberty for combination and it enables our men or companies to engage freely in new undertakings. Under other forms of government there is usually a ruling caste, and the individual, regardless of his ability, is hedged about by the arbitrary laws which unnecessarily restrict his freedom. And above all, Dem- ocracy insures justice. In the long run it is most efficient, as all have equal power in this mode of government. ' There is warrant then, in reason for believing in the divine right of Democracy. We confide ourselves to the hopeful and progressive View of human nature and to the prevailfng justice in the arena of public opinion. We bless the memory of our first and greatest hero because he had no desire for a crown, and so by his personal influence helped to make the choice ruling classes in the United States neither autocratic nor automatic, but Democratic. At present, Democracy is in the infancy of its development. True Democracy which is founded upon the just measurement and appreciation of human values, re- quires honesty in all public and private relations. The foundation of self-government is firmly imbedded in our spirits. It only remains to complete the true structure. To- day the power of free speech voices the appeals of hate and envy as well as those of justice and charityg a free press is made the instrument of cunning, greedy, and selfish ambition, as well as the agency of enlightened and independent opinion. However, argument against the democratic method, all of which is based on weakness, folly, and selfishness of human nature supplies greater force to the autocratic methods. The individual follies of a multitude of men often neutralize one another, leaving an active residium of plain, common sense. But,.for the fool king there is no antidoteg and sometimes men have sadly found that the only way to set his head straight Was to remove it. We have been compelled to see what was weak in Democracy as well as what was strong. We have begun obscurely to recognize that things do not go of them- Page Forty-.Seven -, llolx , ,.-ff , 9 J 4 t :E 2 Q 3 - H2 .gii f'!fil!i'l 2 t 47 ..A Kiel f zzpsaww '- ru, aff Kilimwiiuemlimiiifnfimmilwiwriimu,xw14iS,rf1'ti,dl ua. S el' -Ftrs' S967 selves and that popular government is as the virtue and Wisdom of the people make itg that when men undertake to do their governing they enter upon the dangers and responsibilities of the function. We, the people are its power, its peril, and its hope. i The young man Who has gained the primary object of education that is to eman- cipate, to free from superstition, cast off tyranny of worn out notions and to clear himself from prejudice, he has caught the true visions of Democracy. For him American will ever be a word of the spirit and not of the flesh. So let us further The Trend of Democracy and face the world with an attitude characterized by sincere democratic sympathy, enthusiasm for the common good and a genuine love of justice. Our life to the full extent of our talent and opportunity shall contribute to the reality, the security and beneficience of this government of the people, by the peo- ple, and for the people. Page Forty-eight ,.,L'-io' I A V7 'M' X5 'A2 N 'll' I ' 4A ' rMW: W 'W -.C gf -mm u V Class Prophecy, 1931 -B RUTH GURLEY ECAUSE of the wisdom of this famous class I thought it would be advisable to gather together some facts from a few well known authorities so that the prophecy of the members of the 1931-B class would be accepted as true. I had been devoting these last few weeks to these few vol- umes when I was called to a very important social function the other evening where I met a philosopher sent by Mahatma Gandhi, the great little man from India, to this country to interpret the philosophy of India to Americans. He was in his native costume and his dark eyes had a supernatural light in them as he talked of his native land. Suddenly he looked at me in a strange way and asked me what was causing the distressed look in my eyes. It was then that I told him that I had been entrusted with the great task of foretelling the future of the 31-B Class. He smiled and said, I will help you,', and told me that in his country the future was always known to them. The only question was, how far into the future I wished to look. I told him that I thought ten years would be just about enough to settle most of us. He reached into his garment and drew out a small white wafer that to me ap- peared very much like a Life Saver. Then from another inner pocket he drew out a small gold tray. He placed the wafer on the tray and a vapor rose and it was then that I felt my eyes becoming dreamy. I looked at him and noticed that his were looking far away. Now he began to mumble. He said, As a whole the 1931-B Class will have a great future in national and international affairs and will make great strides in invention, philosophy, and food! I see,',ihe said, a wonderful leader who seems to color the future of every one in your class. His name is Andrews, Calvin H. Andrews, a great leader of youth and a life-long inspiration. He passed his hands before my eyes and with him I traveled into the future. I seemed to be in Paris at Hotel Golub. Isadore was standing at the door with apron pulled tightly across his stomach and smiling as usual. He was evidently the pro- prietor of the hotel. Chester Johnson, the great architect of skyscrapers, who only had to stand on top of one of his buildings and reach for a star and it was his, was seated at a table with Eva Skibinsky, now a dietician. She was reading a book en- Page Forty-ninr 4' -A V 4,-QQ js... 5 A YQ f' QFV gk? titled, 'KI-low I Have Learned to Cook for a Family of Five, written by Mary Pierce. I smiled as I remembered Mary's appetite in Commerce. just at this moment Margaret Fielding appeared, followed by several girls. Isadore told us that this group was employed to give the right atmosphere to the room. The group consisted of Doris Hagg, Helen Hehir, Myrtle Gustafson, Helen Haven, Helen Horton, Elsie Sullivan, and Rosalind Fine. There they were-the old Room 73 group still gossiping in loud tones and eating in between. The last in the group was Ann Gagan, whose charming personality, as usual, was attracting every one in the place despite the fact that she studied Latin 8 at Com- merce. She was now an aviatrix, flying high over Paris. The moment they saw me they rushed me into the inner dinnig room where Alice Adelson, Dorothy Anderson, Frances Belsito, Ruth Auburtine, Impi Luhta, Janet McPherson, Stella Zukerman, Caroline Zumma, and Esther Aho were grouped to- gether at one table. I learned that they were all studying at Cxford and had gathered together to attend the opera that evening. I joined the group and later at the opera saw Irene Werner, prima donna in Faust, and Dorothy Covell assisting. When I looked at the orchestra I could have wept for joy for leading with all the energy he had was William Italiano, with long, straight, black hair, and sharp, black eyes. Abraham Brodinsky, Samuel Lubarsky, George Zakarian, George Bauer, and Leo Leavitt were obeying his baton. Maurice Griff was almost hidden in the coils of his big bass horn and Bernard Yanofsky and Albert Yodzonis were arguing over Who was to pay for the supper bill that night. Ever since Yodzonis had collected bills for the Mercury he had been careful about financial affairs. VVe were just having a wonderful reunion when a little messenger in blue, with brass buttons, rushed in. It was George Oban, who smiled in his usual way, saying that Robert Kincaid, now the foreign John Gilbert, was playing in the well known picture, Girls I Have Known and Loved, assisted by Edith Woll, Nellie Woodman, Mary Prendergast, Mary Walkavich, Dorothy Weinheimer, Jane Wisniewski, Doro- thy Solomon and Beatrice Alavosius, and wished to have us for his personal guests at a private showing of a new picture at the Hotel Casey. Imagine how thrilled I was when Eugene welcomed us, in the old handshaking way, munching something as usual indefinite. He not only welcomed us, but told us of the beauty pageant, with Mary Kenney as Miss America, that was to be held in fthe ball room. The ballroom was a beautiful structure designed by the well known architect, Leo Glennon. The show was about to start and it certainly was a beauty show. The girls were handsome and the gowns divine. They smiled at me as they passed and it was then that I noticed them. They were Marjorie Chamberlin, Rita Scanlon, Marjory Brown, Germaine LeClerc, Olive Burgoyne, and Evelyn Hannus. Page Fifty -gr X f S V7 -MM-M-4w.' , , 1af,g1q--MMXX fll?ll'l'l7i' Wllg il' Wilililiii I ' U- fb lfflfwll?7l 'IfMf5 if il l' if H2422 5lll'?lilifi' .. .- fl i '.n-'19 A' . I seemed now to be at the sea shore and, there patrolling the beach, were Herbert Carlson, Stanley Chambers, James Carney, and Raymond Emerson. While here I saw the King of Spain's son playing tennis, While Marjorie Clough, Mary Coakley, Mary Doginikas, Bernice Downing, Helen Bilsey, Celia Shapiro, Elizabeth Stearns, and Miriam Bloom were apparently enjoying royalty. Suddenly I Was attracted by the philosopher, who was taking another Wafer from his garment. This one was of a different color. He put it into the gold dish and prestog I was in London. There was fog everywhere and the London Bobbies were controlling the trailic efhciently, and then I noticed Helmar Stenquist, Robert Brandt, Daniel Gagan, Reuben Gurlitz, John Healy, James Howe, Edward Miller, and Joseph Cohen. The boys told me that they left Worcester for adventure and went to Scotland to get jobs but everything, of course, was tightly against them there. Their ambition had been to return to Commerce and solve the traffic problem-slippery days-on Wal- nut Street Hill, but they heard of jobs in London. Irving Jacobson was the leader of these great men, perhaps because of his slide over the Commerce wall with nothing to show for it! He said that the day before he had been talking to Vincent O'Rourke, Clifford Stolpe, Bernard Sutherland, Ralph Lockwood, Irving Ulman, and Peter Jonitis, all attached to the U. S. Embassy there. Their experience in high school days in smoothing over troubles with their teachers had qualified them for these diplomatic positions. Irving said that Walter Coakley was now the United States Ambassador to England and got the job because he looked natural in knickers, called plus fives. Irving then told me that Helen Bass was to give a piano concert that night and was to have for her guest artist Julia Rogles, but just then I was suddenly attracted to bright lights and the sign read- Great American Picture, Why Men Leave Home, starring Evelyn Kennedy and VVyman Allard. The strong supporting cast included Ida Jacobson, the fastest and most excitable talker on the silver screen, Winifred Hogan, although only 90 pounds heavy but still trying to reduce, Seymour Cohen, still acting the part of a great visitor to the sick, Alvin Goodwin, now serving the young ladies of the screen instead of tennis balls. We went inside and bought tickets from Theodore Thomashaw and it Was then that I remembered his Mercury days. He called out several ushers, among whom Were Stanley Volk, Raymond Warfield, recommended by the Olympia Theatre of Worcester, Meyer Cohen, Margaret Deignan, Dorothy Fleming, Arthur Argoff, and Mildred Blum. They were resplendant in blue and gold uniforms. They told me of an arena show across the way, run under the Great Wayne Tony Ambrose. I entered the Arena and was met by Tony, who took me to a ring- side seat. I was no sooner seated when the boxers came into the ring and I then Saw John Thomas in boxing costume. I remembered one time in Commerce when he Page Fitfty-one fel?-g . I tt, . - .,.... , had appeared in like costume and had very soon disappeared. He was to fight for the lightweight championship against a great French boxer, Francis Mahoney. Edgar Rylander acted as second, while Russell Starbard was referee, and Sooren Zaminigian matchmaker. David Aldrich, the time keeper, was busily watching his watch and every once in a while gave Walter King a chance to ring the bell. I found quite a few fans sitting around me that I knew. Among them were Isadore Boyer, Abraham Breitborde, Charles Broadbent, Walter Brown, Harold Olson, William O'Connor, Abraham Plotkin, Manuel Silver, and Justus Belli. Seated around the ring clicking typewriters as fast as they could go and eagerly watching the boxers at the same time, were, Mary Cronin, Leon Delude, Sophie Ep- stein, Edith Price, Richard McCarthy, Howard McCormich, Line Honkenen, Flor- ence Lapin, all expert typist for the Associated Press. Tony told me to be sure to go to the horse race the next day for some of my classmates would be there. The first one I met was Russell,Hemenway, collecting money, as usual. This time it was for bets, and he was extremely finished, just as in High School days, and smiled in the old way as I placed a small bet. A He told me that the horse I was betting on was Lucky 13, to be run by Lennart Backholm, who was known for his ability to hold down any seat. Mallenson's, in London, was the next place I visited, where I viewed Meredith Hutchins, Rita Johnson, Helen Pachoulus, Dorothy Zolnowski, Marian Witkin, Helen Wrenn, and Linda Jaskari, all posing in beautiful gowns advertising the fa- mous silks. They invited me to go with them to the American Dancing Clu.b, run by Paul Reynolds, Elizabeth McEvoy, Evelyn Starbard, Cecil and Victoria Aslanian. How well I remembered their skill in this line in Worcester days. Before I left the dancing club I was stopped by John Clifford, who tried to sell me a two-wheel automobile called the Western Union. It was the next day when I entered the largest library in England and found that Vincent Crotty in the past ten years had become Librarian. The clerk, with head bent, and writing poetry as fast as her pencil could fly, addressed us. I was amazed to see Mary Flynn. Others connected with the Library were: Anna Nourse, Lena Daboul, Margaret Burke, Edith Bazoll, Marjorie Kitson, Gladys Stone, Margaret Hoyen, and Thelma Brown. All great readerston outside books in Commerce days and now great follow- ers of romantic novels. Vincent took us through the library and there we found an immense statue done in soap! Inscribed on the front of it were these Words, Napoleon Bonaparte, done in soap by the great sculptor, Henry Grant. Henry began chiseling in his Y. M.- C. A. days, when soap trimming was one of his main occupations. Near Henry's statue was a beautiful picture. It was done by John Nanigian, Page Fifty-tfwo 40 -Rx g 1 H1Eif'!'H LIU, 2N Q5'rfL!!1ff's1IIIfHlf iff slil H551-' 1.11 ' '1 ffv v11I 1 I1rv,'rv,v1 v'rv'li' Hflii' rw 'sggzgiq Q1-QXtOf'v X J., - cigky ' who always did like oil and who had by this time gained quite a place in the world of art. A noise attracted my attention, it was the philosopher taking another wafer from his garment. This one was of a different size, much larger than the first two. He placed it on the tray, saying, This is the last, it must be that the rest of your classmates have remained in their own country. Just then I saw the Statute of Liberty looking over the deep while she was being decorated by Harry Sackstein and Benny Jacobson. Harry, as usual, was signing H. Sackstein in long letters at the base of the statue while Benny was holding the paint pail. The scene now shifted to the Yankee Stadium where Carl Sweeneyls world champions were exhibiting their skill. Some of the men on the team were: John Noone, Anthony Sinkeiwicz, James Sullivan, Russell Barross, Albert Archambeault, Raymond Johnson, Howard Johnson, Ray Mahoney, and Robert Quist. There was something about Carl's front teeth that I suddenly remembered the time he caught a baseball with his mouth in High School days--AND HOW! I bagan to smell ether. I was in a hospital and there was the head surgeon, Dr. Herbert Edmang James Petrides and Alice Peterson his assistants, instructing nurses who were, Helen Kosky, Gertrude Fillow, Agnes Cepkaukas, Arline Carlson, Anna Argosky, Dorothy Borgman, Ruth Hoyle, Annie Hovenesian and Margaret Houle. They looked very professional in starched uniforms. One end of the hospital was devoted to a store that sold nothing but bandages and as you have already guessed, was run by Julia Miller. I knew Julia would have something to do with this worth while product for she played basket ball by the bandage route. Kenosha, Wisconsin now floated before my vision and there I found Linnea Stenman running a business school. She was typewriting at about 150 words a min- ute and chewing gum at just about the same rate. In her school, as teachers, were Irene Rice, Rose Riley, Jane Mileski, Evelyn Minehan, Virginia Knowlton, Catherine Lane, Celia Bretholtz, and Gertrude MacNamara. In the Lone Star state I found Gabriel Namen locked in his labratory trying experiments which usually exploded and awoke the surrounding neighborhood. In Pasadena, California the International Spokesmen's Association was holding its convention. There I found seated in a large chair and the center of all excitement, talking as usual, the great, silver tongued orator, Mr. Thomas Patrick Joseph Powers. Other members of this 'well known society were Theodore Johnson, James Courtney, John Power, Josef Dine, Harold Stowe, and Edward Karolkiewicz. Tom told me that he had heard from a number of the 31-B graduates and said that Marguerite Perry, Agnes Anderson, Katherine Daly, and Alice Dacunus were all traveling together doing a dance and song number. V Page Fifty-lhfce ,-'fi Vmlliiiw N ,gui ,1.Q .Mi ., ,.i,rf-.1 .,..11, ,gg ,,,g,,4er., .,,q,,,s ,li . ,,1i,,f1y A . He said that Lillian Kunin had opened an advertising agency and that Laura Jordan, due to the practise she got while in the Latin play, was now teaching aesthetic dancing. She had been inspired by the Latin Flame dance. Tom told me that a new city had been organized near Worcester, Mass., run by a woman, and was called Utopia. Grace Stewart was its mayor while the alder- women were Edna Lawrence, Mary Zecker, Regina Nemitz, Eva Neske, Irene Morrisey, Helen Ohman, Sophie Ohrstrom, and Margaret Martin. The Common Council consisted of Catherine Kelley, Miriam Krock, Ethel Kuivila, Helen Masterson, Barbara Carey, and Edna Connor. Working in the City Hall were Zelda Rutman, Tillie Sak, Edna Simpson, Viola Sochon, Sarah Solomon, Mildred Sootkoos, and Angela Stozinski. When I asked for Leo Garrepy he told me that Leo had established a hot dog stand, called the Bow Wow Store, in Paxton, Mass., near the Navy Yard and his little hot dogs traveled nightly on the illuminated battleship in the harbor. Esther Grogan was working for him as his secretary, while Rita Bombard, Enid Carlson, Edna Field, Lorena Crowley, Stanislas Tononna, Araxie Torosian, Mary Raymond, and Jeanette Riopel wrote his letters and kept his books. Tom next said that Lawrence Young and Herman Eurenius were now running a garage that catered exclusively to Austin cars. He stated that at times they had a little trouble in getting in and out of them but otherwise they were getting along nicely. Before concluding all the news he said that Stephen Savage had just returned from a visit with Einstein, where he had at last solved the Einstein theory and that Helen Potter and Phyllis McCarthy were now writing for a magazine, one on styles, the other on food. - Just as the beautiful sun of California was fading away I came into South Da- kota. At one of the largest ranches in the state I found Chester Casperson, the ad- venturous member of the 31--B Class. He was writing a book on the woes of a cowboy. At the ranch I found Earl Burns, Nelson Medoff, Arthur Grennon, and Harold Raine trying to break in some very wild horses. Wallace Morosky also belonged to the troupe but because of his bashful nature, which he also had at Commerce, he usually managed to get a bashful pony. Chester told me that there were some Commerce girls running a neighboring ranch and despite the fact that they were very small, they managed fully as Well as the men. I took one guess and guessed right, for there they were, Syliva Sherman, Yvonne Harper, Gurneth Smith, Elizabeth Calfain, and Elizabeth Slater. Chester also said that John Collins had gone North with the Eskimos to try their famous Eskimo Pie. I imagined that it must be very hard for the Eskimos to find John when he is all dressed in his furs. The wild life of the ranches and the cold of the North left me and I found my- Page Fifty-four G glx 5-W-g--.-.g-Q..-as-:af J,-.g ..--..:.f..,N 7 f 'wif e 'fi' rw 4 'A' f'TT'TAVVf':'1': ' if self climbing Pikes Peak. Right in front of me was a group of people, headed by Francis Lawrence, who by this time was losing his breath and stopping every few minutes. At last I caught up with the group and I found Rita Guerin, Bessie Haroo- tian, lylinnie Herman, Catherine Hilland, Celia Kendall, Angela Ragalauskas, and Dorothy Frances. We finally landed at the top with the help of Lawrence when suddenly Celia and Dorothy began to whistle, while the rest yodelled. I knew then that they had come up here to practise. I noticed that Francis didn't even bother to sing, for he was too busy puffing. I decided to look around and there on the very tip top of the mountain and in the most secluded spot, I found Doris Anderson busy writing one of her prettiest poems on nature. I did not bother to disturb her for I knew she was in deep thught. The mountain air was just beginning to agree very nicely with me when I heard somebody spelling Constantinople. An enormous spelling bee was being held. Those that were busy spelling words Were: Ruth Javery, Ruth Johnson, Anna Kaskan, Frances VVest, Vivian Westerberg, Anne Zukas, and also the Lincoln twins, Elizabeth and Virgina, who had the judges so baffled that they divided the prize between them. After the spelling contest there was music, furnished by Snyder's Orchestra, which was led by Benny, with Abraham assisting. The members were: Vera Boyes, Elva Rutherford, Vanda Stokowski, Rebecca Chervinsky, Ada Goldstein, Esther Sykes, Helen Tamosounus, Mildred Townsend, and Wilma Wagnet. Suddenly everything appeared blank and then just as quickly as the light had disappeared it came again and I found that I was walking along the banks of Lake Quinsigamond. I noticed a man fishing and who was it but Howard Lee, a boy that had always been interested in fish stories back at Commerce. Here I was right back in Worcester and it was here that I found a number of the 31-B Class and quite busily engaged also. Martha Bearse was now running a school of etiquette for the exclusive 4-00.,' A new newspaper had just been introduced to Worcester called the 'lDaily Buzzf' The reporters were Sylvia Coppersmith, Andrea Duquet, Anna Forzley, Ruth Griswold, Mary Lavin, Sophie Levenson, Anna Linovitch, Edward Rome, and Paul Rosenlund. Edward Shultz was now the prosperous proprietor of a stock brokers concern, employing in his office, Doris Moline, Helen Monahan, Eva Montville, Phyllis Oberg, Rita O'Malley, Frances Paulauskas, Dorothy Peterson, Bertha Smith, and Catherine McKee, these girls had always been good at figures. Katherine Fox, true to her hair fixing days in Commerce, now was the owner of a beauty shoppe. A number of her classmates worked for her. They were Reva Cohen, Dorothy Simpson, Rose Prescott, Agnes Rantamaki, Helen Saltus, Eleanor Scola, Satinig Shamagoochian, and Anita Sharon. The telephone building, which stood in the same place as it did in 1931, now Page Fifty-fiqzf .O X e !,, Jig . I'-g'll?T' Y. P' 1':V lilf- '9if Il-T?'21liEYi' I!'l1 N . A U'Y6?,'7w clgb ' housed girls who many times were looking out the window to watch the building go up when some unknown force made the teacher call upon them. This group were A now fondly looking back at Commerce and wishing that they were back again. They were: Katherine Cronin, Margaret Curran, Mary Delaney, Mina Denowitz, Nora Donahue, Margaret Drohan, and Evelyn Farr. I found that Alice Donaldson, Frederica Donley, and Grace Donley, true to their wonderful understanding of business, had gone into the insurance business, which was run entirely by women. I As their agents they employed Norma Finkel, Doris Forkey, Anna Galulis, Sophie Ginsburg, Irene Grunditz, Dorothy Holbrook, and Pauline Kaplan. In their office the girls who practically ran the business were: Catherine Burns, Anna Casale, Anna Celesius, Ruth London, Phyllis MacDonald, Anna Maghakian, Loretta Michand, and Marguerite Smothers. The well known Commerce High steeple next came into my vision and I found Helen Spitaels, Viola Stankunas, Constance Chevrefils, Mary Murphy, Carolyn Nelson, Frances Palmer, Mary O'Brien, and Bessie Savatsky had returned to teach, because of the love that they had for school, and also Mildred Cinsky had returned who was now a physical instructor. Suddenly everything appeared black, I could not see, and then I heard music. It was the strains of a familiar song yet I could not place it, but then as quick as a Hash I knew, for I was listening to the good old strains of the Blue and Gold. . Rally round the gold and blue, The banner fairest of them all, Show that we are tried and true, To Commerce High, and Prove our lasting loyalty, Oh, we shall strive to win for her, And tho the fight be hard and long, We won't give in we're out to win, So sing our fighting song. I opened my eyes and looked around me for my philosopher but he had dis- appeared and there on the table stood the gold tray, empty. Page Fifty-six - 1 O is- o-sb, Q ff-c. S X , ,A C59 ' Class Will, 1931-B STEPHEN G. SAVAGE HEN, in the course of human events, it becomes necessary for the members of the Class of 1931-B to dissolve the bonds which have connected them throughout their high school days, it is but fitting and proper that they bring their affairs to a close in a legal manner. WE, the Class of 1931-B, realizing that our time is short and that we are about to depart from the blessed and happy life at the High School of Commerce, and being fully possessed of sound mind, memory, and understanding, do, hereby, make, publish, and declare this, Our Last XVill and Testament. OUR effects, which Fate has bestowed upon us and which by our natural talents have acquired, we dispose of as follows :' Item I: To Mr. Andrews, our beloved Principal, we leave our everlasting gratitude for the inspiration he has been to us during our stay at Commerce. Item II: To hir. Boyden we extend our sincere appreciation of all that he has done for us in the last four years and wish him the best of luck in his new work, for he has indeed been a friend. Item III: To llflr. Casey we present all our pains and aches, and sick-appearing countenances, as well as a new supply of dismissal slips. Item IV: To the Freshmen, who are all the name implies, we will our books, notes, and Boston bags, so that the ancient and cherished custom of hauling them home shall be forever preserved. To this same group we leave three more years of P. his and homework, as well as fvisimzs of a diploma. Item V: To the Sophomores who are being initiated into the intricacies of Bookkeeping are left all our old balance sheets, bottles of red ink, and erasers. VVe also present them our battered and worn Economics books. lylay the heirs show their gratitude by studying as long and as diligently as did their predecessors. Item VI: To the Juniors we kindly bequeath our home-rooms, where they, like we, will be granted the privilege of using the window sticks and pencil sharpeners. Sole rights to the use of the corridors, both for promenading purposes and as a meeting place for pre-class discussions, are also granted them. Our Senior dignity- the most Page Fifty-.fefven ,coax to Y - g e fir L, VW 'P ' E' ififiwwl lil! IV tw, fgrvu s 'fe111!f'::'wgf,g 3I !f 2 agile , Q ..-.., at t ra.. pm H- ------ ' , highly prized possession of all-isxconferred on the members of the Junior Class on condition that they do not misuse it. Item VII: To the teachers listed below we leave something to remember us by : To Mr. Ward and Miss Bosworth-all the medals, trophies, cups and plaques that members of our class have won on many an occasion. We request that these be kept in a highly polished condition. To Mr. Wilson-undisputed possession of Room 60, including the noise and din which is caused by members of the Crchestras, the Glee Club, and the Band. To Mr. Sweet-a book, entitled, Geometery, the Easiest of All High School Subjects. To Miss Barnes-the administration of the trust fund we are establishing, from which all athletic subscriptions will be paid. To Mr. Moriarty-a steerage passage to Europe, where he is to make a detailed search for the ghosts of Macbeth and Hamlet. iTo Miss Boyden and Miss Ellis-More Latin scholars, as well as hopes of developing new talent for the Latin Play. To Mr. Ruane--a phonographic reproduction of Good Morning in seven dif- ferent languages. To Miss Mclver-a book, with gilt-edged pages, bound in Morocco leather, entitled, Birds of a Feather Flock Together. To Mr. lVIorrill-a patented device to use on the feet of prospective secretaries who persist in turning in their toes. To lVIiss Elfstrom-the chance to retail the story of her college days to the new recruits in the class of speed type. To Mr. Hutchins-a collection of Commercial Law test papers, which, if he is so disposed, he can have bound and sell for a new joke book. To Miss Moran-an all-talking picture of the witch scene in Macbeth, to- gether with three or four likely theme songs. To Mr. Disney-five tanks of oxygen to be used by him in the conducting of an open air school in Room 78. To the rest of the Faculty-our deep appreciation for their patience and self- restraint while listening to our silly questions and foolish answers. ' Item VIII: A few of the members of the Class of 31-B, who are for no apparent reason generously disposed, take this opportunity to show their extremely generous nature: Bernard Yanofsky leaves to some budding scientist a supply of chalk with which he may practice Newton's second law of motion by bounding it off pupil's heads. Page Fifty-eight LQ or s so 2fgCf W i NEWS H' f '!! I fiffhll! '. WH! Il TI W. 1 I EVE -17:5 gig 1 .1-2' '32-1, ,ish 4? Martha Bearse presents the heroine of the next Latin Play the remains of her make-up kit. . Arthur Argoff offers the space which he has so nobly occupied at Assembly meet- ings to any member of the club who will but apply for it. Ann Gagan cedes the title of Most Popular Senior Girln to the lass in the junior Class who polls the greatest number of votes in an open contest for the title. Leo Garrepy leaves his drums. That's something to beat. Abraham Plotkin disposes of three suitcases of notes which were used in a recent debate on India, by giving them to the janitor. Ruth Gurley and Mary Pierce surrender to two ambitious Journalism pupils Cambition an absolute requisitej the Editorships of the Mercury.,' J. Russell Hemenway wills to the treasurer of the next graduating class the remains of the Class Dues Receipt Book, together with his autograph. Doris G. Anderson leaves, to all Commerce, prospects of surpassing the average of 94 per cent which she has set in all her studies during her stay at the school on the hill. Chester Casperson leaves for open competition among members of the Sophomore Class, hitherto unpublished directions on The Art of Throwing the Voice. Julia Miller promises to part with the dance programs of all the socials held during the past few years. The APS CArgoff-Plotkin-Savagej bequeath the Winchelling Around Com- merce Columnu of Mercury fame to Edward Starr, together with the privileges of the colyumist that goes with it. George Zakarian leaves his trombone to someone in the Orchestra to blow about. ' Linnea Stenman parts with the sealed test tube of HZS gas, which was prepared in our own Chem Lab, to some dramatic society for obtaining the proper atmosphere for war plays. Harry Sackstein passes on his position as cartoonist for the lVIercuryl' to anyone familiar with Freshman jokes. Nellie Woodman leaves to any member of the Track Team a copy of her limited-edition book, entitled, How to Overcome, Catch, and Hold a Fleeing Ban- dit. Leo Leavitt donates ten dozens of his snappiest ties to those who might need them in giving bright recitations. Francis King rewards each member of the Golf Team with a hole-in-one. Eva Skibinsky leaves to the Girls' Debating Society a list of long established rules on the persuasion of judges during debates, especially with the boys. Page Fifty-nine aoaxl - f, - - ZF Herbert Edman presents two masks, a wig, and a moustache to any member of the Blackfriars who can use them. I Rose Riley donates to the school library a manuscript entitled, Assorted Excuses for Every Occassion 1 The destiny of the 'fCheer-leader is left in the hands of Joseph Weiner, and John Ascocks, with the single provision that they learn how to manipulate the mimeo machine. Thomas Poweres, our noble President, passes on the torch of good will of the 1931-B Class into the hands of the President of the next Senior Class, with the under- standing that they, the Class of '32-A, will carry on where we left off in bringing fame and glory to the name of Commerce. Item IX: The whole class leaves the school-June 17, 1931. In witness, whereof, We the Class of 1931-B, the testators of this will and testament, set our hand and seal this twenty-second day of April in the year of our Lord, nineteen hundred and thirty-one. ' ' Signed, THOMAS P. POWERS,'Pres. ANN E. GAGAN, Sec. STEPHEN G. SAVAGE, Will. iv Page Sixty EQ ie- Vi em 11r-' :ll 'JH gl'fll'WfiiU ?f5l'15'f'g'i'E EV ff'fE'I1I5f l i''J fll'if 1mi ' ,KKEE 1 fQ5f1iiiiUWl7v5i'Vwfs Q?s:qQgrll:fHPUQubYQHELM1 11 + J . w SSEII, .iZggiii giE3E:w2y.Eii,i i,, Words By Music By Beatrice Greene 1951 5 CLASS SONG Kenneth Stewart k Roland Tannebring ' 1. Cheer our blithe young Mer-cu-ry Cheer him to the skyg Ev--er wave the PEE?-4 z z V- 4 . I' . ' ', - r A . y - 1 Q ' H wi -a 3-- vmf 4 J 5 : L - . ' I? f',gfEff,f':rlJ flihqf Q ol-.14 and Blue, sign of com--meme Highg Wins--ed feet Of Her--cu--rzf. ' B F FL? 9 ' 47 B F . H+ - . 1 43 4 j i E I f : 1' -GP wr 4- I I . E , J J 5.514511 is J ,emi B Q . Take our hearts with you, As we sing this last fare-well To the Gold a Blue. , , , M 1 fZll ' 1 -Q 9 A ' iosflyzg 3:-nn.lllslrEE-gi fiiiiat qi? ' 571 J :vii gkizi .245 ' J , 2. Blend your voices now in song, Grateful thanks for harpy days, Hail the Gold and Blue: Let the melody ring forth, Loyal hearts and trueg Rise now and salute them, Sing with all your heart, Pay to them one last tribute Ere we all must part. Valued as pure gold, Days of fervent, youthful joy Spent within thy foldg Shout for all those classmates dear, And for friendshins true, Made beneath the banner folds Cf the Gold and Blue. Page Sixty-one L fl fx W 7 ra'- 4-Z,'-f z 17, .,,.. X! -get The Gold and Blue KENNETH STEWART VICTOR P. B0lN'33A and ROLAND TANNEBRING '31A 3 -L-- - X l X - :- B. I A . :ge-: 4 EE' 'E'l 4 5E :'5'z'-55' -1 :5 g ..-..-...r:-.......-!!!!.. - F-2' f .. ! . F :-:EEEEAE- l'!5'E: . E! ' ii.-E . n ' ' i, . i ' , 1. Ral - ly round the gold and blue! .l The ban- ner fair - est 2. Mer - euryk staff of gold so bright...-... With all its charm and 3. Sing1-v theng sing of gold and blue! l... And raise your voic - es l I . E 1 l ' l F S? l l fr E . . ! ! ! J 9 , : 'I . S' . , 'I ll , :L Y e 1 il 'x I 2 . . Je .. he zo. Milli. WE of them allg 1,-, Show .. that we are tried and mag - ic power,.ii. Lend - ing us its speed and to the sky! iii.. To ., our schoolwe'll all be . I 1 ff' aj? 4 Z ' -- 1 . I I v' . ' ' 7 'l I I Q' 1' 4 X X I . I I ff- , ' ' Q 59-5551-Q-lj-5-3.5.5 true ..l.... To Com-mcrce High, and prove our last- ing loy - al- might, il. And show -ing us the way to has - ten to our Drum . And ev - er let our flag wave on its stan-dard V J 2 i- 1 Q 1 - 2 . 5 if :, 1: : ?T, :4 F E: I . N I I I 1 . Lil! 1 'f 'S 'f F ' -' 4' I , 4 . . . . A : 3 .............................. : Copyright,1930,by Worcester High School of Commerce Page Sixty-tfwo ,fe II -S V7 Q szs2aJ1iP:s5sah:e5m-wMAT5 III'II'I'IfIf IIIIIIIII I5Q'II5fII'IIIIIIIIIIIIIIIIIIIII- I'-. 'III I-I' 'IIIIIIIIII'TI7II I5'IIIIIIZI' I I' I I Q v 6 ' Li: II Yi 4 . P ,-5 if 'FQ' If I I I 3 I I vgzif ER E55 ,I , . Wh? I ez-I ty! Oh! We i shallstrive to win for herI ---- And tho' the goal. Oh! May, it ev - er wave on high, 1 With gold en high! Oh! Nev - er let the gold bc stainedI T. And al - ways L. I I ,,f-Fx! I :.1F'- '- - I I,f. I I I I I I I . 4 I I I 93' +I-aI If I I I I If I I I I I If-1 I I I If OI If 1 -J F' 1 PJ :I f H 9' I . I I I I 'r' I I ' I I I I 2.5: 0' 1 aE:Ij' s' E ,E cj fight 1 be hard and long, -. We worft give iIlI ------ wings - to land it flight. . So may the famei-. keep... the az - ure clear, ......... That roy - al hue, ...l I . I I I I Z' I, - I E- ' I I I - - I I ' ' 'ii71x-1 1, -.4 1.415 ' ' 3 I f ' , . I Hi J. . J. 7 Q 7 I , I LII I 5 I ge i 4. I Lf - we're out to win, 1- So sing our fight - ing - of Com-merce name Climb to an un - reached 1 that viv - id blue, To Com-merce hearts so 'L' I . I .1 I fksx I I I ig... . ., : ri-gg, .. .. 3 I I, IVF? 5? I I I I 9I:f'1.I If 1 II I I- I JI +I I I :I 2 :II I F' 1+ 1 4 XJ Illand 2 II 3, I f eg I,.IL f I EH Aix lj I 3 'f H song! .. h ' ht. -. . :elg : dear! -.-...TT 8 .... 5-' 5 'J If : - 5' Xa ' I I I I. I I I I. J ' I I 1 I 5' 1 I-Y I t I I J 4 'J' 1- 4' 'J' ' The Gold l!ldIBlUO 2 Page Sixty-three - IL Qlxz - f' il , 713: Isl 'i-Ef 1' fir' uw 1f-- l 1!Ev1l1: 5 -11' :'!i : i 'f5 I 12 if ful a1:I'e:2' 1, 1531 Eff TO COMMERCE R. R. GREENWOOD Alla. marcia CHARLES I. Rica Eg.!1 T '1,i, Z I -Q..J:5i,- .l A jf- ' - 'lg . K-- -Ai'iZ1:-lA 1. G-ifve a rouse . . . . . and a. cheer And a paean oi vic-Vry 2. We be sons . . . anddaugh-ters staunch With the spir -it of our 3. We will stand . . . . and hold the field Tho' the bat - tie ra, -ges 4. Let de - feat . . . . . or vic-t'ry come We will cher-ish with a, .' -- - ...- - -J 2l- .J -A-.5 ., . 4L!iECEi-'ffl-v-Lexi-E75 :Lf-H:-435355511-iiij -Q--Q-0, C -w. ,- ' -C Il- -- i--:-ll-I1-- -3- vo- 0- -y 3,1 -L .E 'QL LL ' S4 I 'Fi' L24.T.- 44. - ,JZ egfae-we-155-.315-. 4- 32 E31 Eg Egiemefgg-1-3 ' . 1:21 C- gn rf 5- F+--:ji-'J jlq ji2l-i-3g,,LYgE1ai.l1.iA2EElf.,!:1-..,L3 'i.i.' itfL. 1:-iff!-zzg---5- --1'iiE- '4vf7:l:-y:: llngg Swell the song . . . withvoi-ces clear Till the fir-mafmentdoth youth, And our ban - - ner we will launch In the glow-inglight of long, With no blot . . . up-on our shield While weshont a.-gain the will The . love . . . that makes us one, While ourcheersshallech-0 'T I ip , -ii-T' :l7.,t'iT4iP'-i- - 14 -- ' I1i,. ijfll 1179:- '-jtgil I-04-+4-T-I-cel 7'- .l-'L'j:Ei:11'1-1,- 1 -1 ... ... v I .,3.. i- 'T'if5'T3f3 ,,. -J.J:514Ejff. -n43-51r4l4-4!4.--n+!f5f1i-.-:4-'t1--n-.-,-- g:E2'f l riT':E:EEQ -!--'f,'EI- ,-E17-Fi-,.F?:i 1153553 e ,C e r e ee -T few fr il bl V R J, I lgrses 1, 2, 3:5 -Y 4th, vgse Q- Q i Q , 5 Fl. T .-.--Jiri-.::L5H2l:n.1ritr-,Eg- - -V 4- -, 3. -1- -'.2 :i1 .,4..l:1t':-w.1i-i1 ring ' Truth . Song To Commerce! To Commerce! To Commerce we sing! Commerce! To Com - merce! :till ' fh ra b b A. Yagi:-fi '--gm -1225523255-E522-i3'5 2-Eiiia'E'5f2a . 2211-+ HH- - -H--Leaf-11 - :sage-+6 broadly - 4,':i. Li'gl - ..--Ja-lv- T w. -Jw - - --J.-J 'L 'SgE15?ffJf 4D3E2:'5?5EEgE 3:1?EEE2!:EH3iEi1E?l11'I'?gES If-fc-C-P 5----f,f3ff3,- Er-9.--1,4 ' .greg-gf 125+ ....,. ...... .-4. Copyright, 1916, by WORCESTER HIGH SCHOOL OF COMMERCE Page Sixty-fo-ur ' ' ' 'lijlljiiigijgfi siiif Wxg i,'IQfQiQli ff'jjj Tiig'i i2j2 1 ?f,. ,'ffte,g if tg-1 f: a if A L44- xx ' f f i : m Ci .LJ W : L M'W 'fl ' 4 ' ' ' .... ..... . Life' args I ',- ' . -'Lili'-,tv. f'gGFH2- , v,.L , -. ,..,. .',. LIL on X D' so SARAH ADELSTEIN Sonny minds nobody's business but her own and consquently has no enemies. She has made many friends since she came to us from Junior High because of her cheerful smile and sunny dis- position. The diligence and ability with which she has prepared her work at Commerce shows that she will make a success at Fairchild's. Bumble Beesg Stamp Clubg Honor Pupilg Cadu- ceus Editorial Board VIOLET AHL ,Indian Hill sent us Vin four years ago. She is one of our happy-go-lucky classmates and is never seen with a frown. It makes us almost believe she hasn't got one. Dancing is her hobby and she excells in it. Vi intends to become Somebody's Stenogf' when she leaves us. Britomart JULIA ALEVITCI-I Three years ago Julia came to us from Junior High School. She is a happy-go-lucky girl and her studies do not weigh heavily on her mind as she is looking for the good times of school life. Julia tells us that after departing from us she is to train for a nurse at City Hospital. She will make a first-class, eflicient, cheerful nurse. Britomart EDITH ALMGREN Some ol'Hce is going to be lucky enough to get Edith Almgren, who we know is a stenographer of no little ability. Edith has made many friends since she came to us from Adams Square School and is well liked by all. She was active in the dilferent social events and was prominent in the Bumble Bees. Britomartg Bumble Bees HILDING A. H. ANDERSON Clark College will get an excellent scholar when Hilding enters in the fall. Anderson came to this school from East Kendall Street School. While here he majored in Chemistry and Physics being assistant to Mr. McCann in the Physics Depart- ment. Hilding is one of the most argumentative members of his Class and usually wins his point. Stamp Clubg Boys' Debating Society Page Sixty-six e0 5 as V if .......XXXU Milli'LT'l W1?lUgl?' ' f- - ww:-y y , Qlsqiitifigpaz ,, 3 . f fist Qi - .Q Pfiigiriszi-QFLQQQ 4 'W' were c ALICE J. ADELSON Alice is one of the best declaimers at Commerce, where she took second prize in the Declamation Contest sponsored by the Girls' Debating Society. Her quiet, friendly disposition has won her many friends during her stay at Commerce. She CCI'- tainly should continue to cultivate her declamatory powers, for they are helpful to anyone. VVe wish you the best of success, Alice! Winner in Declaiming Contest in 1930 ESTHER CECELIA AHO Esther is one of the few graced with talent in drawing, having studied it for four years at school. She is an ardent stamp collector and was honored by being chosen secretary of the Stamp Club. Esther also lent her services to the Glee Club. Not many students have spent their time as profitably as Esther has in so many various ac- tivities. Au Revoir! Esther. Girls' Glee Clubg Secretary of Stamp Club BEATRICE ALAVOSIUS Beatrice owes her primary education to Saint Casimir's School. She is another one of our six- teen-year-old graduates and we are proud to have her in the 1931B Class. If Beatrice goes to col- lege she will be only twenty years old when she graduates. We hope that she takes advantage of the wonderful start that she has made. Stamp Clubg Girls' Debating Society DAVID ALDRICH Dave came to us last year from South High, where he was well known as a golfer. He con- tinued his golfing ability at Commerce by being manager of the team. Dave intends to matricu- late at Harvard. Blackfriarsg Golf Teamg Glee Clubg Lettermen's Club WYMAN ALLARD To make a success in the business world is Wyman's aim. Wyman came to us three years ago from Junior High as the President of his class. He well deserved that position for his ability to mingle with his classmates won him much popularity. While here he majored in short- hand to help him in his future work. Blackfriarsg Glee Clubg Track Teamg Basketball Team Page Sixty-swan U . 'Q , A , K. Qi ' x X f by 'L viii 4 if s . V11 igfgtg few Rf'I'me--er' lu ,-0 A xx f!!?!54l '1'H me ' 'ill' ' 'il'If ' I 'I' 1' ' PZ iinmmuf mit .iP!EiZfifITS.,l'liILfll alll f W ll El ' e SUCCESS. e . R Page Sixty-eight VIKING OLAF ANDERSON Viking is one of our quiet bovs He came to Commerce from Upsala Street School in his fresh man year. Most of his time was taken up with his studies. Spanish is his most lmportant sub ject and he completed the course here He intends to enter the business world after graduation BEATRICE BAGUSENKAS If personal charm could be turned into ready cash Beatrice would be well off before she ever started to work. But we knovs she has other qualities which will be more useful Ill the busl ness world, and these will be appreciated by those who need help. While here at Commerce she has made a host of friends all of whom wish her well RUTH BARSKY A talkative young miss, with dancing blue eyes and dark brown hair, is what the Lake View Grammar School sent to Commerce in the per on of Ruth Barsky. It appears that Ruth liked to join clubs much better than studying for she says she has no favorite subject. She plans to attend the Leslie Kindergarten School upon completing her education here. Good Luck' Orchestra Ag Girls' Glee Club Vice President Stamp Clubg Bumble Bees Britomart MARY ELIZABETH BARTKUS Mary, who came to Commerce from Lamartme Street School, is one of our quiet girls She be lieved in work before play the four years she was here. Her main subject is bookkeeping and she plans to enter the business world as some b0dy's bookkeeper. The Class of 1931 wishes her VIOLET AMELIA BATSTONE Nova Scotia is where Violet hailed from in her freshman year. While at Commerce she has proved herself a worthy and earnest student and made many friends here. Some business college we know not which one, is where Violet intends to go after graduation. Success is sure to await h r rigs .,- ,- M-4 and lj r U ses p l NX .lllirllt-1 'rw ,zz l.. ll lim 5, m.rE5llb!Tlw'.f lil l lllll 1 ll? s ,3::i' ANTHONY AMBROSE Tony'i is one of the most popular boys in the senior class. He is an all-round athlete, excelling in basketball. ',Tony came to Commerce from the Jones Street School, where he had already made a name for himself in sports. He will ex- tend his athletic abilities at Boston College, where We may expect to hear of him. . President, Lettermen's Club, Blackfriarsg Senior Class Day Committee, Boys' Baseball, Football, Basketball, and Track Teams AGNES ANDERSON Aggie is one of the brightest rays of sunshine in our class. Her merry laughter is sure to at- tract attention because of its heartiness. Agnes is a talented dancer and crooner, and has appeared several times before school audiences. Good luck to you, 'iAggie. Britomart, Bumblebees DORIS G. ANDERSON Quiet and unobstrusive by nature, Doris has risen to the very pinnacle of scholastic achieve- ment and despite her retiring nature, her popu- larity was as firmly established as her marks. In poetry, too, Doris displayed great talent and her contributions to the Mercury and the Class Ode aroused the greatest praise. Middlebury College will appreciate the company of this scholar and lady when Doris enters next fall. Editor-in Chief and Vice-President of Nuntii Vir- gilij Secretary of Britomart, Motto Committee, Co-author of Latin Play, Horace Mann DOROTHY ADELE ANDERSON After a year at Classical, Dorothy decided that Commerce was the place for her. So to Commerce she came and here she stayed. Her cheery smile, friendliness, and sincerity have made her many friends. Dorothy claimed membership in the French Club. We Wish you all the good fortune there is, Dorothy. French Club ARTHUR ARGOFF Although it is a bit trite to use the age-old ex- pression, quiet and unassuming, Art enacts the role to supreme perfection. Upon arriving from Junior High, Art betook it upon himself to be- come a debater, and to hear him tear his oppon- ents to pieces at Assembly meetings makes his enemies shudder, yet his innate modesty forbids his telling of his many triumphs. Good luck, Art, Assembly Debating Society, President, Varsity Debating Team, Chemistry Club Page Sixty-nine ,ff- ii g ,S XX is HC-.ylll Mil ,I ml I, 11:1 Il I , 14: :i:lllHf'll'Ill'-f '1 l U XI K H I ,Jann I I MJ! ii, aiglqiilil +3-S' -r 0325? C ANNA ARGOSKY When Anna came to Commerce from Ward Street School she was only twelve years old. Per- haps there are many who, if they were entering High School at this age, would have a tendency to become slack because they were so young. But this was not the case with Anna. She studied hard and now she is graduating at the age of sixteen. CECIL ASLANIAN Good humor seems to dominate the Aslanian family, there being three of them in our class, Victoria, VVilliam, and of course Cecil. Cecil is known far and wide for his ability to tell jokes and keep people laughing. He is what can be called a Ublues chaser because he seems to ra- diate good humor. Chemistry Club VICTORIA S. ASLANIAN Victoria came to Commerce from Abbott Street School and is considered as the best looking girl in school, and no doubt would be the winner of any beauty contest that would be held in the school. She is also quite a popular girl in the school and because of her good humor and looks is the envy of the rest of the feminine set in the Commerce high school. She is also quite active in social affairs. Chemistry Club RUTH AUBERTINE Ruth was among the many who came here three years ago from Junior High. She seemed rather quiet and reserved, but once you became acquainted with Ruth, you immediately found her a good pal, full of fun. How pleasantly Ruth would greet you every day, rain or shine. What- ever you undertake Ruth, 31-B class wishes you the best of luck. Bumble Beesg Britomart LENNART BACKHOLM One of the fellows who is known all over school affectionately as t'Major Hooplew is Len Back- holm. He is a diminutive lad who takes life with a grin. However, he keeps up well in his studies and limits his outside activities to the Hy-Y Club. We expect Len to show the world what a Com- mercite can do. Best of luck, Len! Commerce Hy-Y Club Pzzrfe Smwnly 4- ,. , T, ,.,, Te' X fffiiim We IWUW ii S V: Q Z6 ef RUSSELL BARROS Rus as he is called by most of his friends at Commerce came to us from Oxford Street School. During his stay at Commerce he was very act-ive in sports, playing on the Football, Baseball, and Basketball teams. He also was one of the found- ers of the Rifle Club. Rus intends to enter the Bartlett Tree Surgery School. Baseball, Basfcetnail, Football, and Rifle Teams, Lettermen's Club HELEN BASS The class of 193lB seems to be rich in the number of Horace Mann students that are in the class. Well, here is another Horace Mann student who ranks high in the minds of students in the school. Helen is quite a popular girl and this no doubt is because of her continuous good humor. Because of these assets and because of her ex- cellence in piano playing, she has been elected as the class pianist for class day. Orchestra Ag Euterpeansg Class Day Committee GEORGE BAUER George is one of Commerce's best known stu- dents because of his gentlemanly manners and his good studying. He has many friends here, and no matter what he attempts, he is certain to suc- ceed because of the diligence with which he ap- plies himself to the overcoming of the obstacle. He plans to enter some technical college next fall. We wish you the best of luck, George! Bandg Orchestra B5 French Club, Chemistry Club EDITH BAZOLL Three years ago Edith came to us from Junior High. Edith's favorite subject was United States History and she has often enlightened many a dull history class with her interesting periodicals. Edith has not told us what she intends to do after graduation but we wish her muchlsuccess. MARTHA BEARSE Martha was dropped into our midst four years ago from Midland Street School. She had the leading role in th: Latin Club play and showed her ability to act. She has been attached to her books and has thus obtained the distinction of be- ing an honor pupil. On leaving Commerce, Mar- tha expects to continue her studies at Boston Uni- versity. Horace Mann, Honorg Photograph Committee Pagf Smfcrzfy 0 If LQEX !!r,,,, -9- Kr f Vi it '1 ' ' fi'rem'i'r'mrg:'2lf11:ir5g'-will:almost fist! 'W 'f JIVXZX E550 ETHEL BAUMGARTEN Ethel and music have been associated with each other ever since Ethel went to Junior High. There she was Concert Mistress of Orchestra A and when she arrived at Commerce she climbed the ladder until she, here too, became Concert Mis- tress of Orchestra A. After graduation she in- tends to enter New York University and continue her study of the violin. Concert Mistress of Orchestra Ag Euterpeansg String Quartetg Three and one-half year graduate MARIE GLADYS BECK Commerce can hardly be said to be gloomy when Marie is around. Although small, she can convey a lot of sunshine with her bright smile and merry ways. Her ability to draw should also not be overlooked for it is more than ordinary. She came to us from Dix Street School andplans to do oH'ice work after graduation. Secretary, Bumble Beesg Blackfriarsg Chairman Decorating Committee EVELYN HELEN BEDIG Evelyn Bedig was graduated from Sever Street Grammar School and came to Commerce to gain more knowledge. She quickly gained favor in the eyes of the students and with the aid of her pleasant, bright smile and good nature she be- came a popular member of her class. She intends to further her education at Boston University. Britomartg Bumble Beesg Stamp Clubg Girls' Glee Club DOROTHY VAUGHN BELL Dorothy Bell, who came to us from Adams Square School, has become very popular during her stay her. Besides being prominent in school organizations, she has attained a good average in school work, excelling in Journalism, which she states is her favorite subject. She plans to fur- ther her studies at the Colby -lr. College where We feel assured she will succeed, President of Bumble Beesg Britomartg Treasurer of Blackfriarsg Girls' Debating Societyg Mercury Staff-Advertising Managerg Caduceus Commitee GRACE VIRGINIA BERGESON The broad smile of Grace Bergeson should go a long way in securing a stenographic position for her. Besides majoring in stenography she is known for her ability to draw and paint. Ask her to show you some of her work. Quinsigamond Street School lost an excellent pupil when Grace came to Commerce. Bumble Beesg Decorating Committee Page Sezmnty-tfwo . ..... . . XX M 1 wl'Uli1lil lI W 1 ,u-'i5i1HiliZ A1 E2 nr Boch DORIS BELL Doris, during her entire stay at the High School of Commerce, has been playing the part of the Good Samaritan to all. Whether it was English or History, or Stenog., she was ever willing to lend a helping hand and it was this trait, above all others, which endeared her to all who were fortunate enough to know her. May all your wishes for success be realized, Doris! FRANCES BELSITO Frances came to us from East Kendall Street School. She has gained many friends, not by an everlasting flow of conversation, but by a pleasant, continuous smile. She did not join many clubs as she devoted her time to studying, and so we know she is prepared to be a perfect Somebody's Stenogf' HELEN BILSEY Charlton High School certainly lost a pretty looking girl when Helen came to Commerce in her Freshman year. During her time off from school Helen was working in Schulte's store on Main Street and she was considered as the best looking one there. Helen says that after she has graduated she intends to go to some college in Boston and probably take up a secretarial course. Chemistry Club MIRIAM BLOOM VVho has never seen this tall, young miss walk- ing through the corridors? Her bright, sunny smile and amazing, blue eyes are really fascina- ting. Her quiet disposition and pleasant manners won her the admiration of her teachers and class- mates. We hope that Miriam's adeptness will help her and bring her to the highest rung of the ladder of success. RITA BOMBARD Gates Lane School gave Commerce a good sport and a zealous student, when it gave us Rita. Rita always did her own work and did it well. She was not satisfied with merely passing, and accord- ingly made perfection her aim. There is no doubt but what she will be just as ambitious in her training at Saint Vincent Hospital. Page Seventy Mme -O S- Vwieiiiailiegf'QW'1ml3s1 Iig25g51ffg3f 'f' H121 lzialzlfl fxwtulmflzs wi-. 'Q1 DELLA H. BISKO One of the most likeable girls in Commerce was Della Bisko. Her big' smile won 'many friends for her and will continue winning friends for her forever. She came to us from Lamartine Street School and intends to go out into the business world for a year and then continue her education at Becker's. Bumble Beesg Britomart MARCIA BOYER Quiet, demure, smiling Marcia surely has en- deared herself to many during her stay at Com- merce, where she came from junior High. Marcia is one of those girls who made the course in three and one-half years. Forsythe's Dental School in Boston is her goal for the future, where we are sure she will succeed as she has in her school work. EVELYN ROSE BRUNELL We are indebted to Junior High for sending this classmate of ours to Commerce. Her favorite subject is German and she has proved quite a wizard in this subject. She has not joined any of the clubs of the school, but nevertheless her popularity was not diminished by this fact. Com- merce's loss is the business world's gain. ALBERTA MARGARET B UC HIN SKY Alberta, quietly and smilingly, entered the halls of the Blue and Gold, coming to us from the Bel- mont Street School. Alberta's hobby is playing tennis and we are sure she will someday be a star in this sport. When she leaves Commerce she will go to Simmons College where she will study for a librarian's career. Good luck, Al. - STELLA M. BURNS Nice things come in small packages was proved when Quinsigamond Grammar School sent Petite Stella Burns to join our ranks at Commerce. Her favorite subject is Journalism, in which sub- ject she takes an active part. Stella's main ambi- tion is to be a newspaper reporter and we are sure that she will succeed in this interesting car- eer. Cauduceus Committeeg Mercury Engraving Manager Page Seventy 'four :o ' ,tt T 1 qw Z1 ' h :' Li 7' gb DOROTHY BORGMAN Dot came to us from Belmont Street School and those who have been fortunate in making her acquaintance are glad that she chose this school to further her education. She is quiet and very sedate but in spite of all this has won many friends. We are sure Dot will be well received in the business world. Girls' Debating Society VERA VVILKINS BOYES There is one fair haired, smiling, young lady at Commerce who deserves commendation as the most popular pianist, for she has been School Pianist for two years, Pianist for Jazz Team, and Pianist for Orchestra A. Vera certainly is popu- lar, but she is as modest as she is popular. We hope that she will continue her marvelous ability. Best of luck, Vera! French Clubg Story Hour, Britomartg Vice-Presi- dent of Euterpeansg Girls' Glee Club, Combined Chorus, Orchestra Ag School Pianist CELIA BRETHOLTZ Fate indeed favored Commerce when Junior High sent Celia to the school on the hill. Bening naturally reserved, and of a modest disposition, Celia was not one to force herself into the lime- light, but three years of A's and honors brought her to the fore. Her modest manner and ever present smile Won for her the friendship of all who knew her. Horace Manny Girls' Debating Society, Secretary, Basketball X CHARLES BROADBENT Charles came to Commerce from Sever Street School. He did not belong to any clubs but never- theless he was popular. He was always an out- standing Hgure in his classes because of his ability to deduce difficult problems which arose. There is a high place waiting for him at VVentworth and we trust that he will step into it. ABRAHAM BRODINSKY Abe came to us three years ago from the Junior High School. While not participating in many of the affairs of the school, he was a very well known musician, playing in Orchestra A and also in the String Quartette. Abe plans to en- ter the New England Conservatory of Music at Boston in the fall. Orchestra, A, B, C,g String Quartette Pagz' Sefventy we EOAQW - - ' ,W Bien MARJORIE BROWVN Marjorie is one who is always capable of cheering up a friend or a group of friends. For one thing, her smile goes a great way in helping her to do this. Marjorie is undecided as to what she will do after leaving Commerce, but in what- ever she does, we wish her the best of luck. Orchestra B and C3 Freshman Debating Society THELMA BROWN Along with some of the other people that came to Commerce from the New VVoodland Street School came Thelma Brown, the best looking girl in Room 70, although Mr. Sampson does not seem to be aware of the fact. When she was taking oflice practice 1 she was given zi good mark be- cause she was up with the leaders in her speed typewriting work. She also likes to mingle with other people and because of that she has joined some of the clubs in school. Glee Clubg Bumble Bees OLIVE BURGOYNE This charming miss came to us from North dur- ing her Sophomore year and many are the friends she has acquired since her arrival. Her future career has not as yet been settled, but no doubt it will be of a business nature. Whether or not this be so, ability, diligence, and skill in carrying out orders are sure to earn for her the highest degree of success. Britomart MARGARET BURKE Tall, dark, and dignified-that's Margaret. Al- though she seems retiring, those who are fortunate enough to know her intimately say that outside of school she is jolly and a good sport. Margaret is an excellent typist and very speedy in taking dic- tation, so we know some business man will obtain a fine secretary. Best wishes, Margaret. Bumble Beesg French Club CATHERINE E. BURNS The business world will claim another Com- merce student when Catherine is graduated in June. Catherine came to us from East Kendall Street School and is one of our quiet and unassum- ing misses. We all know that luck will not elude Catherine in the business world. Bumble Bees, Britomartg Girls' Debating Society Pa ge Sefventy-.tix ,abs ,Mfr 7 J' X LN 1 fI .'f ':'1 ' 'H' igiwrwf '1 isiev' A 1 v If 1 1 ll 1 lg .m.fQ':a T3 NIJ H 'Sill' EARL BURNS Earl came to Commerce from the New Wood- land Street School along with the rest of the popu- lar seniors that have come from there. Earl is quite a baseball enthusiast and because of his en- thusiasm for this sport, he was chosen to play on the Freshman baseball team and Freshman Soccer team, playing second base on the former and guard on the latter. BARBARA ANN CAREY Ascension School gave us another likeable stu- dent when it gave us Barbara. No matter how busy she was, she always had time to help some- one else. And this goes a long way in making friends, any place. She is undecided as to what she will do after graduating. Bumble Bees, Glee Club ARLENE CARLSON Arlene came to us from Dix Street Prep, four years ago, very quiet and studious. During her stay at Commerce she was very popular with both sexes. She intends to enter the business world. Success and good wishes go with her. Britomart ENID CARLSON Who in our class is not acquainted with the jolly Enid Carlson? More than once have her lively remarks caused much merriment in class. Her best friends would even quarrel for a front seat in order to be near her. Her charming ,per- sonality will help her in all future undertakings as it has helped her in her four years at Com- merce. Britomartg Bumble Bees, Girls' Debating Club HERBERT CARLSON Herbie came to Commerce from West Boyls- ton Street and although a quiet and unassuming lad, he has mixed in well with the class. He has attended to his studies and prepared himself for the big Task. We wish you the greatest success, Herbie,i' and may your luck be of the best. Page Sefventy-.ve-ven ,Aoi . Y ,7 I 'f' X! f' ' 'I 1' I' In vw v..' 1l'fl'3 my E21 mf Q 'P CD .LAS-Ji: VII O36 CHESTER CANNON When Chester entered Commerce from Sever Street Grammar School, he was a bashful little boy, but now he is one of the most popular boys in school. He plans to enter some college after graduation where he can push along Journalism. Chet's favorite subject is history. Chester's ability as a verse maker is well known. VALBERG VICTORIA CARLSON From junior High, Volley joined us in her sophomore year. Her ability to draw has cer- tainly made her many friends. But do not think that that is all, for she is also liked by everyone for herself. Stenography is a subject that she excells in and we are sure that she will- make .a success of whatever she sets out to do. ADOLPH CHESTNEY Adolph is one of our outstanding athletes, being prominent in football, cross country, and many other sports. He came to us from Millbury Street School and when he leaves Commerce he will go to Trade School where he intends to take up Drafting. His favorite subject while at Com- merce was Mechanical Drawing, in which he did some excellent work. Lettermen's Club ELIZABETH CLIFFORD Betty is the dark haired miss who came to Commerce from New Woodland Street School. She has been very active both in the Britomart and Bumble Bees. While at Commerce Betty specialized in Shorthand. She intends to go into training for a nurse at Memorial Hospital after graduation. We know she is just the kind of girl to make a lovable nurse. Britomartg Bumble Bees: French Club ANNA PAULINE COBLENTZ V Ann certainly was welcome when she entered Commerce to help us cheer up our old .Alma Mater. She came from Junior High after leaving Union Hill Grammar School. Ann is one'of those few who made high in three and one-half years. She will continue her education but is un- decided where she will again take up the book of learning. 4 Glee Club, Britomart Page Seventy-eight y Log M .4-W . ., 'Wifi Tf. '- ,k . Q . f, , 1 '7 l X M -e C ,sas-s-i for js? ANNA ELIZABETH CASALE Anna is another member of our class who came from junior High School. She is among the group of small girls of our class who have brought us much, despite their small stature. Anna has studied hard and we hope that she obtains a fine position as she certainly deserves it. - EUGENE FRANK CASEY Gene's interests have been so many that to record them fully seems hopeless. Possessed of a wealth of executive ability, his services Were sought constantly, a to the Presidencies sembly. Whatever he cannot help but look on life assures fact attested to by his election of the Stamp Club and As- walk of life Eugene chooses, succeed, for his cheerful out- success from the start. Circulation Manager, Mercuryg Stamp Club, fPresidentjg Assembly Debating Society, fPresi- dent, Secretary!! Varsity Debating Team, Boys' Glee Clubg Combined Chorusg Science Clubg Chemistry Club, CSecretarygj Commerce Hi-YQ Caduceus Editorial CHESTER CASPERSON While at Commerce, Chester has taken an ac- tive part in debating. In 1930 he was elected Secretary of the Boys' Debating Club. Any de- bating club should consider themselves lucky to have such an orator as Chester on their team. Chester intends to finish up his school career at Becker's Business College. Assembly Debating Society and Chemistry Clubg Secretary of Assembly Debating Society, Member of Ciaduceus Committee. A ANNA CELESIUS Anna is a girl who takes her troubles with a smile, and her good fortune in modest manner. This temperament means a lot to a student about to seek new friends and greater achievements in a life outside of school, and this is why Anna has a great chance of making good. Bumble Bees AGNES THEODORA CEPKAUSKAS Agnes is one of the perfect posture girls of 1931-B. She played on the Girls' Basketball team in her senior year. Many clubs, as well as ath- letics, have claimed much of Agnes's attention and time. Agnes is very efhcient in shorthand and typewriting and we are sure she will make an ex- cellent secretary for some business person. Britomartg Bumble Beesg Girls' Debating Clubg Basketball Page Sefventy mne LO Q ig -,,,,,,,,, Y 1.935 fl , 't U' ff 1:1'Nr ' 5irQ!'!f'1'1l 1 'gfm1'iw'i'i i1'E1 N Ir' l I Y-if MARJ ORIE CHAMBERLAIN West Boylston Street certainly lost a pretty looking girl when they sent Marjorie to Com- merce. Because of her winning ways she has been elected Treasurer of the Girl Reserves. Marjorie has also taken an interest in athletics, being on the basketball and hockey teams, play- ing forward on the basketball team and center half back on the hockey team. She is often seen on some of the dance floors of Worcester. Midge is also chairman of the Class Gift Committee. Bumble Beesg Britomartg Girl Reserves, Girls' Debating Team REBECCA CHERVINSKY One bright, sunny day in July, 1913, the Cher- vinsky family was happy because a little girl had just been ushered into the word. Re came to Commerce from Junior High and at once be- came very interested in the musical organizations of the school. She is on the Mercury staff and is head of the Engraving Department of the Mer- cury. Re has taken four years of drawing and expects to go to some art college when she gradu- ates. Well, good luck Re. Orchestra Ag Girls' Band CON STANCE CHEVREFILS Connie came to Commerce from St. Joseph's four years ago, surrounded by friends, and they have never left her, but have been joined by many more. We are sure that her sunny disposition and happy smile will make her liked by everyone in the future. Britomartg Bumble Bees MILDRED CINSKY Milly came to Commerce from Junior High Prep and has won quite a name for herself in scholastic circles and will graduate with at least second honors. She has also been on the Hockey and Basketball teams for 1929 and 1930, playing center forward on the hockey team and forward on the basketball team. Bumble Bees JOHN CLIFFORD In leaving Commerce, John leaves a vacancy -which can be filled only by a boy with a great deal of will power and an ardent desire to get ahead. It is a safe bet to say that John will be well-liked and appreciated in any business that he enters. Band Page Eighty L ,, O R ef V 'llzzw-wiqz i 1 X l iQillfEffg: C E EJ H I Q e core' L... S--112355, Q...- F336 MARJORIE CLOUGH There is quite a great .deal of laughter and noise in Room 71. Who is it? Why, its Mar- jorie Clough, usually called Midge by her friends. Marjorie is a blond and quite a dancer, seeming to be dancing every night, and having a great time. Marjorie has also been on the basket- ball team in her sophomore year, playing the for- ward position. EUGENE WALTER COAKLEY Oratorically speaking, Commerce is fortunate having a young man of such striking personality and one who can orate and debate as well as Walt.U Besides being Class Orator, Walt is Vice-President of the Assembly Debating Society, where his winning smile has brought the judges' verdict to his team. Much is expected of Walt, who has many friends here. We wish you the best of luck, Walt. Class Oratorg Vice-President of Assembly, De- batingg Trackg Swimming MARY COAKLEY Four years ago, Mary packed her things and departed from Saint Stephan's School. A few months later she was among new classmates at Commerce High. Within a short time, these class- mates did not seem new to her, but seemed more like old friends. Through the four, short years she has kept these first friends and also made many new ones. Mary will enter Memorial Hos- pital. Mixed Chorus JOSEPH COHEN Among those who transferred to Commerce from Classical was Joe, who has always been ready to give his opinion on all matters of any interests. This accounts, in all probability for his popularity, especially among the young ladies. His ability to wield a tennis racquet won for him many hard battles as well as a host of friends, hoth on and off the courts. Stamp Club, QTreasurergj Varsity Tennis MEYER COHEN Loyalty and ambition are two characteristics which have been great factors in Meyer's success- ful stay at Commerce, since his entrance from junior High, a school which largely through Mey- er's efforts we all know Well. Intricate bookkeep- ing assignments and brain teasing Latin phrases- all succumbed to the powers that were his. Some business concern will get the services of an up- right and hard-working young man when he leaves us. Page Eighty-one 2fl:, 1, ' , ........ .f...,.. ..... f IT Wife' ' ARLINE COTE Arline, better known as Pee-Wee came to Commerce from Woodland Street Grammar School. She is a petite miss and one of the sweet- est girls in our class. Upon leaving Commerce, Arline intends to go to business college where she will take up Comptometry. Although we Shall be sorry to have her leave us, we all wish her great SUCCESS. Britomartg Bumble Bees SONIA COTTON Some time ago this miss dropped in on the old U. S. A., looked around, and decided to stay. In due course of time she made her way to junior High School and thence as a climax to a success- ful career to High School of Commerce. VVe hope she has enjoyed her stay here as much as we have. She will succeed in her life's work. Britomartg French Clubg Glee Clubg Combined Chorus HELEN CRONIN Helen came to Commerce from Chandler Street Grammar School and soon won many friends by her carefree manner and winning smile. Helen was prominent in the Britomart, being secretary of that club. After graduation she intends to take up a secretarial course at some institution but is undecided which one it will be. We all wish her every success. Bumble Beesg Britomart Executive Committeeg Secretary of Britomart ETHEL B. DAVIS When Ethel came to Commerce from Sever Street School, four years ago, she brought with her a pretty smile and winning disposition. Al- though she has done well in all her studies, ste- nography is her special forte. Upon graduating from our Alma Mater she will enter a local busi- ness college where she will broaden her business education. Good luck, Ethel. Britomartg Bumble Bees: Chairman of Class Gift Committee RUTH F. DAVIS One of those neat, sweet girls is Ruth, with her sparkling eyes and pleasing personality. She came to us from New Woodland Preparatory and while at Commerce has become one of our out- standing members. Much of her leisure time has been taken up with the Britomart Club, where she is Vice-President. We wish her success in the business world. 1 Vice-President of Britomartg Bumble Beesg Glee Club Pagr Eighty-tfwo QE V Q 'E sl LJ l -Fl MQ oglb REVA COHEN Of course, you all remember the talking mara- thon that was held in some city quite a while ago. That was to see what woman could talk the long- est and not get so weary that she could not con- tinue. If only Reva had been there. Reva is con- sidered as one of the fastest and best talkers in the school and she is proud of the fact. She is quite active in social affairs and is quite a good dancer. Britomartg Bumble Beese SEYMOUR COHEN In a practical ratio, Seymour was to the Com- merce tennis team as a paddle is to a canoe. Be- sides being a good tennis player, he was also a good mixer. This fact alone is enough to carry him to the top rung of the ladder of life. Seymour intends to enter the University of Florida in the fall. French Clubg Glee Clubg Lettermen's Clubg Cap- tain of the Tennis Teamg Member of the 1931-B Social Committee JOHN COLLINS From the day he first came to the halls of Com- merce from St. Paul's School, John has been one of the most popular of our boys. An ever smiling countenance and a readiness for both hard work and good times soon won for him a place in the hearts of his comrades. The best wishes of all go with him when he enrolls at Cornell in the fall. Lettermen's Clubg Caduceus Editorial Committee EDNA CONNER Edna probably has as many friends as any girl in her class. And little wonder when we consider that she always looks on the bright side of life and takes everything with a smile. We are ex- pecting big things from Ednawhen she enters Trinity College. - Britomart SYLVIA COPPERSMITH Sylvia won for herself the admiration and re- spect of her classmates by her witty remarks and her happy-go-lucky nature. Her plans are un- known, for like all the truly great, she does not publish all that she intends to do. May fortune smile upon her efforts and make her future bright. Page Eighty three ' ,342 O R-Q-f ' M 'ny X Vl'l Wl ll, A' 3 nw' n 5 l,. 1. lil N - .'1S4 --M-2 f-1-r:-'-xii' -pf Page MARY CORB ETT This dark-haired miss came to us from the Sacred Heart Academy. She is well-known among her classmates and has become extremely interest- ed in French while at Commerce. When she graduates she will go to Memorial or City Hospital where she will take up nursing. We know there will be many patients who will enjoy being sick while she is there. Girls' Debating Society, Britomartg Euterpeans SONIA REVA' COTTON Sonia is another one of our classmates who came from junior High School. They certainly send us some good students. While at Commerce, she has been a prominent member of several clubs and an outstanding figure on the Girls' Tennis Team. Sonia has decided to begin train- ing at the Beth Israel Hospital in New York. Britomart, French Clubg Girls' Glee Club, Com- bined Chorusg Girls' Tennis Team JAMES CO URTNEY James is one of those fellows that everyone likes to know. A pleasant nature and an even temper are two good reasons for his poularity. Although he did not take part in any clubs, it is easily seen that this was not necessary to win him many friends. James intends to matrieulate at Boston University. DOROTHY COVELL Many times at assembly we have been given the pleasure of hearing Dorothy sing. These were the assemblies that we certainly enjoyed. Besides being a good singer, Dorothy was also a good musician, having played in Orchestra A, B, and C. It is expected by all her classmates, that her ability in music will do much for her at Gor- don College. Orchestra A, B, Cg Glee Clubg Consolidated ' Chorusg French Club KATHERINE CRONIN When Cambridge Street School gave us Kay, it gave us a girl with a cheerful smile and a good word for everyone. Next fall, Kay will bring this good cheer to Trinity College. We hope and trust that her schooling in college will be as suc- cessful as it has been at Commerce. Britomartg Bumble Beesg Debating Team Eighty-four 22-.2 4s1 fefe' ww my1H'U'f!1 !'f'1,v'1'i1: ' 'L 4 N ww:,,,W ,fc E. U LT. N Xx.lwiwi.4l1 los Kv.. ' im v1,.,,1 lmsllrihwi 4s1.s,l- ,,4. , FSJQGW o v MARY CRONIN Mary came from Belmont Street School and im- mediately upon her arrival at Commerce, was recognized as one capable of chasing the blues away. Mary has made up her mind to enter some business office. Several years from now we will not be at all surprised to find her in a high po- sition with some large firm. Britomart VINCENT CROTTY Vincent was always ambitious and his reports always showed it. He never wasted any t1me.1n going at what he wanted to do. Although Vm- cent is as yet undecided about what he will do after he leaves Commerce, his friends feel sure that these traits will lead him on to success in whatever field he chooses to proceed. LORENA CROWLEY Lorena took her place in the assembly hall four years ago, ready to begin her career at Commerce with much vim and vigor, and she has lost neither while here. She has been a success in whatever she has undertaken and although she has not made herself very well known she has many fine friends. Good luck to you Lo1'ena. MARGARET CURRAN The class of 31-B received Margaret in '28 from Junior High. We all found that Margaret had a quiet way about her, but all her friends will tell you that she is always ready for a good time. Margaret spent her time profitably during her stay at Commerce and we know she will continue her good work in her future life. Britomart LENA DABOUL Sacred Heart Academy sent us Lena, back in September, 1927. During her four years at Com- merce, Lena has light-heartedly followed the max- im Laugh and be merry. In spite of her petite physique, Lena is destined to establish a record in the business profession, and we know she will. Best wishes, Lena. Page Eighty for E56 CHARLES FRANCIS DENNEHY What was Dix Street's loss was C0mmerce's gain when Charles came here four years ago to get a business training. Although he is undecided as to continuing his education, his main ambition is to join the ol'l'ice force. When he graduates there is no doubt but that he will fulfill his am- bition. Track Team MERILDA DUBE VVe can thank Sever Street for sending Merilda to Commerce. She is one of the outstanding mem- bers of our class, being a splendid all-round athlete. Her hobby is any kind of athletics and she has received many honors for different sports. VVhen she leaves Commerce she will continue her education at the Sargeant School of Physical Education. Bumble Bees JOHN DUCHARME John sailed into Commerce at top mast from Saint Joseph's Grammar School. During his stay here he has become very popular, especially with the girls, and has appeared in many of our school plays. He has been one of our outstanding students and we know he will be gladly received at Bos- ton University where he will take up journalism. French Clubg Blackfriarsg Latin Club VVILLIAM DUGARD Smiling Bill brightened up the corridors whenever he went strolling through them, joking and laughing with his friends. He is one of the few boys who entered Commerce from the Cam- bridge Grammar School. VVarmer quarters are sought by this classmate, who is going South upon graduating, to the University of Alabama. Lettermen's Club, Stamp Club SONIA EPSTEIN Keen ability came with Sonia from Junior High to Commerce. In addition to being a Horace Mann scholar, she is also a three and one-half year graduate. Some orlice will employ this clever hookkeeper who showed her powers in keeping Mercury affairs straight. Horace Manny President-Lucky Thirteensg Mer- cury Staifg Caduceus Advertising Committeeg Blackfriarsg Girls' Debating Society Paar Eighty-.fix sack tgl I I QW 2 O36 1 cr KATHERINE DALEY VVhen Kay came to us from Sacred Heart Academy she brought a ray of sunshine with her. Her cheery greetings have made many friends for her during her stay at Commerce. Kay plans to go to New Rochelle College, where we are sure she will make good. Treasurer, Bumble Beesg Britomartg Girl Reserves ALICE DAUCUNAS The Mercury Staff will certainly lose a valuable asset when Alice, the Advertising Manager, graduates. Being particularly fond of dancing, she has rarely missed one of Commerce's socials. Alice plans to go in training as a nurse at Christ Hospital School of Nursing in Jersey City, New jersey. May the best of success follow you, Alice. Bumble Beesg Britomartg Science Club, Secretary of Stamp Club, Glee Club, Girls' Debating So- ciety, Advertising Manager of Mercury MARGARET DEIGNAN Very little has been heard from Margaret since she came to Commerce. She is a quiet, little miss who doesn't say much. Therefore we are quite convinced that she knows a lot, like the wise owl which got all his knowledge by sitting on a branch of an oak tree and saying little but seeing much. We all wish you the best of luck, Margaret, in whatever you undertake. MARY DELANEY - This quiet, little classmate of ours has been with us since her Freshman year. Although she is of a retiring nature, still she has acquired many friends at Commerce, all of whom love her be- cause she is just herself. Mary will enter the business world after graduation where we wish her the best of luck. LEON DELU DE A bit shy, quiet, and unassuming, but a A'man's a man for a' thatf, That is Leon. His stay at Com- merce has indeed been a pleasant one, and many are the times that the application of his helpful nature or extensive knowledge has solved a prob- lem for us. He has won a place in our hearts and it is hard to see him go. Good luck, Leon. Puqz' Eighty-Jmffn A 1 0 -i Y il' j sv' dggfxf MINA DENOWITZ Laughing is Mina's favorite pastime but she also found time for her studies. She was always seen about room 72 before school and recess with a crowd about her. We sincerely hope the future has nothing in store for her that will tend to silence her merry laugh and happy chatter. Britomart MARY DOGINIKAS , Everybody let's play sickg not now, but when Mary becomes a nurse at the Memorial Hospital, for to be such is her greatest desire. She came to us from New VVoodland Street Prep, and we have enjoyed her quiet and pleasing ways since she nas been with us. We all Wish her the best of uck. Britomartg Bumble Beesg Decorating Committee . NORA DONAHUE Four years ago this bright, happy girl joined our class from St. Peters. Nora is well liked by all her friends, and they are many. On leaving Com- merce, Nora intends to enter the business world and we are confident that she will meet with much SUCCESS. Stamp Clubg Britomartg Bumble Beesg Girls' Debating Society ALICE LOUISE DONALDSON Quiet, but alert, was Alice ever since her arrival from junior High three years ago. Her career at Commerce-has been marked with a great deal of success,'both in her school work and other activi- ties. Her quiet and unassuming nature won for her the admiration of all her classmates. We are indeed proud of this ever-smiling, ever-willing, young miss from Boylston. - Britomartg Stamp Club FREDERICA DONLEY Willingness to work brought Frederica to Com- merce from Elizabeth Street School and since then she has attained a high standing in all her studies. While attending school, this young miss made many friends and we are sure she will continue to make them when she enters the Memorial Training, School. I Britomartg Horace Mann Scholar Page Eighty-eight l V Y will , ' . f Hi rrw 'wv1f:1.' ter ' - if 1 Hlliifflf Tx! 1 .iiiiiim ,,i..., , ,.,ivi,vi.i,,-i..,x.,.l.,i i GRACE DONLEY Grace came to Commerce from the Elizabeth Street School filled with great ambitions to be somebody and her ambition still clings to her. No doubt, in the future, Grace will be known for her level head in business. Stenography is one of her favorite subjects and through her school she has had good marks in this subject. Well, good luck, Grace. BERNICE DOWNING Good things do come in small packages as Bernice has confirmed this. Wherever there is a good time to be had you'll find Bernice there. Bernice, with her sunny disposition, certainly brightened many of our dull school days. She joined many clubs and was an active member of each. We do not know what the future holds for you but we know you will succeed, Bernice! Britomartg Bumble Beesg Girl Reservesg Caduceus Editorial MARGARET DROHAN How lucky our class was to have such a mem- ber as Margaret. She has graced the Bumble Bees and the Girls' Debating Society. Peg is an entertaining person but doesn't talk too much. Wherever Peg was, you were sure of a good time. Good luck, Peg Girls' Debating Societyg Bumble Bees ANDREA DUQUET Andrea came to Commerce from Holy Name School and starred in basketball and Hockey dur- ing her freshman year. Her stay here has netted her many friends because she has always shown herself to be an optimist. With such a bright out- look on life, Andrea certainly cannot fail to secure the reward she so richly deserves. Basketballg Hockey HERBERT EDMAN Junior High School sent an all 'round fellow when it sent Herb. Besides being president of the Blackfriars, he is an accomplished orator and has participated in assemblies. Popular with his schoolmates and prominent in activities here, he has chosen as his future educational school some medical college. VVe wish him the best of luck. Bandg Chemistry Clubg Blackfriars Page Eighty-nzne fffff - X X WTTL K . 1 1 f' fm - YX xi ' N4 X 'Wgicf' ROLAND A. ERICKSON The year he came to Commerce from East Ken- dall Grammar School, Roland was elected class president. He was an excellent student, being a Horace Mann scholar and in addition won First Honor of his class. Roland will specialize in economics at Clark University. His success is assured. Horace Manny First Honorg Blackfriarsg Orches- tra A, B, C3 Chairman, Caduceus Committeeg French Club President '29-'30g Class President Freshman Year EDWARD EVERARD The day he graduated from Adams Square School, Edward ran to Commerce and has not stopped running since then. In addition to being a good runner, he is a musician of some note. Commerce will sorely miss him when he leaves to matriculate at Springfield College. Lettermen's Club, Orchestra A, Bg Indoor and Outdoor Track, Cross Country CHARLES JAMES EZEN Charles transferred to Commerce in his senior year from North High. His attractive personality immediately secured for him many friends in a very short time. VVe regret the fact that he did not transfer early in his high school career. Charles goes to Wentworth Institute at Boston to further his education. Soccer Teamg Lettermen's Club FRANCIS FAGAN Edgeworth Grammar School sent Francis to Commerce along with that pleasing personality of his. fThe girls will attest to that.l He is a scientific person as his favorite subject, Science, proved. Francis's love for children asserted itself when he let it be known he intended becoming a teacher. He will enter Fitchburg Normal on graduating. Lettermen's Clubg Caduceus Editorial Committee VIRGINIA FAIR Virginia put the class in class day we all agree. She was Chairman of the Class Day Committee and Class Historian. Virginia joined several clubs after arriving here from Belmont Grammar School four years ago. This popular classmate will further her education at Northeastern Uni- versity. Blackfriarsg Bumble Bees: Britomartg Class Day Committeeg French Clubg Class Historian Page Ninety SOPHIE EPSTEIN Providence Street favored us with Sophie way back in 27 The mlschief in her eyes had led her into many Jolly scrapes, but who cares if she can rush into school at eight fourteen and fifty-nine seconds and still make it. Although Commerce's activities havent claimed Sophie, her friends have found her merry spirits a help. CARL HERMAN EURENIUS Herm1e entered Commerce from East Kendall Street School and has displayed wonderful ability as an executive while Circulation Manager of the Mercury He can well boast of many friends, as his popularity shows. Hermie also took part in he Blackfriars' play, Mary Rosef' Whatever Herm1e attempts, we are certain he will be successful. Best wishes, Hermie! Blackfuars, Circulation Manager of Mercury EVELYN FARR Modest Evelyn one of our popular girls, has proved to us that good things come in small packages She lb one of the nicest girls we have the privilege of counting a loyal member of 31-B. We are sure she will be a valuable asset to any business man and will make new friends wherever EDNA MAE FIELD Edna entered Commerce from Malvern Road School and her quiet, attractive nature soon won her many friends She has maintained a high scholastic standing and has been active in several clubs We dont know what Edna plans to do but she surely will make a success of whatever she attempts We wish you the best of luck, Edna! Brltomartg Girl Reserves MARCARET FIELDING Did you hear that darling giggle? Why, it must be Peg ' talking about what a Wonderful week- end she had with one of her many friends. Echoes of Bob Louis Charles, can be heard if one was the type to eavesdrop, but as the advertisements say Such popularity must be deservedfl and we re awfully glad to have someone in our midst rate so well with the college boys. Good luck cg W ggynwyg .I Jax- l-' -7 f -1 rw. , U-Nilxfyyfe U CJ 3,0 Britomart Page Ninety-one ff..Z .-agua- if 7 ll T l ' ll I 'II Xt iii' ' !:!l'T'f- ! i2'v Tv iZ'14' If I! wg 4 l ww ,, .N mm C RICHARD S. FALVEY f'Looking at the world through rose-colored glasses -that's Dick Falvey. Dick camle to Commerce from Union Hill Grammar School and immediately endeared himself to all his class- mates. He is a high flyer, having served his school in the High Jump and the Pole Vault. Worcester Tech awaits his entrance in September. Good luck, Dick. Lettermen's Club, Pole Vaultg High Jump HENRY FITZMAURICE Henry is famous for his witty remarks that served to put everyone in a happy mood. Com- merce benefitted when Upsala Grammar School bade him good-by four years ago. In a very short time Fitzy made many frieds who will not forget him when he graduates. He will en- ter Georgetown University to take up the foreign service course. Lettermen's Club, Decorating Committee LILLIAN MARTHA FORSBERG When Lillian came here from Quinsigamond Grammar School, Commerce rejoiced. True to form she made progress in her studies immediate- ly. -Her shorthand course has stood her in good stead and she will be someone's hard-working stenographer after graduation. Bumble Bees ETHEL LYDIA FORSMAN Ethel is a sporty girl, as her athletic record shows. North High lost a valuable athlete when she transferred. Ethel was Assistant Girls' Sports Editor of the Mercury. Some physical training school will get Ethel when she graduates and success will be hers. Hockey: Basketball: Mercury Staff, Caduceus Advertising Committee ' AURORE FRAPPIER This stenographer entered Commerce from the Holy Name Grammar School, ready to take down notes. Aurore is an Honor Student and also a three and one-half year graduate. She has studied faithfully and has realized the success she strove for. Her every ready smile has won her nu- merous friends. Becker's Business College beckons her. French Clubg Honor Student Page Ninety-two e e ill R C V7 , 1-'tr !1,,3.l2,w.f2':il-Z'Expiryt11,ry37,EE'5:4ewufs'llt'lE!,:eif1lEgl1l J l V , l X Q il' T I 'Qi' X5 GERTRUDE FILLOW Quiet, demure Gertrude surely has endeared herself to many during her four years stay at Commerce. Although quiet, she has made many friends. It will be great to be sick when she corn- pletes her course as a nurse at Memorial Hospital. ROSALIND FINE Remember that sweet girl who so willingly gave us our picture appointments for graduation ?-well that's Ros.'l She is outstanding because of the fact that she completed the course in three and one-half years and was able to be a Horace Mann Scholar. Normal School will open its portals to her next year and we all wish her a happy four years there. Horace Mann Scholarg Honor Studentg Britomartg Girls' Debating Society NORMA FINKEL Norma has only been here with us for two years as she transferred from Classical at the be- ginning of her Junior year. Norma immediately showed us she was no ordinary person, as she earned a Horace Mann Key. She also participated in activities of various clubs of the school. What- ever you do in the future, Norma, do it as well as you did everything at Commerce. Bumble Beesg Girls' Debating Societyg Britomart I DOROTHY FLEMING In her freshman year Dot decided to take a business course and therefore transferred from Classical to Commerce. She has proved herself an asset to the school in more than one way. Danc- ing is her hobby, and she excels in it. After graduation she plans to enter Post's Business Col- lege and continue her business career. Bumble Beesg Basketball MARY N. C. FLYNN During the year 1927, the Adams Square School sent to Commerce about 10 pupils, among whom was Mary N. C. Flynn, destined to be one of the most popular girls in the school. Mary is quite a sociable girl and because of this quality she has been voted into many societies in the school and has held the position as secretary of the Nun- tii Virgili Club during the past year. Britomartg French Club, Nuntii Virgilig Girls' Debating Society Page Nineiy-lln ee .0-X 1. lk f ' 'll I' 'Nl' 'r I flllllfjf'51'lQIflll'lEl?XS Y +A -M---'W jg KATHERINE FOLEY A pleasing addition to the Senior class is Kath- erine Foley, who came to us during her junior year from North High School. During her short stay at Commerce she has won a host of friends and has also gained membership in several of our clubs. Colby College will be the recipient of Katherine's scholastic talents when she graduates in June. Bumble Beesg Girls' Debating Societyg Britomartg French Club DORIS FORKEY Doris came to Commerce from Classical at the beginning of her third year. It did not take her long to become acquainted with her new school and her new classmates and within a few months she had many many close friends. Doris intends to enter Colby College in September. We trust that she will make many friends there also. Bumble Beesg BritomartgGirls' Debating Societyg French Club ANNA FORZLEY Anna came to us from Junior High School. She is one of those cheerful, happy-go-lucky girls who make school life worth while. She has made many friends while at Commerce and they all declare her to be a jolly good friend. She will enter the Worcester Normal School after, and we envy the kiddies that she will teach. Girls' Debating Societyg Britomartg Bumble Bees KATHERINE FOX Katherine came to Commerce from Malvern Road School. Although she has not belonged to many clubs while in high school she has been well-known and liked by her classmates. Kather- ine has decided to enter the Memorial Training School for nurses, in September. We all know that this pleasant young lady has all the prelimin- ary requirements of a perfect nurse. Britomart DOROTHY FRANCIS That courteous, well-poised, pleasant girl is Dot. What a shining example she is of the faix sex from Auburn. Who ever caught Dot mis- behaving or without her lessons done? She never hesitates to assist a friend and because of that she made a most loyal and helpful pal to us all. Loads of luck, Dot. Page Ninety-four L Og at V ,: -'SL-iss?--:f'9' XX I jiitl1':!l:x-legalral-lrziiwiiu -t If ,,,,,E:-,,:,Iyt:,,:1,. -wit 1 X M' C: .nf I qui ly X . , ---- ' e e l ANN E. GAGAN Ann may be hest described as a personification of the word personality. From the earliest days, we find that she has commanded the esteem and respect of all who knew her, while her untiring efforts as Class Secretary, her endless activity in the various organizations of the school, and her scholastic ability, won for her the admiration of all. We wish you all the luck in the world, Ann. Class Secretaryg Chairman, Caduceus Editorial Committeeg Britomartg French Clubg Latin Club, President, Secretary, and Treasurer of the Girls' Debating Societyg Varsity Debating Team, Asso- ciate Editor of Nuntii Virgilg Horace Mann Scholarg Honor Student DANIEL GAGAN Danny is another one of our quiet boys who always tends to his own affairs. He came to us from the Canterbury Street School and has done well in all his studies at Commerce. Danny was also a prominent member of the Stamp and Chemistry Clubs. As yet, Danny has not decided what to do in furthering his career, but success awaits him, anyway. Stamp Clubg Chemistry Clubg Lettermen's Club ANNA GALULIS Anna Galulis came to Commerce from Upsala Street School and has turned out to be quite a sociable girl. She has joined quite a few of the clubs, being in the Britomart, '30 and '31g Girls' Debating Society '30g French Club '30 and '31g Bumble Bees '30 and '31, After graduating she expects to go to Becker's Business College and take a secretarial course. LEO GARREPY Leo wandered up to Commerce from St. Paul's School and since then has made an enviable repu- tation as an actor and in his studies. His cheery smile broadens even more when the fair sex stroll in. Leo has been very active in the Blackfriars and has appeared in Assembly, playing the drums with the Band. He plans to enter Fitchburg Nor- mal. Good luck, Leo! Blackfriarsg Lettermen's Club, Band PATRICIA GIBBONS Pat is the happy-go-lucky girl who has made so many friends while at Commerce. She came from Junior High School and has always taken an active part in social activities as well as ex- ceiling in her studies. We wish her the best of luck when she leaves Commerce to enter the busi- ness world. Britomart, Vice-Presidentg Bumble Bees Page Ninety jifve - Jifjgx Y s , x- - ' - will w 1 v pl 1 'S ,r ' l Britomart after graduation. D versity. Assembly Pagr' Ninetyasix HILDA GAFFIN Hilda brought her quiet and dignified ways with , her from Junior High and began working n dustriously. Those students lucky enough to know her say that under her masl. of sereneness lie the noble qualities that mace and hold her friends. Hilda will continue her education at Sargeant's Physical Training School DOROTHY R. GALLAGHER Dot has made a good record in Commerce for friends and studies. Her quiet and amiable dis position drew many friends to her standards Mid land Street School reluctantly gave Dot to Com merce, and Commerce will as reluctantly let her go. Dotl' plans to enter Posts Business School WILLIAM MATH EW GARRAPY One can't think of Bill without smiling for Biln's own smile is a smile that wont come off no matter what the situation may be Bill came to us from St. Paul's. Bright eyes, good looks and a ready wit have made Bill a favorite with both sexes at Commerce, and the best wishes of all will accompany him to Leland Stanford Uni French Club, Lettermen's Club Boys Debating GERTRUDE GAUMOND From West Boylston Street School came this happy, smiling miss. Toots is one of the popu lar girls of her class, and her pleasing personality is an asset to Commerce. Her pet subject is Harmony, while her favorite hobby is dancing She has selected as her future institution of learn ing Forsythe Dental School in Boston Britomartg Bumble Bees Euterpeans MARY ETTA GOLDBERG There is an old saying, A friend in need is a friend indeed. That applies particularly to Mary, for, no matter what your request may be she will do her best to accommoia e you I is a well-known fact that Mary was a Spanish and German shark. She came from Junior High and intends to enter the business world Class Motto Commr tee i' ?L,,--- -egif A-Q' X lili3i'l'7lliiil,l:liillllili llfilllflfiii' 'll'liV5'l5V?e ff l -U ' I ,.f,c-Jill 1, , it ,wt , Ill I Q '- p' f?'1l'- il i SOPHIE GINSBURG What would we do every morning in Room 73 without Sophie to greet us? She is the kind of person who is as rare as a sunny March day with no wind. She brightens up many a dull recitation and makes us feel school life is not so monotonous after all. Here's hoping that everything worth- while will be yours, Sophie. LEO GLENNON Leo is one of our quiet fellows whom everybody likes. He came to us from the Dix Street Prep and all his work at Commerce has been done with one aim, to prepare himself for Holy Cross Col- lege, where he hopes to make a name for himself. We all wish you every success, Leo. Vice-President, Latin Club, Lettermen's Club, Glee Club, Hockey Team ADA GOLDSTEIN Ada came to Commerce from Junior High and her friendly disposition has won her many friends. She is an excellent scholar and has achieved the distinction of being a Horace Mann Scholar. Ada has been very active along musical lines and she should cultivate her talent. We don't know what she plans to do, but we are sure she will succeed. Best wishes, Ada! Britomart, Girls' Debating Society, Orchestra A, Euterpeans, Girls' Band, Girls' Sax Quartet ISADORE GOLUB A young man comes sprightly down the cor- ridor with a smile for every one and a bright word or two to cause an outburst of laughter. Un- dergraduates wonder who he is. VVell, he's Isa- dore Golub, one of our best loved friends at school. He is a good scholar and is active in several clubs. Clark University will claim Isadore next fall and we wish him success. Assembly Debating Society, Science Club, Chem- istry Club, Blackfriars, French Club ALVIN GOODWIN Al came to us in 1930 from Classical, where he was well known in sports. He was captain of the Tennis Team at Classical. He immediately took up where he left off by being made captain of the Commerce team. He also played on the championship Basketball Team of 1930-1931 and was treasurer of the Lettermen's Club. AV 'in- tends to spend his college days at Antioch College. Lettermen's Club, Basketball Team, Tennis Team, Football Team Page Ninety-.vez fn iii fl Eilfx, l e or - ff' tx E is ' C 14-fl W fl A JQN5 fm., aio ROSE GOLDMA N Although Rose is quiet she is popular with her classmates, and has played her part in Commerce for the past four years. YVe can thank junior High for sending Rose to us. That she is in- terested in furthering her education is shown by her intention of going to the New York City Col- lege. VVe wish her success. French Clubg Stamp Club ELIZABETH GOLUB Betty came to us from Lamartine Street School bubbling over with delightful plans for her four years of school here. According to her, these plans have been carried out and she has enjoyed her course thoroughly. There will be a rush for the dentist's chair when Betty graduates from Forsythe's Dental School and begins to practice. Girls' Debating Societyg French Clubg Caduceus Advertising Staffg Mailing Editor of the Mercury CHARLOTTE GRANT Charlotte is one of the most popular girls in her class. She came here from Elizabeth Street School. Her bohbed hair is of reddish auburn and is a crowning glory. Though she has in- troduced manv styles of dress during the last year she has kept to the eternal style of study- ing. 'fGood luck to you at Boston University, Charlotte. Britomartg French Clubg President, Bumble Bees: Mercury Staffg Social Committeeg Class Pianistg Honor Pupil EMMA GRAVLIN Emma is just what we expected her to be-a nice, lovable girl. Although very demure in school, it is doubtful whether she is quite so shy outside. Emma came to Commerce from New Woodland Preparatory in her freshman year. She is now going out in the business world and some office will be far pleasanter and better run because of her. ' CATHERINE GREEN Catherine, a quiet member of her class, has chosen stenography as her favorite subject. Three years ago she came from Junior High School. With her soft, unobtrusive ways, and low, well- modulated voice, she will suit any employer to perfection. Catherine expects to enter the busi- ness world upon leaving and we wish her the best of luck for the future. Page Ninety-eight so, , V, XX Q '!'i 1 'I -. 1' f, i i f I I3 IJ WSW Q, Lair? Ir? ROSLYN GOULD Being always a firm believer that opportunity knocks but once at every man's door, Roslyn, after attending North High for a year, decided that her opportunity lay in Wait behind the doors of the High School of Commerce. We are sure that the knowledge Rosalyn has obtained While at Com- merce will prove a great asset in her future work. Britomart HENRY GRANT Henry has always been able to take a joke on himself with a smile, and to give an answer to whatever the joke might be. Perhaps this is why he has always been so popular. We sincerely be- lieve that Northeastern University will appreciate his good humor, as it has been appreciated at Commerce. Lettermen's Clubg Hi-Y Club, Cross Country Team ARTHUR GRENON Classical was the loser and Commerce the win- ner when Arthur came to us in his junior year. Was there ever such a smile as Arthur's? And if you were lucky enough to know Arthur you would quickly discover that his disposition was as sunny as his smile. Dancing is Arthur's pastime and in the art of which he is very proficient. Lettermen's Club GERTRUDE GRIFF Gertrude is that wide-awake, eager-looking young lady, who may be seen daily, hurrying from class to class. Her less fortunate classmates who have heard her brilliant recitations do not wonder why she appears so eager to reach the class room. Gertrude is treasurer of the Latin Club and she is planning to matriculate at the Worcester Normal School. A Treasurer, Nuntii Virgili MAURICE GRIFF To look at Maurice one would take him as a quiet, docile young man. But alas! ,Tis not true. He is one of those fellows who delight in action and plenty of it, too. Maurice has always been musically inclined, being a member of the Band, the Euterpeans, and Orchestra A. Best wishes to 'you Maurice. Page Ninety-nine ,O gsg iglzaw 11I'1 wr il-i'l1lllfI!lEi!'ll'l!'!wml 'va 1:'1' if wf'f 7-1'w.:'1f'i 'qagfml' fwlwwx ' ,1.a4--:i....q 0525-u Page RUTH GRISWOLD Lucky will be the patient who has charming and capable Ruth as his nurse, for Ruth intends to go in training after her graduation from Com- merce. Although quiet and unassuming, Ruth has wended her way into the hearts of her class- mates, who wish her the greatest success in her future vocation. Stamp Club, Science Club ESTHER GRACE GROGAN Popular! We should say so! This little Miss with all her vigor and vim, plus a radiant smile, has been one of the mainstays of our class. To have anything happen without Esther around would not be worthwhileg she can always suggest something which makes that which is good, a little better. We are sure her ability to please will be one of her stepping stones to success. Britomartg Girls' Debating Societyg Caduceus Committee RITA GUERIN Hlrish eyes are smiling, whenever one meets blue-eyed Rita Guerin. Although very quiet in school and partaking in few social affairs, she is not backward in enjoying a good time. She has made many friends at Commerce, and with her pleasing personality we know she will make more out in the business world. French Club RUTH GURLEY Combine attractiveness and brilliancy and what have you? A very charming young lady-by name Ruth Gurley. When any one has the ambition and ability to complete the course, after being ab- sent because of illness, besides taking an active part in school affairs, surely that person is extra- ordinary. With her sense of humor and bewitch- ing smile she has livened up many a dull recita- tion. Best of luck, little pal! Treasurer of Britomartg Girls' Debating Club' Class Prophet, Editor of Mercury 1 MYRTLE GUSTAFSON Myrtle is the happy, contented miss who always greets you with her winning smile. Her sparkling blue eyes and light brown hair make her very attractive. She will leave behind her many dear friends whom she made while at Commerce, but we know she will obtain more in her business car- eer. Best wishes to you, Gussy. Britomart One Hundred L Ga g m V f' 03-aes? X l 'fill' 'l W' ' 'f'iil55li.'l ' llf'!ffZ W?!'fwEfliifl'll l 1 l ' l X QR lc: ,,.a14qmflil1'iimi.elll3lllluhjll llllliizg 4 HQ Cribqgcgfxf DORIS V. HAGG The corridors of Commerce will be considerably dimmed when Doris takes leave in June. Many have been the admirers of her lovely, blonde hair and fair complexion. Not only in looks, but in studies, does Doris excell, especially in the art of speed typing. How we envy the business man who is lucky enough to get Doris. Caduceus Editorial Committee EVELYN HANNUS No introduction is necessary because Evelyn is known by everyone by her two large dimples. As she is fond of dancing, she has rarely missed one of Commerce's socials. With a personality and a smile like Evelyn's anyone could make the friends she has made and be proud of it. She will certainly brighten up some lucky business man's otlice. Britomartg Caduceus Editorial Committeeg French Clubg Mercury Staff BESSIE HAROOTIAN Bessie made her Way into the hearts of Com- merce classmates by her loyalty and staunchness as a friend. She came to us from Belmont Street School and throughout her course showed a fine spirit of co-operation. Her success in her future work is assured because of the very qualities she displayed here. Britomartg Girls' Debating Society Y VONN E HARPER Dot is a little girl who came to us from the junior High. She appears to be a quiet, little girl but looks are deceiving, so We are told. She is full of fun and is always in the midst of things when a good time is being had. Her good nature is sure to carry her to great things. Dot in- tends to enter Trinity College. Bumble Bees, Britomartg Girl Reserves HELEN HAVEN Petite Helen is one of the prizes we received from Chandler Street School. With those clear, blue eyes and wondrous dark hair, she has caused many a heart to flutter. Helen is fond of dancing and is quite excelled in that art. Any member of the opposite sex will confirm this report. Good luck to you, Helen. Britomartg Bumble Bees, French Club Page One Hundlefl One ME -l'1ClT ff Q...-Q--Egg! , I I Il VI 1 I 1111: gn J, .iwilw ..,, Vwseitiliflimi-tjiiiluaiii,Witt!iIr.iI:fl!Wivii: xx is I C3 MAS-if ill ee' -fi - if o oooo o BEATRICE M. GREENE And now allow us to introduce a young woman with decided athletic leanings who came to us from Dix Street School. As an all-round player, Bea has no equal. She shines in every branch of sport, being one of Commerce's best athletes. UBea also shines in Journalism, being the Girls' Sports Editor. VVe have no doubt that Bea will make a name for herself at the Boston School of Journalism. Bumble Bees: Girls' Sports Editor: Class Secre- taryg Captain of Hockey Team: Captain of Basketball Teamg Author of Class Song MARIE R. HARBOUR The Adams Square Grammar School sent an excellent pupil to the High School of Commerce when Marie entered in her freshman year. This lass is one of those neat, sweet girls, with dark hair, and sparkling eyes. Marie intends to enter the business world where her traits of dependa- bility and earnestness will stand her in good stead. French Club THOMAS JAMES HEALEY f'Tom entered Commerce as a quiet, unassum- ing Freshman from Auburn Center, but it didn't take long to reveal what a real good scout he was. Although Tom is not known as a shark, he always received good marks in his lessons. Worcester Tech is the goal toward which he has directed his footsteps. LEO H. HEHIR Leo is a shining example of two old proverbs- Silence is goldenu and f'Actions speak louder than words -and it seems that he has guided his life by them. He has never had the semblance of an enemy at Commerce and his friends are countless. Leo came to us from Adams Square and plans to further his education at Worcester Tech and play golf. Golfg Ice Hockey JOHN HIGGINS John, a clean-cut boy, came to us as a Freshman from Sever Street School. Being an active boy, he joined many of our school clubs. His ambition is to go to Boston College for more knowledge. He was a fast runner and was on the Champion- ship track team of '28 and '29. He excelled in history especially. Lettermen's Club Page One Hundred Tfwo , Q ., -Y , E e . ' '....::.. A tit Q 'f .A, .,., .ig ,lt 'P f e From the very day that john entered the con- fines of Commerce he has been regarded as the quietest and most calm of all our boys. His mod- est, unassuming nature soon won for him the admiration of the entire student body. Patience and ability to work hard, the two characteristics by which he was always identified, will undoubt- edly go far in gaining success for john. of the smallest members of the saying goes, l'Quality and not quantity, seems to be the way with Helen. She is one of our happy-go-lucky girls who always greet you with a smile. Helen came to Commerce from North High in her sophomore year and since then has made a great many friends. She intends to enter Normal School. Britomartg Class Day Committee Helen is one class. As the J. RUSSELL HEMENWAY Russell's four years at Commerce have indeed been years of achievement. Possessed of the capacity for hard and painstaking work, he soon reached the very pinnacle in scholastic endeavor, while a pleasing personality and an ever-ready smile won for him the position of Class Treasur- er. It is safe to predict that these traits which he has shown at Commerce will spell success for him wherever he goes. Class,Treasurerg Chairman of Social Committeeg Treasurer of Blackfriarsg Treasurer of Chemistry Clubg President of Latin Clubg Horace Mann Scholarg Honor Student MINNIE HERMAN This attractive, smiling miss came to us from Ledge Street School and has won many friends during her stay here. While here, she seemed more inclined toward her studies than toward the social affairs of the school. Her future ambition is to enter some field of business, in which we cer- tainly wish her success. Girls' Debating Society CATHERINE HILLAN D VVhen Catherine came to us from junior High in our Sophomore year the gods surely beamed from Olympus upon the Class of '31-B. Catherine is the girl who always looked so neat and nice and had her homework done faithfully. She was a loyal member of the Britomart Literary Society. We bid you farewell, Catherine, and success. JOHN HEALY HELEN HEHIR Q-qgxq-sggf-,,, Q56 Britomart Page One Hundred Three 191 ee ,,, , ' 3 l -fpx 'll' ll-Jimf' .50 Ms F , R , 'keel ' 036 o WALTER A. HMURA The High School of Commerce received a very good student when Walter came in from Lamar- tine Street School in his freshman year. Walter doesn't belong to any of the school organizations but has made many friends through his pleasant personality. He has not told us of his plans for the future, but we feel sure success will be with him. MARGARET HOYEN What was Dix Street's loss was Commerce's gain when this young miss came here four short years ago in search of a business training. Because of her quiet manner, her careful work, and her neat appearance, she should make a fine stenog- rapher for some busines man. Her success in the world is assured. Britomartg Bumble Bees: French Club ELSIE C. R. JACOBSEN Elsie came to Commerce from the Quinsigamond Grammar School and has won many friends dur- ing her stay here. She was one of those Journal- ism sharks and preferred'-lournalism to any other subject. Her hobby seems to be swimming. We know she will be a great help to some business man when she graduates in February. Mercury Staff MINNIE JAFFE Min joined the '31A class when she made out her yellow schedule at the Junior High School in june, 1928. She has the distinction of having completed her high school course in three and one-half years. We are confident she will be a success at Beth Israel Hospital in New York where she will enter this fall. Who wouldn't be sick? Britomartg Mercury Staff DOROTHEA WVINIFRED JENKINS 'Dot, as she is known to her classmates, came to Commerce from the New Woodland Street Grammar School. Her favorite pastimes are ten- nis and golf. During her stay at Commerce she has excelled in Algebra and Geometry. After graduation she intends to enter Simmons College in Boston, where she will take a secretarial course. Glee Clubg French Clubg Britomartg Chairman, Class Photograph Committee Page One Hundred Four OO- V siii 1 ,Q s I5 U swf, WINNIFRED THERESA M. HOGAN Winnifred, or Winnie'l for short, came to Commerce from the New Woodland Preparatory School and has gained the reputation of being a good salesman as well as a good story writer of the Mercury. Winnifred has also taken quite a part in the school activities in Commerce, being in many clubs and still having time to do her homework and be able to go out. She is also a member of the Mercury staff. Orchestra Ag Girls' Debating Societyg Girls Glee Clubg Mixed Chorusg Euterpeans, Chemistry Club DOROTHY MARIE HOLBROOK Who in our class is not familiar with this pretty and versatile, dark haired miss? 'fDot entered Commerce from Junior High and brought with her personality and charm. She is not sure what she will do after her graduation but whatever she undertakes, the Class of '31-B wishes her the greatest of success. Girls Glee Club: Mixed Chorus LINA HONKONEN Lina is a very quiet, unassuming girl who al- ways does her work well. Although she did not take much part in the social activities of the school, she got there just the same. She intends to enter the business world after graduation and we know she'll succeed. Best wishes, Lina. HELEN HORTON Helen is a girl anyone would be pleased to meet. There is a certain quiet charm about her which has made steadfast friends of those who have been closely associated with her in school. Much of her time is spent in studying and many are those who wouldn't mind receiving the attention that those lessons get. Our sincerest wishes for success go with her. Britomartg Bumble Beesg Girls' Glee Clubg French Club Pagz- One Hundlmi I We M..-232-e i ,e 1'?11?fce S I VMI, r if 1' ,i CI .1954 W JQ gs 2::g:L3g5EfiEiiQ'3f.a--,flif1 ' D ANNE HOVENESIAN Anne came to Commerce from Belmont Street School four years ago, and was destined to stand forth eminently as a scholar. Her pleasing per- sonality and her popularity won her a warm place in the hearts of her classmates. We are sure Anne will be just as popular and successful in any future work as she is in school.. V Girls' Glee Club, Mixed Chorus, Treasurer of Girls' Debating Societyg Inter-High Chorus, Horace Mann JAMES FRANCIS HOWE East Kendall Street School certainly lost a good humored fellow when Jimmie came to Com- merce. Orchestra A certainly started to flourish when Jimmie joined it by playing the French horn. He also has very red hair and it has been rumored around the school that he would be able to stop a train if he stood on the tracks with his head uncovered. Orchestra A and B RUTH HOYLE Ruth was proud to tell us that she graduated from Auburn Center School. And from what we know of Ruth, Auburn Center ought to be proud of her. She intends to go to Becker's Business College in September. Becker's will be the win- ner, Commerce the loser, of a good natured, so- ciable student. MEREDITH HUTCHINS This charming young lady is known by her many friends affectionately as Babe, She came to Commerce from New Woodland Street School and has been very active, as well as popular, in the Birtomart, of which she was president. She has not said what she will do after graduation but her fine executive ability ought to make her a fine Somebody's Stenogf' Good luck! President of Britomartg Bumble Beesg Chemistry Club, Girls' Basketball Team WILLIAM ITALIANO Unbounded ambition, a pleasant disposition, in- tellectual prowess, and a capacity for leadership, are some of l'Bill's characteristics. He is a tal- ented violinist and has been a member of Orches- tra A for four years. He was President of the Class of '31-B for three consecutive years, and helped to select our class motto, Insta et Praestaf' Bill intends to be an accountant and '31-B assures him of our best wishes. Blackfriarsg Orchestra Ag Motto Committeeg Three and One-Half Year Graduate Page One Hundred Six Loix ' TZ..........I'..1 r'V ' '- 'p:?::?:'13XC.:.i17 2-Q x -I min? ego BENNY ,IACOBSON Benny Jacobson came to the High School of Commerce from the Junior High. During his stay at Commerce he has been very popular with his friends. His favorite subject, drawing, has lead him to be selected as the official cartoonist for the Mercury. He intends to follow up his studies in art at The Boston Art School. He was also a member of the Lettermen's Club and the Soccer Team. Boys' Glee Club: Soccer Teamg Mercury Stalifg Lettermen's Club IDA JACOBSON jack of all trades, master of none, certainly doesn't apply to Ida Jacobson. She has tried everything and made a success of everything. Ida only needed three and one-half years to graduate and she was a Horace Mann Scholar, and Honor Student. One hundred per cent business efhciency, an elert, talented mind, and a personality full of vivacity and cheer are the characteristics any of her classmates would ascribe to her. Horace Mann Scholar: Honor Studentg Assistant Treasurer of Britomart, Girls' Debating Clubg Vice-President of Nuntii Virgilig Associate Editor Nuntii Virgili IRVING JACOBSON Everyone knows Irving, with his cheery smile that brightens up the atmosphere like the rising sun. Irving's many friends testify to his popu- larity. VVhile his school work was good, Irving has also managed to play basketball. His busi- ness-like manner will certainly bring him a rich reward. We know that whatever business you enter, your success will be assured, Irving. Basketballg Lettermen's Club LINDA JASKARI Upsala Street School gave us Linda and she has certainly proved herself a worthy addition to our school. Linda is very studious, but she is always ready to enjoy a good time and never missing at any social event. Our heartiest wishes go with her when she leaves Commerce to enter the busi- ness world. Britomart RUTH ,IAVERY When Woodland Prep sent Ruth to us it did one of the best things it could have done. Al- though Ruth is quiet and demure, her marks in classrooms show her scholastic ability. By her good nature and unassuming manners she has won her way into the hearts of all. All success to you, Ruth, in the business world. Bumble Bees Pagr' One Hundrrd Sm ' hp' E Ogl - V H F.-551,22-Q-xv XX , x,w:ji!.1flXN'!'l,'N Q .X 3 k'W?tf i' RUTH ELIZABETH JOHNSON Ever since Ruth breezed in from the New Woodland Street School she has been a shining light. Her ready wit and keen sense of humor make her a desirable companion. Her favorite hobby is dancing. Since coming to Commerce, Ruth has specialized in Bookkeeping. After graduation she intends to enter the business world as a bookkeeper. Britomartg French Club, Glee Club ROSE JONAS Commerce will surely miss an excellent student when Rose graduates. Rose has won many high standards in her marks, thereby attaining the distinction of becoming a Horace Mann Scholar. Three years ago Rose left Junior High School to enter Commerce. Her favorite study in school is bookkeeping, and she intends to enter Fair- childs' Business College after graduation. Bumble Bees: Stamp Club: Caduceus Committee, Chairman, Caduceus Editorial Board, Horace Mann Scholar ANNA MAE KALAGHER Lake View's loss was our gain. Anna has taken part in many of the school organizations and is well known by the senior class because of her bright and jolly manner. Her preferred subject was Harmony. She is an exceptional pian- ist and plans to enter the Boston Conservatory of Music to further her knowledge of music. Britomartg Glee Clubg French Club MARY KAPRIELIAN Four years ago the Woodland Street School gave us smiling and happy Mary. All those who knew her found her an agreeable companion and a good sport. Her preferred subject was His- tory, as most of us know. In History she starred when most of us failed. After graduation she intends to enter the business world as somebody's stenographer. ESTHER KATZ Here's a little miss who came to Commerce from junior High in her sophomore year. Esther is one of our smallest girls, with black, curly hair and dark eyes. She is an excellent student and has achieved the distinction of being a Horace Mann student. She excels in stenography and plans to be somebody's stenog after graduation. Bumble Bees: Stamp Clubg Horace Mann Paae One Hundred Eirrht V7 M,-'i'.---e..n. 'e2i IL,-ggi-i?+ A-ef J gl Ii' 'lip' f,gVgfl fgjjgliall'f f'!gil3',1!gr53 g,: AQ 1 s Miz' 'mi Nm l ,s-is ll 2, -R .. 2 P ...3i,a.ar' CHESTER JOHNSON When bigger men are made Chet will grow. He is perhaps the tallest student in the class. His height made him a valuable asset to Coach Ward in his football and basketball teams. His favor- ite pastime, that of studying airplanes, will prob- ably lead Chet to Massachusetts Tech. Here's hoping that we shall hear more of Chen Senior Decorating Committee, Lettermen's Club, Boys' Football and Basketball Teams HOWARD JOHNSON Howard hailed from the deserted village of Quinsigamond. On entering Commerce he appear- ed to be the quiet and unobstrusive type, unmoved by the wiles of women, but it wasn't long before the fair sex was attracted by his neat appearnace and good looks. Howard has always fared well in his studies and we are sure he will be well received in the business world. RAYMOND JOHNSON Ray learned his reading, 'riting, and 'rithme- tic at the Dix Street School. Ray was always liked by his classmates because of his obliging and polite manner. He will enter the Massachu- setts College of Pharmacy at Boston in the fall and we wish him the best of success. Lettermen's Club RITA JOHNSON Charming little Rita came to Commerce from West Boylston Street and if we are to judge by the many friends she has, she certainly must be a success. Her activities have included dramatics, debating, and singing, and she has been success- ful in each of them. We wish you continued good luck and success, Rita. Vice-President, Blackfriarsg Treasurer, Brito- martg Girls' Glee Club, Girl Reserves Social Committee RUTH JOHNSON Ruth is well-liked by her fellow students on account of her agreeable manner and her loyalty. To those who are not acquainted with her, she seems quiet, but to those who are her friends she is jolly, good-natured, and a good sport. She in- tends to enter a business school but she has not decided which one. Bumble Beesg Girls' Debating Societyg Stamp Club Page One Hundred Nine , Q p -QQ I I Wx ,V3'fT fl! f'iT ' ! !'iEff',1 '5 iii? T2152 iW lf'V,ElSiI H I Ill! Il ll W C w Xxl f si CD V1 l il ll l JOSEPH L. KELLEHER Northeastern Law School will claim Duke when he graduates. We all hope he will be as popular and successful with his new friends as he was at Commerce. Duke'l graduated from St. Paul's Grammar School. His favorite subject while at Commerce was Geometry, and his hobby was swimming. He has been very active in sports, having played on-the Basketball and Soc- cer teams. Basketball: Soccer, Boys' Glee Club PEARL M. KEMP Kempy is the happy contented miss who al- ways greets you with a smile. She came to Com- merce four years ago from Tatnuck Grammar School. Since her stay at Commerce she has ex- celled in Stenography and after graduation she is planning to take a secretarial course at Boston University, where we know she will be a success. Britomartg Bumble Beesg Girls' Debating Societyg Caduceus Editorial Board MARGARET KEOU GH This charming miss is very well known among her classmates. Her fair complexion greatly adds to her charms. She is a faithful follower of Art and her presence is greatly welcomed at all school socials. She is artistic also in swimming. The Massachusetts Art School will have a promising student in this young artist. Britomartg Girls' Glee Club ZARA KRASNOW Zara, the little, curly-haired miss who is always ready to laugh and be merry whenever she gets a chance, came to Commerce from Greendale Grammar School. Her favorite study was Mathe- matics. During the summer her hobby is swim- ming, while in the winter she turns to skating. After graduation she is planning to take a libra- rian's course at Boston University. MAURICE KRINSKY Junior High School sent an all 'round fellow when it sent Moe. His favorite pastimes are football and public speaking. He is an accom- plished orator and has participated in many as- semblies. f'Moe has been president of the Class of '31A for three years. After graduation he in- tends to take a course in business administration at some higher institution of learning. President, Blackfriarsg Treasurer, French Clubg Vice-President, Assembly Debating Societyg Boyls Debating Teamg Orchestrag Bandgl Lettermen's Clubg Stamp Clubg Footballg Manager, Tennisg Manager, Basketballg Class President Page One Hundred Ten X of, l7Q11W,C: ' ig i. J ly I ....ri.:li1,, ,?Trl II ,.-,T-. ,,,, , 1 i THEODORE JOHNSON l'Teddy hailed from that thriving metropolis of Shrewsbury to spend his senior year at Com- merce. He is a quiet, modest, gentlemanly sort of scholar and is well liked by his teachers. Ted has no definite plans for the future, but in what- ever vocation he elects, we are sure things will not be dull. ALVE JOLLY Alve came to Commerce four years ago from Nlidland Street School. He was one of the few freshmen to make the championship Football Team of 1'9Z7. He was also prominent in baseball, basketball, and soccer. He was also a member of the French Club, and Lettermen's Club. Alve plans to enter Holy Cross College in the Fall. Boys' Baseball, Football, Soccer, and Ice Hockey Teamsg Lettermen's Clubg French Club PETER JONITIS Pete showed his heels to many runners on the cross-country, indoor, and outdoor track teams. His sparkling good humor is Well known around school and we expect much of L'Pete when he enters Clark University. Pete is a member of the Assembly Debating Society, the Science Club, and the Chemistry Club, and he is active in all of them. Good luck, Pete.l' Assembly Debating Society, Chemistry Club, Science Clubg Cross-Country, Indoor, and Outdoor Track Teams LAURA JORDAN We never hear Laura say much, but that is the very reason she is probably doing more thinking than most of us. She has many friends and has worked hard, thus having gained a very high standard in her studies. Her ever-prepared les- sons and her intelligent answers have won the ad- miration of her teachers, as well as her classmates. PAULINE KAPLAN Pauline, called Polly by most of her friends, came to Commerce from the Junior High School. After graduation Pauline expects to go to the Traphagen School of Designing in New York. Perhaps along in the future when people attend a ball they will probably see that the women have beautiful gowns and that they are telling with pride to some newcomer that they were made by the Parisian gown designer by the name of Paul- ine Kaplan. Well, good luck to you, k'Polly. Page One Hundred Eleven .0?M fi r ll ' ' ' 'll I ' 1 iv ' f 1 ' 24 in l-'VSSSQ' va' ima!! I X if W C' f ,l .1-fx-4144! Tr ANNA KASKAN A sweet voice, a happy smile, and a willing- ness to help whenever possible, have endeared Anna to all who have been fortunate enough to make her acquaintance. She is one of the few pupils who has had the distinction of not being absent since her entrance to High School. The class wishes her success in whatever she under- takes. Girls' Glee Clubg Nuntii Virgilig Girls' Debating Society, Combined Chorus CATHERINE KELLY Catherine came to Commerce from Cambridge Street School and is considered as one of the quietest of the feminine gender in the school. Catherine is also quite active in sports, being on the junior Basketball Team in the years '29 and '30, and playing the guard position. This prob- ably accounts for the team's ability to capture games at quite a high scoring. Catherine has also a good voice and because of this sings in the Girls' Glee Club and she is hoping that sometime she will be an opera star. Girls Glee Club CELIA INEZ KEN DALL Celia entered Commerce from New Woodland Street School and since then has enjoyed a very successful school life. She is a talented musician and a good debator. Celia's dimples have won her a host of friends in school, so why not when she enters the business world? We wish you the best of luck, Celia! Treasurer of Girls' Debating Societyg Orchestra Ag Girls' Band, Girls' Glee Clubg Combined Chorus EVELYN KEN N EDY This enchanting young lady is so well known for her charm and grace that a large part of the success of the two Blackfriar plays, The Swan, and Mary Rose, in which she had the leading feminine roles, is due to her. Evelyn will certainly be a success should she decide to enter the drama- tic stage. We Wish you the best of luck, Evelyn. Vice-President of Blackfriarsg Britomartg Social Committee MARY KENNY Mary, the girl of smiles and charming person- ality, came to Commerce from the Sacred Heart Academy. Her smile was known along the corri- dors like sunshine breaking through the clouds. Mary was Vice-President of the Bumble Bees. She intends to take up physical training at the Posse Nissen School. We certainly envy the pupils that have Mary for their instructor. Vice-President of Bumble Bees: Britomartg Black- friarsg Girl Reserves Page One Hundred Twel-ve ROBERT KINCAID One need not look twice to determine who this yocng man is for Bob is one of our most popu- lar Seniors While at Commerce he has taken a great interest in athletics, which is evidenced by his membership in the various athletic clubs. His class wishes for him the best of success in whatever Lettermens Club, Swimming Teamg Cross Country, Mercury Stat? WALTER KI N G If a pleasant nature could gain knowledge for a student Walter would never have had to study. But he did study and studied hard. Still, he al- ways had time to make friends. There is little doubt but what Walter will make a success at the Kerry Medical School in Ireland if he continues his good work which we trust he will. MARJORIE KITSON Midge is the happy, contented miss who al- ways greets you with her winning smile. Her sparkling blue eyes and reddish hair make her very attractlve She will leave behind her many dear friends whom she made while at Commerce, but we know she will obtain many more in her VIRC INIA KNOWLTON The Liberty High School, of Liberty, Maine, sent us an honor student when Virginia entered Commerce during her Junior year. She also at- tains the distinction of graduating before the age of sixteen Virginia is planning a secretarial course after graduation and the Class of '31 wishes her the best of success. HELEN PHYLLIS KOSKY What was unxor High's loss turned out to be our gain when Helen came here three years ago, for her pleasing personality and happy smile have indeed been an asset to all of us. Studies came easy to Helen and she also had time to engage in other school activltres, being chosen Vice-President of the Girls Debating Society in her Senior year. May success always be yours, Helen! Vice President of Girls' Debating Societyg A'i M M Eli O isis-, U7 , sy ,E i C S KH yt, Britomart Page Om' llufrdrfd Tlzirtferz 70:- --- T -r-J ,, Q if G A lil f' .is 9 ve ' UXEXQI jf-yr :J gb MARGARET E. KRUKONIS This attractive brunette, Peggy by name, has many friends among us. She came to us from Lamartine Street School and she has done well in her studies. Her skill in shorthand certainly will give her a good living. Swimming seems to be her chief recreation. French Clubg Girls' Debating Society M. IRENE LAMOTHE Her music ability has caused her to become very well liked and very well-known by all her class- mates. The nimbleness of her lingers has made her a good stenographer. Sever Street School certainly hated to lose this talented girl. Irene would rather sit in the house and study music than go out to the movies. Blackfriarsg Secretary, French Club. EBBA L. LARSON Bubbles has the distinction of being a Horace Mann Scholar. junior High School certainly hated to lose this talented girl who will someday be Somebody's Stenogf' Most of her time at school was spent on studying and not on recrea- tion. From her nickname it is easy to guess what a happy girl Ebba is from being t'chummy with her friends. Class Motto Committee LOTTIE LEAVITT Lottie is one of our very popular club girls. She came here from Junior High School as a sophomore. She is deeply interested in history and intends to continue her studies in some col- lege. Her basketball activities have won her many friends. The class bids you Good Luck, Lottie, and don't forget us. Bumble Bees: Britomartg Girls' Debating Societyg Mixed Chorus: Girls' Glee Club SYLVIA RENA LEVINE Sylvia came from Junior High. During her stay here she has gained many friends and has been a real joiner. She seemed to enjoy history best of all her studies and she did well in it. She plans to enter Beth Israel Hospital in New York in the Spring and to keep herself physically Ht she engages in various kinds of sports. What a splendid nurse she'll be! Girls' Debating Societyg Britomartg Bumble Bees: Girls' Glee Clubg Mixed Chorus Page One Hundred Fourteen c L Q , N rg MIRIAM ANNA KROCK Along with quite a few ambitious looking young- sters tbat came up the hill that fine September day in 1927 to go to attend the school on the hill was Miriam Anna Krock. Anna is quite a popular student and her friends stand by her. Among her favorite subjects are World History, Zoology, and Spanish. After graduation Miriam expects to train for a nurse at the Beth Israel Hospital in Boston, Mass. Britomart ETH EL A. KUIVILA Elizabeth Street School certainly favored us when it sent Ethel to us. Ethel is a happy-go- lucky girl, popular with everyone, and a member of several clubs. Her pleasant smile certainly cheered us up and we hope it will bring her much success in the business world. 1931-B wishes you the best of luck, Ethel. French Club, Bumble Bees, Britomart LILLIAN A. KUNIN Why can't the Assembly Debating Team seem to be able to defeat the Girls' Debating Team? The team of the girls' is very good because Lill is on the team and how she can argue! She has also held the oflices of Treasurer, and then later, Vice- President, of the Girls' Debating Club. Lillian has taken a course in journalism and is assistant advertising manager of the Mercury. Girls' Debating Societyg Britomartg Bumble Beesg Mixed Chorusg Glee Club, French Club CATHERINE LANE West Boylston Street School lost a great little girl when Catherine graduated. Catherine always has a smile for everybody and with this and her pleasing personality she has a great circle of friends. Here's hoping that Catherine will carry her smile out into the world. Bumble Bees FLORENCE LAPIN Florence is not very big, but she certainly fills up a big gap at Commerce. She came to Commerce four years ago from Dix Street School, laughing, and her gayety has remained with her during her stay at our school, much to our pleasure. The Class of 1931-B Wishes you luck, Florrie. Britomartg Bumble Bees Page One Hundr-gli Fifzggn -' if VTW'l5fi'l'i w 'S :I 'f -Z ++' - TQ NjHesflEriKZ3,f A fe of ' E s Page One ..,.. o o OLIVE LAWRENCE Hahnemann Hospital will certainly get a dili- gent student when Olive enters this fall. She came to us from Tatnuck four years ago and ever since has been an asset to the school. Her smile, which is never lacking, will be a comfort to her parents. Success to you, Olive! Britomart DOROTHY E. LEES This bashful and quiet girl came to us as a Freshman from Cambridge Street. During her four years at Commerce she has gained many friends. When she comes to school in the morn- ing, she starts to study immediately. One of her outstanding assets is her speed in shorthand. Good Luck, Dot. Britomart JULIA LEVINSKY Julia hails from Junior High School. Her greatest asset is her ability to talk. She has proved herself worthy of her reputation many times. She was a popular member of the Girls' Debating Society. Emerson's College is waiting patiently for this good student. To keep herself physically fit she plays tennis. Girls' Debating Society, Photograph Committee JACOB LIPSHITZ jack is a quiet dark complexioned lad who came to us as a sophomore from Junior High School. His basketball training has brought him much fame during his stay here. He has kept in touch with Mr. McCann in Physics, his favor- ite subject. The class wishes you Luck, jack , as you enter the business world. Track Team, Indoor Trackg Cross Country RUTH LIPSON Ruth hails from junior High School. She is one of the many girls who take to knocking the ball off the tee, and then chasing it. In other words, she is a golf enthusiast. She plans to enter Boston University to increase her knowledge, although her stenographic ability is great enough to get her a position now. Decorating Committee: Glee Clubg Stamp Club Hundred Sixteen ,wg , . i g F151--1: 412' MARY RITA LAVIN As well as being a member of a number of clubs, Mary was also on the Mercury staff, a group of students who have always made our school paper a success. It is our ardent wish and expectation that the experience which Mary has received while a member of this stall will greatly aid her in the years to come. Britomartg Bumble Beesg Girls' Debating Societyg Mercury Stall EDNA LAWRENCE Lake View School sent us Edna. We all hope that she has enjoyed attending Commerce as much as we have enjoyed having her. She seems to have had an unique way of acting pleasant, even when she had reasons to be blue. Edna intends to enter the business world after graduation. Success awaits her. Britomart FRANCIS LAWRENCE Francis is a good-natured, robust, young man with a world of geometrical knowledge. He claims he's only a slightly overfed gentleman and that it does not affect his good studying. His friends think him a wizard at stamp collecting, as he's President of the Stamp Club. Francis plans to enter Holy Cross next autumn. May your luck be the best, Francis! President of Stamp Club LEO LEAVITT One of the outstanding debators in Commerce is Leo Leavitt, the boy with the sunny smile and the Hashy ties. He is so active that it would take long to enumerate his achievements. His natural wit and ability have convinced his many friends that he will become a famous lawyer after he graduates from Suffolk Law School, where he plans to matriculate. Treasurer of Assembly Debating Societyg Boys' Varsity Debating Team: Treasurer of Euterpeansg Band, Mercury Staff GERMAINE LE CLERC Germaine was always seen hurrying down the corridor at 8:14 but usually managed to reach her home room on time. Germaine has taken an active part in all social activities and her appro- priate dress for school has been the envy of many girls. The business world awaits this charming miss. Britomartg Bumble Bees Page One Hundred Seventeen 1 20 --1 A' W TM-M-mm 3 -, 4' Q N -,,,,,,,-,.M- , ' ' pl' fri MABEL K. LOGAN Mabel became 'tair-minded and Hew from East Kendall Street School to Commerce. We are certainly very glad that she picked our school as she is a very able girl. If you go to the gym- nasium after school you will see Mabel practicing basketball. Her ability in English will greatly aid her in the business world. Britomart AGNES G. LOVEJOY Aggie's kind and winning smile has won her many friends since she came to us from Gates Lane School. Her business ambition has brought her typewriting speed up to a high standard. She has decided to enter Becker's Business College for more business training. Her ability with the racket on the court has brought her much fame. Britomartg Bumble Beesg Blackfriars ADA G. LUBIN A Goldie could not get to the High School of Commerce soon enough to resume her study of drawing. In this subject she has shown much ogress since she came here from Junior High School. Her winning smile has won her many ends during her stay here. Goldie's ambition is to become Somebody's Stenogf' Britomartg Girls' Glee Club MARJORIE B. MACKINNON Marjorie, who is better known as Midge,,' came from junior High. Midge likes to play tennis and one can easily End her at this game any time during the open season. She has made no plans for the future but her energy and natural brightness will make her a success. Britomartg Bumble Bees EVERETT MARS North High sent Everett to Commerce and we gained a scholar and athlete as well. Everett is a quiet sort of chap and takes much interest in his studies. He plans to continue his studies at Princeton and we are sure that he will have success in the future. Assembly Debating Societyg Lettermenys Clubg Cross Country Page One Hundred Eighteen ,pr E 'grlwz -IAI ',,. -,i 1 .A,,.4., - ,.,.,, j I Z I s ter Elgin HOWARD LEE Howie came to Commerce from the New Woodland Street School four years ago with the reputatiaon of being quite a tennis player. He played Number 2 man on the Tennis Team for two years. He was a prominent member of the Blackfriars Dramatic Society, appearing in some of their presentations. He will spend a year at An- dover Academy preparatory to entering Dartmouth College. ' Tennis Teamg Blackfriarsg Letermen's Club SOPHIE LEVEN SON junior High School yielded many a good student and among these was Sophie. She has won her way into the hearts of both sex through her pleasing disposition and everlasting smile. The business world will claim another Commercite when Sophie receives her diploma in June. Best wishes to you, Sophie. Glee Clubg Mercury Staff ELIZABETH LINCOLN Elizabeth entered Commerce from Sever Prep and has proved to be an adept art student. She plans to enter art school next fall, where she will continue her studies. With her ability she certainly should make a name for herself in the artists' hall of fame. Best wishes for your success, Elizabeth! Girls' Basketball Team VIRGINIA LINCOLN Virginia entered Commerce from Sever Prep and although she has not been very active in school clubs she has maintained a good standing in all her subjects. She plans to attend college but as yet is undecided as to which one she will enter. VVe wish you the best of success, Virginia. Girls' Basketball Team ANN LINOVITCH Ann is a quiet sort of girl, yet she is popular with all members of her class. She could always be depended upon to have her home word done and neatly done. Ann did not join any of our clubs, perhaps because of her bashfulness, but we know she will be successful because of her stenog- raphic ability. Page One Hundred Ainrtren TO? ggi, , 6 ,tg cr RALPH KENNETH LOCKWOOD Quiet, but extremely convincing. That is Ralph. While a lad of many interests, his greatest delight is Philately. From the day he entered Commerce, Ralph has been playing the role of a regular fellow, and we are positive that he will scale all obstacles which confront him in his ascent to fame. Some business concern will asquire the services of an excellent bookkeeper in Ralph. Stamp Clubg Science Club RUTH LONDON Ruth came to us all the way from Boston, last year. We feel sorry for the high school in Boston that had to lose her, but we are glad to have had her. She made friends with many of her class- mates as soon as she arrived at Commerce, and that is why we are betting on her being a success. IMPI LUHTA Impi is probably the least frivolous girl in the '31-B Class. She has always been a conscientious student and seriously interested in her subjects. She has not given extra curricular alfairs very much of her time but she deserves a great deal of credit for having faithfully followed the funda- mental purpose of the school. We wish you the best of success for the future, Impi. PHYLLIS MCCARTHY Four years ago, on a bright sunny day, a bright, sunny girl came hurrying up Maple Street to begin her High School career, and Phyllis has hurried about the school ever since. Her blond hair and sparkling blue eyes have made many friends for her at Commerce and will win many more. Good luck, Phill, Britomartg Bumble Bees, French Club RICHARD MCCARTHY Dick also came from Saint Paul's School. We are surely glad that he came to Commerce instead of going to some other high school. Dick has not told us what he intends to do after he gradu- ates but we wish him all the success that he has enjoyed during his stay at Commerce. Pave Om' Hundred Tfwenty - AOS A C L jg-s---illei rs HOWARD MCCORMICK Howard is another one of our hidden lights and although we all know him, many have not had the chance to become fully acquainted with him. How- ard has some outside interests but he is a staunch supporter of our Blue and Gold. His intentions for the future are as yet unknown to us but our best wishes follow him. PHYLLIS MACDONALD The day after Labor day in the year nineteen twenty-Seven, a small, curly-haired girl was seen asking other bewildered Freshmen the way to the Assembly Hall. This was Phil, beginning her career at Commerce. Phyllis enjoyed much popu- larity among her many friends and we all wish her success when she enters the Boston Conserva- tory of Music. Britomartg Bumble Bees ELIZABETH MARY MCEVOY Some of us may worry about getting a position when we get through school but Elizabeth does not need to worry. She is certain that she will secure her past position -as stenographer in the Worcester County National Bank. Mary came to Commerce from Chandler Street School and seems to be doing quite well. Girls' Glee Club, Combined Chorusg Britomart I CATHERINE MCKIE Catherine came'from Scotland in 1925. VVhen she entered Commerce she won her way into the hearts of her classmates by her sunny smile and her sweet disposition. She joined the Bumble Bees and helped the club make unfortunate persons happy. We feel Catherine cannot but help make a success in whatever she starts. Bumble Bees 'GERTRUDE MCNAMARA ' Gert, a tall, attractive miss, came to us from St. Stephen's School. Always full of fun, good natured, and ready for a good time, Gert has been welcomed in any group. In her studies, too, she has proved she is capable of doing good work. VVork, play, and be happy at Boston University, Gert, and we'll bet on you. Britomartg Bumble Bees Page One Hundred Tuenty a ze :QQQW . . ---1 , N C C A' W yypyp t J gb JANET MCPHERSON janet came to Commerce from Belmont Prep and has held a high scholastic average so that she is both a Horace Mann and an Honor Student. She came to the U. S. from Scotland in 1923 and adopted our ideals and standards immediately. Her success has made her many friends who hope for her continued good luck in the business world, which she will enter upon graduation. Horace Mann Scholarg First Honor Pupilg French Cluh KAREN MADSEN Although Karen is always ready for a good time she has not neglected her lessons and is always ready to share her knowledge with her classmates. We are sure that she will be a success when she enters training at the City Hospital. Girls' Glee Clubg French Clubg Britomart Mercury Staff ANNA MAGHAKIAN Anna came to us all the way from Chicago and we feel she must enjoy VVorcester because she has so many friends at Commerce. She always had a twinkle in her eyes and a grin on her face. VVhereas we can't call her a bookworm, we certain- ly can't say she was negligent in her studies. Commerce will miss you next year, Anna. FRANCIS MAHONEY Francis came to Commerce from Lake View School, and has firmly intrenched himself in the hearts of teachers and students alike. His natural ability and good scholarship are to be commended. Francis is President of the Science Club and is active in several others. Holy Cross will claim one of Commerce's best students next fall when Francis enters. We wis you luck, Francis. Stamp Clubg Blackfriarsg President of Science Club RAPHAEL MAHONEY Upsala Street School lost a good scholar when Ray was graduated but Commerce gained not only a good scholar but also a good athlete. Ray's specialty was running. He was a member of Coach VVard's Track Team for three years. Ray intends to spend a year at Dean Academy before entering Dartmouth. Indoor Trackg Outdoor Trackg Senior Decorating Committeeg French Clubg Lettermenls Club Page Une Hundred Tfwenly-ilwo ,Og ' .., f X IE U Sl' 5 v 3'-.4-as cy fm 0-wjslg MARGARET MARTIN Margaret seems to have done quite a bit of traveling. She began at Hamilton Street School then went to Canterbury Street and then graduated from Abbott Street School to Commerce. Margaret has taken a course in drawing and she is so in- terested in it that she plans to go to Paris and study art. Margaret is quite a tennis player, being on the Tennis Team in her Sophomore year. Bumble Bees, Britomart HELEN MA STERSON Helen needs no introduction for she is well known and liked by everyone. Helen belonged to several clubs and took an active part in all their activities. We don't know what her plans are on leaving Commerce but we wish her every success in the future. Britomartg Bumble Bees, Girl Reserves NELSON MEDOFF Nelson is one of those quiet, bashful fellows who never say very much, but wouldn't it be a sad world if there were no such people as Nelson, who are wise enough to be silent. Nelson claimed membership in the newly organized Chemistry Club, in which subject he was very interested. He has not revealed his future plans, but we know he'll succeed in his life work. Chemistry Club JANE TERESA MILESKI jane came to us from St. Mary's School and has been an ardent supporter of Commerce for four years. Because of her sweet personality and merry smile she has many friends and is well liked by everyone. jane does not have much to say to any one of the opposite sex in school, but then, out- side we wonder. She has done well in her studies and we have no doubt as to her future success. JULIA MILLER Julia is another one of our Seniors who will go in training for that fine and noble occupation as a nurse, after her graduation from Commerce. With her sunny smile and pleasing ways we are sure any patient will he delighted to have such a nurse as julia. The class wishes her the best of success in her chosen occupation. Britomart, French Club, Bumble Beesg Basketball Teamg Caduceus Advertising Committee Page Om' Hundred Tfurnty three E Oxide - or -a VVVV Yiwu v-v' w Yvnvn M- Elgin CAROLINE MASON Caroline came to us from Junior High. She has worked quietly and faithfully in her studies. and has made many friends. Upon graduating, she plans to attend the Fairchild Ofhce School and the close attention which she will give to her lessons will assure success. BESSIE MINA Courteous and agreeable is Bessie. She came to Commerce from Lamartine Street School. Bessie, who is one of our Honor Pupils, always seems to be doing a good deed. She is Assistant Editor of the Nuntius Vergili and upon gradua- ting plans to continue her course at the Fairchild Oilice School. Her success is assured. Honor Pupil, Latin Clubg Assistant Editor of Nuntius Vergili ALICE MORRISSEY A Alice came from Belmont Street School. Alice, you know, is the girl with the everlasting smile and is a member of the Class Gift Committee. VVorld History is Alice's favorite subject although she is right up to date. On graduating from Commerce, Alice plans to attend the Worcester Nurses' Training School. We wish you success, Nurse Alice. Class Gift Committee MILDRED E. MORRISSEY Mildred, or even better, f'Millie, is a cute little girl with her wise and carefully set waves. Abbott Street School claims Mildred as an alumna, Mildred has an ability for stenography and al- though she has no future plans we all envy the one that gets her as a stenographer. Success to you, Millie. Britomartg Bumble Bees EUNICE NELSON Upsala Street School sent Eunice to us and we obtained a very good typewriter artist, Eunice is better known among her friends as Bozo. She has no definite course in view but we rest assured that she will make a name for herself both for work and social grace. P1112 'Jne Hundred Tfwenty-four VW--I-v -vi'T Oi.--Q, V ' 1f g T H 3,, f or Q ,, Ri13'1lllwQIm 'ug jfs?Tliittv11:ll,::ZiI,1wii i lt:W:f:Ti,N-:T l Evelyn was one of the smaller and quieter Crib? 7 EVELYN MINEHAN members of the class and therefore was not known to everybody. It was noticed that she was fond of dancing and excelled especially in the art of tap dancing, Evelyn will enter the business world and our best wishes for success go with her. Britomart DORIS MOLINE Doris was liked and admired for her pleasing presonality and her whole-hearted co-operation. VVhen it came to boosting Commerce, Doris was sure to be there with flying colors. She is a good sport in every sense of the word and has won many friends while with us, and we hope that she will continue to make them. Best o' luck, Dot After spending two years at Classical High School, Helen wisely chose Commerce to further her she has are Eva is one of our school's best students. In Britomartg Bumble Bees HELEN M. MONAHAN education. Since her entrance to Commerce has made a host of friends and although she not signified her intentions for the future we sure sne will be a success. Bumble Bees EVA MONTVILLE every class she shows remarkable ability to think quickly and well, and so, gets good marks. The midnight oil is often seen burning in Eva's house and we take it for granted that she is studying. Eva graduated from Lamartine Street School to Classical and then transferred to Com- merce in her junior year. After graduating she is planning to take a course in nursing in some hospital. Britomartg Girls' Glee Club, Girls' Debating Society VVALLACE MORO SKI Wallace seems to most of us a bashful boy, but the fellows and those of the fair sex who know him think differently of Wall. 'fVVall's appar- ent bashfulness has not, however, barred him from our athletic teams. He has been a member of the track, cross-country, and tennis teams since 1929. VVe are not sure what the future holds for Wallace, but we wish him much success. Track, Tennis, Cross-Country Teams Page One Hundred Tfzcenty ive - O -ics i V74 ij EQ ' If be -.- g.QL,,..g2QgQ,::'M 'A ' f -if-M .-f. ' Z r IRENE MORRISSEY Quiet, but alert, was Irene during her sojourn at Commerce, after graduating from West Boylston Street School. Although she did not make herself very prominent in school activities, without a doubt, she has been a valuable asset to our school. We are sure Irene will be well received in the business world. MARY M URPHY Mary came to our school from Greendale School full of pep and ambition, which she kept during her four years at school. She intends to go out into the business world and see what the future has in store for her. VVe certainly wish her plenty of luck. French Clubg Britomartg Decorating Committee GABRIEL NAMEN Gabriel came to Commerce from Lamartine Street and brought with him a charming personal- ity which has won him a host of friends. He is very interested in chemistry and in law. Gabriel plans to take a law course at B. U. next fall so that he can argue with the best of them. His personality will prove a great asset toward assur- ing his success. Vice-President of Chemistry Clubg Boys' Glee Clubg Lettermen's Club JOHN NANIGIAN In 1928 john came to us from the Elizabeth Street School where he had already made a name for himself as an artist. He kept up his art studies at the Art Museum while he attended Com- merce at the same time he was on the Track Team in his Junior year. John plans to further his art studies at Syracuse Art School. Boys' Assemblyg Track Teamg Lettermen's Club CAROLYN NELSON From Sever Street School, Carolyn decided to honor us with her presence. So in nineteen twenty- seven she joined our class. She is well liked and has won many friends for herself. Carolyn in- tends to enter Emerson School of Dramatics and we are sure that she will he successful. Britomartg Bumble Bees Page Om' Ilundrcd Tfwenly-.fix .GR so if L13 U is r ,Q EVA RITA NESKE Though Eva conceals her humor behind a cur- tain of bashfulness, she is very lively. Qjust ask her friends who came to Commerce with her from Millbury Street School.J ,She has studied hard and received high marks. VVhatever Eva plans to do after graduation we are sure she will be right on the top rung of the ladder. ' JOHN F. NOONE Here is a youth who personiiies optimism. Al- though always faithful in his application to the books, he has found time for other things too. When any event called for the support of the students, john was not found wanting and his work on the baseball nine was diligent. His loyalty assures john a bon voyage over the path of life. Baseball AN NA ELIZABETH NOURSE Anna came to Commerce from junior High and now she is prepared to matriculate at Framingham Normal, where she will be a success, judging by her excellent record made at Commerce. She has made many friends while attending Commerce and they wish her the best of luck. Girls' Bandg Bumble Beesg Girls' Glee Club PHYLLIS OBERG No one ever had any trouble in finding Phyllis. One had only to look for her hair, which was easily distinguishable because of its beautiful ver- milion shade. Although Phyllis is conservative in manner, we can assure ourselves that her mind is well stored with knowledge that she has received at Commerce. The business world calls Phyllis, where we know she will be successful. Britomartg Bumble Bees MABEL O'BRIEN VVe never heard much from Mable, who came here from Abbott Street School. Mabel was al- ways quiet and paid little attention to extra-cur- ricular activities. ln spite of her bashfulness, she was a good pal to those who were her friends. Here's luck to you Mabel, in whatever you plan to do in the future. Page One I'Ill!ltI'I'1?d Ttuenty rn fn VT X !f 4-XXX! lil l ll, ! 'KN 1, vjv'ji i1-I 1'vwvr sift 'vr,-1:y to L C fkl 1 it s i .sas f w '- CARL NORDGREN Carl has a jolly disposition and a smile that never seems to wear off, even when the teachers scold him. Carl came to us from East Kendall and is an active member of his class. He plans to attend the New England School of Anatomy and we feel certain that he will succeed in his future work. Bandg Euterpeans RENA NORDSTROM Always watching her studies and never the boys gave Rena good marks. Rena has much talent for music and has been chosen as Class Musician and was a member of the String Quar- tet at Boston. She came to us from Lake View and plans to continue the study of music. Secretary, Euterpeansg Britomartg Combined Chorus: Orchestra Ag String Quartetg Caduceus Committeeg Class Musician BERNICE G. O'CONNOR Bernice boasts a 100 per cent attendance record. During her four years at Commerce she has been neither absent, tardy nor dismissed. Bernice came from Edgeworth Street School and has been as alert in her studies as in attendance. She is plan- ning to attend Burdett College, where she will further her studies in commercial lines. We wish you success, Bernice. , Britomart EDITH O'DELL Edith, a quiet, young, miss, came to Commerce in her freshman year from the Auburn Center Grammar School. Her one ambition is to become a first-class nurse, and with this intention we all know she will succeed. Any patient who gets Edith for a nurse will be in luck. EDNA CLAIRE O' NEILL Edna intends to be a nurse, and what a charm- ing little nurse she will make when all dressed in white! Edna came from Elizabeth Street School and Commerce gained an ardent rooter. Edna likes to pick flowers, as one can judge from her ability in Botany. Good luck, Edna. Basketball Pwfr Om' Ilundred Tfwcrlty-eight V .:, 'Q' Q 1: U SHI' 1 -Q ' Ga., o-rst fy 4,61 U36 WILLIAM O'CONNOR After going to South High, Bill decided that Commerce would be his Alma Mater. Throughout his stay at Commerce he has made many friends of both sex. He was also a member of the Boys' Glee Club, Band, and the Lettermen's Club. Bill intends to enter Fordham University in the fall. Boys' Glee Clubg Bandg Lettermen's Club GEORGE OHAN Be cheerful seems to be Georges motto for he is never too busy to Hash a grin at anyone. He is everybody's friend and a cheerful one at that. Due to his keen sense of humor, life is to him one good laugh after another. He intends to en- ter the business World. French Club HELEN THEODORA OHMAN In the future when we are all happily married and have children about us we will then start to think about teaching them how to play the piano and then we will start to look in the paper and Hnd that Helen Ohman is giving lessons. This is not an advertisement, but a write-up of what Helen intends to do for a living. After graduation, Helen expects to go to the New England Con- servatory of Music. SOPHIE OHRSTROM Four years ago Dix Street Prep sent forth Sophie to help brighten Commerce. Those four years she has faithfully attended our school and has made Bookkeeping her favorite subject. She intends to work at this when she leaves Commerce and we wish her every success. French Clubg Britomart RITA O'MALLEY Room 76 boasts of a shy girl with glossy, black hair, Rita O'Malley. Rita is intensely interested in her studies and is quite a studious girl. After graduation Rita expects to go to Becker's and take a secretarial course. She is immensely in- terested in work of this kind and no doubt will make a success at it. Britomart Page One Hundred Tueniy nine f 1,13 0 E' 1 ' ,ffl i I 11 her. succeed. Society Page One Hundred Thirty HELEN E. OlSHEASY After completing Adams Square School in seven years, this attractive brunette chose Commerce for her last study home. Helens brlllxancy and charm have won her many friends while at Com merce. Her favorite studies are Commfelcxal Law and U. S. History. We all know that the VVorcester Normal School will more than welcome Mixed Chorusg Girls' Glee Club Brxtomart Class Day Committee JOSEPHINE PACEVICH Upsala Street School sent us a lovable miss who answers to the name of june Her favorite study is German and she spends her leisure time playing tennis or dancing june fou d the business subjects so interesting at Commerce that she is planning to continue her busmess car eer at Becker's Business College in the fall Bumble Beesg Girls' Glee Club Britomart GRACE PALM Quiet, but popular in her own way 1S this tall blond miss, who came to Commerce four years ago from the Greendale Grammar School Her hobby seems to be swimming She has been very active in the school organizations and excels stenography. Grace intends to enter the business world after graduation and we know she will Britoma rt 3 Bumble Bees ISABEL A. PAPASEEN Pat came to us from the Barre Gramm School in her freshman year She is plannlng to enter Becker's Business College in the fall and we know this calm, winsome miss IS well suited to the profession she has chosen Although not a member of any of the organizations of the school she has attained an excellent record in her studies GRACE W. PETERSON ' Pete, the girl who is always smiling is one of the most popular girls of our class having the honor of being our vice-presldent There is not one person who has not met her with her winning smile and charming personality Though Pete is quite a debater, being on the school team she keeps her argumentative ability to herself Pete is planning to enter Burdett's College in the fall Vice-President, Britomart, Girls Debating If-as i at li El HU .il H nl y fi 212--1' VINCENT O'ROURKE We have Dix Street School to thank for Vin- cent, a good tennis player and a hard worker. He made a name for himself two years ago on the tennis team as an able and a clean player. Vin- cent has decided on Becker's Business College as a suitable school in which to further improve his education. Lettermen's Club, Tennis Team HELEN PACHOULIS Helen is one of our smaller friends in Com- merce, but small in size only. She is loved by all her classmates and is always ready for a good time. After graduation, Helen plans to be a nurse. Her sympathetic nature and sunny dispo- sition surely make her well suited to that humane calling. Caduceus Committeeg Bumble Bees Basketballg French Clubg Britomart FRANCES PAULAUSKAS A calm, quiet, young miss is Frances, and if it were not for her cheerful personality and her willingness to help those who need help, she might have passed from us unnoticed. These two characteristics, together with her ability to make hard work seem easy, will undoubtedly insure for her the success she deserves. May your future days be happy ones, Frances. HELEN PEPIN Helen always had the habit of putting herself out to say hello to someone. This fact alone showed that she was permanently cheerful and at peace with the world. Helen told us that she was fond of Stenography and hoped that she could get a position doing that kind of work. We know she can. MARGUERITE PERRY Peggy is a bright, vivacious miss who insists on getting into everything Cincluding mischief.D 'lPeg, with her sister, Mary, has often entertained us in various clubs with their clever song and dance acts. Commerce will certainly miss 'LPeg next year and '31-B. Britomartg Blackfriars Page One Hundrfd Thnty arf co- to ff o V is Q ' ' 4 Ill H ' 1' H E fi : 'r f':1 i ' 5'f5'f?','Y fl'T'll:?if'5'fl illfllil Qwrs' l Ill D36 ALICE PETERSON No matter what fame Shrewsbury High will ever attain, to us it will always be the school which sent the charm and cheerfulness of Alice Peterson into the ranks of '31-B in her Senior year. The popularity which she enjoyed there was continued here, and the hard work which had won for her the honor of Horace Mann scholar at the Ward School was also noticeable in her stay at the Blue and Gold. Senior Basketball Team MARGARET DOROTHY PETERSON Dorothy came to us a short while ago from Shrewsbury High, where she was an honor stu- dent. She has maintained her high standards while at Commerce and we feel certain that she will be successful in whatever she attempts. Her many new friends which she had made here show concisely the high measure of esteem in which she is held. Best wishes, Dot. Honor Student JA MES PETRIDES jimmy came in unnoticed and almost unknown, but it wasn't long before we realized that we had a man of real worth among us. Although appar- ently very quiet in the class room, he was always very alert to hear everything that was being said. Whether Jim's future leads to financial deals or into other fields, his high school career forecasts success. Mercury Staff MARY HELEN PIERCE Mary, since the day she left Woodland Street Prep, has been one of the most popular and like- able girls in the class. Her beaming, pleasant smile and her wondrous faculty of instilling cheer in all her classmates, as well as her fine work as Assistant Editor-in-Chief of the Mercury, will remain forever among the lasting memories we take with us from Commerce. Girls' Glee Clubg Combined Chorusg Bumble Bees, Girls' Debating Society, Girl Reserves, Assistant Editor-in-Chief of The Mercuryg Honor Student ABRAHAM PLOTKIN Armed with a willingness to work, a sunny disposition, a keen sense of humor, and a genius for doing things well, Abe left the confines of junior High and came to Commerce. Abe is a debator of no mean ability, as well as a scholar of high standing. It is with the best of wishes for a successful future in the advertising field that we bid him adieu. Assembly Debating Society, Secretary, Bandg Var- sity Debating Teamg Caduceus Committee Page One Hundred Thirty-t-wo HP LEN POTTER It was a great addition to our school when Hel- en came to us fiom Classical in her Sophomore year Whenever there was laughter about the school Helen was always sure to be in the midst of it displaying her ready wit. Helen intends to follow a business career and we are sure that shi: will make a success of anything she undertakes. Bumble Bees Ctrl Reservesg Caduceus Com- mittee, Chairman JOHN J. POVVER bt ohns contribution to the ranks of '31-B was indeed a valuable one. A broad, pleasant smile, his care free manner, and his red locks of Curly hair endeared him to all of us, especially to cer- tain members of the fairer sex. It is hard to prophecy anything but success to this lad whose high school days at Commerce have been so fruit- THOMAS POWERS Four years ago Tom came to us from St. Paul s School He has made many friends during his stay at Commrece, and through his winning personality was chosen President of the 1931-B Class When Tom' enters the business world, he will carry with him the record of not once be- ing absent tardy or dismissed during his four Boys Crlee Club, Lettermen's Clubg Orchestra A, B and C Treasurer of 1931-BQ President of 1931 B Basketball Second Varsity Team, Manager, Tennis Team MARY PREN DERGA ST Our class would not have been complete if Mary had not come to us from South for she has an ever readv smile and cheerful disposition that attracts everyone Mary intends to continue her studies at the Posts Business College and we all wish hen the very best of luck. Britomart, Cauduceus Committee ROSE J. PRESCOTT Rose came to Commerce from Auburn Center Grammar School Some people may think that to be hard of hearing is a curse, but Rose does not think so Rose is quite an expert lip reader, hav- mg taken second place in a lip reading contest held in june 1930 for all of Worcester and Wor- cester County Because of her skill in this art she can make out what the teachers say and has gone well in her studies in school. Good luck to 1 E01 riririri' lli25'531Vllff'J'? fl,-'vv:f,'i-w if iw, aio Page One Hundred Tl1ir!y-three T so V ST 7 . t fri '1fA1 'f i2'1.5,'vwf::,5V:ig,f N I C9 .ANl11'IE3i?l1fl1MLM,, nl vi f MARGARET D. PHILLIPS Coming to Commerce from Upsala Street School Peggy'i needs no introduction. A jolly smile, a merry twinkle, a magnetic personality, is the secret of Peggy's popularity. Her short, brown hair is proof that shorn locks are still more popu- lar with the fastidious dressers. Peggy has no definite plans for the future but with her pleasing disposition we all know the business World is waiting for her. Class Willy Caduceus Committee WVILLIAM P. PILOPONIS Bill hailed from Lamartine Street School and during his four years at Commerce has excelled in 'Salesmanship and History. Although Bill claims he has no hobby it is 1'umored he likes Historical Research Work. Bill intends to go to work in February. Good luck, Billfl BERTHA PLOTKIN This pleasant little girl plans to do oH'ice work when she leaves school. 'KBetty'l came to us from the Junior High School in her second year and has won many friends during her three years stay at Commerce. Betty's'l favorite hobby is studying, therefore she ranks high in her studies and has become popular with her teachers. Good luck from '3lA, Betty. VERA LOUISE POLINI Vee is another one of those gay young per- sons who came to us from Canterbury Street Grammar School. Her favorite hobby is dancing. She is one of our attractive brunettes and having taken Spanish here four years makes her eligible as a gay senorita. Vee is undecided as to her future, but with her easy going manner and capability, she will be a success. Mixed Chorus: Britomartg Class Motto A Committee LEON A. RANCHYNOSKI Four years ago a live wire joined our ranks from Canterbury Street School. He proved him- self a marvel on the cinder path, and earned a name as a line student and an excellent athlete. As sports editor of the Mercury, he Proved his writing ability. Ranchy goes to Tech where these qualities which have made him so greatly admired here, will bring him out on top. Blackfriarsg Lettermen's Clubg Assembly Debat- ing, Running Track Team Page Om' Hundred Thirty-four ZOA 'T so fINHYHW11m n::sg,fr '-2-f 'f'f 1 12f-' gm ,. .I Q..limi fC 'U .U S X -r ' W -he - .eps f 7 EDITH PRICE When Edith came to us from Junior High in her Sophomore year, Commerce gained a valuable member to her student body. Her loyalty, both to her school and to her classmates, coupledvwith a charming personality, gained for her the respect of all. We can only wish to her the success which she deserves. May her future days be as happy as the ones spent at Commerce. T ROBERT QUIST Robert's athletic ability has always been devoted to track. At one time he placed in a Cross- Country race. Since there are so many runners in a grilling race of this sort, it is no easy matter to receive a place and we believe that Robert de- serves a good deal of credit for his achievement. Cross-Country Teamg Outdoor Track Team, ln- door Track Team, Lettermen's Club ANGELA J. RAGALAUSKAS Everybody loves Angela-sparkling, blue-eyed, blond locked miss, who came to us from Ascen- sion High School three years ago, and who since her entrance here has been spreading sunshine into the hearts of all who knew her. Her charm- ing personality and winning smile will spell suc- cess for her in whatever field of endeavor she enters. Good luck, Angela. Britomartg Bumble Bees HAROLD RAINE Harold tells us that he intends to enter the business world. This tall Senior will surely be capable of filling some responsible position if he strives as hard as he did at school. While at Com- merce, he always had an ardent desire to get ahead and a never failing way of doing so. AGN ES RANTAMAKI Four years ago Auburn Grammar School gave us a smiling and happy Agnes and now we are going to give her up to some business man. Agnes has made many friends at Commerce and we are sure she will continue to make them after graduation. VVe will all be anxious to hear from her when she returns from her trip to Europe this summer. Bumble Beesg Britomartg Decorating Committee Page One Hundred Thzrly yi gba to or X XX f 11li'ww:11'fa,g::i,1 . Xl WC? JA. l L5 so f A ' M'-'il ALPHONSE RASIMUS Al, by hard study and conscientious work, has proved himself not only a good scholar, but also a capable athlete. We expect good things from him in the future, for VVilliam and Mary College is his destination. Good luck, Al. Football: Trackg Hockey VALERIA E. RAWKESKUS Val came to us from Cambridge Street School and although she is a quiet miss she has won many friends among her classmates. Val'sl' loves are English and Dictaphone. She likes to read and swims well. Becker's will win her in February. Britomartg Bumble Bees MARY HARRIET REYNOLDS Mary's ambition to become a nurse will be ful- filled after she leaves Commerce. Drawing is the subject that was beloved by her. She will go to St. Vincent's Hospital on her leaving. She en- tered from Gates Lane Grammar School and her school career indicates a successful future. MILDRED L. RICE To be an editor is the highest achievement and Mildred has attained that honor. Ladylike and courteous and intelligent she represented the Mer- cury in a dignified manner. She came here from Sever Street Grammar School. She is 'headed for the business world. Her efficiency and fine per- sonality will make her successful. Blackfriarsg French Club: Glee Clubg Editor of Mercuryg Class Prophet PAUL RIVERS Northeastern will claim Paul as one of her own when he graduates from Commerce. From New Woodland Street Preparatory School he came to give a good account of himself. Into the business world he will go, as an accountant, with high chances of accomplishment. French was his favor- ite subject and his favorite pastime was smiling. Caduceus Committee Page One Hundred Thirty-six ella f , , CLS, pl f E555 MARY RAYMON D When Mary came to us from New Woodland Street School we thought she was a quiet miss but our impression changed as the years rolled by. VVe know her as a studious and happy-go-lucky girl. We are sure of her success when she becomes the stenographer of some lucky man. PA UL REYNOLDS Paul has always been popular at Commerce, both with the girls, and the boys. He has gained this popularity through his ability of making friends quickly. He has planned on entering The University of Alabama, in the fall. The 1931-B Class wishes Paul the best of luck. Lettermen's Club IRENE RICE One of the ablest supporters of the Commerce High teams is Irene. She was the girls' cheer leader for two years. Irene was also a prominent member of the Girls' Hockey and Swimming Teams. Irene did not confine herself to sports alone but was also a good scholar. She intends to matriculate to Smith College in the fall. ROSE RITA RILEY How many are there at Commerce who do not know Rose? Very few, we believe, because cheer- ful people are not left very long without many acquaintances. Rose intends to continue her education at Boston University. It is not necessary to state our reason for expecting big things from her in college. Britomartg French Clubq Caduceus Committee JEAN ETTE RIOPEL Jeanette came to Commerce from the primitive wilderness of Auburn to further her education. She is a quiet, but brilliant scholar and has made many friends here. Jeannette is a member of several clubs and is quite active within them. She plans to follow a business career. Best wishes, Jeannette! Britomartg Girls' Debating Societyg Caduceus Ad- vertising Committee Page One Hundred Thzrty sewer: ,,j.O-QQ--- . ,,AE,K .. ,XXQ Q, C A 1 ll . E .G-tc. - Gxiqxfzyf-ti Q50 THOMAS STANLEY ROGERS Commerce will lose one of ber stellar basket- ball and football players when Tom graduates. Midland Street Grammar School had the honor of sending him on to us. Mechanical Drawing is the subject that has won its way into his heart and football is his hobby. Some college will soon welcome him with open hands. Football Teamg Basketball Team, Lettermen's Club DOROTHY ROSEN BERG Framingham Normal will receive this young and happy student from Commerce and she will make a good record there. Dorothy became an outstanding figure in her most loved subject, Geometry, and we think she will become a high school teacher. She is very sociable as the club list shows. Britomartg Bumble Beesq Stamp Cluhg French Clubg Chorus EDITH SAFER A great addition will go to the business office that receives Edith's services. To be a private secretary is the position that Edith is looking forward to. Lamartine Street School sent her to us in her younger years. She gave her full heart to the subject of Arithmetic. Bumble Bees ADELINE SALTZINIAN A bag of noise, laughter, and fun is what Com- merce received from Junior High School when Adeline entered this school. Her happy disposi- tion has won for her many friends and much popularity. Her hobbies are dancing and music. Adeline plans to enter Beth Israel Hospital in New York this fall. Bumble Bees, Britomart, Girls' Glee Clubg Com- bined Chorusg Girls' Debating Society GRACE SCOTT Grace is one of the happy-go-lucky girls of our class. She came to us from Malvern Road Gram- mar School. Her favorite subject is Stenography, as her teachers will inform you. Gracewas a very active miss in all her classes, and due to this, she gained many worth-while friends. After graduation, she is planning to study nursing. Page Om' Hundred Thirty-eight SQL V X D - .3 n' 15131-.sv JULIA ROGLIS Whenever we think of our Senior Class Day Exercises on April 22, 1931, we think of Julia. The selections which she sang added greatly to the program and we are sure that we could not have chosen a more worthy Class Soloist. Julia is undecided as to what her future occupation will he. Bumble Bees EDWARD ROME Edward is best known for his jolliness and keen wit and many a time in his stay at Com- merce did these two traits bring joy and cheer to us. His willingness to co-operate whenever neces- sary and an optomistic outlook on life will surely go far in gaining success for him. Best o' luck, f'Ed.'l PAUL ROSENLUND Paul, the six-foot-two wonder of Commerce, came here from the East Kendall Street School and has been accepted as a regular fellow and re- garded as a pal. Among his favorite subjects are Physics, Zoology, and Chemistry. After graduation Paul expects to go the the Post Busi- ness College. VVell, good luck, Paul. ELVA RUTHERFORD Four years ago Elva Rutherford, as a shy, bashful Freshman, learned to play the cello under Mr. Wilsons' supervision. In a year's time Elva was playing in Orchestra A, and had now lost her shyness and bashfulness. Elva never announces her presence by a lot of noise but we always know she's there. May good fortune be yours, Elva. ZELDA RUTMAN Boston certainly lost something when they sent us Zelda from Phippips Brook School, Boston. Zelda has gained scholastic honors, especially in Shorthand, in which she is very proficient. Zelda is also honored because she will be only 16 years old at graduation. May you be very successful in the business world, Zelda. Girls' Glee Club, Girls' Debating Societyg French Club Page One Hundred Tlmly mm' X, 7 --v. S..2i ,LQQ .eg - -e 'Jr .................... W..- ...,. . .,.,, ,,,,,.....,..,,,,.,... . eibqxt ,rift J ago EDGAR RYLANDER VVhen Dix Street School sent its quota of pupils to Commerce, Ed Rylander was among them. His small size did not keep him from partaking in any of the major sports. He was a prominent member of the Basketball, and Swimming Teams, of which he was one of the organizers. Ed was also President of the Lettermen's Club. 'tEd intends to matriculate at the University of Illinois, where he will take a physical training course. Mercury Staff, Swimming, Basketball Teamsg French Club, Lettermen's Club TILLIE SACK VVhen a good many of the school clubs held their meetings, Tillie was always there. Not only as a member, but also as a booster. Fairt:hild's Business School will claim her in the fall to further advance the education that she received at Com- merce. There are always positions for boosters, so Tillie's chances are great. Britomartg Bumble Beesg Girls' Glee Club, Mixed Chorus HARRY SACKSTEIN It has indeed been a pleasure to know Harry. His keen sense of humor and his ever helpful nature made him the most beloved of all '31-B members. His artistic ability placed him high in the opinion of the lovers of real art, while his cartoons in the Mercury resulted in many a smile for the reader. His initiative, loyalty, and happy spirit make anything but success impossible. Mercury Cartoonistg Lettermen's Club, Business Manager, 'tCheer-leader HELEN SALTUS 1 From Tatnuck Grammar School came petite Helen the fair, Helen the lovable. At Fairchild's Business College, Helen will seek further educa- tion. Our fair Helen will be somebody's private secretary after her graduation from Fairchild's. English was her favorite subject, as her classmates will testify. STEPHEN GEORGE SAVAGE His scholastic ability placed Stephen among the leaders of the class and four years of faculty barrage failed to dislodge him from this position. His pet avocation is argumentation and debating and he is satisfied only when some unfortunate forensic foe is quailing under the force of his oratorical denunciations. Staunch determination and a thoroughly likeable personality promise a bright future for this ex-Junior High lad. Stamp Club, President, Treasurer, Secretary, As- sembly Debating Society, Secretaryg Science Club: Chemistry Club, Secretaryg Captain of Boys' Var- sity Debating Teamg Editor-in-chief of Cheer- leader , Caduceus Editorial Committee, Class Day Speakerg Class Treasurer f2nd yearj Page One Hundred Forty 0- ,I- V ,RW I ll l.,1l'g gill 'l ll,'lfF',' 1K 'rw wil ,t 'I ll l 'iw Xf li lllllillllidlll 1 + G-'El U N ff u '1'2l'f kAkkML'k - --.-.,.A-.-,.- ..ah -5 J oss. Q47 ED gb BESSY SAVATSKY Ambition without limit, coupled with the ability to do hard work, and a bright, scholastic mind, made is possible for Bessy to attain the very peak in scholastic achievement at junior High, and upon entering Commerce she kept up the excellent work. Besides gaining honors, she is also one of our few three and one-half year graduates. The best Wishes of the class go with her when she leaves. Girls' Debating Society, Britomartg Honor Student RITA SCANLON Rita has always taken part in a number of clubs. Many of us have become acquainted with her through these clubs and many through our personal encounters with her. But we all agree that she is a friend worth having. Those who at- tended the Britomart play, Not Quite Such a Goose, can easily recall the excellent acting of Rita in this play. Britomart, Executive Committeeg Girls' Debating Societyg Bumble Beesg Caduceus Committee ELEANOR ANNE SCOLA Eleanor is a live wire. She is sparkling with animation. Many dull days have been brightened by just a few moments of this cheery maid. Eleanor joined several clubs during her four year's stay at Commerce. They'll certainly miss you next year, Eleanor, and 31-B wishes you much success. Britomart, Bumble Beesg Stamp Clubg French Clubg Combined Chorus, Girls' Glee Club SATINIG SHAMAGOCHIAN Four years ago Commerce welcomed Satinig Shamagochian, who came from Abbott Street School. Satinig has since distinguished herself in the studies of History and Stenography. She is very accurate in her work and we are sure she will get along with her employers. CELIA SHAPIRO Model Commerce Lassie can be written after the name of this popular miss, who came to us from junior High three year ago. Besides this distinction, she has won enviable success as a writer, a reputation well borne out by her prize winning story in the Christmas issue of Mercury of 1930. Judging from past performances, Celia will surely be a winner. We're all rooting for her! Girls' Debating Society Page One Hundred Forty one H Ogg -gg . -ff I Z! -7 l'g:?- E-M- X E tx ' -A ll 'PX VICTOR SEPAVICH One of VVorcester Polytechnical Institute's stu- dents will be Vic, a Hne example of youth and knowledge. His desire is to become one of the great engineers of the world. junior High sent him to Commerce and he has done well. His specialty is Mathematics. Lettermen's Club I ANGELO SETARO Many colleges will he waiting for Angelo after he completes his high school education. The great Field of aviation will claim another associate in the near future in Angelo. He found History to be an adventurous and entertaining subject. From New Woodland Street Grammar School he came here and he has been a welcome member of the organization. IRENE SIFF Irene plans to continue her education at Boston University after her graduation. She has devoted a great deal of her time to the subject of Stenog- raphy while attending Commerce High. When she becomes a private secretary she will have achieved her highest ambition. Junior High School graduated this joyful student. Britomartg Bumble Beesg French Club ROSE E. SIMISKY Blond hair like fine threads of gold and blue eyes are Shorty's outstanding features. Beckeris Business College will throw open its doors to greet her. Like many other Commerce students she came from the good old Lamartine Street Grammar School. Her favorite subject was book- keeping and her proficiency will make her a star in the business world. Britomart MEREDITH SIMPSON To become a stenographer in the business world is Meredith's greatest ambition. While attending the High School of Commerce she liked office practice. She came here from Junior High. Some business oflice is going to be very fortunate in getting the services of this alert girl. Bumble Bees Page One Hiuzdred Forty-tfwo ,at p --d XX SARAH SHAPIRO A fondness for journalism has won the attention of Sarah and made her record in that subject a good one. She is a Junior High School alumna, and she has been a credit to that school since joining Commerce. She will enter the business world. Girls' Glee Clubg French Club SIDNEY SHAPIRO Stenography looms up in Sid's career as a very essential factor in his aim to reach greater heights after graduation. A cordial greeting will be waiting for him in some large financial busi- ness. From Junior High School he came here to continue his education and he has made a host of friends. ANITA SHARON Anita hailed from Greendale Grammar School, four short years ago. She is a rather quiet miss, but she has won an undisputed place in the hearts of her many friends through her charming disposition. All who know Nita have found her to be a delightful companion. Best of luck to you, Anita. Britomart SYLVIA SHERMAN This smiling, happy, young lass is none other than Commerce's own talented musician, Sylvia Sherman. Often has she ,thrilled her audiences at Assembly or over the radio with her wonderful skill with a violin. She is concert mistress of the Worcester Consolidated Orchestra, and Drum Major of the Girls' Band. Commerce expects her to succeed with life as she has with a violin. Good luck, Sylvia. Concert Mistress, VVorcester Consolidated Orches- trag Assistant Concert Mistress, Orchestra Ag Commerce Representative to Syracuse, Drum Ma- jor of Girls' Band, Euterpeansg French Club EDWARD SCHULTZ With that characteristic naval air of activity, Ed came to us in 1930-a newcomer to the class but an old habitue of the hill, for he left Com- merce in 1926 and ventured to see the world with Uncle Sam's Navy. His tastes, however, were not wholly nautical, for the facility with which he handled his various studies marked him as one of great ability. Assembly Debating Society Page Ona Hundred Fofty tlnff ll -C r2 , t ' ' f' i ' W f i T T1 .!-1fL f Elll-Q i C A D U cf C. U s X i v...:. 1 ..... . ., ' jig '.,. ,.., i 1 'i.i 1:,IiI't X l ,X nfl I tsigp ANTHONY CHARLES SIENKIEWICZ This youth, whose name has often been heard bv reason of his achievements on the gridiron, diamond, and cinder and board tracks, came from Upsala Street School. His spectacular line plung- ing and tackling have thrilled Blue and Gold ad- herents time after time and his prowess on the diamond was also well borne out. His success did not cease with athletics for he also won recogni- tion in the class room. Good luck, Tony. Footballg Indoor Track, Outdoor Track, Base- lvallg Lettermen's Club DOROTHY C. SIMPSON Dorothy, one of Commerce's three and one-half year graduates came to us from Upsala Street School. Although she is very quiet, she is very popular among her friends. When she leaves us she will enter the business world, where we wish her great success. Girls' Debating Society, Bumble Bees EDNA SIMPSON Stoneville lost a good pupil when Edna Simpson came to Commerce to take a course on business. Among her favorite subjects are History and Of- fice Practice. Edna is now running a comptometer in office practice and is making good at it. Some business man will certainly be lucky if he hires Edna to be a boss over his other grils running comptometers. EVA SKIBINSKY Here we have Eva, who has endeared herself both to her class and the whole school. As a de- claimer, none surpassed her and many a time the walls of the Assembly Hall resounded with her eloquence. She even found time to dabble in dra- matics and The Swanfy and Mary Rose might never have succeeded had her help been lacking. May success follow in your path, Eval Blackfriarsg Bumble Bees, Mercury Staff, Presi- dent, and Vice-President of Girls' Debating So- ciety, Class Historian, Captain, Girls' Varsity Debating Team, First Prize, Declamation Contest Winner: Blackfriars' Cast, The Swan, Mary Rose. ELIZABETH SLATER With her quick wit, her ever ready smile, and her sunny disposition, is it any wonder that Bet- ty is popularity personified? Her radiant, golden locks, sparkling blue eyes, dancing ability, and an enviable personality, made her The Sweetheart of '31-B. If Betty makes as many friends in the business world as she did at Commerce, success will be hers without doubt. Bumble Bees, CExecutive Committee, 1930i Brito- martg Girls' Glee Club Page One Hundred Forty-four so--.53 C' ' C BERTHA SMITH Bertha Smith came to Commerce from Junior High School and is easily recognized by her pleasing personality and charming manner. Ber- tha is planning to enter the business world after graduation and she is hound to brighten up the offices of her future employers. GURN ETH SMITH Junior High School gave us Gurneth and we are thankful that it did. just as there is always room in the Army for a good soldier, there is also room in Commerce for a good student. Gur- neth intends to work in an office. VVe are sure she will always be a credit to Commerce High. ABRAHAM SNIDER Quiet, but good-natured, and a regular fellow, Abe won the sincere friendship of his classmates as soon as he entered Commerce from Junior High three years ago. Although he did not be- long to any organizations of the school, Abe was always willing to co-operate in any way whenever the class needed help. May your future be as bright and carefree as your high school days have been, Abe. BENJAMIN SNIDER Bennie came to Commerce from junior High and throughout his stay has been actively par- ticipating in musical and dramatical organizations. He is one of our most popular and likeable fellows and we will surely miss him when he leaves. Bennie's optimistical outlook on life assures him of success. Orchestra Ag Bandg Blackfriarsg Euterpeansg Commerce Novelty Orchestrag Chairman, Class Day Committee VIOLA SOCHON Normal School will claim Viola when she grad- uates from Commerce in june. Viola, with her pleasing personality and her fine sense of humor should make a line teacher and we know she will succeed. Viola was prepared for Commerce at the Millbury Street Preparatory School. Britomart, French Club, Bumble Bees Page One Hundred Forty Jive 1O,g W , SX' -j' H A ll? lll11C . , . l l v .ae-, 2:.,::,k-1--ffE:re .f WW 'H r 4,-qsiggf-tk EDWIN SMITH Edwin is one of those popular boys. He came to us from junior High School. He is one of a select group, an honor pupil. He intends to take up the engraving trade upon completing the Com- merce course and his habit of attending to de- tails will mean success for him. Cross Country Team VIVIAN SMITH Junior High lost a charming miss and the High School of Commerce gained one when it opened its door to Smitty.'l This attractive and smartly dressed miss has gained much popularity while at Commerce. Smitty'l spends her leisure time in dancing. With her pleasing disposition, Viv- ian has won many friends. VVe all know that she will be a success when she enters the For- sythe's Dental School. Girls' Glee Clubg Combined Chorus ABRAHAM SOLOD Three years ago this dark-haired boy left Jun- ior High to come to Commerce. 'lAbe's hobby is tickling the ivories of the piano, at which art he is very adept. When he completes his course at Commerce he will enter Clark University where he will train to be a teacher, and play as an avocation. Stamp Clubg Science Club AGNES STEELMAN This golden-haired miss came to us from East Kendall Street School and has smiled her way in- to many hearts. Her pleasant disposition has won for her many friends. When Agnes leaves this school we know it will be a great loss to Commerce, but Oh! what a gain it will be to her employer. Our best wishes go with Agnes. KENNETH STEWART 'lKen is one of those hail-fellow-well-met boys. Wherever you see him, he has a good word for you. Sever Street claims him as a graduate, but Commerce will be proud to do the same. Kenneth is another lover of music and intends to further his education at the New England Con- servatory of Music. f'Good luck, Ken.'l Orchestra Ag School Dance Orchestrag Clfass Treasurerg Wrote music of Class Day Song Page One Hundred Forty-six - IK -U E IHUL9Wlillllw'lI:iD 36 DOROTHY SOLOMON Dot is also a former graduate of Junior High School. She has always been a hard and honest worker. And what more can anyone ask of a student but hard work and honesty. Dot has intentions of entering Catherine Gibbs School in New York. She certainly has success coming to her. Britomartg Bumble Bees SARAH SOLOMON Sarah Solomon may be short in stature but she certainly has her share of brains. Sarah has the distinction of being one of the pupils that is graduating in three and one-half years. She has taken six subjects for three years' and some of us would have died had we taken them for one year. After graduating, Sarah plans to go to Simmons College. Bumble Bees ESTELLE SPINNEY A When Estelle came to us from Gates Lane School four years ago, we did not know we had an artist amongst us. She had the honor of having one of her posters sent to the Artists' Con- vention at Atlantic City this year. She did not confine herself to art alone but was a prominent member of the Britomart, Bumble Bees, Euter- peans, and Girls' Swimming Team. She intends to matriculate at the Boston Art School. Senior Decorating Committeeg Bumble Beesg Britomartg Euterpeansg Girls' Swimming Team HELEN CHARLOTTE SPITAELS Helen is one of the good things that came in a small package to us, for she has kept the groups in the corridors before school feeling very lively. Her clever, witty remarks have earned many friends for her. If friends are a credit, she cer- tainly has gained much. Helen is not certain what she will do in the future, but best of luck, Helen. Britomartg Girl Reserves MAE SUTTON Pufling and panting so that she would be able to get up Maple Street, in 1927, came Mae Sutton to begin her high school life at Commerce. Mae came to us from the Millbury Street School. After she has graduated, Mae expects to go to the City Hospial and train to be a nurse. Britomart Page One Hundred Forty :even Jglrrf- ,7 -N m'uEl'Gi Qfzklil' lll'mlluM?a VIOLA STANKUNAS Viola, since the day she shyly walked up the stairs of Building One for the Hrst time, from Junior High, has been playing the part of the model high school lass. A wonderful sense of humor, mixed in with a thoroughly likeable per- sonality, and a charming smile, will make her future days as happy as the ones that she spent at Commerce. EVELYNE E. STARBARD Evelyne was one of our quiet and unobstrusive girls, coming to Commerce during her Sophomore year from Holden High. But d0n't let this fact mislead you and make you think her lacking in humor, for when the time is auspicious she is full of fun. The business world calls her and our best wishes for success go with her. Britomartg Girl Reserves RUSSELL STARBARD Rus found his way into our midst from Gates Lane School, four years ago. He has been blessed with many natural gifts. His pleasing stature and blond, wavy hair are the envy of the fairer sex. During his sojourn at Commerce he has been a loyal supporter of the Blue and Gold and his classmates wish him the greatest success. Lettermen's Club LINNEA STENMAN This vivacious, young girl needs no introduct- ion.-A jolly smile, a merry twinkle, and a mag- netic personality-the secret of her popularity. Linnea is not only Vice-President of her class, but a Horace Mann Scholar, an accomplished pianist, and also claims membership in various clubs. We are sure the greatest of success will be yours, Linnea. Vice-President, Chairman of Class Day Decoratf ing Committee, Orchestra Ag Britomart, Mercury Staff HELMER STENQUIST This young man, who is known throughout the school, has been so active that to attempt to enumerate his various successes would be well nigh impossible. Helmer had a leading role in the play Mary Rose, and had much to do with its great success. He is a Horace Mann, and a First Honor Student, and we know that his suc- cess in life is assured. Good luck, Helmer Horace Mann Student, First Honor Studentg Black- friarsg Treasurer of French Clubg Boys' Glee Clubg Combined Chorus, Mixed Chorus, Euter- peansg Lettermen's Clubg Freshman Basketball Team Page One Hundred Forty-eight ,gt i 57 TACT. .f1 , fx he as T ' 'IT' ' ' . ..- 'W' 'il' Ql,f 1' P 0 U 'Q GRACE STEWART Grace, the fairest occupant of Room 78, came to Commerce from the Dix Street School, in 1927. After graduation, Grace expects to go to Becker's Business College and take a secretarial course. VVe know that with her great business ability and her keen sense of humor, she will make good when she goes out into the business world. We wish you the best of luck, Grace! VAN DA STOKOWSKI Vanda, medium height, and studious, came to Commerce from Millbury Street School, four years ago. VVith her pep and sunny disposition she has won many friends at Commerce. She has taken a prominent part in school activities. She intends to enter the busines world after and we wish her the best of luck. Bumble Bees, Girls' Debating Society, Stamp Club, Britomartg Vice-President of Stamp Club CLIFFORD STOLPE VVho is that fellow coming down the corridor with a wistful look in his eye and a sober ex- pression on his face? What, that's the handsome Clic Stolpe from the Stoneville Grammar School. Clifford has never been absent from school. The baseball team will also be strength- ened this year by having him on the team playing the center field position. GLA DYS STONE Gladys entered Commerce from Boylston, and although a quiet, reticent girl, she had made an unusually large number of friends, due to her personality and charm. She plans to enter the business World at the close of school. VVe are sure you will succeed, Gladys! HAROLD STOWE Harold came to Commerce from Boylston and has made many friends while here. He has al- ways maintained a high scholastic standing and has been very interested in Chemistry. Harold was President of the Chemistry Club, which he organized. We know that he will succeed in whatever he undertakes, so we Wish you luck, Harold! President of Chemistry Club, Boys' Glee Club Page One Iillfltllfftf lofty 71 71? , CRT :xi ! i 'r lllllsti 'll ll I 14 lil itll!! i ilu: IX:Tritt:r 1i'ttv r11151i,f5i:g1 w: ij'- tu iit.1l:!gl ' ll 4 l 'll' l' .sa- jf f ' or C PHYLLIS STOKES Dancing is the hobby of this little New Wood- land Street School product. She is thoroughly in love with things commercial and has worked hard to increase her proficiency along these lines. Someday she hopes to be somebody's stenogfy and we predict now that some business man is going to like his new secretary. BEATRICE EVELYN STOLIKER Beatrice received her Grammar School educa- tion at the New Woodland Street Preparatory. A quiet and diligent young miss was she, and there- fore she attained many high marks during her stay in Commerce. Ev likes to play basketball better than anything else and for a reward was chosen for the 1929 Varsity Basketball Team. Varsity Basketball Team 19295 Horace Mann CHARLES THOMAS TAGMAN This brown-haired, snappy dresser is none oth- er than Charles Tagman, another product of junior High. If anyone ever intends to become a great track runner, he should get his pointers from Charles, one of Commerce's greatest track men. His many friends at our school all agree that he is a regular fellow. He plans to enter Worcester Academy. Good luck. Lettermen's Cluhg French Club, Track Team ROLAND TAN N ERBRI N G Roland, from the time he left Sever Street Grammar School, has been one of the most popu- lar boys of his class. As a writer and composer of music, he has made a reputation for himself and plans to increase his knowledge along the music line by entering the New England Con- servatory of Music. We all wish him the great- est of success. Blackfriarsg Euterpeansg Orchestra Ag Bandg School Dance Orchestrag Capt. Swimming Team DOROTHY WALKER Sargent's School in Boston will claim Dot after she is graduated from Commerce. Dot came to us from Greendale Grammar School. While at Commerce, Dot has taken an active part in the school life, both in social events and in athletics. She was Captain of the Tennis Team and has played on the Basketball Team. Britomartg Bumble Beesg Glee Clubg Captain Tennis Teamg Basketball Page One Hundrrd Fifty -wx !!,! . f' I 'lliilfllllql-3,11flMdiiS4Lli!1rQiIfW?l.1ll,1llll4l+Qf2l.mmill 'El U L mliij Q - azsffgifffgigfegfe- ei' ANGELA BARBARA STOZIN SKI Here is a student in the truest sense of the word. From her Freshman days, Angela has kept her eyes on a worth-while goal and has achieved her reward-scholastic honors and graduation in three and one-half' years. Besides, she had time to devote to various organizations of the school. Suc- cess will surely be hers. Girls' Debating Societyg Girls' Band, Orchestra, French Clubg Girls' Basketball Team, Honors ELSIE SULLIVAN vi She's the girl with those sparkling blue eyes is the way that Elsie is described to those who have been denied the pleasure of knowing her. She is full of fun and her charming manner makes her presence welcome at all times. The Class of '31 wishes her the greatest success in whatever she undertakes. Britomartg Bumble Bees HELEN CATHERINE SULLIVAN It was junior High which sent this ray of ever- lasting sunshine and joy into the folds of Com- merce, in her Sophomore year. Her Winsome smile and remarkable personality made her one of the most popular of '31-B's lassies. Her love for music can be attested to by the list of musical organizations in which she has participated. Good luck, Helen. Orchestra Ag Glee Club, Combined Chorusg Secretary, Euterpeans JAMES F. SULLIVAN Here is a lad to whom the word blues is nothing more than another color of the rainbow Never in his stay at Commerce have we seen that characteristic smile of optimism and cheerfulness which he made famous, leave his happy face, and never have we seen him unwilling to aid anyone in time of need. We wish you best wishes for a pleasant journey through life, -lim. BERNARD G. SUTHERLAND Bernard came to Commerce High from junior High and upon answering the call for ice hockey, he quickly won for himself the position of left wing, even as his cheerful disposition was quick to win him a place in our hearts. Quiet by nature, he possessed the steadfast quality of making friends that last, whose best wishes will follow him wherever he goes. Photograph Committee, Hockey Page Om' Hundred Fifty 07 ,aiu -as I771 ii W' l' il my IIIWQ 1f f 1 flfv'vwlfv'2iliii'M12ll'r1isiT FG: WX! W P536 i CARL SWEENEY Hello, everybody! Carl Sweeney at bat! Yes sir, that's Captain Carl Sweeney of the Baseball Team, the hardest hitter, and best player at Com- merce. Carl is a quiet, unassuming fellow who has a host of friends at school. Besides keeping up well in his studies and being a good athlete, he is Boys' Sport Editor of the Mercury. He plans to follow a' journalistic career. Good luck, Carl! Boys' Sports Editor of the Mercuryg Captain of Baseball Teamg Lettermen's Club ESTHER SYKES Our class would not have been complete without Esther, for she has a happy smile that attracts everyone. She is an excellent Bookkeeping scholar and although we do not know her plans for the future we wish her the best of luck. - HELEN ELEANOR TAMOSUNAS Helen. a graceful, light haired girl, graduated from Millbury Street School in 1927 and decided to further her education at Commerce. Helen is always for a good time and is always among those present when there is one. She has a loving smile that has won many friends. We wish you luck in your future work, Helen. French Club JOHN THOMAS John came to us in his Freshman year from Classical. He immediately made his presence known athletically and socially. He was a prom- inent member of the Track Team, earning his W in his Freshman year. He also made the Baseball Team in the same year. John also played in the Band, and Orchestra. He intends to spend a year at Andover preparing for Uni- versity of Southern California. Trac.: Teamg Baseball Team, French Clubg Lettermen's Clubg Glee Club THEODORE THOMASHOVV Ted has made a line record for himself while here at Commerce because he has only been in the United States seven years, during which he has gone through grammar, and now high school. His luck and determination to win should carry l'Teddie a long way in the business world, which he intends to enter. We wish you luck, Tedl Assistant Circulation Manager of The Mercury Paar' One Hundred Fiftyftfwo i7 , iilllw ' ,ffl j lfftjll l 91:35 im i i i fxx' li rlgif,isrm1Q3,.i1.i5lz.,...,izt5!lHEi.ig,.iiiV1ehwLH I rl LJ L Gfkeq 175' G50 STANISLAS TONONA Stanislas is one of those persons who has that rare quality, optimism. She always possesses a smile, the warmth of which cheers and inspires. Stanislas was quite regular and conscientious in her studies, and always looked very neat and trim in school. Activities did not attract her much, but she was a member of the French Club. Best of luck, Stan French Club ARAXIE TOROSIAN Araxie came to Commerce from the High School of Commerce in Springheld, certainly setting a fine example of the type of girls at that school. Araxie has very soft, wavy, jet black hair, the envy of all her classmates. She is always calm, cool, and collected, and we feel sure she'll be a big success. MILDRED TOVVN SEND New Woodland Street School lost a bright and lovable girl when Millie entered Commerce. She is a dark, wavy haired brunette, with charming brown eyes. Her favorite hobbies are swimming and bowling. Although Millie has not revealed her intentions for the future we know that what- ever she undertakes she will be a success. Britomurtg Girl Reserves- VVILMA YVAGNET It was Westboro High School's loss and our gain when Wilma joined the ranks of the 1913--B Class at Commerce. She has not taken an active part in social activities but has faithfully attended to her studies. She has not revealed her future plans to us but we hope that she succeeds in whatever she undertakes. RAYMOND VVARFIELD Here's Ray bringing along a host of adjectives describing briefly but concisely his skill at school. Ray is witty, clever, dexterous, expert, and bril- liant. His laughter mingles melodiously with that of fair maidens and his studies are always well learned. Ray intends to become a business man and Commerce expects him to elevate her standard for the world to see. We wish you luck, 'fRay.l Captain of Soccer Team Page Om' Hundrrd .Fit ty lfznw tfjl N ,! ' i4,N I i l 1'. I ' ' I Mff' f1'w'!f:f1:'f':ifr'v :r 2:1f:ewfliu .. 4 MCD' 1 l Q Tlliblll allwmf n 5' M1 e.3i:....A----e'L7 2 Li r ROBERTA VVELC H Roberta is one of those girls who is always seen, but seldom heard. An all-round student, Roberta came to this institution from Quinsiga- mond School. Roberta is noted for her shining dark locks and bright eyes. She expects to be somebody's stenogu and whoever employs her will have an attractive and bright girl who is wished success by all. Mercury Staltg Chairman, Caduceus Advertising Committee NORA VVERM E One of the most popular girls of our class is Nora, popular not only with her classmates, but with her teachers as well. She is an excellent advertisement for her class, and ranks high in all her lstudies. Nora is a graduate of Quinsiga- mond School. VVhen Nora goes from Commerce we are sure she will tread the path of good for- tune in the business world. And you know, Nora won lirst prize in the Telegram radio contest. Mercury Staff, Caduceus Committee GLA DY S VVESTERLIND Gladys VVesterlind, who came to us from In- dian Hill Grammar School, has had a splendid career in sport activities. She has taken part in both major and minor sports and is on the Basketball Team. After graduation she plans to do general of'l'ice work. The class of '31A wishes Gladys success. Basketball Team OLIVE VVRIGHT VVC gained a charming little lady when Olive stepped into Commerce from Lake View Grammar School. While at school she was a brillant stu- dent in Algebra and History. She is intensely interested in her studies and takes them seriously. Her hobbies are reading and dancing. When Olive graduates, she plans to be Somebody's Stenogf' VVe are confident she will succeed. Girls' Glee Club, Britomart IDA ZIEPER If Commerce were full of students like Ida Zieper, who was graduated from the Junior High School, no electric lights would be needed. Smiles would illuminate the school. Zip considers His- tory as her favorite subject. When she graduates she plans to take up interior decorating. Suc- cess to you, Ida. Frye One Hundrfd Fifty-four LO- ...M A..,A..A.A, . -. .M,..M .5 L 'RFQ gg? l Wilttttll-lutifrf it 1 l . xl L 1 1 it l ull l l lll ill ill! M 'M' - libifg. J. ' DOROTHY WEINHEIMER Dorothy Weinheimer, usually called Dot by her friends, is among Commerce's social set and is one of the best dancers in the school, being on the committee for a sorrority dance along with some other members of the school. Dot'l came to Commerce from Arlington junior High School. She is also quite active in some of the social do- ings of the school. Girls Reserves, Bumble Bees IRENE VVERNER If loving cups were given for singing and sweetness, Irene could open up a jewelry store. Her singing is well known to us as she appeared before the Assembly many times and was Class Vocalist. Midland Street School Sent this maiden to us and we are very thankful. After graduation she intends to work at least one year and then enter the Boston Conservaory of Music. - President, Bumble Beesg Story Hour Groupg Brito- martg French Club, Girls' Glee Club, Class Vo- calist, Combined Glee Clubg Worcester Consoli- dated Chorusg French Club Chorusg Only New England Representative for National High School Chorus of 1930 and 1931 FRANCES VVEST Frances came to Commerce from the New Wood- land Street School in 1927 and seems to be making good as a stenographer and no doubt some busi- ness man will profit greatly in the future because Franny is his secretary and has a good busi- ness head. Frances, besides these other qualities, is noted particularly for her good humor and seems to be ready to smile at the slightest provo- cation. Britomartg Bumble Bees, L'Amitie VIVIAN WESTERBERG VVho is about the best swimmer and skater in the High School of Commerce? Vivian Wester- berg claims the onwership of that title and is often seen with Miss Lundstrom on Leesville pond skating and having a merry old time. Vivian is also quite a stenographer and next to Linnea Sten- man holds the record for the speed contest held in Oflice Practice I. Vivian came to Commerce from Greendale Grammar School. JAN E ELIZABETH WI SNIEWSKI A magnetic smile and a willingness to help whenever possible have endeared Jane to all who were acquainted with her, from the very day she entered the school on the hill from St. Mary's. She has been spreading sunshine and good cheer during her entire stay here and we are sure that she will succeed in the business world when she leaves us. French Club Page One llundrfd P1 fy jifvr ipigi - ff TX' as . ,, ff' - , Q IC A H Q JQ Q ffm Bgb MARION WITKIN Among the best swimmers and skaters in Com- merce, Marion VVitkin's head is above them all. Marion came here from junior High and is quite popular among the Commercites. Although she is short of stature, she has a dignity that makes up for her shortness. Marion is also quite a sociable girl and because of that faculty she has been voted in the French Club, and Britomart. She joined these clubs in her second and third years respectively. ' STAN I SLA US WOLK A strong, well built lad came to us four years ago from the Lamartine Street School. His interest in wrestling has led him to be quite a wrestler in amateur wrestling circles. He played on the Boys' Football, Baseball, and Basketball Teams. He intends to take a physical training course at Springfield College, in the fall. ' Boys' Baseball, Football, Basketball, and Ice Hockey Teams EDITH M. WOLL The Girls' Glee Club and the Mercury Staff will feel keenly the loss of Edith after her gradua- tion in june. Edith's large brown eyes, and lovely brown tresses, have always been a source ot at- traction at Commerce. The business world will claim Edith and we are sure she will be a success. Bumble Bees, Girls' Debating Society, French Club: Girls Glee Club, Combined Chorus, Mer- cury Stalf, VVorcester Consolidated Chorus NELLIE G. WOODMAN Nellie is by no means one of our quiet girls. Although her name is not on the honor list, sne is one of our brilliant girls, especially in History and Economics. Her success in the High School of Commerce forecasts a successful future and the Class of '31 wish her all the luck in the world. 1' rench Club HELEN MARIE WRENN Helen came to Commerce from Upsala Street School, where she was known for her good humor and her good marks. Helen's favorite Subject is stenograpny and she has just finished a three years' course in this subject and having attained a high mark in it in the course of three years. Helen is quite a dancer and also quite a good sport when she goes anywhere. She is also quite active in the social affairs of the school, being in live different clubs. Girls' Debating Society, Bumble Bees, Britomart, French Club, Stamp Club Page One Hundred Fifty-six TQ- ,L . ll C mr 1 QU' A age BERNARD YANOFSKY A'Bernie was in all of the musical organizations and also participated in sports, being a star mem- ber of the Soccer Team, playing right outer wing. He was one of the organizers of the popular Novelty Orchestra and also played in the Band, Brass Sextette, and Orchestra A. He was also a member of the Mercury Staff. Bandg Orchestra Ag Glee Clubg Novelty Orches- trag Brass Sextetteg Euterpeang Mercury Staff ALBERT A. YODZONIS Here is another popular member of our Senior Class. Al was business manager of the Mer- cury Staff and was certainly on the job all the time. He has also been musically inclined, which is evidenced by his membership in the various musical organizations of our school. Although a loss to Commerce, we are sure the world will rejoice at the gain of AL Band, Orchestra Ag Novelty Orchestrag Brass Sextetteg Euterpeansg Mercury Staff LAWRENCE YOUNG Larry, the jornalism shark, is one of Com- merce's most ambitious trackmen. His personality has won for him the admiration of his many friends. Larry should surely succeed as a journalist because of his charming traits. Best of luck, Larry. Lettermenls Clubg Outdoor Track, Indoor Track, Swimming Team, Cross Country, Assistant Edi- tor of the Mercury GEORGE H. ZAKARIAN Who in our class does not know genial, and sunny dispositioned George? Since his- entrance from Junior High during his Sophomore year his presence has been a joyous one. He is a talented musician, and many are the times has his ability been displayed, both as a member of the Orches- tra A, and of the Band. Wherever the future leads him success will be his. Orchestra Ag Band, Novelty Orchestra, Euter- peansg Blackfriars SOOREN ZAMANIGIAN It is one thing to merely be on a school team, and another to be on a team and also be a hard worker. Sooren took an active part on the Track Teams for three years and he put his whole heart into it. Sometimes he was the victor in a meet and sometimes he was defeated, but he always fought hard. Lettermen's Clubg Cross-Countryg Indoor and Outdoor Track Teams Page One Hundred Fifty :elven CO re -E U fill mbsll ' lll .sw --H--- ---H----M Cries? MARY ZECKER Mary came to Commerce from the Lamartine Street School. She has been one of our 'tsilent ones who prefer to acquire real friends than the honor of being a member of any of the numerous school activities, although she did belong to the French Club, and the Bumble Bees. Mary has not yet decided what school she will attend but what- ever one she does attend will gain a good student. French Clubg Bumble Bees DOROTHY ZOLNOWSKI Dot is one of Adams Square contributions to the Class of '31-B and a very desirable contribu- tion she has proved to be. Possessed of a charm- ing personality and a disposition that has won her hosts of friends, it is impossible to predict any- thing but success in whatever walk of life Dorothy decides to tread. Basketball ANNE RITA ZUKAS Tall, dark, and stately-that's Anne. Lamartine Street School sent us this fine musician and schol- ar. Anne has played the violin in Orchestra A for four years. Her scholastic ability is proved by the high average she obtained in Latin VIII. Anne feels Htted to step right into an excellent position and we feel sure she is capable of holding one. Orchestra Ag Euterpeansg Treasurer of Nuntii Virgili CAROLINE MARY ZUMA Caroline, like many more of our prominent classmates, came to us from Junior High School in her Sophomore year. The three years she has spent with us have been of a most pleasant na- ture. Ability to do painstaking, and diligent work always made scholastic work easy for her and she always found time to participate in other activities of the school. Good luck, Caroline! Girls' Glee Club STELLA ZUCKERMAN Who hasn't seen Stella and Edith strolling the corridors daily, making everybody feel happy with their cheery smiles. Stella came here from junior High and immediately joined many clubs and played an active part in each. Stella intends to train for a nurse at Beth Israel Hospital and we wish her heaps of luck. French Clubg Bumble Bees: Britomart Page One Hundred Fifty-eight 0, - . , A Q1 ff fr 4 W!Uf2fs 5'W5-Wi fef.xQ,f,?+ V ' 1 ' V Vf, NME W g:ff?35W1f E 1 -1.1 .,w,'1f- wi1. F1wev1'?N1'I.+:wl :!'w,f M ww 1 W' w w xii N! i?!vnw+wf1if1l,'l'W'f fd 'fl ' ' '-'::,,,M, ,,,7.,,,4,,,,,,,.,,.,,v,,,,i-fi--4,1 -- ': iTii'm'--...gg:.3Q't5::f, Gkwxp : -w . , , f 4 J gl? 931 Y, FEBRUAR -4 SCHOLARS-- HORACE MANN L Page Om' Hundred Fiftyfnine :N , rf: Q . X CTN-, fy AA'-Y-- VV gg y ...- -:----D X , X ' 1 - X ,xl Y YA W w -' , 4:,-,A wx X - x fy W ,fu 'Ilia -275--, N .. v-if v ',jqf:'PIfj:::-.ff - f.., ,vv-.hh-i X,.N .,,V MZ., X .. W. w a, kf L s JEiQ:V4T1 E E' CAL I 41 11 LD la ,.. ... .. : W 4'C .E i'I E Q pi Q aa 1 :2 - - Id ? 5 13 E :E -1 : U CC 2 D6 c:' , if A : .1 5 N-2 ox E F .-1 x: .Il D , V... ,-. U-I fi 1 O 7 C 4' rj N 5 C f-1 2 1 ,.x : Q , I rs FL' 'I E Q Q' 5-f 53 ::' Q 3 94 A J 9 -' 'D .gg 7 , J, 2 1 'm W 7 2 Q 4.:.3l1 rc Q 2 m M .2 LQ I: ,X ,5 A Q Q : ,g vm 4 C... A 5 I. E -1 E72 C4 2 -11 5 : 5 ,J 'E D :xi gg 5 ,Lib i fv I+ fp -H Al :S E 3 4 . 'U 5 2 LJ in 2 .A 'S 5 :'E L1 L ,lm PH111' ' 0 ne Ilundrcd SA Ixly , flex - M llll ills ll! Q, - YAQPI4- iv Horace Mann Scholars Doris Anderson Helen Bass Celia Bretholtz Frederica Donley Roland Erickson- Rosalind Fine Norma Finkel Dorothy Carlson Hazel Casperson Walter Dahlstrom Harriet Glynn Ethel Fritts Alice Gaides Helen Donahue Natalie Read February, 1931 Anne Gagan Russell Hemenwav Anne Hovanesian lda Jacobson ,Rose Jonas Janet McPherson Linnea Stenman Evelyn Stoliker 1932 Miriam Harris Adele Joseph Asaline Kalil Helen Krafve Janet MeKearnan Yngve Nordstrom Shirley Olson 1933 Genevieve Strakosz Ida Yarock Page One Hundred Sixty-one ffl, V-wf.f.,ff1f EJ gb CD :' n. L3 cm. D6 O 7 O CCI Page Um' Hundred Sixty-Mm fill l lll lllll , 1 XXVff! bil rickson, Rosa- E Epstein, Roland Sonia ild red Cinsky, M retholtz, a B Cel earse, B 3 rth Basm Ma Anderson, Helen FS 0 D I .C O U N P1 RS rn :E rd U CI as ? o CIC .2 G C QC .sh 2 :C fl Q va E E I-Ll Ef Q.: .2 i rh NJ CU -:J 42 C. ra BD C5 ,- Q :: c: Q1 .52 c.. SL E1 I1- U lc C L-A : ff 4 T: .M :: LL ns E 3-1 ho L mf CI B- .E azinski St ngela nn, A Stenm RUSH I. Snvatsky, CSS C B Tina, elN Bessi Nlcljhe srm, La rs mn, janet b a Katz, Eb Esther G. Z L 44 H U2 31 Q, D L14 ' 'ig1ifr125giE2 T'Tw'A' W f 4- W, l: X :rx 4, f T T TT T ?X 4 mmm- .W ,.,.. - ia: ,,,. ,. .,,., ..,.-.--.......- xg ff' V 56 Flu AA' TTER- MENS SOCIETY CLUB ORCHE-ITRA EOL Lo f D I7 M..- 45f il,-12-gage QT.-W--MR ww' ' K V ' l3lVZ3fQQl'lfl7l'N ,' E aa? Blackfriars Dramatic Society john Cakes Faculty Advisor Officers MAURICE KRINSKY . . . ........ ...... P resident EVELYN KENNEDY ..... .... V ice-Presidenz LEON RANCHYNOSKI ............... ...... S ecretary DOROTHY BELL ..... . . .............. ...... T reasurer MEMBERS David Aldrich VVyman Allard Wayne Ambrose Evert Anderson Marie Beck Lorna Dean Malcolm Dickson Jean Ducharme Sonia Epstein Roland Erickson Herman Eurenius Virginia Fair Leo Garrepy Dorothy Gibney Isadore Golub Philip Harwood Russell Hemenway Herbert Edman YVilliam Italiano Ida Jacobson Rita Johnson Mary Kenney i Irene Lamothe Howard Lee Page One Hundrfd Sixty-four Anna Levin Agnes Lovejoy Francis Mahoney Dorothy lllichaelson Lucille Nichols Vincent Ojerholm Mildred Rice Eva Skibinsky Benjamin Snider Helmer Stenquist Edith Wolk W Constance Vi7ondolo sky 1ff i ! L?QgliNW J Pagf One Ilundrfd Sixty-lim' 'XMARY ROSE FOR CAST BLACKFRIARS Ducharme, jenn edy, Kc-nn ll lively Srenquisr, He mei' Levin, HHH son, A Erick fi Zll'l , Roi Hi Z1 Il V, VVym n n A 'ilmimk SL Il .5 -l-4 ima ii A xiii: Q2Q2Af iEfp1sPi iii3EfJ i 1 ,::i 3Y'fI,', f i ii W 'Ji in ii far ij ,f ' 'pi i 13,223 ,fi it - 1 .,: i,: E !Q5 W s ki e 1 ,ij 4 fl it all i ACM ,fgfgiiflgi Dickson olm Malc A ,ogy -H Y ' we Q ffgj sv? R l7?'3ig 1 'A' 1' 132 gigw' nj? 5 'f 'f'f 'E Z3F 35?'g:e ffl 1T ! 'E'!E'i ' ' f'1'f.'l' ??'1wsiV'1:f Qu ffl E21 Members of Britomart Faculty Adfvisorx Miss Gunhild Elfstrom Miss Edna Lundstrom OWCETS MEREDITH HUTCHINS ......... ..... P resident RUTH DAVIS ........ . . . Vice-President HELEN CRONIN . . . .... Secretary RITA JOHNSON . . . . . . Treasurer Page One Hundred Sixty-six LAOA xt EEEW ff' fi'fVff l 'ii-dQ'f'Viifl?' U 1 S7 MEMBERS Dorothy Allison Agnes Anderson Doris Anderson Nellie Bender Evelyn Brevard Leona Brock Ellen Brodsky Catherine Burns Marian Cassidy Constance Cherefils Catherine Clifford Elizabeth Clifford Rena Cohen Charlotte Cronican Margaret Curran Alice Daucunis Nina Denowitz Nora Donahue Bernice Downing Virginia Fair Evelyn Feldman Edna Field Harriet Flynn Mary Flynn Alice Fogarty Katherine Fox Ethel Fritts Alice Gaides Patricia Gibbons Dorothy Gibney Mildred Gilmore Ada Goldstein Roslyn Gould Charlotte Grant Ruth Gurley Myrtle Gustafson Irene Hebert Ellen Hedwall Ida Jacobson Louise Jelicka Ebba Kasparson Marguerite Kasparson Margaret Kelly Mary Kenney Mary Kiley Joyce Kislak Ethel Kuiivila Viola Labenski Eleanor Lindstrom Helen Linquist Agnes Lovejoy Mary Lucey Phyllis MacDonald Nina MacGe0ck Alice Mazeika Eva Rlontville Mary Murphy Margaret llfloore Phyllis Oberg Doris Pearson Mary Prendergast Mildred Reynolds Dorothy Rosenberg Bessie Savatsky Rita Scanlon Eleanor Scola Viola Sochon Helen Spitals Viola Stankunas Linnea Stenman Vanda Stolcowski Mildred Townsend Cecile Victor Constance W3HdCflOYVSkl Frances West Loretta White Rita White Hazel Wild Edith Wolke Page One Hundred Sixty-sc-wr: e - Gb me r E X,,ff5525Z??5ES5EEEi:gixLW L V7 H 'fff'-T xii-T 'rw 1-3-firlfii-+5 74? M' 0-Q1gXQlf,f-L, or gb 7 ' 531193 of V BRASS SEXTETTE High School of Commerce Band Edgar YVilson, lyllflllfbl' llirewfm' Alhert Yodzonis Lawrence Kend rick David Champagne Leon Ranchynoski Paul Rosenlund Sam Hurwitz Edward Price john Waste Ernest Bouley Benjamin Snider Carl Nordgren Gerald Langevin Stanley Anderson Domenic Rosetti Herbert Edman Barson Bedig lVIelvin Budish Bernard Cormier Julius Noar lValter Bliven Leo Leavitt lliatty Turo Bernard Yanofsky Joseph YVeiner Edward Feldman John Limoges George Zalcarian George Bauer Anthony Tomailo Nlaurice Griff lklichael Sullivan Edmond Gagner John Logan john l-lohin Leo Garrepy Nathan Feldman Saul Freedman Sumner lVIeiselman Edward Feldman John Clifford John Zulcerman Harry Eminian Nlaxwell Ruhinisl-ty sw gf Q r e if' Wi wi it . , fri f... gff5iF'Q2W 25, i f f., Nr gf if r f ar f re-,, . ,,,t, M X jp, In xi NU l, T K ' 45-, ' L QQ 4 Jr M or I an , 1 1 xx. ,Late x :W .4- f U ' 1: 4 fffx, U f 'fm ' ff 'f 1 f 1' ff 1- 1 X ' -. ' Ll W ' ff if l JD afagl-t:f Q' f.f'fflf fee Page One Hundred Sixty-eight - T 0 ex ee V W vu f--vf'- -A--'3,7 vf '- rel- - iiZ1T:93':3::T3? 'EMM 'W U-s.q:Xf?6ft. mum Louise Heamel Helen Carlson Mary' Mzlnning Francis Robinson Irene Lamotte Ada Goldsteai Kenneth Stewart, Lmder Roland Tannebring lvlaurice Griff Earnest Bouley Novelty Orches Girls' Band Edgar YVilson, Leader Rebecca Chervinsky Lettita Jones llffary Toomey Ethel Fryer lVlary Christy Angel Stakelunas Helen Thurston Raymond Havey Benjamin Snider Albert Yodzonis Lawrence Kendrick tl'21 Angela Stazinski Aruta Askalis Anna Nourse lblary lWaCKinnon Agnes Sundquist Celia Kendall Herbert Edmond Bernard Yanofslq Mike Sullivan George Zakarian J K . XQJ J , EJ ' , 1 i?f?5C5JL' I l im 49 1 -,rf W A ' ' y, ' N71 ....r 15531 MW! Page One Hundred Sixly-ninf '-nn'-TLT-ii kin? '- ' W- l 4 ----- ---- lr- Maul' , .,.A .'5' :7:'::,::::..:?.rAgg . 5215? 425 CJ u-vw-v I Q Ethel Baumgarten Sylvia Sherman Yngve Nordstrom Ruth Barsky Bessie Brunton Dorothy Hurley Roland Erickson Beatrice Yanover Lillian Goff Ivar Nelson Leonard Fisher Frances Thibault Helen Sullivan Joseph Weiner Anna Zukas Orchestra A Edgar Wilson, Faculty Dirertor Pngz' Helen Rankin Angela Stakelunas Berget Smedberg Florence Posthuma Gilman Hall Roland Tannebring Benjamin Snider Gerald Langevin Agnes Sundquist Ada Goldstein Rebecca Czerviniski Julius Noar Ernest Bouley Rena Nordstrom Elva Rutherford Milton Slovin One Hundred Smwzty Kenneth Stewart John E. Carlson Solomon Hurwitz David Champagne Albert Yodzonis Lawrence Kendrick Bernard Yanosky John Limoges George Zakarian Edward Feldman Linnea Stenman Helen Bass Vera Boyes Maurice Griff Ann Goyette ZOA !,ff V 'gr ace qllwll l U1 mlllw-W?-5l1':iQ G .sas-ri' 1 -f G-if? 371' ogb Assembly Debating Society President ...--. Vice-President .... Secretary ...... Treasurer ...... Chester Casperson Eugene F. Casey Jordan Cotton Louis Fagan Saul Gilman Charles Golub lsadore Golub Raymond Hall Charles Hendricks John Hogan Peter Jonitis Edward Karolkiewicz . . ...ARTHUR ARCOFF .. WALTER COAKLEY STEPHEN G SAVAGE .. .... JOHN J CAPUANO Leo Leavitt Everitt Mars Abraham Plotkin Edward Starr Robert Abodeely Robert Cafarelli Elmer Holger George Mkxrphy' Samuel Silver John Logan Julius Noar David Mrirrman Lawrence Penny Page One Hundred Seventy-one MEMBERS ,OL AA ,f , ...,.. i jI,,,,g,,,i S rr E Dam CHARLOTTE GRANT MARY KENNEY .. VIRGINIA FAIR CATHERINE DALEY I o Bumble Bees Miss Louise Colegrove Faculty ddfvisor Mary Adamonis Edith Almgren Nora Baker Marie Beck Evelyn Bedig Dorothy Bell Madeline Bell Nellie Bender Nora Bergstrom Adele Bernstein Adella Bisko Bertha Blanchard Marian Bloom Irene Boss Charlotte Bottomley Catherine Brennan! Evelyn Brevard Wini Bromage Dorothy Brunell Mildred Buda Rita Burke Anna Bushman Madeline Carleton Rita Charbonneau Soderveit Clisie Anne Colaizze Doris Corr Margaret Courtney Adrienne Cousineau Mildred Croteau Mary Crowley Rose Crowley Ethel Davis Ruth Davis Alice Daucunas Camella Delie Virginia Dickie Nora Donoghue Irene Eagan Mae English Anna Erlandson Alice Falvey Corinne Frissora Rosilyn Gould Mildred Guilmore Ruth Hall Julia Hemura Charlotte Hoffman Pauline Holt Rita Howard lkliriam Jacobson Beatrice Jastremliska Elsie Johnason Louise Johnson Gladys Juneau Rita Kabel Graksea Kalligan Jessie Kargun Mary Kernan Mary Keane Edith Kinnear Gladys Kosciak Barbara Landon Josephine Loughrey Mary Manning Adele lVIaykel Doris Marshall Madeline lVIarshall Alice Mazeika Anne McDiarmid Jessie McDiarmid Janet McKearnan Mildred Morrisey Dorothy Morse Anne Murphy Gertrude Myers Page 0110 Ilundred Seventy-tfwo . . . . . President . . . Vice-President . . . Secretary . . . Treasurer Eva Ordung Grace Palm , Mabel Palm Theresa Paggessere Svea Pearson Pauline Peltier Lillian Peterson Frances Pottashinsky Albina Purvinskas Josephine Rano Marian Randall Bernice Richards Helen Richmond Edith Riley Margaret Robinson Dorothy Rosenberg Mary Ruthewicz Meriam Rydberg Gertrude Schaftel Pearl Schnare Eleanor Scola Anne Shea Rita Simonean Dorothy Simpson Meredith Simpson Vanda Stokowski Florence Storer Dorothy Sullivan Nora Sullivan ,Ruth Thiel lVIary Toomey Frances Toomey Hazel Turner Dorothy Walker Mary Wallavick Gertrude Wallman Catherine Waitele go, V7 M 2 ? X 5 Y 1 - ,J ONE? Girls' Debating Society President .... ..... A NN GAGAN Vice-President . . . . .... HELEN KOSKY Seeremr ..... . . . MILDRED REYNOLDS J? Treasurer . . . CELIA KENDALL A 4 ,ff XVfW5 Sfflxtx . 1 A 'XS' 2 'PS' 4- ff M I 'IDU IJZLC 5 M: K 'f if Jul, 6 A ' 'lj 4' f 1. 'I 'h' y ff ef '42 a l n X f AQ: fM.fRMDf . ff-' wow W 454 , ,XNN-fu'iikff Page One Hundred Sefuenly-tyhree a OQQEM - 'Began-ax l XJ 4 E 2l V1WiWE!Y 'i2g'?'2!?E??!' '!' 2'I2'if5f?E:'HiEi'lm E- A f ' Q'll I n Evelyn Brevard Mary Canning Alice Daucaunas Irene Darche Rosiland Fine Mary Early Patricia Gibbons Esther Grogan Ruth Gurley Mary Hurley Ida Jacobson Anna Kashan Celia Kendall Helen Kosky Ida Kline bee Q Lillian Kunin Viola Labinsky Mildred Reynolds Edith Sandstrom Bessie Savatsky Eva Skibinsky Vanda Stokowski Minnie Herman Nora Donahue Ann Gagan Mary Usher Florence Storer Helen Wrenn Mary' Rooney Alice Gaides GIRLS' DEBATING TEAM Page One Hundrfd Seventy-four Anna Forzley Helen Clifford Margaret Clifford llflarjorie Scannell Catherine Ollis Eloise Lamoreux Clara Dexter Judith Goldberg Dorothy Goldrosen Ruth Goldberg YVinifred Hogan Florence Mee llflary Pierce Rita Scanlon Celia Shapiro , LQ, ig V7 I ll i.....,XX 1 1 f l L - .L-...V2-Q-:ii-:W-flsaazg, Euterpean Musical Society lVIAL'RicE GR1FF .. RENA NORDSTROM .... LEON RANCHINOSKY HELEN SULLIVAN . Helen Bass Ethel Baumgarten Walter Bliven Vera Boyes Bessie Brunton Herbert Edman Edmund Feldman Lillian Goff Ann Goyette Maurice Griff John Hoemer O rem' lnllflllf-1' nlzzlwiyor llflr. VVilsOn MEMBERS . Lawrence Kendrick Leo Leavitt John Logan Tammer llfleiseleman Thomas MOllm lvar Nelson Florence Pasthuma Russell Perron Sylvia Sherman Benjamin Snider Linnea Stenman Page Om' Hundred Seventy-jfqfe ...... Presizifni . . . . Vlrr-Presidezzt . . . . Treasurer . . . Sefretary Helmar Stenquist Kenneth Stewart Helen Sullivan lwichael Sullivan Evelyn Tremblay Joseph VVeiner Bernard Yanokly Beatrice Yanover Albert Yodzonis George Zarkarian Marx Rubinsky so O er ' ' ' -- 11 ff?Q2EfZ' ,ik 35722 Q 'Lg' -V ,Y ' ' f -----.-,.,,- Q :Vl 5 fi' 'UW F'! 'i 'fI'H 'Af'f'!!E ' 'Zi' 'lf'-1r1 y iVvw w'1:w,ww Aww? f ,i:.:w'uwf,1 l TT f4l'.1, w fnkllr- Jw wiv' iw ef' y ' Yiffwv-.,1 ..,,. .T A 1, ' ,i -Q 1, V x, lf li '1lL,f'Tf'n'- N3-.i'?fl'l MV 'liflllllilbl' i'l-'ff' fl, Xi --' W ll.. ' -l'lI'?'u'u'L'f' X l mf: HMM lI1 '1'fTl:,'i,.ll'Tl :sl llBi? ',mlrvfff'1,wl 1,.Ef.f2,'l Ti, 0373373 M --f- -Nw h,,f -S ' 'Ls -V-an-W' -f -Q:-X 1, ,LW JU Allen Durward William Costello Cecil Aslanian Evart Anderson Melvin Budish Chester Blackman Abraham Cohen Nathan Feldman Leon Greenberg Sydney Goldberg Nathan Goldstein Boys' Glee Club Edgar Wilscmn, lfllfllll-1' Direvior John Hosmer William Goldstein Alexander Krikonis Irving Mann Julius Noar Louis Parent Daniel lVIcCleely Errold Moody John lVIara Thomas lVlorrow Sumner Meiselman Russell Perron Prwf Une Hundrrd Sefventy-six Milton Slovin Frank Thomson Sigismund Tolvezko Francis Robinson Vincent Ruseckas Morris Simon VVilliam Symonovicz Helmer Stenquist Anthony Sakalowski John Zmayefski Joseph Zakarevich ,,n-'- --1111? Q iifiiill' -N---?x,, of-H aaaaaaaa A ' Q V1 in W 'Q'2' 2,1,142iiwsrsfiiiz'3 v:'fETii:7V:F : 1-WSE W ua' X 'alwa-lslililffkaiilvislaimaifiillsrilllflyl B '51, , lx :t:1 i-ff H Zf 05250 Girls' Glee Club Edgar Wilson, Faculty Director Evelyn Anderson Dorothy Allison Vera Boyes CPianoJ Martha Bearse Glenda Huffington Dorothy Covell Alice Daucunas Lorna Dean Thelma Branison Irene Campbell Dorothy Holbrook Lina Honkonen Laura Jordan Rita Johnson Aisa Hovenesian Winifred Hogan Anna Kaskan Celia Kendall Catherine Kelley Katherine Lyden Ada Lubin Irene Lamotte Beatrice Metrikas Mina MacGeoch Mary Madden Rena Nordstrom Mary Pierce Anna Pucilauskas Elizabeth McEvoy Phyllis McCarthy Lila Meiselman Agnes lVIcCarthy Page One Hundred Sefvnzty-Jefven Eva Mcmntville Claire Portelance Julie Roglis Isabelle Ryngstrom Dorothy Rosenberg Bessie Shreiar Eleanor Scola Irma Swenson Mildred Rice Helen Sullivan lklarguerite Smothers Arline Stengenzer Olive 'VVright Irene Werner Edith Woll Celia Zack 1 X -:1:f- V'-'wi-ge -1:!-1N 1:1-it-, 'xxx Aff in-M ijwrwrfr Y- Lira' 3' iq ...,. ....,-....-..-....i---- -J u N zffk' Ego Mercury Staff, 1931-A Charlotte Grant Jean Ducharme Mildred Rice Leon Ranchynoski Sonia Epstein Stella Burns Minnie Jaffe Nora Werme Anna Fradkin Ethel Forsmzm Norma Finkle Beatrice Greene Roberta YVelch Dorothy Bell Agnes Anderson Linnea Stenman Elsie Jacobson Herman Eurenius Karen Madsen Page Une Hundred Sefwrzty-fight kM'ifWV4W7!fi,2'iii9 flilf - f NR nif aiu Q az' : E V A :aff-:1w,L,,,..w Mercury Staff, 1931-B Ruth Gurley, Editor-in-Chief Helen Potter Phyllis McCarthy' Albert Yodzonis George Ohan Carl Sweeney Rubin Gurlitz Eugene Casey Theadore Thomashaw Phylis lVIcCarthy Eva Skibinsky Robert Kincaid Bernard Yonofsky Sylvia Sherman Rehecca Chervinslq Sophie Levenson Mary' Pierce Lawrence Young Alice Daucunis Lillian Kunin Florence Mee James Petrides Edith Wall Evelyn Hannus WVinifred Hogan Page Onrr Hnndrfd Seventy-nine O V7? f'f'A ,Af . Y Qwlf f'Q' A 4 A N V f , ,, -V' ' ,Ugg-, ,mi , j,w19ljgNJ,3w1 3 f5.v,L' 1 jp vQ1l:i Iif': Ik M A 'T fx :un-fn' Uk iw 'fm-rf-Y .'i,:El'?'si1f'!1 mf' -- , --ff:--G ,W!,i?1:H4Q-Eff: Q ' X aiu- 1- W H f ' ' 51337721, U36 Page One Hundred Eighty C' . 1 -4 on ox v-1 f, -1 my n-1 rn E-4 F Z 'rl Z A V v f H p., LLP L H ,..f A 4' U a-T an 4: Z E Z ua V fu ,- f- E L.. +.. L 7 :1 aa Z ff -A -4 L1 Ta .. m 5 .5 M A. f-4 i 11 Z '-1 ru Z: :E ua 2 P1 .- 4. 0 , :, 51 E 'Q -Lf u 'S I 4: 2 fp v- E :2 Y 7 , ,f fi- frfifff' ,Qi .f'f,,,g,1j'- f,,Y,,,l'i - V + Xxy'-or l l l PX w w I 1 D V l ,.-:1'l,' 1, 1 ' , 'K ' ' 'M' ' ':':TM - TJ: .zzgggzv cL::::3it Yfi-.:,,i.Y 1T1'xTT' f' - 7:'g': ' V-Q65 jf-V E156 Caduceus Committee, 193 l -B Helen Potter, Chairman Olive Burgoyne Rose Riley Esther Grogan Edgar VV. Rylander Abraham Plotkin Rita Scanlon llflary Prendregast Katherine Cronin Page One Ilundrcd Eighty-one -- A---- --:eg---Y ff 2 A-f -2iQf'fl2e2f255liT gi'4fL.LxQ...w...... ----:rn li l V 'ltgflrllldllllllll,ulllzlllflliNAL' ,ffl ll. g U ' IX V rx .v1!rU iH!y5, .,..1 gy 7 X ,,, W., l.. ,Vg,f,g1g:'5 .igj l N -izgr.-Yfv,.l1,,.,.,. f-A' ---'-e'-- - X C338 as 'ff 4,2 SU Caduceus Editorial Committee, 1931-A Rose Jonas, Clzairmrm Sarah Adelstein Mildred Farrell Barbara Moody' Chester Cannon Page Une Hundrrd Eighty-lfwn Pearl Kemp Edwin Smith Francis Fagan Carl Nordgren Dorothy Walker X t i i 1i2ff ii3.Q. to to f' ' ' V fifilififi?5 f?!f'Xx. , jj W - if i' AAAMW ,,7g,i,j,i,Q,, ,,,,,. ,A -f44':Df:ix J' f ' . 'EVN' f -1f'1-iihif-E---3-4 Y. -.,1fAl1---,l----- ' ' W-fffh-1-,ff yzifzf -TLV :fy j- Y -- --X'-V-N -- ' A --'---H-'-W-'-H I 2,V N., ill- J, !,., X! .,:,ii'k-k1Vi1ii,..,. W,-E.,:lA.xs ggvgzi Wiyi. iigionrliiii ii ,il ii .N igl:.I5,iTAi X w i f ',j.1 - y ' - ., jx, X-f-i j Q , fd i' ,, l ,E injvwfi- i 1 , ,fl-X, , f Wpwj X3 KMA ,J,,i,i.g,, X ' Nm-' R14 1'i -M-f 1, -V . 4 gf i, Q., f' ,i, , :tl ,i ., i V i ian- Emil: l 1 :figfjxz - Y- -l--M --------mv f-A---hl----- 'fi' - --T? W ' 65 .: l VK., of Q!-U L. Q V Caduceus Editorial Committee, 1931-B H elen Potter Clmirnmn Olive Burgoyne hlziry Prendergast Katherine Cronin Rose Riley Esther Grogan Edgar VV. Rylander Abraham Plotkin Rita Scanlon Pnyr Um' Iiundrrd liigllly-tlirfz' ng-gxhl-M 'ls-.pfgka ,ff X5 , ,, ,, i '1,Lg, 4 -I-31, 61 111:-iggfjw' ' ff - f-- ,Y ,V ,fn .V-Y-V-K --ef' W W -- 'Q'-X if AEM . WJ- 7- 'Y r ,, J if ffifcf ixxi-1 --- ., ' rr'-fe -- wx--. J, , fr - ' ' ' ' H, 4-f 'Q2f ff14' :14 EQ'-TX-1fQ X' -QE M , Y , LI? ,.1?'5Ei'.,a:f1.Q'f-:fi T.: EQ.-f-fauna, E ' V , ,V mf ' ' 5 or . A , x 1 lfllhllillfm ls rd s TLT W' Q 1T31l::--- , Q:-3511:-F.1 , .,., .... . .H-..i VQNQ, f7 ' :L 3,0 M--www The French Club JEAN DUCHARME .. CECIL CREDIT DELIMA DUFOUR .... HELNIER STENQUIST ... .... .... I az'uIty Jdwisors Miss Elizabeth Craighead, Miss Miss Jenny Schofield Joseph Adele Eva Anttonen Olyvve Atherton Aphrodite Badjo Norah Baker MEMBERS George Bauer Mary Beals Marguerite Beaucais Madeline Bell Adele Bolafka Pagr One Hundred Eighty-four . . . . .. President . . . . Viff-President . . . . . Serretary . . Treasurer Ruth Snitzler Ida Dorothy Boorky Howard Braconier Anna Bushman Florence Buijnishi Olive Cahill L61 L- -1 --M XXX ii V4 ll ICU ill iff M' '-:A flfflif' iQfllf3,fE'57fif'll r if 'QQ L I a fKiiQ1'5-7'-T MXH V ply ' pi Ai I Wien' MEMBERS Edna Caldbeck Alice Carey Alberta Carlson John E. Carlson Helen Carrig Signe Christenson Elizabeth Clifford Frances Cohen Dorothy Covell Cecile Credit Walter Dahlstrom Irene Darche Ruth Davis Marjorie Denehy Kenneth DeRugh Rita Dion Frances Dodd Helen Donahue Valeda Donais Jean Ducharme Delima Dufour Irene Dumas June Dunleigh Carol Edelman Ethel Eckman Roland Erickson Anna Erlandson Louis Fagan Harriet Flynn Mary Flynn Rita Ford Mary Finney Aurore Frappier Rose Frappier Corrinne Frissora Ann Gagan Albert Goldman Anna Galulis Patricia Gannon William Garrepy Lillian Goff Rose Goldstein Anne Goyette Evelyn Gravlin Helen Haddad Lois Ham Louise Hamel Page Margarette Harootian Elsie Heber Harry Hilbert Betty Howe Gertrude Hickey Margaret Hoyen Linda Jaskari Elsie Johonson Charlotte Jeromie Edith Juneau Anna Juska Theresa Kalagher Irene Karolkieivecz Sarah Katz Eleanor Keough Gertrude King Muriel Kobell - Gladys Kosciak Maurice Krinsky Irene Lamothe Gertrude Larkin Estelle Lavallie Anna Leibman Sadie Leinovitz Florence L,Heurveux Germaine Leclerc Rose Levenson Eleanor Lindstrom Florence Loiselle Mabel Loughlin Shirley MacKinnon Mary Madden John Mara Martha McGarrell Rita McGrail A. Irene McGuinners Harriet Marsden Davis Marshall Madeline Marshall Paul Martin Helen Masterson Adele Maykel Anne Maykel Mary McDonough Elizabeth McManus Janet McPherson Helen Meade ' Corrinne lVIercier One Humlrrd Eighty-fire Dorothy Michelson Margaret Monney David Murrman Dorothea Nally Elsie Nilson Yngve Nordstrom Rachel O'Brien Helen O'Connor Margaret O,Connor Betty Pendleton Rafliella Quatela Mildred Rice Rose Riley Pauline Ritzel Marian Roberta Bertha Sack John Santoran Lucy Santora Nancy Shea Sylvia Sherman WVinifred Snell Stella Soucy Albert St. Germain Leo St. Germain lwartha Stafford Evelyn Stanbard Helmer Stenquist Marie Steun Hayes Sullivan Mary Tashjian Helen Thomas William Thomas Francis Trainer Evelyn Tremblay Eda Trippi Roland Vaclron Vincenza Vicalin Helen Walsh P Josephine Walsh lwary Waitlavich Frances West Sydney VVillios Isabelle Wolcott Helen Wrenn Nellie Woodman Ida Yarock Celia Zack Pierrino Zampatti Y-1-'SQOYR-4 ' L f,,f - 9 iagze ' ' Zs1!?23WV112V'f'l! '2AU!if 'IEQEEIEHVim'g '2llViE!2f2':'ii f'rw' 'f'1: irfi:'2 ffvw! 'aflwlq 5li TH WX! 1 Yr Stamp Club Page ,One Hundred Eighty-.fix W- jg ogy, -,-,f- fzfwfi, 'ssirli-- xx-m-R 'ffTif'IfIf..:Iff:.l.- ,.,.,,.,. ,.,.... . ..............,...w...,,... .. ,... ...,.,. V,-Xixfly. 7, ,1 L, gb ' ' MQ-vw Chemist Club Pagz' One Hundred Eighty-.rmJe11 J!! -4 5 -,fvlrktw ,I mm, , 11 we'r -1 rfpvrwjlfw in, 1::.r-:fqggvfFS -' --- f -- f s ' ' ' ' E256 Nuntii vifgini Faculty Advisors Miss Ruth Boyden Miss Grace Ellis Miss Grace Cheney MEMBERS Doris Anderson Russell Hemenway Jean Ducharme Ida Jacobson Mary Flynn Laura Jordan Ann Gagan Anna Kaskan Leo Glennon Janet McKearnan Gertrude Griff Ann Zukas Page One Hundrcd Eighty-eight ll Q fffiiilf f 1f: -- 1537, 'S'-.i 7,? f 'g-T:- '5 745- l XI QfyK:w z'l'f M,'ii3 Tf' i' ' v, lx, w1j1gl s'1jj L ful vf 1'v' xlizwmig 5'Xf,'?,7'V pf ga g g 2? 1 1 - - I 5-:E i ff? rg 9' A' if I 5 1 S :GN E ' 2 5 P, ' 7'-U 3 K I f 1 Win , l. I .11-. !. tl.,- . 'i- l ' L L I I E ... :B . Q :: l v Q 21' , L .1 5 r' -P' - : l .1 .. 1 in rex 1 W 'fm xx w'l 1 u s' fi I S? 5-,gg IWW HQ . X P .1 , 5 2417 2 5. E .. kd, ,4 2--- Il' ff 4 5 lil +7 l,,,,.. X 4 X wma!! f X W 24 ', 1 X75 ZW! X 7, ff X NR 1 x v lm Wm if 4 X J unqun in fx 1 72 A O aim T V Q . - Wg' -3'---- Q7 J so . High School of Commerce Lettermen, 1930 31 Name of Players Abodeely, Robert Ambrose, Wayne C Captain D Barnicle, John Barros, Russell Chaleki, Benjamin Chestney, Adolph Clark, John Cronan, William Debs, Abraham Flaherty, Robert Goslow, George Johnson, Chester Krinsky, Maurice Kubicki, Edward Lekesky, Benjamin Lepore, Arnold Maclntyre, Paul Ojerholm, Vincent Pakula, John Power, Edmond Rasimas, Alphonse FOOTBALL Position Letter Hwnrzled G'uard C Center and Quarterback C Halfback C Tackle and End C Fullback C Halfback C Tackle C End C Guard and Fullback C Guard C Tackle C End and Tackle C Center C Halfback C Center C Quarterback C Tackle C Halfback C Tackle and End C End C Guard C Page Om' Hundred Ninny , 0-xx - XT - Y J, W-H.,..,L--A-M-aff-5f2? r -49--L--X ' 1 ' 2+iW'lfi'2WE! '?'TTTZZ? 5Z2? i1 ' i '- . 1 S93 F ....,- W.L.,...,,., Rasmussen, Gordon Reynolds, Andrew Rogers, Thomas Sienkiewicz, Anthony Sinaskas, Joseph Trombowicz, Walter Urbec, John Wickwire, Everett Witko, Joseph Zarr, James Dunn, James Aslanian, Cecil Hobin, John Langevin, Gerald Chestney, Adolph Hobin, John Langevin, Gerald Langevin, Gerald Lekesky, Benjamin Chestney, Adolph Hobin, John Ojerholm, Vincent Ambrose, Wayne Burke, William Galena, Louis Goodwin, Alvin Gurlitz, Reuben Johnson, Chester Guard C Halfback C Quarterback C Center and Quarterback C Halfback C End C End C Guard C Tackle C Quarterback None CROSS COUNTRY HWY! Sakalowsky, Peter, Captain WCW Quist, Robert Swicklis, Peter Toloczko, Sigismund Zamanigian, Sooren INDOOR TRACK , Ranchynoski, Leon, Captain Nolan, Richard Nolle, Palmio Sakalowsky, Peter Sienkiewicz, Anthony OUTDOOR TRACK UW!! Nolan, Richard Ranchynoski, Leon, Captain Sieniuc, Francis HG!! Sienkiewicz, Anthony Slattery, John Sweeney, Henry BASKETBALL Guard W Forward C Forward W Guard W Guard W Center W Page One Hundred Ninety-one Powers, Thomas Center and Forward Rylander, Edgar Verick, Alfred Zarr, James fCz1ptainJ Krinsky, Maurice flllanagerb Forward Center and Guard Guard and Center BASEBALL Barnicle, John Pitcher Chaleki, Benjamin Pitcher Greece, Max First Base Krintzman, Henry Outfield Krusas, Alphonse Pitcher Lepore, Arnold Third Base Noone, John Outfield Reynolds, Andrew Outfield Ruffo, Joseph Outfield Sannella, Louis Utility Sullivan, Hayes Second Base Sullivan, James P. Catcher Sweeney, Carl CCaptainD Short-Stop Urber, John Catcher Zarr, James Pitcher and Infield Page One Hundred Ninety-lfwo qi as illQgM fell el i Q EEE E 29, Q2 0 H KC If None W or C ,, f f X-Qflsfrrffxi'-'V'--Q L, -V- Page Une Ilundred Ninfly-!ln'f'e' V 1 W Ei 1, s A 4, gg k 2125? F W3 afx ' Q ai U' ,Qi fix fr, E55 'V' X1 A Uv li fig! . 2 rm , ifg 5 gf? 1-Ti IX, Ulf .X f M FOOTBALL TEA 1930 ,201 L V, Inrr,.r'1.H,',.gHiiI,. ling yltnf hm!! swelflllvlllyrlrr, I'IvlllIV!!'IIIl5IHlI1II 'IlUlIIvI 1II'rv''IW -- I xxx lx ,W Football, 1930 Commerce O , Haverhill H. S. 19 Commerce 13 South H. S. O Commerce 0 Lawrence H. S. 13 Commerce O North H. S. 7 Commerce 0 Lowell H. S. 31 Commerce 0 Classical H. S. ' 18 Won l, Lost 5-Percent .l66--Scored 13 to Opp. S8 INTER-SCHOOL LEAGUE STANDING Won Tied Lost Points North Z 1 0 5 Classical 1 Z 0 4 Commerce 1 0 2 2 South 0 l 2 1 mf roo'r.a.fiLL W 5 -Q-lm -17 .4 . f 1 I I!!! . u . . N- -IQ- Page One Hundred Ninefy-four t .Cf ,,,C,--- , f .4---ef' ,X-ff , f' , 1 Xef' 1 . i 'e'-tx Sw - V fffjl' 11535 a ff .gigs i qw 1' X' 1 zgyyn-1'iwm:i--,ii1 fxv- ,f , 1 -1 - 5 PCD 3 ID fxfffvl 12 T- I :::g:': :,.::..,.: ,... 1 :i1i'.'i : '.'. .:ii1'1:1.7.'i . JSta7fEii..1..a...s ak, o v Track Team, 1930-31 INDOQR TRACK, 1930 1. Classical 45 2. Commerce 3292 3. North 22 -I-. South 712 State hleet Commerce fifth in a held of seventeen teams. OUTDQQR TRACK, 1931 1. Commerce +922 2. North 38 3. Classical 2514 -l-. South 15 NV. P. 1. Meet Commerce failed to score. N. H. U. llfleet ninth in a field of seventeen teams. Page Une llznldrrd Nirlftyeffw ,ff 12 S?f---x,s 1 1 i' Y , Qf 'f,f1f six Q , ffo age Cross Country Team, 1931 Points Scored in Inter-School Runs 1. North 188 2. Comm erce 151 3. Classical 69 -1. South 12 Myi flm Page Om- Hundred Ninfty-.fix m ll'- W' 'ww '1 'f :Tw '1l ' 'li m '1 'Q '4 N mf N ' m ' f'w '1'u3'1Tfiq - ff A X l C ANXv6?,ffX' 50 Boys Swimming Team Pugr' Om' Hundred Ninety-x ff X,'j' fi , f-,ff , I Q .,.kV ,V X Fgtilf K,-4253 -Q , A' A T:1'7:.pf'ZAf fig-:Q ,V fffifgz , ff F 1, ,'i -'- - .,,,, rfknei- -- . ,, .,,A 4, X f' 'M' ' 1 Lf ' ' 74,7 T . 3 -- -q X Q, . ,V . ef! LX we i Ti i . 1 . ss he f Q h 1 1- lr + 1 1 1 ,x , 1 , , l Q ---W -f-7 4 f---W A--ff -A-------W----..w.vf.-:z-:1:fyf 1i-Y7,7 , -f-ff-'-'-AA---A---- '-' --V-M f.ff ii..-......,.,c. ..... .-... ......... new ...,.,................ . m,,.....,, , -....N-1-V-T, Fc, .... , . any .AA,f 7 ie Gly? ff -, 41:56 J Baseball, l93l Carl Sweeney joe Ambrose Jacob Ohan Hayes Sullivan James Sullivan Henry Krintzman John Nlax Andy Noone Greece Reynolds John Urbec Benny Chelelci 4Alvin Krusas Henry Lepore John Barnicle Captain-Shor top Xlanager Nlascot Second Base Catcher Center Field Left Field First Base Right Field Third Base Pitcher Pitcher Third Base Pitcher Page Our Ilundrrd Ninrty-righl W L Qgx it fum he l ' Commerce 2 6 Millbury H. S. 4 4 Shrewsbury H. S. 1 K' 17 Clinton H. S. 8 8 South H. S. 5 4 St. Iohn's H. S, 3 8 Classical H. S. 2 13 North H. S. 6 4 Gardner H. S. 17 8 Orange H. S. 2 16 St. Peter's S. 12 16 South H. S. 4 6 Classical HIS. 8 gg t 5 North H. S. 4 3 31 S '.., srr' s sr. John's H. s. 9 Won 11, Lost 3, Per cent .785, ' Scored 123, By Opp. 85 INTER-scHooL LEAGUE STANDING ' Won Lost Points Commerce 5 1 10 Classical 4- ' 1 8 North 2 43 4 South 0 6 0 SCHEDULE April 22. Shrewsbury-at Shrewsbury 29. Woonsocket-at Woonsoclcet May 1. South-at Athletic Field 4. St. John's-at Oval 7. Classical-at Athletic Field 12. North-at Athletic Field 13. Gardner-at Gardner 16. Orange-at Orange 18. St. Peter's-at Wright Field 22. 29. Classical-at Athletic Field South-at Athletic Field June 2. North-at Athletic Field 5. St. John's-at Oval Page One Hundred Ninety-nine 5 , U C A 7 Q:-415. f'- f' 1 50 Pngr' Tun Iluf:LlrrJ BASKETBALL TEAM COMMERCE CHAMPIONSHIP 21 len Ga Nugy and Zarr, A1 Ve rick, Ed Rvlander Tonv Ambrose, Captain Right- 0 Left t uw, R First M E A J QE Min I I pi 'V li EQQ5 1x 4if yN fi s'Y1 A M E.QAA' fm EA NE f y A E 152 gi af 'B V I 1 Sw 1 t X wg A hnson, Jo , Chet nager M a C Krinsky urice Z1 M Goodwin, 2 z cu P f D-1 E c P' fx .:: U E U Q2 If .1 .: 2' 'U 1 2 3 c M E cr Q 0 va E O ix 7 F 7 Milli 'liilfiiili '5'1!li1 llliililim 1 lal Ji' if.llTf! la l llllilllll ' l Il liQrlil'glllEQlQl1l 'MQ lil 1 rl A51 . 1' acl 5- - Commerce 25 Rogers H. S. 42 Shrewsbury H. S ' 50 Oxford H. S. 41 Bartlett H. S. 37 Uxbridge H. S. 20 Woonsocket H. S 36 St. John's H. S. 54 Turners Falls H. S 21 Classical H. S. 28 North H. S. 31 WV. P. I. Seconds 59 South H. S. 37 Nashua H. S. 37 St. Peters H. S. 22 Classical H. S. 33 North H. S. Z7 St. John's H. S. 42 Lawrence H. S. 36 South H. S. 53 St. Peter's H. S. 46 Gardner H. S. Won 17, Lost 4, Per cent .809, Scored 777 to Opp. 48-1- INTER-SCHOOL LEAGUE STANDING Won Lost Points Commerce 1 Classical 1 South 4 North 6 Henry Lepore Max Greece Walter Trombowicz John Pacula Hayes Sullivan Wilfred Blum Walter Dahlstrom Bill Burke Irving Luharsky Right Forward Left Guard Left Forward Right Guard Right Guard Left Forward Left Guard Center Right Forward ' if ?f lS Page Tfwo Hundred One O ee fjfg- V - MU' 7 lf 1H1f!?ffSV'e ' ' ' f3?'f?f3 f 'fE14V 'fi ' 'WETTV 5 1 '5'f'F N wwf 'HIEQIE'???5I,E51,Wlf2EEU X ' 'T' 1 m '- I T sg? Ice Hockey Team Boys' Tennis Team Alvin Goodwin, Cnptnizz Seymour Cohen Thomas Powers Joseph Cohen Nlaurice Krinsky, flla zzfz yer Mr. Timothy Boyle, Cond: Page Two Hundred Two , !!X i -S a - V, I. ' ' XXJ ' llllllwdilll. llllilill llhfllllilii ,-:, f, ,..' T, 4' lg lr LMYXX Y 7, lk -- ' , W ........: C.....? : g: SEV Girls, Basketball Team VARSITY BASKETBALL Wednesday, February 11 North vs. Commerce North Classical vs. South Tie Thursday, February 19 North vs. Classical North Commerce vs. South Commerce Wednesday, March 2 North vs. Commerce North South vs. Classical Classical Thursday, March '6 North vs. Commerce North Classical vs. South Classical WVednesday, lllarch 11 Commerce vs. South Commerce North vs. Classical North Thursday, March 19 South vs. Classical Classical North vs. Commerce North PLAYERS Captain, Mary Anna Murphy V Manager, Mildred Cinsky Forwards: Anna Ambrose, Judith Goldberg, Beatrice Jastremsl-ra. Guards: Gladys Hill, Mary Murphy, Edith Butcher. Sub Forwards: Helen Smith, Mildred Cinsky, Helen Balakonis, Edith Grann, Ida Jeffrey, Mildred Shanocks. Sub Guards: Marian Brodeur, Myrtle Day, Catherine McSherry, Phyllis Stoliker, Florence Wray. CLASS BASKETBALL Freshmen: Sophomore: Commerce 10 Commerce North 0 North Classical 4 Classical South 10 South Junior: Senior: Commerce 12 Commerce North 6 North Classcial 2 Classical South 4 South Total School Scorer: Commerce 34 North 20 Clasical 22 South 20 Page Tfwo Hundrzd Three ,Olxi e , li X ' A if - CLASS BASKETBALL Class Winners Freshman Commerce Sophomore Commerce Junior Commerce Classical North and Classical CLASS BASKETBALL PLAYERS FRESHMEN Captain, Beatrice Jastremska, Forward Forward: Edith Grann. ' Center: Helen Balakonis. Guards: Myrtle Day, Mable Palm, Mary Burbank, Violet Pope, Frances Potashincki. Subs: Laura Kolodziejczak, Grace Lovering, lrene Temoczko, Marjorie Gould, Betty Brosnihan. SOPHOMORE Captain, Edith Butcher, Guard Forwards: Helen Smith, Mildred Shanocks, Ida Jeffrey, Aileen Crosby, Jessica Quill, Ruth Chelking, Alice Skinger. Guards: Marian Brodeur, Florence Wray, Gertrude Hickey, Beatrice Yanover, Catherine George. JUNIOR Captain, Mary Anna Murphy, Forward Forwards: Anna Ambrose, Helen Ross, Judith Goldberg, Helen Swift, Anna Pucilauskas. i Guards: Bergit Smedberg, Catherine McSherry, Phyllis Stoliker, Gladys Hill, Mary Hillery. Page Tfwo Hundred Four NERC a at 177 AAA. 9-H N U X '1 , l 1 l EJ il Ha 2, ' ,,j,..,,,,, J-W ':.g- r, if Girls' Hockey Team Beatrice Greene, Captain Mildred Cinsky, Hlazzager Edith Butcher Louise Butler Marian Brodeur Helen E. Carleon Merilda Dube Ethel Forsman Judith Goldberg Gladys Hill Mary Hillery Ada Johnson Jeanette lVIcKearnan Katherin lVIcSherry Florence Mee Maryf A. lVIurphy GIRLS' HOCKEY SQUAD Left full-back Center Right half-back Goal Sub. full-back Rt. inside Centre half Left inside Right wing Left half-back Sub. Center Sub. inside Sub. wing Left wing Left half-back Right full-back Page Taco Ilundrrd Fifve ' W'-M-I- O or FIELD HOCKEY SCHEDULE 1930 October 3, Friday Classical vs. Commerce-Tie ' North vs. South-South October 9, Thursday South vs. Commerce-Tie North vs. Classical--Classical October 17, Friday South vs. Classical-Classical i ' North vs. Commerce-Commerce November l0,- Monday North vs. South-Tie fljostponedl Classical vs. Commerce--Classical November 13 Thursday North vs. Classical--Classical Clzostponedl South vs. Commerce-South November 4 Tuesday North vs. Commerce-Commerce ' Claostponedl South vs. Classical-Classical SCORES Classical -11 Commerce - 6 South - 6 North -- l Page T-'wo Hundred Six uf t O Rt - rx , P-ian---uzqga-fE54' f'i'g-gifrrev l---Q-,I lim ?1'fl'VH'T1 l l lI1f1l'If3ffFlZ fl'2 : '1I!i'1g'!fi3!Ef'ZIr 'mil W's':'!::::'2 1 i':ir'+jyjfv yggiQi+f l I F i 'I Y V -imarivw W--W-W wnn- ---,,' i in-N -Y - -ma? vaf Girl's Tennis 1930 Won By May 18 Commerce Vs. North South vs. Classical lVIay 25 Commerce vs. Classical North Classical Classical South vs. North North June 2 Commerce vs. South South Classical vs. North Classical . ,,,,,, 7 H ,.,, ,I Hs- H WS - nf- I ' ' . . ' ' N' -fin Pagr Tfwo Ilundrfd Sefven - ggi? f f -. 1 1 Q 1 ! to G., G G A Criixfy ugh Girls' Varsity Hoop Team llflary Murphy CCaptainJ Edith Grann Helen Smith Phyllis Stoliker Mildred Sharrocks Catherine McSherry Judith Goldberg Nlildred Cinslcy Page Tlwo Hundred Eight lVIyrtle Day Helen Balkonis Marion Brodeur Ida Jeffery Anna Ambrose Gladys Hill Edith Butcher Florence Wrayf M Q Ylfijgiiiiiig if jlpf Y 1 11' fl, 4 ,M-i ff-izff-fi':g'f-V----'L H ' - ,. ,, J., , ,,, ,. XVGV- XG, V, , - , S . 'L-F 1'?'5L f?f aim I I SIS , SSSS liff P 'S f 5yEFIInT2+l+AV 221,94HWFl-H5'fir5Y'i?fWi l5 Q ww:VW-Am-H 4IHM.mE'i1Iziglwkailk:HWNEII Q .L ff 'mf' Z ..I.f.fJ Y .... MLM.. i. ,......TI'.lD C.1........ ......., IT ' 4- , ,,,. ,W ' ' COO GIRLS' SWIMMING TEAM W... W.. H.. BOYS' GOLF TEAM Page Tfwo 1IIlIIdl'E!1' Nine f , -f-2gVf5ef?'V! 'xfiixll-ff'gij-Qiig ff ff,., ,,,Qf--f W, Lil fi I E r M ' ' I ' fI fg-I-I-ww:-If X fr If I I , , ,XXI , 1 ' g- :IN IHWTNQ f 2 TL? X P' f H ' 'VLQQ' ' A fifiig . xg' ENVNIXN N.T.!1 xr !:,:,.,l M .. !,.T,i.E! XJIIQIIV XXIJ W Q1 ..L..J L.. :,! ,,,....,..g'4ggg1,..-.C.,g.T ,.,. , L Sing, . :i'fi.':.:'1:1......, l', -: --q:T::fNi. zgrgtz- ------- 5111 . , 3 li V1 , ws. I I ,ff ,V i H' C50 SOv,IT, 1931-A PHOTO COMMITTEE, 1931-A PHOTO COMMITTEE, 1931-B Cmss GIFT COMMITTEE, 1931-A LATIN PLAY W , 1 ' ADVERTISING COMMITTEE, 1931-A DECORATING COMMITTEE, 1931-A CLASS DAY COMMITTEE, 1931-A Page Tfwo Hundrfd Ten 3 'Q fQfli1?i 'lT5E fiiff-iff V Y g H W ' T +f,gi1-:- H T j N ' ' ' ,A.A A., ff-:.Q,,.f31 ',g,f ,Ei.g:7::-:Q 'iii 4Z2f?i+ig2fN3i3Q-'iw .,,, f 'Y- k, H--,, ,.1 -1f':- TL- Auagr- , f-'Xu - 'T' X. , 'V' ' 1 W1 ''W .fI,:f'.1ff'vv v'f '3+'f'7f ':!fJ. '1,, 1 T 11,1-5 ' 'Nff1l2Z'gX! T .V ' --f' -,XE , ,E Q Vfzlx- 'W ' Q M if -15 ,rx Q 1,1 ,lf-vvrrgl j-' I g,l5:fLg QQ f+.y1 l'429?',i'l2l'J AQITJQEVH ifjwlifl Ax Tv w 4 1 w,:w,,,'::',y 4, yu 5 1 :11,'.:,., T ' 1:.s:T.,1,,g:, 1v1,,- -':!1m '13, H' hifi'-' ,::.,..- W '- ,V ...T..g:: c.:.,A4,?f':,jg,1,,,.,.....:: ..,. ,. ,,,, I!! :i,gj1S?3Tf X'.'AT-,l- ':, -l-Tjxlcgfgtrgiz QL -K--ff:'II'::4 C-mx 5 7-U AnvERTT51Nc: CRTMMITTEE Cmss NIQTTO, 1931-A LATIN PLAY CLASS MOTTO, 1931-B Socur. COMMITTEE V Cl..-HSS DAY COMMITTEE, 1931-B DECORATING COMMITTEE, 1931-B Cmss CTIFT COMMTTTEE, 1931-B Page' Tfwo Hundred Eleven ,,- OA Kg -,If L Elllfllifiill l'i'l!'l lllwsfilf fIfr vffl if T:-QI I: T:li ini gb 1931-B Census Report Compiled By STEPHEN G. SAVAGE, ABRAHAM PLOTKIN,iAND ARTHUR ARGOFF For first mention the eyes have it. The browns and the blues were about even. Five admit green eyes, while one frail lassie has gray green. ' Height: The boys average 5 feet, 9.7 inches, while the lassies average but five feet, three and one-half inches. The shortest boy is 5 feet, 1 inch: the shortest girl. 4 feet, 4 inches. Age: Due to predominant influence of girls in '31-B, answers were unreliable. Suffice to say, however, that all the girls are about Sweet Sixteen. I Color of hair: Brown dominated in both sexes, while the blondes and black haired finished far behnid. Among the answers were redhead, ash blonde, H202 blonde, and navy dark brown. Political Party: The two major parties polled equally. The Know-Nothings carried one room, the Populists, and Prohibitionist secured two votes each and the Tories, Royalists, Socialists, and Communists but one. Favorite Actor-ress: Joan Crawford, and Robert Montgomery seem to have gained a monopoly on 31-B, these polling 100 out of a possible 200. Charles Farrell and Janet Gaynor followed, also ran: Greta Garbo, Buddy Rogers, and Leo Gar- repy. Favorite Poet: Edgar Guest was adjudged' favorite poet, with Milton, and Shakespeare close behind. ADoris Anderson received fourth place, preceding such im- mortals as Burns and Longfellow. Favorite Author: The following were the most popular: Zane Grey, Temple Bailey, Kathleen Norris, and Fannie Hurst. Others preferred the following: George Eliot, Nick Carter, and Walter Winchell. T Favorite Musician: Sylvia Sherman was overwhelmed by Rudy Vallee. Walter Damrosch, and Paderewski were also listed. Favorite Pastime: Swimming overwhelmingly headed the list. Second choice Was tennis, while basketball, dancing, and skating tied for third. Scoring some votes were such: Ping-pong, marbles, tiddlywinks. Favorite Magazine: True Detective Story, and True Story Mags,' polled 79 votes, beating Saturday Evening Post, which came third. A few selected College Humor, Popular Mechanics, Boys' Life, Liberty, and Colliers. Most Popular Boy: Tom Powers, '31-B prexy, received first place, followed by Russ Hemenway, and Stephen Savage. Also nominated Were: Walt Coakley, 'fHerb Edman, and Wayne Ambrose. Most Popular Girl: Anne Gagan walked away with premier honors, trailed by Linnea Stenman. I am, anonymous, was also a popular answer. Best Students: Russell Hemenway, and Stephen G. Savage finished closely, 4'Russ winning by two votes. Doris Anderson outdistanced several other girls, among whom were Linnea Stenman, and Anne G-agan. Noisiest, Quietest: Irving Jacobson was awarded the title of 'fGreat Gabbou without much competition. Chet Casperson, handicapped by a cold, copped second place. And for the other extreme, Doris Anderson received first place, the only corn- petition being offered by Alice Donaldson. Page Tfwb Hundred Tfwelwe ,OR ,,,,,,'- AT -- - v ' '1'f' if W . .4...Q:N,,+14 -----W ., ' L ' L . Q X' C7 i fi. H E i f ww f? Q L w w V ' ,W , 3 y f A AMW ? 'Q W Q mm fgi 'M Ma xx , i x . ,jf 7 2 'K xygg . 0- ,. -Ff h ,L....,f'ff' ' f KW I My III A P 2' JA - ' ax!!-4.4 A in 77,,,,.f2-Q,m1.,,a.,L.,,., , . MWf' l emi f V Q 0 I W ',e fe I fr . ,f-4 f . . 0 Z my ?2ff,Q Qa g g Zag- ' Xifw zffzuzffl., Jw? mwfffffiw Xfagwxfxvwk? im WMM ww-SEZ ' Mffgigggmiml fwfwf I F Q 0, A f Vfwmm I Vmwl 1913! fb LL ' t A,...:.,.. K .g,f1r4-04' QAM 4514! fggymm WM KH f ,1fw4f1CM1f JFK-w14GQw-7ff' HAM, ZW My mfg zz-153 - ?mgW,4,Jw4y www ' ' X' L , Y A, - 1 0 V Q P TH!dTl 0 M as X QZETV of Wie MM'-Q QM? W QF-ad cf' H J M04 ' . dm W, ' Egflfi ggi V4 gwqfix. 42. 7 EW f SEMM WG' ' 5 ww My f dj ffm Zffffi' ?ifW2 Qmfw mpggqgpy M T, f ffm, Www. ' ,ezjjw Gif Wpw gN 5 q f,jjf4?7'jf':,,'V Qgwaffk-fa, P91' Hddl , Ji N I 1 Y.. YL GWZQTU - W ' Q4 ' -fax-my Qkxw fwfw ffwfwf Zwfiwplfm ,ZM4 www, al1Tf 'f4.fZL lfjjv 0'74f,,M7f '4 j?f 4'f'- rw RQ-44141 MW 976.-f....:.. -1 .' law! K l L,f4a4A4...f4 , Qffgl, M Sipifzi W 2g,Q.Wf2 Z?L ?ff.ff,fg 73' Nga. dnb! . 'numb 66f'f 4DCvf'f5Q L '74 Mg, 4 ,f4.,,.ff,f,- JAM 3Z fWfN'?Qw7'w'1 n,,5,w ,iwgwjgfedw 4'-f-f fi' A1wx.Y..QJ,.,L.,.. - - 4? 5. Z , f,,,go1u,AU . . Wg,f-aw WQMMQ m-JM.-. OJ.-.4-. X f - ' ' u?0g3pg5+ MLM Aga ' , Glwaoivff VZ, io-MWQ-DnA,4,, P ge Taco Hundred Fifteen M M n W S . m my W It nw M U M W G .H W e S M Q W W IG M W e in W A v V .m W IG N M A ?Q7cfN5?f1-zfbgS?Q-,1?Q2.O::'3Q7cfFNSG::4'9GN'Q7:?9 FD Q Z3 3 P' Q E . 4 P' f li 4: S 2- 2 fn CD li 5 1 fb Q ,.i ff 8 :i :' PU , 3 cn '- PU pg 2 E. S, Q ,w 5 E' c: N L. -E 5. 5 2- w ' r-r vu sa , N Q 3 Ei- F-I ff rn 3 5 S :- 3 Q M If: 5 r-- ,1 W m cn Q- St Q O nj :: C 5 N V' US- Qi' 3 20 E 123 C Q cn S 'E' E' OS ' M 3 w ,sg E 3 -3 f CID 2 De QL ' 5' m pg Q. 1 w Q 2 9 0 E. 3 :D E 2 2 if H 2 Cf. 'U 'U : :J L-rj 3' :s 2. De Z C H FU 'ff o E 'QJJFR ' ell 5 K' MANY COMMERCE GRADUATES 2 S5 have found a Becker Training E - in ' SECRETARIAL SCIENCE ACCOUNTANCY Q5 BUSINESS ADMINISTRATIOQN ' or FINANCE Q To be a direct route to a good business position. 55 The upturn in business is bound to create many desirable openings for young Q men and women who are capable of filling them. GNQvs x9 Send for new descriptive catalogue at -l-5th year. I 5 5 5 ia 9 I is Q 3 li 22 il J I Q I, .I Q Q Q QQ BECKER'S COLLEGE Founded in 1887 98 Front St. Dial 3-2987 Q Q fl Q Ll Q Q Q 2 Q5 2 2 El Q Q 2 GNQM QQ be ei Qs Q Fel Fe' es fs 35. Q 2 Us ?4Q7s6:4 kJ5Qx:9 J In later life when you will read T Z3 and reread this T r e a s u r e E K, Book of fond memories, S Q remember that Q THE s'Q'oEEs PRESS 2 'l was instrumental in making E this Aftermath a treasure hold Q7 S of p 1 e a s a nt reminiscences. T Q7:GNb16::'fQ7:QnfN Qt, SERVICE PRINTERS Q Q PUBLISHERS GRAVURE 2 .D 'D KD , 52 Q it SC G34iaQ:99Q.w99'4D:J54i:J5Q:J3:s9G::9KDN9VQzw:95Qe5Qk:95.67Qzf:95'Q:J9QG A POSITION WITH GOOD PAY Good Fooa' is an Aid to Success in Life 5 A few weeks with Fairchild will put E you in touch with the best and add dollars to your pay. 5 Summer Session Q, opens JULY 13 J Offffflhfbfff0PP0ff11'1ffifff is the Hnest flavored and most Ka for dfffifly Plflfffl wholesome loaf that can he 5 I baked. Kr FAIRCHILD OFFICE SCHOOL Served at all school lunch counters. Central Building 332 Main Street . Q vvorcester, Mass. Worcester Baking Co. THE E OLIVER-PLANTE C0 1Pll m'5 S STUDIOS Of 393 Main street A an VVorcester, Massachusetts 5 Clan Pirlurrx a Sprrialty K, SHOE CLEANING Sl DYEING 5 DEPARTMENT 13 Trumbull St. ' DENHOLM Sc MCKAY Co. VVe carry a large selection of Fur B t 5 Coats and Neckpieces. asemen Q All kinds of Furs Repaired and Complimenfj 5 Remodeled at Low Prices. Of Dial 5-4630 Worcester, Mass. A. TZQULIQS Mgr. or K 2 fl T 2 2 '52 In I I 3 I In E E 'D T I T I T ggi. G RQVMQQ 6 xiii JKT. GRJVQQVENQBQ C9 Q Fedex J J. Chester Bushong f 11.4 to PORTRAIT PHOTOGRAPHER Photographer to the Class of IQ3I Studio, 311 Main Street Worcester, Mass. GMD VWJQ 354:03 NDSQQVQD ,ab 545655 KENQ 59 VQQVQQ QFD QQ VQNWQQ 5 QNQ Q5 Q 9 Q JJ Q J Q 9 Q 9 Q 9 Q J Q J Q 9 Q Q5 Q 9 Q WORCESTER TELEGRAM THE EVENING GAZETTE SUNDAY TELEGRAM RADIO STATION WTAG Bryant-Stratton College of Business Administration Founded 1863 Providence, R. I. QA Business and Student Centerj First college of business adminis- tration in America, chartered by a State to confer bachelor degrees for two-year courses in Busi- ness Administralion-Accountancy, Economics, Finance, Executive- Secretarial, Teacher- Training. Co-ed. Social Activities, Athletics, Dormitory accommodations. Expert Placement Service. Over 1200 calls a year from leading business men. Graduates earn preferred positions. 68th Yearbook on request Address Director of Admissions Bryant - Stratton College Providence, R. I. Take the Post Road to S144-1-fu POST7S INSTITUTE Of Accountancy, Business Admin istration and Secretarial Practice. -P76 Main Street C. B. Post, Prin rifml T Q K Q K Q in 'Q K' 'E K' 'E I 2 CE K' L2 Q' 'Q T 52 K Q K 'E K' Q in 5gDzs:99Qe'fi :QQ Lb J G BUY OR RENT A NEW REMINGTON PORTABLE QAFQQVQ 'QMDSQ Ka Very Easy Terms - Q J f VTE' Q KU JOHN A. X 5 Q 119, -- i.: ' Sb FARNUM, Inc. f ' ' K Q A gl Sb Vvorcester, Mass. N' ' 7' E Q Dial +-6347 1- Q 5 cj Compliments of lj 32 5 YUM COW EUGENE FRANK GRAY Q K2 Info Its Ofwn Photographer sb in the Fashion Shops STUDIOS Q Q for Juniors and Girls Q N V Q at Denholmis -I-76 Main bt., Worcester b M lb Q Fitch ur . 5 Fashions specially designed ar on g Q for vibrant youth. 2 Thfy're snmrt! TlI6j',fF iillIl'i'Z'il1lll!lI.l 35 And they're not expensive E -third floor- 0 U R ' UU Q-4 T' Q' CD U3 TU P DENHOLM SL NICKAY CO. KARL FRANK Q Ladies' and Gents' Fine Tailoring Q5 . ll Q Dml 54592 275 Grafton Street Q 56 Salem St. VVorcester, Mass. Q Q gl Q Q Q Q Q Q Q Q Q Q Q cl Q 9 Q Q Q J Q Q Q 9 Q Q .ll C92 G3632346249?Qy?bs?T2Q7s?2S,?fQa?fbs62fS,?Qm?fb4?fQA?fbc67NQAG .5 Q V THE q Tbe pews! S 55 lomle jir that prom . . . SC' 67:4 E my nv E O uv 2 'U :cn H CD CD R9 Q THE SILVER-NILE ROOM 5 v 1 V THE S PRINT ERS and COLONIAL DINING ROOM 2 PUBLISHERS KJ THE CRYSTAL BALLROOM 9 A Lots of Free Parking Space' S Austin and High Streets A Q VVOrcester THE AURORA HOTEL Primers of The Merczlry' 654 Main Street J SF Q Q 9 E S A WORCESTER TELEGRAM Q 3 Q THE EVENING GAZETTE QC FU D2 E O U1 H D' E2 O Z E E D2 Z CD U DP 'Q' H LT! F' ffl CD PU E S QUALI THOSE ENGIIAVIN G CO. ENGRAVERS FORQ SCHOOL AND COLLEGE PUBLICATIONS sonmncsm STREET - woncEs'rEn,,MAss 3 Ei 13 M 5 S L! Q Q 5 S 5 5 Q 'E F ,1 It