Whitman College - Waiilatpu Yearbook (Walla Walla, WA)
- Class of 1929
Page 1 of 181
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 181 of the 1929 volume:
“
Wx ,E J?-wg Milli: 6 nc mums k ' I I ,, W Ei .12 - filyf-.4 If ' XWN '15 .V Q . Y, J J' is 1,5 'I f rife 1 - -is ' EE- 9' 793-if V L t, N fi ' ,IZ 3. sf' if ' Qu 620 ' A Sgutif, ,. Jeff 6203 Phinney Aves. N. Seattiee, Wash. S-EhE3103' SU. 2-4656 . ' J. J3. ' Che waiilarpu VOL. XVII 'Published bg the Class of 1929 whitman College at WALLIS VVALLA, XVASI-IINGTON Copyright 1928 by BERNARD MOLOHON Edilfm' VVALTE11 L. ZFRY, Business Manager' Foreword An annual is usually nothing more than a catalogue of events covering the school year, filled with memories dear to all who have helped make that record possible. It is hoped that this annual will prove to be more than a register of one yearls hap- penings. For the sake of those to whom it is dedicated, we have endeavored to picture events of not only one year, but of all years, in the history of VVl1itrnan. -The Class of 1929. III ACKNOWLEDGMENT .. 1--. , 'A Miillin STUDIO, VVALLA NVALLA Sroxgxn A,B'LERIQAN ENGRAVING COMPANY, SPOKALI- S. K. SNIITII COMPANY, CI-IICAGO INI,ANIli'PiiIR'li:ING CODIPANY, WALI,A XVALLA NVI11'rM-AN IXLUBLNI' Assocxmubx - JOHNSON 8 S0N,4 BCISE -VI THE REFLECTED SI-IADONV OF MEMORIAL TOXVER BELIES ACTIVITY NVITII APPARENT CALM. AGAIN IVE HEAR THE BELL REMINDING US OF TI-IE FAMILIAR IVHITMAN HOURS. VII W. ,K 3 1 'Q' ' N A., H., - . 7.5.4 w ' c fn. -A 4 I' f , .... ,. x n .-.ws x ' -1 :.+ 1.--1:4 A: :-:-g-1 '--1 'wk -'ws yi.-:Q rilz-:-ru ' 1-5 Lg 551 .,i Q. . H. X I 1 2... . , X I ,--, . x--, ,,-, 1 . .:. bg.. ,g 4 A . OVER Tl-IE XVHISPERING IVATERS BEND XVI-IITE-BARKED TREES AND ON THOSE BRANCI-IES SOMETIMES, LIKE A GREAT FRUIT, HANGS TI-IE YELLOW'-COLORED MOON. , R . If-.1-1-ya:-1' A qg'gw:fae-vcr. , - 4 1 ff, ,i.:.- . I -:QI FL! mi art I ' Q, .219-.,V 2118 . ' -f X 51,1 f.:g,.,.,g:9 .r I V, 4:1w.,:Q-mga, . ,,,.g -ff Q + ' ' 'Q' I0 ns . fri 'CR ' 'P - diukkii' X QV I QQ, . '-. IMI' , s 5 .xx-' '3 1 . A. N I J VIII mg.-.: 11-:vw or-1-:vz . in-.if -,-1:5 .-as J' A Q- :4g.,:-: I ., . P 1 J ng: .:. :-. 1-:Q .9 3:-1: -4 .-1 ' , ,X ' ' flflisbg Q A GREAT GREY DOOR OPENING BETXVEEN MASSES OF GLOXVING GREEN-VIVID GREEN OF SHRUIZBERY AGAINST BRICIij THE FRONT OF LYMAN HOUSE .X-5f.::e:f.azmvQQ: ,. 3:1--V, , A W, a,egs5wr::u5-: , 2:4 S' ' Q- .-H, 3. 111 3, L ,gs Y' ' - - M f X- - 1. .-N-.-, .-.':: -' .X by - -My ' .f,f5+.cxm,3,- V H ' fc -.f .. . 7-1 V7 ' ff' L 1--ex Q. 7 V, , WM. Q S, Yr. ' - .-lk -V -ff' -- LA V IX M, ,,,O ,A L x 1 VIICXVICD THROUGII A CLOUD OF T1-IIN FOLIAGIC, LYMAN HOUSE STANDS EVER READY 'I'0 NVELCOME XVI-IITMAN MEN , X . v z ,..-,.....i,i.,...gA,, ..,s. Q.Ti. S' I? I Y :tilt vm -,N 5. '+A G 1 5 Q C 1 a , ZX I Q sf---if A fgswix ,Q . .wg r 31 2' 4 .IA 'lk' ,i Q-It .4 Y ' s . ,X -X363 Ls?-I 'Q ' A ' 1-.,, QPVWQ 5' Jw ff diff ,QQ lsvswk VQ ' + BILLINGS HALL, ONE OF THE OLDEST STRUCTURES ON THE CAMPUS, STANDS A MONUMENT T0 SCIENTIFIC RESEARCH ,111 zrrrmmng -1-my Q. 5 4 I . 1 Q A K -- , , , I-1-csv: . 'fy , XI x X 'a 'QL' , .Ar 4c .oymyf . , , , aw.-.. .. , A fk.:f xr, 2125-Li' , 3 A .... ,K O '-215525 .Exp g X e ww 1r1ki?R f J'SiiT?E-, 45' W15i3?!.,1' '5'xf'l2f 'f5Z3'7'31m I . 33-323 - .:Q:. -pw ,F 'zgfk vw Xa 1-f-1-.fc mum-,Q-yix MBE, vzpi N.-1:4-.A eww. -. ,, .... 4 ., . . 'vw ' 6 ,-: vi: :-N:-5-'r '-.IA 53213: 1,- 1 T '5:5:':f 1,1512-I 2:1 ' K xv---1 Y -. , :bfi-I :Ig ' WEEE: fp:-1+ TE, Yiff-f:' X I., 355.5 133:31 5 '44 fr:--:f 1-:g-Q., W.,-:p my 1:55 f mfg mzfrqm 2513+ gy-:E 21:-5 45753 mfg l-'fm 2:2551 2'--2: :: A: A., 365:-X :Q-qw me-a :aw P31136 Tak. S5115 125352 YQ. Qfkgg, 453554513 Wax.. Leis, ,-W,-:af www if 5 ,, Q .w ERECTED 3 f si I sf lik, Rf -552-1 f? 5 TI-IIS STRONG DOOR SYM BO IfIZ ES TI-IE SPIRIT OF NAI-ICISSA PRENTISS T0 'WHOSE MEMORY IT KVAS i??7?7f?mPf5WQ 4 E: - . , - V. K , .,,,.. N Wwgl, , H I , 'ij .2514 igfwrmw M A Lv nj 6:4 5 A , ' -' - ' ' x .1 5 if 242343 QF ' my v f I 5 y f iff 5 fezif frlsvk 5:-swxsf.E-ins-am'-:4:f ' cazwx mfs- -kQf.L1.J XII g,:p:w:wx-zzf-:gg OL, f. .fl S Llrfffiarrr-ffsarzavr ,gy K -. ' M3 X, . Mt. nw -1: my 4 Y, , fQ:':1E:- N X -:. : 1' ' 1 4. K .4 , 1:-11 4 1. ,I fr .rr C, .- ,V-w 1 AS TI-IE OLD STONE BRIDGE SPANS THE FLOIVING STREAM, SO DO THE MEMORIES OF COLLEGE DAYS SPAN OUR LIVES :,., e VY, ,C K X 3.4.5 XIII - V . ivtufe- L Q, PM V I FI, Y. I,,.,y-.., ,344 5, -V-5. I,-,f.I.I'V, I1 I 14.5 5 V , I. 51, ,T-'ggi ' ' ' ' w '1 ' V f'?f III I, -u 557i ' -V: W I , ' V . I ,:,1v,j.yL u If. rf Ezefaziw 4 ' -V . 5-- 3513 . I V- - - wi -.-. A. --f emi' - V, V :. . 'P1v3r'uQ' E, V V' ?5E Ya. - . ..-1,,Jm. 1 f 211: --nf, ' 2 f . 1 M Ifal, Q,-j-f V- ,Iv , 115.125, 91 V. ' Tl. SJ-,Iji ,IW 1. , fzigd. 'b'-, - ,I -.--,-2 5 gy, gr, -If -. , I - 1 ' miqa- ,I l'f i' 1 1,1 I , .. .,.,g-1,5-, AY 1 n ., ' lIuL,,',uI .-C. ' , - . .F . M 1 '-g ,' ,. ' V V ' V ,-'Iqfg ' fi' L Q' F9 9 1 L ' ' VM' 'I Q5 fl V: IEILJVVTVIF . In I I II H - I .' ,. ' JLQ-.sg 11-3411113 , 1, F ' -, E wi' '5giffQ,fGiz3, AV -av - ,VV - ' VV ' , A A 'gk -VQVV J ' , -JT, 'qi +- fu, F, 5 f . - V ,J - '-' 1' ' V' Z'7',f.? 7' 5 1' f V' - lixl 4 1 Nu . V' ,V ,TS 4' II A II W I I I ,, I I, 1 ,.- fkgfe- ng - V I . ' 1 ' , ' V V ' 2' -- V, - I .- . '-xf1q1fq .3 '. L .1 . 1 A 1' fi K A. I 1 . , , ' K' ' ' V - K- 5' , ,, I -L' ' 1 V- V V V ' al A . II I I QI I ,I.I, V I- :III . v ps-J X '11 1 . I , , L: ' L 'ul vii V Lil, 3'-H ,. ' V Q' J V+, H' 5, 5 - :V I f , I . , , . ' ' WV.-Vw,-.X 5 1, V I V leaf , if ' - V- . W., V' A.--VV:' f 4 -'Emi 'fr41'e.zH3 ZtYQe 'wivrtiehfmvv ,V 7 1V'1i5'1-V'. l 51- V Q. . fl , 1 V f' ' L LH- ' -' ' ' 41 ' V 4 1 - Vfp,.1fQp:Q1z'f AJ' ' 1 -.. 3 '. 1' ' 'x I. II I I I . , L ' Vt 1V 1V 5 2:2 I: V E' lf N - -I X :Q 5 Ag-,il-c' , I II V1 A I , I fi A IIII . ., I II, IIIII I , ' V? 111951.-. V W Q -45 , II A I -V , ' ' . A mil - ' ? 'f,i, 4 .I III? . 35' 1 II, , , III - ' -' . . V+ , :np .V L: N454 .1 l ' yn Xb , III h :Ei'LNf'f-li' I: ! 1 Vae1.fnf4rf,-,ml V . 5 ,V X , 'aE' ' '11 ' ' J II I :. . I . ,, I ,W 5-5513, I'III fl' .3 'rf 'I ' V - v .'BV,-:Wir MVII II4II7VI,5 V I I I IIJQ I III EMI 'Wi' -- ,- V. 4 , , -- T715 mg? ' ' II '. ,ITFY V III . , .. II IIIII,?W,IIII3I,II,I '---. ., , 1, ., we ,J P32-1:4 V ' uf if ' 1:-.' H 2 .,' ' V 'b 1 -' V1-K 7 , , ' r I9If ' , P 'Z ! n WWII II'w 'QT w 1, QV V ' 4 , , VV ,V , V 3,41 1 ' ' . 55 '15 , ' ' 1 'Ml V -- 1 -. E: ' I ,, ' I 'Iwi 'Ir I ' ' ' I 'QI I - - IIQNII I.II I'I I , I , 5I,1II3III II LII up , ,l, :I II ,I QI I II IIIIII ,III I II I II II I I Ziff f Wi 1 ' n A W ' V I :' 1 I ' . 1 - ash L. 'MF' '14',f.l' ' K, Iii' -.j :Q .-U. K-.,. ,iffh Tia- V K H . ' ,QL Lf? S 1 i 'WW f WHS W aj, 3 li 'X I 0 jx 15-7 'LLl.MLl. 'T:17, A ' 9 6 k Qgjffiwi-A V21 YC 1 I 5 - I 'j ' I ' .'., 1 A , kv b P , , , ' r 'Jill ' r V 7 A J ' ' Q '1 A. - Luffy . ' ' A 5 31' : Q ,jk , ..:, ' 1' . Q V 1 . A ' ' .,,.f ,. 31.3 . 1 1 - ,,,. ' , f,-- - afar. NK . X. . ,.., . x ' - 1, ,ty ' ' ' P V gm figy 3L::,,,lL I X If - , V A . ui- L-'gf'-,. infix ' ,cus ' - ' A it .s- -1 I2 ,. f. ,y .11 1 ' f f . , 1 1, .:f-:vm- :va-:-rrxx-p vw- jlmaht X-Iigglgw, ,-www qigiv, is -.,-Q-f:l ,.,w mm my A .1 .. 5255555351 1 A lfffl ' :ee 1.5.15 -.151 if l7QI5iQy '15-45279, 5: F3115 KW! 5:1315 1 fkfrtv F212 ff' i 'A ii' We ,N f -.55 Fixer. ,P 2555-fiiiiif f . oard of Deans Z5-TES 21525: .x , f S'l'EP1iEN BElXSLEX' LINNAHD Pmuxosm Ax - 1 . A.B., xv1lllZl.1TlS, 18854 D.D., 19054 L.L.D., 19194 B.D., Yule, 18904 5 D.D., Ripon College, 1902. Presiclent, and C-ushiing Eels Pro- fessor of Philosophy. . XXVALTER ANDRENY BRATTON A.l5., NVillizuns, 18955 University .E of Berlin, 1903-41. Q , Aleivancler Jay Anclersorz. Profes- .vor of Matlz.emat'ics. RJUTII ELEANOR xxrENS'l'll0BI A.B., Carlton, 1918. - ' Dean- of Women. f XVILLIADI RACES DAX'IS 21.15, Ripon College, 19014 A.M., Hzirvarcl, 1910. Diary A. Denny Professor of Englisli. P IEDXVARD :ERNEST 1?-UBY A.l3., Indiana, 1897g A.M., 1901. Clement Biddle Penrose Profes- sor' of Latin. f'Absent on leave. ,, 45 if Exam-4: a-FT L72 ,Q - 5 . :fi -- Elif 'X 525 1 3-5:-,uae E ff gi rf? .ff-'Wx if 1, 'Q,QE 5f':?57:f?K'Q . r-1-, is-' - -,f to' ,gj.,,.-.Wig 2 .' -' , 'f 0 , -W-.Wmeemmfw-9-me rf, g ,x ' 165: 5-z-f :gm ,- - Q- ' ' ff 4 ' ' ff lil 523' QMQSLQTZQI W MJ '-Six QQQCFG7-'f ,P '5 f1C NG1fR1 ,351 cw- y.?-.7--,--.V-W : . - Y g ig- J U' 9, , -if WI, ' if , x 1 ,xv,,4-,,f'f,,.--':,L,.o,A. f . ' :QV fucvmezk F- ff,-4' w L42'1 f f 1 . 45 if .r A 3 . GQ, v +3-1: . . ....1,.,,,..-:,,:1 ..z, - . -N -2 nf.-N .- .e , , if. V I - -H f ,. f L-. n ' .. :ww f' firm. xi, -'14 ' V..-,W.,M.g.Xi,Qqgr1 pg-'ypgfgwsmuezeffmnf:f,M-:H ....4,mw, 'fi---. 'E-.-.Til 1 ' si 1 , 1 'T Tix. ,A if . ,f 4 fi .. f i z 7, Y A i ' 55 -, rl' . 2. f 4 Wt. ,.,, 6' -:fn ..,.:.e,,, ' L ': 1 Y. 11- .L S , -,.,ii.,. . ...w.,e.ei, We.-. , . N...-, .... ,,..V..-.,i.,,,,.,, ,.,,. Page One Whitman College Facultg CELI T. ALI,EN D.D., XVl1l'CWO1'tll, 1921. IVeyerha,e'user Professor of Biblical Literature. 'LoUIs FRANCIS ANIJEIISOL' A.B.,VTHSl1lHgtOH, 18823 A.M., 18853 L.H.D., VVlIitInz1n, 1922. Professor of Greek. DORO'FI'I1' A1'I'1,EG1kTIC B.S., Xvllltlllllll, 19241. Instructor 'in llIr1H1.en1afi1's. NVILLIABI :EARL BIQEM A.B., Illinois, 19244. Instructor in Public Speulning Debate. aufl RUsSIcI.I. BLANKENSIIIII A.B., Missouri, 19111-. Assistant Professor of English. XVII,i.IAnI I-Iunsox 13I.I:AIcN1sY A.B., Grove City College, 1894'g PHD., 1904. Professor of Greek. NIIGNON K. Bonnizsicn Instrizwtor of Physical Ecluocctiion for Ufomen. NBINCENT R.. BoIxI,I:sKI: ILS., xVllltIll2l,Tl, 19104 L.L.B., Ore- gon, 191111. Director of Plzysir'n.l Ilcliuocnfion. l'lowIxRn S'l'l'IDlIAN 131101712 S.B. and P1-LID., Chicago, 1896. Sjzeoioer F. Baird Professor of Bi. ology. BIQNJAIIIN HARRISON BROWN A.B., Ripon Collegeg A.M. Nmilzariiel Shipman. Professor of Physics. I-LIIIRIIIT LULU CAIISTENSEN A.B., Penn College, 19023 A.M. 1903 15.L.S., bV11Sl11l1gtOI1, 1915. Libraricm. 1:1nI'I'Ifr lVlI5Iuu1,1, DAVIS A.B., Ripon, 1901. Asslistant Professor of English. +Lea.ve of absen ce. aye Two PWRA Roo R EG F RA Lizo JAM NCIS DII:1zoI,n A.B., Wlisconsin, 19214 M.A., 1927. 171-Slf'l lL6f0'l' 'in Biology. 1-IIINIIY MATIKAN :ELLER A.B., Nebraska, 19255 A.M., Har- vard 1926. Instructor in Lativi.. ER FOLGATE A.B., Lake Forest, 1925. Iusfrfu-rrlo'r of Physiml Ezlmfutiozz for Men.. INALD J'AnIIss GREEN B.S., Vlfzrsliingtoii University, 192114 A.M., 1925. I-nstructo-r Ein Economics and Busi- ness. NI: LOYAI. I-I.-IIGII 5 A.B., Ripon College, 19085 PII.D., Yule, 1912. Professor of ClIo'misM'y. CI-IANnI.I:II I'IU-BQIPIIRICY I D I BS., Montana':SHaite'Cbllege, 1919. Assistant Professor' of 'C'lzemist'ry. MELIIIN CLAY JACOBS A.B, Ursinus, 1915g A.M., Prince- ton, 1914-5 HD., Princeton Theologi- cal Seminary, 1915. Prifessor of History. Izs AI,IzxAxIm1':II IKIGRNS A.l3., Michigan, 19164 A.M., 1917. Assfsfcm-6 Professor of Lfativi. RAY MON n LLOYD I ,AP1-IAHI A.B., Reed, 19194 A.M., Oregon, 1926. Instructor in E'IZfglI:S71.. Hmusiciu' RIcYNoI,1vs I1ASLE'1'T VVIL A.B., Kansas, 1918g A.M., Stanford PILD., 1926. 7 Professor of Psychology and Edu. mbion. 1.I.xnI Ezmciisi. IIEONARU P1I.B., Grinnell, 1899g A.M., VVis- consin, 1922. I Hollow, Parker Professor of Eco. onomics and Business. CCOI'1tl11llCCl. on page 40 x mace' xs- Q 53 A Sf- 13 'G-L '7 ' ' A 1-Y 1 - -1 - C2952 F5125 alfa -12? 33:58 S5421 V M ' ' -5 ','T3S f P2 -1 A ...gf - aw . , - be 4 fi Jw -A Q.-.59 1 , I, 1 ff . - '- gl -. i A .QF 24922 if A3253 gf grail 2 X I Y ., fr, , Q3 97,7 ,A ,. nw , . -qi 8 J L.: 3.31 Ek X ,if-Eg .3.5k:-35330 E Jig, A N . H 1 ' C' WT: . ' 'E ' WGS: fi ' v fflvfrs' 'f ' 1 .- 1 'sg g F C me W , -gvdiwww - : 1 ,wa A me Em '2:fa1f,,.ff lim' nu fi ..'1,3, wi 1: ' M: -A ,X-if RV: Q1f,'vf'?Z .3 ,, ws Q' QS ii.-..I-N-A ' si V . .Af 4 yd ,gg V P.-Q31 N 3 Z3 -2- Q F 0 l, If . 5' Q ,--N. fs Exe Ti A.. Q 'Q 1 E1 515 3 fx. :Q Eff l :rf ,. 4: if 'Y fivzr,-x-:mi .14 E: 21 2:5 355' .l Q A :ze fc' ,pt-, :,:f: 53' A E lf sis l .gf f-QL 32.-. Q . ,.,. 2 Allen Brode Green Lasslett Osgood 15 Applegate Camstenson I-Iaiqgh Leonard Parsons Q Beem Davis Humphrey Lvman Ramsey -s Blankenship v ,f Bleakney 5' Borleske S4153-515313 ggi-zmsrcg? Li: '- 'K' . fic. Q V .,fiQfgcr:z-rf-xc:cecszamammaesfaxsmeqgo 5...--5-, ': '- , '.'c-,-Wd? . 1 4.--' -,-5.1 543 1 -I ,K . . . . . . . P. Q L V -V . ,- 1 1 '- 1'ew211::onxcfrf'ifPrAiitM01Qf:'s62kc5u1wmnr-':-mam-imc' Diebold Eller Folgate Jacobs Kerns Lanham McMu1'trey Maxey Miller Ravasse Reynolds Robertson EQRSQQJILQQ Q, 15 ig 3 ., 1 A- Zil , xf Fi 5? S1 95 1 f- ' , gg ' 2: Q, fp. if 3723?-2315-53 fd' Wy, Zwrfikkgg jzlcgigzgi V 2 SE 5 3 555 if Sc S fig . Nz 52 if E 5 25521 G1.,. 12: 33: .w V. .. 6. ef. .45 :fr .-fl , S092-i'X'5t6' '2z, 16' If fQd'Hm,? 15w1.:ffl.f1 2' 1 I 4 iffy. A ig: E: .2 fi 5 N fb A . Q. v w lf 54 1 F . yu 22 S gi . 54 mania-21:53 gpm-aazzat Jr N ,.7f'TE'3:f .-,7 , Y-.tcgsavzrgnsnx :Q X 'Qs .1 5, N, . 4 ft , ,,-.-9' Q Army' X322 ,16w- v , 5, 1:3-gc'w31Qe1wmu'-gfzvtagzcfyac-:cewsa-34 ja 'A We ,fl 'o'ggfYf2f.ff,-'5 wm'..gm1.1,-'Vg 2 1 I ,. ., .f . Q 33 N y ,p 2, P .Z '-H f :z L' 5 ft- ,--, ,. SHN, 5.5.5 lf ff:--I-1 Q. ll .., , .EH-I 5.-5,.:,,,-yy, :t'..x .gg ly, .l.....,:.,,: 5 r, - -.,m'- 3: ' 'f V? 'M mf? ,pf fin. 1, 3 ..' LJ. ,. xw., .',..14if::2f Cvbz-f6'9159'-758' 5528,-444' .'fP,rv'.15fr'Nx.2Nf'!UZ.lv,. W5fLs'.7l-5v'J':.'5:.13.-v-A. .'5'I-.1.-.-..I7- f Page Fhree Yi L7 Qi 4 1 ...Eff F 4 . . 'Ghc Conservatorg of music The VVhitman Conservatory of Music is fortunate in that it is intimate- ly associated with Whitman College and shares its intellectual, social and religious advantages. High standards of musical accomplishment are maintained and constant endeavors are made to secure the best musical tal- ent available for concerts and development of a true musical atmosphere. The Conservatory occupies a handsome building devoted entirely to music. The auditorium, MacDowell Hall, is a beautiful concert hall which seats about two hundred and fifty. Its equipment includes a two-manual pipe organ in addition to the larger organ in the College Chapel which is used for frequent recitals and concerts. The other equipment of the Con- servatory is new, comprising Chickering grand pianos for teacher's studios and concert halls and excellent upright pianos for practice and class rooms. Green Cottage, which since the building of the new girls, dormitory, has been reserved exclusively for Conservatory women, is a substantial, modern, well-furnished residence. WVH ITMAN COLLEGE FACULTY-C Concludecly Joi-IN Cusi-imixn LYMAN Louis A1.i:xANn1aa PARSONS B.S., XVhitma.n, 19095 M.D., Johns AJS., Iowa. 18955 A.M., 18995 Pu. Hopkins, 1913. D., Johns Hopkins, 1902. Mecliclfl 10-l7CllII'l'7lH7', Nrrlhcrvzziel Slzipman Professor of , PI Luis MCMUn'1'1mY lyblw BS., VVhitnnan, 1926. Instructor in Matlzematios. GEORGE M' RAMSEY A.B., Harvard, 1921. Clmsfl-ER COLLINS NIAXEY Instructor in Romance Languages. A.B., 'VVhitman, 19125 A.M., Wiscon- sin, 1914155131-I.D., Columbia, 1919. Yvoxxis RAvAss1c Miles C. Moore Professor of Politi- B.Es.L., Sorbonne. 1918. cal Science. Assistant Professor of French. JO!-I N 1,E'1'Iill MIT.1,E1l Pi-LB., Lowain, 1895. Assistant Professor of Modern Lan- guages. 1'lu'ri-r R.1'IYN01.DS A.B., Nvllltllltlil, 19225 B. L. S., New York State Library School, 1926. Assistant Librar-ifm. Romzm' Sroiuzs Ossoon A.B., Grinnell, 18945 B.D., Chicago Grnxcxs K.-ROBERTSON Theological Seminary, 1898. Supervisor of Health and of Dormi- Professor of Modern Languages. I tories. - q 'E :'f:g f W.q,,,,,,,, llwvzsiib. ' lg 4 I' J. . F 2' s ..I.,.f..,:1 K ,. 5:61 9' l Page Four qi 1 xi 7 Li: f2'21' 'Di12T ':9f'C7' 'ffiiw .i:. 'yfiffzf' was-p.-.3 S -z25 1'-.S-.Wig 733101724 TFP -wg. ff: zv-cazzfvfwx-'14-:-:ax f- , -:Q f , sin 23:52 9:5161 gr.-:xr -' 3:1?f3?2l3f5?51- aff, ,- If Wg, E225 3' 5235.3 52:53 555521, 952251 32255521 gfirii gi E2 Q' gk . .f'-g L' 1 1:55553 5' ,Q 223555, 12313532 ,Y 'afifi Ei ..-,si-'. fr , -- 1-.avr :':I:1:C:Q- 1 .am r.-:gc 3255, ,gr-aj-: 1 is-L 52142: ,Ip-:gg 21425: E' EH ' . 37113 Wi,-2 -25-1ii3..,5 sf- fs 17 is seas. ,Q 1' ' .esisai mi grass 2QlQ.e.,jgq.gg-iisw IM., 'wM,.., 'f L is 4 251- x lijfol. ' x :L 1, ii! 3 iff? fy' y Z . , X Q Bienfang Bowers Coyle ar - Curtis Evans Pratt Heric McCormick Maxey Ransom XVoodward Q Pacultg of the Conservatorg of music ESTI-IER BIENFANG B.MUs., Bush, 1925. Il1St'l'1LCI5OT in Theory of Music and Head of Pianofofrte and Public School Music Deprwtfrnents. ELNORA CAMP1ii:l,L MAXEY Instructov' in Theory of Music and Vo-ice. IESTI-IER SUNnQU1S'1' BOWERS Head of Violin Departvnent. Niclioimxs E. Hicmc I-nstructm' in W incl Inst1'u-ments, I-I1-:l,1cN CURTIS B.MUs., Xvhiflllltlll, 1925. Instructor -in Pianoforte. NIAIIY Omvx-3 EVANS A.B., YVliit1nan, 1927. Instructor in Pianoforte. .-V., wWa,mQ,zuzg:35 Q U -. 'Hzif riff 0 , . NORMA CUYLE Instrnctoo' in Pianoforte. . IlARL MCCORRIICIC ff 's B.MUs., Oberlin, 1923. .Q ,-:Ex 233 Q-L I-nstructoe' fin Theory of Music and Hemi of Organ DeQm1'tn1,ent. Q H. X- Howsnn Evcmxl-: PRAT1' -- University of Michigan School of Music. D-irectoa' of the C'onse'r1:ato-ry and Head of the Deprmi-nie-nt of Voice. IIOSELLA VVOODNVAIID Secretcwy of the Con.se-rvato0'y. LUCY S. RANSOM Inst-ructm' -in Folk Dancing. H., , .,,., -q::gfseme,r f A-.ss ' i.-Q 31 ' -r, . fgv,-vmvcaozmg-zmfgfzsf-I--J-Q f-4441:-'-wr:-'waV:11.-,,f,m:-:-:-5:1w:L.amvf gr - Q . ' - .' -255 A,.,i ,cl-' . e r , - 1 - . .. - --5 W '.,,'9 fi 2- ' - .V 2. 1,4 '- -.wr .V 2 ,1 -- , - , o 1, . , .fl C H4 il , .. -. -r ws.-i-.0-, . , 1, .- , . A. -. ...- .1,.,i,x.,,,,x.,M.y, l , 5 ff., 5- H 'Q .1 -,X-,nm 3 ,1.,,...-., , . f e-swf. .. . - gg' me-1-sys-.ri-, .-3 ,qui -5, -2- . ' Q -A - ' x, fi- s 'I ,,..,., , X . -- -C '1 21 -- .. 1 1 11.1 sig' .... . - Page F-ive 1 f fs 914 1.4 .m....V A-.M-.---U-ffww Swv:-mr. ' '-Y-fx' I C-'QEEISG 'IITSFH ESPN - 'fel 2:-I 'xii'-?'f ?m ff me . fri-1-1-ilffff -Y 'Q ' m':5.:12I. 21? 3 532 '--1:1211 sd. 'ARE-f gb 3' if--. . ' - T - 2-.1 5.3 :g.'.,'g:, of-in A' . X -: -1-.':-.qi 2-as-I 5:-21 5 -1 I plz. -Us -I , I, r 17-. gif.-sw, 3. x ,:- S Q-113 :,. ,.g WK 3,-,A X, . . K. gg .-1: Q1 W. R. .Q 51- ,. 1 1 f':f.'1s. ' -F 5 :ww ', 'M 4:4-,S 'R-LCS -,wg ?:. f,Ifz.--rg.: 8 ' M- L. S5 '1 -O S. 1 I 2553 xiulfl F P7 +f-- :HQ E..-:IU 3:45 55254 7:-.251-1 'f:f:fi': 5:f' 515531 1 W ll Y ' 'ri 52: - S 0 iff.. If 55522 2515555 25552313 Is- i:f5e'5If ' 3:12252 4 -5 ' 1 .5 ..'..'-sg. :sSs:sz:, arisgifs., -z..m.,:5:sif. 'ifsfeii 522222 felis eww-41.15-. 45525353 ef IE. , ,- I 1.. 2:f'- ..f -1. I Af? 'aishlgrwv 'i:21:2b..f? ,S --ferr. 52:11-3 :k':E1z 1-:ki cf 9-if: W'-A -0' Q?-fm.-Y-ff -' X-A T S if WAN WSL.. of-.2f.1.'1.4 cfiitbo -:Jug wma rom. .Sf-.-:-:Q New-'-+ N:5,gXi 'Qt S :A ,' Q X ways-. I . ,.g .,. -15. S, -:-1 - 1:1 .I . zt' -'fl 3:55 'HE :Q .-.rf-,iii -1- 5. 91:35. :.: Q. +1 if 1 - s. 5.f,,.wi gisz. L15 S ,' .JS '-: V gl 'L ja g.li+:+.va.I.A Sh.1'n.vLx k . f , I'EsQ0m'I'I' 54 rj E 4 sf 26 52 4? cj: 32 S - Q E R7 I' 5': L R ' Q gfxg fl 4 : IPI I . Q : . I. I , f Qs v -I :5 3-'E E is S, E2 X31 I :E fx I EL N 3 I f Q I 5: f A x .1 S I S: rr X S I S- :f: I X IET 1 ' 1 .sl 5.31 . 1.2 f '35. .j. 4.3 Y, .3 4 5,20 E Q 4 ' 9151- 15524. 'S ,Ig 35 'Q 22 Reynolds Hill G-Ose -'gg-:ez-:-.-I '-1 2 2 ' 3 X. gg 'bf 551 23 'Ii S P5 , 5? Ein .453 il .Lf R' if 'A' S' ff? sf . cl C M l gig Overseers an rustees 1 5: f if I I I I cv: S-- f5 5 5 5? f, fi f 5 OFFICERS OF THE BOARD OF OVERSEERS X Sl I Z 5-5 ff' I I 2 I 4 313 , N ,. . 5 BIACK F. GOSS, Clzamwnavi E. D. MCCOY, I we-Clzrm-mrm. DORSEY M. HILIJ, Secreirwy -,I OFFICERS OF BOARD OF TRUSTEES ig- . ALLAN H. REYNOLDS, Presidenif DORSEY M. HILL, Sec'y-Treas. ' BOARD OF TRUSTEES .5 QR. T1-IE PRESIDENT OF TI-IE COLLEGE, ew-offwzo. 5 if 55 ' I - 23 WILLIAM HUTCI-IINSON COXVLES, A.B., Spokane-1931K g,,.:R,,,gq ALLAN HOLDROOK REYNOLDS, A.M., Walla Wfalla-1931. 4.4 LOUIS FRANCIS ANDERSON, L.H.D., WValla Wfalla-1930 lie, Sf' ,U lf. v , '75 ROBERT LINCOLN MOORE, B.S., VValla Walla-1930 A 5 Lx OSCAR DRUMI-IELLER, B.S. Vvalla YValla-01929. 2. If . 1 A fi JOHN VVARREN LANGDON, ALI., Walla VVallaf1929. ,f 5 ifl X3 DORSEY FRANK BAKER, L.L.B., VValla VValla+1928 ECE' PARK XVEED VVILLIS, M.D., Seattle-1928. 4' .W J: ij I I fThe numbers indicate the years in which terms Of Trustees expire. The election 3. S takes place at the annual meeting in June. I' .gpg-J-:+r'Pg3::a X 1' .f:f??'?T0 Wxirfff AN- -I -' 'ei- A ' fw 11'4'5i5'f'f1 .'-' N 2'-3.017151 .ffl34-51,155-if-.5-542 32 A Page Sim rl , H 15, n i . 5, N X X 1-w ,: ,pg , 1 V 1 ,L J l : ' A 7 54 0 1. 1 Y 1 1 c 1 -g,,,,.- I s J msgs? if fyff Y ta? if 1: f' .I 4 ff .-.5 ,,,,r., I -fpfgm ,s .Z 135214 gl I fy 1 Joy McMur'trey Bernev Blankenship Copeland I VVHITMAN COLLEGE ALUMNI ASSOCIATION I-lanrnn JOY, '22, P'I'8Sill6lI.If NIARY Qlhaxizosizj Cov1c1.ANn, '18, T'ice-P1'es'ide-nt y w , LEE McMUn'rumf, 26, becreiury NViLl,1,xnr E. limixrzv, 15, fl'rensu1'e'r ITUSSELL l31.AN1cisNsif11r, Ex-'12, Editor of AZunmus In 1895 Marvin Evans, '90, called to order the first Alumni meeting. The object of the Association as stated in the Constitution soon adopted was to foster a spirit of loyalty and fraternity among the graduates and former students of Wliitman and to effect united action in promoting the welfare of the College. The aims of the Association were ably carried out and their support was invaluable to the College. In 1917 Waltei' C. Eels, then pro- fessor N, 1 1 H-V- f-w'4-v '-M ,,g-jI ' gfi' Nsfe,5. 3 - ' g ,,y'5fZ:3-' , H 1: - -A , , A 1 lf? Q' 21:51. 5:-E 5, V , ws- -.Q-vrwwsi.-1 A ,s 1 . s,,.4f,a.-wezgsasssbsw. - 1- -. f -e X ' V' ,L .. A'-101 as A' ,. ., F , lf-,. 'Q - I-at Q 43,1 I Lg . NYE-' 1 - , 4 Burton Marquis Hill V V Wav., N i5j:', ,LLL'2' .221 it ik'- of mathematics, published the Alumnus This magazine which appears about nine times a year has been highly appreciated by former students and is today a potent factor in keeping the lllhitinan Clubs live organizations. FINANCIAL ADMiN1srnA'r1oN Robert A. Burton, Counselor George Marquis, Bursar Dorsey Hill, Treasurer Colonel Burton is a newcomer to VVhit- man College, He comes to us from Bowling Green, Kentucky, where he was President of Ogden College. He is now the official representative of the College in its relations with the outside World and is closely asso- ciated with Dr. Penrose in interpreting Xvllltlllilll College to the people of the coun- try. He is interested in augmenting the re- sources of the College. Mr. Marquis of Literary Guild fame has been with the College for twenty-two years, first as assist- ant bursar and now as bursar. Mr. Hill, who hrst came to VVhitman in 1911 was first bursar and is now treasurer of the College. : , 5w:'x::::-'f' -1 .' x A 4 Page Sqziewz 9 9 C4 Q: ,, 91 Q1 - . f ' f- 9 4 si 1 ' ' Q' -Mgr yi- I 1 ' . , X, K. Y V- 3 I '- Q PM Ff':' - f. 3 H L , 1 'fg .gfg , f' :Is 53591: , , ,5 SEK-Clivxii? x. S' X- 2 R Ref bf L1 f 1 :fi I 'blys 4 .V - w -:r gr 1 5 .. EQ 2 4 . Qi 1 gags sg is I r A ,N !S1'u,clfu1'cl McPl1ers0n Jones Y, , ,Q B 1 Q . Y , Vi if I . 5 32 5 1 ' Q 3 4 3 f L3 S Pl ' cl S cl S 3 - SSOC13tQ tu CUTS 5 65 f 3 - E3 if 2 if 5 , . 5 I , 1 OFFICERS 1927-1928 X E .It . . N Mark Bradford ..........A... Presldent 9 Alice McPherson .... Vice-President Arthur Jones ..,,., .r.,..... S ecretary x f 5' OFFICERS 1923-1929 ti: 52 ' Ki. -vfmi Arthur Jones ..,., .,,,.., , P1-esldent , U . ,,..., Le1la Lundy ........r.. V106-PFCS1d6Ht :ji Robert Garrett ...... ..,.r..... S ecretarv 25 ' Ifr. ss: L31 f A f 5 2 f? 5 F ii 2 A f Q5 'N '1 5 21 ' 2 F1 X 9 ---' -3222 59199995 :JS SC xi:-: I-.cfm 3 , , S171 vi J Y'f'f4'E'F 7'155fWwQQ2W'Qf F - , 'EE fgg-rcv mmaqygg5Lwoow4xuzxs:g1ji'fg'X, -HA Q 1' 55 '- g .,,,..Q-ig1 f1q',.:jrffZf'-:LQ 1, i1'1'+f'r:,1Hm ,lu if ' 1 D Q 9 L'i,'1E A f 1 I '- 517' If. -f' 73' NL k ,Ew '?ri'5 K QQ 'gmt g'W'MZ'r 'h J M5 N H , . Rf- 2? :ef ' ff H X nl' ffm ' ,1 wr- 46 - 23 K 4: rf rf 1 sz: W A '- ' A -' - 13 ,. 1 wa :K .V 10 2 5 X3 PM ' ' Q 1 2 rf up Hur . ,. 1-, . A ' 1a'.'-frrrrk Wm!-if 'A I 3 -'95 'f l'1f4'-Ulf: 1':'5:f'-'P-if 221912 Sfflffw hlbsfwdiwg R-wwil.-9: Q2::3spsL5:exf:esf::r:5,:.Qv3fof,-Q::l:zsS,caza:iA:zz5f:-:-1l:'22:M- rel Page Eight A '4 Y ' ' , XQ , , X CLRSSE5 V, i lx X J F P U qw il V if K G Dui 4.-f-TRW ffl J W 1 mf sy wer, Z'-J W? XX -,lf X , , KS yu XX yfx x 3 ly . 3 :I 9 W, D W 1 B! . 3 N I x , 3 4 'J 3' A f W ' , J, Q Q I3 L I , -K M 1 ' - r yy V xl, Y .ffm-1,1 '-4 Q1 J - T 'Wi 1 :SEX su XXX A ,V H xr' YF , V A X4 N',, , Q ' Y XL: A , I! J Q4 if 5 'Q 7 .gn -.Y f, ,. 's . 4. 1 bf? X Y ' 12' MN Q-we 11 fvfvk 3-ri Q12-re 5:-N :-:+-- :M Q-:4-:4 mx T- bn' - 7 1 0, V. .1- 169 F5193 4 s- we Ric-1: :--1:9 s' 9:-s 5:1513 Stew.-.-Y'-rs' if-:-1,4 ' 22 wh' , -' -:mc vm 5 if fee me Les: few J zfsff G 'f , H fg --A W 55 c. 4? ,lx-,ww.f:QEg.,. 959.1 rLN.,,..v1:qgf'-, E533 5 ,' H X' '- O ? x me 4,1-14:0 f-'ibm P mf Sneak Kar-my ir Om. gm eg:-, r-,fm .f K ' 5 ff,-5, f x ,A ' , .,,y:s,:11.Q1fEv eww wir- .3.'f2f:L :ibm ,fiibvx -.-QL. Jizz. 5151. ,-za-wc. Wwzwff .bzcxfw 15:3 . H, 'Z . y , ' Yi F' Class 0 ., ivkfw-:Y 55641-l.-:'J'1 Mx -'H I I EQQ li fl l l 5 Q X Eg 7 4 -. 5 I it McClane Payne Myers gt 4' :U Q 1 ' 1 OFFICERS FOR 1927-1928 Q N 53 3 if E President ............... ..... D ouglas McClane f 3 , Vice-President .... . ..,. Gertrude Payne ' 2 Secretary .,......... ...... R obert Myers 3' OFFICERS FOR 1926-1927 Y President ..,.........,. ......... J ames Yenney Vice-President .... .... A nna Lou Curtis f Secretary ........... ,...,,,,, J oe Webster .QF 1 ,f 3,3 OFFICERS FOR 1925-1926 ef xr 126535265-w President ..........i... . ..., Mark Bradford 5 1. Vice-President .,.. .........,..,.,,, B etty Ruby -5 Secretary .......,... ,...,. D ouglas McClane if . , ... Y X 522 OFFICERS FOR 1924--1925 1, ki 1 ' El . i 5 gi President .....,..,.. 1,. ...., Lyman Lynn - Vice-President .,.. .........,. , ,, J ean Bi-atton a Secretary .,..,,..... ...... N Iarjorie McLean 4 7 Q is-:a...,if:l w- Mm iv Q-9' crm ' MM. f?l':'j',f-Hi? gZgge i1E5fif 'As9?2 81? , 21,111 fe A-CQ, 31 H.L,..Qe,LLL.f,.f,.e.z ,ff '- 'QLTZQ U. vii:-2-Lai-Q: ,fer-S' ff, fizj g wi-tfifzfp, ' jjwa gf? : fx LSR, Fei:-Aff N ffl riff 'e e' ' ' fi: fw'.,':'Cf-.FL skilsxz-xglikfx-cj-.,.Q YK.-.no-i 1-.5 '1 hjllgi' 5'ilX'3-I-Z-scicugozf-aa'-V: ,'-,r.vs:cv:oe1.s:-w:.:'e:woc-::H:-:.:b:a:I: Page N ine 9 A E Q.-:+.':: w c J J 515-5-5. 4 5 -fxrie sfgfff Px iz-51123 v:g,., .1 T1rE1.ntA 13LIZABE'l'llf AKEY Pendleton .,., . . sg Q f .1 rv ,, Q AN .M :aw 7 fre- A , ga, , 4 + A so 4 , ,Qt Q ZR . 4,40 4 K .N t - xx I .nv f W Xl i 4 6 '15 -4 YI ff My ' 'Q 24 s-.1- -, N. . V , . . 9 5 ' se 'sz G 5 4 Ny , 9 fx ...ff Q . S. .. 2 Page Teil f J if-tezsewo 2 ti' . .4 ,.,, -of-. Kfzjig :ffg Y 5 ,ff :2?,.J,.,g1ll . 4 , , lfnglish, 11.13. Delta Gamma: Antigone 415: John Brining Contest 415: Pioneer 42, 3, 45, Assistant Editor 445:Robin Hood 445: NVomen's League Council 435: Pan Hellenic 445. . Ftovn ME1.v1N l'SA1a'1'oN Englislz, 11.13. , Sec. Y. M. C. A. 435: Oratorical Con- test 445. IXLEXANDER RonEnTsoN BELL Spokane Economics, B.S. Phi Delta Theta: Pioneer 41, 2, 35: Xvaiilatpu 42, 35: Opera 435. GLADYS BENGE Heppner, Orc. Clzemistry, B.S. Theta Chi Theta: Dramatic Club: Pio- neer 425: Pan-Hellenic Council 425: Pres. 435: Trelawney of the VVells 435: Self Government Council 435. THEODORE BEN Bowl-:N Blaine, Wash. Chemistry, B.S. Alpha Omicron Kappa: Pioneer 445. DTARK ll',x1.1:o Bimmfonn, Vancouver, VVn. E-ng!-islz., A.B. Phi Delta Theta: Phi Beta Kappa: Delta Sigma Rho: Order of Waiilatpu 43, 45: President A. S. W1 C. 445: Pres. of Class 425: Commencement Marshall 435: Phi Delta Theta Schol- arship 415: Australian Debate 435: Cambridge Debate 445: VVaiilatpu 435. ROBE1i'1' NEWTON BRONVDER Grandview English, A.B. Alpha Omicron Kappa: Order of VVaii- latpu: Press Club, Pioneer 41, 2, 35: Blue Moon 42, 3, 45: Editor WVaiilat- pu 435: Inter-Fraternity Council 435: Zkgsfistant Commencement Marshall MIVRIPIL JANET Buiuncic ' Seattle Kappa Kappa Gamma:Dramatic Club: NVaiilatpu Art Editor 41, 25: Pioneer Staff 415: Blue Moon Art Staff 41, 25: Y. VV. C. A. Cabinet 425: Opera 425: Song Contest 42, 3, 45: The Copper heacl Sta1t 425: The Swan Staff 4351 Trela.wney of the Wells Staff 445: WVomen's League Formal Chairman 435: Junior Prom Committee 42, 35: May Festival Chairman 435. lfA'l'1'IER1NE JELLA CANEIELD Cle Elum French Club 42, 3, 45: Opera 41, 3, 45: French Club Play 435: Pioneer 435: Pep Squad 445. TEVELYN CLARK VValla Walla Economics, B.S. , Del? Gamma: Waiilatpu 435: Pioneer 1, 5. . 1 rr eo -ae-z-ztsrssffz-:xg . . , -1 :ygzsgixrfran . fb: r-:ntl , .ml H' f-'- 2 'YA . - s. --vi J bmzeafzu 4 J 9, Q 1 4. - -:' ig' .1-2 Q., 2:4131-1-:Sz-1-,Q-: W 4 .Y .El .. . . MW, D . - - ,A ., 4 4 ?t,...t., . Q 4 Q.. 2- S 9 R Ji Z 72 E -Q W c A w , ,Q . fa Q, K.-4, . New Hz-.-: 4 55 11 . , . artsy, .t- , , ci: 4: .-.1 -1 E9 55 a' . JESSE- Yirlii. Sift-5 f NS- -1. 6155523 13553 ' A 31313 'UH ' 'EES if at 'if up iii? sfifff. l?3EF5?F:?3:EI 43153 li 'Gi-4' ' - . . 5 ' - ' F 1 - . --'- ,:: 5:-1---.3 ffgfzflf r' .322-I 21,1-,fi M15:,:f5,:1 4: hge, lg:-15 S-15-5 'r-pp-:Y ,ll gl,.,.',4.,.v. L. , - -:-3 . 5, .'.-wa. .fam A-:ral saw.: .f.v:.. Kasey. .-f..-ost 4 -mfwo..,gg-1 y N , . , 1 Qi, 1-2 . ,A .E gi,-'rggxgz .. .lm , , , , s . , it QQ Julius Dixxnim L,1.A1u: Casper, Vlyo. Q Economics, B.S. ,- ,E Beta Theta Pi. if ii! iii ,,g fl 'v-2111,-install V I 3 Mmum. ITRANK CoN1.uY A . Cove, Ore. il 1- j Political Scr'ie11.ce, B.S. 1, I :Q Beta Theta Pig Glee Club C233 Chapel ' Choir 12, 333 Opera fl, 2, 3, 43. VE. GUS GIVENS COULTER Vlleiser, Ida.. 3 Pol-it-ical Scie-noe, A.B. W'1'fvf-f W WA Sigma Chi. frfgg IXNNA Lou CURTIS Donald, WVZLSll. 3 I, f Music, B.S. V, .Q if Delta Delta Deltag Mu Phi Epsilong Glee Club C2, 3, 43, Manager K333 Vice-Pres. Class C333 Opera Cl,2,3,43. 31 E 1.1z,x1:xc'ru lDAUGIAI'I'ERS Spokane , Education., B.S. 4 ul i .1 Entered from U. of M. Sept. 19263 Delta Delta Delta: Opera C433 Glee Club fill: Basketball 13, 433 Chapel Choir 13, 43. lVnE.vr1-1 EI.A1N'l1 DAULTON lklallallvalla 11- Matlzenmtics, B.S. 1 Delta Delta Deltag Phi Beta Kappa: QW AY. VV C. A. C13. GLENN EMMETT DAVISOX 'Walla VV alla History, A..B. -ll Captain Applejacl: 6333 Dramatic One Acts 13, 435 Inter-Class 'Debate 633. 55- Josnrl-UNE DE LYRIA Yllalla lValla 2 Education., B.S. - 6 z ' 52:5 Sf: u.,., l ,, 31 f :E Eng? 'ff' fi e. -4 SER7f2C5I?i.?' Ross Lucius DIYIQDLAN Vllalla Walla E'11f1l'is'l1, A.B. 4 Cmmc AuNo1'.D ECKAll'E Seattle 5 Political Science, B.S. S Q . Phi Delta Theta, Delta Sigma Rho Pres. C435 Football C2, 3, 433 VV L ' . Club 42, 3, 43, Pres. C433 Yell Duke 1 W C133 John Brining Contest fill: Dovell in gg 4 Contest C333 Order of VVaii1atpu 13,43 .gf ' C q , K ,qqcqj , ww.5.,fze'-1. AJ: sip, In A I ' W . 1.2 ,A ' F A A L 4 ix. iii-ZA-lg A 5' pg i .41 -,fl I ' I iv' 5? 5l3...,Z5l1 . TL' 3 :WX l , ' . , Q '. l H ., !ySaw.s.,,g i eQ,4l,i' 4 .1 ,.mmm.:-:u.i:.-:QL-.vp1-:ie-1-.4-.:4'-411. up ,. , 1, . ,...:.:e:a:w. 3. lm Page Eleven c a C in Elms 2 S3 1 Q g -.if x ,-zenwf-wr. 41:2 :L 4-1.4 f-:-:ers ' LC TI IHC -:': tl:-:-'-: .. - i- 2:21. 55? 231:23 N. if 5.-M .i:.:..7:o in 155 Page Twelve eww--fr - W 6551 if-1-5 1.551215 ill 122153 'B KN':fN -:mme- 2- 3 3? U V 72353, e 1 1251, ' 0 , ff Rf, 2 Q A N':34f:5:ww-'C C XVTLHUR HENRY ECKAIU1' Seattle Econonzics. B.S. Phi Detla Thetag Baseball C1, 2, 3, 413 Spanish Club C2, 3, 41. Il'l'I'I Anicrrz ICICIIELIKI-IRGER WVn,itsburg English, AJS. Delta Gamma: Mu Phi Epsilong Ger- man Club Play C31. CLARA E M.1G1-I VVa11a Vvalla HIa.tl1,emat'ics, B.S. Delta G-ammag Phi Beta Kappa: Mor- tar Board: Tennis C2, 31: Y. VV. C. A. C215 NVomen's League Council C213 Pioneer C31g Waiilatpu C315 Pres. Y. VV. C. A. C41. MAIl'I'l'IA S11:Lixm IENGELIIARDT VV. W. Evzfglish, AJ3. , Dramatic Club C21, Vice-Pres. C3, 41: One Act Plays C31: Torchbearers C215 The Swan C313 Trelawney of the VVells C41. Cierlxnms fXCCEIlhIAf ESSER Spokane Economics, B.S. Zeta Phi Epsilon. EDNA MAY EVANS Longview Englislz, A.B. Phi Mug Opera C215 Pioneer Staff C415 College Choir C2, 3, 41. NIARGITI-Ill1'l'l5 1?OKE1!ANT GALVIN, Portland Englislz., A.B. Phi Beta Kappa: Dramatic Club C215 Sophomore Play C213 The Copper- head C215 'Trelawney of the Wells C413 Sec'y Dramatic Club C415 Pres. Independent Vvomen C41. 'IRUMAN CARSON GAHRET1' Raymond Eo01zo-mics, B.S. Zeta Phi Epsilon. M u.1:1us1i P.xUI.1NE GlllIPINXVAY,WU.112IXN7ZL113. English, 11.13. Theta Chi Thetag Antigone C115 Women's League Council C21g'Pioneer 141. CARL Fanniciiicic I'IAllENSTllEIT Seattle E601l0'Ill'iC.9, B.S. Beta Theta Pig Sophomore Play C2,41p Pres. Y. M. C. A. C413 Inter-Fraternity Council C41. -,sh H qiQQm:w4a.aefi5 ,Acc 322490 In C ' . R. 1, x 7 13' jtnzvw'-. sw y 1 1 f 1 , 1 x . . is W1 PM 9211. ,HF-V-' . --'S Qs-:zzsiuemriccwqfxffrvssuexrf-v 1--1 7f:'s-wtf,--C gggeyawgqgv ' Q. . . Q 1 -A 2 2. A we-.gg t 1 if ' L -.f...,.x..1.,.:...f.'A ,Q Aim D. 5, :g'Qt 'f- -' ., . A-E' 3 ,-.14 , ' C 3 2 ., L-,..,. .iq . 3.5 N, U ,Q 1:2221 1 , 1.1, L ,.., : , . 5 0 I, yu l IU f ,. , IVIARY AGNES HALEY The Dalles, Ore. II-istofyi A.B. C.xno1.1Nr: E1.1zA1ns'r1-1HANGEn,VV al1aNValla Education., B.S. Kappa Kappa Gamma: The Swan 133: Trelawney of the VVells 143: Blue Moon 133: Vlfaiilatpu 133. GE1vi'1zU1m Mmmni 1'1lI..l, VV:,1lla1. VValla ElI'MC1lft'i07L and Psyclwlogy, B.S. Kappa Kappa Gamma. FRANCES NIARGUERITE Jo1fINsoN Vllalla NVz1lla English, AJ3. Delta Gamma: Phi Beta Kappa: Dra- matic Club 13, 43: Pres. Dramatic Club 143: One Act Plays 13,. 43: The Swan 133: Trelawney of the VVells 143: Committee on Inter-class debate 133: VVaiilatpu 133: Pan Helenic Council 123. E1.1zA1n-:Til KALEY Entered from College .of Idaho Sept. 1927: Delta Delta Delta: Dramatic Club 143. KA1'IiLP1EN KELL1' VVa11a XValla Economics, B.S. Phi Mu: Pioneer 11, 23: Pan-Hellenic 11, 2, 33: Waiilatpu 133. Kiwi-11.1-:EN JANICIC ICING 3VaI1a VVa1la F'0'e1z1:h, AJ3. Delta Delta Delta. Ixus LAUREL L1'r'r1.1s Herniiston, Ore. Political Science, B.S. Delta Gamma: Mortar Board: Sec. W. S. G. A. 133: Pioneer 12, 3, 43: Asso- ciate Editor 133: Editor 143: Associ- ate Editor Vifaiilatpu 133. DOUGLAS XYALENTINE MCCLANE Alderwood Manor, 'Wash. Eco'nom'ics, B.S. Sigma Chi: Sec. Class 123: Sec. Inter- fraternity Council 133, Pres. 143: Sec. Upperclassmen's Ass. 133: Choir 12, 3, 43: Order of YVaiilatpu 13, 433 W'aiilatpu -133: Pres. of Class 1435 Glee Club 143. XVALTER CI,AY'f0N MCMIXIBIEE - Sunnyside, Wasli. Econo-mics, B.S. Phi Delta Theta. 1322! . ,' Wa-..--,M '- 'f1x'- KAN 2 Qrg,-.i'gg:o:b:-:e ' f .2 Page Thirteen I 1 1 Ji W 92523, 11313: Sal, ':?,f5z,, . '-Q: 'sea 'L o 1 wfizf, QW: . A ,qzgay he-I P 1 'JF rl ' -L off'-f .33 Q' Q31-:I A 21 , ,A . A JN, 1 Q .e we , A . . 1 ,f mg.-6 .4 25. .-tk. . 5 v ,.g.,,,, f -we 9 J 722-A 31,,,:Q,, ,y ,. ,W 4.3, . on Q WML ,X K We me N. -:Q 4-rf ,-wer:-W - uw . W, 3 . vc A We .13 11. k gag Q35 E559 6-who Ui 1 Xe Nc I Q. :Qi ,ii x 32 . 2257231 29 v Y El Q I m 4 l 1 . fb, V -'--frm-:swf-:ms aff:-ww:-:v::-:mazewwe'-fag: W? 1, . 1 1, r .- ,---two., n . . . ,Z : f i-1,2 ,tW,,,b,+,x.Af ,- Q. ,.,5. 11 11 -ff'..Q,:H'HM-111.1 L Q 'A lunge 1p0LU't66IL 55l:i', .4,j, ' 53:13 1 fig ,-.:1- nw . - 'fxvadcfzcg i.. Q . , -.HQ-,I-, I I 'rd' .- , 1: f-5,1 2w:,We:3.-4' '-A . fm rw., , , ,, ,, ..t.- .Q 1 me :5:::3L:' Q- 'Y 'eg' -1-N ' cl ... 93:29 :-'+L-1 - A A I 3QK2f in :Nqr 15 : , -ffm ple:-. I :' ':- iga, 3 Exif. 5:59 .-.5-za:-.-3: ,Q Q i:i:g:2 3 VW 15:3-' Fl:-if-9Sf:3:,:: -12+ w 'l gala? gf 11:33. w---H+ wr V: Q R' -.1-: ' cf I K 1 . 1 ., 5:55 215152. F1 ', A ' 5 'l'wAoil.?Y, aa' . if . . . W 33. tammy: eww llqAIlIE J oYCE BICMLTIKTREX' Vllalla Nllalla History, B.S. Delta Gamma: Pioneer 115: Honor Committee 125: Waiilatpu 135: Wo- men's League Council 12. 35: Social Committee 145. , ALICE CARLOTTA MCPIIERSON Yakima Economics, B.S. Pres. Independent Women 135: Wo- menfs League Council 13, 45: Vice- Pres. Student Body 145. MARY KATHERINE MAI'LE Walla Walla Econo-m,-ics, B.S. Delta Gamma: Sec. Women's League 135: Social Life Committee A. S. W.- C. 135: VVomen's League Council 1255 Pres. Women's League 145: Mortar Board 145. IRUTI-I MARILYNN MARTIN XN6l'li1.tCllCC English, A.B. Kappa Kappa Gamma: Phi Beta Kappa: Y. NV. Cabinet 12, 35: Fool's Frolic Chairman 135:1VVomen's Lea- gue Treasurer 135: Mortar Board 1453 Self-Gov't Treasurer'1,3t5: Pres. 145. ELLA MAXIIIE MATI-II:soN Sunnyside Matlzeorzcitics, B.St Delta Gamma: Phi Beta Kappa: Mor- tar Board: Antigone 115: Y. W. C. A. Cabinet 12, 3, 45: Vice-Pres. Y. W. 125, Sec. Y. W. C. A. 13, 45: VVomen's League Council 135. :ERIILY FRAXCIQS NIIQNEFEE Portland Eclumationi' A.B. Theta Chi Theta: Phi Beta Kappa: Self-Gov't Council 135: Pan-Hellenic 13. 45: Pioneer 13, 45: 1Vaiilatpu 1253 May Fetf: 135: Opera 145: Glcc Club 145: Sec. VVomen's League 145. IFITANCES EI,IZAl!E'l'II, Micvicns Pomeroy E'11,gflisl1., A.B. Kappa Kappa Gamma: Opera 12, 45. CLARENCE XVEBSTEIK Moxron Edwardsville, lll. ClIemi.s-try, B.S. Phi Delta Theta: Dramatic Club 12, 3, 45: Sophomore Play 115: Opera 12, 452 Copperhead 125: Tre1a.wney of the NVells 145, EAIQT. RUDOL1,I-I Moxsox Toucliet illatlzefmiatics, B.S. Alpha Omicron Kappa: Pioneer 12, 3.: Opera 125: Sophomore Play 1355 Bus. Mgr. Blue Moon 145. ,l!lI.IzA1na'riI Pmuw NOl3I,PI EngZfi.s'l1,, A.B. Phi Beta Kappa: Mu Mortar Board: Women's League Coun- cil 125: Y. W. C. A. Cabinet 13, 45? Orchestra 11, 35: Vice-Pres. VV. S. G. A. 145: VVaiilatpu 135: Pioneer 12, 35. Spokane Phi Epsilon: mgz:-ruemwsrffgm J -it . ,, ,. 5 .Z-64. .--A 51.24 3 ii.!.!3A 'EI ' '.' F203 veit ee- Q . fr 1-it. : 1, -, , .I-2-'-. .12 .1 . .-,-,A uf.. - , ,I , ,, .., fefN,K.I,aA.-. . v A :..f.:..:f 1 'fi ,.-.,L.,.,-A ' 2 ,fear 4 1 3 1: vm , H32 iw--1 Fri-f'Q:j, 1' 59155 te-111, KE:--gii? X-1121. wa- , ,., t'-:v. :Q :wet at-:Pisa J 5145 ' ' '35V,fl,+- DOYLE LANGDON Nonwunuif Olympia Mrmtlzevnzrntics-Physics, B,S. Alpha Omicron Kappa: Phi Beta Kappa: Press Club: Mgr. Editor Pio- neer 145. Jomv Lnwxs OLSEN Olympia Economics, B.S. Sigma Chi: Baseball 11, 2, 3, 45: WV Club 11, 2, 3, 45, Sec. Treas. 145: Foot- ball Manager 145. MARY GERTRUDE PAYNE XValIa VVa,lla Econolmios, B.S. .,Delta Gamma: Vice-Pres. Class 145: W'aii1atpu 135. S'1'Ev1-IBN' BEASLEY LLNNARD PENROSE, Jr. VVa1la VV alla Chenvistry-Greelv, B.A. Beta Theta Pi: Phi Beta Kappa: Oi'- der of Waiilatpu: John Bltining Con- test 115: Pres. Y. IM. C. A. 11, 25: Sec. French Club 125: Pres. Class 1251 Tennis 12, 3, 4-5, Captain 12, '35: VV Club 12, 3, 45: Glee Club 13, 45: Chap- el Choir 11, 2, 3, 45: Varsity Quartet 135: Opera 12, 3, 45: Pres. Student Body 145. Vinczixu. Pznnosis VVa1la VVallu. Freowh., A,.B. ' Phi Mu: Phi Beta Kappa: Y. W. C. A. 145: Pan-Hellenic 13, 45, Sec. 145, Vice-Pres. 145: French Club P1'es.135. MIRIABE ESTHER 'RANDALL Lewiston Music, B.S. Delta Gamma: Mu Phi Epsilon: Dra- matic Club 12, 3, 45: Pioneer 12, 353 XVaiilatpu 135: The Coppe1'head 125: Torchbearers 125: The Swan 135. IXLBERT EMMANUEL 11AUGUS'l',XV1,lllilxviluil. Economics, B.S. ' German Club 115: German Play 125: Opera 12, 35: Chapel Choir 12, 3, 45. FREDA RIUTII JREED Vlfulla Vlfalla History, A.B. Phi Beta Kappa. HOMER WILLIABI RE1-:D Dayton Pol'it'icccl Science, B.S. Zeta Phi Epsilon: Football 12.13, 4'5:' VV Club 145. ,,,,,., , 1. w NANCY JELIZABETI-I Risisin-Gnu , 'Spokane Englislz., A.B. ' Delta Delta' Delta: Y. VV. VC. A. Cabi- net 11, 2, 35':fOpei-a 12, 32, 451 VV0- men's Leag'ue'Council 12, 35: .Pan- Hellenic Council, 12, 3, 45: Waiilatpu 135: Dramatic Play 145: Trelawney of the Wells 145: Chapel Choir 13.45. 'f f 1 3 L i , - x Page Fifteen f 4 V f ,is , . . f . Q 11-,rip 15211, . - Q qw 1115: ,521 5.g.i:-:25:5:3.f-- g9fi:,r ,351 ' -' 'rf -s -Q H rar-9. is .ai W: vip. 3131 1:21:25 ,wi - J' H CSN- -Avzfnw 1? - vw ft, .Rv 1002 4' M-.n law ty:-sw 1921 J -'Tv 5 ' -.., f . 1 W 1, X 5. . . 'V el' Y ki IXNNA NIARIE QRWONDEBIA XValla Walla. Latin' A.B. Spanish Club 11, 2, 3, 43. W, A ra 34-' 1:15 ,Q .yt-. Mc- 'Ff:Ya::-fx-:', fr , fi ff., W 1 lqA'1'I'lEllINE EL1zAuE'r11 RUBY Q - Walla Walla Greek, AJ3. Kappa Kappa Gamma: Mortar Board: Vice-Pres. Class 133: Opera 12, 33: , Chapel Choir 133: Sec-Treas. 143: YVaiilatpu 12, 33: Pioneer 133. as M1N'r,x 1flvHm'N Snrluzs Dayton ex Englixh, A.B. x, 5 Kappa Kappa Gamma: Dramatic Club ? ' 143: Pioneer 113: One Act Plays 143. is JAMES ROBERT SCHIIEINER Yakima Economics, BJS. Sigma Chi. '1'1-Inmrlx DOIlO'1'1'IX' SI-Il-JPIIERD VValla Walla Music, A.B. 5 Delta Gamma: Dramatic Club 12,3.43: Glee Club 12, 43: Opera 11, 2, 3, 43: Pioneer 133: Spanish Club 113: Ger- man Club 12, 43. Donorin' RUTH SBIITI-I Vifalla VValla History, A.B. . Gmclc MAGDALEN Sw:-znsx' Harrington Mal I1 enmvtics, A J3. Opera 11, 2, 3, 43. l'lr:N1u' IJA'Vlx1.is'1 1'ls 'l'AYLon, NVallaVValla lllatlzernafics, B.S. Phi Delta Theta: Order of Vifaiilatpu: XVaiilatpu 12, 33: Business Manager 133: Undergraduate Honors 113: French Play 11, 33: Inter-Class De- '41, bate 133: Varsity Debate 143: Debate Manager 133. ,, JAN NYAN nm: X-'ivrlc Bellingham M V H'iSf0'l'!j-LClf'i7L, A.B. 'Qi Phi Beta Kappa: French Plays 11, 2. , 55 33: Undergraduate Honors 11, 2, 33: Sec.-Treas. French Club 133: German . Play 143. A XVILDIER XNAYNE XVARSVICK Oakesdale f I PhyS-ics-Mathelmat-ics, B.S. fi I 5 Sigma Chi: Football 12, 3, 43: W QQ Club 12, 3, 43. iz: -3 1:3 ll x xi ' 1 Q x Si ' R Ai A wma? '51 u 1 A f A .. P , . , iff'i'i1'P1:f1, ', -. Y N. -, Mlm ij,f :':f3 ,ai all ..-. 2 . -W-l,--+2 l ' 1-. ':?i age ,Sixteen fggyrmarrzm-f:,1-are , , 4, 4- 11 ES' 2 .N. L? 2- J -5. .3 -r 22 --Q L: f. :VA Stn- - ' '.': Et. '13 ti J -fr: farms- f'SQ? Qi-lligt 7. 3 22 s 7: 'E fi ra 'A PS 'ET 'sum X iz-:L X ,. 2, 'iz -c x is A A f 4 R 2 'zwMf.51, A..1 .1-.::. 1. 'PX J? ' -v. :Q-. ' 41' i .9 mg gage. yi ,R 45:5 fe:-:X 35291 :af if if 1 Nlmu' E. YVEMYER F I'0'Il-Ch, A.B. Kappa Kappa Gamma: Phi Beta Kap- pa: Chapel Choir 11, 2, 372 French. Club 137: French Club Play 137: Greek Vase 127: Burke Spanish Prize: Pep Squad 147. Spokane J oe xNI'IIiS'1'EIL - VValla. VValla Econonlics, 15.8. Zeta Phi Epsilon: Baseball 11. 2, 3. 47: Capt 147: XV Club: Order of Nvaii- latpu: Sec. Class 137. Miwiuzn XVELCII Gig tlarbor Biology. B.S. Phi Mu: Y. YV. C. A. Cabinet 11, 27, Vice-Pres. Y. VV. 13, 47: Self Gov't Council 13, 47: Varsity Ball Commit- tee 117: Chapel Choir 12, 3, 47. CECIL YVILLS Wztlla NVa1la French, A.B. French Club 11, 2, 3, 47: German Club 137: Spanish Club 11, 27. A Lois Vklxsisxon Pomeroy E'11,gl'i.9h, AJ3. Phi Mu: Y. W. C. A. Cabinet 12, 37, Treas. 13, 47: Vkfaiilatpu 137. JAMES Fmxcis YENNEY Vtfalla Vkfalla Economics, B.S. Phi Delta Theta: Order of NVaiilatpu, Sec. 147: W Club 11, 2, 3, 47: Track 11, 2, 37, Captain 137: Opera 12, 3, 47: Basketball Manager 147: President Class 137: Assistant Commencement Marshall 137. JACK Mixuinciu IXI-LEARN Milton, Ore. Physics, B.S. Alpha Omicron Kappa: Tennis 12, 3, 47. Captain 147: Art Editor Waiilatpu 13, 47: Blue Moon 12, 37: W Club 13, 47: Order of Waiilatpu. KAT1-iemxn Bxtowx VValla. Ytfalla E11,gl'i.9h, 1-1.13. VVAYNE CI:IAS'1'A1X Freewater, Ore. Economics, B.S. , CARL CONNELL Seattle B.S. Beta Theta Pi. E' co'-nomics, DANA CRANE Mt. Pleasant, Iowa Iiistorllw 11.13. Entered from Northwestern Univer- sity Sept. 1927: Opera 147. Crniusxcis Dinxim Vtfalla Walla Greek, A.B. -vw:-.-,-vw mcg my-W -f. . -, . . y . . f. ll: af' :sw .g!:7:7'f'e.-1 E iff' fs rw- ' me 'arm :fare -1' 's V Q . 75:15 557:24 123' ily 7? 1 mf:-:yy 13511: VL? 5:22. ft nag. 7 :5,','5g Eg?-cvrkgagzrz i- v. gg 9' we far-rf: Z:a:,.'f2ew' 1 v 1: .fl K .-15:5 3 ' 4fe-e'Q12E2l- -551:41 -2, . 4 'cffg if-7,2 am, feet ,V .1 4 ess.. ,fem ms. Mm. mn' ' 1-we-'X'Y1ne.1 Gi4uAi.n l7N'l'HONY 17TECKEl.SON Xvkllltl. VVall:1, Economics, B.S. Zeta Phi Epsilon: Football 12, 47: Captain 147: VV Club 12, 3, 47: Or- der of Vvaiilatpu 13, 47: German Club 13, 47: Y. Mf. C. A. 147. Vinm Immis R.A'DCI.IFl 1C WV alla Vlfalla Biology, B.S. PAUL MEIIIIII, REEDEIK Portland Political Science, B.S. Zeta Phi Epsilon: Opera 147. PAUL ELDON SCIIILLER The Dalles, Ore. ,Mathematica B.S. Beta Theta Pi: Football 12, 3, 47: VV Club 13, 47: Baseball Manager 147. NAIIINE NIARIE XVADE XVa11a XVa11a Economics, B.S. Pioneer 13, 47, Society Editor 147. 4 sf 7. .p it '1 s-1 .M 'S 5 3 X 5 .2 'M-vwwxi. ffwfr-:f4e'wy:+2m-Mwvxff-.1-.ax mr .3 ,-fem-Naam 4,- ,711-Ia h f.---m:e.:f.vmmwf- 1, 5'-1-'fall -:gr-M2221 'Kar f. . . ,y I'Macs-:m:u:w4e1v:ps'ogvoasasasamvpgmfzcgf 2 M -,J Zahn F. 5.11, sfjzk . - - l. ,. , Q55- g f fl'fff44f ',r3i'?'33f1' 'f A . . - -1 ' -'l ' - -' -'f 1 2' I-: '15, te 7'.'f7 T7 fe Mfiuwh-wx - - 41 ff 1 - ' ..,...,,,,. . ' - - 1? QT,-fA,'4.5f-W-WM 'uf' If . 4, 3' ' : --if 1 1 -....4--zu.: L.: l rf 4 2 fA w M. ' ' f f'5' city NX L'ii 11 'FE . X .2 . ' ' . , 41-?.fQv'-2-,f'-S.- f - N13 wmooas ,-'?.,.f 55 Kfwww- H 1 57: 1 9-as-wg:t,'..,.: af-.' ,N ' H, tj.:-R ,Q-ir ,fr L +4 ' f .- ,-v V: ' i 7-' '--H KC '3' 'P 'ala Q,..'....,.'..l.J,.- .1 c -1-.::frafm:eem:s9.mmmmmfu: M'-'P- 'f' L ef 'ff--'--7-'M 'UM' Page Se-mmteen f,ff5 v c V. W Senior 'Propbecg Graduation of the Class of '28 marks the passing of another group of students from our institution, but this is not just another class. It is undoubtedly one of the few foremost classes that has ever graduated from our institution. It has been exceedingly well represented in athletics, debate, dramatics, student body affairs and all other activities. Furthermore it has maintained a high scholastic average throughout its career at our college. Since this class has attained such a high round in the ladder of achievement, it is most interesting to speculate on its future. Most typical of all seems to be the prophecy of some bright mind on where we might find members of the class of '28 some ten years hence, Its striking and educational revelations urge its print- ing: So here's to Reverend Browder, Our Abie boy of yore Of Charlie Chaplin fame was he but tir- ing on this score, He turned to more celestial things. And here's to Jimmy Clark, a ladies man is he, He simply loves the women, we all can plainly see: A regular little rascal, he spends his money fast. He makes it at a popcorn stand, and he cannot make it last. A toast to Thelma Shepherd, movie queen NVhere'er you are, her face flash upon the screen., She acts in all the thrillers would make you faint And she is sure one beauty and grease paint. v for she's a is sure to her stunts in costume Here's to Ella Matheson, we all remem- ber how In our school days she swore that she'd 'fore the preacher never bow. But ah! that pledge is broken for now. upon my life, They tell me that she has become a car conductor's wife. Gertrude Payne into a nursery comes. Of small children's toes and thumbs She, as a nursemaid, shall take care. More might we say. but I don't dare. Merrill, back to nature goes .Timhill and tumble-weed he hoes, Yet who, for this thing him can chide For who would not a combine ride. Betty Daughters is married now She's a tall physicians happy frau She was single for many a year Until this man came quite too near. Clara Emigh in law doth succeed: As an attorney she helps all those in need. She terrifies the jury, she frightens the judge And many men her place begrudge. Here's to our Frances Meyers Vvho has traveled near and far, She's on the Metro film As the leading movie star. Clayton McMinimee we've known as a get-rich-quick For in betting on your games he was there with his trick How he's making easy money as we all may know By grafting from rich widows in the city of Reno. i L Page Eighteen Bob Meyers, as a scientist is greatly famed For the degree of Master in his line he's attained. But his greatest achievement, one of which he is fond VVas the captured affections of a cute little blond. The Misses Sayres and XVisenor as you all may see Have made a deep plunge into matri- mony. On lovely old bachelors and homely old maids They've taken pity on all colors and shades From north to south and from sea to sea They're known as Sayres-W'isenor Matrimonial Agency. lYe'll drink to Jimmy Schreiner, and loudly laud his name: It will go down forever in the sought- for hall of fame. A tailor's model he's become, he sets the fashions bold: He says he just can't stand the pace, for he is growing old. Oh! Nadine Xlfade, here's to you, we'll shout your name with praise. You certainly have changed a lot since those old college days. In those old days, no one could think that you would ever get The courage and the heartlessness to be a suffragette. To NVayne XVarwick here's a toast for he's turned out to be The savior of the human race, father of twenty-three. In the NValla Walla Valley it's quite the proper thing To call the Xvayne we used to know Mr. XVarwick, the WV'heat King. To the honorable Douglas McClane let us drink a hearty toast, For in politics he's famous and he's been heard to boast That in years to come we'll know him, not as we know him today, But as Mr. Douglas McClane, President of the U. S. A. Alec. it need scarce be said. will soon in the future Evelyn wed: He shall work with might and main, smashing baggage on a train. Now Louis Olson, bashful, shyg not a lady will he go nigh A hermit he'll die in an open car which for his use, Mother Nature gave. 4 .3 . r. Q- . . ,, v Q, 4, Qs 'L J ,. 9 f. WWWW wWW3WW WWW twwwwmw. fry IEH A ' ' -- ' 1 6531 1532553 P55295 H55 2? M - , -5 - V' V + ' A , .1 n 5-55:5-fr-2-2' 'fra - ., ., F. A , .nv Jivgg, 1- S ,241 is 2. fgifv E..-V . 'Z wr. ix, ., -yi, 'J I My cf Q , 4gfQ1w1.x :W - X8 x .Mr ya jg K: hr W C., .V j 4, 9gp,f:,w'm:k- , 5.. , .ww .1 . . 521 . ,121 -1123-.-v 4,4z,:.1:msvwQ,3!3 -. Y' 9 ,tl cf: I: U ea .,' X -4 5223 -4 - S' 53. fa -- ref lx hw, V- ,fx A W .-., ,. if-V--vi22:3 S G Q , , ii ' ' -' I. J S Q 1 2 K 1 1 5 '- :Ei 35 W f gi: .I H2 F4 f LP fl E: F52 -:1 :Z :lf 5 -5- aft! ,F rg. mmmwix :gash 9 'fxi' :gl QE gba My r 1 Wg Buck Lundy Fleharty 3-, 4 -N I If as Q. 1- Y f . , .3 Q, : : ' f- X .L J-3 S I X E. S, ,., OFFICERS FOR 1927-1928 15? 1 , V 1 ' yi ' ' A 'N 342. ' 3 4:3 ifwa .gfzzz :rely 'fa 4 4 Q: x js I , -4 5 qv .Q , :za Presxdent ................ .... ....... Vice-P resident ...,,.. Secretary ........,....... OFFICERS FOR 1926- President ....,........ Vice-President Secretary .......,. President .............. Vice-President .,.. Secretary ,,,.. O '1 '1 P-4 O N 'Ii U11 'Tl O '35 F-4 X, ao. no C71 1? .xx-vnmefwp .1 . , Cx ,,,,n,,, 1- f- ., 0 5,11 ,f..H.., 3 V , , E132 I gpg , 5,3 iz N.,Lj.fCL: 4Q341.f 'fE5:.: 19 . 1 . . Zbbznwmmxweaca,-mwmeeomamxgsw-b ,Q , ' ,,..g,v '---Q3 51,1 1456.4 , ., Q ff-.-fNm4.,M.x,...-'Q . , v ta- -5 ,,'f'.f29 of yy, gill-' ' ' xp 'I : 5 ?:- 2f fkf'm'U 4 ' 5-'lj N ' 'xg Ig-: Q T fx fllT.,,f.f.v3, qi X, -,SJ 1 1 ,. aff' ff , I , ,U gf' . . '3S?m:-,r:ga-swxcifwswez-3fa:-ri:::zc'g.zQA.xw:2f,va:sza9-.:'S.wxrg-av:42:i1- X 'MKMN' 'f' 5 hcldxe Buck Leila Lundy Harold Fleharty ,4 1927 FW -f 'Jiffy 4 Harry Rothrock Betty O'131'ie11 Arthur Jones -1926 Gordon Cross , Catherine Bleakney ' Harry Rothrock Q: V5 . s 4 A Q rj .,iV5:3,as- :afwg.sgje11-gr-wie?-xii-lair' '- 1l 4'W5ffC' - .fu nf ' N,f.f.,.l..i.E..:..E 1 www: ,S 1 1-,my-L, 3-I L , Y H iarciwxh-irzsgimv. - 1ww-:ctM.:-.rf-'fil::.1,:-:1:-H. Page Nineteen 1e.1.f:fr.g-ggmovx.-Ltfrsq -.1 .. 1 .2 is fl' 911.5149-l 53231.91 5' e b' 2 , .. . Lg. -1. sf l' H f- ,W , ff -gyf Q.-1.1, .1 on W -ns. 1-ur T5 . 14 ,, ,1 11- .U ev: if 1 :5' ,. 11: Kitt., 1.31: 'e Veg 'f- ME iv- .5 .gi Rwscmvzi igihii-,wZ'ifo'12 ff s cg 1 if EQ .1 ' fl? .Es 91 If? : fzl 11 :iq EZ g if 45 f if . 5: is 1 125 5 -egg H' .fr A., .5 Ilia fl? ik 4' 3 we 2 1. 2. 41 552?:f:' M I fbi? ff Q 2 E7 5 if 15: 1 :ag gg if sg l I Q: 3 3 Z :5 Q L :fx rg 1 1 15: 1 551, H W .-3 , X 4 5 K '12 . gf 1 ..v '1-:xl I'5lT'fQf'7N ff T' I I, li X 5' 1 'x lil :la Q 1- .fi 1 JA: . I ic: -' as 5-f ' in 3352-LLRYSDXSZ 'if -525' 'Z of SQ 5 We teaser 12 we f if gf VSQWQMWQ.. See. . 1 se. . . .0 If 11535 'Q 4 3 'ihikozwvd' rx'-T' 4. 'N?'x?fxv 1 '42 1-. Q ml ffmfsll fe .5 gm:-fi 552'45f'-5 5 i- My name itself explains why I'm Self- Government president. 5 -Edna Jecm Abel 'Y '21 Y L W .S 1 'Q El . I E Love? Huh, that's my middle name. -Keister Love Adams. ' , lla. Im the guy who made razors popular. 51- -Pwul Arnold. f fZ:1:'::mm1' as s SS 05 Some women cry for freedom but I If? .if adore Fetters. -Elizabeth Apm Austin e -111.1 The height of my ambition IS to pick ,g the Apple by the-Gate. -Chester Dale Babcock. 323 5 1 VVhere the hell, IS Milligan? I know I but I dare not tell. 5 -Donald Baird. 5. J i I believe in long hair, short skirts, and Q23 5 free love. ff ' -Charles Frcmkliin Baker. ala P . N if-sg-1.:- No foolin' both the color and wave .ln ,mb 5.5. mv tresses are the real thing. 3 Q5 ' v 6, f. -Dorothy Clare Berlm gee' is ggi '53, 1 ,s lc-iff' Qfntiff' 1,111 still feeling for a soft spot in the gym floor. -C'cnther'ine Lcmgclon Blealmey I live up where the trees are tall, the men are small, and the women wear chin whiskers. -Theodore Roosevelt Boswell. yerzawzg 355 06 .V jj-' lf va 114 21 135 :5 iff, E? is J 3 Q21 s E A --11-, :E 1 .4294 U.:-:rii'g,t ,Nw--T.. qggggwaewszvysmmq xxlqy 1, ch .5 or -My . .,.,fQ-' 1-peg,-,-wx ,,:.'.-4, ,'- ' - ' V - f . . 1- Q -AH? .gflal vj : 1' .i I- gs, ,,.. 3,1 -wg, 151'-,ff .' 2.51-Stk-Q ,, 9 ' 1 e-1. 1 -swam , 1 ,,.-.A ,st r .-A L :...,Wp,E,4b-AMWV9 M , :fy weve. . .. ,,.',.Fyf .e..,.s1v.,3 .Zn . ,, . Q51 -.,4CA.,gQs,,3,,gM,gk-L-5 U. 1x 1 , .- -, . F ' ' - 4 . 1 f' - th! .' 1 2, .- .. + 1 - P---S -:Eze f Q. ' 1 1 th? 5'w 'f . .135 R- A' fffczf' fi? 1 F13 ' ,-fn r-fain rc' h .l. T '2 fi 3 1 f-f-vm--fffiw-is-rdffi1 I K. 'f,?g.,.... li? -L' .555 i1'.3'..,LMW...-.1..a at 1 '-lf! -A ..: .1 3. nm. or 4. 1 5 . -1 1 1 f 4 D MA-ea,oocc-t1f,ex'vs:1.f.,v.:-1m4sw...1w4m2Gm4lSa .fswrb wo. 4 ,,mw43mgy2Mm,1.mM,f- - qzxlwv Page Twenty 1 2 64 '2 .0 X -2 , .,x ,. o 5. H V, v .f 2 4. 0 6 U2 J C'T -1 5 -v E 4 6 32 R 1 U , I M , A W iwwg ' 11, I. , 'JA 7.54, -gpg: V 1' -as-merevzyrvr-:-:::apEf5g wiqgazzmagoerwxvowt-Ll1WwQ 'mifw 68, 3 gy gg ' 9 5 N ,,,1i 0Na N554 ,ww W 'ef '23f'1-124 1a:f:er Q5 we Hee: fm:-ra 29411: as-r. 25212 we 5 W W, Af X it ' W, -gf 2 Q 'T.-few' iii-:rg 1235123 :gigs-f are 'us if ff , M, ' K .4 .J ?a 555315, 225552 F523 WEA -' K.i,a..3,,','t- ' T '-52 A.-, - gs 2 .c,.- in ,4-if fc gy 'ggei '- -' gg ' iff' 23: V f1i'tf.IHI,'1i 2E mill? 5? S.-zeslcfi ic.z.e.agqE 134.4-1-xx'2 . I MQ I Just can't understand why every0ne's Q9 Q so nice to me! A sg Qf -Mary Crr,tl1,erin,e Break 35 :yi as ge 153 tee '33 S? ff? 'fi' A Ea? I will welcome any and all bets, either YS? Ki gg way, on the number of dances I am to , 2 4 attend during any special time. 5 ' .s I 5' -Glen EI-mea' Broqqer. 4 1 :F I l 4 QE J' .QF fi 9 .. fl' xig at I went, I seen, I beat. eff' -Eddie Buck. gif-.Lily ' K: I K If f-.-, ' . ' NZM, My pm she has returnedg her love IS 9' Q -X , , f, ,. 9' goneg but Oh! how I Crav'er. 2 -John Herbert Cctley. 2 '- if I 7 E3 Q My artistic temperament interferes ff 5 J with my executive ability. --Frmze-is Rae Campbell 5 . H 1 3 I 25 ' . . . I Lf ' i 1-- I have a musical middle name and live . Q, Q with Mr. Pratt, but I have a hard time F 5 3 . 1: sta 'in 1' on the Glee Club. E f. 1 Q .1 ' E' .. 4, r -A ei 9 . -H rirolfl Sr1h,la.'u,busch Cartmell. 1 23 Q2 1 355 3 'l' Q ,. I haven't allowed my popularity to go ki, to my head in the least. ' -2:1 -Kenneth Lafayette Casey. ,lyhvl Zami? rw- 5-'it .s Q. Q Believe it or not I used to have long iz? eg' curls. if 7, :ai -Margo,-ret Elecmor Greasy Q 'ir l 5 -f -, no ' Y! 'ff' 'Yay eases, I hail from the had lands of the Da- If kotas. VVhoopee! EJ -Emory Damon. 1' :h lzg' '12 ' lx , .. Q3 ,fy VVhen it comes to Proms I know-my 1 K 5 E men! ' I f T -Thelma, Anne Dellfttt gtk jg f l, GQ W J f .T V 3 X I 25 f' ,. W .-.f- HQ EQ! , in lk 5' Zlzerzn-:'.6 rlfzffezpss q .Y , . . . V'f:'rz:X'1vwoa:::zaw:zqeu1:'JvH'Yf93'2 fY:'?U X1 til! D131 S?'U 77'f'h,'? -gfIm:?:5:2-1, - '55 Q 1 3. Ci.E..4.,,5 ' tl I' U V V V C ' 'J if , rl ,Fai-5,1-Efeccmisixa ,A.:..45y .lrhhflillmkevzgg :ii ,git 5' lkettrru Au , . x K, 'Q 'l A vii. ,f --seems... , 3-1-I. L. ..,, Y 1 1 I. 1 ' '- 'Vail' 3' 'iff 'A 3 li-Mf'i-f' ' -7'i ? '7-7 ui F -U Pk .f-err: :Q ,N 4-.ff l V. Mk 5,23 +464 :MQ .V X ,5,,,q3.f44:34f,egfs--,. . :.4-.-:v.-.Mq..,tQ4.,..,.,., gzjgil,-I1.Gf.gysz:'1:4-1: g:92f:'zfsie:2:-:4-::':qc.1mrem:::,:5'. Page Twe-nty.one F M2-:lv V ,..w .,,--A-5, J, W.-.1-mv. M-M-..-f -:,:-sr' .4 lf' -: 2 - -J N -. -. 7 W' .r if-C 323 ::-,f.: H E N 7' il.- 4 P V :rf .ir 1:-.- . gn.: i--,E-5 . 5 Q59 ,, ,, ,, , + 'flffifffiz ,, 1' S? Z5-E159-. .pi 521523 llffiii Qi' 952513-. X :ffl ' 215.-ss, ffiffflh f 5 235:11 Izrirzxi 5132113 ffiirif. .fri 'Q-fir: 325.5135 1.-E113 xr. - , 0 .::: wfgzgfglg-'gafrr f' ,W--W-'A1:,:gfgp 41:15.51 25:24:51 for-'m2ff:5: 3 s:1:z:5:, 2' V. Y' C1955-3 oligfriih- -191. az. 'v14f.asv l:1:s41,:L C X V if M. is -, lil: 'x Q: 2 V45-5 ' ga pfj. ,SE ' N3-BL:-ZYIEE' lf Browder could only write some de- ? Z x l C X I I I cent words, ltd write the music and E? :g ' we'd heccme famous. Hlrlowawl llflllirmz. Deye. 6: 11- Il' I cnn't he boss I won't play! 4' ti rd -ldlemmr Angeliflm Dunlap IVhy yes, I would like a Good-one. -Nrm'j0'rie .Inqueliine Elliott. .lust came over from Montana, and I donlt know what it's all ahout yet. N f-Dezrtel' Fee. And they learned about i'la.dies from 5-5 me. 4 5:5 iillnlwel Atwood Fiske Ferguson. I I-Il Although l'm called Dorothy I'm a Belle with a ring. v -Dm-ollzy Belle F'e'rrell. ' I have never discovered anyone else who would admit coming from Sunny- side, even if they did. -Rulh Fefrrel. I am ahout the shriekinpgest shiek I know, and am very fond of hahies, espec- ially Daughters. iflrwolcl Duane Flelzrwty. X And so I got mad and decided to take a vacation. -Rrnynrovlfl Miwler F'o-rquer. , f I nearly worry myself sick thinlgingr how I would look with a girl taller than myself. I -.folzzz Bailey Forsyth. oYiW5WN2'f?'2f?:Q? .-.W Wad... A' .gp 5-:J,5.g. r. :gf af-Ao:-:vc4:-:-:-femme-:cas-rx.:-mx-iz-rozpf Q ,' f' ':j, M'1g, fi 'Rfk .-j K-US ,......a MG., ,K u,,,c,,,w,Lgf I 1 -Q ' '4 QW' nj '1 7 . ff Q, Ttrfvfif ' L::: .:.Q,abssz:5:-:IL-J-:-1frzuysrzzx-z::-sz-:ez-szrmafsiaax lsagyfxovg- -f,:,,3,,,Lf Q55.gm.g.3f5,5W4,gcg:-:,A,1'm,i44.g.:.2.5-gag Page Twenty-two rxmumqi, Q Q FX it 3 me ! put rue. .- QV: 4. C. vu, J sr Q 3 U 4' -' A fwszgicg 2551524.11 .9 Jggfys Wye' Pay +531 2351- ff 71 If . 4 I ncver mind the first of the month for a Bill cloesn't frighten me! -Helefn. Fowler. , E, It is well I clicln't mnke the Drzunatic Club, or I w0u1dn't he in school. ', Q' --Wnltea' Lelnncl Fry. ' I Of course the Orcler of Vllaiilatpu li only takes the best men. H.- -Dun, G'c1,ise1'. As El statue I'm el. regular limhurger -strong, silent, and clurahle. -lVillfiam. Alfred Gallrrcviflz. I love debating-they have to listen to f -Elizabeth Galloway. I I'm the disabled athlete who turned 5 XVOITIEIII-ll?l.tCI' after I got the mumps. F -Paul Hcm'tsl1,om Gcwclviier. , And so I diclnlt care whether I made 1 Delta Sigma Rho or not. -Kewmelfli, Eclwwrrl Gawler. Girls, I'm at fast man-anywhere you -Robert Wuwevi. Garrett. it Ask me where the student fees go. -Hllcla. Jfme Guylowl. XTTT 225112- sz '- - L Q M . ' 53 I'xn so speedy they call me Dynamite. 55' --Mary Elizabeth Gentry. i I M I EQ I .1.. , . . , ,I 'K maven:-:' :eLf::-:co-2fsWS:r2vfe.'-vw...M' I-13 Q J Lqf I -- .- ,ill ' -V . X5 'LF5'-lfssrer:c4f:gx:z::.-gf'Y-ffrlf Q X nm? '5 'L Swv? 1 zkfyaivwriof 'Z ' 7 '-I ,. X 5 A Ln' , ' V Il g,,,,.-1, 2 .. ' , , I :.:.-. 1 v -M ... X 1:-1 asa: u. 14.196 'freeiwgiz-'wwf ' --:,.-:- -fAs:'v:f'.':::-.1 - Page T'wen!y-1'hree ,Q -c WAV W wywg ,fm .. Q-5,44 Q-mg.wfqi1-ef .w.w.-- L '- mg? is-::, '5fZiT': 5 alyirm S1-A+ q'i5:5:3i :ill Q4 +1 all 342 51 -, u I, f ig -I lr. , 211 5' 5 , Q33 f 51,55 w,1.fQ1fa3::.1.Q-' gif: in 221.1 Q gp .. 5 1? 521233 fl' 'iii X552 Qs'2y3:?:1:1-2' if ,fl- fo I it if I 'film Fiiffi 355221 af 9 S59-13. li'2PSf5? 5352153 S -Q N? ',Q' 1 :Q 'f if ' LSE my md. 'HU' 2245. Mi fl 'fs f -, dL'i2?3.- vis :cali .c4re.s. www' -vsei-:e,J4 , -. vw? x W-1 'R 1' I :V sl' Ei TI ' , H. 1 ,-.. . 5 -' 1 xg 3- fimsiif w'lN'A' mmm l keep my du,rl's fll1'Il-ltIl1'C business ggvffff--I ulive hy palniing off furniture on the V, innocent Phi Delts. 1 1 -Frederick Nye Gibbs. 1 sr: H ' ' ' S: . an f ,ll :B ti- 1 rf , f ' . . 335 I ,X Eg Small but effective-tlmt's me. X -lVillimn. Russell Gilman. Pill ' Ei? ,f -S J iQ kg?- H As :L basketlnall player I'n'1 a good X, I. tif? bench warmer. 2- 1 3519-.wif-.919 -Critlzerme Elizabeth Ginn. i1f 'fG.,,w:k .5 i V25 I'm the 1IISpl1'2Ltl0II for the worlrl's best omtor. I -195 -G rrwe Inez Gollingeo' E35 , , f VK' hen they call the P111 Bete roll next 3 year, I guess I won't be there. g -R.obe1-I5 czvifm-fi Goodwin. 21 2 fl E 2 E Genius is often silent and hidden un- 5 M f 525 til it comes to song. Q QQ l 1 -Nrmrzf l'VelIey Hm'1 is. lf if 1 1 FS ' ' 2' 4 :- E 1 ' A ' You have to he good to work in n husiness college. -Velma Fay IIm'1 i.v. ?e v Oh, yes, I unclerstand now. VVhy 35 of clicln't vou saw so in the first place? 1' N ' . ,A 'Q ,git -llfalclo Evans H rm'1'1s -3, Vu, Va ,. ,,. 5 ,7 zz 'f W . Fw? V211 XN'hy I think he dances quite well! .. il li-m49':Hs?5 f -rgsazmcggr, , . . . -H elen .flinzelzfl H rss-lmzs. gk ,sg .E ., li, .511 W9 N llcheve it or not, I haZven't got the 5 Z ,wg I Q mumps yet. A ' SIE 1 Q, -1E'l'i:nbell1 T-'nfughn Ilaslnlvzs. , 1 3 3 fx 1 5 f 5 1 15: ' fzi - 53 f Q ,' ks la li: SIL ' 312 W fifwlrssffrfi Eieawumzff 0:4-: :-kwa Viiw-533333: 13, , Y 1-.5 W y qw. gf, N ..-.f?i-343, vfvyis ' 'QP 9j'r'-ffl ,fav . A 4 Q f QGQCSssvwx-s:4s:wawcmr:-rawfxsfrauzmmg Q Q Q 1 Qg::::,r,X1.'sQ:ssx-eoas1fxcr4::fo252zwAx?5z?'f..' , ,L '- f ' ', 'P ' ' 1' ' , 'fi QJQJEZQQ 'W' ,ifil EEK-f'P?Z 5'g ' li-I ' U I '- f' V Q' 20 ll T. Yi .Q 'P '- ffl ,i'-:-75f-.....t,.- it , 2 if - ' ,Avi --wmiwag-3,1 xg- , L--7-QW,f,..i.zt.i..1,.G 5- 1 ' it I LX L Arlhlgf' 551 jsci :gig 5-gas, Q in ' K 'egg 1'- ' -' wr :f':i 'fllhf S'- :7'fffiTl if-I - 'k44f5l . f'f7'f'Tl 'S -f:w:7 t 514-f f'--I-.iff A-:4-1'-2:1-crease::-:4-:vi-mr-L:-gf-M '1zoa:.::aswss:1..- -m-M-4'-, 'Yinvzwxw fszkgwff 5fgQi,,,5,ig:R,9,g2.w,g 3-Q9gq,g.3'.,4512 u'w:4:a:p-L-,151-' 25:3 - Page T1n1en.ly-four , , vi -,I I 'F 4, ff. 2. fi X1 .43 H,-:IA 1:21. iw cifff.. 653.5272 11: I 3:2::-5: 1:21315 :rm fs::f:- g5:3.5-5 9 if ff ,. I wwf -2.1122 1' S-9121: :aus .wh :wi 95:52 1.1.14 was bi 0 , 1- W Y I JS' else? ,. eff. 35:35 If -- I ,. 'I N .52 922555 fwm 'Nev X 51+-K 7 I -2 Wi: age. ,fit Aero Sw:-wm.1' . ,6 !.:'i.,f X 2 iff.: Oh! 1 just lo-o-ove zee stage! 3 P -Ellen Dow Hrrzeltiifne. I , - Is. I . iii I I'm so glad gentlemen prefer blondes. iii, -Olive Heath. sl ' 1 . tl.-. 1'm working up for Prof. Hmglfs -'jf' chair. fi ' -Abbey H 0'l11ll67'.S'01l. iii ' if' f lil. Oh, I just ficlclle along with Jimmie! -Cfatheiri-ne Idliznlnellz flomey. I have weight behind my words! 5. ' -Dorothy Mima Jcwk. s . :Z I nm Gorl's gift to women. I -Usual Burfett JIlC0lJ.S'0'7If, 5 Even the Tri-Delta ezLn't 511121-111 me! 'lll'fl.'l'f!I'lL Erlgiuglfon J e11,k'i11,S C Q I-Iere's hoping my line with the wo- men never grows stale. 55 w -IVilliafnz. M elzwin Jensen. Z, 55 Innocent, fearless, and boyish-thzxt's me. -11. .5 -fl'l'Hl.'LL?' Da.-vis Jmifes. Q PF ii But Dr. Brown, the size of it body 'A i has no connection with its relative mi- 'Q j portanee in world has it? - -Kemz-efh Jose Jh Kim. N . - 17731, Ag KW kffuugflq '.--:'T '-Q ez:s::mr,w:'x4-m'.sf.ff-wwgfdifwzvff . f wrsrwwg-:coos:t't:ff2:...'4:2 ,gg ., ku'-,f fy- gl I--5, W -'ij' Ag . , . . '-'Zi Qs- 7 , , , f -H - 1 f I . .H I. I A .L.j.1.l-1',:'l.f555' uf v9RmMXS1.' 01:11 SAY 5'f'fj'9j'txL'3 C 7' Z km, ,. . ,g1.g.,,5Qg5 fo? if :mme X135 I ',::, if 4 ft, 'Q . f , 5'4i-:A-si iikffil' , M1 7:'f I. Y -f fl 1 u ,. l QQLMUJLQEI X --1L,:,J-if Q:-:-fatcclx-1,clwQ::.15, ',.gc-gaaww-1m'f '1-14-1-lv:' '54- I+-:1 Page 'I'-wen ly-ive Page Twenly-sis: f -fb- .5 ' . ...W ,Q,,4w-.l.-- . ...., . Yah, I come from Montana too! -Sophie Pauline Kirsolzevzi. I gambol on, not with, the ivories. -Evelyn Rose Klinlc. They call me Cyclone because I swept up the alley by the Y. M. C. A. -Eugene Storm Klfise. Vllhen it Comes to standing Pat Pm right there. -Dorofliy Pearl Knfiglzt. Girls! It wonlt be Leap Year long! -Rfmgnoo' Kroowquist. Yes, Ruth and I are both good bridge players. -James Roflney Lrulley. PIII the girl with the big voice land feetj -Mary Louise Lipsco-mb. It's harfl to keep up a, reputation for being innocent! -Lillian Lockwood. I publish the Alumnus and put out the other vollegre publicity. Blanken- ship also helps. -Leila Lundy. I know I can write a. play that Will be as popular as Getting Gertie's -Gar- ter. -Slzrrwalter Ly-nah.. .i .V M- 3 I iii .ffl ,aw ,, , ee. 1 2 Q? 5 A f . 'I -:1 9-Q:--. L' 4111:-. Q:-2-'-: 31::C:1: izrigy :l:3'3ff 91:2-fb. 5 4 or Ei' - 4 Q ,fi X aff-:g :-32511: .grg:q:g:g q:5:g.1: cg,-rg :gpg -1-zo 1: gf. Q 4 . ..:5:r 'gf ,MEX2 37-Erfg: Eqxjfx carp. 3j:j1j:gQ5g3vs:a ,W 5 fm, :-5:21313 wir! +1-1,12 -!aj:r1i!-:rfsiif f f 43 5 iii:-. f'ErE'P: fcizfrf f:2E2?r21 'gs' 'P-'K aw l-zlvzfsvxlfl 53321: it :- :f.2:f:1:f.- 4-' 115 ff:f:1:l, 1-15:54 f:f.-ps! 5 X 'f 'IIC--'I -H+! 'VM -1 sf .'. , ,,,.,g,1'gr:5:j3:-,.gJ gf ' 315153 3' flex ry,-.. 532251: 5 ,f :lf 'iff , Q e::1:r- Lag. 4:1935 S143-3:1 ,flea gjafiwzi Ke, U-feel! +29-1-' vfeilwf-14011,-: 2: -3:5 TQ E, I run the gym. Borleske, Folgate and Millam work there also. -Harold Lewellyni McKellar. ' I I had to throw a Couple of wild pai'- .5 ties to overcome the reputation my big if brother established, I -il -Paul Hmmon MCH-ivwwmz. I'm the guy who did the papa aet' when 1.5.1 la! the Pi-ess Club serenaded. --fi TA iff-az nf!-my. No, I canlt sing either! . Q -Be1'e1'Iy Esfher Means. 1 I can't keep time when my Little ll 553 Ben's gone. -Helen Estlmr M'eyer.s-. Some guys--they look for perfect legs- She's pai-enthetieal, Oh Gee! But now I only see them eyesg 1 They are as wicked as can be. -Rhiymfmrl Arfhw' Meyersick. I RUN TI-IE GYM!!! Borleske, Folgate and McKellar work there also. -Illerle lWillr1.m. I carriecl Browder through a perfect duet-all for the benefit of the Dean of IN'0men, and then she didn't appreciate it' U -Be1'v1rr1'cZ T'Vill'ia'm Molohon. Musieally, I admit no better blower. -Robert Myers 1. I know which Forkferj to use. -Nelda Nraiomi N ewsom. .fs 15 fb t x Q: .X ,..fg'i2g -gg !,.f:7 .x P' ..g . an .FQ ' '. '. -'4 U if-.w vg.'.xQ, . Lf 1ff:f . ' fl' ' ' 'H zzfi-11:4 fre u::mmcevw::4:-.ex::1fa'14' LQ: If 'if 1,5 Y ry if Q-:X gpg ,pq l 5 - . . ' - V - -Fl! ff. us- if lg-fevfi affemgqm A -' - , - . .59 - f ,-way !:W,:,L,g,' ...Q .-Ia., ,- . , I 3. H .3.,. gxafx- 1 r V X. t , I 5 5,1 X , Mme? r u -HQ p' 4, af ' 1 . - I ! xx 5 'g,sp:..l.h gA.ht,m,,g . xl .:1-: - ' :fs-:-:avi-.mazbwff '+mY '?'9 'X'-2'f- 1:- 'fiswsi-Qeiewjaxrafajzfiul:-wy:M SEQ' -1 r.-xg., ,,-.sf ,I ' e 1 4. 'F v .. u ' Qin Q ff sr..v'Tg fa 3 2 . ', 'le ,I q 32 Nl wg 9, Q2 1 f-5. wc.:-ug. 2: EE! 1 Sh ng S: K: lil 'I lf! 1 56 3' .ml 14 32- .- f 5, xi M ., .4 ' 1. c V y ii, Eiif fc!-: 3. iii! .gp .Ei c 2 :f-Iwi-.c 7. QMQX 5 Va .,, .. .N 936' il M. 5: 4 li: s ii if 1 2 xi 'Q 3: .Zu .- 4.gqg4.ygg.g,g.2:.!.,g, ' , N.-:Q-49:4-14-mez,1n.1,:1'-.44 . xl: ua Page Twevity-seven ,,5.,:ra A Q-.cl-V: -ray: .in 5 4 l K 5 , . 4 C .4 5 ,wg-.-is , 1 7 it 1 r A fi -.S 'J at M X 3:2 me-:-:Qc X 5x V. V- , pr .c 'N ' X I 1 -9 Ei., wh: -. K 3. -4-:vin lr:--k v. C gl' 'WE' 52:-5-:': F: PT , ' 611'- 'ii.f- l 't :5 1 .1 1- m-:f.: .1 Q. Serene, stately, sophisticated, sour on women-that's me. -Charles Deacon Ogden. l had quite a time discovering anyone who was named after my last name, but I Hnally did. Maybe someday I will return the favor. -Betty Paul. I'm an advocate of more Reeds and fewer saxaphones. -Roy Ben,jmn.'i1z, Reed. And one of their rushing arguments was that they were pledging me, and not the whole family. ' -i-Victor Rhodes. I once took part in a play entitled Three VVeeks. -Noah Orlando Richards. I wish it was vacation so I could move into the Phi Delt house. -Jena H awry R0777lL'i'71f8. If the gentleman of the negative won't have the Grace to admit their fallacy, by Golly, they are begging the question. -Harry lVcw'd Rothrocls. All good bass singers are small men. flirlwa-rcl Ernest Rfwby. Tm an advocate of light beers and strong wines. -4A 'l'U1'lLT Schatz. I'm the guy who takes his Beat-ing on a. step ladder. -Pafwl Barry Smithsou. '45 . -' -1 ,K Q3rf,fx:n:,a:-asm.-.gg I. 4 45.1242 :f?a.,:.4pf5 -Qc.:-1 I M -45 :gg-5 ,cr .A . , yrg qzfm:-cl:Qmamzai.-,.A. -ML ,4 .,f y.-,ji A-,Q o11:zn.vrx-gg, - -ffl Q ., , .N , ., l 4 f 3,3 -we-r-'A-' 5 X 1 v . A 1 4 D Q YJ ,. ., 1 . a ,- 1. .. Y ' ol, P -at-' .Lael v Y all E w u :-: 1 .V -5 l v L 4 x :ki rg :Q -5 xia- va- Q, T s v l ' l x , l 1 ff Q Q Zi . - -. A . 4-if .:l:fg:g.g. . 41105 LLM P'T l-if +21 :-1-1 -.-:fr .5 '-sp: 1, .-izgg. , gf.: . . s Q 4 Q? XQ3..,.v 1, ,L ....,4:, .- ff-' ' -- .cm..f.- i., me Still waters run deep and I'n1 at regu- lar bottomless lake. -El06lllf07' E'ulal'ie Still. I may not know Greek but I sure know music. -C'oen.stzmce Sunclquist. 1,111 blonde but not light headed. --Infcurriet Swain. My smile is the rival of Pepsodent ads. -Ruth Sweesy. And to think there are two more like me! -Jesse Olmsteud Thoma.s III They still whisper scandal about me down at the Book Nook. -Ruth.ve'n Chcvrles Tick-nor. PIII unpopular us zu. chapel monitor, but I made Phi Bete by it. -lifintou Allen TiU1i7'ILU'l'. 1,111 the reason men leave home. . -Petronilla Margaret Tierney. And I blew a ditty that even woke 1 r. if fl I m n ' l J-,...., I u:7.Q: A . Q -1, . M N 1 r N.....-,W M Q X ..,WAQ,.2 the Deon. -Daniel King Tilley. I just adore sluuly Glens. -Selma Grace Tontz. Y ' I Q- E-139 'e A., A Q' -1-.'ZniCw 'W Page Twenty-nine A-A ' .I A ',g,pv: -or 12:2-1-Q 5 V wx: V? Ki-'si 5 mgw file -'rr-ri' ips 5' 114' - 'ax .. J fi me seg, QW' is sei Yer,-ly ,v sys. Eivm wk H Y.-12 1l? .:l 'tfhfii 13 VLH? .523 Qiggg I'm the guy who cleaned up on two a,,,...,m,, robbers single-handed when I was a fi sophomore. NVhat could I do now? if fl -Milton C'lm1'les Ufighl. 1-gf ,sf Pl l l . As I was saying, Ilin a charter meni- ber of the reducing class! if X -Mildrecl Hooper WllI'ia.m.v. 1 TZ :E f- lil -5 1 -ig A ,iid - 5 'ish At basketball QZIIIIC-ubNll0,S deal IS -igrsfzfsmif it now? 5.5 -Fwm.ces Ethel W ilson. 1 l 1 ' My ability to write stories about poul- try got me a job on the VValla. Vllalla Union. V- -Havrolrl George llbilson. Si tl 51 I ,-gl 1 :fl gil il ' And then I decided to go to VVhitman. And 50 here I FUN 515551111 A 1 -James Cl1.Clf27'TI'lCll1. -Cflthefme Lutolwl' Someone said I was quiet but you know 1 come from Montana.. -Florence Colby Bray? Of course I can bray. Ever see one that couldntt? -I ruul.: fl7'!l.lf Conway. I can sell anybody zmythinpgl -JOS01llI.lI10 Vl'l'!fllIlIl1 De1l'n'z1 . I came to college for an education, but I learned to wa.sh dishes and blaf base- . l 5 ' ball instead. -Hollis Denoe. l'm the guy who raised heck in Ly- 'f man House for three years and never 'ff failed to get away with it. ' -Im Er'iclo.s'o-n.. I cantt appreciate anything-my eyes .lyk went bad. -Geralcl Glemzil Gblbsou. No, I,ll1 not exactly what you would fi call bashful. 'L' -Rfaymourl Rexel' Ifuglies. Now that reminds me, folks, that when I was abroad last summer-. if -.lurlll Dfzmlclee Kifmball. 1' Z So I gave up chasing Hies and went after bigger game. - ff -E'rnesl Eclwarcl Kohl. .:. l Q12 4 01, 'Q ' -s:-:yr-gx ' ...r-rv 4, ,.4H?'1. '. ,f-.ef ,- Y - -' sv'n:0g-v:.x.:w.ram:'un-za-zezzzmmfs: 1 ' ' r 1 ' W ,f 5' 'WNEX .-A-.......:.,,.,. .,g,.P . I Q if ig:-1,1-viowdfmth Jjj ff gf: -- -' ' Q.. A .1 4,.--2-.fr-.-fjuI1f2,ifmAI:f :ig wlmi Ji-S,- r s , .s-:gg-1--f,..,,.!..4,:,. - ,Q 44-:f..z'f1: fsrmarssf as:-:-mars-an-cr:ziQa:eiss:xs:zmoos4'z:,:e1v sbfwwhy, Page Thirty So I decided to let the Blue Moon go to hell. -Lyman Lymz. I hail from Minnesota. My daddy raises snutt trees back there. -A 'rch i o Mwrslzrlll. l'n1 getting so low that even the Lyons won't have anything to do with ine. -Orla Luzcu'e'ncre Moody. I still don't see how the basketball team won any frames without me. .IT ., T -.fumes Itemzellz IN eilxon. I stand for silent chapel periods- give the boys a chance to study. -Clarence Elmer Neumeier. Environment cannot subdue my native endowment. -Mcmaiue Isabelle Stcmflelcl. I just absorb reading and writing-. -Frcmlk Slowell. My moral influence keeps things aright -Enya-ne Cm-l lVebe1'. And this house, founded upon the spirits of pre-Volstead days, with its new president, shall not perish from the campus. -Thomas Ed-warfl Wood. N..-5'-1. V 4r.1..-ifffg A . 'Q ,W :- 5.-ff Mn 121 .. A . 4:.f.s:v:f:.-:Q::-z w5:r- Q-fi:,xfwwHfQ 55 .g,,,- ' ,:l 135 ' 4 ' K 1-f:,s.:.Ljpg fcff 2 , 3 W.. fer :YF we wr .43 If .iii ' '-'V' s fQ'.Q.3 ' awclcrf-5 1- amfzfz-rxvcws-:iff E :J 'fiv?R5.4f' ---A:-:ff ww 1, -- - -5355: A I C ,-X .f, .A fa 57 M- , , , 4 4- ly-:-:V , IW' f., y ' WEE? Fi 1' E'-if. .4511 5 fx: iifilff: :ft fix. ' '-1222? 'ffm 9' ,alfiim 'Sea 551:45 fm 1 23:2-'e -P122 'fini 111 , HE- . - Vfnfzb. Q-.wi fr 1f'f:5f fs:-av '415f E v :ie-, Wfzffz.-2212511 12211 Zi Q. -: , K '- YPXQ5 .5 fi- aw P-'vs-:-: MP1 U cw :,::-:a:g.4-H+' Lg.f:,-: 4 Elf' -J' fn, '7f522i23,. A' 3 Q3 f?f?5?f':2'l Q-rv ggi, 1. .,,N,. ,L ,, R V3-Qggiggigg if !5q,mMi??1 ,pvwnfxggx 1555121 in - , . U- -' : 'V 4: 'ff 11 fr, '. 1' 'wr :f21:a.wg- '- fr vi?-' fzv, , vs- f., , -Em? M.x32f.f,:!m.m .-Lag, 4,2573 295521, .1131-13?-T1 psig. 1:38. ff' 40:11:11 'fwevw xv-Q ' I ' Fw wg: 3 - fa -Aw 'C55f'?SIlL'Il Class of 1930 ' 1 'ff as 1315 - F eg' fa iii Eli 9: I : rf ' 111 7. 'I-2 ffl ' To 7 -I 1 wr' 11 se -mf ffl f if ' fi :-: f ,gg A if: E 54 el ,Q ti,- --Rx ' vlCY1:l'S'E'.E-I' '1 ww gi E , I Q z 41 A49 r 1 4 ' Y Land Clary Fetters ,' 11 E 1 1 :gig I J -, PK E Q: f OFFICERS FOR 1927-1928 2 : - 1 ,Q 1 . WYE ' -' Vice-President Secretary ...,.Y,...... .... Presrdent ..v........,.... Vice-President Secretary ...,......,. Treasurer ,,... . Pres1dent ................ ....... ,...,. I I aye Land Elizabeth Clary Marvin Fetters OFFICERS FOR 1926-1927 f Carlyle Roberts Beatrice Irving VVilmer Froistad Richard Ginn 1 I 'A . J 2 X an -rr fra :I ':'f::::,v9l .-:1fff?Y3. ,-w -T ' W:7?xW'5':'1'15'I'2: . .' V' +L' 5-'f . v ' 1fqzx:Q::-fo:-'-f s1:e4.:s,.3-:1:Qg:- me , A' jqq W, gy-.31 ' ,522 ' , 3 - , ' '-'.Lr?' ' mi-' eAf'22'1ff faf.t1ge . 1 ' ::-- cg - '35 5 4.1 f I' lZ5!?:QFc4i mf? 1. H-R1-11215 1 1 a 1. f' 1 , 5 ' 52 3 1-,mg-YJ,.i'f4::fv:-:-E-:QM Me,:L,J- 3.2.1 .. :- .-:-:.. : ,z , 1 :, , . Page Th irty-one 393 :-. II. 41 -.. V 5. x Q. .4 Z3 -2. A ,, 4. lin if 5 '4 .1 nc I -'s 75 'c 5-.T .. . - .. .- es' www-mffw frees' Q-f-WW' Wi ga EJ: M ' 5537? mi df -: WE? Yiiifii 'YEA VY ' 4 2.55 I .. 2' it U sf 3 - 1 AF H , - 4- W. W? 'J-.13 'iz - fb 51 E15 ASE? 5 259' - 1,f'n4 'E 'ff f i N Minn fi QS' Q. -had if gkwbul W1 . ,, .,,-,QM , um-mv . gil: . S: If -1 'O V: I' . W' ssyzfg Jw :iA ai..Qf5 -5,0 A-7, -,, Sw .- akffmxwl f5':5n?kW!i5 W aww-ma Wlffii 2 I . ass 0 X 35: ik 51' :fi 515 ' 1 '72 -1 ' '- f 21 102 L , 252 ' iii 3 1 , ' 25 Q 551 4 ,e 3 gi :gr E 3 55? ', fl E. 5: jf 352 33 -QA ff ,gf 2 -:Q ..-NE igqvyhw? vga-' gm, ,Irvin M Wa 'fff 3 QB .Q ' ' ., 65:52 If ' '15 Ogden Martm Gray Q? lf 3 5 L i E151 ff? 1 if if 1 5 , 5? 5 . f 3? M 2 QI 1 I-1 :af V fi fbi . ' ' Si jg. .f ' 1: 1 , . fi , I ' E12 1 -5? 5 OFFICERS FOR 1927-1928 sg EE 1:1 C J . - ' I 1GS1d6nt .............. ......... P aul Anderson 1 . . . ,fr V1ce-Presldent .... .... C atherme Ogden E: Secretary ,,.,..., Marjorie Martin F? 'I'1'C3.SU1'C1' .. VVilliam G1-ay g5'f-mf-33 Via 55 O , ,: J . N if z -f if :fc of Q: ' 'B ff: I I 2 A :-' E 1 SE 1 -S :-. f Q 1.5 A 2 3' 5 J EY L S' 1 .3 1, Q Efaiezfgr-5:51 g fawff-:arms-f4:2 ,ff-QU ,.-..X X 5: . W 'qu' 5. -,. ,l-gf - fr 5,-5. 355, 5-,rift-'. A--, - Q . ,- Q , - ox -' A QQ - 7 f , Ix,''iyrmw?r?v:.wwvssmw:41ceog.?w:.yrAg95f:Q,? QL 2 C -I gi jj G1-fa ji! Qfbggft wj ,E qggpzmvnwao,,.3Qg.mgpQQ,wcg5u'ss9gpfg5L-ig'x,,1 H -J Q' Wa. , , Y. ' ' ': ' f .' -' 'f 4 N, W ' '.- '- w'.gLX Lak ibf-I .aww-Fi--'Q -v'- J - - ' vw -. fr 4 ' ' V '- T' H Q : -, 7 'I k.fW,.,T.-5..,A..,W1..': . . fff. i,I,jg.lLf5 QZWQYMQYQQ E,..,.:,.5.i.,.?,.,n,.E..a.,'E .' 9. ' . H3 J' :E .s ' . . ' zWEf'41,f'f:w'-.- f - ' mi may ,wr f.3-'J ,, 576 .away v .- U 21 .L --Jn, ' -' 'G S - SQ ' if -I W ,qi ,Q 1-4 bug, , Y. : M ,bg ,-,VE P55 1. AY: I . ,Nw Q ,, lf. .I r Lv VI I N ,, f ffff 7',2 I-!L'fll fv-U., -fb., 'jf --5-',lf4-1-'iffy 1 f ',j'm.fja 2-,-: :-mv csmsaf:-am:-J-:2:rw'aimv:lx4:cx+:2ffxw:2r'?nr1wx4oed3:- f Q'Lmx-Nah? 'bw,',,.bf fSAQ:f'fw:e3fz,xsd'a-3,115 xsoorwrrvmzbzkzcm-7: gcwwt-:::ZL5 Page Tlzirty-two Y 1 U ,x gm. 3. ., ,. ,, gl., Fi' ' ,V 'r vv- ' 1 U Lf-'Tx -- if ht, ,v . lit. ua, al' .5.da',', -1 fav W W, :cw ..-. -. 11,34 Eff f':.'A?VE' A 2415, .,- 4. , ,iff-, W fp mil-,. ,S a nz W A '55 , ,,--.Ti !,'f'.:1 'wif Lf sa, fa f?QEf: Y 'Tgigi-vi 2 ' . 21'-aff: F5111-inf? 'N 2f'.gr,.,Z . - if gifs ' , F'5f'i'1 I U . -- 1 ,A N A, , . ',-Ik? 'QAVLM v I ,A I '. X Xegnf' L ,A f,..h,-.A - Y --hh. r .L ,5 , ,V .-.r,L5.4 ' , ..U '1',4 .' ff'.il' : I ,fl-A, , '- 14. 1 , b- img-gli' sm X 1 we 1 1-D---exe: A --':n:f+ I V,-L 1- X-1? 42255 1: 42:42, rife def. 5:2311 5: Le- lf ,Mx 51523354 Vi?-' '+R .nga 23:29 -4-1 111 G': 1-in 1 :vim wi fs' ,H we W ,ff::?f, If-1-fi .1-im Sn Q if ,? P' 43521. S521 eiffl ferr' 5 915298 , N Q- 5 7 5 ? -171211 2523! is--W---W -saggii 51.1, -' '- l- Ngo.: g HM swf f.,q::1N .- ,A Q-,Ira ,1.f,.:5 aff: res- :mf 1 .-...Jess 4.95 441,13 Q, .'2,gfpf.:.,5 .,+.1 1 Q as Akcy Benge Berger DeVVitt Ferrel 1-Iill Jenkins Knig'hL Lovell Menefee Moulton Penrose Proffitt Reisinger Xvilson 'Pau-'Hellenic President ,.....,..., ..,.......,.....,.........,,....,..,....,.,........................ .......... G l adys Benge Vice-President ....... Virginia Penrose 1 Secretary ..,....... .,..., ....,..........,....,..,.....,..i,...,.. 'llllClIT13 Akey Gladys Benge Marian Berger Mary Catharine Thelma' DeW'itt Marian Jenkins MEMBERS Dorothy Ferrell Gertrude Hill Marian Jenkins Breck .lean Lovell Emily Menefee Helen Moulton Virginia Penrose lfllma Proffitt lilizabeth Reisingcr Frances YVilson 1 Buck Esser Fry Gibbs Hebenstreit McC1ane Monson Penrose Schreiner VVight O O Inter-Fraternltg Coumcl president ,,,,o,A4,,,,,,,,A,,,,,,,,, ,,,.,,,,,,.,,,,..,,,w..,...A....,.,,.,......,..........,..,.......... D ouglas McClane T1-easurel' ,,,,A .... ........,.......... . , ............... .,...........Charles ESSC1' MEMBE RS 1 Edward Buck Frederick Gibbs Stephen Penrose, Ur. Charles Esser Carl Hebenstreit James Schreiner VValter Fry Douglas McClane Earl Monson Milton YVight www mi vA-,J ,,'X' .gig in H Page Thirty-Hvrcrz nv fr S l 7 ll Ph' CD Founded at Ufealeyavz College 1852 Tau Chapter Charterecl 1912 N Number of active chapters 52 L FACULTY Mrs. Chester Maxey 4 X SENIORS f Edna Mae Evans E Virginia Penrose Kathleen Kelly Mildred VVelch - Lois Wlisenor J UNIORS Thelma DeWitt Lillian Lockwood Elizabeth Galloway Laura Lynch H Vaughn Haskins Eleanor Still SOPHOMORES Marjorie Allen Elizabeth Nicolai Gertrude Boals Elma Proffitt Edna Burke Mary Ringer Wfinifred Dunphy Mable Schaefer Helen Kane Betsie Towne Elinor Lyons Constance Sundquist f FRESHMEN Frances Clark Ruth Haskins Marian LeFevre Harriett McIsaac Ruth Galloway Helen Richards Bernice Hamilton Edna Thielke Cornelia Hansen Josephine VVisernan 2 imrasyczvgag-21233350 f T55 N C.-1, 5 4f3gyaepcn':f.?-z:':wq,?.g X y J , L ..li at Page Thirty-four v i M., F. f . R., ff, v Ev 55 5 fi S 'Ei Q 225, .rw 5? 019:-egg. 1 L .QL .,:9' 4 3.- -4-1 5 1 . i ci .5 .- if 2' s 1 i z -, 1: i v fi 'D g. x i if-. ,- Eixv-. X , .- J-.L L? 4 R 7 4 7 ?f- . -Pic: Wg?-: Fai? I-ia 52351 E2ES1::.r 'WE 4312.5 ' A gf Nag 535515 5225+ 5 A 1 M X' A-wi . 4. Q -' ' wee ,igicffi 'C:.- .,:i4. ':-.511-s:g.1:3: will Q: an .I f is . W- W. New Q' Km. 6,225 za-af:-:f ' 99535 ,raw -1,25 V, , ',, I . -34 15525 .rw 5 32,,,,,mmfir3 on ?Q,.v,.,.,g55 any fiifgl ,ad ' 'f ' 132' '-Lf? ,L 'V 'N ' 'FAM f 5 - 'K l-,Xu 55' X' in -1,2 J , , K . mf 'A l 1 ,L,, i . i. , ,. M., . P, .L 52' 'M 1 1 s, 1: . fs '7 1 5 V f YK gg sea' -,i , -J- 4: QE 45 ?7if fi: .,l' '31 cQ:' if J WE, 5 EE 9 Xi gg ig 'm A X f 1 Burke Schaefer Rl-Iaslaiiis N ' ' -vffnems-,ffffrzi min-Q-nmaccgg 1 -oL.QL'. ' 5:,'y,'jY:,5w' I - , .12-ff-L .-..,.,. A 5 f-.x ::r1.l.-,-,:onine-rw-:ar-1:av:-Frei-H x .izizfwwrsr-cove Evans Kelly Penrose VVelch DeXVitt E.G-allovvay V.I-Iaskins Lockwood Still Sundquist A111211 Kane Lyons Prolfitt Towne Clark R.Ga,1lowaY Mclsaacs Richards Shearer' Thielke , . 5111, , Qi??mFV?'m fo 5- 5 3- ' 1. fi Z fc , 1- vw., K V, ,fill-j,,,...f',, ,Z fr- ' x' M11 V. 'M-..w.wg, w1,,.,.f Nvisenor Lynch 1 Boals 1 Ringer Hamilton if W'isem an v S emi-:ze Q 1 ,v.:+'-- wk- i 1, , 4 ,, V 2 .. - f. ' . , 'J 4 . .arising wmv.:f,1-:-5,-,.u:1:,,+:: . -.ix '- Page fl'Iziv'lyLfi've .asus ft 95' ' 131 V 1 a. QV' -Ffwiireltfggzmzi lvtslxsrmim aa., A M ' , of jg 1 1 -F r 1 Q. 3: ,, ma - 'wamafzi 'zlv' - Te! ., My fx U 1' il .3 5 :,. A J Il lj . .Q 5 azz -, 4. r Q: ci f- s' in ' X. ai il' 23 4.fx:f:sfsw: - .a EW:-ma:Q2 5 E1 .-. 1 by g El: 2 is i :Z 'IM ' Y f 3 ap za 3- K 9 af 3 'LT ' 3 22 1 15 wi :a i gg 5 2 1 ai ir Q ' : eq. .N at if gf? QA iii-s,m2r1-z-2? 3425. :: '-rw 353 if ig, ' il J' 'ie ,J . 1, Aa, '-995 41-:sas-, '-:gf gf: 4 1 .y ,. gl 'l fl 5.5 :tg I A 2:2 i: f ' ft f E ' ? silf' 31,5 cf F5 pf '52 V1-' ,sw -fi, ,-7' 'QA 5' 'vip yn :e c-t nib. '23 1. 4, xg,- '-::E- R, 1 Y if c ,if s 4- ,:,m::-:P-rg, V: v , va, .5 . -4., . nv, -.4 ' .L-A -' - ,. ff 0'.f'6 K.-FP :. rx-VRS' 54:32 5' Jr SW gi? .5 .xg sf? rf sf-LQ' X 2 1 031350 5e,mQg, 52.122 aww? rg 'fl 2554 5 .-2 M , A- f aa . ,. Ni .. 45-rx . -.,5. r' 'vi ,H N, V J H xi 1 -2 Qlrxdri Xl' 3, Llp. rc , , 1 ., ,af -A . QQ? . 've' 1:2 iff-:-:S-:srfocii gxivzlmmg X . v' Delta Gamma Fozmclecl at llVlLI'? 67L Female Institute 1872 Alpha Eta Chapter ClLlL1't8'I'6Cl 1916 Number of active chapters ML in FACULIX ag ab lL5i'2?2f-Iffgl Dorothy Applegate fe :Q SENIORS W5 Thelma Akey Iris Little Evelyn Clarke Kathryn lllaple - Ruth Eichelberger Ella Matheson Clara Emigh Joyce McMurtrey Frances Johnson Gertrude Payne E5 Thelma Shepherd 5 as 5 Ei ii f JUNIORS gl - Elizabeth Austin Marjorie Elliott Catherine Ginn Beatrice Irving Marion Jenkins Betty Jeffers Ruth Baker Lucile Beck Bernice Becker Isabelle Doclcl Angeline Howells Jean -291'-'N' , , 99 53 . . . . 5'5Zglmrc.-:.::w,f.w1wfsv1n:+-fcfxrcsfsqs-:v.1az'o'-EQ 2 'A -1 ge -V fi f 'L,.,.,'f . 3' f 2 J ga ,pf ,,,.MJ,,7waMa..,,.,,,.g .5 .f -V 3 . , ..f,a,-g,ja.f'efw- 4 . 1 as I-.in .lf 4,..,-,f ,AQVXQE gl K , 1, i,i,t,r,,,,,,.,.f,,,, , N ,J . ,V 1,,,,., e ,,,..o, . -' . 1 X , f . Mfwzkocbcwsevdwmmc-pcnlwp Page Tlzirty-sirv K EZ Helen Fowler 1 ff Nelda Newsom Ei SOPHOMORES lf 43' T -3 it 1-we-:-1-:-f,f:f Leah Lester E Q5 Mary Lou Lipscomb X Q. if .'. Helen ltloulton if - hlary Richmond . Margaret YV all S 44 ifafglif-:rf FRESHMEN as Katherine Kiesling ,- Marjorie Martin ' f if Frances h'lcCormack 5, hlildred hlurray cr 1 il 5 2 :ii QNX -Q1-L 51' Elizabeth Raymer 1 VVorthington '. at 5? L25 Q41 fin lmifilfwiwfvllgfimg ffif 'Selina' Q.-3' 'EEN -' .' Q c:-sa:.nm1swvnwws4vvq:avgeogcw:-g-SSS'2? , '- ', ': , 3 ,av 2.3 a.-fl-Wim 85- 4 ef .-. .. . , - .-1.- - , V 2. ,ra ,f:'A-3 5'-1:-av,QQILcj-'ill ' A f ' rr , i-.Q.2.rLf,..:..5,.E.,a,.3 ,J X f 5,61 g?igl9 ' ,SLE I .:fEf'ifiEI?lfl!lE'i'3 ffl gg .a.f f' -for '-A gL'T .Z J 5P 2 W. V-0.12 iliwwefflsii vfy,QJ7l imQiscrafavfexmm-2:-imccwer-xewiszfif-L uw fwmclzvorxce-szfmzrzgzzg wqqcpgs' Lfmlff-' 'mix' nf cfiesm gzqm-g. lp 1 K-5+-'am-Qvgv:-'waz ,i -wtf - .. V.. !,,,,.,..., Nm 5? 'YP 1 ,, ' Y-Fil' 2515.9 :-'Vx-pb. -11:24 Sm 331g J 2112:-9 451743. 1:2:2:: ' 22 EQ is ,X NW Wick- -211123 ' +P'-2-:QX 5445: x-gy-2 Kelli: Twill EER? Effie' 5-'-:I 5 5 ' 1, A '- ' D 'X ,l lil 5' A X as M ,J 5 fgyi gm 5335? 5 5 xkfwc , K ff Q ' 'HX Q-:Baz 3i::g:4X ,J Q .X LSQX fx-:-2 Ig-pa . x-L31 e:-'--A X 1' -Xg.gff- 22 1 -' 0 iz- c-:wg Jg.X-.-.Xu Q4 13,,.K,c. , wo'-'1 wr 14:24 4, cl, x,,.5-.gg X-:Xia r-,934 wg- 1 V 1 X. V 4 S: -- W X: f:1rE'isl-1 ,lv fsff' PM 'ffm F1112 gfxgfg 'ixzi 2 XXX- X X A X . mg M49 ,,.f5- ..2e'Am. Sm.. 143852, 'L X.,+,,,,,,.,f e,lf,awX,XX .. ' HV N, , L+. 4 X G, ' 155 ...HM ...,. ,.,. ,Ig W, X ' ' 54: -: X X. 5 - iii STX' X X -.fl X P51-frm-LX 3,1 X. 4 gf:ff..:..: 55 51 ll 'Q r ,g ,N X l HQ 33 ,- 5 f 5 X ,, .Xz 1 4 : l 2: , 1 1 232 ' E? 7 El if :il ji? , 55 l '15 lil :Ar 1 3 .X 2 if E 51 .. f l E12 ' QE 1 12 56x ,-15' .4 ., 9552 . gf 1-2 fi, 4-:ds 52 ii , . :- -1 X. LZ ,-4 af? -F5 ee l :lf 5: f XX, cg Q 31-I LL. I 2 2 f if: l :El as 1 if Q T5 f fr E 52 1 2 l I Z5 'J ' X li f 2 gg XL ? X X ' Eli Q X 1' X 4. H r re - aj Q, lf' , 6 ,.-, ug- ff- ' Awww Q ow: ' A .in Q 6 L 5,5 i ,I 15 , 1 L1 I- 1 35.3 jf: Akey Clark Eichelberger Emigh Johnson , Q X Little McMu1't1'ey Maple Matheson Randall Payne l 2 Shepherd , Austin Elliott Fowler Ginn Jenkins E f N: Lipscomb Newsom Applegate Irving X2 2 X xc ,, . x X 7 35 .letters Lester 'Moulton Rxchmond WV-.ll Baker I 5 Beck Becker Dodd Elmendorf Howells Kiesling H f ,-' McCormick Martin Murray Raymer lvalker lvorthington 5. A .fpsr-. G55'4 - .X --'-ji:-.-.m4X1X1:'flex-rw:1::cef,ra.mg:fq-,f j ,I + in M.: 5, HL-fl ,9 -- ' X , 'jf of. .'w::ww-0ff-:f-'g4--Q-'PN'- -1'1 X ' 1 l. - l , 2 - ' e w- Ivo '.- f .'.'?X - J lv-gffg-fu -K 9111 4. . 1 X , S ' ' .NJ,Nl.-ho..,...,.,,-3,,f- uf? S'- '-? J6xm ,ef-F' '95fXfX..Q,: 'l? W:,f-V' 1 ' 1,.,.K.I.s,,...1 4 ' f . ' . ff Cimeage wp:-W' if ? M551 , ' , Sa- K . ' . .LX-X. 45'-:' , E55 Fif X 'X ,. Q, 3 X ,jk Q valiy fu , . I , ' Y 'C- YV 1-'vfiwf-'-T-iff ?!755-'Xiici :QI-1-I-'-T-5 fic' J'-if 4111.221 ' ' A.z:4:z::-g-:-gc-.- af:-. -:-:-zfmmz. mm.-n -. Page Thirl y.seven 0 em,-.X-, w X f c 2 mug- N 4. N as R 4 I .a -w 2 S B? A ,zm-gl . ' Q1 f, 2 w .Y '1,if'i gi 'lm' i: 4- Z' E1 iff? 1 Q-ac: ,Wx 5 .. .,., 13-55253 gg'-5' A 1 EF qziifi, Sew-ff -'-' 1 753155. gi-3 51523 55,1-W gewrf 3553553 ffi .Si E?-1 f 5. X W ' as wie fflfiv-4' ilwrwr--'bv I 72 S li: C l 313133 QP? 3 QITIUIR 5.1 x t it ,FOZIWVCZKCZ at D'I0'fL'l7l0Zl,HL College 1870 Q Gamma Gamma Chapter Chafrterecl 1917 Number of active chapters 53 S E N I O RS Muriel Burdick Ruth Martin 3- ' Caroline Hanger Frances Meyers , Gertrude Hill' Betty Ruby Evelyn Sayres . 1 J U N I O R S X Catherine Bleakney Petronella Tierney lflllen Hazeltine Catherine Hoxsey 5 Josephine Denney Helen Meyers ' Frances W-'ilson X , SOPHOMORES Agnes Clark Ruth Ferrell C Jean Lovell Dorothy Hoffman Elizabeth Merriam Katherine Ripley Margaret Collins Marjorie Stirling Catherine Wfaller - it F R E S H M E N E4 -- Helen Gray Hildegarde Patterson Freda Herndon Margaret Thomason E' Gwendolyn Rarnseur Ruth Thomson Mai-celle Vfyynn 5' 4 ff'ifW9:?Q'llS?Pf?l: X ,Q-':'f3a., Q? '5Z'iY'T r1t':-4 f , zzmnX.me:a.r...sfv:n:e4'q-L'::-Q-:.sf'arx.gnupg . j'f-1 '- - f f , ,ff his ,f bf! lLM.4,X.,g' -41 f l ' 1 f 34 fe? 'Sify ,JL .1-f i:SQ. ,r' 1 xjx - , . , I'-:L C v ' aff -5-ws, ,ffiex ,ff -Af-A1---f -bvff H f ,, ':fJ:z,zrii:-:Q:i1,'rfrQfi:ie2g:1-isaQ2-2-99,2251-:ff:Q15Z:. SQ?-2426! 'W-be div 1' age Till-rly-eight 1 'WTQTE' ll L 6?-T11'i,5 V N.-T1 -ll: , , I I .ned-n '37-If'-2: v.-,-.-., - ,Y-v 1, .,.....- ----, V i , I 3--.ri-. 23: ,gl X ,H l,:vf,:::ia --1,5 -I-54 , A u Q:-:Q ,jimi f Plz' 5:2231 w':2,7'I- S:-:-151 3-H '- 1 ' '--.5 71F:',f',i ' ff'-L., v pp-1-gli r Y-1:-1-J-I 2:':-:,,- 1:-114-J ':-'-:-:: -1 a , X fm ,lr-N A 3. J . f owl 5--4-' L.-,QQ w 'iw Pr ' I- X.-:-.1 Q- H 9 R29-5 i f 3' 155:52 2:25-:mia-Elf?-15 -:5:2:S '5 X , Q, 14.5.3 ,,' gfgfg, gg gvgigi gif:-J' ga fgi' 5.115151 ,..1:5-:,:3g,5:w zqzigfe XZ :ffl X S'f:1:f-X 531:55-i ,ff ,Q -all 2 ? 5 gain' affgc 4 '-' Q 'i.z2N,l'n1:-zrzl-v cf i-1- :w'f:Q2: vigrx :LM QM-1 -Qin. -lffzfgd 2 M '-WW '3'l'5Z3'l-ii X-Fil SLIM EQ , r ',.,Ii' fi-321 lrlff V 1 X W-'JU H- H -:1ff'k--'4J:-:- -Wh f ,V--:mp ifzffa. ARS, i'-ww' ' 1 1 f i f , X '5 P: , Z 5 ' -, ix 5- , : -4 -2 : 1 3 -1-. f 1' E2 ,Q 2 c f, : ,v , Q 54 S Burdick Hangar Ruby Sayres Paul Tierney Collins Hoffman Merriam I-I.Meyers G ray fm- ..-green. fl-:Hz lww Herndon amy T gsm. Hill Martin F. Meyers 1 Bleakney Ferrell Hazeltine Ripley Ramseur , 014. , Wlfilson Clrk Hoxsey Dick Lovell Stirling Wlaller Thomason Thomson .,, .- L imma... ie: f if' if -' .12 - -, -' X ,E -4 f , ,gs ,,...,,f. 41, rf.. ,M N Fi' fl- 3 vs J it- ':- x ' '. ll.. -' -- ,lm XX KV :vw ,f'- 3 if ,I .N . l' 2 --,311 VVyr1n ' 5. .-I-'QQ-5 ff' K . fin.-. Q' K - ' X f' ,,f:i:,:1' Page T11-ifrly-qiivle Y- ,R 4 w, T , f N . , 3' f ?f , f 1 i gg: , .i 5 .' Q V, 41+ 1 F . e. ti , M , oc 4' Q, ,.f x 5 x .51 V ., . , 1- 'fgrpiy er 5sg,55g': ruff Fifi, 5135? are-2 5.12-555 R534 .. F X 'v1.1:2, 5 F 23. :en-3 51:21-:rn girsgg arzzlzz gggrzvg-E:'f'G' Ear: :Q W .. :.:2:2, ,P q' aes? 55.51 t 3532115 -,:?:s2 fs ,5 5 i Q, f 1. its '1-2f:5g.5'6gaB:sE- fmmfilifg 9533552 ,svfmnrsg was ,, N -, -x mem-f :wif -, 'S x.. lXZ'I'f'iJ A fa X 'K '13 . 1 , li Delta iDQlt3 Delta fil Fi I , . . E1 Founded nil Boston Umversziy 1888 3 fl'l16lfll Omic1'o'n Chapter C71a1'te1'eal 1923 ' N Number of active chapters '78 P731 sf' kg. SENIORS 1 i Anna Lou Curtis lilizahetll Kalcy 'Wreath Daulton 'Kathleen King Elizabeth Reisinger 1 J UNIORS 3 4 F' 1 L, Dorothy Berlin Dorothy Jack 5 Mary Catherine Breck Dorothy Knight i Q 1' Frances Campbell Sophie Kirshen 3 Beverly Means 5 ' E55 i SOPHOMORES V Marian Berger Olive Heath --eg, A Ethel Cartwright Ruth Robertson gf Helen Graham Mildred Shaw 23: '5'f Lorene West gt? 7 FRESHMEN X Helen Bullock Dorothy Hull Olive Cornwell Catherine Ogden ,Z Mary Garner Margaret Saxton ' 55' Maui-ine Her-big Virginia Thompson' Florence Hinshaw Anne VVuest , C f EQ 5 9 5? I P 2 H filosrfzm XQFIJPI-1' . 1.jf-Ke,La-x-:Q:fx:4g.5:fwajf:ef:j::fzsamgpfagqw Q j Q- 5f'5lff m-5:22 'QQLJQ39 Q-Q-'J .giczfagmgmmmszgxzpxfg-Qfpaimy-'ffg 1 41 -Q Z' -iff 2 ft J ref Q zg1.g,M,tgeQffL:,4 fr' 'J ' -A ,..1,,-I ,,.-I :,,-IPM' gL:ajAY5gi91 -..g:',.-.:.:.,...,-i..J:-T42 Q 57'Y L,,.:lgx -1.--'f--1212-1:.-:-:uae-:-.-re-:z-w::-zezagaaz:-::4:s:29awss:.m4m xw.,Q.n-xwzb Y+w...ai 'E::6f::c-5-ssdczaaez,-.Lsazrg-x-:vrsaszxebza-:QL-.-.,.-av:--f--4 Page Forty Xa' -mm -1. -. .,- -. . I... A-2 . gc -- 35 V P3 wi I PS - R v . .K Q. - . r' Z-1 , Ef- - I -:g Em .f-'Iii ' 5:1 14. 27 .Q N .5 SS V.-is .. .1 gl ai 1 Qf 1 4- v 15: 1 LE :Ky .Y .J qfz .QQQQ - Q: 95.5, W. ew LQ. FZ- L E3 . fi : ga 1' .15 1-5 cy- .Q. A L3 K' .. YE 'fm' 25:91 .0 airi-E 5525131 iss? if--Eb :ffffia 5-SQ --32221: bf F ' f .. -.- ,:'-M - -.1-- 54-lf. fffsfs. .6 term 5-sei: 1-5:5-we wi ' 'J-. bf' H. .H -f -sv wa -:pt-r-. Q ff-A 5---1-3 -wel 55 Vs Q-.:. mybw-gf 1:-1.4 B M X - . ...Q 'M 91- 'fzififw 'V 22-I5 E CN' 235- I-:5':f: E5 Q . 'W .Sf -- 1 f 5 - V- -V - 5 T 'IC-F1 YMEJ- wr... t-.Pm , M553 332159 gggim ,im 02152 Mx- -. -' 5-'::wr-9:4321 -N' -. . YQ M. .. . .. . ,W Qv V Q? Iv I' . L' N 1, 1 ' .4 X - J: .,. Q, .., ij' I Ir .t,,.Q...,..,,,.,v..,.,.t-.Q....,-.Wg-. , . Q, Q. Q Q QQ Q , . . H V - V ,.,Q.l,Q. ,fl V wwgw.,-M -H , ,,....,, , ,. - ., ,.. V. , ff 1, . 4 f...-...sq .mf .Q fy, ...gt -4- ..- . V.,--,..... .:g.,.::. .gl -'-Vf .V N .f .- A - Q ,.,. ,.,, . 1, .. 1:1 'zzaw ' x2 Ywukt. --.-...sea -4-' 5523.3 g:3z.5,i:2.-V-' Q 5:25522 Q52 -gg-Q S-f-,f3fV,--1Qi:-2,22-..Q z-' . - f-9f'w-'Vf--- fi Q, ' - . - - JY .mx - -' a.1:.:sa new A ' -.fix -'-f:2:a:-2521... MW f5:f:f:V:,V5-1.- -.1 -.:.- -1- :tf....V- ,? P1 S: ff--ff - Q ,Q ,. ' 5. x f ' 21. X .,,f3f3Q -' QQ fx.-saw X if :. :?w..1 11-Z. L'f',E'i7P:, ..:::ft:ff Yrs- 'f f 5-:I rw X- '-' nw. -,ma n - my fm 2-.-: Ssf '4 ' . f 5, ,IW -141,114.2 'yy' '- 1,32 'wwf:r:z:1:':Ef if , Raj 1 U :.-,:.g.Q 'A si3f:.g:.Z3i. ' f f 'fn-' ,' ig- lff' fs' 1 - 'V 31, 1 Q -X.-M N, ,G-.Q-'f',r1-3-5 -1 . - VjQ---V--if 1-1--,V ' ,Q--r '-.-1---QM ,Q-1 5--511V-A Q--5.-.,. , ' 1 ': 16 Q, H , , ., ,. V1 -.,5.-ig..-:W Qf .: , A ' M ' f.--.:gf...fV..,. 1' ' ' f- .-W 1---fin -E Q 5- , ' ' - , 1 y -- . - ' fa- - . 4 - QV. 5, 4 . . . , - , , :..:,,,- , , .Q Wg . -VQ.Q.,- , 6 QQ 5, - . .. 2 ' - '- aw 1--N ..v-ix 1:-.- IS'-545'- - .15-':-ZH, ? .'7L2-f'1J77Z15'.bf:1,-, If 1 I ' 'k25:7:'f-:2I.1- -' :nr :1!'!f-1 -: -75: I' - -' '-V v... .ffF125'f? -. ,j:..f- 1' ,, 'TY QL. -if fa---1-'Ai ' S' N5c.4:'f-.ma V ,553 . I -QI,-'1 iff?-21' ,C Q e-f-ww-Q-X: - ,. Rf-.151-. ..-, .v-Vw----5. ,..:AVe. -...-Gp , -- 'V---:f: '.-'Aw ,,a, ,- 2- - K - Q f Q ' . - ' :.::T::2'P ' Wi.. ,--.fs-' -L..V...-.-W9 fmt ' T2 X Nr 1-zyfi' ' IE: Q ---' ' '-4-fi-f.---Vi rf ' , , . . I -.1555 QE.-.-SQ. , 45.7 ua:-Q5522 -f,Q- , .. .,, 4..Qg.Q.4.,,.V.,, V:,,,,.V V.,,g .ny ,QV .Qu -QZQ' Wg.: if .- -..- Q. .. --,,,gQ.,:.:..---- iss:-fax ...NQ.::55...,.::e-.1-Q-.::: -C... 2,35 -:km-1-,-1 .y--1w:q:--V.V.---:,.-.VM f - .Q Z. r ...Q 7 V QQQ. 1,, VE. 3... is V ,V Q, X 3: -QQ, QQ V C+- ' -. ' .4 l' - W T' 'EZ5'If'75':' 'Af3? 1V' -.ff ,. 1' fs.:-' ws ,. Q i.: 16. H., 1' - . . ' . .y-, .5 IV.. vm' , 13.33. .-31.1, , ' meiiliifi. ' . ' -V-T: ' 2- -'f55ffl.-- 'sm-..:.1:..,,:. f 'Vx .V-S 32.11. -V-',v2?f3EE5 '-K511'. ' ' - 4 f N .mQQgQ.x'. M AJ V, .Q , ,Q,,., ..Q ., ,...,.:.,Z,..JQ...?,..'Q.Q,.i,,Q,Q,.,-,?,., -13,5 .-...4.,.- Q...-V .. g. pg... f.-W L- J -gym Q - Q. -Q. Wg ,QKN,,,...y-,5+,,..-WV-.,Z.,..2,?-.mf 5...-Q--.-tm... .,,4,. QM- . .-.1 VM.-Q. V ,mf :-: -1 ilifisxr 9' ?5g-5::vl-Q7'w-- , fl- 'Q 53.52.-. Q ff' 1:1-fl-Zh. 5 fiibif .. A 35. .,- ,2...,.Q,.V?.4q.ffV4-. ..-,.3..,5fxs,VQA..V,- .g.4,.V.,,..Mmwf,sQq.Q..--......f...Q.,. Q A QV ,wg-,Q.,Q-A V --,-I.. t- Q 4. ,,,,QQ,. .V ,f,, ,,1.Q , VKQHI ,Q ,,., 2 VQ ,,,..,,, ,. ...... . QM-,.Q..,,...Q.. ...,,,., .,.. ., W,M,V.,-q.,..,,...,. .,. ,...,. , ,..., ,.,,.,f..,..-,.WQ.W,,,.,-,,.., . I 5 -Q49-.-...Y X ,QQ . v-V. Q, - ...,. y-,-Q.yg5.fV.,.. Q A.y,fz,u.-.,f-n:f:V:,z,-.Q-54.-.5-. ., - Q.-,-..,Q,,,,uWgg4-1-M-.,4,,.q,f-.-.,.. . r ., .mm - f- Q-:,,Q.e'.g.gg.,Q -. ,- -- 3 . ' V -- - .,-.1 95,-,QQ-,-Q Q4-Q-53-.5 1-. QQ .3 . Q- .--2-- wists .... Yzlyi' '-..I--5:':1:zE-:-fel V 4f1:'.-WFEEQ?-':..C?' !'.??:1?f1 'f 1.':'.':-.-1:2--.--:sw 5 I :- .zg-s-.-ry-we-.. -21, X .. ,, -Mg. , pf- ,. ,. -- - if : -as 'fl at V 1 - ' - :If - 1--V-f 'T . 75 -fm:-as -' -2-1 .-+fV-V : . - w- .F -:- ze .1-3.3. - :-:- . .,.2 P' . Q. , '-I -,,,. ' ETIZW' X 1 'M f . , ' f.: f'-a-:as-sz-:-f- Ma- , . - .. 4 - -1, V. 4-e...Vs-,.z2.-cm -. : - '-: f-E-wb ,. if Z: -' . 1 -:I-, - '. - . - Z:--5'v ..j:ff:3:z::M' ': 1' - 1 .ff-w 'Y ' ..f:g., 'xg-, .i V. K 2' 5 1 -15 '-11ff-:':2'- .4355 591153535-IZ. ,-9 f1f?f3:fE-r.. I ,---1-3-3:2-5'-if . A 21-'gii..,: - - 71 if - 'Y ' Q1 1 ... ?-:2.54'w'l 'f?2-- L 5 F-59524 - k l Q , . -Q 2 2 ' ' - VS:-,-fr:?F?2f2.?.f-3' . ,.-If .. , ' V- - 4 , . -. --Zfwef?--s. --eww f f Q' f -Siezkfiif. - 'X 2 4 ,, .. ' FQ-t ' Q. ff V- 5:-I W' T '7--if if? - f Xxgffl :-'. , X' :fn . Q WV- -V ' tif... , :sj,.: -'f -V..-,ew 'z f ,,- .,,. .,.gf- Q. V. ,g,:.fQ - Q-Q , Q! QQ .gg .. , .. .QgV,,,-,,-.V- ,,. X, ,, ,,,-,.QQZ3has..-.,.,.Q.,,4 'QQ .- ,- QV... M-:lm sw - , V:'.V QQ. 3-',rQ,-5-5.r.'.g - f .fz.g..:- . --f---V:gQ? - .-, NV, K--ew 2- 5 '.,V:.-,ff f ay...-.-Qu - - iv. . ,,:-- ,4wf.:s-...:-:.:5..e- - V , .Q -- V . -'A -. 'cs , :M::i.s:.'.3:-:2:s:aff:1.. - w V41 1:2 if '1 22554 , 42' ig.. f' .4 -.5211 ' ef -. - 1- ' W Q9 ' fWf11-fe.- - r? 3- - H --1,5 - , Q 'fgff-If fm 1. - -. . ' 5 ml wigs. Q-ft. wg... .... ...Ez-5-gy ,. . '.Q4Vgfsa.f Q - ,,-. .. . , ,V .yn-.w Q -.f Q Q 7' 55 .. W' Q fffl 1f if7 f,52'? in 'f-QQ:5:5'::f11. Sifsgijfl' 15.-gg'-fQ'fWl7-ff-Q ghmwi' , T4 - J .- ' - V - 1 '.,IfSi.1'-' . lf- ,.- 55.3. ' ' 1.12 Jiiifzial .-:if ' sf z 1-12 .2a2-2:2.-:Efi'- '- Q51 ': gg:g:5:,'j1:V25s q.-21 ' 'a : Q ,gf . Q gi.. is f L ' '. , -1 . -' . ., V45 . :J-.,-5-shi - -- 'W533 ' -' R? k 3' -f'.'5 5:'- 1 'KV:1:'-ie19.6?r', ' 'Z A --ESE W J- 5 W6 Z ' .6'.' '5'wP4'5S' , V f f.J'Ef'F5::,'3 If ' 'Gff55 '.f -' Z' -AV.-. , VK- 1.-Qxiwe-V 5-V. , -, ..4.x,y,,,.- MW. --ff.. 1 ..,, ,, QQ 'ff 4 ffl 'Qi ' VV 'M ' La- '- fm-fzwzfx . - 131-f .Qc - f ' ., . .e-.-V,.,':..7.f4,:.-1.ef- .Qz , E? 1 , Q Curtis Daughters Daulton Kaley King' A - R.GlSlllg'CI' Bel-lm Breck Campbell Heath Y Jack Kmght Kmrshen Means u j B61'g'EEl' Ca1'twl'1g'ht Graham Robertson Smith . 55 . . . . .Q X-Vest Bullock Cornwell He1'b1g' Hmshaw - Hull Ogden Saxton Thompson XVuest - K 1. 'z : -1 :3r:+:iv:-r - we-:V:1:Q-QQ .. --- -- - ,QQ v- V-, . 19 . ' .'-'-wmv-4.-.5-.--Q.-1.-m-.mzwfmvmm 5 . Q Qfq. 3, bi lyk .3 .f 3 V- .,-.5 1gf:?ff?wf'1-W3-1'?f2? 'f'f t'Ni ' - , Q I f ' ' '1 ' ' - ' 5-Q.: V-smzffgiz ,ftp E,jj 'T1f'7f-1 58912-ffvz. -L3 '4 v R ' ' 4. 0 : - . . -' - 'z ----r -Vv.--Q.-..-. : . , - if ir. Q fyy '-Y-wQ1,'y3 QE. -Mrzwju-'-'K--5---- - Q s A . ,Vg ' .V:Q 4 1 H' -iiviuwl' ,rg fy. -Q ' -wzsaezbl ' eg ' : if .Y-,1., f-V: - Q ' ' ' . . ' ' .1 .m 5 .Qs 3.-'f P.. Q. ' .., X .. : --.Q.' - v f ': c E .r 1,4--.--', ' A911 .4 4 NM' ' '. -1 r . '-.., 'w ' V' - W, , XX ' ,if :?',:,...' ,. L ' . f. f Q. . .. .- .. R2-141. .Q.::,,.Q.,::,,,g4q,,,Q 5595, '...f,-.-.-.-v.X,- .Q.::.-,.N.S4V...a14s:u 3-1-.5..-M-..zwV,5:--..L-5. Page Forty-one Page F0'rty-two Gheta Chl Gheta Pleclgecl to Alpha Chi Omega Spri-ng 1928 FACULTY Mlle. Ravasse S ENIORS Gladys Benge A Pauline Greenway JUNIORS ' Edna Abel Eleanor Dunlap Dorothy Ferrell Hilda Gaylord SOPHOMORES Lucy Bell Mary Elizabeth Crawford Mildred Ebrel Marian George Kathryn Harmon Arlene Howard FRESHMEN Helen Lee Chastain Ruth Goss Clara Gross Frances Jones Dorothy Johnson Emily Menefee Evelyn Klink Nancy Harris Velma Harris Selma Tontz Anita Hughes Dorothy Kelly Irrnal Kinnison Houston McKissick Helen Shell Margaret Towne Margaret Kees Hortense Kay hlarjorie Nelson Marjorie Neale Mary Louise Reed fl I , 1 1.-. V V '.:f,g. ,. K 1 .- . fflfiil V123 f 1 iff, f xv-:f:l:21 .- U ' z I-I 23.51-'9 F! l . fi ,:-:-: ,-2' :J--,-1 x - - ---:fe if 'I-231 S , l , , 2 f,.,..1.,.e.,-Q-.Cx , 45 555555 i-.-.,., z xx -wxl E J, 55:41. - A 'ia 232-SEV , '11 1' wwf:---,.-.-.,.-Q ' .,... ' ,. ' . 54? 'M 2-5 'MILF , I' 'G' ff'5l5':5. 'Q-gf-'n - . ,.EI,:-. ., - - ' 2 . fi 'Ffh '7 f 4 l ' is .'f:f21f-, - '-4+ V - . , . . -'. , ,ff ' 3' 'X 162' , as ,. ., V,-,ZZ , 5 ' ' --,C 4 5 , , f 'ref ' - , -we , . N- -,: '-5797 0 -:sa Benge Gx'eenwa.y Menefee Du nlap N. Harris V. Harris Klink Clary Ebrel Howard Hughes Kelly Shell Towne Chastain Ferrell Tontz G60I'g'0 Kinnison Goss Gaylord Bell Harmon Mcliissick Gross .Tones Johnson Kay Neale Nelson Reed . X l ' -ffl? ,fgif Z -f 11. H K- ,..-.'QQ,f,, . 1 k'fff:,' 425: j,.Q .,,V . ..,,A, ,.,,Q I Page Forly-three f l Independent women Katherine Canfield Josephine Delyria Martha Englehardt Lucille Durman Edna Able Florence Colby Margaret Creasy Mable Ferguson Audrey Bleakney Helen Bown hlargaret Broom Harriet Ahearn Anna Barber Ruth Blaine Margaret Boyd Dorothy Bridgham Olivia Clausing Elizabeth Coulter Inez Danielson Mildred Dayton Helen Heath Page F'o1'ty-fou1' SENIORS Marguerite Galvin Mary Haley Alice hlcPherSon lilizabeth Noble Freda Recd JUNIORS 'Elizabeth Gentry Grace Gollinger Helen Haskins D Abbey Henderson Leila Lundy SOPHOMORRS Nadine Brown Mildred DeBord Ethel Harding FRRSHMEN Charlotte Henderson Betty Israel Margaret Kees Lucia Knupp Virginia Laing Catherine Lutcher Marjorie Miller ' Maurine Moore Martha Moore Eva Peterson Caroline Rasmusson X Anna Rondema Grace Sweezy Nadine Wlade Cecile Wlills Maxine Staniield Harriet Swain Ruth Sweezy Mildred VVilliams Verna Rasmussen Elvira Rhodes Marie Smith Lorna Reedy Lola Sims Evelyn Sporleder Margaret Stirton Mary Stirton Virginia L. Thompson Katherine Torrence Etta Van VVinkle Alice VVhipple Bernice Young 1 x X 9 K J N 1 A Q . -V ' if X Qiiff., J ,? E.-,V. 'fag 553329: ,VV xii-'iw x,j:Q2. V? ,'ZV.,,..-V.-.fiffFV., ff-if 1151? ,QV f.FE2f' f 15? 4 -rm Qa:ggLsf'..,,4g, ,.21.fg.,!V-22245 1 ' . ' K V' - '2'7'GZfV ..-:F5iff 'm -, f.,: ,z Y-1.I'1:: ,... V . VV ,fi ' ' f .' V- J' Vs.-12? 'x T- VV V.. x Va.:-V ,ffm 4ffff 2:2:V ' f .V V ' ' V ' .V as ,-5223! if Vu V. ' .V 'f iii' ' 1' 29. ' 9 :f V '93 'V , V 2 ' ,tg - 2 1 V 411,125 555, .. . ' 17 ' l -V uV'1,h Vgfff. If HVQQJQ 192, V. . V, - V . ,MV-V . V A .- V -V - I-,T ' V V .:-:VV,- V VX-V ' ' V ' ' V' -1. v:-V-.-,V V221--V '-2 ., . V - ' .,V. .1 V. ' .V 1. V V - .,V.f V' , -'V'4 - - V V ' an 1 ' X3 . 'zgfii ff V . VV. .V V r '- ' . .- V - 1.19, 52:12 ' V' -'V 7:'5 .5-r .f, v 5 ,,- ., ' 4 ' 5' 'i V Vf ,- V , , v 4 ii i, V. ia 1 ,, 4 gr A 5 V 3 ,. , .. fi ':'i ,f?5?'V.I:. ' v '-' I-7-VV ' 'V.V ' . V '-6' ' f ,. ,V V, .V ,. VV , ...V.,.... . ., ,,,.:.,.,., . V V ...,,. V V, V ie .V , I V gy. XV., gfgil? QW 4-ev N x ff wr' f R-J ills!! ' gf-m .Zi '- ff' ' 52,57 V . MV s -www M , V., -' ., QV 7 f 45-5?Vm ,Q 1 ix ja: wwf-V Q: Akfiixwx-,-ff Vs .VN A Vg , WM. y wks? .1 -4. V 6 f-M , .1 V ...S-sr fi... .4,, ,,A. A . X 'QQ cz, .,.. .K A '4-3 1 4 -:Vx A W , 0,,-way. l V1 v' ' Yi Nr 4 1 Vogfaw 5 --., . - - -QV, . ' - N V 1 fx 2549: .- - f IES' ! nde ' ' 2V :' ' ' 4 X Vp X V .: V- . 1:5-A 31 , 1 Fi - -- Ml- . . - - My V1 A endexii: B W ggVjgV':1:.: 1 .Qf af ,V M V ,V ffm ' 4fv,-my V ha X W ..x. NVV., V4.4 ,, V V. -5 QW' ' 6.4 f fig? V Q 11 , ,AQ -D. . .,,f '46, , .44 X4 yi, f V, V 1 Vw N.: 4, 41 X xx, mf 1 if KM 'f 1 v,,, W 17 f if-W3 A f f Vfvmfnggi. Nw -. ',,..-L -2 '::3V::::V:. EEL IVV: . W QV. ,ff Wai, V .. I. ..f ,V I V ,f f JW VW4., M.y,,kV,V, Z-245551, V. M, 3 i 4 ay Vg? 1.4.7 , 3 Q, we V1 Wye 3 WV ASV wg L?ffgia?gi,2Z8Qf,,?gzgw .,,, - V 'Wi ' Wi 9 , ' xr ,- V, V . ...,. . .4 V ff f rf, fic I , i ..,., MV- f ff Q99 ,, . , '-,ffl f Lanfield DeLyr1.1. L glcheudt Duinmn Lmlvin 1 ICPIICI son Noble Q P i Q A 'V sy ,, ,3 ? f 4' ,gg V f wgw f r ,f ff - ,V ,J V 'ff VV f ,sg V f f 4 is s 7 f f 2 1211, V V r Vrwi , 995 QA J 9 A V, , ,A h , V. . .. 0 V f. ' - ,.. V, X --Wo-g' IV 13, , V- , V- gr,-s -x.:-ff .fv1:w,--- -X. ,swf nh, ' .V - V f l fp.. . -rein: -- aff'-rf'-' V V f--f -V:--wif--1 2- :. X I f f' .4.1f?L'V':2:'x-,. . ' ' ,Q 7 V . -V ,VVV XM .VV-V4.s.uVA.V.M.VV.. V .rf f f' WA: Q.. -11.1 f.:-:V '-I'Ls-'lf'.-- ::--.1 :QV V-V-:V:V:-VfV:V?-v5zea-rw-Vszwgre-5:-mg .-:Vww v . V V sql- ,V ,.V-Vmsmf 1,--.W fV.5,3VM 'Vf-ASV.: -V--Vagas - X PA' - . V w.:'?i'?- ' li V 'A ' 51 ffffu 2' , V- .V VV 221-2' - ' - ' ' -51 :ina 1 .. ZV VV. V VVf:Z5V2f::.-f ..V5V.. VV iff f- gg! 'V i , sm-1.-,V' 'S' xi 13:14 -- V: H? i - V 1 ' E52 2. 1' ,QJ M ' ' '- -A-V,VV.f ,V ?,f.V- f-:V':-.zE5s1 -'gl ' Pi'g.W ?'- V WE., ' 'I' SV' ,J ,V ' .. fr 1. Y . V 1' . V -9 - - -. S -. 1321+-.V 4 wx-55' '- 4. fr sf U ,V ..,. Mm.. ,WV 'i BL :V..pJ , V V if .V--4 be - - 1 ' ..::.Vfff ',V .-V-f ifwi Z Q-V.V.V:,. .. Til' at . .V --.,.,. ':. ' 'i' 3- 'if5V.V-if ' .: . V Lf? b V -' V' . K V f 23321222532 V MV 7 '-:4:--.-:- ' i' V. 'V P' -if V I' V. .. wif ' 'Ili-'fi' urs - ,:f-1.z:sV-VV. 1 ' -: '-fleV'.ZV V. 4' 2 .VZ'Ss.VVp- -' f2'i :: 1:f.If'E:: V . I f . 1. skis-5:1 V Ii' 'V V ff-eV.'7J1VV -1 ' .X . . ' if-V V' 'z im... .:--i'.l'E.5:f- ... V..V-:VV.:.:.5:VV1'-VV fr, .:VVV:i5EE?3:':i 1 .:V- -V: V ' V 1g,.::::q, . V, mf:-:ip ,41-: .,v' V -' .-2: :-: 39 V ' 1:2'fV'Vs ' . . ' -- V. ' 1--2 VV. VV ' I?-'ifi' ' .5 , ' .. 1. ' , ' ' ' V 1 -- -' ' f I ' - , li Q ' 2 ' ,-'- 1 ' - if - ' V :5.2V1:-'fi V V gr- 3--2-32 Um ' - :1?E:f:Z1V is .2 '51 'Q V-.5V'QZf'2S - 1153 . F ' , 4 ,5-5.1::,:- A ' iz' '52 ' ' ,VV .ff-' if -'ff' 1 Vs:V:- VVV7 ' . 'I ' 2121:-34' if' Vz-15:54 - 7.-EIVEEVV V r - - V: .v 1, -' , 4' ' .-il? ::ZII1::3327 ' - ' .5 1 VV .f-1-1'VV- -' . .V . , A .- V if- . VV - V ' 5:52:12-V ,ii h.'l'f E- .1 V V-3' 2 ' .V 2. -X +r? Pfff-'V' V ' ,V:.:V,VQ .V:V. -, -' V -- . - ,:.1V-fm, 'VV .- 's ,,Vq:1f:-4135-1.,V.,.., ,. Qfiftil--2 V-..f:'f'5'- '? -V- -' .4-f.E?: ?I5-VL:-1.2-:V .--2 ' V 'V K . ..-Vg:-.,.f V ..f -,.Q1-V.-xr-f:1::V1:zz- -- vw 1.1-af ww ' V.:'-'V.:f.v-f- -Wqfzt V - Viz-F-VV 60' V , 'Qf.'V -i:11 ,V XV - f- Vw --.515--'-V' V1-:z.: V :V f V' X '-V 13-1 :5V, ,Z-Viz, 1- -f --251:15-3.-,Z ,V,Ig.g'VV5- '-ft., 3- 255155, ,VJ we V -- L 3' ,gg V H -ig- 'i3?'ffiVf? 52715121 V. if Ifgzigi ,VVV-QZQQ 5 ' 2 ' V in A '-,-,Vj.V:j:f f'-Q iv' is 1-' .V :Q 2.3 - V 1ES':V:':Vg-4.5:VV'V-:V 5 ,mg V- ., W , - '. Tn I- , l V - v 1 Nl- ' N, I Q . - .4 G.Sweez Nvills XVade Abel Greasy Ferffuson Gentr U Bond-em' Goll inger Haskins A.I-Ienderson Lundy Swain R.Sweezy VVi1liams Broom Brown DeBord ding Rhodes Smith Ahearn Barclay Blaine Boyd Burr Clausing Danielson Dayton Heath C.Henderson Israel Kees Laing' Knupp Moore Miller Peterson Rasmussen Reedy V Sims Stirton Stirton Thompson Torrence Vanlvinkle Whipple Young Bown Har -V V, V V, l V 4 X , ,W ...- V- u. V 6 Page Forty-fizvc S fPhi Delta 'Gheta Vincent Borleske Wlilliam Davis Alex Bell hlark Bradford Clark lickart Eddie Buck John Caley Frederic, Gibbs Paul McKinnon Founded at Nliami University 1848 pVlLSIl.I:7Lgl07l Beta, Clmpter Clzartered 1914, W'a,lfrcd Holmgren v Stanley Atkins Gayton Bailey Lynn Croxdale Paul Anderson Kenneth Davis Francis LeRoux Orville Lee Number of active chapters 95 FACULTY John Lyman George Marquis SIQNIORS lyilbur lflckart Ray Forquer Lyman Lynn JUNIORS liugene Klise James Ladley Showalter Lynch XValdo Harris Kenneth Nielson SOPI-IOMORES Saxton Ferrell Richard Ginn James Hill FRESHMEN James Monroe Alfred Newman YVorth Oswald Alfred Parsons Edward Ruby Lee McMurtrey Clarence Monroe Clayton MeMinimee Henry Taylor Jay Reynolds Harry Rothrock lidward Ruby Daniel Tilley James Ycnney Henry Napier James Richmond 'Walter Ryan Payne Paul Lyle Pricliett Donald Rader Paul Stewart Maurice McDonell Mercer Yeager Page fmyega' . , 1 r . Q - .. H ' if l--.aff V : Qi-122 - '-9 .9 ,. .,Vj.g.5: 5511: 9-1-If :- Q, 'Vyfz-: :S A -5:12 -S 3' jigjgf 1:5133 ' Lf ki 411299. fre- 252:22 Al Q-if - 'SES Vx' 'lggggg H2351-VfV-' 'ig3V Qfiiif -L? W' V ,V1' .-Aw. .-my 434.1-215, N n'.-:.:5vYv.m:f-up,,-wf1mA1'fv-123-:er-WK-fw-:7w,-,1'f-yf'-wg':pf'- A - ., ...T .,,, ...,..V,,.. . ,, V . . k M ,X ' ml I ' -V '- ' 1, QV--Q---1 f-.,f2M.wwQM .-1-.-:.-.V-1---:-:.r::r:. -V-vw-www---f --V-fy:--f :.y...g,,:.,,y.f,, '- 'f-4+-www pw- 1 ,951 ,,z,:?'n,,g. 1-.g,,g --g.yg:3:5:5:, .11-f xVa:..,wim-.521 - - -V Wmf,+,mw 1-1' . f- -iw , . -Mesa-fr:ws-.rqf-W . , -:--me V.. x-W-www fn . ----z.1fQ4f-V . ,.V'- ' ' fswfww - f -1, - . .V .MV I 212.55 ,WW-7 fs -1. - , - v.gQ.vQ.:-,.-- - Vwmyf-V - ,ff-K - -2, . ggyv-4 - Q ,.,44r,:,g.s. 3-'-gyrq, - pm'-rig V: 1. A ..:,:,g. 'Qf,f',jgi, -'wg4:'-jggv ' , - 15:35--1 , . gf - If 4V ' 2,7--A ' '..,,1N.-y-aww pf,-.1 - .-M ,ilfgoy : . EGM? ry,-X. f:5.,. ,,,1 ,Way ffwzf 1--zrfewf Va V Neg . -f 25- -'fc--W JV--M Wir- f-- .,.V.-.:-V--?-V-ew -::.a..- . ua g --.4 1-riff? vi : ..r M2 25-, ., .. -112VV:'-- V-ff.. 4. ..:.z-nf ,I , 1 T125 5'- . ., ,,,-,,,.,Q.,.M,., ,s-V -.,:,:,:.- :M .... -.,,.,. ...ff VH-1. fr.:-1 sv-AV -....:v--::.:-' .Vw W , 4 -V. Mgr.: Qffifatafflici- 1'f-V'- -V wi:-:. ! V,,5V.-,.,, givyf, 'f' 'Gi tm-sziiraesmil if ..-If,-'-Er' f .J fwifki- :.':'Z-?f 22,27 5 ' .IW .wzw-.x..a4N.V, ,f ..1V-:::..,f,:V 4 ...L .17 -3:-f ,mfv-2. 1, 4 z-Q2-'MV if .f A ' . ' . . '92, 'ilgzliflwifliwafiw f-1525 'Zlfl X71.?r':' , -4 3'f52 !f'E. ' ' l'fQ2f7','fV-.-,G -5221 5.3 kai, cw ' JZ .- Y. 422, .,e1f,sf-f -52. , - - - 311433--I-. - V 0?5f?iV-if-AV If -wr ,f zzyguzg ,gwff ,v..V.,.gV..,,,, , X736-f - my M gf?- ' Wi-rzpfr. V- - :yfggf-,Vf-1'-,-zqgggw 52.3 ' .Vxrfv YP ,Vu-I-Ig--P 2I:E-125'-, 'M' -.,.,,22i' 53,9 ,,,Vw15Qgf ..x- -. :VgV, ?, x -'-':': gf . ,5.::,21:..,..V. -fffif, f 1' V-'gh A ..Lf3,1q.,,,. mayffgf-Vf ' 'GLJQZQ-2 39, -5 A,..fg:,2.-5: '-'55, Vfg.Vff3-9' VV-V I if .V5V,:Vi 45 Eff, 1Q'V:,-pq-Ziyi, Q. f VV::s.:a.5 HJ. .4 'I. '2 ilk? . :a2 pl'-V9 I'1:5I Xa.:-'22 L,Va-sr If' V-'gif--41 V ' f.q-f-:mmf ,31,:':f5S'-2 '..5 fl .5232 ' .- ,. .':jj':. 222952 4, . 4,3 IEZPZE, 22 ' . Wi' -7E:f:EI- T51-1 245.5225-' 9 .g1,iV'. , X '- v iwcgzg 5 -..-...rg V .-:T V. ,V 'Q' wfixfi :-:-wih-'J wry. V :, -My '-512' .-:r.'.1:'-.-42-2I-:P-'-.I-:N--1 5 f -' V '--- AQ SV... -.Q V- .fa V - V .1-,.:.,:,:.V, .,:-.1 , ,. :..V-4: , V, .V.V:--.Vw 1.1 . .W . VV-fn.-L4 ' - ' 2 '- 3 Va. . f -- -, 4 ' ,.-Leo... V.',.V Y-2,-' H2255 . - -V .V . n ,.g- -.V-3-.5 x ,,.., Q . ,,,,:Q-5-,-.-.4,gQV..gV5,-V: 2. , 'wwf-V-, .VHVQ4-of-gf TEX -. -V.. RQ..-W.-w.--QV. nv M. V ,V.,,.VV,Q,.,K.q,..k. .1-..V,QV,.. . ?V,.MV.3Z,V-N-gzx P W..-L.. , Ml if 'f?'f0. P iff- 'fg .,f iSIfj'.-: -V '.wf..-121272: x'vf?w:w4 , ' ,- - , -' lgzieggq ?1gQg4gstQ1Sf2B' Q... - M V if-rv'1:,:V5'-'Qty-.p:'V2:7 - ,-.u4-..,Vy,.V.- --:zf.1.Q.Vg 'JMS .t.A'Q592afCll .:.:V:-1 19' .VI X1-VV +--f-V?32.5feV12 M111-W I if . Q X .R .ffm-A.. . . I ,,V,.,. - VV- ww.. ..V--an-f ,,--f. 1.411 V, ,4,,,,.,4. ., ,VW X.-.vw xg, 51...-. . ,. ,. -,-,VL . V, ,,,z,.,,..' if I ,.--.V.3...,,,f,- f:,.fV-dyf. , bl, ' ., - wzagrir vaimwwifii-s1'1 -' f i5'3f33ZY 1'2I. w- f m .ff f 2.Vs:VfVV.:sg-.V .,,,,, ,ml .:..-., ,g , , .4-.-...xi 14 , W.-zu, .1 -' .1-:M-z-1 f-- wt, '-ff: :-:,Vff:w- . . ww. .V--Va V., mi... -M,-fum, . V--'::,.,:-' Ma, -.,V-::..:4,- '. ff :em--,----1' ,f-:' sm. .f ,gf.g.5.,g eV.4VfV-...gd - 4 rg. V ,,,:-yan-.1 . .-5-:gm .. g,,,,-agfgyig-brew 2. ' .... 5 - ,..Qgr2j .,?.Qf3xaJ.-21, , g.V.3,:f,l..a-.- ....-::'...:-1--1. YbV,,..,.,.: 60:9 ., .,,V 'f- -Wu? -'.':2'f? fig .-.QQ .f..,-V .V ..V..f. .,.,.V,,VV,-. 1--Q'4f'::- x-f'fV sf'-Q:44:2:- -wi-v-V -asiisisisfei5---f.5 .f:-:,. ...'fE.V:31' fi-:,V V-: Esfkilfgxyfff I ,ff3i3f?-V' V - -lfa':.V.'.i2f?ZEf2 ' V ,...,..,,,. ,.::..::-...Q Vw.. - -- A V- ,- wp., W., ff- A -5.7 f ,, xS,.,--.-1.3m W..-0? .4q1.:...V... 4- VM.. - . fe-44-wa.-V , -ww .- M.,...,fffh.-MQ -I V f V--f ' ' Swv - ,' 7 V emi,-,. M, , ...,, M, 1 9,-,,.V.V.,.-1. ,,.,.,,,: f.,qa.,:,..- W- V, ,.V.,,-V. Ag - ...V ,V . :-3 .,v::--H -:..:. if-:ew ,.,,,..,....,.Vm..,V.VV,-,W 5V-V-' :' ff- g ,,eV w, A . . : . -Vw-., V. ,,.:V-raw'--wc'-Q-+V. ,iw . a-'-fwgw,ggejjw-f:-351.314ff'w'z.ef.V. .V.-fsf-VV ' '-Jiiaff' -za-...:2f2:.Q . - : ' ' ,S ' -' ' . ' FI' :..I2E-513375 -5-1 323232-11:31-,.' 'fir ' f-55?-fZ:::i-I. ' -VW'..ff-55' ' . :lgypwfs-'P ,,,., v:g.:.::4u-'--.v-faafff.:.2:z::f-2-2951-1-1-f:2:5:1.:.., .'f'f1':.-. - 2Yr,Z:W.,.,W:E'..:'?' .' 'N' ..:ZE:E5! b'5.' 32-Q--QJHSGS 221.-. X -1-22-V2-S--.2-:Wg-W' . 6'5'-ifffwrzwply 1-f--fi-'- E5 c,.,5X,A-r, . y--.-.w,.-,m:.- . as f Vg-bgwm g. 'V-.nVg. vw'-.V-0,14 . VwgegV.4.,,,f 4 ,. ,. ,.V-4,-'fra-41. .V-1-1-Q M, --.- M-:--1 i--.-ff.5,, .. . .-4-5-.V.w,.,:g1.5:.:.. x, -MVS-V.V:Q' ss - fxmfw x -2.-. 'L-:f-a,-:-.vjfb V: sf Va -fvbvkg sy.. f MV, .,.. ,. ...,...,,., ,y ., ,,. , -V V. -- W 'V3'. ffffik if-YV ':- ' 5 '- P 'f:?'3-if . 7935235121:-7-1 -. 1.- F if .. :znssfi '11-S:-5, az., ., 9952 - :avr-31 1. 'f 'F' :- QV'-G-f'f-1 J 7 4' -:H .. ,22-s:a:,--., ::-.-- was A J. ',..w- Nw -1. ' V-2-wgf y . -' .5f5f5:,-311.115-. 5,1-5-.:..::.:,.51.:f ,A - ' . .Jw V y me -V .,, - ,,..Qo,Vx ,.g:, . ff V-,,:.,.:.,.. Vi-V My -., - .-.V--.W-.,,.,,, .4 ., ,.g:--V::,-V.,- ,,,.,--,-.:V ...,n...., 4 . 4fq..,.f., .. ,,f.,,.,.f .. ,f-mf,-Sr fVVV-:V--..,f,.- ,, V. . A if ,1V,.l.., V.,.V.,.... , V ,,.-A,-:f ff- f- law- 133. . - ee.. ,:-:,V- -..f.,:-.. .41-V-1-A V'-A-wi -: V- ., - .MQ-ff V-fm.:--zz-215: - .V . I-. ms 1 .V.Vf.V- -f .w..:.- 4 f , ,.-+V! 1.--Vs-1-I -mf-' Q.:-V, VVhrwvfd,1-mf:-:.:.-2:-. -ff -, .,,,m?4 ,,,-,-.,V:,V1f -,VM - VM... . , ....p:,.,.....,n ,..1,V,-,- 1, 1 ,, H, w,.4:.V.p.V . ..::,.:::.::4smf,y,.-A:, ,--- ---- M 1, g ,.V-Vffgw V.,,z:--, V14 f.-4 v--Q .Vf--'-1-vi 9 ..,. VV '- :fu -:argl-' lv .-.wzzc 35 -:1: '.f'-'v ' ff '2. . 'JV ' 1 ','2f'f :V:1, ' .' . 'ad'-V--V'-1 '-':'i'T-12 if 1-1217 ' 1-vez-. .f-'f'I2 1?-2.-gf-' 574'-f'i--9+ K .... ,V ' , hir u ' ' 'V ., gw 21... - ' ...Vi-ESM ew :Q Mm .- .Q ,7,,- -2 :.-Vg,.:::--gV:.eg. .-, -,rw .119 9.452 '- -X 553-e ,p V ,if-.fb 55533. V. , . e::...2..- - V.. ,.3:.mi, . .f,,.-,Q-. ...Q y.V:f2 ,'wQVQ75?Z-ff ,:y:,','.'?L'f2 .- ,P V.. X :- ---rw .. qc- -g,,.gV, ' -,Vg . ,-1J1,.r'1:r- .-,.- ., sw, , .px ,- . , v,,?,..V?:4 , 0' 45:2 - - M ,VMMWQ Q. ,, A.. ., ,V N .,,A,,4f4.1 . .. ,,,,,, . .. Nj ,,v,,...zff L,V,...,,,x:gW 3, ,,-QKQM ,gf 5,-fafi ,,.,,-.. !.,.,..4,M- -asm-S N34-a,,fV,.,9w3Vg ,fr5Az4..,,f9,3J Q-fi.-Qf5fafA4v2.Qg,'4' 3.565-3' .- .V . -:-- -- ' , V, ..::,4--- v .J -I .-. , .kqa-,earf ,.:1sgV.., ,Vf -'u:...g. -pwwfg, -- ww?-MM Y - - - x -' ' 1 -f , :. - 1- If-V A fa.: iaffew Vf'I-if-ILf- 1 ' '- '1.1'5-:Vi2If.. ' f wif V. . V- 'V -V GK? ' -QV-ff-QQ? 22.-1:-. -7.4 - , ' aww- i ..:5z:.:a -1:VVZ.15.?V-' '+'1:f'...V'-2:::e:y ,, I'r wi WW . 2?Z:1QV5ff qwV--ff: - .::, -.am-:-G: M -V rs-:. 4-fd. V- 1. -gyff - 4 :via Mew' ,.., -ei .- - - V -V X V ' f ,w,N..w, ....5 ,.V. .. ,.....A,. www.. . . . .. . ., ,f ,Vw 4 . ,Q .m 4041. . . 4 ' W-Xi.J: :f Q..-w VV 211. ll!-211,43 1 ' -- .- -mfg ,a y gV.-43. Vywg- , 5. wxw, .W 1,59 ' , -mwa-MQ- -Jigga. -.gf-r - . . 2-wh l aw - iwwmk- . :PVsCl1-:if '-3- ef. , - aww-r .' :.i':Va.4zg,:ummlmmM12was,wiM.1-awzr.-::s.1:,Q-,..,,.41A:,..:.wV......M...-.,.-:V.Vmm.oi.,--Vwawyaa-,,M,..,1--Q.W.-..- -. .VV-4---: --:wa-Vwr eq-4 Bell Bradford C.Eckart XV.Eckarl. Forquer McMinimee C,Monroe Taylor Yenney Buck Gibbs Harris Klise Ladley Lynch McKinnon Reynolcls Au. B .1 Rothrolcgx lllluby , - - V , . filley W1 son un ai ey BFIG Ginn Hill Napier Richmond Ryan Davis Fields Lee Y LcRoux McDonell J. Monroe Oswald Parsons Puckett Stewart Nvallace Yeager V. Mfage Forly-seilcri 4, .i xi 41 ii .,, 1535 me-1. 3 Q 2295 ff? fi' 55333. 121221 33553 1. JY. '- f W W' . I if: 2-1-sf ' :ii ' ff Ei . ., ?i L-.M-.9 Q 3 Q 3 -Q f Fozmclecl at Nlzavnz Unz've1'sLty 1839 gg Gamma Zeta Chapter C1LIlf7't8'I'C?Cl 1910 231 'gg :Sir In fs: T . WE jf: Number of active chapters S6 ' FACULTY Louis Francis Anderson Chester Collins Maxcy ..o.. Qr:-:-:-:-:oz-:ff 1 W' 'x'-'x-vx'. SLN I ORS gf-fzgpffbi ax . I,-af I James Clark Carl Habenstrelt 2 0 Merrell Conley Robert Meyers Carl Connell Stephen Penrose, Jr ' Paul Schiller l ' J UNIORS P ' 5-S 4 E4 Charles Baker Robert Garrett Kenneth Casey Osval Jacobson gg Schuyler Darrt Judd Kimball f , Dexter Fee Archie Marshall If ' John Forsyth Orla Moody Daniel Gaiscr Thomas YVoods SOPHOMORICS Harold Bagley Ralph Gibbons V Robert Evans Ernest Kohl f v. . J LeRoy kicker Richard Rogers so Lester Wfilkens FRE SI-IME N , Fred Cartwright Norman McIntyre 4 -1, Henry Clodius Lawrence Meyers X E QQ lillwin Deyo Kenneth Norberg ,I Q. Clarence Elliott Howard Pfirman X A . . . 'Q X . get Homer Hachez Merlin Phillips 3.5 . , Y, I Rangor Kronquist Albert Quine 3 95 A V - -f . a - X, Roy Llndman kenneth Serier H -3 52 6 5 . at ' :ff A f - Gordon Manser Jose ah Vlncent ia li it E fs 1: f ikvffrffwaz aeazsxfrl.-frmfg-an-.Agx:za'e::293Q1:-Qc iil2f m'i' ly? :T Q54-atfn:-ww:-1'93P2SQ?f f34g?f33 'xf g:'i V 4' 'Q ,I -' , A . Q if-fbi, 'L-:,,-fczfh -A' . 'A 8-me Y 1' if 5254114 -it 9 ' c A -Vtw- v ---- L Page Forty-eight Schiller ,Is A ef- J .-:- K. if-. 5:1 3. ,M As f M K :-:-x-:---:A-:- ,. .- -1'-1-:.-5 -I-N . -we 5 -,.-.-,fy . .-.-N-,-Q., .I --fzqffs. I ,- All .TA ,-Q, --SQ SQ.: ,,.2. 5' AK 9551 Q73 A35 -GAAAAAAAAAA-A f I. rf .gg--I 1 I1.q5,2I q-.-gg 35,3 xg.-.II ,vigil .ef A. gy-Q, --, ni , -- u. TA51. Rifle ,,- ,.A'v,4:qz uf-45 Q35 ffm. mas--, St-1+ '- 1 ol.-:-:R Q ,-. - . - - -gg' A-1351-Q ,r f Aqfglg 5,33 351:-A, Q9jf:a.,.f1f,-, .am R -A ' ,C v' 5' 5591 .fl 1-2251. Zi ..-iff .f J- A45-AA. will 4' ,Q -fel J 5451, SM ?A?iif .5 A . ,I . I, S -Ra j Ig. -,x,.,-...gpg Img If I X351 ,IIIIIIII I ,? I I I . II Igffyfgige , ,'fA-Affqwewwf-ef-AAfsf-A:AgAA2A Aeflvwws meg1'ff-A017-A-'Aff-1-1-1-fefzmlv-Www -1.I, ,I - A A AAA - AA Q' ,, fm.. .xA -IEA. ,-,s,aE52A::12E.v1 .. a-zo 1- -A ,, A- A We - ,gf - - ,A -AA W - -A :- ,A . - . 'Q ff- A A A, , -- A Xrssr- A'A'-:A PH A' A A .Q.-. :Z-A Ag Q 2 I-::. if ,! ,W L, Mfg . ' ' - 5 ' A. A' - A . A IA ' 4. A. A - ' A' 'A AA:'-,5'j,, ,,,::f'iA:A,AE-gsj---.I-.I Ale.-2,-.W . ,.'1A- A-..A .,.4I.- , ,II., -A .,,..,.,-5.,-,II ...QA ' WEA-4--, ,--fA0f' A ,FW , ,. I A' A- -4 A-122. , A 3-. . A:i1E5'5.I. ,qs-Asf . ff Q-fe,-Q?Z2,e I.,-,A -av, ' , . ' W, .A -EAA Aw- - ZA?-AA: A , ,, A 2512-2 A:.:A:e:a am. ,l:s- . ,... A' 4:- A 'AAA W,-...,,--I -Ag --e:--:..- -:A:.sA E12 -. --35355135 , ,- A , I-1:15 32135, I A'?'i3' . -var: A' ff ,. '55 A A, .- 1, fAA3:2A'y iff ,if - 'Asf -A9 ff A' A2223 ' I - -13.21A A- ,.- I -,.g . . -. ..,, I II I -- .-7 -N ,y 4-,g,I.I,. -., I M ,E-.--,.:,I,, , -.,,4:.ff :S 2-11+ ' AM .:-:AA -r- --5 F A A2-Q-A .. ,A-S :I,-2.g-:--- 5.5.21-:::2rJ:-2,1-3 -A .A -A A ' A- - i - A W- , I ., if-I:. IM A I-1.43.5 A-A IA a, I IA . I. .I ,. ya gg? A-r AS II , , 5 A A. , .,. AA I 5 A'Wf A'2Ak?3 , A- ,I ,,- -. .Awww-M424-A A W- M- -- -. -.Q .,--A W-M .,-..1,wY.s,5,,-mg.-,-,f-,VM.,,W,.-,-,--,,,1.--Q-,g,.N.-..s-...,-..-- ,v.,WwwQ5,vm--5-f-mmm-,zfnyza-4,ff0:-w'fiZw fwfff-SW,-:,f'aff4f 'Im- aweg. ASPN.-falqps ALJ A -w-f-Y-A?- 'N-MAA-5-4-uf?:Q.Aww:-2-.4-:--5--vs-we-2-Iyleaa:-.4213-Q42-,g,,.. .,,- --.-1,gg-1-,mwgggM-ffe2Aff1- - .- - W M vw, I I II M..Q9II,r II . V,..,4I0, ,WM-gsIx4fIf,, . MgII.W,,,,41,f ,. . .ff.ff. .. IQ, I- A AA sm.-.gy .f:,. xcggiizd A-QQ Xzifei,-I-if 3: 1- -. A- A 47 .,. , - -A - - 3-251, ki-2.2-2.1 ,-:E H 1,-ff :31A,,E:- -I-1 4225: 1-MAH' -- 'Z-I. ,A'I' ' . - A-i.,g.- -A MA A- -K --: AFAAJ .. .- wiv - A-,A--1:1 - .A ri? -Q ,A A - A - A -21 -A . A. iii? --,A::5::sfc ,. via? ., A f A'A' ' - A A .. A- -122,5 Eeliwiy 'af' f' F M55 AA N? 35- .i1i'?fI' A ':'A- . ' 1'-5115-EZ WY A- 511.2 in iw -95? 52 -. A' A A-z-:rp -'aus-1. 2 -, Arg -A . -2-,..f-11. gf. -A 1 A 'A .. 'BL-, .,- YI-I.,..,g-2. :.-.-,.q:-q:g,:-- -I-N ya XI- I .,:-am-.5 I 2 W- .W-.H -- -4. -1:-..-:ef-f ff- ,,:.AzA ' L 55 -. , 'P , 'A '- 22' :IEIGH YT? f .2912 .JPL--V -xa Am:-Q-,v.g,. -:-msxxv. aAA mx- -A - 1 , .1:-- N - ,:--- ,.-ci? A -CA--' v 1 g.-zz::-N-:1.- -1 --mag:-...f ' s-2 A A, :-,E , A-zz-: --gg -A . . - AAI-f Ar- gf-A Q., , ,-:ja . - -- . A- - -- A A ,APA . A A-A - -,AAAQ I I. A Q., , M1332-AeI.II -A1--A 11 A .-2-f:A,a-'ff-eff , A7 ' . Q., ..zz-::,--Ig:-4-Ay,. .a wg ff I--,-.-lp . ' A 1A.,AA-.-.... A -1-Wfygr-A A A 12- -A M A I - X. 1--A -so A AA A' . .. -2.4 - Q15 -1- A' A- viii.: A- -A B ,,. - A - A A , . ,W A A A i A .Ar ,A nl A A A - :ggi-AIQW as - -A ESA-AAA' :A' , , 1 ' - , -4- - I A 4 gg' M554 ' 3 - 52 5 :lr--Aw- - A ,- A .-1:-QA A AA A. - AA W-fwefiak AAAAPZXQ?-Av M4--W - .5 - -., - ff--1 - 4 . 92, . fr' -I 2945 .-f W-H Agwzcffv . - - , , A . - we - ,,z5ye2.- If Qgfwaife 4 - .. -, AQ. , A -3, .I . .- rr.-:II ....m- -- II , .I-6II,,.Ig5qII -:Q I I .JI ., , qw? -of II-5-.:e,.:-g,.., -'AA'EZ2f ' 1...,,.Egs,.g.-s:,a-A1954 ' A-ff fa-figs-..I.,..-,q,v'fW 'AW?'4 .gG -ge 1-r-I.- 'tems Xg.-Aif4A-.v5yx,.,1gyfA- - 4fs-fsA741q.41:- A9 .1-AA:-EA-:A..---1:1:A:AAIf:-, ---waxy , --V62-avfwx-. . . 551-.. M' M 4 --A :H - W A .sw , -wmw.,:-4 K., .- A---.fa wgvgys 45-1 -m,wIqg,g,. ,- 0635. Wg 5' ' ,Z 7' ' AAA3'1:., .AAA QAM -Y.2,iZ2.l5Zg2:-A .Q 5 - ,.5I:j1:A!. -If 'A1z.fg55EQ5., I . '3 -AY , - A'AAA:'Ag.I A A.: A472-M12--T' , AQ -A U E AA3-: I 'fbi' ,'AEIfA:.f:.1?- . .L AE-3 .- fir. -QS? , 1 53. - .. -sig-I 2335- ,ge1A,Ia5,z-3-III ..4fz- .55-fi! ,. .- ,. ,' . 1 W A. ' 'A' ., ' ig- - ' - -A . .f - W- , A .- AI .11 - ' , .... . 45gw:,1gw'II,I.:.g.,:,.55:g.g.:IY.I:g,, 'eff . ..:1.3112-,:.-?A:A..:--.. -14' -.1-as-ZEASZ4-23Ez:.:--. -1.f-5-EET24e:2A-L--35-592.1 'A-ffs6m2e?:fQfA9 w--A :W -A-wiv A?A.:s.3- AA A--A-3-3.221251-. AA .-S AAZQZA -rr-Azrffzs-A-.1--4 .,,-.:eya:s:A,A..2-. :lwei Aff.. -AAA as I.f-g,g3ze-,-I.W3:,- gs-fA::.,: -AAA- - .- . AA:-:- A Aw A- .-2-A51-:Z-Eze .AA - , ,. A g.,-5-:.g:.55g, A A ..s,- 'W-ff .. '- A1E1,4v3e- In' iii 'A A. 'A-.1 f2 A:A':AEizE-1zE- I 15 ,-2A::-A.- .I AA ', -rf -.Ag: A -is-A 5113:-.fa-:-Sv, A -:IMPEIF - -- I,,,AI:11f:- 3-ig im ., . , A .:f., 4,44 :VA ,g-2,52-If , A - -' .I Wm, I .W -, 5 -3,4 1,544 -1-, ,, 5.A-gm-.:-:,g.,,:g,g.g:I -9221.551 -::.A:,, --Q ,2:,::::,9:?. if A 4-A -A , ,. 5'::jAA1:'6: - ' ,I1 fa -, . A -A g,g- .5:A55A IA:1,2f-1259: . A. - -:Az ' -,g A ' 111, .A -ZA'5A'11 A ', If A' A, 1-A552 4 A 4-1,--. A-A-Aw -If-1-A-AA:A1AA A -.LL .AA'.,Q:Af',i1:fA- mil ,. :-. AA A .-A --A--4.1-rss 1 A' :WE -5:24 mfg- A 1-ff---I. IL-A. 1. '-A 21 f. ,UA --AIAA ' ' AA M2-:ff H, ng ,gr -1-..1...:.,a ,,,,-.I,I,- ,,,..,,. .1 - , A ,v.,I.,g :wx-4 - 4, Mm . ,WIK- -- - . ,III Ig. 4. I I, I,-..--I, --Q-.Is--, :I A- 1. I..I.-4. - 'Q ., ,-,-am,-I I .gr .. i s A55 - A. ue.. ' ' A, -. . ,I . 1- 1- - -I. W Afv: . - 21 A1 A JA' A2A:,ZA'A...,.. - I A-cg, .f,- I 'A--1-2.--.1 ,AAAS-A2144 av - w2nM-.,-f-.- -QM ,.-W? QA-. , ,..- .. .- -....,.-... . zum.. A - ,-,-.1-,Asw .r 5- A - .,.g--A-Q ,, -, , . - 3-A ,A ., -A 1. -1-4- A K AA .551--A: :s-, .--5 --A , 71.5 IA2A:s-2 A A, YAA...-f' 'Aa .- 1 , f - . . -, A . -, ' A . QW.-A - -. , .- w- A ak AA.-3: -62.--,.-5A:'5Z:?z: 22 A A' i A' -- 323 ' . A -'31 ' .:-A-1A M45-AIEZAIEEA5 'YAAIA' ' j . - A 33' A A5iA5f-:A,' 'V f A- , E- Q- '-':-': '1,E'.'- A A, file-z+IV if f rw .I.,--I,--. I II QA Q - I - I - 5 . 5' ,- I. I3,I,?f,5,,k,7,I:,,,I I .I g .. -Ig-gm . .. I .f, Clark ' Conley Hehenstreit Penrose Baker Casey Dartt Garrett Jacobson Kronquist Land Mansfield Clodius Deyo E1li0tt Ervine Lindman MacGown I I Phillips Prewitt Qume SGTIBI' 2 Pfirman Fee Forsyth D. Gaiscr R.Myers Allison Kicker Rogers Cartwright . T. Gaiser Hachez Hattabaugh Manser L.Myers Norberg , . 2-f .Igg QE mf-- Y 4 gqrq-3-1:n.:f-raw- .5-I.,I I I Y :gy-.: I I . , I IIIIII... I. I-,I Ip., II 4-SIA - .qw --.--:-M-xg.,-nf.-xc-:wr--uw.,-, Ap - . . -,. II I: 2g..f VI-.4 Ie- -A . --: A- A . I A A - - - A ,-351 . X A -J:-I My v- ,A-I..1y -N. '..,Z,A A A :Q - -I I .II IW. Inu, A4-,Q,wyw,-. - .. -.. ..M..w,,I., 3 , II I - . - As----fn - 4- v-A A 2, III, Ag, fA..,AJL A-:ww all ,-Al',- 11---A X. 5 L-1.-.f AH V' -. - .,- f .c .,,. 1 I I - ,. - A- I-up I 1- - II ,I,. -l. I,,I xII.I-J V- .- ,A .1, I , J C ,-.s:.-.-:z1,:.,1fE-in.-efA --A---ff-ff-2 wa- if W.,-,X-.f - - A-Q.:-ee.-.-.Lf-,-v:..:-. A- -- Pago Forty-wziuo Sigma Chi Foufnclecl at Dliami University 1855 GfLWZ'll1,lL Epsilon Clmptev' CI1fIL7'tG?'CCl 1923 Number of active chapters S7 FACULTY Wfilliam Hudson Bleakney Howard Eugene Pratt A SENIORS Gus Coulter Douglas McClane Frank Conway Kenneth Garner Robert Goodwin Alex Campbell Marvin Fetters iloseph Bailey Fred Clanton Purdy Cornelison Calvin Iverson Robert Lloyd Page Iliff-y Lyle Melsaae Louis Olsen Jean Rornaine JUNIORS Melvin Jensen Arthur Jones Kenneth King SOPHOMORES Loyal Perry Donald Rennewanz FRESHMEN Ralph hlarsh Clemans hlerchant - Barton Moriarty Harold Otfesen David Parmeter James Schreiner Vllayne Wlarwick Harold McKelle1' John Mathews Paul Srnithson Carlisle Roberts Gene Spaulding Donald Rosenoff Kenneth Shields Garner Talboy George Wuest Geoffrey Yake .w at-. N. i - .. IR aye? H-'T s ew. 99232 :Im 5221: Nfffe 'Em -'I:2:1i: za 'ze ' 1' - . - .-.-A Tw wk .- Wg. .w -Q 4-.- ww ma- A.-,-.. .- .- : Q? 1 - ,QW 5' 2-:-xl grigzk .-.fi L,-rg 4 Sr. .v L -Q ,X 'f -:gf 3.3, 3,4-5 ri 1' j.-g, 2,9 4'-25-3 5- jzlpp j.,:::5bj 5-.:g1,,.:.L:i:,-I-V-.' ':l:fZ jr . 5' 5 .P ff K be , ' , ' . , '- '--'W 'Rib . H -isa 5 1.-liz. 121-2 ff :Tv 'l N 2' A. '51 f7g5'5'+ 12? ' pigs A.,,.-A-fggszzyh 3234 fgap E .. ' . :M l wwf 'YLQS4 2 .f 9' ng 102-216. 4 egg -:-'Sill 55522 -.fm .' - -, f . fi. - . -sw5+m:.- 1239, 2.-:fm me, ,.1Ai'.,. ,, ,510 5,93 '-firm.-.-' f . ' af, z Q 3.5 1. 2 ze' -5.1 PM-122 in 52 iv.. -11 - 1 '- gi -- f' 7' Qrfffvfmw- - .. :.. 11. ,v-ss-urs . 'fr1H.1.z12nmw W- -' - - -ff .2-.f-- ww . J- vw.. Q -, N-ww, .ZW .12 W, - - ,- 4. 55. ' Gul li L Tiff:--all-4:25-.'ff' . .mfg-51:-:.f.,. A lv I Qs' ,- 5535459-15.7 sggz.:-rzirzfgxlf..-my .2,-ze ..-: Q.21,.f, 1 S. k: - ,..., . if ' P g fr :-: . -- - --rw - ' -WS 21252252 y 'rx -ff 'W we ,- A- -Z 2 1 2,3129 Ms:::2-'r-.2-- .1:2::fr:r:r:''.'-mr.:-rzl ' y. 2 - v 371--5 as-21:4 f.:.'.-1 Y f 1:-:ewefzsrs Mi' . .H '. 47f -4f:,,.. -5 4: 2. f WSQQM 1....:..:.. .. ' ,,. 1 -:wu z c,-:. wr.. f-3-.z:.3fr-mf: -. -. :gr :-, 4: wg.-Q5 q.5g:...:-51.2. -G-:P A f . 55-:Z-ifz' g .7-. mlm .,f 5.5:-5 ,.,:. .yy,.f-ff ly 3 Ei . ' 4 - 1 . T72 51: . : .S P- - . 1 Q f f f C 5 . .1 H -2 1. -' x . 2 .1 f ' ' 1 . 'IS ' :Q 1 Q:-L' WH f ' 5 ' . I J'?2.:f N ' V? 1 --Q3 . ' - .' 75125 .1 -Q 3' -. ' , f f ' 7 la.. QQ M A :2'i:11.. ' .. .....':r :j,. ' Y- Q- S X. 1 - M3535-Q--1-, v ' ' ., ' 2: an -2 ' :x ,:2:i-2-:'f'-:Ml '1-1-fif52:.. 1 .f? ...sz-.rv :..:. frv,v3,..,.E: gg . .. .-.. -121 .4 -9.259-,.,.. N.. ,.,. . 4f2ge,s.z,- ., ' :2'.-.-'- , b, .. . N2 . 135- -:wi Q5m..:.,., - f s -. 9 V. X 5, -- f-- - , .... g - . . can ' .-,.., ' X -. . .sn . :ziE.:5.... 'I-'f .. 5:55 -1f.':- 2' - ' Q- - 2221: 2 5. His.. ' ... f ' 32.1.2 . 45 ... .-z . ..-93. ij 22.6 5. 15-5 ,,1:,j i . 2: 1.12 'i.f2::1:g21?'-1521. ' . . - .1 2 z f-Qs. ' .3 .. .iw -. .N in - f ' - 'szzg-3332513 f- M5155-f f.-s,.:. ' gf:- 1. - '11 I v ,X 5. . 1 A, , 4 .. mm ... ,. ' - .1 f,.,:,..5... - ,. ' ,. -- . 1 -2 . iq-5 -,mg--.3-2 Q ,V .- ' - fer. ' :.1.3-g:5fr65' -1- 12 1.-:ZEf7'E?1If1jI15' yr- .- :- '-Q ,Q9 . . -. -. . ff 5 .. ' 21:5 -- 3.2:-an ....-. . -fi-fr.-'fi-5 '-511st.-f::i.::- .- f .Wiz--3 ' . - --2251-:fm .Q fgzfs:-.' .- i-142.4 -. .v lf . ' 2 . 23 f f , mg. - '- Ufw--' --1-. '-2:--5 --.C . , cv' JA -3:31-5gf', --if f f-'--f.,.j':'r.l.g- 1 5, Y i.'4,: ?i,?F'.fE '- .fi f'. . -N - 53?9:f?5'?f'5f? :9ifM.. Il-zi'3v Y ' '-For .. ' .Q gg. 1 . ,Z ,Eg Q.....f35,.5pm,M,,A.,.. A ..,,..,.g,h...,44......:,ff M... W,.2.s...,..w.... A .7 ,. . - 1 1 . -' -'-' .- V, I - ' ' I f C 'lil - - N Q Fi 1 ' :S ' ji , 4: . .,.:22Q71'?-5. - .-1.2. . V af' Sw .. ,g3f'g.-4 'V 5 +. . x 'R ' , Y. -H ' .ff .- 1 - Zi: - ' gl w'ifggw.- M ,.f..-.Q -- ....z--izffslagam.:..--- --l..,,. - ., '-fp., 4agMb.., .- , ,,-..w-- V. K . . 1 5 - - :A . - '- ' 3 5 gg -' -- . 1 L- ff M 2.-- -r. 'f .. . '-.fin--2 . ..f::.: . '- 1127 - ...-21.-.':'?' - . -4 ' f 1'-4:2:1:3'. af:-:7::f5: 21 4.F1E.If:f2.- - 4? 2 ' 'ff' If 2511-2111 -552515 Y'5 51 -f '15?:f:7. 1 52195. 1'f'E.1i 2-E - - 14 - '-1 -' y'A'f-.' -WZ:--2 -vw 1.1.2.2-1-1..-1:..:' ' -- 1 .-sm: - -.0 1 ff-ZW-0 uv.. ww ' -': Yi . A . 1 15. ,. , ,-ff, 435- ff-M .. .. 1' ,.. -.-ww .4-. - s , f-74-1, ,,..., - . , f xl -1 -.1--Q f , , -. .J , .N , J ' . - , ..-...-7-9... v ??'l35' ' iffy-. ff ' 'f' ,. L2-fl. f -.5afj:3.2'g-g:,g'z:p .,..,,Ei5'I'2'.5153'fI5f1E51?jQ:.:. X'Ei12Z.F - .'LZ..,- , - - ' A' .1 N f , .. . - ' ' ' ' . ' .. -'-'- TA gg - .A 1.-j 1: .4 ...gf ff - M., -f ,gs g.q,,:5: .Q- :Q 'P - ' -. 1, ,e- .5:2:' ' 4 -. .-1-.fmz:,-.f'-..1v ... 1.-.-1 ' .: .., A fy lm:-f 2' -1' .Y ff. f ,. ,mfg :-' 3.3 -, ':fgg:zw,.. 25:25-,' , , ---,f.:.'-gpg... -- . 322. ff? f ' ,. , .5-12 -1 ' -- . vw S-is-..1 ' -- .:.if4vu.,. ,.-:-..,..5'-f-2-Mfalfv ,... ,nf W'-f '1fgZfswF'-yfrqzf . -:mf '2:-Q-' M ...H .,,.,...,..,5.., ,e,,4.,,,..-... L , , .a....,..:.,.,,.,. ...,T.:....., .... .f ,,-,,.,..,,'.-we I .. ,,., Z-:f,ff5f.,:.. fa-. g.2..,.3n3.-..,,-2-W,..-..-,...f, ...1,.,.,.7.,, f f .................,. . .,., .... .... , ..,. . , . ..,. .. .....,.. ,.,...., .,.. ,V . - . .... - -. ...... . ., .,,.,, , .,,, ,....,,,, ..,, . , V 1 .l -yi--V .' ' ' V 1' 'WQ5f9'1-2123 ' 1' -f2'1 ff'- ii 11- '1 4 '7' 1 :J - - . - 12 'ft l ,, , , .f,4s..,....,.., N, . .0 . . .. 1 . PM . .-. 4 . 0491! , f f -9- ,... . 49955-1-2 69913:-!27JH1,. .' fi 'Ez-' -'- ' 5'.14'Z 7:?'l-7.1 'nw f S. . , ' tix? , V., . : 'iGS::f: Zu 7' 'J .fn-. fzg: Q.-,J-H :S-iggff 5. . . . , -1 .g.3s..,-.- Q-1. M: .L wr, - ., -1.11.-., ,145 N.. ' f'.,g, ,a:,.,g.W I. :-: , . -- . 1 A ' 'Q 3 . W E- '2 ,Mi . ' p sf: ' -' 'ff' . fain f ' if ' -2 , , ' .,...:: ,,.-1, pq., . V ,.:,.5.5 .v , : -. '- sg.-g . .xr--my , 'cf'-'H 2 f . ,. 25212-lrrw: .15 - ima? 1-11... , .Y.,-me if - -. x 11:6-5---. f 'S F31 -f . . .5 ' 1 Q. v-sw ..:.::'. -.1 ' Mew, 'f .g .f -' , , y x wg, .1 A, 25... :gygei , ' :Ig 1 zgflff .22--3.1 wx..- 1 13191526-.fg'. f 5533-g,:,ggj5,..:-1' -Hy ' ..... 1?L3:.-ig... f ' 'rig I I ,,,, .g.f.Z..5,.:.1:..w :- -M 7,94-4V4-Eff-sax?-1. 'f --- aff , f . Coulter McClane Mclsaacs Olsen Schrelner Wfarwick Garner' Goodwm Jensen .Tones Kung . ,I McKellar Matthews Romame S1111thSOl'l Aldrxch Campbell 2 X 54 Clanton Fetters Pel ry Reese if . Re,-mewanz Roberts Spauldmg Balley Colher COI'I'1611SOY1 - Iverson Lloyd Marsh Momarty Ottesen Parmeter , l Rosenoff Shields Talboy XV1l1d1Sh VVuest Yake 11- . . 53 L 1, . ,513-b VI 3 r X :ggi-5c.pvx.1q.-fgg-.nrag ei.. .I - -. I -Qff ..'.-P He. W .1 23'mW'52- f - ' . i..',,......,. .ff lx fi !'..5,. ..m..q,M I-is ,M 1 . . I .-1:-,-fn, -Cr.,--sw ' . fy' -:weomok ,-:qv il.. -' Ywcma. - - p. , , ,W , . ,. . .flu .wp 'fi ,of-' . I , J . v sl -,,M-Ma, ir!! if . . .wg . . J . 1 .1 gf' ,f'.f',, .15-. 1,-13.49 A-.. 2 1. .. -ugr.-2:-:ax-mY'-J. f- -5f-I-5-3v:6:aC2:trv1:af4A7f4fg-k. 1-,mm-r.iv .lycfdoniz-5:-sz ,, Awlx-..Fs.1Qo:r':5-:-re-:-1-:f Page Fifty-one as ,W .N 9 A 'Q-,A F3233 5 ,f 23:33 3:31513 525:35 sag? gx:y::1g5f:n-1' gzrszgq Q ,.,f::gff X ri Qta lll PS1 OU X , Esmbzislwfz at nfhirmfm Collece 1920 ' 112 J gg f lan-, am-my FACUL I' Y x Russell Blankenship SENIORS Charles Esser H Alfred McVay Paul Reeder Truman Garrett Gerald Meckleson Joe VVebster Homer Reed ' J UNIO RS l l XV alter Fry E Merle Millam Victor Rhodes Wfilliarn Galbraith Roy Reed Noah Richards Paul Gardner Arthur Schatz Q SOPHOMORES Leslie Armstrong Lewis Lutcher Donald Nevitt Bruce Cassens George Marshall Don Peter Tennis Johnson Edward Van VVinkle A F RESHME N Clarence Anderson Arthur Crossler Vernard Soper Leslie Anderson Elmer Dorathy Fred Sundquist Carter Bass Ralph Ellis Earl Tibbetts Charles Cross Ned Ransom Norman Kennedy Allan Shears iisvfomffl EMI? f gf?5?FW3'fU2fi 'i' 5f'fij,,- 5,7 4 y:4:--a:i5x'ren-ffzgsmw Q '4'E?ff7ffV 0f?475'1:99fW'1'WfW5Q75'fW9 'U V IF.: ii :l'm'l f,1li .1 l if cqcwzvmsiofsbwerwewreffrtc-Q:'wim1::f5'l Qgff ,,,. 4 QQ Q Q r,l',-gif If r filcvmcoii Q L iz iff 7 ,ful le,-wx q.l4.gM-'4f,L9- lass., 'A-g,.Lime,..r...,...,44.,:.t Q . 'k:i2s:r1.-:?,v::r:::-'-lv:-::cti1z.i:2famcxef.w.i1v2umQhl L 'u'aLx,Q.l,7 S54:Elmshim-Q2slzadyr-rar:-,ouvQ':rfx:5rf: Page Fifty-two 4 .a K-A N1-1-pg-9 mmm .ve .4 -: , '::-M994-rar'-A-Raf:'r'q U , . L -asv.-w Kam Aw A . pq V -.-.f Y -qf-amy-Af, V ... W ,, . Tl 3. H F2521 ,ef ' fir ' -Es Sf Q4 -A .'A 'Az ' ,,. .V. A 'A'-I-:+C-. A- 6-:bf rio:-1 M:-.-:H .2 V 'A' ,.-:W ,,'-1' T-:-:A ' .' 5 9 ' A ' at-FQ 'iff-3 kiffflfi 5' 33212. F625 5315.5 Q . - -A, ' -A we ,x Q: , 4, - -1-.h --.-.-. gg... :-:.g.f 4- -35.-z A:g.- .gf.:5!.5:,13g7g., 54 A 1 , r v QQ-. A . fi-M 52 ,P Am 9,-5:3 qi 555.-91 gi-.352,.9,4: P23352 Q 25, 2 - K :- GA A ' A' AN Arm. vzrssz -V :A wk effaaf :rf-rAA. -Qfzf -'A 1'-an M92 WSW Q wx Q 4 N. ,. .- f-. 1,-.--,Q .-uf--fe Q' 1-.-:.V Aff., rs-.aj M 1.44 1-. M.-V if A Vx, . T? ', . .. 1, R- :Air-1-, ,F w1:f:.1 ar 51A.-mfxfrgkg, 23-:fi we-: 32115 ,31.,,VV-...mn-efdgm +1-.4154 iqjfgg 5 sf. , '- ,.1- A V if-I wg: 1 ,f q,.- -:ms -:Qs V.,-Ve , r eq., 3.-:Q , 1, ,. A- N . 4 . y tg.. A V-,wi---222-ff+f' W9 We ,iliac-M .Sei A+m,.w- we-rm.,fV...-. S .. Lp' AA 'E i2 A 'af :gf fr .ww-----swsw .,.1. ,,7.,...,,,,,,, , M H lil' , :-A AA V1 -' 2-Af- wAmi:.An-fA'IA. :- A Vrfaiiwvf-0 .. new .A A VA' '-ANVAA VQKWW , A V Wifi? .!'fW2Q7 W,V 'WTA 'A - - A .- . W ' QV. 'f A 1A V-'- A V. V --WA-A WSVAQQJT ,.,. . .A WEE A QA' A' .A A AA: . .. .. ' 2 A .- , . 4 , 1 ' ' V. if xg .4 -1 sw ffm' fd' 'f A': 7' A:-- ' Q - 'A A A V ,- , A' A. -. . -. .- -, V ,. W. .- ,rms A19-fm--,A 1, ., ' 1- 1 'Ai VV V M! N' an - A-1 I-AMB-.. Vee:I52?2'2E5':1A5-:'.2:Tw. -- -4- .MVA -A ',f'Af,-s , -A '4fQfQ5Hp,V,. A, V ,j.Q,. f-Af , 5 ' , f-A1413 .:f,-V-AA Avpnf Vg ,,4Vi7':,,,.: Q, V :AA-1 is V A VV - 1 1-.5 '-'.'-'e ,:1A2fAEfr5 I , '11 A,1 :EEfi:1'F'2rff 4. 4:'2E5Q:g: . 'f5Cf'3EAj' - - -r- ' f 7 1'f.A.-327' A 3 .j ' 2- 4 -VV.-..-VK. - V . .,,-W .-..-..-V- .. gm . V. Q-ew: .--Q., Va.-M WV W. -9 ll :gf . 2255-1... .V ::r:1...H5.gA-E ak .. ,wk - gan, L 4 . Aff, V 2,-Z W - . . - A-1-:---:.. .Vp-M . 'fa-'z 2. A- - -- 'iz-1 , 'VQA Q, A' rg, , V.j.V:-fjgg., Z -' aging- :mpg-2-g.5:,-,y5 :gage 1, -414:35 ffi Q ,1fr.g:g- A, -'i q-,:.,. W1 ,, 1 f ia A' . .fl A V v ' 01492 'A ' '. V31': f ' ., ' Q .- 41,453 - v,.xf.3. 3515:-:5:'55 I- :7':K7'.-.5:ii'-4. iff'--R V- 3. -fV4 - -:I - A' :'.'! ' A I -1- . -L sf:-J., A .ie JM: 3 zascizaafif' ,. VeA1w:- A , ww - .A -CV A' Wx V S f Aff - A A .V .X A 'I AM V . A 8,mAA,,.,,V:-A, gg. new--A-A-AA -A -1 V. 2 .V A- -LA .V ,.fuy:,Q::,A XV gs- ,, -V . +L., V -A ' F3 '-ax .iw - ' -A 'A2:2 'A AV.-.Q-' :A L -A M41 .V-.53 ' ,A:L.,A1 A cf V - A f :ras-.o:,.48 i 'g,x,gA -A-2-3 E-A-32 , , ::--,qi f 4 I, I . ,K .Al gm., A - 'f ' ' V sz '-'X 4'7 fi-2 .- 521532 f.,3VIJ' ' jf V3Q . A '-:,5'A-iff? Ver ' - 'I - . . VM '47 'r?.1'6':-.4 A V . AA A- 'A Ml, ' 4 s ': I--S9552 4' VA V V- - AA. - -W ,. 4f,I:AAA.. :'Am22511w,1.A.f3Af:A,'aw-1-2'-'--'::ff A -- -A fA' 'H 1.:5m.f.iZAf W-145-,2f.iG:f . ,. V vf-f 1 . M214 -,VY I' '?!Vff .. ' f A- -V 'A -V K ,-13?-I' .. 'A?A2e:. V.A5i-A-' Af? 12- Q . A A 5' ,1a:I-E-11.2--iis zi ' A' . 492. f6w z:r' ii '-'Aa 'ffl VJ ,,.V .. ,.,.... . ,.,, , .,,,, . V .. ... ,. .. V V ., .. V. .V ,A V ws ...... :Wt-..'.1 ' vias- fV2A:'Z'if'Q x'2 'AS MWf3f.- V my '. ' A4 -- . 'V ' 2 gg 7 -1,4 55 .. - ku-55 A Vf'A1V,-,- A-.15 V .5 : fn- v A+ we :Z---A.:.' A AJ., ' 1.A ff: f1e:5AfA-A2AA'V A1A 1A:V A N X1 A- : 14 5 S P512 . A'gA,.fV.V.V2::f.g- Ziyi. . V .iwzfa 1 .af .A -V -. , Ti 1 5 iw A -. 1 4 A ' F2 - . ff V. aref1551515.135-'i f-Vffr-si-.2'fffi V1.::AV:A1f.i, ck-42 . Aw 'L , . . NM, . . V We .,.V..f. .Vw f4fM..W.f-.MV..MVV,,,fpW, V. . Q4 V 1 ,g g ,..?55,5y.:.,3.3,,.:,-H.-I.:. 65 -...,:.s,.1:.frgg.5.g-:V1. N'12,ivg:amf-fgiyw' ..-mga:-I-A-4g,,, ,W h 4?-,.,mV.Vy H. . 9 - A :V. t,7fi?.,isA? .-52-Aff 'XF' ??Z'i5'3'3?'5:C9 ' Sir . 'A , V- . 'V SVEVEIEQLLSA1'-' - .' 1 :7:.A2S259-W? 4, QV H- AA----rl.-'--2-Vg 'A'A:'-- ' ' Li.ZiA1:7ASiA2:. fb: . ' 1 :4 t gg -' Z ' ,V A2 . . ra 2 . We ::'- . AAggj43. V -VI.ff,. A 1 ' 225-AA' 42: JV f V2 5 : ' V ,i:A:V fin! ei- 5. 5Q:::A5V -K' V . .,Af-Exp.-, A L- I-E: 2 A ' ' A' 4 45-Aziegggg Q A, V .15 V' .f - 1-A A-A152-iw. .DA - , EAY1-'S:zLA1fg fA ' 144.2 :' X ' f .: vg,3.,,,,.,,3.W m,,,1.,A ,, ,Vfq egg., ,. A,V...,.V . , V.fV,.--WV -, :L f 4.15 'eff -an A-A ,VVV-W..-.. V4 fr :-: 2:CiZ1w.r..VZQVAEK,ff V1.1-..V-.-.. Am-A-Ai-V V ff-'-1-T f1S fl-V V 1:- -., f ,. Qi f ,. A -V x GA' ig- Ag-5 ' .Z1.-iz..-2. 1, T21 1 1-A53-. - s . 4-Lf: E5 42 A gg AV-. ff: new A 1 V -4 A.V:ff 'A2-A2-:ew -A A .1 .- L- me .AV Ar,-:fl-V-, f- .3- -.V,Vf,AV -Ag, -A -S H -665,330 -- VV,p,j2e.VW - CV.. ..:V- , .,.Vf:-A--.--wg. eh-gg, ff: A-4.-V VV. mi V-..,e. 4- V- V - A :I N -4 -A A . A -A -if-V5LV-.-Q....-,:.,1A--,ggej V Q, 4:11..54V:v.Az:...-192V-.g:,,, -VW., 3 : gr- A L' Ja, -Er Q ,fe . ...-at-2s.1A:.:'A -Lp.,-21-2-AAfQf? ' .-.521-z:z:A:em... yfifff, 1' S V A f . 1 'I v A A .. 1 V' 'A ' f AA ' . A A -. ff - 'WW -' AA? . . .V .. V .. . . 1 5' M wwfvi- df,-. V 1 . f,,55?,,,...V5 V. V. ,JV , .,. V w 1. VA A -. V- - W '1 5 ig . 1 tl f .V 1-wc. , L, ,K.-V.,-,g,..--V,,-V,-,-51,.V..V.-.::-V, f...-,V,V.z..::.a.'. :..AAAg..:f:-.L..A.fA:7. 91 1 , , , mmmaww.-AV, . y .. ,.M-MM. -M..-.4rV,W,1.,L-.Vq,...1.m -W ew:-.-V-.z.A .sv4.,.-f4,V.AV.,rf-.-snA.w.wm..2:f:aA'AA1q.2,,.,A.rzM:s-A-suysfff,,wevVVV'A- Q3 : 1 gs gf R ff Esser Garrett McVay Meckelson H. Reed :gg . ,gf Reeder Nvebster Fry Galbrauth Gardner Mmllam gij V R. Reed Rhodes Rmhards Schatz gf f Armstrong Cassens Johnson Lutcher ,' gg N6V1tt Peter Van Vvmkle C..-xnderson L.Anderson Q sq Andrews Bass Coppock Cross Dorathy Kennedy 5, .Q 5 O'I-Iarra. Pr1tcha1'd Shears Sundquxst T1bbetts .Q VA A A3 -V' 1, 221--1--. Eff-.-we 3,ugamo:QAk ,J A 1 Fifi Fi-y?55 ' ' 51,730 ' 37? gf-T X, ,g- -5. I-2Hi'65EG?63li-mfj ' Q? V - Wt... uf? sJ:Ij,a-Qi, .51-'AA-3'-7: if -ff ' . V ., L CFavhas-gc-Joeefszfiuc-.A::ffs'x1rn5::,v:g?:: Q .x 1 1, if fy-3 :Q Y - A' . ffl qgsxfzwvrewcibzaicfqgz.-fr-I c-swan A Ll ' as ' 1: .i.,A'J0, If 1 -lfggipcq-fit ff.f1?J 1:81 -.-.Arsvfzw .12 ' 4.4-..: 1 A . . ,,,V,. . ,V., V . A ,-'jc--Qs.,-A'Al:,.-AAAAA ' 'JS' ii:-.-141-1 I-ff., ' 0-:V-, y 1 5:-tm-mai' QE, ' Az, 4 V . -'A.1 . C . f x.- YV, -.','. , , 4V--N... A 9' , -..g,..:,,,. V .A:,-siizgubl-If. fix:A'-o:1SmQffr::xz-:ffsr'::'. -' 'f-5' 'A 1 ' ' .oA-s'-:+'-1-L:VA-.-.::A Page F-ifty-tlwee C N fx gfssf., 3, J qc 5, Wg, R .K , ,I J tv...M Tfffi, iii .f 1255534 sv. ' fa 1. vf,aeex.:.1 Q .1 4.-,wa-.-, ck. X 2 23 E-ga, 13? Q-E:122nw,f Alpha Cmicroul 'Kappa Jack Ahearn Ted Boswell Paul Arnold Chester Babcock Glenn Brogger Donald Baird Harold Cartmell Thomas Amos Lloyd Cassens James Glasspool Nevin Alderman Merle Alexander Jack Brooks Sidney Cottle Ralph Edgerton Clark Emery fe 1 Page Flifty-four Establisllefl mf Iflflziivrzrzvz College 1925 FACULTY Leo Humphrey SE NIORS Ted Bowen Robert Browder JUNIORS Hollis DeVoe Howard Deye 1-larold Fleharty Russell Gilman Raymond Hughes SOPHOMORES Howard Graham John Joyce George Lewis Robert Ringer FRESHMEN Albert Garretson Earl Gilman XVilliam Luhman Thomas McNeil Raymond Northrup Stanley Root Jag jimi L -.,. ,,, in al, 2.4 , N w.,,.,,1-X if Hin? Kazaa-:anal-,fi x1wu.Lo.Qf! Quai Doyle Northrup Earl Munson Raymond Meyersick Bernard Molohon Charles Ogden Jesse Thomas Milton Wright Richard Van Horn Vernon VVaterman Glenn VVhitney Gerald Russell Sanford Sherman Jack Squire James Thompson Allen Wieisman John Wlurster we-,vooee,,.,,.i. ., , e N - 'ri .'-::- Q -s-aepvcm.:m:fawr:-'I-cf s Q. V ' - -1 'e 'A ' .-xv, ,Ng ig, x , Q, : . ,- av: f.- 'S V? :wx.vasf54Q:.:-1-:-TV:-Zcexszafg. wq-54:7 -wg.-514355 wmv .f .yvgggg :,V-.,y.- 4 -Mg. , C, L-,MR .1 M, .. ,.. ..., lf W I w ' 'ix V-af l4:3 5rs 'vil'?27: I5 JY-tm I-Eff.: 122555 P.-Wi -xi-5-V :-:f:5,- 5237- P6255 ' fS 'A 1 .Jul .. -' ' 'Q - 5 '4'T:3?:V, KYLE ' V'V'-K 25:':5:i' 517274 11155, U? , f-'T:3:- 5512? Fifi-E' '1-:-3' ' f .0 V -V X Q V 'V' P we A? gl 95315 235531 -I5-2 Q' S WSH. ,V f--F.: ,K -- 'A ig 'V:-:,:V1- 'flrg' - . -:-.-: L-Q37 .?:'RL ,V-'-, 2153- Iggfj:-nigh? '. M3 ' V 1--3 ' xigizzgk 555:52 ff :QE Q ,.525J,1- . V V .1 .gl A ,,, . 4355 lc-'ggi n 245.513, 1 Vp:-so--eN'V.:V4 ggglgg 4-'.:V, L,N,..V,..-. 3, 1335 55.3. igig' . I xc- ' C gg: -. V iV-.-Vol-5 'Rfk 321213-ff Wi. afiii ,VY im :af Mig, f ru 1 ., . .12 . A , V--3 V-MW VV-14:0 .mm cw-SV. ms-'-we -fu.. .em --3w..VVVf 1e.Vfe,,-wV,.y, V- . x, V V:V Q., V Q13- . E , Q v . 1 -' 5- .5 ,-L -' -7 VV wtf V .V ., -M 2 ,-:ig.-, - -.r -. ss.v'- Bxgiyavf- . --K wwf,-V, M - ...,,,V. ,-.ww MW.. I ,, ,,. ,,,,,,,,.,,.... ,, , ,. .. . '51 . ' V , ' ,il in H fni ' . ' 3 .sl Smejfl, 'qt FIV Q- ...afaftr-121' ?E-1.3-,ii-2,13-552 5'LWi2?ffQZ1: Q 1. . --'V:.V.: 'Mixing .. ,' 5 '- 152 igii? 7 ' V - . ' 4 3'WM'2 U1-Flllil 5 fllff' ' rf- .VF -EI V .J 21:3-'fifff' ,f ,. . .,... V'f3 -IVV-ZZ 1 . -V V V - . VJZVZMVVV- V- :V-1-,Ml ..V:' F .':2-2:2,.:V' VV ' .' 5 . ' . -1-VV V.-f V' .V ? '4 f: V-Mfu. lsfazf-. VV 1 1- ' , ,- -V-1V--- VV . :iw 4121.-.. XV 5 EY V , , F ii XS mf' whiff? Vff.'Uf-'-'P42 fi'Ez ' 'Eff' V. VV fiiyizmf: if 9. .-K. gays., an , , ..V,ivy-,:ef:-:Vi-52115., ,. , , . -.V wV'-Vfhfaazig 2 ,., gS 5 ' 1.5 - .,,., . V- V 1.1 .V ' 5: V . f. V 'ff fEf1 E',':.. ' .f11f2'f.-Eff -iff -16 V. :Vw -' 'e V -V l 'KV fkyffiff VVV,:- V 4 555-2-if .fvgizjgs 51,-g-22... ' ipgzf-,5:QZ'E1E. EIPIEZEES- N 111 V531 ' EU: fe . -- pi.. V- V, qijii-. Pri- ...iss VV V Vff3e.': - -'I ,V if V , V -I-'V.V.Sf1Vl5!V f if'-1241 - . .1 1- 1 - Q K . S '-A 2-1157-' w.,:5....V . . V'.s15..5j:2 ,:,V,-:.g:2 ' -V if - l F? gg-., . 5 -II-:5'-'V' .VaV?i'2?fVE-:VE1-?'f 1f'2a..,, .ik , ,,.,.,.:a5.:.,,.... . -Q -'iVV1E- .I'-jf? ' A++ A , V51 V ' ' x 'V -' , . 52 5 .V ' -I ' - 35 , - I1 ,,V kv 1 : f1Cfi5'-SA 'Sm-E-E1:,. fl 5' 'Tri . g1gi:1S.-::'V2:- 15515. 1 . .4G2.4l2 .- - V- '- -' w2if. ' V ,I+-'VV595-'V, VV 1. ' v ,,,-.V-...LV . 1 :QM ,-Vsx-.:..V.:.:V, -.,...-.-:Q-V: -V-V:-:V- A. 9:-:-r.r:::, U :ff-H V: -AY . V 411- '1:r,r:':2:1:r: V Wy 'fsrs '-'s:V14::.fy:1 . . :1-V-V l- ' ff V -f415V:VVV' 'V -1 --1. 11 4551j1,..,-1 15..-1.-.VH-V:V, 9 :w s -.g.,:V,fg:l 57 V. V wr--. V. -151' ...5:'::, V:2Vk-X 5.3 K z:V.V,gf.., , V, mo 'f fm 1 92 V: V . V .fs we 'MV 2554? f 5 J 2 fi-' sf-25, .fg,2:1'5? I ' LQV' :E-lf5'35L 2'192 .V --ff 'xii I , nj' ' f ' ff . V 'N r E535ff 5 ' .13 :'.':' db ff, ,AV ., --.V3?':? ' V, . -xl 5 V 5: ,s5fg1.1j1':2. ' , gg' ,iq 5:15.35 W Z ' V -:1 :VV-f.2V-4 ' V sf . ., f V5 f- ' J V 1 ' ' V --41 1, ' S7 '15 l. H . . . , ,. :V-1-:4 '- -.. m-.QV -- WV. VV -,5.2:a::,V , . V f V,:':r:r . 1. . 7-4 a1VEV 'ffV.- 'V 5aE::1:555-5.g.,., ' e,.V ' Erazfif' 4, f- WV:-. -2 :4 aV,A.l'- 'ig' fm -V .0V-:.-..1:--..-VeV---- ..-VM . V.- :-V -V f. iifivhiig 2:51-asf? 2 ,. ' V Za,-5, . . . ' AMV-V. -- V-Q g V - . ., V, - W, ' 1... A. Vw .V fififfil-'zo Vpjggxa. . .5 y fVg,af:?-V':w- VVVfVVV.y,.-.mm - ---:-V----'VN Q..-.,.: fb- :V .-fa.: f .V . IVI mmf' 1?-E Q- .ffm , . . . .fxyi .' .W gswov 1 V- ' ' V 1 f-.-V11-f :5::,V- 'E' l V '-' 1 E l I 5 4 , si , ' Z .: 5-lf..-:.,V -V wife. 52423 -E1aQ.,ag.1. 3:11 .,,V,1e::- .fz,:fV-1 1'Vf ,V 59 V - z .V 'V V ' I K: 1 f . 1 . -5' . Vfyfrggy QW ,VV.-f-pw.--:V--....... E2 : - V.- . V . -- -V'V- 1 ' VV - gs , 2 1 4 4- ,.v,:.:.s.,, i.595VyiV -1-:-.. V 6,-.gig-,V..,V.-Aff? - - -V :l:V-.-V , -21,92 V .-V V QV?-:1V ,- V -:Y , :jf Vg::,g.:. ,ggi VZ MV, ,V 4... -, 5, -V -:. -.-:,:,1,..:1.-:, ' V. wr'1Vg-'-g,Mz- 7V V V -V V-V-nf-P -:rx-11. V 1:5429 V ' ws' 1-af. X . V -. . 'Q . gf 5 1 x 1 ,.. ,, .V -ggi-..,g V, .V I V-...L ,.-,-V1-,.,.,::,3..:V:.g- ,xxx-:1.:-,:q5--505, h, 51Vmg.4.,g:. , V.. ,-...p s ., 435.5 .,'Vr45..2::V.7.:-:. :,1vf.',, , - -5 . V V ' l V - '- - . ll . V :: ' f - . - ' V wg. . , ff -V - V ' 1-V :,- ... -,VgVg.g' - --V Q 2 . V.: V. 1. .f2gfqZ:,:.eV:4a 2 V -L - 1 . tiirigjgsx 425.39 1:15221-GV 'X -V f , W W- V V. V fl gwggffm. 14... ,,.v. 4,,g.:i,,,,Vge7. gag.---,,,V..,.., ly -. , qgfwvgffiz' 5139 if ,-s7'4yMw4.. ,V ,NV Q-1-.,y - ,zu - ,fm ., 5.',::,-V- -241.-.gr-7V61f:V -.L. :., '1 ..VV V:f ' gi VN. .:1.,f41E'Z1-1511- . V' .:V'-V ':f7:'-'. .V-. 9 -'iv:,LLf 2 .5e.2A:.V3V-35. 5.1 VV 4.42552 -'f1ZE3I::'.1f,gf3gff. 5, ,jV.-15259, - K 105.-.. eegvsfw 5.ig:.f- - V V' .hi-5:24. V:-,E-51, 'Ii-MQ:--Q .. . :Ve . .V V: . , .V .V - NH-. VV - was V ,.,.::':, 1 . ..,'1' .Z . 'fi' . ,gm-5:1-,V.Vj.Vg.j,A,. '1,. gi, 2.-:QQQLQ A: 4 ,V-. M- -w.V-.:V-M' ' ' ,. -' .:ef-5v.ggV . I 4,-,rem 5551 . ' V - -f. .. V 5'VF2:I!::' - - '4V?'-4'.w 3. e-' QV V. 2- we VV- - ,f fflkaf--sr .. , . . ' -'V .fVf V V' 'V::f- .-ffifif ,' 1-3:21 -'g QV V +2- '-11. - 5 e. .. V W '45 V . X . . , 1 . ' -' 9 -1 K Q . .,., . , x..,, . ,- . . Q,g,,,4,43,f?+ fffxjy 6..m:.:V:m-13.1.-I. nga-wwyffjff Vw.-Wwffmzaxy .,:.:-:-g:.-. ,ff-:.V fazV:,??5,V,:f,:gg G-Sv--Vw , N b' ,: 1s...g.--..-:rw 'Vm.ff1w2 ':---. A442-f::Q: EIQVVV21 ' 'ii'-V1 622341-V:V1.:-v.,.f--VV. :rr w.:.:f-VV? Q V' 211 N ..::- V.,-2 .'??w:Vg1 .gazgifigsf -' ' ,Z ,Viv-7-':1'f 'i.-521: .iii-f' VMVPPVV? .- 2 4. - + Vs '17 . - . f' 15 QYXVW, . -' -V ' 'ff' V-f2z2s:fs25z21.1-Vw . I V- -.f---13 ' 1' VV : f f ' f-ifsgf-12V -- -kg V. ?w2:i.2 4 'f V-21:2--.. -4-,Vs - , -ivy 4 ,55 -Q., V--f.,V:.-.V-.--Q-a.- V AV- . 1 Ag -:.g3:Vg',.. V:gs::f:- ,,V -gifzf: 2: 1, , .- ,. yea., - .- . Y ., . V ' -. 2 'L 5: , . - '-V1.5-pf.. ,J V ' 2.-..Iifa' VV: 1 3 5 ig ..., . 1 , : QA ' - lm l 1332 Bowen Browder Monson D Northrup Vxdams . ,V . . . I . - Arnold Babcock B21l1'd Boswell Brogger Cartmell 5 gg . Deye Fleharty R.Gllman Meyersick Molohon .. x ,V Ogden Thomas XVlght Amos 55 - 5 , , . . V rg Glasspool Graham Joyce Lew1s Rmger Van Horn - I. Wh1tney Alexander Brooks Cottle Edgerton Emery 3 Garrettsou E.G1lman McNeil R.Northrup Root Russell Xa QQ Sears Sherman Squ1re Thompson Weisman NVu1-ster :.Q,,,.,.-.Qi :-fb3g.7g,Qzh :',go:v:V:-1 ,V VA, 'V ,rv-f., , .wx .,5.V..M.....e....? .VV - '-V. .. V ,V .V ,... . . . . . P-fiasrzz-:gc:-:ws-atv:-5:1-osawesmsegecgfs - j ,J 3.4-' 'HJR igyzh TQ--'. - , 'E qxjmgmswrce-ff:-Vxczzgglsqzar-ez-1 mfr:-VVQ . - J A -- --,V- H- .- -,Q -,jf -GL: 1-.yr --.mf-.V.VV f'.,'g1,V 'AV 'LV , V- ' - l X ' Vg-Y--...sl f- .,',-pg' -is jfilflkwgtf M,-.1.l1..i .'1f 'fo'- - V-'Sly Q2,,T1.fY..1,.V.f V -- ,- ,gf 21-6-:2rL::E' ,g-..VV -5 5 ff 11- 4 L, ., I , , . ., ,- ...V N, in .,.. V -, - . f.. g ,, 1.5 ,'-- .,,....-,- . i .7 . 4 ' 7 N, ' QL . V 1 2 f z . V f 4'-I'-Ii iGn'fl.-'Ca-,I.I2S lEF'AY7l09J9.V 'z' 1' 'v P-S'1fIIi Q N . ,:-1-,:-:I-31-'Vj'.'1-0: 1-141-:-' ZV s ' Page ijfly-fi-ue Independent men Floyd Barton Wayne Chastain James Chapman Emory Damon Laurel Beech Louis Berelson Earl Bixler Fred McMillan Herbert Altergott Cyril Brewer Clyde Bridger Owen Campbell Donald Castle Marshall Curtis Philip Davis YVallace Davis VValter Douglas Gordon Giles Page Fifty-six SENIORS Glen Davison Clarence Drake JUNIORS Ira Erickson Clarence Neumier Ruthven Ticknor SOPHOMORES John Carpenter Jack Kirkman Joe Kirkman FRESHMEN Wlilliam Gray, Jr. Keith Gawith Ralph Gustafson Elmer Heimbigner Roscoe Hoovel Robert Ingram Ralph Kerslake Eugene King Thomas Leake David Lehrer V. Albert Raugust Jan Van der Vate Wlinton Ticlinor Eugene Wleber Charles Neher Frank Stowell . Vernon Wlilkinson Glen lVoodward Wlallac BIcDougal Edgar Putnam Gordon Ramp Sidney Rogers Howard Rolsheim David Sehoessler Roy Shenefelt Gordon Steel Albert Vieg Robert Melosh l m.,,,m , N,.W N ..,., . .... . .F .'.-my V 31 U A ,,, . N 1 x 351 .N, 3 W Q . l l 9 4124.-.-, v,, f :4 Q 2 X E, f 1 lm 4, A , f 1-' Q 5339 57353515 ,-c-:Hy .WN -:-5-:-1+ .1 sf :,:1.,l:fE 'I-KOT' LMI, 052275256 F Q 5 C:-:4: 5- .'? L' :'iTf fE?:r l'??I'f!2 .. .M 4.4 5 A . 5 c-+3-2 'fm wa' , ' TTD.-lx ,VK 'r 5 X 9 M -.wg g.g.5.:,3. . . ,, ' K 1 X-K ' 9 if l S 1 fc- Ax l C' X, 9 gr QQ w Q' ,f 6 ' wc- I .... . 255322 , . . . . 1 ., 'N Q l,..1,c, , .. 3 K -Q 4 .,,, .,,,,:,- n, -fy Q5-, . 5 525, M , 1 1-vs uffli' fT:I :f. f 5 if VL! XIX 813- N 5:3-':f1-' -- :CLC-92 -.. ., . V.-.-.Ls .-mas. -vw. S, Z as J 5 ,wwff gzgmw-somwflgzrfgwg:Ax- 'ffj V , ,, . X 5 J . 3 11,2 , Q Q Y: Gyn D 9 , 'fvf ' -4 '.-' ,mf-J, 1 . 1 ff fl- .' It 'T lZz:l:,Ea:1a...g,l Q 'C 4 '2- 1 af, ' v Q Ji ' 2 5. S21 Zi: Q , 5, : 1? Y 14 ri X re Q7 -4 'Z f 1. qw f lj: l x Q: 'fl QE :ir 32: 3: 4, 54' f ,-3 x fe .af L w Brid gel' P. Davis' XV. Davis In gram Kerslake 9 Douglas McDougall parssscgvz-agar, , fri -.. ,RAL Y i li. v ,.. ,,.,,.. . -n-rcvcvozfu -f,s.v.,..,.,, , . . g,4,: -,gf'..:11, l W, .- . ,, w , 312-:c-cc-:cu-If Q 'J .ug u c 1 3.x-,Wig Q 17 f 9 Barton Davison Raugust Van derVate Damon R. Ticknor X NV. Ticknor Carpenter Gawith ' Stowell NVilkinson Campbell Giles Gray Putnam Rolsheim P- -J-ms, ff . V1 -mklf. ,. . ' l ,, ,W s- ,r.,g.. w- n f w x ,Z mqxwsxqlragagg -591.111-,:l:: ' 'A Ff bkkzzzivm A , Gustafson Steel -, f cj:-:-Ram-2 :mc : f Qcussg, so rf N' 'w1,a,' s lgzxh f mags:-L 1 .1-.-.Vw , V, . 3+x:+,,.,. If 'a .2. . . I-Z-5? 45- V . 3:15 f 5 Q, R,-.v xv- ,wwf . .-,. 1-:4.:-.-20:4-Ea ll.- h2,':':'--11.1, ffzfri-aff-fr. l .' E 5553:-'E:9:z55': .3151 5335435 Eifiiilitw' 15: 611323: ifigififg 5 Ng.,-, x . 9. .-:. . 1:-sa iw. 'SI 1, l 2'- ,-4 Abel Break Knight Martin Means Newsom Noble Tontz . XVe1ch NVi1son lDomen's Self Government OFFICERS 1927-1928 President ,..,.....,.....,,.,,, ............... R utli Martin Vice-President ........ ..,.. E lizabetli Noble Secretary .......,.,,,..... ...,,,.,,...........,......,..,.. ...A... B e verley Means Treasurer .,..... .................,...........,.,,......... .,... D 0 rotlly Knight COUNCIL Edna Abel Frances lfVilson Selma Tontz Nelda Newsom Mary Catherine Breck Blildretl VV6l.Cl1 Elizabeth Noble OFFICERS 1928-1929 President ..,......,....,. ...,. .............1. E d na Abel Vice-President .,,.,... ............., S elma Tontz Secretary ..............,,. ........ N Iargaret Collins Treasurer ........ ........,..... E Ima Proffitt 2 8 A -3: 5- N :acc-6+ 5 ie-aKg4ff,3, X . 1 2 '- , C , l,,, Qgjfi 1. 9 ','i Page Fifty.e-ight . or.-.-vw ,A gf., .M .. ,. ,. , t .MH ,, f ff -1 ,-.-1 - -.f-:f-:- V. ,- 1-:-1-1-u rf .. , af 11525555 iffiil 5555 2225 .L 1:2 '- ef'f -11221, ,533 FC ' rw 41' ff. i ' X Che UPPQTCl3SSmQH,S Association The Association was organized last year by members of the junior and senior classes. Its purpose is to administer a reasonable amount of dis- cipline to freshmen. 'l'he'organization grew out of an increasing distaste on the part of students and faculty members for the haphazard and sometimes damaging methods used in subduing freshmen. The organization, it now exists, will have a strong tendency to prevent small group action against freshmen with a consequent development of a finer spirit between classes. Another aim of the association is to do all possible to acquaint and in- struct freshmen in the traditions of the college, as well as to assist them in the matter of adjusting themselves to college life during their first year. The organization, young as it is, has yet to express itself to the fullest extent. But as its members become more aware of its value to first year men and begin to think more of their development than hazing, it will doubtless come to play a leading part among organizations on the campus. During the year the association through its officers and executive com- mittee, successfully handles freshmen in regard to rules. The president as- sumed the task of creating pep in the student body and as a result the foot- ball and basketball season saw great transformation in student activity at the contests. OFFICERS President ,,,,, .... C harles Baker Secretary ,.... ............ l fred Gibbs Essex' Gibbs , fit --be 'f.-M1.- -as ' 1, 2 'M - 55' fyif C -5.373 -Lkxs.--711' 4-in 3.:.: ' , V x Fig.,-!?,.,,,mca ,Q-N5-I hxldizxglt- ,was , W ' , , Q Q, 251' smfaa 2 , - . .1 - .--: c Page Fifty nme x . - .vz-. .X-:QM-lg . , -i, .- -:-: 4 5 5 J A 5 . 4 cw 4 f ,. c z 1. fi , I !v,, in +:25:.Q'f.2i-fuizl-' 513: 115212, Q .-f '.-1-Le ., ,Q .mzb aff, -,-.us it ,rm-bi.-:bzf -1.-:Q me ww ffclh. iii x .' 1-3 , I Abel Flausing Collins DeXVitt Graham Hill Howard Irving Jack Jeffers Lyons McPherson Maple Menefee Tontz ZDomeu's League OFFICERS 1927-28 President .........i.......,.. Vice-President ....... Secretary .,.,.....,... VIIFCHSUFCI' ..... ,..... A ......,..............,. . CAB INE T Edna Abel Olivia Clausing Bfargaret Collins Gertrude Hill Arlene Howard Selma Tontz ,...........Katl1ryn Maple ........Tlielma De Wfitt .,......,Emily Menefee .......I-Ielen Graham Beatrice Irving Dorothy Jack Betty Jeffers Elinor Lyons Alice McPherson U OFFICERS 1928-29 President .,............. Vice-President ...., Secretary ...,.,....... Treasurer ...... w11fx,'sf.-,-X . . , - zu - ,f.f1,,.z,g i Ld.. ,Q .....,.'1ll1ClI1'13. De W'itt ..............Betty Jeffers Beatrice Irving .....r..E1inor Lyons QQ:-:ec ras. maezgsag K N - , , . W.-,i..,.,fr lg 4 sf - ' - Jr- c.gp:-x,:f.:- M. . X' 4 - Page Sixty ,- 1, X ,-,..,l..w, ,+R , ., 'fy .4 1 A f: ' 1 .-rf M-:iq , . '-Q 'ix r F sqm, ':::':f:',,,' ,www rf rw, : 0.4-L '.f.r,1cfb , keel ff: ph ,V g., .I , V- - q., 1., X ,.,,.g b V 1 .,r .41 4 L 5., W , i , Bell Cam pbelli Clark Elliott Emigh .Teflfers Matheson Noble Xvaller 'Welch Nvilson Wiscnor '15, 10. C. A. OFFICERS 1927-1928 . President .,....,,,,,..... .....,..,.,....,........,.,.,..............,,..........,.....,............ .....l. C l ara Emlgh Vice-President ......, ....,. B flildred Welcli Secretary ,,,,l,,,,...,..., ........ E lla hIatl1eSOI1 'freasurer ,,,.,,l ...,,......,......,,,,..,..,.....,.,... ....... L 0 is VViSCTl01' Catherine VValler Josephine Denny Agnes Clark Betty Jeffers CABINET Marjorie Elliott Frances WVilson Frances Campbell Lucy Bell Elizabeth Noble ' OFFICERS 1928-1929 President ,...,....,.....,, ........,,...,..............1,...........l.......,,.......................,.. Vice-P resident ,.,... Secretary ....,...............,,..,......... 'I reasurer .......................,,....... ..,..,................ Undergraduate Representative. ...........,....... .. lrmal Kinnison Ruth Thomson Bernice Becker Lucy Bell Agnes Clarke CABINET Frances Wilson Frances Campbell Mildred Williams Eleanor Dunlap .........Catherine VValler Harriet Mclsaac Maurine Herbig Helen Fowler Betty Jeffers hlarjorie Elliott Page Sixty-01Le Qmqea 5 MSQET- .4 31- 33.3, A-v -f 2 gl 21. x if Q ze f 'i T-f'tPm :?'fW' 5 .'N3'i'?f '1'1ff2E?E wlfw 4? L V N. L- , ., 3 .V 7- . - 4 1, 'i 4' '- '5,.-2' rc, 1: 522555 - + ZLL? p. . Q fi fit ., E. 4 q 1 li- 1 V' Hebenstreit Land Van Horn Penrose . 'I-J. CU. C. A. K, FACULTY Rev. E. T. Allen OFFICERS 1927-1928 President ............... .... C arl Hebenstreit C Vice-President ...... .......................... K aye Land i Secretary ..........,.... .... R ichard Van Horn '1l1'C3Sll1'61' .,... ..... S tephen Penrose, Jr. T Reorganized at the end of last year with a small but interested group, S the Y. M. C. A. of VVhit1nan College had a very successful year. 4 The outstanding accomplishment was the printing of an excellent K ., 4 Freshman Bible. Other things accomplished include the clearing of an R15 F5100 debt, the distribution of food to needy families on Thanksgivingg dep- utations to hold services at nearby churches and several vocational talks X to the men of the college by Wfalla WVa1la business men. The officers for next year are: gl I I President ................ ...... l Villiam Galbraith 1 Vice-President ..... ....,... W allace Davis 3 55 Secretary .,......... ,.,.i,..,. L oyal Perry E Qi Treasurer .... ........ J ohn Forsythe Q lt N . :Darwen A- '- ' ,AVlfiffxm-iv:a5:.:.:w::ws:w,v.ovmrcsree::1zs,ig 7 -if err:-ssfcxzrz-rs :,,c1q92592g0Ijf?'Pf'f4? rf'-45 ' 1 1 g,gQig H 1 jff ti,f.:gfgfQfALe211ei jf? qyfrfrfiwt. fa? 2 L? ggi. -Q . P- .A-N L N- . , J .E-.-IZ.-.-KQXi,'?:',':i.'af L . .ice-Q,-1 -,Ig-if 55.2 .mn-:iff fry 3,35 gait lr? - x , -A Ci 1 wir 1:45.13-z.m:Ef:ri5f:14ta51:+:6z'xwxsv2ia:malff:?J+ Micke-01243 f1m:.lfQ.U? Twixeciwifcozd fssc-:enema-51:5 Page Sixty-two ' ,L.r5' . -l A., ,- p wil A. ,A by .. - , , l, .ny uv -.-.+.T'jQ,M-w.: c ' fy ' ' ' Nrfle. . , 4.31 ,.-1, 4143.4 ' 'L' wif, .1--uv fa , av- ra, . 'Y M .vf K -1., . Qfihql I, 5 .5 , -:a ,P 2 X 1'4 1 Ulufllf'sHIL. b A' lg? U AM 1 HJR cg ig2?Qr FN ' A , ..- ,A -- 5 1 1 , SQ 7?'55 2 .... 11 'V . 'v f, . 53 -I , A t -.mir A J , I ,hr A' , 2- , ..5 'I5':f . J f A 41A., 2g'. J W - 'll ' X '2 L W' ' -R94 J A: I X 7 M ' 1, JJ 3 f.q ' A'f .: 1, ' - ' U - N5 K9 is . I I xX ,f7 I 6. ,JJU A 1 ' ,f-U G V Yj,3iK : MH 'W ' X K' ' A i f:g,g.g - IA I ,Fl . X X ,Q -if -1 .3 5 'i,. x ' ' , y A! ,U '-l.- 4- -JJ I :XQRL : Rf' XR, 'E ,Y 7 FT 1- 12 , '92 ' i A ' 1.5-V W I ' jx gg' ' ...LSO l L L i. my f fdfl 4. www W Ag f R 'H i:3iA K A fm ?-i3 -1:--1 ---A MV? 6 22225 XX ui 4 14 - 1 L . X . rp, .9 52531 E45 -F' 2 l ,. -1- my -: :gage -' .yrs .-4.3, Q .Nav 35.119 4. In 1.1:-.: -.f-.-Q24 vs Qi.. .f-.-'tr-in 1 -v . .. ..,, . 4.-... 1. ...ay ...K .. :,,,.,.- L'-,5..a,, Q, ,.. ,MJ-. JJ:-:c .-21:3-ls. mast 1 - , Bradford Daulton Emigh Galvin Johnson Martin Matheson Menefee Noble Northrup S. Penrose V. Penrose Van der Vate Vveaver Phi Beta 'Kappa National Honomfry Scholastic Fmtemity Fozmclecl at- WillliCL171, and Diary College 1776 , 7fV6lS11.i1'Lgf07l Beta Chapter ClllL7'tC7'Cf,l 1919 Number of Chapters 99 ' FACULTY Louis A. Parsons Dorothy Applegate Vlfilliam H. Bleakney Howard S. Brode Henry BI. Eller James M. Kerns William E. Leonard Lee McMurtrey ' SENIORS Ruth hlartin Ella Matheson Emily Menefee Elizabeth Noble Doyle Northrup Mark Bradford WVreath Daulton Clara Emigh Marguerite Galvin Frances Johnson VVillia1n R. Davis Stephen B. L. Penrose Edward E. Ruby Ruth Wenstrorn Stephen Penrose Virginia Penrose Freda Reed .lan Van der Vate Mary VVe.aver JUNIORS Eleanor Dunlap Nelda Newsom Hilda Gaylord Eleanor Still Dorothy .lack Winton Ticknor Frances Wilson -r'f-S+1f1- abs- .. . -- .. Page Sin:ty-Lhree . J L Q., 2 yirhg E il R9 13 ers. gk 1 W ,A .X v,., ' -f--,I 'VZ A t-:I-, faq:-' ?:-:3:f .57 Wy. r -'wf:9f- +2161 wa bras: ,::f:rszm:: few:-1 NA 5' . . 1 .X a. 8' X. , , .. 5? gdsiefzfkfqxf ':::::'1 --j::- .- .gf 'WSJ :Z-,Qt gqlzxy L .QQ 5119- ,, 4? 'if-4 qigggii 'J '92, 5302 he-,J 15 Wm 2232 rf v ,4f,maX. M. Ms, Afygawswxam .mr Q. A frm.. , gg-cw: -:-:-an ez- mf sl, wg, Q ,K c Ip 1 H X Q55 F r Q 6:51532 .Nig- 212' V 7 QW C ' wg:-213, V Eels 14 W Babcock Bleakney Bradford Eckart f .Tack McVay Rothroek D Ita Sigma CRho Nalimzal PIO-1Lm'a1'y IrU7'C'll,6'iC F1'aLcr'rLil y Foulzclvcl fu' Chicago in 1906 rVhif'771ffl7L College Clzaptcr Cl1cL1'fe1'ecl in 1920 Number of Chapters 60 FACULTY VVi11iam R. Davis George B. Marquis UNDER GRADUATES Clark lflckart 1 Chester Babcock Catherine Bleakney Dorothy Jack Mark Bradford Alfred Mcvay Harry Rothrock 4 fgqjtqga . 3Q?B1C72R7'FLY3Q?f1'2 47 -'T 'lr YY.., rf'3'Q3563'4l,-'GEM , E , 5.',.'.' -'j,-145' ff!-'PE ff ?.x.-'-'H- ,' - r ,' ,Zif-mm,mwfmmaw.mu1may 251 ,-if ?:I,j9yM-92'-5 1 -'92, fffrwmw:rwifeiffef-?f+5fTf? 3: W ,-.,.,7.,,,..,..N., - , . Wy- -,Q ,Ny -m.,,,.V,.. V-Q 1,41 A -f.--- A w1-- A , 1 . ,FA'f5i:-57-xi.,4'e,.f':,,-,' r ' 1k,6wle3 ',:f54k Q-pi, 'Q H' ,::,: - ,., pg , V ' Qzivsslvc H554-Qna-JSJE HE-2fJ'l ginf'-Eb:-x:2v,wfSa91:21-.':-xwSf,e2lQm1aw3 Page Sinsly-form' A q: 3 4, 0: Q ' 3: iqafofv - X :az M... fvigwv.-A.. ...u 'QQ-vos:-ze,-'crfrmzzl Q. .-fx gf. way, , , ,fi I, , ,K 'MW-Q x .I .,..,..,., V Eye. N Tl V 3 5 135. f Fifi 9 mr N ' F' 'ref 3 we 5:5211 :fell as H . X'-K lim, 5+ W gm awg:..fr5e:x1 :ggi ' Q,-,.,,..-'rf ,L , g-:gi '- r . ,il gif? 5' 3,351 M1 ..- fi 'L 3,53 -t f ,. 5, L:-4341: 1,5-53: of--,.m,' 5 f- -5 ' X 'gs'-1 .'r--9-'f-eiebgxvg, 5 : za: S,-. , -'QQ..p:fSfrf1Ms3 -ga -ff Mao, .- S l11S'f..fff A L ' gf, viii 3 .A an :S 9 L - Q male - Essen Q: - bcvrswxbf .,. s Q H 5 4 5 gn E. , if X5 2 Z: .S T35 gy . .H .5 x .- if ' .' , 3 5 S y ,. rs ' S . '52 'gc 95' x EZ?K'i9F'E'1?:? PP A -:V :EL 2 EV 2 . E 5 Beinfang Broom Coyle A. Curtis 3 . W H. Curtis Eichelbergei' Evans Sundquist 1 -1 Maxey Noble Randall Hoxsey D 5 1 I EQA 5: GU . .1 ' 11 lil S1 OU 9 National H0'1z.01'rLv'ly Zllzlsical F1'cLtm'nity 4 -:Eh Fozmclecl at Cincimmti Met1'0p0li't1Ln College of Dfusic in 1903 .cfkc-, -E Esther Beinfang Esther S. Bowers Marguerite Broom Norma Coyle .R N- ig Anna Lou Curtis f. 4- . rcocecefz-bzrvr,-.4 1 'fiem Fbzxw-1 2 12:53 W S: 4xv.:s-.1-Q15 ,921-:-1-t-:zz-:L K . ie.. , . . fx?-5-'-new-ax-:fanmyeczc-gre -Liam: '.-J-1 33. Q --a,N,.5.,,..,,.,. - 4 .:4g,f' 4, , X If - A-,,,-3..1:,,,.k.,-M.If - -gs .- . , N.:-,L-f :.....,, ' ' Y 2G.,f.e'Y ' - 1 -5 rv A .' - - simrzwwmvmf wskfxw -rwifiiva-wa.g:i 1 wx Mu Zeta Chapter Clzarterecl in 1920 Number of Chapters 440 Helen Curtis Ruth Eiclielberger Mary Olive Evans Ruth Falconer Catherine Hoxsey afaqw,-::,x1-,p1:.f ,A t , WZ., '5-'-- ' ff:'- 1' ,LMS-. 1 4.5:-wash P - .Z I ,' 7 4bf:'n1n4-1 jj -jf, 5.V':'f'f ?Q fu? twat-.15-,fra Elnora Maxey Elizabeth Noble Miriam Randall Constance Sundquist Mrs. VVoodwarcl Q,,.,.,.. ...- . , Jr fw- -ff. ,A ., - , 1 . --X .lime-we A ' zl gp- 7.3. 'ffm-rzfw 3 ,V 1... It iriijliiiizlfflyg 4 Z is may ,,. ff?-rr' Af Q ff :':-:- xc 5 gr ? A' TEE-E 9 'Fifi E 4? fi? .Y . if ., .- a -1 :-:-:- , r :Mg -1 ,Q e-pf... , sv ,M X 'Y Y .fkfffa ,,,JE'f1'f. ,.,. ., ,,-Q., --v :, gp . 1. X 6 L . WA, ee. ...,,.. . , -:liz 3531: . fs.-55 -:ff 52, 115- 3532525251532 iii r 11- uv' t-gr.: iff-5 211-1 '11-:ef 5193 'cxjk 11551 ew . ,1- ..f 5. Hanes-s' X i 'A Ii Emigh Little Maple Martin Matheson Noble Rub y mortar Board National Senior Honorary Fraternity Fozmdecl at Syracuse New York in 1918 Ufhitman College Chapter Chartered in 1926 Number of Chapters 24 FACULTY Mrs. S. B. L. Penrose Miss Grace Robertson Miss Ruth VVenst1'orn Miss Helen Curtis SENIORS Clara Emigh Ruth Martin Iris Little Ella Matheson Katherine Maple Elizabeth Noble Elizabeth Ruby Page Sixty-sin: I--mm. .-f..,.y,.ff f.-w.-.-,- ,I --.-M f--, 4 'R 22.-t: fi 'Q Q 11:1-fa .J Wggtgfg. ,,, L 9 45.-,lm 4- Q 'cw icq f 34117555 15:5-ff GU f A f Rgfaz 'liftni W Zi' Y-,V ggi C:,,.- - 1. - 252231 J? f ?ei:5:s 2 a-2. '-E:-fremzkfge frm fm: 4 'L-X xr '- .rw -45:21 :wg gc:-.,,,, ff 'fin fr 1 W , 7, 1: 2, 5 .Mm 41 ,1'x4w,.1f , :ei or l Mockelson Gardner Gaiser Ahearn Forsyth Eckart Buck Yennoy Vkfebstor Molohon Garrett McClano Brad,fo1'd Browder Taylor .Jones Penrose Order no walllatpu UP1J61'CL!LSS'I77,6'7l,-5 Activity Ifonomry SENIORS ' Jack Ahearn Douglas McClane bi? ' Mark Bradford Alfred McVay Robert Browder Gerald Meclielson Clark Eckart Stephen Penrose, Jr. Charles Esser Henry Taylor Lyman Lynn Joe VVeloste1' James Yenney J UNIORS Edward Buck Robert Garrett John Forsyth Arthur Jones Dan Gaiser V Bernard Molohon Paul Gardner QI-larry Rothrock -Ar 11 Page Sixty-se-amz, 44 75 .w -2 'ZS -A -4 jj Q qt -Q , g .-1. 5: -x f, -' M -n Q f M or r 1 ML'T?'5l. 45m'Gf?' P55 A2223 My is :Q 1:-'11 K, . f Q k e jQ,5g'Qf:gglW,gwL?: 'miami Mio me .dak Wfrm --fy,w2.gAxwgLA1,', . , 'fif4Rf'r if - i.: 467,13 'e ii fu-5 I gg ge ,fc W 2:1 .Q I, Q' I . is 'A 9-2 -571 ' I c-, K r Xu ., 'il ' 'Ta -'gig AT-fE:?7'5K me Q. 'YN or SM 5041 N - SE.-9 :. 0 :Q Q V: Browder T. Garrett Mclsaac McVay Northrup 3 , 1 Fry R. Garrett Lynch Molohon Smithson E Q .- 9:1 ? Z? L ii Q 4 ' 1 E1 5 ,E , 4 Press Club L X 4 hlonomrly Jozwnalistic .flssociation fg J FACULTY Russell Blankenship WVilliam R. Davis Edward E. Ruby 22.1.4 'frees SE NIO RS Robert Browder Lyle Mclsaacs Truman Garrett Alfred McVay Lyman Lynn Doyle Northrup X J UNIORS 5 1 5 1' Z.. Wvalter Fry Showalter Lynch Robert Garrett Bernard Molohon RQ Paul Smithson , ts ' v r - - ,- X Nishcfkigv per, 2 , 3' Q57 1:9355 31 A 2' ' N 5:33 .f Tw- -V :A--L 1,2302-ze-uffffmvmmqgg 32+ X. ' f f , V, ' ' ' 4 A .?ll?-WQIQrsfgwmvwuymvewfgxfxz' ,fr N .' ',.A bfi 'WH 1 qwwww:w.:9::rger:gQzg1f,:c.aa1:vzo:5f+f'M. x '4 p 7' ' ' 'g-4g,L.L','- dz-.f.:1vffA2a4gf42a ,J ,gif QW?-A RQ 3 1 0 ' my 'Qyfj Q 2.1 , K 5 1 lem :mf ff 3135 we . , 4 . w 1 Hi' 5' -' U J HP 'Wren' ,af 's gen s, F Hmm: 751 ,'.1'2?-7ST..wE?-EFL? 'A , , . ZH f .f :,-ffff-41-5u.:..,.V1f,r f f 'lx 3' r' ,., .HQ JZ-'P Ai' - G 4. ' 01, ,' 1 1,1 za me . ' f v f ,-Uv -f- 1 'f 'U P ?- :w?f' X '?l Y'3'Q' V' 'WQ Q'm'f-uf -', f x 1' r-A +-..lv:'- Swear---zzfi::f,:-:cor:11wwxs1:'f:4fu:mv:5wn2x?Q:m:acePM Eienwxdwli 'ma,:.Le:f Yidfwiwzrf-uw?:g: vQ'm'm. :mi-s:?7.u'z:t? Page Sifuty-eight ' 5' - N tl F MEMBERS M eegwzcgrfu Cggggcgvf Qq:3:::3:xg1 f-'-13:-'J a3f:5-.5211 , +31-g,f::4,--, 4,0-1-1 J. ' A3 if l .. 1w.xm..,, ---1-:af f .C .,-. e::.ff,1, fe w-1: ew Q-.-2.-, .f if--,ff 4- 6-:Az-:-: as Q Y we Ar fx- mg gf' f if-+3 1:31-gi 33325 y,:::,:f ' sz: .. ,X , ' A 4 v.-.'.-,. ..:,:. : -:-:A an -wr , X -TF' 1555179 91:35. 5392 53131112 1-1472-' 1527553 Jf x:. 4:7:T:kf 5,1-tc: 119,13 +513-' ff - -. ' ,--:QQ 1'-zz-1 1 :ls if Q lqzfas tkfrkxi area il isp. alrcsfl k:5:z2,:21:-fp: Q b X A-Legg 3.72, 5 fa ,435 ay.-5 msg .:.g.'.gLg ,Q ego- 37:-:A cg-55313:-:+:o: 25 -74-. ' X -, NM. :':-A 4, . :iz -'wr H12 ff C -'-' :Q:1.2'l 55-:4-: '-1 :Iv ' ti vi:-' ' 133, G,-f-L -1-:cs -2 -5 ml, ff 4 W -L 3341 U' 'Q' -:g-:ec fa:-QV 3 NO' . P -, Ai: -Zh., .,girf '4, 525112: , Ji,.,,,. :Iva T'-fi? 'J-W3 9 fi -- , 'H M' A W ' 1912- wif-H e :L Q , , 'Mm-1 .lm , l. V . . M... . .V W. 21 aaa .442-: ' '--.-Jin-we r f ,E 6, i 24 .4 l gf , 3 5: lf 7.911561 2 Benge Casey Engelhardt Galbraith Galvin Glasspool Hangar Hazeltine Jacobson Jensen Johnson Klise McVay Monroe Myers Perry Richards Sayres A Dramatic Club Local Plmiowwjy Dm'nza,ti.s-t's Society HONORARY MEMBERS Russell Blankenship lfVilliam R. Davis Mrs. VV. R. Davis Leo C. Humphreys Ruth YVenstrorn Gladys Benge Kenneth Casey Martha Engelhardt VVilliam Galbraith Marguerite Galvin Ralph Gibbons Tom Amos Stanley Atkin Marian Berger Louis Berlson I Catherine Bleakney Glenn Davidson VVinifred Dunphy Charles Esser Mabel Ferguson John Forsyth James Glasspol Caroline Hanger Ellen Hazeltine Osval Jacobson Melvin Jensen Frances Johnson Eu0'ene Klise PLEDGES Dan Gaiser Robert Goodwin Helen Graham Beatrice Irving Arthur Jones lrrnal Kinnison Kay Land Orla Moody Paul Reeder D Alfred McVay Clarence Monroe Robert Myers Loyal Perry Noah Richards Evelyn Sayers Elizabeth Reisinge Ruth Robertson Helen Shell Paul Srnithson hlarjorie Stirling W7inton Ticknor Petronilla Tierney Elizabeth Towne Margaret WVall Harold VVilson 1. 5:--ggi,-al.,Cwgrg N , . Q i ,Q .1 .cl-zzfaegg ax-N:2':.urls-:':t:4e3z:.+:xXmzex.-f::: 1' ' ' X ' ' Al Q -'T A' , arc. ' l T f f -' f, 'ff ' ,A--y,ff'ff' 1 lvl , -'ii X, -. 'Z ' ..,. .,se....- : , .- iff ' Q ?', -. 1-2 5 4 4' A- ' -13 '- ' 1, A32 Q: A' - -- , A . ... Page Sztly 7llIIf' rr'-p im:-J -:f . J xl, X., . sg, , 3. . we-M . - ..,- -1 1? llfiv ' 'ff 552552 5' Q5 1 5 if-T? xg-22 255.5121 2 '-sire., Q :fri - -ffzrw. 25211 u-rv:-zz wr-4: 5. iraq- -f , :-. I1 . . :L-.-Q-. 125.55 neg-1 c MFL-vi. is... ,. 5ee.,4w.:5:j.g'., 5551:-Q 5g-3:f:: 521:45 Aff..-,r,x:1:-.qg,.k 1:51 P5--:ix 5: '-:Ak --5:21112 3:53:13 ,:::E::' 1. L 11.111-f 2:5121-i x New g.5:,,:. sting. ctr:-541755-rms. , sa lsr- w. Back Row:-Newman, Norberg, 'Webstexg Napier, Millam, VVa.rwiek. Center back:-Meckelson, Ladley, Gardner, Woods, Reed, C. Eckart, Yenney. Center front:-Ahearn, Schiller, VV. Eckart, Olsen, Bailey, Kohl. Front row:-Buck, Croxdale, Joyce, Penrose, Garrett, Fetters, Bagley. Hrmomry ,-I Hzletic fl ssociation. R. V. Borleske Jack Ahearn Carl Connell Clark Eckart lVilbur Eckart Edward Buck John Caley Ray Forquer Paul Gardner Harold Bagley Gayton Bailey Lynn Croxdale Paul Anderson Roy Lindman FACULTY Victor Karlsen SENIORS Gerald Meckelson Louis Olsen Stephen Penrose, Jr. Homer Reed JUNIORS Robert Garrett Osval Jacobson Ernest Kohl James Ladley SOPI-IOMO'RES Marvin Fetters Wfalfred Holmgren John Joyce FRESHMEN Nick Mengel ws- M, 5 PP . iw .S'7 ?r George B. B-larquis Paul Schiller WVayne lfVarWick Joe VVebster James Yenney Harold McKellar Merle Millam Kenneth Neilson Tom Vlfood Henry Napier John Reese Vernon Wvaterman Albert Newman Kenneth Norberg n A- -'53 V5 Q I ya n im Qdsczxfreg W - . . . vm ' M az 5 51 .L gfcfinpri-qi ,ii s N5 fi H , l 25 F? ii til 1 5:5 f :tl . f W . .1 i 1 -qc :imma-rzfaza..qwifrrz-:fc Q . ' 1 'f y'2 -V. .l.7 m'::Qk NH f fr ' ' Iii , .... -m -wma-,ar-,9,wQwvwf1. ' X va 1 ' :lf . gf , ffm 11 5152 liixmiiilt 'f . f 5f'lf G:f5'f'Y ? JE' Ti 1-'2'Q f , . J V . . f, ' 'M .affzf 3-iftlaz.. Mmxwaf A Mt t w-aL:,f..E' ji.: .-1 3 il ' J A TS , P: FJ ' .ff f ' ' fl .' 2 'L 7 - A -, .N .I 'VM ,,f:H, 9. A V -X'..v.k,'-get .4 A .,,.lr.v...v.,a..: ,A ,v- a R :1:':-x-,:'::.:ee,rs:-n-:- :L-:s:.rszxa::,4':f Qsawlff: ' X--,-f,5,L.,,'.- g3w:3.5.p5 D,Q.5,ie'Qaa:a.w:-p.z.1x:segi,.J, Page Seventy ' f,.' 'U' ' , ' ' 'Wiszff , , x-'fl '51 1 .- . ,A 1. U wg 5, ' ,J Q, . 'V' D I .'5'-Wxx, ,, f f ,I 'f,2. - ug: g X 335 - ,.:vv' pimms 11 3 Jounwrmsm 5-f x...J Ng My Xxbjf r '1 Q N 1 ,Q . ' 'T 1 9 , Ax , fq . ' 3 h ,ffm ,Q Q ' - , 9 X. A ' X X - 5, .Q ,, - , 1, 5 -ff , V . ' - ' 1 f -'::- A i . ,a d .-1 . ef- ,- ' - r. QQ , K ' ,?...i. 525, . , A . -L---4 ?':,. ,T-, v-I mv iq. QC ' few , ' Q QA ' V ul- r wx! xgxg ,-.X ' N V 1 . V , gugifgu ng Rf y N :rf n J 4-nw I r A 51. ., . , ' 1 T- lg-i.':ywf:' 51 - - '- - - A , l Prospectus Previous to this year, forensics have taken a relatively minor place in . the activities of the students of the college. This year, however, due to the coach, was ably displayed. activity and the energy of Mr. Earl Beem, the coach, there has been a successful season. The Missionaries, both at home and abroad, have brought much credit to Wfhitman, in their ac- tivities on the debating plat- form. The Hrst forensic activity of the school was the Cam- bridge debate, which attracted as much attention as any event that representatives of the college have participated in this year. This debate was followed by both men's and women's contests, in which the ability of the teams and of the Coach Beem At the beginning of the season, there were but two women, and four men, A with varsity experience, who were eligible for the squad. VVith the heavy . debate schedule that had been made, this seemed a very great handicap, but A due to the fine turnout of material, the college was well represented in the contests, even though it did not always gain the victory. 'With many of the members of this year-'s team coming back next year, and the abundance of fine debating material in the Freshman class of this .- year, the forensic outlook for next year is very bright. Page Seventy-one 4- 3 31 '7 e c X, ' i 41:- iv- 1 :Q -3 Q , 79 -1- -1 em-.ev .. c, favs: f -1 .1 ' .. .. ly ,. , . .-1 'i ,a .8- ii 5 . 4 Q 1 Y 42 1 v 'I as ' . f is ---A X A 19.23 e:..2'R i '2.E X SI:-5' 9 Q51 fi 5 Q ,ME is ,, 5 if be test.. if EH 4' We 25252 2532535153349 SEI? AW N -Qs 'H if '- .w '- -as -:sm asv.. f' -3151: wi sm isis 45? X-1:45 Sea: 1 - 9 ' 2 3 '-2' 'E A ll f i'5g'Xf.lEf 3' Q ff-W1 . .. K' rr -A ' gmxmv-.1-53 4-sezszsag gave-:-343 fl 3 gif- l 4: T95 Sl ff - 5? i it is 155 Ei' . si x -.225 fi H E W? if 5155 Bradford Rothrock Taylor X55 Q -,.3.,.QP ?,..f.'-'asf' 2 .fi .ff was Ch b 'd CD b , e am YI ge e ate W 5353 gg' One of the outstanding events of the college year, ranking as to inter- 4 est shown by town people with the Opera and Dramatic Club Play, was the j 121 A debate with the University of Cambridge given on December 7, before a full Q ..:,25 , 1 is - rl 1 1 if Q 1 if house at the lxeylor Grand Theatre. , 'Q The British institution was represented by a very able and experienc- I :hi 5 ed trio: Lionel Elvin, A. B. King-Hamilton, and Hugh McIntosh-Foot. :g gy C These men are members of the Trinity Union and were on a tour of the 112, ,ff United States. 'Whitman was signally honored in being- one of two institu- 53-W..-.Jie . . . . . . . wwf? .. g tions in the Northwest to be included in their itinerary. S V lo ' ' za a, 53 fi. Our college was fortunate in having on the team two men, Mark Brad- 82? 5 s -f fl. .. ford and Harry Rothrock, who debated with the University of Sidney last 3 year and thereby had experience with the English system of debating. 4,5 r q 41? Henry faylor creditably filled the tlnrd place on the team, and the British- ers remarked that Harry Rothroel: was one of the ablest debaters that they jj , . had met in their tour of thirty-three colleges and universities. ' A . . . 5 V I'he question discussed was: 1'R,esolved, That this house disapproves of s A- 3l , . I , il 3: women, 'and the debate was characterized throughout by scintillating wit and fx S f . . . . , if friendly banter which delighted the audience. . All iiltwwvwvvbf ii. ..C.f..s .51 59f'm'siQut .51 W1 T2 ., as . N,-fs., Nw ,Jig - 1 . - wocececlzzrrczc f 9 3' . 5 1 fr 3 -iif'f if-3 Am'bg'?f ', Q' A ' '. - W Wag- mama? 1 4 'A ' '- . 1 ' an ' Q- , f' -1, '57 H V it Rza' Slismsllz '- '- 51 ?if'5m.mfgf'3mW ,. s fi A S Vi ' 'N ' x ir..-A,-Awww W..--.i.',q Seam Q v t, U. Ly. .Q P,,- Q yr N X .JA .- Q H X g- ff 12 M WEf .W .-Q. 'lit w 'e'W ', t UT 'fa 2 , W. F: -,f'i Q'1'i ' ,mg ' -A-4 6, 'Ze' :ws 5-1 Y 'Ss t :Q :Ac 555, 5:5 ng . ' 'N ' F' 'Q , ,-QA,-1 ,, 4 .fn . K,-,fish -4 - ja . , ff:- . 1 7, , 3 ' fff'2'-l rj-:ge-:ff 1 fx 5 -3.9.-.ua .413 56'-. .N..1...e..,.--..,...Je L QQ- MN'-rg iff-1 cl .- -as-, fr ei 1. iff, .TL ii' '13 ' 1 ' f ' 'B ' V v MU' ..4-.-...s.s.ssf,,..,..,x-. ,....,-.as.,.vs..fasw4Mf..1m ,res seam,-.M -a,,,,f wg,ygsMWM,,,w,a,,,,62s,5agQm,M,.,m.m5 Page Seventy-two ll fr Q .4 :sf-fx-:-: '-gmrwsy mwgrw -Vif-sw ..- VIEW'?F:1f4W-ei-awe sl-'-'f5'1ff'4:f1'xg-Wei, --nfs--V may -eww:-V.m. X , V- . --.lg Mir' r nfs? -.WF M12 ff. sv .ls-4. V ilvrf? ww. fi if 2 1 - -x V .X ls L .6 .cs -, ,....f .-.-.-3 4 . . N., . ' .. fa ar,-fa wrgw. v 59.4 .Miz 21.16 4-414 fp-23? gat: 121.5111 q:-fs ?i tr L A , -ol' V'ET4i3. 'N-:W V ' W:-'M -I-Ffh ri-231- CYK-W ' '-Jr:-D NF95 P547 '15 ' ' ' 3 ' - mais U J Q-bt :wg 4.14.15 ss.-...-. 1.-14 ,-.-f-:r.,f:.-Sy sw sf. - 1- G .- 'Q get lr .v ages: . Zrfaaf . jf' . ,. Aff -fra. :iz-: 7' y 5' - .gl ti-22 P:-UQ ' CAI! piimiw- :4-. .. ri VSV'- . lv Q '-X : -. w - ' , W V-5-:V E,..y ff 1:-.or -fer-3 :QQ -1-rf, . V. . .-1-1: -at-: S-I-M Q - , ,. ..f V . N' if ef as-,1 .' x M M - , V ., '- '- -: -4 'r be-. ' V1 X ' 'c1.-14.5. 2 ' .' 'tc -3- -H f' ' c 1 . V , f Q . i.-:,..,f-...V.1a.-.s ts .au use SE. Hfwff . Q 'V fs 2 .5 'V ,ig , .1 M 1 Q5 nm? E 4 Qass be -: Hs A s fa 6 11:1 V CUen's Uarsitg fDebate This ed six men's inter-collegiate de- bates. The question discussed was: Resolved, That investors and investments in foreign countries should be protected only by the government of the nation in which the invest- ment is made. On March 1 Richard Van Horn and Eugene Klise repre- sented Whitman in a no-decis- ionn debate with the team from VVeber College, Logan, Utah. On March 2 Van Horn and,Henry Taylor lost the de- cision of a critic judge at Pull- man. Clark Eckart and Chester Babcock, on March 3, sent the Utah Aggies home with the better part of a split decision, year W'hitrnan enter- W Ce. . -.M.A,.,,e. we 'X Q95 WXW , , F, gen A .. . 'fQ2sy. V. . Vf,-4'-nay-., ,s : :sag-:.sf:iS. :mw- . Babcock Eckart Roberts 1230 us- 1 .,,. 'Q . sfdazt-1-gf V-1: '::3:15g,,. .VV . .,:f:1':91 ,sf sg? A ' :rr W A ' rb wy. 'ff' ' . :V 'tiff' icfsifi' VIII -gt-It x- : 1 .4-.'-V.-f .. . . ':V,L' K'+.:4 'f- ' Y Qc 1 f 'S'-??:iI?IM ' X Wx .sw , ..f.,X,... . 4-v me-...,.., ,A W., WA... 1. 2 .,. 1Za.- '.1VcZss.:1:aV:s.. . ta. . wxq.V.-.v--:img .. V - .',.V,.1+,.,,,:3z--., .Q e a 'V -A'- K' -K -A4:.-a-y--.s- ei-Q.-'fssrdzsgf . , ..y 2 - W- V - ,-, . 2:g.+sVsgs5yV:x-:me-,,. - 3 QQFXZWQQ I 5 4-.''95?:E f'ffWf7?E.f.'2'!.Z'f'tg'45:y-'C'Iiffvv Ms, xtq.4.,a.,t , .,., , ,. . .,,. 'X ,ii-' 35, ..4L,-,.3.,'w4f-' J ',3,f ,v2 ' V 1-.:gg.yws+ -. :,.,3s.Ns Q, . 1 ,-fs: '1 X , ,N M 0 gm ,z ff was tg 5 ob .QM .W :K X 9 Klise Va Vw , N-Wagga. -- - 'if' . A Q n Horn Perry .,p:.f-.gums-r.V.qgc 1. iv. .x . Nia A WM ex 351 as r M Y.: .. , ,..q,. sX. E, , .qw ' wears, . ,f.-2:,s-15.1-1 1 -sity ' Via we 15- 55-v as ff 'NWA and on March 5 the O. S. C. debaters had similar luck against Klise and Taylor. March 6 Babcock and Eckart lost to O. S. C. at Cor- vallis by the decision of a crit- ic judge. Although new at varsity debating, Carlisle Roberts and Loyal Perry on April 5 won from the experienced W. S. C. team by a split vote. Each of VVhitrnan's debat- ing teams represented the col- lege creditably, and the many students who attended the de- bates this year found that these clever and instructive battles of wits worth while. were well , -2:3,Li4wf.w.utna.q3 s . - , an '- - 1 rQ'.f-il .' '--Y s' Y' ' 1 fy' ,V Q -fw'--.Q s, ' Q , - Hg- ,.- ...,..,x. -1. .x.1,'z:-.ras-rf-T-ewnswz.-ff, are-1'ff-si 'ff . . j I ri ,ilwypi H ,iff 2 . ,' - 'jf 53 i . ' ' 5: ' ' ' 'f' pw 5'-. q.,q.v15yr-1 .- -- -5 3'-'52-Mawr, ' 11 ' A , '.?. Q ,x - ,,,,,kN,,,,, ,- N- . Q V --fs-.,c,..,,,'... gn. 1. 5 '53 t i--ww , 5' f L ' ,1,.j, 1Z1.,H55.j,9 A-., S 59 :: r . ,J --5 ff . . .1 K Ki S it :ksfy , m-.Va-.-:ca .qi 1:5 1 A x iw ,. 'C' Y tb . .gh A. 3.5, nf 1 Q .4 s s E f 6 1 15 2 -as .V.q:-. auf 2 5 J w::yQm 9 QVwsx.m.- .mn-, A .rv Q: 1 I , ,, -M ...ir C 4 .,. X, N v fr.-'af ' - we 5- iff JA lf,.,, i:'f1:f'-. , N L'-'-', , ,at-Q 'iiih 253555 lE:.ftf:S3E35' A. , 4 :vii Cxkru L' 1.1152-2 Wil' fri: A rw:-:-. -111:19 'Xp-:-y 5:4411 f ,..af:,1s1., g:.g,::3 but ,uf ' K '1:rE:3, 535:-5 ELSE: Sr5:E:2,,g,s ,C 'ffl'3,1. 5225 1312512 iii-ia xy wp:-ig. 612154, ,fzlgglas-..v .4 .svzlo ost'-tv .1-:za-. '-I-M2910 '1 F L i Gaylord Blealcneyd Jack Galloway , lUomen's Uarsitg Debate THE WVASHINGTON STATE COLLEGE DUAL DEBATE On February 16, Whitman College, represented by Dorothy Jack and Hilda Gaylord, upheld the affirmative of the dual with 'Washington State College, at Pullman, on' the question: , Resolved, That co-education in American Colleges and Universities is a failure. A few evenings later, N , , So hie Kirshen and Mar'or ' Nelson u held the Ne 'ative of the uestion J here in the VVhitman Chapel. On the trip to Pullman, the VVhitman team also went to the University of Idaho, at Moscow, and debated there in a non-decision contest. THE O. S. C. DUAL DEBATE The second dual debate of the season, Wlhitman versus O. S. C. was held on February 20 and 28, Agnes Clarke and Harriet Ahearn debating here, and Catherine Bleakney and Elizabeth Galloway, going to Corvallis. ' The debate was on the question: Resolved, That the policy of mass educa- tion irr the American institutions of higher learning be condemned. 'lhough Whitman was not victorious in either contest, the women rep- resenting the college, displayed a fine style of debatino' .f I CJ' Q - V, V ' , I H - - ' ' ' A - V . . Clark Nelson Kirshen Ahearn A ,-.- Y l..' ' i l 'iffffif ff's-m-fa-- 'L..i.e,,,f., i ' -A I Xlffv'-N09-'.' '-KX,,.l,r LI'ml'2l'2':C'4L'S4ffbsXkFl:-, Q. Page Seventysfour l o J Ga, -:ff-,rm-'M' , H9211 Qi 5. ti: il: t 2 3 rf-:wa f'-v:X-w:f'vaa:- :::4,,. Q,.,:,..,. ,, N, 4 - -1 .FA .-2,211-:V 3 as-qv: snr:-:era 1-A ,X - 1.3:-H rg 54 . ,V ii:-13 5.-:-:f :su-:.:4 Q, ..-,,, 3.,.v, ,,- 4 . G, M 1 f .9 5 5 ewf-ff:fffw 55152 23212213 .si-M-ffff -aff 5? awe, . , .51 A53 A ,N X Sam E. K Ifltfafnllfal iDQbatQ Y CJ F i i This year, for the second time in the history of VVhitman College, teams from the different classes competed in -. the inter-class debate contest. The trophies for this contest are the gifts 2 from the Reverend Hu0'h Elmer Brown f O ,-. 4. of Chicago. The class to whom the trophies are awarded, keep them for the ensuing year. , The debate question for the men was: Resolved, That insanity as a L f plea for crime be abolished. The 1 Freshman class was represented by Y v D V, Kenneth Davis and Ralph Edgerton 3 Edgelton are Sophomore class by Fred McMillan Q L, if : Ogden. , it In the finals of the menis divisions, the Freshman men competed 47 against the Junior men, in the chapel. The Freshman team was victorious. 1 The women debated on the question: Resolved, That advertising 5 plays too great a part in the life of the American people. The Freshman team was composed of Ruth Blaine and mal Kinnison and Verna Rasmusserg if Dag. the Junior team, Leila Lundy and 43 Eleanor Dunlap. There was no team 4. entered from the Senior class. In the finals the Freshman class was again Simian victorious, giving both the debate awards in the inter-class contest to the class of 1931. I L Blaine Sims 3 rip.-Nas ,fgfgg-M, frm'-c-:ce smgxssqgg' ' 1 1. 923' F 'fgfi li' ,,,ff'. - ervnroa-:-zsef:-..,x-5 J i' 5- .---w-.wx Afifi' if 'af Q Avjjuy Q t Q ry . , .. if ' A .... L ,.,, M .A-.W-ff - ' A Za lf X ,F 1 .Y bs A p Y g'2'i'f'EQQl2ZiQljiLg v 4 and Richard Van Horn, the Junior class by Harold Fleharty and Charles .as ' Lola Sims, the Sophomore team of Ir- L qi..-sf, X-,W -. ,c.,..,- .A .cs X X 55555553 L f al :uw fs ia X iff-2:4 1 -,L as . 2 fiat ?fEE'E6'i' i K v I ,. ,-1 'Q X Z 225.2 1 I fl hhilf '-A' 17-. a x iz as-rf .. 'ft - 2, .at N ,. .V s, ms- .fa 1 Y J N :fi Intramural forensic Cropbg -' To stimulate an interest in forensics, both in participation and in at- tendance at debates and other speaking contests, there was offered this year for the first time an intra-mural trophy similar to the ones given for intra- i mural athletic championships. Points were granted to groups for each member making an inter-class team, making a varsity team, trying out for 4 either inter-class or varsity debate, entering any of the speaking contests, and winning a contest, and extra points were granted for each member on a victorious team. Groups received points for attendance at debates in ac- cordance with the proportion of their membersliip present. The trophy has been the object of keen competition. The winner will not be known however until the close of the Dovell and .lohn Brining Contests. Che Pacific Coast FGTQUSIC League VVhitman is a member of the Pacific Coast Forensic League, which in-- cludes eleven colleges and universities of YVashington, Oregon, Idaho, Cali- fornia, and Arizona. This year the contests were held in Los Angeles, and YVhitman was ably represented by Har- ry Rothrock, who gave an oration on: The Valley of Forgotten Men. He was not allowed to enter the extempor- aneous speaking contest, since he took first place in that competition last year. The next meeting of th league will bc held in Moscow at the University of Idaho. VVhitman will probably be Hothrock able to send several representatives. ,K A j 'E p In In U ,AA li MMM M ...,V. -.,.. ,,.,,-.,.,f.:,.,, K , i,.. .-,,...: , ',., .me iilf I zf. is.. .:f, . f.f Q -Q., :safaris t Page .Seventy-sire Other Speaking Contests TI-Ili DOVELL CONTEST liach year there are awarded prizes of thirty and twenty dollars respec- tively to the winners of the Wfilliam Thomas Dovell Oratorical Contest, which is open to Sophomores, Juniors, and Seniors. For the preliminaries each contestant must give an oration before three judges seleetd from out- side the college, and from those competing four are selected to participate in the final contest during Commencement week. Last year Chester Babcock and Clark Bckart tied for honors. Great interest is being shown, and much good talent is turning out this year, but the final participants have not yet been selected. THE JOHN BRINING CONTEST Annually at Commencement time there is held. the John Brining Extern- poraneous Speaking Contestf It is open only to Freshmen, and the final competitors are six girls and six boys chosen by elimination contests in the public speaking classes. The twelve selected are allowed to choose from a list of subjects and are given three hours for preparation. There seemed to be a large amount of talent in last year's freshman class, and thus the contest was close and interesting. The prizes offered were twenty and ten dollars. They were won last June by Carlisle Roberts and Loyal Perry. These men have kept their laurels green by forming a winning debate com- bination this year. Puye Se-ucnly swan whitman College Tioneer Official Publication of the .flssociatecl Students of Ufliiiman College ltlembei' of the Pacific Inter-Collegiate Press Association Editorial Staff Editor-in-Chief ...... ...,......,.......................i,........,.........,....... .......................Y...1 I 1 'iS Littlli Associate Editor A,A,.,,, ,,,, ,,,,,,...,.,,,.A,......,......,.... ,.,......... .......... , l 5 e rnard Molohon Assistant Editor Thelma Akey Managing Editor CFirst and Second ternisj ..,...,........... Doyle Northrup Managing Editor Clllurd termj ..,...........,....Y....,,......... ........ N evin Aldermafl Sports Editor ,.,,.,....,...........,.......,.,..,......,,.............,...........,,,..... ......,,....., B ob Garrett Society Editor QFirst Termj ............................,i.... ........ C lara Emigll Society Editor fSecond and third termsj ................ Nadine Vllade P. I, P, A, Editor if ..,,,,.,,...,,i,,i.,.,.,.,...,,.,,.,,..,,........,............,.. ........,.. F red McMillan Elma Proffitt Lucy Bell Bud Lynch hlarjorie Allen John Squire Mary Ringer Edna Mae Evans Dick Rogers Wlilliam Gray Hilda Gaylord Vernon Wlilliinson Laura Lynch DEPARTMENTS Frances Clark Helen Kane Mildred VVilliamS Ted Bowen RE PORTORIAL STAFF Jesse Thomas Ruth Robertson Dorothy Kelly Margaret Collins Ralph Edgerton Dorothy Hull Harriet Ahearn Shirley Blaine Pauline Greenway Eleanor Still Gordon Manser Beatrice Irving Paul Stewart Ruth Thomson Marian Jenkins Garner Talboy VVallace McDougall Business Staff Business Manager .............,r,,......,.,,..,,,,,..,,,,..,,,,,,,,,,,,,,,,,,,,,,ii..,,,,.4. ,.,,,,,.,. J olin Forsyth Advertising Manager CFirst termj ....,.......,... ....,.. H oward Graham Advertising Manager CSecond termj ,,.... ...,,............. ......... K e nneth King Advertising hlanager f'l'hird terrnj .,.....,,......,...,...,..............,... Arlene Howard Assistants-David Lehrer, Betty Jeffers, Marian George, Kenneth Serier, Velma Harris, Sophie Kirshen, Helen Shell, Lawrence Myers. Circulation Manager ,, Assistant ............,.,,,....,...., Pc ge s29Q2aiiiQl5i5if'W D an Gaiser Allen Crocker Q fwip- ,, 1.1.-,-W., Q. 4 3 Q L c-:,:-g- . K g,1.:-,- fc, f:fg.g,g1 ?ifI-112 1-3 ' Q -455:-zu if -if-E22 i?:1:1:Y fEfE1E'?: 1.5111 wk-L, 55:E:+, v g, v3:':j:j:7: ls? 2111121-, 3:29:52 jeff! gf 92.25 515' :rg-Q-:5,,, 1 f 'g:g:,5:1 fr M' 'aiqrx Wzgzf plgizigi 12:19 1 ,gg --.-.2fg.5f:, 1 2:31, '?-35515, ,g 3' mai, fig: rgggaf: gzg:,,q 9' gm gag: ?,:3-5:,g:',:- '11-.2-'rl .Q-fb:--, -s ' 1:11251 we M5 1211. lf aw:-. 3111: N-12:11 Y:-1:55 -- ?g,qr,:4g 1: ,c3f'--f-rM- 5:-1-'- mc, 2471.-I P'-19:4 yn-.-MM:-'55, cf.-:Z mtg.,-f wt-:WY ict:-:fy f MQ- -Aw as-xl' 'ov-:-:,,-.X .e ga? gr-xr :-:-:-.-f mi: -A--v-1 es,-124.-.1'r:ra, nemo .:EJ1Pm1:r:a eau, L-:mi m:E5.f,. -iz K 4 ,Q i V , G-N 'SE i Center:-Little. Below:-Forsyth. Top:-Williams, Lynch, Wade, Bowen, Prolitt. Circle:-Molohon, Northrup, Squire, Thomas, Mauser, Still, Jeffers, Gaiser, George, Howard, Robertson, Garrett, Greenway. Allen, Akey. Left col- umn:-Bell, Clark, Gaylord, Edgerton, Gray, Thomson. Right column:-Kane, Rogers, Jenkins, Stewart, Ahearn, Hull. ,gee-:isvjzvr-x-5:55 ,I-15555, V Y 2 Q-, ll., , .lv I AA . . . Q - .- W . ,413-,zlzecw v-:- f 'Mf'-:gg :jg .1 K 5 -.ga 2 7 ' ' , 'eil' mil--:S:6E:E' '-5 E ll M' ' -. -:- f V Q if , Page Seventyxnine L A w,.,,,.. Li S5 Walls .: Sz 2 X in T .W .. ,,.,,,,,'?-,SF - . s I Nik 35? iw 2959 Q 3315-E :xiii s ,: 5 ' ., ,1 1-gs.-., : me gym: mx: 5 --g :Q-ft-3 ':4'4:-:qc .5 - gilt- ,J 355353 R We fiifia 33-5335399 Q Q X Q :N-2 gm:-a 0 age: mr, -K' Q-rw rf ' V fffsq: .,-ass, 1: ff. Wngig. ,ft pl.. se, ,, nw ,gif Mfr sf: .iv- law: mesa' fgvtx' ef-,Sf iq-iii' 252, -.-2b A 'QW a 4 '-sfsfffmes ,nzqfa Sass, san.. isa Asst was s A :ww 1 -' 'V '- : s. pb 1 f 4, Che waiilatpu of 1929 rf 5:,wecwk3 A y The zlvmual Pulalication of the Junior Class v , Editorial Staff y Editor . .. ,... Bernard Molohon EDITORIAL BOARD Paul Smithson Marian Jenkins Catherine Bleakney P Selma Tontz Eugene Klise Jesse Thomas ' Senior Adviser ....,. ...i... ..... R o bert Browder 1 X Art Editor ..... .......,..,.................... J ack Ahearn 'wildly Assistants ......,......... .,,.... ..,.,.. ,......... ....... . . . .... B e tty Austin, Don Peter Makeup Editor ,,......,.....,.,,.,,............,.,,....,............................,........i...,............ Keister Adams Assistants-Donald Baird, Allen Crocker, Frances Clark, Marjorie I Allen, Elinor Lyons, Edna Abel, Velma Harris. Photography ...,..,,.......,.......,....,......................,....l......,................................ ...,. L loyd Evans 212 5 3 f E DEPARTMENTS Y- Administration ..... ...,.... L eila Lundy, Frances VVilson Seniors ...........,...... ......,....,,. I ienneth Garner, Hilda Gaylord Juniors .........,...,..............,. ,..... I Iarold VVilson, Elizabeth Galloway ' Drama and Music ..,........,.... .....,. P 'rances Campbell, Sophie Kirshen Debate and Journalism ......., ,..,........., I Dorothy Jack, Ellen Hazeltine 4 ,V,V, Organizations ....,......,........,....... ....,. ' Thelma DeiVitt, Helen Haskins Honoraries .,.,. .......... D an Gaiser, Dorothy Berlin I 5: Athletics ......,...,.............:..................,.....,..,,..,,...,............, Bob Garrett, John Matthews Looking Backward-Kenneth Casey,Mildred VVilliarns,Nelda Newsom Business Staff Business Manager ,,.... .....,........,.,.. Wfalter Fry Advertising Manager ....... .... W illiam Galbraith Assistant ............,.. ,,..,...,...... ....... A 1 'lene Howard 5 A Circulation hianager ,... ...... E ugene Klise K if A.: Syn? g.i,:a::gw31 ' gQ1Q!:,'yii,fl'j 'vgxqxt imc- LNG t u -, if ' I ' 1 gg Q 4 53' iff gl mmm. Q ec ,., Y L 'L it-ffiif k ? Page Eighty -1- . - - :u -' 'Aw- gigs 517557. I 1 xx .-.,.,,., ,Q U :H - .,.. . ..... .... . 5555: :ez-. Q 21.2 - -1: 'A-M--i'.m sas- 2-. sera? if V- -4 H,-555 pg., -gggjb .' '-:gh 25412 4 '-5-, 'Jr : ' 1 , v . , . Isis -if :rig '- Q New T - .-'55 sie: 511125 .' W- zz-i gs.: J - ,f - -N 14 --- Ewir? 15251515 ' W -31511: E545 5 f - .4 Q-2 ' -2 rim? Mg f E J' 4-f 1 -Q Y- J . Q mx- 5. 1. -:f. me + -vbwwf' Menezifgaqv, 1 I3 , ?' , Q x ' Nascanna ' 'ww Qi' 'Q in S z 'V -I I -. 4 Q if Q. an 1 N? 1 .ww '1 'ff - w I A ,-,-yy, , 1,5 - -Wi, L-: 5-:.-.A Mg, 9 J, I -. i A . - 5 X- N RY. 9- f 4-'fx 4 Q, N fi? Y . -A N 3 ya ' if MQ? by 'N W fi-. D Kg 5 - Q r' ' -2- Ev x 'Q :T V -'7 -: Q. Q -.- -+ - -5. :-, . 1 sg ,--. :' ,, 1 nn- : 1. 3 xv -5 'I '1 -.,.. .. . .. L ,. 'IWUFL -4' : - fenifi-' we-: ?2 fe Af . my-Q - ..v...-.www -. f V -X 2 2-5- '7 - ' 1 1.-.riweirf374-QP?-5-.'-.W9f :E7W--313-29x -ff i L i?-3?3f'?:''4:3 1f?:3f.f?.5 ge111i 2 fx 3 5 k A if 'is M53 4. ..., mywwv, .- Q4 - 1 .A .. sf -nw. ,..,4ef..f--,.fz,--..- 49.--.hgwwm--1-4, L- Y -..-fm 1, . .. -- -0 afvnfff- - flwimfeat- -Qvsfswf-fQf,2xf:f1g?,-e--5.5:-,5wg.N4s:? . 1.513 .,-my-:Q-.4-5-'ZWinn-3555-..g15f:WwMff-'wf,.f. -rw! 1- . 1-. ':'2f.1:-1 1---1--.-vw:-:-r-121 ,, my . ., ggnx.. .. .. . ..,..A. .X ..,,,..,,.,..,,,-.,.-ew,..... -. ,.. .. M. . vw 1 W-1. , , ' - Ti FEI -fwvifjisaz gs-5.--ggwm:--121241222-T:?ik'-.12f' 'S' f -f- - 'f-51 Q-Q-W, ... . .,x..,.,e.,,,..,.., .. . . . ..... , Ag., .y.. ,,..... n vw... , T. ., f, . .,,A.,. , 5' 2f:.'5II.1,:' -' -.1...g5'gg' '-1-X-.252-giax . '-1-.:s-11: -y: -1:31 :'fgt-eww ., .- : 5, ' -. 'A ag -X-1.--'lm x ' - -f 'ff ---Q '--im ml- 1zy--1-.-L- . 51 A rf: 'EMR --.f . ' ' gl: . - - , , -- 1, . L :I 2, ' ., ,gm--' - - ,, Er 1 2 i2:'5f' 5125 'fi' Q 9 -' W 'Y 2 -Off '-- Q: ' -5:3:aW.Z55'2f' .. 6 : - ' 3 1 r - -2 - . Zz ' . l -. - 14 1 21 , I ' - - .. 1-1,4 g:,Qspg- ..., -:.5,3-4-if -y . f - -'mv -1-,...-.M --ww-Q. . . ,,. J., -- ag . - - .N-1,,fL.rf .:-gg' -4 , 4 .,-.::---.y.:,..-,-,H 11. -'qw-x--: - 554. ve. -ff--' -,'- ,. .. If.. w-v.:-- .,1,,, f- 1--1 - gr- ., --L .. n H ' , by- -:HQ -'5g- .- .- N' 1-:pw V! Mig-. - -- -5433 -,,.g -.: .- - -- V, g.-,.-g,. s .. 12 . :Q A J 'f' M- 2-ii! fa- ' 1-s11:....:1--...-W -In 55244 .1 , -:f-:,-- - 5 E2 f - . - 4 - . '-' 1 - 1 H gm.-, ' --Ng fwfr-,. ' S-Qffip--H 34 ' 52 J 1 I-ff . -54 -gre.. '-,ag My 'wif-Y--:L-H-ww . - ' . ' 355.153, n .' gg , 4,-,.v , ..3.-5.5.-gg 3...- mf?-2,5 ...,i,?1..f'st-1-gi' ,..-.-,.-:3 .:i,..,. . f w , . 1-5.--2515.3 -- 5. 3 . g .ff . . bf- 2 Rape., Q vie . A Neg, . e UAA. W X .,,..., ,Q-, - ,A U V, A . W., ,. V,..,v, MM. V. .. X9 if -.-my--4,-.-4fM,v? ,,- - .. .- ,...::.-1--.. A-Q, ,U ,. - 1 -.-41 ff-., we , .-r 13, ' '-,xl,ggI?Cf2':-.1I,f:'4- 525 1 A1110 JEJP' -:Mp-' ..f P5, K-' ':j'r:.r' ,g2: ' Q- '-'5:5,E-Eg ,K 1, . K j- -mf .- 1 we , - if - -Q L - - 955- V-i-Z:-yWM:z v 1-.1-F --.fpfhvky A-'sf-,. ' 1- -- -Bi -W:-H . .f .1 -,, -. - . -- K - -:+P Q-,smb . .... I - , .I -,. mi...--. -- - 90'- - '- ...L In ' -2:11-3' ' -:::-5512-335---:-55:1 '.-.Kef'igg5?54f41QQ'V:5.1:. 1 -:1:.. n . ' . -'15 .. I '-.iff 9 92 X85 A ' ' 1 ' '.. 1 P 6. .. ,A ,A . 1. f,wz.fmf. .4 vi.:---,-rPj2?'gf5y'ye. ,-...-- ms' wow? n 1 ad ,,- -' a- 2:-.K yi-:-1.1-.2 .R 57- M 'GV ' .. H Q E .. , ,, - ag . - v ' 'W' ' ' . ' ' 'Q W .. .- -- if .'.-111: 'M' A' ' ,Q-15.f.z-fgqgafsgisfe0A'Mlfwfifs'-fggggiii-125.15 ,-Av it :EW . . , ' - 1 - , V M555 ' NSR if ' :. . ... ,4,:1L2f.-If-I7 ,,- Wa, -i'-hw . - 2'-155- -W-QQ' -Lg., .gf 5- 5 5 ' ' . fazilz..-ay .. - Q iff-5-3 -.:.2Z1z2I :117f:'-.2. ff . M4221 956'? -.4 -55E'1 '5- .1 1 ga - 9 4 0 Rina- 1 104 S . 'SR :3fia:..i'f fffiig-ze - Qi ff-:.: ' - -1 Z:--1-.W-sv5a5,2fgQ.-'-:ge - ,. ' - - - YY-152 ,:.s, '- , Q C' 1 5, ' ' - px, 5 2 gi Q ' ' p -U 'S E f' - - : 'liif 1-?fI:'?:'7 f--'.'-. . f .35 .- -i?f1:-iii.-PQ Q Ml, :f57 -I ' E 1 F ' -1--2 2 ' . -:rf H.: '. - ' ' 1 ff' Liz: - - : - E - K' i:1-ir.-- -' 21- -- fini.. P ' -1 2.07 116:25 .eff Q . ' ' Y - - 1 -f g : ' , 'F T5 ' -- .,. . 2 2 ,fn,..'s.-1 -..--.1-4-, we , .- 4'.'- 1 ---- - -4-fr-:--h --1----wf-.14-----A--..,v..-. ,+,-4.-Mk..--as V .... ,gf,,A-m,J .L - ,- : .5 A . . 1 .1 ' E - 1 if .. . iw..-A Nm.--N -- .-251.5 --..-.,,,.,. -.,. - -an-...?4 '--f-5:-7-25-fn-,Q--f .,4f,2-.. X.,-., .. , gf 4 - -. -1.-:Im - P,-, 9 1:35 f' ,fsgzy-f -3-313:23 A- ,. My 51 -P12-113:15-.--,-3-. -2 .ff pg ik - 4 be 'H I' .-'fs . . Q 5' '14-.551 fs -5,222 - -:W5':'ifg.... - 1 ' ' .- , ff-Q 'iff' 1- ' f S.. . V .,., , W fc. - ' -: ff ,Qs-f1'..f -'-::Laf.-:-12193241115 we 5-. 1 -' ,AZiW.vx'?11 'W '-.'-fa-:.--2.-'Ji ' ., G H if Y ' 5 3 ff- 2 ' ' -. vs 4 1,6-52 ' , -my -' .,.. ' . 1 1-rf' --1.--1.-. 53? of ' -'JIS'-wa:-+--4 '1:- 'M' 5 1.?5f2f.4?I2f'5I'I' .-J4ff5ff2242.'f 1 A ' 'fffdzifi-E213 lj' '- ' fQ ffc-J W' ' 'Q f'W, . 3 2 ' A --'if 'Q-fa N1 ' '.v.z1::?:13:'-'-f:':f:1:r:z H ..':?:E-1-Jw ::,..,-gg-:-.. .3r'.f4g-f -:-5225 1 .f . -s:1:5:5. : ' '-N? 1 - 2 K V: Zi-2 923 5.515511 'iT75'12fEr'f 11- 35:5 ' 'lf ' - 1 ' - 5 'ff Ns , X' g- 425- Q. - 1. ,- -- - . 1-4-.:f.-...-- ' V: . 9fi?evf?+A- .3 .-, ff' 4-, E Q Wi - - ' - '- fi 2 - , k -- 1 A. , yy.. .4 .. , . . , .,,,.,g3 , ., . . . . ,, 1 H4145W,,,,,,,...........,y5f. . 0,4 . . , ,. . .. .4 ., . .-,f--- .. 2- 4..+,.v ,. . -f-A .Q-,.N,a -,-.-W -- .-:ff .s ,...f.. ,,,.,.b 1- -.,- - . .. . f -. 1. - .. .... ., .M -,- . .W -- .. . V.-.. fn -.-- . - - ,,..,-Am... ...-- , , L s , 4 M. A, .gy ,.,. ., ,,..,,.Q,Q,v.w.,, NW, ,,.s..'Iz.,.Wfg,,,,,4f,? ., .1 .. .. 1. -- .. V ' F a j , f H 4 .L Q V -.f, f ' 1- .5551-1.5.2--, Q IN 2 , ' 1 ' Center:-Molohon, Fry. Inner circle:-Klise, Bleakney, Smithson, Galbraxth, . A Ieter, Browder fX'L'lSl'.l11 fhomas, Tontz Jenkms. Outer CITCIS.-lLd2i.l1'lS, Mat- . A - . ' ' ' . . ' . . . .1 Q 1 1' thews. Balrfl, Lyons, Berlm, Ga.1ser, Hazeltme, Jock, Campbell, Kxrshen, H. W11- vi 1 5? ? j Q.: son, Lundy, -Wlllxams, Howard, Garrett. Upper left:-Casey, Newsom. Upper f 3 . U 1 - rlghtz-Allen, Clark. Lower left:-Gaylord, Galloway. Lower Tlghti-D6YV1tf, 7 F55 Haskins. 2 . -, ' - A .y?mP .-. 1 . ,:, . . 35.1, ,A U, woaewwagms 93. b X . ' 1. 'Q nw , -fu -I-'i ng.:-J,-2-W... 'Q-,K A CW ,fu ,.'- -G M. ' 'f : - -Ru 4 5. J . -'12 ff-'---'Tix - - f' P 9 V- A U' rf. if Z .-55 '.1.' f' J- ' b E...,,Q.:.2..-.,A.!:.4.,i ,' v - -' '. Ng 4- .Awe q,,rg,,-- . . ,1 A - ' :J 'VL -, - -A1.f, , ' fy -. -l 'Vf-J-,Q 9 ,f Aj, 2, 'J Q. Jiffk.-'w 1P-f u 5: J H 15.91 - ff' 1 f --ff , :-:fa -'nw H --.--N-A -- ,ww -. W.----M-4----A-. - , - -. . -nz- .amxmammmmnm . f -zf.qs-saws ' -3 hx-ar3g .,1,,mM' ' ,wg,4-meg? Page Eighty-one .f 5 A rf Q- . 'A , 4 .ao wee 'S'-2 cfvze LZ f 5 .52 5912: :-, , ' ' 1'-4. Sify , ' cg A . 1, A ,A -xl I V 'Q ,g , 4 ZA- wrt' -:-jr QU: - - . , .3:-:q5::Q,f1.--:-:' city- N'-cy, ',:: wv- ' T' 'L '45 .5 S --'R WS: Tfiwim 5::ff1': . I ...Af A 4 S7 fax' .-N wif- ,Q Sag 22 H' i '. 2 1'- ,, , ,, 1, Q Q --X I ff r c-A -1 , . was-84 'S -. gh- ., . - N X ,. i bf, VW5 33155, qg'amm,,y. ,IQ , 3 gm . g Rl., 0, if .4 , X Z 5 I2 iz, Mega 35555, S31-' -'I , ,I A .im . ' Q Q'x:R:Q5:y1LI'5:-: U 2? . ' WT fr 'X 9 I5 iff gk? 3?,5y:'frEr Ye QQ: V-fx: ' 1.41 ,I pq' ,ibxwz-wifi? Smwzmgi Q J J' -'E 7-I fi 1 TR gi f M i A V1 Iii 1 :Q 5 Ez 52 gg 1+ 1 QS! fir rg L : ga , - Q I- f ff iw RZ a f 1 1 E 51 JI lg rf 1 ' Wg .ff +1 , 1. f.- ffg glee-wxvsf' vewmrsx-21 :SLR NCB: I . A .4- ,I N by -2 Ei 'JQ E3 ,Q Q, P5 .21 Q : Q '12 .f E5 3 3:39 ff gg M3 '-QI Lynn, Garrett Browder Monson 5 fzjg McVay Lynch Fry Molohon if 5 .3 :E s L2 I3 1 3 Y? ' 1 IIE ' -- 1 gf i E U i if S 525 5 I Y , I Ei 5 -5112 A Blue moon A If EDITORIAL STAFF Editor QFirst issuej ..,,..... ,....,... L yman Lynn fgfefwgergg Editor QSecond issuej ...,,. .... T ruman Garrett 1.5. i ,gr 'M K DEPARTMENTS y ji 1 6 Jokes .....,,............. ...... B ob Browder Eyffw-4 5 Short Stories .... .....,.. B ud Lynch 2? if Features ............., ..,...,..... W alter Fry 9 ' ,' I Poetry ........ ......... A Ifred McVay sf ' B I B na I M I I K 11 , , oo is ...... .r... e 1' ,rc ' o 0 lon 1 1 2 Q BUSINESS STAFF at jei F 1 55, V -Q, . ' Q : Busmess Manager .... ...,., F. arl Monson 'Q 5 SE 1. S . ga .Fi :a 3 if . Q 3 2- -,fa , ' 4-Spf-4N g:P wmv 5 www 15 w 3 :fire 'Ml rw' ' Y Q '. Z' ,'.:'21 ?3bQQs:awc1m.yv:'Q:Qnn::c-f-xvysaetxfxs-+,gq gh.: I I ,I . ff ff. 'U '. 5.1 I-grggwgrxrifiwl' :ff figs? rf Qxg:i.rr.f.,rir.ir..f,- ws if l .V Q1',g51:-5'j-f.-3,fg.fL,L-If -. 1 my A -if .fk I-4 575151 w ,Q-Q' f 1 ff'1L9h5'A5 a'lf'nf V fx Wfefffib gf-3?-,f3'F fl: 'f'LQ'L:'To 2 50? - F ES5-JQZQWSM1Q-:f.yfe53Qlf5ZfJ19a2::eff.wwfiw+ifM- f3flv91 f64f 'Willy ' -lf'WHW'WQWAf'WbW'W'WmM' 'WWWW ' Page Eighty-two Y-M' Off Q Q B X 0 FACE -rex x ,ui 4' 1'-1 fr, N .i . Vs- .. 5 :if ,- -- ,fm 5543 ga? ,nfl 7:3 an U fi 5' X . im-A Ps: A' H22 7 . 'A , L 'sais ., ik WWW wi? M 3? ,- grfrf- T:-:iff-: Liss. f get 305 M + f'A 4 f aaa i:e:f-sE:ef- , .za V+. L ,L g 4 ,. ' 1' ' J-K Q 'cfwfxaajzfvnx I 'QQ s ,' Drama and music Howard E. Pratt fi This season has been an especially successful one in both drainatics and music. Under the able direction of Mr. Pratt the fall opera and the Glec Club have both been particularly successful. The College Orchestra has been larger and more active than ever before. .It has been directed by Mrs. Z.-,.-.-,mg-ga+:1-:.:g4ugnv, 9 - .. , ,A .N-. ' 1 ny.: c 1 my G if 5: , -. :law z as a w ,mg 2 'WN : 521 1 :lt ,' xt fi amalga- gamma 553 51 if 3 fn: J 1, if .1 - f - so 4' - 5:-:cc 1-51- sq. ,, 1 Fi ff M V5 if '- 35 E5- 'Zf J. 1-. ,ff-1 5. if: Q 5 Mi 31 S? filf if 5,-.-., we if h -:ff cw 'Cf '53 . ,VA ,x if we m Bowers. The Pep. Band under the direction of Howard Deye has played 9' 52' 5225 consistantly at all athletic contests during the year. It has also appeared aw,-1 a number of times 111 chapel. -fi, Mrs. Davis has coached all the VVhitman Dramatic productions this year. All the-plays have been both artistic 'and financial successes. This N year rather more difficult plays have been offered, with great success. 5 it W 1, Q f fffrqwe:-.vc-:,.:-:Q:,:4swuf:oci:w::e:fsgv-sm: iibfiv 5f'lQ'f Xf pak' 527 5 , qgg''vmWf1'4f+fif2-P i4ffX4?-'Fi-ff L'- ,' X 14 4,,.- -, 1,5 L3 Hcfqig M.:-4 ?..P1?'5-fwux. Qig.,.3,,'.: .Ll 151' 11, .' 1' ' , --7w...T.,fgff-A-f.:.v i , 'rg' fiwmm' VJ7i'.t'1 'ffw.aQQ' ' 'iw'-S'i.v'?: .iffy ,:-,.,,n.: .,.,. v,.,3.L.,.,': In 1: -gli 1 Rwdocoo: icqilyf :fi 3 ' f-mms -all 'lcd W -'Lx :qs 1 :fir-if-firlfs--f-'.f 'ga cg fig' -W--'g--fr-nj r'- 2 1 '- ,, V3Q,:g,3:54f:'VL,.f,,qL:-,QmQJ3g4,i,:.1,.,33?,, fl.:-a-:whirl f,4-Lge! gf:-::l:':2:j?a:4h-52-S , f:-spas:-f.,:e':1r.im:-.,::'V' 11 f 1 Page Highly-Hzree .x 5. at f ,s qt UL f, Q. .4 if Qi 4 , Q1 L 41 ia P fx X07 - 4 f '1 vt ' 'R' ' '- '95, I IN.,-' 7' . ' 5 it 1 15. X123 .4 iii? ai. f as .F IE 1 ,I Ji . ...ri sa, ,v.,?.,fg, ,..,,,,,,af,g? sag sr. sg. . , QR... if SVN f., UQ? N' N ' K 'f'W1. 'R .L X' C N' was Y Q, if 5.357 j2713317,EI11'iVQ:i W 1. fl 2 'Q 'bl s: 1l- Sl 'V' .97 e. xi 531 ,ei :E ' 'S: V ' - Kp A' ii '.' Q 11: l f nf 5' :fi 7. I ' :L em E7 cy :L ' g,:e5fi:. x .W ffl, 3-1.532 S 1 EWVNLQA3 1 op homore ag ff , ,, 1 '12 ff 5 X2 gg Che Butter and Egg man Q, 2: Q ' 'Z : 5? 4 A A ' - if ' 3 The annual Sophomore play was presented at the Keylor Grand Thea- 5 -i , . , , , . . 1 , tre on November eh. The 'Butter and Egg Man' is the story of a Mid- 3 r,- . . . . f 1 ,Q is Wlestern youth, Peter Jones, who is anxious to get rich quick. VVhen he 5 1 X . . ' . . as reaches New York he is roped in by two play producers, Lehman and 1 53 McClure, who persuade him to invest heavily in 'their company. After the fi L 5 If C play has been a huge success, Jones learns from an attorney that the author -gk' ,551 ' of the play has never received his money from Lehman and McClure and so 2, I 5 '3' Q. 5 til gladly sells his share of the company to them. ln the end Jones.ma1'ries . ...-,. ,-4 .-.-. Jane, the stenographer, who has fought for him. R. .w 1 32 Mrs. Davis directed the play. Jean Spaulding was the businness man- if K ager. The main parts were taken by an exceptionally able cast: wg Peter Jones ,..... ...,,.... Noah Richards gwfmig R5 rf! Lehman ...,..,... ..... J ames Glasspool is McClure ....i .... C arl Hebenstreit Jane ................... ........... H elen Gray Q g X, ,,, Miss Martin ,..,. ....,.. E llen Hazeltine 1 5: f Q , ! 45 OSC31' ..--........... ............ O rla Moody 5 1 Ffmrly ......... Betsy Towne ffl-' V :iii if Q 5: ?s . . ff 2 72 N v Other parts were taken by Kathleen Shearer, Melvin Jensen, Winton 52 ig Af Ticknor, Lucile Beck, Albert Garretson. in-vc. Zcizxlkvcki ,x 1lg5T'ff.f'V'5f5?if?ff 3 ffm, ir --57, 1'55gzw.mRfrQ41:?,8 'P - ' KL D- 'S s:2,i4f:': pl Y iyvfffffy Q-fs....f35f ,sa '1'hw,fl, urzfwgmizis-.f,ccus:u,Q1a'd,vyfeE51-nk---1-Qmwewraigs..25924:I. lrmrsm- me -5-e.:..lQ ilvnnitmdimimmmii:fwaaowvfwwivwsnsisfrx Page E'ighby-four ,clad-w. . -2 .NM . .1 -1 I 1+-2 V. -N -.,- ,., ' '::f ? ' fm , f ..- Q 'W . 'act' fi-5' :rf 'TNT '.ft1:I5 2.-5:-I tl-Pi 4 f'l:'.2' -Wi: if.-:PI -'42 V li 3 this -Q Q35 ryggg. if il' 55.15 351515 lf waz. 151311, 521:55-Ii f .5-Q 1 fr 2 X-1355. Qi:i:2L2'T5 ' t ig, Biff! jw2:fTf P2715 J hifi aging' 6571? .51 - 2 'SY-1-.2Lf:s:f.ff ftfm-f-ffm 'SEN 32421 we was W -V , n . . , . , N . tg wi, he-. lzyfsff' an ' ,. .1 ,A ' :ew rv. t W-A X . ca. ,L -y ,.,,,.w ... . A, 2335. 45231 -Z3 .fast 'utzfiv . . One Act fPla5s The Dramatic Club presented three one-act plays at the Vx7a-Hi Audit- orium on December 2. Most of the parts were taken by the candidates for the club. The regular members coached the play. The first of these was the VVonder Hatl' a fantasy by Benn Hecht and Kenneth Sawyer Goodman. The scene was a park by moonlight. VVinifred Dunphy portrayed the part of Punchinello, the old vender who owned the Wfoncler Hat and the Magic Slipper. Harlequin, QPeggy Vlfallj and Pierrot CI-Ielen Grahamj are rivals for the love of Columbine CMarian Bergerj. Columbine obtains the Magic Slipper which causes its wearer to be loved by all who see her. To protect himself from her, Harlequin wears the Wlonder Hat which makes him invisible. In the end the old man demands back his hat and slipper and Margot, the maid, QI-Ielen Shellj advises the audience to draw its own conclusions. The second was a Christmas Morality play, Dust of the Road by Kenneth Sawyer Goodman, Margaret Galvin played the part of Prudence Steel. Loyal Perry took tl1e part of Peter Steel, who with his wife planned to steal SS30,000. The Uncle was portrayed by Harold Wlilson. Clarence Monroe was the Tramp, who was the reincarnation of Judas Iscariot. The third was a melodramatic farce by Gilbert Emery, l'Thanli You Doctor. Mrs. Lester QBeatrice Irving, enlists the sympathy of Dr. Gur- ney QPaul Smithsonj for her insane brother C.Iohn Forsythej and while in his office steals a valuable string of pearls from a jeweler CBob Meyersj. In the end the insane brother returns with Mrs. Lester in l'13I1dCUffS. He is wearing a detective's star. Irmal Kinnison played the part of the nurse. M, '- 1 . iP'i3f':2f'm9WW fQ'Tfvt:WAI k ll 4 t 'A Q 4 w : ' -. ...J .1 'ff : -'. 'La 1133. ,vc ig., ls za...-.,,..,. f t -5 Y. .1 -. X K an T ' - . A ..., avf.1P2i?2,.Ezy7lty me wi Lmsszefg. emma, Qsuiggfs in bmw.: ki! ..g25ji-- if-:Qvfa s G ?7'W yi? 4 4554 Eijfiy 'L 'HQ 1' M1 . . f 1 x . , X 9' Q.-.-N Q' ' ., in -, if V i me ,. , a sl, -VV- X I ,. , 12:-4252 gzidfflii, Q ,,. , Eff? 4?a.wxff:':gQ., 52 '1 N 1' ' ' I H X15 '-.'.E,:,,5F 2.2131 gf. :':IJ1J: fg:gf5g:A4.p, ,.- if.-'1:f. 4 ZR' 2.-:, 1' wa:-1 mms- .wx bg :aan Afsfqsfzfze -was ff - -rfzvrc-'-r . fi ., gfx ,L J 4 7 s 2 -.Z lf? W5- sg? Ei A 1 3 Che Dramatic Club Flag Crelawneg of 'Che wells 'l'relawney of the lVells, Arthur Pinerols four act comedietta was presented at the Keylor Grand Theatre by the Dramatic Club on March 2. The play has, since 1898, become one of the most famous and best A loved plays of the American stage. It is the amusing and tender love story of Rose Trelawney who becomes engaged to the grandson of a proud and 1 testy London aristoerat, who first objects to the marriage but who is later won over to the side of the young couple. The cast was made up of 23 players. This is the largest cast that ha D a ever appeared in a Vllhitman play. The cast was an extremely able one and iiffffififffifiilfi' ,sf?Fl?fT'a , ' f QA Q i 1 3f'ft'F -1 ..t.,o,ujN,5 , Z5:,::Ql5s:-'+L-Q?3i W Q!-'kt diecast-:sl ,iw A 5.1.3 XB' 53,5,.g,gi, :iv 1 5 4,3 A --rt'-:-'-:zz3..1141-':ivgvzz-ffl:if:Qxf.-1:-,eesH .2531-. fame-,rl-:Z-.51 w:.pQf,,y5 ,,V-Gmyflv.-'--1.-A-f,-All. Page Eiightymsin: - MA - M '5 ' .. 'T-Sfflfi '1 ' YVW' i .ff 1 f' iiiiiili 5 P ' asv. V 151752521 ' f :is t 1 f i vi X -, 3:1 1 'S 4 .5 f, ri A 5 c Nl. . , M . put on a truly finished performance. Mrs. Davis directed the play. Alfred McVay was the business manager. The cast included: Theatrical folk: '.l'ow VVrcnch, Loyal Perry, Ferdinand Gadd, Osval 1 1 1 i l Jacobson, James Telfer, Eugene Kliseg Augustus Colpoys, James Glaspoolg 2 Rose Trelawney, Frances Johnson, Avonia Bunn, Evelyn Sayers, Mrs. Tel- fer, Gladys Bengcg Imogene Parrott, ltllen Hazeltineg G'Dwyer, Vllilliam g Galbraith, hir. Denzel, Robert Goodwin, Mr. Mortimer, Charles Esserg Mr. Hunston, Kaye Land, Miss Brewster, Elizabeth Reisinger. Non-theatrical folk: Sir lYilliam Gower, Clarence Monroe, Arthur Gower, Noah Richardsg Clara DeFoenix, Caroline Hanger, Miss Trafalger v Gower QSir VVil1iam's sisterj Marguerite Galvin, Captain DeFoenix QClara's husbandj, Arthur Jones, Nlr. Ablett Ca grocerj, Harold lfVilsong Charles , Qa butlerj, Charles Esserg Sarah Ca maidj, Elizabeth Reisingerg Mossop, We Martha Englehart, Q The song of the play was sung by Miss Nancy Harris who was accom- 1 panied bv Anna Lou Curtis, pianog Catherine Hoxsey, violing and Constance Sundquist, cello. ftwiiif fl ' Z--1' fi 3' ,,, -1 553- .,-.I ,IJ YET' www,-'.l,5 14, Y., at i K Wi... V ..,., ., 2315, -'fx ?'TSi2?i' E-1 V u j'- 'T I 75.31 iit:t.,,,,if ,. 0 Q f f, -1- 'QQ .fggzf-7:.,1:s:??Sf tw 1-.1 ij,QJQ, M ....-.s ..V, . V .,1' N, 4, .-1 - A ,N A H . an.:-fr sr, Y. V 1 1 , ,, ' ' , ., X , L Page Eighty-seven sex i s. is I-. .1 X 7 L -J k 1, i r i i 5? Q 5 .. W W 5 gyms, 1 if-V 'gif -'Z . 'fa Q is 9 if Q' . 'N s . f?e'em', ' Q92 . Gi - ' ri K 2, ' Q V- ' sis' 4 . ESQ.. ss. , iazssffr-Q 'jg gs . Skov ilfiffig 1155: 2 Evkssycwzaasa ' an ua el Club 'Pla s gs-M f q l ' . E 3 S 14, J H If-X1 E 5 4' E Q! g I . Ei al GILRMAIN CLUL PLAE 3? l A l A if f f 12 5 1 si If S l. he German play 'l ravelhng Acquaintances was given February 17. gf 3 If It was coached by Abby Henderson under the direction of Mr. Miller. if 'ai 5 The chief characters were Heinback Qlan Van der Vatej, Fanny, his wife, QMary Ringerj, Proppenburg, an habitual drunkard, QGayton Baileyj, y VVilhelmina, his old-fashioned wife, Cliatherine Kieslingj, Hilda, Fanny's ff-14169 neice, QClara Grossj. Other members of the' east were Le Roy Kicker, 2 4 David Schloesser, Glen Woodward, Elmer Heimbigner, and Ragnar Kron- is JSE quist. The blay contained many huinerous character sketches and was very 'QE A entertaining. Laura Lynch was wardrobe mistress and Albert Raugust, ' stage manager. - 'PO . gay? Q 2 1 BT 5 if :Q Q if g g E i A 5 5 1 52 ' 55 5 2 . E S 3 f TT 5 as is at' 1-ff 'E 1 , Y imma? ii- xi: g gsfg I2 fl , - . We .ff , bPANIbH VAUDEVILLE V ' if ,?,w,.3 A play, a bull fight, dances and musical selections were all included 1n Www a pro 'ram of vaudeville ut on by the S anish Club A Jril 27. - 'ia 1 w . . . , ' I 1 . . lhe chief feature of the evening was a play, El Cuento De Mayo. g Q, The cast included Peggy Wfall, Marjorie Elliott, Alan Vlleisman, Phillip! Da- 5 , 'vc 'E - k Vis and John Carpenter. 2:-x 1 fs 1 x . 15 ' 5 2' YQ Other numbers were a Jantomine and serenade b f Betty Jerffers and if I 5 li 1 L .. NI ' 1 ' - - ' ' . l Zi any l eyers, a solo by hnriquetta Pineda of Mexico, a reading by Dor- .33 2. f othy Johnson, a vocal duet by Beverley Means and Mildred Murray, and a very spectacular bull fight by Paul Anderson, assisted by Purdy Cornelson A l .55 lf' and kenneth Shields. il .. V ,. A L if 5 if . .. . K q5kWER s A M. ,., .3 ,Q 2,39 ',' 3' ,.,e4,ea1.,..,e-'.', ' A 1:1 A.f,'ffW'f?'-L., ' Q ', H . 'C '. F .H P.: Q34 3 .3 1 Q gg V , ml, , ,gif - f r f - is Z ir H - ne... :fm-A-f H we - ' ive'-v . 'z G 1, 2-wfsmzzzsfauiasnzc-r-s5csf:s's-wximfzvfhcwsifameamwt Li-,.w:b,3 'w:s1ff,b 5 1,: ' ' ' .'J,ZmQz7gg Page Eighty-eight :f Sc: A r 1. W 1,1 E ,- N, af Q :Q C as .4 N, 'K , .' I L . ' ' ' H .Y-f 1' aff-Nj fm .gfnkf Q51 If 45-1'-, ' ' ' 'N' ' PM WI, ,xg .ff N K R' --..-M I ':' ? X5' M 1 2 A S r if th 5 'Y I , -WA-W,-., . ae 0- A-.4 ,-.. fn -an '- -- .4 B, ....., . , , . . . eh -'62, Q2 W- -Y ev -f-, A--..-, -f fi ' H f's1--wf+ E-lf gr .r...saA.f.-,.:-.L.-,vmzea -2.44-.fm .-sf,c,,.f ,. if -our sf 1,1 1-,M fzf-,crews-1'zawmsmsuxaaaivi-av awe: Sim:-XMV ev- -ml-Q9 'f2q,,5Q,6,,5,,,,,,,m,,3,6,c,n5,. J., gymwwmawgmg 5'.1QQ5:nef,e:fafgawx-:ee-fg, ,sg fs 2 ws-Tig.: Ea, ig 53. why A' f ' '-1 0 Q gif2asf .'2, O ,- ce, 'fn' . ,.: qu- 2 J r , . J . fr 4 sw Cb ri 5 U' 51' U1 CU H' CD ' P-: O 5 f- 1 r-4 +-A u-4 4 f . ,igjggfozvpawwmzmogwce 1: my-gg,-1fD5CDO'5If97CDONW5 Om -,HQXSE-gf:-, v-'-'pCDS :-v-r-'v-!::s r-1IIS,.1'fr-r- QW :fs'f24'1 , .a..H,,.0, N: ..,,.,.. '4ggz3oH53,wgdkr3Q3ofa1-:H '24 1?g.:2?', .J 1 I5 v-' in 95 4 O WWZFUWQWW :SHUT r-.Q f' v- O o o 0 - P EQWWWUWSQFEEGWWQ df News., , F5 O Q :E X' FUH w moi if 5' H' P-swdixv 'AEP DQ .Lg H ' Aff- 5 5-img.-5'g FSE-mdgfgifw Ein, , 5 085525: Sang' mggig REM j' . , m , www Sf gg 5 ,.. ,... ,.. H 4 :Af 23 '1 gg, ,Z Q. 3 ? Y-U ? f::wP,-.,, ' . KU ' 5 ix Q- - ww 'PU 'U ss: g Q U7 E id ga.faV.N6? f-r an f-1-1 ' 4 P 1-r 5 r+c:pr+Qmc:,aw4+Um:.,Qmmc -g 13 ,A Q eommow H-Ewwws as O EUELQESSSWELSSEEE6 vo- mf? : N O ff: ' ia 5 - if .- fb - o W -- 9' E o A 73 '1 U' '-Q P ' Q ww -' H L2 We ,2aa?w5P2l??B,?UfsC?w :Q v2-'f330f3.S,Fi- ,.UQ.TS:'.'+g5.2,4-5. Q 'sf' 5 '-' V1 5 D1 rl' P-: ' Ur: W N ,-. .- ,. O 0 B . o . cu Q, -J 95 ,., o gi O ,D r H 5 e Za :ff 9- H 3 H ff: 3? : f' B 'L fa ro E re- 2 g kj ay pr. PT 'H-ecvwv'--1-zxxiaqgg ... U1 3 1: Q. 5 :r N af 9 5 :X wif- E' 14' ' Q54 :foe-fzfsff-me-:figs-1 742-6 'arms lfszfwsf f serum- -:'.1f:2 Ns-:s:.1w 1- 1-pa-:eases-:ww-1 '-.mn-:c-sf.--:fax f 2,1-1-,-:swf-A-,fer 'tlmgf -:ly ?51m,o'5K +1-va.sawqw,-,C,,,fMm,m.5.,,,s,.,.,1, W,,.G,,,.,,,.,,f.f.-2 2:Q.g,,,,,5w.g4.,QAit LSA Q., fi z Gap if 'L 5' Vaughn Haskins yi m V 412 . , ' Mary Lou Lipscomb Howard Graham Q 9 3' Beverly Means Leslie Armstrong 1 - f . E sl :w QE i 5, 1? 5' -32 vi-MWC: Jw. A -- F - sfrefrra :D . V r4.,iT'H !,6f.1'5 4,3 1 4, ,I . . H -Qyflf, ,JY if,-jf rr '. jg, V A H V W W ,, .l ,. .y gi - 1 . , .knfgkgrmamevqecflsmaamgweaalfassasmeavgzv Q , N- fdg 315,73 If 'Qjlx 'J . ,iw ' ' . 1 V :E A -1 5.1 ' 1: '1-e' ' If ur- If -A, ' . ff- 1-H: ,f','f.a ' ,. 1 -.' ' ' ,: ,ga 9,2 4 1- -gg fag H J? 7 H -7.,..v...5,,.a,,,g,f. , , ,div vt!-,ifcwff Aiwa fw..,,..,.4:.5 3: - . 5 :..1,.z.K.r,,, , ,1 .xg 2, 51 f , ,' . 1 'Q 1-54:- ?-fx: - 'b.-W1 - ' - ' RP V' V if Q.- H 5531- El ' CESXQSY- I' ,fl H if-3 Fi N n ' L '- ' ' ' in :ph , ga ' ,HA-, ,AQ 4.1, ,Vx ru - ., ,I I 1, x,4,:,- e 6- J 1 effvfsg-1-Y.:..fx.f. ,. ,Q 5 .Ig I, .diawfi J.. ... ..,..,..., ,,...-,?,.L2 1 il. .M .W ul-1 Luv, ., .1 g'4 1 , ' ,1 v fu L- uv A 4 C . Z 7 I 4 15 L- , 'ERE-:X-Em::'aSmgmQa'Mxkir:4murcmw J Rgysqfzf' M4-1-. '. 01 '-ake':ze1zvy.:as5x,5zr'nef:ez:1v..:sp'r.+a-uJ:vf2,yfrfagn- Page, E Lglz tyiqgwine , 2 ff , f 1 Che Annual Upera The Prince of Pilsen The annual opera was given Friday evening November 25 at the Keylor Grand Theatre. The opera was the Prince of Pilsen by Frank Pixley, and i Gustave Leudes. Both acts take place in the garden of the Hotel Internationale at Nice, A France. The opera was an especially elaborate affair. There were two main -. chorusesg the Vassar girls and the French Maids. The Dance of the Cities 1 included dances by Mildred Williams, Bostong Frances Meyers, Baltimoreg 3 Dorothy Nugent, San Franciscog Beulah Burnett, Philadelphiag Dorothy Hoffmang New Orleansg Catherine Harmon, Chicagog Margaret Collins, , St. Louisg Emily Menefee, New Yorkg and Marian Le Fevre, VValla Walla. Page Ninety The Bathing Girls were Martha Moorc, Betty Daughters, Elinor Lyons and lfllizaheth Reisinger. The Heiidlehurg chorus was particularly well received. V 'l'he leading parts were taken by students who had had much previous experience. Harold Fleharty and Helen Meyers. Thelma Paul Reeder took the part of the Prince of Pilsen and Mary Catherine Breck that of Edith the Vassar girl. Binks Penrose was Hans Wlagoner the Brewer from Cineinnatti and Jack Mc- Daniels was Tom his son, an Annapolis cadet who is in love with Edith. lNIrs. Blad- ison Crocker, a gay widow, was portrayed by Katherine McEwen. K e n n e th Casey was Artie and Anna Lou Curtis was Annie the daugh- ter of Hans Wagonel' with whom the Prince is in love. The part of Francois, the Maitre d,Hotel, and Jimmie, the page were taken by Shepherd was the maid. The opera was extremely lively and full of action. The choruses were colorful and well trained. The All-College Orchestra provided the music. i s rv W1 N I V' Q fs. ,J faafx aa' LQ 5,14 -:DQ etx V9 gi 'R X Lx! ' -C oofw' ' motif X? 1? Q' Pi - ' - QQ ers W- v '- eff 2 . .QVQCT ,J ww me LQ! 0,1 Wien J J-sie-'a'::11:.1'f, '44 N. ,, Zvi- Ffh -5- panacea: 1 Magma: S as .9 ' 1 im. : Z, 'f 2 :r .gf . vi . Y . lk ,, Q .. X, it 5 , iz ft iv.: 1.-ff 'was-A- ,. V. ,: 'f:: A V. '- iierritfif 3 ,Q ' ii 'fri -91 V C 1- 1-E-fifwr J' i.1.-.Jackson , - ,112 ' .'-7 , x 35,1023 ,-. .- 1 ,. , 'Cm' e ty one fl ,f A Q 1 milfs yaw 3 K2 Q- 14 . wrpg, , ' y -: - v 4, - 0 - H ,H 3 1-1 i b N ' le' X 'W -. E1 1 . Aj SS. L 938 .asa . .Sala-V .Q W , ,L , ' .aww w52P3i1K4X:h2l'll4l 14 JW' JQLIX.,-2 Ss-,--ES ' ' is -,f 'js Sw 'J CX 39,3 M54 ,.l:Wa..g isssxlaa zQ6xCi!,,':I? 5? 42 Q - gs fx 55 2 -rs 2,2 s. 5 .l 'EP 1 Y' lf: li x E2 '72, 1 seem :EMM 555 '4 I F2 ,f 53 ,V A 4 iff '2 4: so ' 1 3 , : Q: i si - w 2 ' f pw i A ep an 9 F I '4 ' I 1 Eg X ' 353 E i 55 3 22 Q g This is the Pep Bandls third year on the Wlliitman campus. This, Q ' ii year it has been especially active, under the direction of Howard Deye. l Milton Wlight is the secretary. 5 is EE I ' l'he members of the band are: I5 rf -25. Sqn K.-' 5 -J . F' 215 C larme ts- D rums- Geoffre Yake John Wfurster 2-a e 1:1 5 ' 325 Harold Cartmell S0 S I0 5 .sf . zz CL 1 ne- - L 3 Marshall Curtis I , P T, 5,5 'ig Milton Wight 53aFmf9E3 111'0'7'I'l.I90'l1,6Si S I 25352 g,u:e:.:.-Q Dan aigfj 7'07T7g,'ir jf Harold Fleharty en lseman E .v all . V-Rl: 1 Glen Wlmney l ' V - 1 A French If0rn- 'lgalgesii Thompson 3 fl 1 Frances LeRoux S allsom Q 3 5' James Richmond g 5 ji Alfa- F1-ed McMillan Russell Gilman Sidney Rogers 1 5 is L 1 A -E F ff: if A f l 5 l. :? 1 lli Ig 2, 1:35am-res? bg-575.-as 1? ffl'33?+. , , , - A ,.f:f'f7f'?g,. ff,,'g'E:1f.K Q V, .Lg ' lf '- H' 'lf--0 ',. ' i ' l ' .',.-A Q : . K . . . iIw,,e L Ng. tl. ' ' A Q qi?lEF?am6 ?Ka! ,, , ul .P ' P. w1f4a,W1.f- z if ' fs wma- '93 2- 113532 if L - P 2 4. 2 'es V gf 1 1 sf mg' ig - f 3, 514'-:gg . 4 egg gas .- '-or 1 , Wlgfg.i.1,,.,,f , fyw. gf . aj bf- - . , ., j4g,,,, if ws na., 53n3'? v ' ' H 4 1 A 17' 4 W ii '.r 5 'l l NK'. V 'Quf f Mc':. f L 59 4 'wfxxlf ms-za-W' Qszxmsivfnfww-raw: '-abvmlfgi t'w,g,.,g.Fy - ,,.q.,Swy55QQ9,1 Page A , 'L7l0'filj-F100 . W 7, f. 3 .eg ' V gl' endian ' filifilt ,l li-' 5- li gi,-'EZ eff fs - . Erflis S 354 Che All C ll 61 Cl b ji After making a successful tour of towns in Southeast Wasliington and iff 'QA 1-. il: h . , gg Idaho, the 'Whitman All-College Glee Club gave 1tS home concert at the egg 51 El keylor Grand Theatre on April The club was given an enthusiastic ,J welcome in every town in which it stopped. .. 3 .' lg . ' The program began with a song of greeting and several other numbers BL 'vi S M U1 at sung by the entire Glee Club. The Seraphic Song was sung with an in- 'ivzcevrf-has L-My-.fig if Epi if . li - f 3' el La . ' E if 3 3 'Y f ' ' 3: Q2 4? in , ,A le.:-1-:-A. ,ff cxdental solo by Catherine McEwen and a V1Ol1I1 obhgato by Mrs. Bowers. if .LY - 7 5m,f,,,? Catherine Hoxsey played a violin solo. ' Lf-: 43? ' 4 ' .F-.-m:f:'.g -1, il The second part of the program was opened by !'My Arcadyn sung by 2 Mary Catherine Breck, with orchestra accompaniment. May the Maiden, 5 has Q? 21: is E5 w I a choral dance cycle was represented by 'I helma Shepherd, Helen Meyers sq , , . . and lzmily Meneiee. Qi . 13 . i 5.5 fi if 2 : l , . . . . i ' 1' 'L 'l he thlrd Dart of the arowram was the one-act comxc ooera Trial by '- ig I D 3 ' 1 ' as Jury in which Helen Graham, Stephen Penrose, Edwm Beach, Kenneth 3 ls I 51 'S I Q J' Casey, Harold Fleharty and Bob Meyers had the leads. f . viwftiq' ff -. feb .. jjrgaa Qy3'Pf'E'fIY f533'f ' Mmf' K , ff - - V- A '- - 'rd' 9'- ' dw .C .I KR ' V1 ' ' v. ,NU A, pn. ., ,,-,,f,4-,, K . - ' . . 321 exe!-fwaazfmiegwieapsazfssxp.-v,.,Effa 1.31, jrffs' -,ly ve. fl js-an U xpf 'Z K- , ja CQ-ff jrfffr -'-1'-' 'X '- fn . 1 Sf K 1 ' '. J .,,c,,Nf,,,v5,x,i,f,,LLv,f'Nnfl 249: gb,:T13fp'ccwieJg5lR MJ Y,-'S'-,if X '.,..,. . 1 ,tc I ' 2 - , . I l ',,5,,,?.,,g,,,,-we-.m. 4 kv 139 ,e'x,3-'N , ' ameifk '25 1 J: 1--1 f1j,,.,. f , , f ' 1 4 .W , Q 4-,Q 1 Afwa wk :?iL.,,1.3g.,m,Y,5xWp4,,,,j,f,gC.5.,nNo,g,,Q,Q3Qgwaqiwlbr, 4-:m:.ML.v -v..,, ,... Y M.Twm3:1m.q.w.:I .rzcwc-:seepsrg-:5:-:rp-rvgefwv' Page Ninety-three 5' ,- K, 1 ,. fvifrrfsmmz-ffvzin:fwrzzrxtcls - . , 3' mf 2 L -f. -:tk 1 f., 5 1 ia ,, CA rl , 32 1 J 1 N zz 1 Q mem . -.f,. W, .w 1 moi- is: -A '-z fe ,X 5 Q K if f 22 llf: ,S' so-A ,J , P2 ramp . .Nu wc' 2 ,af is rr- 13 ,fi r 1- , Q . ?5 - v i. ' Q ' , .i-:2- ' -'xx 4215: 55:2-' 2:33 :fi-1:-1. 55:22 P-'jp :s.!:T-I ' 2 ' mf ' 35153 E ws? ate We gwa.:1:::3v use E sa. . .. ' if 8,1 Q 1 . semi 3 935 ings 520+-hffixiq .3323 X524 if fin 'Q 5 5 F 1 S 'Rayz 5' 'SSW 9 of fi-,bv 2- M- ws-1-ez-Smash F, e sas-:Brass .,c?zQ3a95,. .4 at f-wmv, '-A12-5xwg-,L-'tg 'ip,5S'.- Q wha iw: QQ 1,7 , 25:5 El The Qrchestra ei Ee, The VVhitman All-College Orchestra has assisted in many productions ofa r 3 this year asnwvellmas making the Glee Club trip. It has played for the i Q 1 f opera, for Ti-elavvney ofthe VVells,', for the Butter and Egg Man and for .4 14 v Hox 4 . l C c J 1 K7 , fi J' tk y .gr f 32 0965- Q. -1-rscwink no the One Act Plays. 4 53:4 The Orchestra lias been under the direction of Mrs. Bowers. 'Catherine 5: sey is president and Lorene W'est is the secretary. Those members of the orchestra who made the 'Grlee Club trip were: Airs. Bowers ..,.,......... Catherine Hoxsey ...... Stanley Root ......,....,.. Helen Meyers ......... Petronella Tierney Constance Sundquist ,,.. Helen Kane Arthur Schatz ...... Howard Deye' Bob ltfleyers .,.....,,..... James Thompson ....,. Glen Whitney ....,..,. Bob Ringer ................ Anna Lou Curtis 5 .-g -Q 2 jf' Q ........bass . W .M ..- . ,- -.1 ':'f'?x.. . s . . ..1'f w--1-ww-:Hm.emmesaw.mm-fam: 1? . - g lif-wig, f-3 5-Wxf,-'Q ts'.'f15 3 ,L 5- , f.-- 'f 'tl' X ' WS? 3 Z-x-'5131 3,25 ?'Xfi,.w,,,,2'q.2 4612.54-'K was--At.4.,w . . lfffzv WNW '. 4 'M..:1.p'gf 'fmwsifxit . w:f.. - , ga fmt- Uh, , ,. 1 .- . . .f.'-:fir-M 11'-iff, - ' ' if '6!N54:::9?l 'flux' r ip r . f - '- f- .1A'f'1'u 1 1, - ' ., . .1 1 .. ,-. U, V, -, V- , gvri- as 1,A.,1,.-,.,, 1-.v.'f'4-uwwe-p.'w.Q:.mf'Qwv:mu-e.z2,w1:f1- ix qv f vf.m.e,,4A3 -.,,,M:L3!' Page Ninety-four ..,......vi0lin .........violin .........violin ....,.,..violin Q ....,,...violin .....j.......,.......cello violin .................flute ..i.,....,cla1'inet W. .......saXaphone Q .........trumpet all .........trombone 5,5- ...........clrumS . :aj .....,..,p131'lO ,t SE l Sr' l 1, . il Q lf? E, 'nr kno:- A !,,,,2 ,J V 5 if, 'Q ...,.q.i.:..:...a.:,,'...2 6' 1 ' . -1- ., ., Wt s V ,' fi Hamm J'-:' H .,, -,, 5902, .,,,1.,,:..,T,...:..:i.f. , .V 1, ? A.f'..:.s..: VK: .- H, Vfmmwwmxzmmr-z .sf dxf-5.5--i..,.x , , - x.,x ff i Zip- J J... .,,,-x K X, I V n, 1 3 ATHLE T155 N ilk! Al-tv X, x an 'KX was 1,-A 2,541 X X fff' In V. ,af LX Xb. , 4,, f bll- A -'Hx xi, 1 U -X X f N xx , . Q Q i I 0 E ' ix-Ai A 5 'Ni ' 1 2 'f.'?f+ 4.' --'q-Ill I L In , fix t I,-45' W ,- -Q.: :y ,mg , 4 Q 6 1 va Y I A , -N ' 4+ , xx! 'xx t . ' fyxxx . - 1 7, A Nw NX f- ,f ' ww fx ' f a ,.f . N, ' -W V7 DN, 3- ,' P any , - A XY f- f A , foot Ball Review of the Season Starting the 1927 season with only a fair number of lettermen and a none too promising lot of Freshmen, Coach Boi-leske built up a team that at several times during the season displayed a fine brand of football. At oth- er times the team did not look so well but the tradi- tional WVhitman fight was instilled into the men with ' the result that a majority of the games were won dur- ' ing the season. . W f Playing one of the hardest schedules in the his- tory of football at VVhitman the Missionaries managed 1' to win five contests. Four games were dropped. One . to Gonzaga in the best football exhibition put on by a 'Whitman team in recent years. The powerful Uni- . 'v versity of Idaho and Washington elevens had little A trouble in piling up large scores on their lighter op- q 'f J4 5 ponents. The conference championship was decided in a well played game with the College of Idaho, Ar- mistice Day in Boise. Tired from three long trips V' the Missionaries were unable to cope with th powerful Coyote attack and lost 12 to O. The Missionaries scored 102 points to their opponents 139 during the Season. Over 100 of the points scored against them were in two games. A record was the scoring of a touchdown against the University of Wasliing- ton. Although four lettermen will be lost to the team by graduation the V prospects for a winning team next year are fairly bright. V Page Ninety-five wa - . 5? Fill - '- 'V I '53 1 .. , 131' 5 V. oi ff gl 'L Q , 44. ., vzgz ww. 31? 'Ay X-f , +:' sg., -gg:-egg. WE- 3 l' 5 v . 3: if '- fd: 2: . im -,z::. 41.3 1122- -.Im me 1 we 'C gf. f 4 'W ' 'QM X in' 1 'mf-1 .',.g..- W -4-. ,341 V -sv. Hgh, ia- P '-4' ' o QL: , f',.' as ' il 1 . , .2 if 2.6-4 E. S f bb S 4 ,L+ be ummary 0 t e eason 5 5 Q ff 'I Wfhitman ,,...,.,,,.. 27 Cheney ...... ..... 0 VVhitman ..,..,,..,,. 12 Linfield .... .... O 1- - :la . N' ' VVh1tman ............ 0 Gonzaga ..... 6 E If Wflmitman, ...,...,... 0 U. of Idaho ,..... 40 5 1' Whitman 1-8 Pacific .......... .. 7 'gf Q fur ,, A' ' ' 1 1 'f Whitman .....i...... 7 U. of vvash ..., 61 Egg? Whitman ....,....... 7 College of P. S. 6 1 VVhitm an ,....,,, .,,. 0 College Idaho 1 2 Sem VVl1itman ............ 3 l Vvillam ette ......... 7 is ga Totals ...........,... 102 Opponents ...,.. 139 5 ya 91,753 5, ? i ! 1 5 it i si 3 3 5 if 4 1 N? 2 12 ll r ' . : 5 ' f ' 1 55 l H 3 9 5 z ' ' 57' . 5 I 5 5 4 Q 1 , -1 Q 1 1 2 . .24 4 . 57 1 3 :fx I 5' Q - Q 4, 4? Qs ,gf ai PS' RQ 55 '-1 e., 5. rtfaesal 'N -Q1-,L gf? 1 ESE lg yi 13 I r t il E3 - ' . . Ill Q' 'Q l gg Back Row:-Folgate, P. Anderson, L. Anderson, Ladley, Napier, NY7?1I'W1Ck, Gard- K ner, Caley, Fields, Meckelson, Borleske. , 2: Center Row:-Olsen, Quine, Schiller, R. Reed, Holmgren, Lindman, Neilson, Dora- 1 . . , K - X- thy, McKellar, Darrt, Ferrel. S f' ., Front Row:-Bagley, C. Anderson, Mongel, Eekart, Fetters, Reese, Elliott, gg' S . Fil gg ,J ig H. Reed. D 1, 1. -fwv:rzmm3cme13go- 4 gg rg' X. ...gg -wi. ..,f3-riffs, MEX . , , . 7f.j?Wwmrm::w m M Q2 ' ,f' '3QKi vi' G . ' V' Xwlnwmwmwimmxnwmmmwnw' ei lf' ', -,,f,-fl-1.v-,w-i'- if iff -.mf-1-Q -1-KH f,HwHQ,l- -.. gfzi , 2? ---f-vfffm. -,..i.L.'.a , I: 1'-3' 'Z t,,..4.f.f,,:...L':..+..i,J , 'fn , f 1 - ----my-.. -- -.3 .'-Y M z.: . gif , ,' . , ,.H.'+-3sQe,,1eVf'-4- ' .' dl? ,fir , ?l.,5 ' ' pq sf,-,,m,5.g'pf Q ' Sf '-'Sw '. swf ,X -341 ,gn -, 3. M . 4, Q' 1 xi 21 N',.iw 'l 1 :HU ff - e'-'-Q 'I '.f 'Nb 'Cf5'Mi'. 1' 'ZA'?WTT 1 L , ' 79 -- 4-'f' 95' www-if ' 5gwuQv:2krsww::n:mfvemsmzaam.m-fmawv' J. - ft, :a-ua1?vznnwxlAms'Qfc2:i:e4fs2w:nrriv22s:c:?m?laood:evJr9i1mxmzrgpgglltl Page Ninety-sim 'r W gills 2 -be i L A ,fs 4, :fu v X :Hari 2, -A--N ' Q -3 1:,'24a2:::1Q. A531 lg q.,Q 14 't ,213 f f r? as ae F ffr U if asia wr 3 Q' 'ff .419 YI 31. if f-H if ii'-M vu' .R ef, if MMS Aw.. ,R Q W 1,331 .YM 5,1 k Mv., t L5 T, A -. ra' s at M .Mmf,.:. ae Q N-' sv mr gd xg was ' W h't an-Linfield 1 if ls 53 ' ffl if YVHITMAN 12-LINFIELD 0 ESQ SEE Q2 ay 3955 352 r ,552 Playing in a downpour of rain the first conference game of the season 1: 3 i if 3 L E52 4 5 1 . . . . 'z it Q resulted in a Vvllltllflafl victory. The Linfield team had a Whole bag of 1 ,J Q! KX I, L 4 , , Y-X .Q A ,, A 1. X'- S tricks that they used in a desperate attempt to score. Twice they were S, f S fi? t za A ffl liar within strikino' distance of the Goal beinv' stopped once by the half-time 0'un E 2 C C 7 D O Zfiwxmmo HIQWKE' with the ball ten yards away and again by the end of the game with the ,rift rr . am 4-at NK? ' 'clgfg 'uf 4 YI 2 E 23: 2 I t ' Q, Is' 9 , , , . , . 1 if E er ,. s A . X is ' r ., , .. 2. 5 '32 1:1 fi V Q, use 1- . ' ,- J . ,- , . ,' l t . : : r 2 1 Wg: 5 Y 1 d '. 1 21 1 : ar: . 1.115-.f ' :.:'?-tvs' 32 : 1 vi 1 c 1' : '5 sr ,. .-,ff-gfjgwi -Lv ? gg -1.41, X- YH:-. 1 5 5: N 1 3-1,1-.S-, 5-.af-::, 1,.,.g: -wg -. 2:5-f I Ye. gf---5 -fear: f::.- -----, f .Y .1115-1-X as rw.-as Q , ' l 1 g 13 ' 1 ' . r J 1 1 9, ..f ,Q Q qgggwxgqgw .QQQE-,,3 as.p?gf ,m.,,w'.,fs.rs-Nagy., - -, . .-,, .M-as. . . ,U .,.,, 1 M ,,,,, U WW, .Q W- -'- '- ' 3' is -' 1 'J' ,. 'E 1..::.. f ' ' '-if-If-4'- 'W . ' -. 53:-rr:-z-:-:fu if 5 J' gig eifs- 'am imma-'Q Q2 . ax E- oval only one yard distant. In the fourth quarter Linfield marched down Syl as v :S . . . . . . 'TSE 5: 'Z 5 the field with a serles oi passes that completely fooled the Missionaries. gi 7: 2- -' 1-4 s- X r f i 94 ii , . . . - R ' -Q gi 5' 1 3 Paul Anderson, Freshman quarter-back, and Kenny Neilson carried the ly E 2 -3 5 E Sa . 3 1 -A . , . . . . 9 f 5? . brunt oi the attack for lVh1tman. Both men did some nice running ends. Meckelson came through with substantial gains through the line. 2 5 ' .4 . Q75 gf! 1, 'of 'tx rm, jfizjpmm . e,,,5Qg:',lr. f LvQ3,:.r5.,.a,sMa,ls,'l, P- f amd' A fra M3155 1 :m.f2f1f'w K 3 Ubi? r f 'V '::'-f,l: 5 -fp-Z ..f--Q 3' QE gf ..l.?,b.2,..S....J..:eJ-C , 4 as-w:5:a4,i2li5 Page ZV'inety-eight --. Xb .K 4, . we . Z 2:3 :Z 1 49, x .5 'N . 1: 2: Q. f. M. C. ,Le f y d K'--5.5 '1..'-at elf M ' rf-. A. ra 5 L M 'ff T .wa A af :na-. M p, LJ' . 5,52 . - S 5 f 'e:fT1-i?If?' Sift: 1, 55,1 -H3723 'fp' -- 2 3 ,iw ge , N- 22? K ,Q 'YW if few 5 5-MMI. 2 N32 35521. .-P252 9- ff-mf' ' .sf fl-WMQXQ, ffiiffx .5 :f ?f.fV'wU?1 'fi Wie! :frm .alike M . ,L , l .1 mf- ff ' Wxmew-1 Smslomiaqgig'-It.-Z -. - j.- .-,br .Jax n '3 EE? 3-5:5 IN il? 2 . . 1 man onzaga S N 1 WVHITMAN 0-GONZAGA 6 3 'f . . . . 19' 21 Playmg stellar ball through every quarter of the game the M1ss1onar1es fa H gf P ' ' fs . . .. if l 5 is Gave the h10'hl Y touted Bulldofrs from Gonzava a stlfl' battle and a bad scare. A X 5, tv an an an 5 tv S ,' ' Not at all daunted by the re utatlon of thelr adversaries the hlalze and - 4 if , 1 J wax K? Q36 Blue eleven fought every xnch of the game. The score came m the hnal per- Wa li Q if, ...,, gmmg iod after three quarters of deadlocking play. ,,. ,XM ' 5 fbi, if if Ehraffqvlgl -z.: 'f' ,fi gX 'fgf?!j ' 3 1 , 1 5 ? 3 f 5 gi E is f ?s 21 . ' 2 I -1- 2 ' E 255 3,-' yo ttf' S' . ., Il ' -' li:-9:-:-:VL-:ve-E5 5?-:ex 5186 c- 3 -X 1. ,D X th 3 :fmfgriii QQFYSSQLQ H'C'2'?1 Both teams showed a powerful offensive but a strong line held both Q 'f baekhelds 1n check. No long runs featured the game. Huntmg was Gon- l '11 zafras 1nd1v1dual star. Hls fleet feet started around end trme after tune 2 1 D E L , only to be stopped by the W'h1tman ends. Meckelson played hrs usual con- 2 l -1 f it 2 ' A 3 If s1stent game. ' H 5 .v:+:w' y gl'lW?l'ffef,,A 56-3222:-,S ,tff'83la. ,'?l - - f .A-RW . ,'fM.:fQ. ffgl- K 2 x-W.ae2.,,e..r,ei,f+f- f -fi fp i 1x'i',qi9f'?.J.1swi,m,a,.5N.A4 X xg? 14 . ,:1 Q55 'Elf - 335 is 'JE SN, 5:1355-W A 515: 2 sixxzfg 30-.i..f+fsyfm1.fng ,Y mffyl -L q..e....:-,,?-.3f4-4 L 1,'uji.,51Q E A Page Ninety-nine w 2 1 Suu, .A.-.4 - -. ,. :Z 2 V. 4 A 'H if f ,, it .f fm ' V-'-13 rmwfs Y' 1 5.52254 li ' 11- ' ,. 'emsese '-a.s:f.rL, .P23s.,zm . v M ff ,gf,2?l . W twiki? ,sw-:rx-1-:ragga YVHITMAN 27-CI-l,lf1Nlf1Y NORMAL O WI The football season opened shortly after school commenced with a non- f X A44.m4,.-, conference game with Cheney Normal. Using only three plays the Mission- aries had little trouble in penetrating the school teachers' defense. VVhit- 5 I 'fu 41 is f. 5? ? man's linc showed up well and stopped every play directed against it. 5 .4 vilazvaem, .L A- Q i ft? affitft' '. , 3 - e ' . - -.. ., ' f, ' '- Q Q ., , ,' ' -' .P H' Q- ' ,- A ,, W , -Fl. gym .,.:g,,,gq5,:,Za,:l 1-,--gm. V ,e.',--if-:f, ..f,.3:,g:::f-'..- .- my tw , ,x,, ' -, ' ' V4 ' - -.:g':::qfg55-iwggffifzgif'f:Qg::QH?5iQffI:2f221553 Q ,f gE.1',f,3 uf... Q-i5,.'7,v1-'Qfig I. Y . .ffx ': : ', fQf ., ' M Y A , ha:-. Q iZsaa -- ' .zs.ls ,:s,z-f.v?ff:.:f- - - - - X1 X. Y t 4 , , Neilson playing one of his best games scored two of the touchdowns by skirting the ends. Meckelson bucked over a third counter and Pete Schiller gf 'jf snatched a pass and ran 40 yards for the final touchdown. Meckelson com- pleted three out of four try for points. if . i W ' 5 'zbmxrzzmf ' ' ' io:-:-x-sm. H 3 . ' ,-,-.-irpxtxvmcfcslesg 15'-.5-T, 1 K 4, efggsrrzaa-zquzeg pf A 1' W., ..,. .W ..,.,. MW. qffaifi. 455-K Q , .. ' ' A . lf 'MLi5 77'-'U7 f '1 it lllf 5 Q23 5l3fm...figf' p K g . . , , Y - pf - ,l.,,,,m.-g, 4. ,3 1. - .. .. csfmecmpy-. . ,. wg - , f i ,. Q , 49' Q51-,g5 ' ,airy 2:1 jiff . :': .' sr.--jv.L,.:vl,4 fi. A' mmmmzi nf? 1 mmafi t' -:c ' -:fj,.f- - 1 ,. -,rr-fg...f:Y..1:.:.: 9' -I - fvfgwsfg 653'-., I. ,, -1, -2?g,gj.f:fQ,!1 ,,,M,.,Q,5g,gf.Q.5,.5,m5g,55Qg.Q,mggg-2 EBQQMQVJQ 'img ti-i:lTe.rLqfis.Jz1:f::s--.- M.-agafssza-wfwm,-1-:az:Z:,:'--'-:V-r Page Nmety-seven riff'-2, y., ff. ww -pw W Q?-C fu v.n-wr-:fr of-, gi.. -..-2.-.V ,,. x s X .wi :Q:fm:v.- . , - N 0 ws- we If .ff1 'E: 't5:'::13i'f Em 4-lzrc 29' 395: 512:11 4:13 ' ,LF . K' -- 2 5? Q f. Q51 453532-. ilk. NYE QQZQRQKFIITEQ W h't -Id h 5 QQ 1 III!-III 3. O if 'ii li. .. VVHITMAN o-IDAHO io R 1- X. . ' l Superior weight and experience counted heavlly against the football fs? team when they met the Idaho Vandals. Too much rough stufl sent Ander- A3 son, Holmgren and Neilson to the bench during the game with wrenched 'Qs ggyuw ankles. The Hrst quarter was a see-saw affair with Holmgren and Burgher ex- l N, changing punts. 17 kicks were made during this one period with the Idaho Q ,W 9 :-: iii 2' 23 sig 2-1 14 . . .f I .,, xl, . 39 it W-1 m 'l :-1 Q , -2 i 2 Li 2: 2 I :ft X : 1 I 1: C: I 5 A ' ' -I I 3 if 'Q 3 ' 1' 321 I 'H 41' 2 ,, X iz 3. 'T Q if x5 i ' .. Q V F7 8 1 :ii 'J f. ,4 gs 55' ,IC 5, E :fl fr X 2? X I is -1: F 51 2. I .3 4-Sf:-5 was-'-. .g. ,- booter having a little advantage. After losing their strongest backfield men the Missionaries did not present a lineup that could stop the powerful Idaho attack. Time after time the giant Kershisnik plunged through the line. Idaho made 19 first downs to VVhitman's fb and completed nine passes to the Missionaries' two. Eefw z Q- 4 ,.. .zcuimf -gm' basic' -I .24 i?fQZ. Jag? 5 f I3 ,ii A'k::4:-1-425 .4 Q sz iS ' iw . ' I-F 55 . 'Q Sa f ' 15 1 ii 1 sg 1 -1: FE- 1 51: if I Li: i-: 4 5.1 , :ft :-E I 122 5-J II . lg, VGNLEQ cr ,224 Q . 'P Q V .V 'fs 22 16 5 .tf:, :mb -15:3 SW. 15: ft-gf 53 5? , 15 6 fri aj 4 . E15 ' '53 5 3 xi iii? ' E: 5 1 A ,. 1 f s, I X .. 'Q 263' iff., 'fel' QE Q' 5: is '41, gf -Q4 fu go-.fuzz-:Q 53 .J .- EQ? X . as- 'Q - I Fi -1- 1 I .X .. ,W 11-l. gg 3: -,Q :Al wif I5 'lg I L, vu: was 42 'E 4-. M, fz- : gf: 'V We ,-:Time 19.77, Q5g:c41f:11:4r.vm'sx. K ', W . 'IA . . i1''fiwszzv-s1zi:3nr.w.xf:fso:e-sooccfavvryxg-rzrqy ,. ' ,. -Y QQ,- l E35 if-i' 'iffy QT. V v'. Q' ' 4 ggsgstvwsre:Mfr-Sijffflviwwfvi-?6'ff'f0L7'5 , : , J -.i rv- - .,+ ,sr ..gz.,::.,a..,,,,,- -..-V gg , --Q1if , Q.,- Q' W'fe'iMf-,,f..,L.'.f fc ay ,ff-r i4.Z2,:,ig.gy'.5 6g'3-mmiif 'MS 'Qi Q 1.i..l.s.i..,9,.,:,,r,a,.e Q 1 P - -, . if: 4 x f ' L18 .3 - I -7- 7 -'-TN' 'T 'E -' -'61 -. ' f.: .. f Q ' :V ik :LT I , M.: . , N .-:.,15'.ffeff:,-fe,-p 2 . Xie, .-S53 2.25 gamer: if ,Q 1--rf-His,-.5 swf C it I xy 'IIA QE-E .' ,,.-' , : fwfvz-fe:--ff-sf' '52, S -R if-H:-Ami isis ,vga e.........7.-A5--Q-W'-. I sm-ag: . 1 fr, ,. ,I ,Ali f ,,-,tl A -, r ., 3 , - :fs-zksyyavgzg 1mq44a:.7f:p5gQmyz+rev-:fa-av:sii.wf9fwfaummefm1t4, lv'-ak:'kw.lf -wgcfkf ?,f,whcaf:l'4mwmr1+.:: vuazouoczvmam :::a:...,x:e-:wx Pug e One H unclrecl ,gm izmmf:-:gi fmgqv A I figjggif it 335-:A-fgygmgfifgjg ws-gil' -wff F..:.,.-,,v.x.g, Q -fl f y xr. up: mr 1-sz-.15 arf, -' 325215 -rf:-:-:-. ss 6 -fi 1 Q .s 'ul X lx 1. pw ...N-151 5:5319 fflji-1 i l54, Iii-Fi I-,Q 5-2523 ' Q , , . .. , c. 1. ., ...gs-' 5 ,Q V pig:-to P:-2-:ed 517:-121' We-1'C -:-62:1 51-I 7 , :1f:g:3:- p va 5 ' H ,:. X 5 g:g:f:g:5 .gm if ,7f5:?:-Q f .r vi:-.3 Air- '3 :If 5-E552 5111522 Q?-ESF? . ? -C251-2 825152:-.va 'Z' 3 , ' ' Q isis 3:22 we 1 3 asa ,Q al 'f'- -: my px- 12:7-ex .fx 1 ' s-if xg, v- Y,-'i its-1 1 may f-5.-ff , -QF, ,N w 1.-.if .i.,1M. .1-. mlm. :ata .am ' fx-:ww Whitman-Pacific XVHITMAN 18-PACIFIC 7 The Missionaries won their second conference game by defeating Pacific by a substantial two touchdown margin. VVhitman's pony- backield did the heavy work in leading the Missionary attack. Reese and Petters broke away time and again for long gains, Fetters thrilled the Stands by running 60 yards to score. An impromptu fight entertained the fans during the last quarter. Lind-- man from Wlhitman and Pollock of Pacific were banished from the game. Pacific displayed a whole bag of tricks in a vain endeavor to defeat the Mis- sionaries. Fake plays and well executed trick formations failed to worry the strong Wfhitman line. The punting of Emerson of Pacific featured their attack. One of his boots sailed for seventy yards to the Wihitman ten yard line but it was soon taken out of danger. i Whitman- . of Washington XVHITMAN 7-YVASHTNGTGN G1 Completely overwhelmed by the power and size of the Husky eleven the Missionaries were defeated in a game featured by nothing but the Wliitmaii score. This was the largest score made against Wasliington up to this time. The VVhitman score came when VVashington fumbled the ball on their 35-yard line. Whitman recovered and advanced the ball 20 yards down the field. A pass Meckelson to Eckart on the goal line scored six points for the Missionaries. Holmgren converted the goal. Holmgren was the star of the game, smearing up many plays that came around his end and punting well when called into the backfield. The lineup for the game was as follows: for the game is as follows: ,gmqezr-g:m?,.vqiggfj,a1w , ,pg 1, , 7... qyggcafonf zeffvqszzr- .ms-.3-.warn-gait. F-mtcw-f.away1u1g.v 5.3 . . jj Qui. 35-N21 Ig 1, jig- git. -- . .' v v f 'QQg 'C j'f'ff'2 ':- ' 52 J K 7 ' f - fmt A-asf ff-r1w::'r -1 is V 1' f ,wpugw-5 W, . V 1 .W 5 Mm, W- 7. A .rg Rh N 1...,,.,,,.,... sv if.-N f-i v- A.-,ai f- i Q., ' - f.M.f:',. - sei:-aw. .1 f rftwetl its f .-cr s , ' 1' J, '- A if I' - . L '. 1 .f:'. 4' ' - 'Q . ' A :tri f k 4 .,wse'Zifix4s,iw2:' 1-ricvvse'-:-s-.-Kas-'-is jc-, :f:.:.:rz'-Jlmcme. L Page One Huvzflred One ,,. I i y V' Q . W7 f X - ' 1 x k xi- gy b Q f .. Q . ,, , ' f - -- . ,,., , if .,,- ,, .. mv. -W' MW W2 MWAW MASWELLEI WEly IHQLMGHUS ifwm,-1.M.wm....,...Wm ayne YZARUNGMS ,wn Gmdw, MEQKEESQN 'M 'Wow Hmmm WMQEQW' mg, mlrwwwsmmlvw f 152559 f ws ,f 4 A 4 J 'f X X X X , x Aewold Cmgnaammm M ,,,.J . ' 29 ,. , J , .,.. 'W . W, W Wim N + eg KGHUGH1 GG E U l m Jdmcemmev M Clap W EASQU., Hem-fyDflL5 UEE3 W ' LeRoy ILUMKDMQW . 1 ljaul ,- . -,I ,- -1. 3, -av ,ry exif Q x A :11-'-f- 21-rze .j:j-,, 5 a- 2,1 . . Era. :'5 iz.: N 5 .A 'gfjzr frsfz, l-5513 casfsf . E i:5:z:2:3 ' P3123 , ,-15+ f ai. ,-1-:Q MC51S2Q,ae,v ' ki 5. ,Ni-' fi :exif ,ag 5 -. Wh' C 11 f P f s itman 0 ege 0 uget Sound E55 ,, VVHITMAN '7-COLLEGE OF PUGET SOUND 6 -FQ Cv as :if A third conference victory was won by defeating the strong Logger out- fhg ht in 'l acoma. Both teams were evenly matched, neither of 'them excelhng W in any especial department. A wet, slippery field slowed the game up some- PE5 wha t. Wliitman scored in the Hrst quarter when Pete Meckelson tore off 25 Neilson Reese Meckelson Anderson Fetters yards around left end. Two first downs, made mostly by' line plunges put the ball on the one yard line. The Loggers held for two downs but on the third down Meckelson smashed through the center of the line and scored. lfVhitman failed to convert but a Puget Sound linesman was declared off-side 'L xi X LE E 1 J 524. llfx flff: '7 K. Q .Q .4 :R Y.QU.:.f.o L If ds I , ,Q I X . . . as and the omt was awarded which decided the Game. V ,' 3 l 1 -X ss l '?'?.'?3.'fl:3 561-3, 45-:Laugh-2 eaiwwemffeflfw ,fffrtfst -V-1. imsfibvo-wm.,.ar. N ffm, , ,r:f1smZ.'S fini-Q-aim '1N'.'C1A-'Sli V 4 fvozmw:-z-uf:5-m?o:v-'vswaixrsxpzfrjgz gg, Q . ' I 5 .af 5f,3 Qqlq 451:25 . , HE cy.:-:tx'5!r::za:ccas7ssm'-vcvmKs5w.pA-5 -. f Q' A E '1 I ' -' 2 fr we 4- Taaaisa .ff-fr fri' Q - H 1 ' U 1 K a ' -. a f AQ,-,-.,V,, ,- . in -, W -4-1 . i q v V f I 1 -NN. x -, 3 - A w J . 1 V Q , . , W' 1 ,wa WC:-'vf fm- wtf 5 , . fc , pf V we fr:-.v -:V-, 1,5 Qarm' -A if ' ar N -' :Z 'li rw q ' ' ' ' , N Q 4 -f..'-r:e1-'-y-- -' ., Q ,gn fyixwf N .,r. Q ,,., ,,,., za I A Af. 1. r,,,.-1- ' 21i5'3aWaiS:2sam':L:La-:is-:':-1-:vfsceaziiaz '- .:- 1.-iarriQ,:e:::cf::-:2g::fc Lrcia-3::f:dL.2,-wx-J ' - - .2.clz.nM1s Qimvvrv-wg 'ffl-2.-7 Page One Humlrerl Four 15 -J l tl if 2? 4 ij 4 iii gr a 53 Q x 5 1-I-:-:Ncwoea ?lff:T ' Elf? MQ .-1 5133? Q- F'2 '32:2:2S.''5:a '3kQgCis.. 11f'1'?P' --23 fm-::.:f.n.f vr z as - Els t r I ' 552535 tl ff I 5 I K . 122 flfgiiib I 42523. E21-:Q vii liffifid 531355 551223 Xiilig fi ist' if ' 5, f-751541 Q' 5- 22315. :g:1.,v .ks-A h-q-g::.- 53' 11:25 icgzgy Qziyzggfa-3539: 9543.5 '-lq. cf-1.12-. 'asia '- YQ wif 512:15 trrff-9 3 'gm 21:-'14 :-2:k:r:-as-:Ina-f - E1 Q .,'-'-: 452:53 Eizfgdi, 52 ,3 Crist? pizzgt- EE-kt' 5 P63 325319 risiri:-'f ' 151216 Q ,wav . 4 -.1 , ,:-:,:::4::7 1. 5. ,gs he-:J :ff-1.-1 ..-:vz-: f. Nb? wif fc-za! sgrsq ,I 'JH K ,, v. .- as-.3 1- q.,,,..r. mi -.far V-I---wares wg- H+:-1 W- 4 zff, - A - f s ., af-, is-:.f .--:-.Q ,- -L wr-.5 f M ,K .r r . , - . . 3 .. -1:-x---,V ., .A-Q 5.3.-.5 v-22:41.-N, n 959: L----, 7-2-'11 -fri. ILC, - :-: -. - Mf1:,:. we-.-1 -asa .- is my .iafzls :gs.:::r-:- Ns. .QQ-:N-. aus. amz.. 'M-uf -'--V: fi ' - f l,.'- F I I- Q? . yy 2 '- ,- I Ji-5:1 . SE ,- I-Q 522 ' 1 5, . Whitman-College of Idaho lg y WHITMAN 0-COLLEGE or IDAHO 12 . v, . 35 The conference championship was lost at Boise, Armistice Day when x the Missionaries failed to play consistent hall and dropped the deciding ' game to the College of Idaho Coyotes. Tired out from three long trips the ' 1 eleven appeared to be not up to their regular game. 22 t :Z- Another rainy day slowed down the fast Missionary baelcfield, the I .X 4. -, ' Q' . ss l 'l Q -- J: Q lf 3 I , tg. mfr. l 3 - 7 ' 1 5 xhfl 2: I ,fill Holm gren Men gel Napi er XVarw i ck Ladle y . ,,. . z-2 31 3 'F 'c .Q s, A ., .6 ea I, . .- - 'G Fifi N ground itself stopping many end runs before the men got started. Outside 9 5, 5 g t e ,-ffl? Q51 . . . W I' of the two scoring drives that netted the Coyotes tl1C11' two touchdowns the w,W,g 131-:.:f:su1x:-Q Tj 5 it . . . . lk 6 if ball was never witlnn tlurty-five yards of elther goal. ' 45' ,J Q .- Dill and Holmgren staged a punting duel during most of the game with 5 the Idaho player having a slight advantage. Idaho showed one of the ' :I - I I n 1 fl strongest llnes that the hQI1SS10I'l3.1'lCS met all season. 1:55 . , f 4 I if . , t - xc ,. I 3, :?- '- M, Q 32. fit?-. FEV ,fgii-rv. 5'fw'-I :FQ ,.,M': i. I '. iiihaaa..--5:-s:.za,m.,-f Alla LIE, -ui Q Q31-j jf' QIIQ :inf 4' - Qi . Q ' ', 4' - - fl : '-f' 'J:vf'jVff- dsssxssmziqg, 311 1- .V aglqnid L5 lk -Q I I -I '32 . -fs--f-T..-.,.r,. M - . . vc-:-.5 14.5, f-f..e..gJi.f b. sg . S 3, ir- 5- .r f., ,,-. 5 j ' C , f 4.-v H3-:44qQ.1s ,ff is--, 52,5 -2. K' M Q: :iq ,S-2 PJ 'Q A tk- Q: I ,. I , x -Q J, 1, L7 1 ,i.',, Lg- . , , Q V - -,J , - . 5 ,K 'WJIIJ M'. x,1f.,' ' mv1 '7. Mf i'gf ' ' Nl.. 1 -.asx-AJ ll 'xx,,.,.4-' IX-zgtzoszlzsaxemgr '-.ocmwmaaasz-rxz.-ff.-aw.-...-JL-V-f..-1-. Page One Hmzdrefl Five ' ' s..s1,.s..:.s.:-.:v..s,- . -.f. 7 wa .Q , - 'J vw .4 ., it 'QQ x 45 -:, Whitman'Willamette YYH ITMAN 31-WULLABKIE TTB 7 The Missionaries wound up the 1927 football season in a worthy man- ner by piling up four touchdowns against Vllillainette University. lvilla- mette was ranked as one of the leading elevens in the conference. Long runs featured the game. Reese and Fetters both made some pret- Fields Caley Eckart McKellar Schiller ty dashes while the longest run of the season was made by Bagley when he Q intercepted a pass and ran ninety-five yards for a touchdown. Vlfillamette tried desperatly to score in the Hnal period with a number ' of passes but although they were quite successful they failed to gain - enough to enable them to reach the goal line. ew tx Q 's C .: ' A vi ., 1. ,' .llk li-' -'-.- , -i L, .- liliiepftffz,-:QA Page One Hundred Sim Intramural Football Close competition between Well trained teams featured the intramural X5 football schedule. livery game was hard fought, upsets were frequent and 5, mucli amusement was afforded the spectators. The lietas and the Phi Delts had the best teams with thc Sigs dropping gig close games to both of them. Both teams defeated every other team in the V league and went into the final game in a tie for first place. The deciding game ended in a 6 to 6 tie. Bailey made the score for the Phi Delts run-1 '- ning back a punt for a touchdown. The Beta!-1 scored in the second half by ' straight bucking the line. Garrett went over for a touchdown later in the half but was called back by the referees whistle. A week later the teams met again under the afrreeinent that in case the , RD score was tied the team making the most first downs would win the Cham- pionship. Both teams played stellar ball both on offense and defense, neith- Q5 er being able to push over a score. The game ended in a scoreless tie. A 1' check on first downs gave the Phi Delts the championship by one down in 1 one of the most hotly contested intramural championships ever held. STANDINGS OF THR TEAMS YVon Lost Tied Pct. ' Sm 5 0 1 PHI DELTA THI:. IA ...,...., ,,,,,,,,. 1 .000 BETA THETA PI .,..., ,.,,,..,, fl 1 1 ,800 '- SIGMA CHI .............,.,.,...,........,,,..,.....,.... ....,... 3 2 0 .600 LYMAN HOUSE .............,...............,....... ........ 2 3 0 .400 Q ALPHA OMICRON KAPPA ............ ......... 1 QL 0 .200 X ZETA PHI EPSILON ....,..,......,. ........ 0 5 0 ,000 . .,.-'. ' , '2,,1 11 '--'f 1 ??e7fw' nj iff? Pep Band In Action X -:ytmnd l - l ' ef ,:f1,'f:f'. , ' e -. 1 . , 1 W PfQ'Ei'l6'iiZ'7I'iiii'ii?ZdHsaieii V. Zilla swf' 'Baslzetball Basketball Scores 1927-28 Season jj WHITMAN OPPONENT u 52 ...,......,..., 37 ,.......,.. 12 ...... 2 -L 25 .....,..... 448 ........... 27 ........... 27 57 ,..... 412 ........... 418 55 .......... 412 ......,..., 31 ........... 44, 28 35 .......a,. i 39 ..,........ 692 Page One I-Iuoidreal Eight - 341 1 33 s 5,16 ,J ,Q 96 Ellensburg Normal Ellensburg Normal Vllasliington State College University of Idaho University of Vilasliington Gonzaga Oregon State College University of Oregon Pacific VVashington State College College of Puget Sound College of Puget Sound University of Idaho Wfillarnette University University of VVasliington University of Oregon Gonzaga University Oregon State College. Totals .51,f-,sf-wzaafsrs fi' 1 ,HA ..,, C ' -: .2-: S Review of the Season Called by many the equal of any team on the coast the 'Whitman Col- lege basketball team went through one of the most successful seasons ever enjoyed by a Missionary athletic team. 'With four regulars, Captain Ed Buck, Tom VVood, Wfally Holmgren, and Lynn Croxdale, and two freshmen, Al Newman and Kenneth Norberg, the squad won fourteen games and drop- ped five. All fivc of the teams that won from the Missionaries were dc- feated in a return game. Holmgren XVooc1s Buck Croxdale Newman Starting off the season with two games with the Ellensburg Normal the team left on an extensive road trip to meet seven strong teams. A poor start gave VVashington state a victory. Idaho then won by three points and the University of VVashington by two. Gonzaga was defeated by a large score, Pacific completely overwhelmed and Oregon nosed out by one point. V The home basketball season started off in fine style with the Wash- ington State College game. Burning under the 19 to 12 defeat suffered 4- vxocezw erm-te-ggi: Z 1 , A ' ,i , 4 ,lvgiex--Q:-at .P ff ff.Q ' 1 ff' . , Page One Hundred Nme , . 7 f. .ww . .. s. :,, H s, -'- '-?FZ'A W'f' V25'1C'.5 7: A mfmw-:mwwvgmq 055,29 wvygg: MES' -N 'fz???E? -sz? it iv' -1,5 :ai :1gG,v'x.2,., Q N W . 5. . A w . X 1 gf Q . . t f .ev S W? 2 i -Y fox 535:33 ,-2' fa 1412913 WH: '53:1'I11 ?'. .' Q K2 .er 45 'san :ac-if-2 if 0 15:1 169 ip:-5 lgi-ig Ag . Wi,-.2 pM:-: y qw 1 '- J ,ffj seaiitvs 4.5-MMWYQQE my 'egg px J! , 4 ., H me maeaanm we in me D -HW N ' ' -wr Z 'fiaf' . .. 5135 .J ...C I . JA earlier in the season the Missionaries came back and swamped the Cougais 42 to 21. College of Puget Sound was next on the list. They had high gy hopes of upsetting VVhitman in the conference pennant race but were 53 crushed 48 to 19 and 55 to 27 by the power of the YVhitman scoring ma- ,Z at chine . il Turning the tables on the University of Idaho VVhitman took the re- ,i turn game by a score of fL2 to 31. The Idaho men were entirely outelassed in every department of the game. VVillamette boasting the best player in I 3331 'W 53 Bagley Sopcr Norberg Ferrell Hill the Northwest Conference and a team that planned to dispute the Mission- : aries right to the pennant fell the way of the Loggers and dropped both 1 of the titular tilts. Making the ninth straight victory the Huskies from the 5 University of VVashington tasted defeat by a IM! to 33 count. The University of Oregon smarting under a one point defeat came to 1 VValla WValla to get their revenge. They managed to nose out a one point victory after trailing through most of the exciting game. A former Whit- man player now attending Oregon was substituted in the last minute of play li 'mm-gm f - ,,. we-vsxqnzwzepasmcfp: ,- , W. gizmrzsazvxmmrsr- . age' Aawivfx Tg , N-.. . Q . xi' Lf -Aflarrfsoxms-:am-:ezorffaf-fair-asa:-:msg gg ' , rf , 5ss, Qff' Kimi cg,r:LY,. ov , ' '3?f'7 f3559i'f'W37?T-2f?7'5T3'if 'I 'AA' ' L 1 1 '. '.- , e - vi i M J 4 .5 .fd 0 -'V fP .rfP'-'ff' - ,-J, .gy I .Y , , A f ' . 1- . . . new - C . 1 gl? '-'REJQEWIS Qffnk' gm, ff 59515303 '45 3 ,st J-4 '?f . '25 rx -. ' Q ' Q: 05.3 E-3 1, '- ia:-102:54-21:31m.22-xi::ic'ark-:ark4a:m2.:zrsaEa184: 'iEP41LXfe1'v-of '2f5Jv7' .-nuke-:a.uf.zaQ:9.:,uL::nx4:-.ocumrssvzim Page One H'uncZ'1'ecZ Ten and dropped two baskets from the middle of the floor to cinch the game for the Orangemen. Gonzaga strengthened by the addition of Herb Roth- ford presented a rejuvenated lineup in their return game but were defeated by the hard fighting Missionaries 35 to 23. Closing up the season in the right way thc victorious basketeers gave Oregon State College a 39 to 27 drubbing 'to make up for the previous YVeb- foot victory. A total of 692 points were rung up by the Missionaries while their opponents were held to 516. Starting out the season with five regulars the team lost a veteran guard when Kenneth Neilson was lost to the squad. Borleske had several prom ising freshmen to work with, outstanding among these were Kenneth Nor- berg and Al Newman. Starting the road trip with Newman in the lineup, he was forced to shift his players after the University of 'Washington game because of an injury to Newman. Norberg filled the place so well that he earned a permanent berth on the team. A mumps epidemic again upset the squad and Norbe-rg went into the infirmary for the rest of the season. New' man again joined the team and made a good showing, making up in fight what he lost on account of stature. Eddie Buck playing his last year for Wfhitman covered himself with glory in every game. He scored heavily and kept his man from scoring. Many times he outscored the man he was guarding. Holmgren was the outstanding defense man on the squad. Time and again his long arms reached out to in- tercept opponents passes. Tom VVood was the high scoring acc of the season. His accuracy under the basket was deadly. Bevo Croxdale playing his second year showed his value by being able to play both forward and guard positions. Croxdale was elected captain for the next season. Prospects for the next year are bright. Buck will be lost but the rest of the squad should be back in school. For the second time the Missionaries won the conference championship with no defeats. Every good team in the Northwest was encountered and at least one game taken from each. The 1927 lVhitman basketball team leaves a record to which coming teams may aspire. Page One Hiwflrecl Flezen, -w 52 f - 2 P. as 1. 6-I - i. ,AM 1iv'f :e':1ff9 1 +'wruw'j ' ff? w'?? fi 'Rims-Y ' mfg 'mitw Tri .sf 9 0 if S -5 -I it gr, ,ah X -wma j ,ap , V 1 ,s -V51 'L ' -133, fi :a ,- I E J.. X , www' ww '- 22521 c:,wfAlQ s2'L ' ia- afie- zn ei 'ff rf' U, - A gases:-zz: Qf'1?Z'iQiS'?t '-:iz , fl l if? I' 1 5 7' '- Q Ll , 4 Men s lntram ural C 1 'l' A I pf '. ,B After a hectic season with four teams making strong bids for first ,fflff ,,- c I place and cellar teams giving the leaders close runs the Zetas and Sigs 'fm' . . . . emerged at the end in a tie for first place. Both the Betas and the Phi .fx 'fbi , 'XL-. 4' . - . ffl' 5 lg! Delts put out strong contending teams. Up till the last two games any of lg ,v,. il51:a? the four leaders had a chance for the championship. , f . . ' l'he Letas had a rangy squad that played good ball in practically every game. Vlfebstor playing center led their attack with his uncanny eye for Q X . , . 1 the basket. Time after time he would break up the game by dropping in if 1 : 5 a long shot from th center of the floor. The Sigs lacked in experience but gg 3 1 if - made up for it in fight. The last game was rather a disappointment. The 9 score stood 2 to 2 at the end of the first half. Soper was injected into the Zeta lineup at the beginning of the next half. He accounted for five points ' to put the game on ice for the Zctas. The lineup for thc championship game: ZETA Qllj SIGMA CHI C Ransom ,..,......,.. .,.... F .i,...... ,,..,.,. ,,........ , , .,,....... F e tters Cassens- ....... F ,...,.,.. .... J ones , Webstei' ,...,,. C ........, . Goodwin T-af' Tibbets .... ..,... G ......... .... S h ields ,it Millam i..... .Go ,... ., .. Bailey l Soper ...... C Y 'flu if ' ' an !. Q? 2 04t5rx':5S'E ' f'i5753??' i.i,a.q, . F:flf.i,3,t2x VY:.7il,.m1 - W ,- L I A-V- 44 ll 1' .ff:5tfW llt 'F ELM 3 YV ,Q V 'b ,f ' 42,Fjrq-1,-'Q..f'-.f ' .' 1215655 -i'f'i,7-N' 65 5:26523 W' pi Q'j,:F,.f:g if fi X 5 , 2 lox -W ------ Page One Himclrccl Twelve 3 :- 41 ri -b fr v gr it Xsflg r ,gf ., J it T ' l Lg:-t p.j il3 it Omen s ntramura A Led b f the stellar ala inv' of Marian Jenkins and Bett V Jeffers the 5 . . an . I Delta Gammas again took the womens intramural basketball champion- lx . if shin. lVith Qracticallv the same team that won the title last 'ear the :I 2 23 ' 'K . fl . . . . . . .Q emehed the nennant in a Jost season eham 7l0YlSllI 'J frame with the Tri Delts. . D a-. SD. P fx rm Q! -i '2- 95 : The Tri Delts were strong because of the accurate shooting of Dol: A .t ,a ., F '- v IQ' I 2 f 4. ,, -. V at Hull and Marian Berger and the close guarding of Ethel Cartwright. They 5,f1eN..f1Q went through the first part of the season like champions but they slumped 9 'NP Q Q gf a little toward the end. :gr fg. Q3 The frame which was to decide the Cl13U131ODSll1 came as a result of If ,Q D w I 4- .,,,,,K ,, a tie at the close of the re0'ular schedule. The Delta Gamma team com- L., 's '--pf? D ? L24 :Q posed of Jenkins, Jeffers, Maple, Emigh, Akey, and Dodd took the game , in real ehampionnshlp style. 5 if 5 :xi ' J 1 QE X f f ' J fi? x 5, ---N 1 ,, .' gzfftif J It ' .492 iv,-? lags? ft: ,V ' S . 51 S 3 Emigh Maple Lipscomb Dodd Akey Jenkins Jefters 4 l-kin: 1?':t-:A-2 f?fiTw i'tW ?'?55i .-11 2 7E'W H153-i-i l3l2f9 'mTl'?Wml I. V .V .- 1 Q' -re!-Qiaillvllfll. ff J?-'fzflffmtfglt' W ,fffcf lil-iiifllvi QWWTEQ' HT '17 2 ' - ',j3f.gtj?.ff3.,fga,f0,,- 3 mem 4,5 We 3155 .rimar A52 jfqln ,Q.f:,g'f . gb 2 .Va Q.-'ffVgTg:.y5:.,.Kiel,:Q U- ,Dk Elqiewlkf, ,mar-. :..,i:..r,n...E.,, :M :W gtSfEEkqQ,wx'C J'm .-Lfmwmgys w,5g:Q,y 'mozbrwlvszvfwaog-: w:-new:m.v,:mr.m:w:-:,:':-,hu ' Page One Hundred Thi'rLeen , , wax.,-y .3 Ivey: ., a .MW .. .. 45:-wHqEt?5fs5i i5?:tF-rw :':'g'-cg' x.:.:.:, K. '--1 o -:Hs f: '- '-gr:-a 'f '-'TSI-5 are-1---: :- , f- ,K 2, in, , S j,.:.3.i we -- me 7 -ig: 5122222 51: i iw ' Q , , 5 3:?2iP. . gl Qian fs: ' gi' life 555535.15 5535253 5? w fl if Ffa . fimf--ffirizffi. 551352 .- IEEE? 2212-512 ff E:-1 . ' Baseball The baseball season which is not quite over when this book goes to press has had its ups and downs for the Missionary nine. 'With a veteran outfield and infield reporting for practice Borleske was confronted with the job of finding suitable battery men. Captain Joe Vlfebster formed the mainstay of the pitching staff. Harold Bagley and Elmer Dorothy have alternated be- hind the plate all season. Both men are dependable players and do heavy hurlers, Soper and Gidley. C. work with the stick. , Ihe pitching problem was solved by the discovery that lVaterman, 5 Q, 5 fielder of two seasons back, could pitch and the addittion of two freshmen 'iv' aa 3. 5' 6 'RSF ff-X E: ' V fx. V A7 f l I . A , ,f . ,J I - f ,'. ' N f 2 , gif? 1- .,,.., . fi .1 . 'II'-. I 'A F ,Fbf1s '7Z hi- 1. X ll me .77 I ,, M 2 V' 51: g ' MFSQ QQ .3 ,. mrs.. E If 3 .,55,,f2i?, J, 5 3 ' J - , 3: 1 ,,- ,Mg e- gg , , ' Q 15 ' 11855, 11 be 'i , 2 - I , iii ' Q, - 22 5 E. ?f', f. is V. fl' I f fQ. 3'7' - l li i aff' N, M 6. .. .-,..... . ,. V s....g ... . ,. .. f .. ss ' - - .. ' i .5 - . . ..,, 1 .- '- - -f-i -M 5' 4 ,,.. 1 . -' - - ,. Gidley Kohl De Voe, Bailey 4 Dorathy 1 a letterman, and Anderson, a Frosh, have been taking turns at short stop. The rest of the infield is composed of Gardner at Hrst, Buck at second, and Eckart at third. In the field we find Kohl, Bailey, and Olson, three men who can field the ball with unerring accuracy and can do heavy work at bat. By winning a three game series with the College of Idaho the Mission- aries won the right to represent the Eastern division of the Northwest Con- ference in a titular series to be played with the winner of the Wfestern di- vision. At this time the coast champion has not been decided.. Vlfhitman already has two victories over College of Puget Sound. The College of Idaho won the championship last year, so the Missionaries are conceded a good chance for the pennant. vwmvffezferrsf' , .1 :S ,-. -s-fwfw -. W. l,..,l-7.1 9-as 4 1' , H: 2: -. . : Liv 1 . 1 '::..., ,. zmrczewzze... r.s:w'-- 'WWQ 'Wi 'T'NZ'13' - fist gil 51:1 ,fffu .. fl gg? H Inf, f f' 7- Q A1 -- A if y - . ' ' . , 2155? ?g5.jh,fg:f.Q-ysas,::. fs: fsmmwg,-.j'Q .3 Q L, V -. ,Qs 5 . , 5 ,i M. ew., ..- - . , ,V ,ln . A-K - .... .W Ta 1-5: CN L.. 3. , p . . . 'I':y ', ii' N cc-:. I1 I stem-14511 3. ' :q sr: g?f,11i, iii 5, , , i 551, J 4. Q -. 'V-1: 5 I4 gf ' Pg-S Af- ' V v ' ,H+ Q 'lf ',-'lf ','.- PM fi,.'t f f'iq 'ff'4f.4f,5, ,t'7i.A' ff' -V i s ' ' 'Q'we-'zwvf-Qwftcfis-azfifw:fcs.'w:+:ff:4m:. Hf.'-.ww-:J 'figs f -?1c.7xe-Newman-,-'fy PllffC One Hfumlrecl Fourteen Q 4 X .E 6253. fsfsif, if 5,5232 as-sf? ' 4 I 423' iigffsi '-mia. ,S Via 1-QS? sri? 512,521 gi 'aff 1315-2 5 , f 3 - 'H'-3 9 ' FQ? 552.1-3 .aff fs:'.r:r ,D ffw ..-if-if I v . loo- 9' . fl 'S .4 ' ' 2 -5. Wo. we-:gap .1 JS' wg? 15545 my fzrffgx :f 'era 1:-:gg f .. jig: vaggga V. ,ff-as.-Je.-:-3 5:-:,.-f rr'-'gig ,g::::,:: eww--':5g - ny - V. .. ,. msc- qt .wr V-.,kg.f,,,,,, 5.9, 44 -c ...SIM ivfi-ffiiwa.. ...ggi Qzfa- 1.7.32 ,Jim ffi. f 4 THE FIRST THREE HOME GAMES The Missionaries opened the season with Columbia University of Port- land. They met with some stiii' competition but finally came through with an S to 7 victory. Both teams counted eleven hits and had three errors chalked up against them. Wfaterman pitching his first game showed that he had some good stud on the ball. 4 The University of Idaho was next on the schedule with a brace of games to be played. The first game was dropped 9 to 5 but the Mission- aries came back in the second and won 3 to 2. Wfaterman again got the call to the mound but received poor support. Five errors counted heavily in allowing the Vandal scores. Vifebster hurled a nice game the second day ning kept the VVhitman score low. Q 1 3 . ' 5 . Tt allowing Idaho 7 hits but holding the men down on bases. Poor base run- ff ff 4. r.. F 95 , '-, 3 - V 4 1 if L, fs an ,551 ,Q 2 ' K-J ', ' gg. 'f '. '- :Q . I .5 2 f. .1...512f?Q,g , jf 'S X . -A I 0 . .fi ii?-Lzrff:.I'1f.'f? '- '3 I f ' f ' -. ' in 4 5 Qi Q if sas!.3zfi1Z1s:f1?225 +11-1-:..-1: M ... . ., ez 'Sri wi- ek-ay' f .'.1. - fy r r ' '-'f:g1Q ,,1-35:-gf f' , K ,,A .,.. , , 4 ,VAK f 5 ,, , -.111-fa - 'fl- fS'4Yf ' 'w i'N1- N ' 1. . f f 1'1 - 2 'T 353 N S a 1 - - f' -limi' :.: .'f':,.f f' ff' ' vf--'.f:Z-1:1-1-Zaff' -. j x 1' . -in 'f IJ 'fc ' 5 ,Li K I. '1: ,.E1 , ..,. - - ' f ' 1 .a '- -'- ,. 1' Of -- ' '- .' f ' f ' - ' 3 4 , 'l 9 . fi f f ...., ' .. ' f Buck Olsen Bagley DeVoe Eckart THE FIRST ROAD TRIP Ellensburo' Normal twice came close to beating the Missionaries beino' I C, . Q J D nosed out by one run each game. The Hrst game ended 4 to 3 and the sec- ond 12 to 11 after eleven innings of hectic ball. 'VVaterman pitched the first day and held the teachers down to a minimum of hits. Gidley in his first college game got OH' to a bad start. He allowed seven runs in the iirst inning and was replaced by VVaterman who finished up the game in fine style. ' The Missionaries then traveled to Tacoma to gain two victories over 'F N the Loo' 'ers from Puget Sound 8-5 and 4-0. The first 'ame was la ed I cf 2: 1 In ., under threatening skies and was called in the seventh. Webster did the if I 1 Y ,N ..,,',,c,,,,,,.W T A , .51 g:.:.,Q5fw A a,. -.pg -a,,,,.,m4,...s ,wg Q3 i ' V 'JK.f'Qg.- 'Ys,v'S25- '5 -V ' 4? i2bEfc':6c-33 ,Z,.1' my -' :g 414 L',i::.-Vg pg , ' ., :-,O K Iwi. 'tv' iii A -at 3 U X ..,,. -..f. . 4 , V- 1 ft f' ,- 1' a,5s+....--fd at ' i' . . ' 1 ' w ., :5,.Q,,,.1.:e:b.54 1-f1-Ifw:5sa2'afiff:Q.- Wow mink: 3046 -4 :ff MIL :. Page One Huuclrecl Fifteen gy--,fn-51125, f-ago:-fgyf'kmfg:g5 Z 'ftlfz --:sl If: I' I f- -sit: 1 L 1 ., .. .. L L 4 ' 1 f ., zigigrg 5, isgfgsgz gffig 2 safe. 321212, eff B rr -'-:uc -1-'55 'K 54:3 E vga, -'Lf-.L -get Jw 'Q t L, ft P pitching with Bagley behind the bat. VVaterman shut out the Loggers in the best played game so far in the season. The hitting of Bailey and Eckart featured the game. Bailey got his second homer of the trip. Eckart got a circuit clout against Ellensburg. The University of VVashington. games proved disastrous for the Mis- sionaries. The first game went down the line 15 to 2 while the team fared a little better the second game, the score was 9 to 2. Ten errors the Hrst day coupled with inability to hit the ball spelled defeat for VVhitman. Soper was nicked for 13 hits. Wfebster pitched good ball the second day but al'- lowcd hits when men were on bases. GONZAGA DEFEATED F In a hectic free hitting and free scoring game during which the lead alternated back and forth freely during the fray the WVhitman Missionaries defeated the Gonzaga Bulldogs 13 to-12 in the first of their two game ser- ies. VVhitman chalked up 11 errors during the game and was only saved by the stellar pitching of Captain VVebster who did some pretty hurling. He retired nine men by the strikeout route. The second game resulted in a walk-away for the VVhitman stick men. A score of 111 to 2 stood on the books when the dust had died down. Two pitchers and two catchers were used by the Bulldogs but they were unable to stop the hard hitting WVhitman crew. Soper did some fine work in the box. . THE CHAMPIONSHIP SERIES College of Idaho came to Wfalla 'Walla this year eager to repeat their victories of the previous season but they were without some of the shining lights of their pennant winnig aggregation. The Missionaries won all three games with scores of 9-1g 10-95 M-2. In every game the Wfhitman players completely outclassed their opponents. Hitting and fielding was especially good during the series. lVebster did the hurling the first day with Nickel in the box for the Coyotes. Kim replaced Nickel who found the going too hard for him. Kim pitched good ball next day but could not deny victory to the slugging Mis- sionaries. VVaterman pitched good ball until the fifth inning when he weakened and his infield began throwing the ball away. He was replaced by Soper who finally retired the side after eight runs had crossed the plate. The Missionaries went on a swatfest the third game. Heavy hitting coupled with many errors on the Idaho men gave an overwhelming defeat to the Coyotes. Gidley pitching his second collegiate game showed that he really had some good stuff on the ball. His work in this game largely made up for his disastrous start earlier in the season. 4 -AA-Y - . ' ' -r'a'-wx- ',.., 1.1 ' ,, 9 ' ' -.1 2 ' , ' ' ' . rg, , i 55, R C iznwrcff- 4- '.. , V an I I bv in 1 . Ri 'Is .Q 24 21 .1 . A w f. 1 55 fi i .sf Y f L mi, 1, f -. R-v 2s . SERIES SPLIT VVITH YV. S. C. Eri z 5? A-515 W i:':3: it 3l.N,,5.,f3l l I ' release-sz-1? In the best plavcd and most exciting game ever seen on Stadium field .W,M3.,. PWMJE - . ' . -. . . P Q the hrst game of the Washington State scrles was won by lnfrlllllfllllfl 1 to 0. 53 V, jf Reading like a storv book tale is the record of the final lllI1l110'. The score Wg . 3 D ' ' . D - 3 l : :1: 5' is was 0 to O with the ninth inning at hand. It was Whitmans turn at the bat aff :fa : l it C ' 'zfj : 91 L33 with the Cougars alreadv retired. Two men were put out. Eckart got on . I . ' . . . -1 if thlrd. Buck got a hit. Borleske put in Bagley to pinch lnt for De Voe. Q Bagley taking a Hrm grip on his bat clouted the first ball pitched for a line ,Q it I, drive down third base to score Eckart and end the game. C -I The Cougars came back the next clay and routed the Missionaries 9 to Q ' ,LQ Alf? V K lixx -155: -:am 22:-:, , 15541. '1f:'iiE Ej rw ' 2 Q -Q,--2. -- '. I g.,f ?fv gf lax, .. . ,, 1, Ter if '.2.,e 57 , ., if w , :Q 'iikl 1? Q V, gziwlggiglg I L V, F, - Qgfxieiz Q Lf ': 2 ad?-il f ' ' 'fl-I 15 , '- ff: 1' ' Y' is -- - if 9 M 1 ,I x ,- rs t I - ' S .H B . ' 2 ' 713 ' ' ,f - ,, '-aa, - n:-,sf 1 f my V-fin? ,MJ I . Z .,.-my .'- wap-,,, .A . l lil . .eg:'f,gQ - .wa -',-. 'I X I ae' 3 I E 1 -tiff . , n ' It : -. 2 1 1.. 13 -ev 'T ff . 3' if 52251 5? ' I . f. ff-I GY- 33' :ff-1' if vfltf.-,fl 'J-i' Jil -'givn-f tf Y f -' 'TWQQV C'W'N1t 'Q 51'-7,Z?3P'?-3 V' '-c .1'4Zv'5:l,-NA. 'f-'wi' 17 53 M . . ,1- 5'1,7f'1ri .HZEQL 4W0??:45f '- ff-'. . V ,.3' 'A ' ' f ,. ..,.,., . .',, .,.,, , .... - -- 9 I he tr, So Jer Gardner Anderson Vvebster E: .1 , l V A 5 12 Zi 12 L? , . ,gin P1 iaimaa 5 in a loosely played game. Wlebster hurledthe first game with Soper go- iff 5: 'Qf21e9 ing the full route the second. 3 le. J if 'fl THE SECOND ROAD TRIP .. 2- Disaster marked the first four frames on the tri to Idaho Gonzaga and ,- X U j O - . if I' I' 'Y . 1 x .. -A is E52 W aslungton State College. The scores ot the Idaho games were 6-55 and , '- -f 1 :ss . . . . ie g f 2532 11-10 in favor of Idaho. The Bulldogs gained two straight by defeating it k' ' -if - , . . . , . . A 35 2:5 the Missionaries 11-10 and 13-7. At the time this book goes to press the 53 E 5 ff 'Washington State series is yet to be plaved. There will also be a three 'g 5 ' JE Dame Northwest Conference cham aionsln 3 series to be la 'ed with the win- 3 .f D , . , Q ,Q gif ner ot the VVestern division oi the conferencep S , ' C. , 315, -I 1' rf 1 fy, 'i' ff my 45? .Erik-.Q3,I,.,eZsgqQ, 'Qu' lit' Svamfizsfqga, . gil Ri- tr, :i , t nfl f, .f 'Q '13 , M ww-..,. J f is W .f I -5.1. - -e,'e:f--f-rw' -ee 51if-'FTW--is-ftvI ftiffy E1 'i 5 fffaflf 'J ' 5 'F ii? f Kirin-fftfaf-'MQ fl 'QE 'kwa 195-,zfif it lt N?-f-'-L-:W.: .I'Tt2 1 l-a','n1-'lrltl' l 'aq.rQ:-5' flzhzf-:53ns5ras?s:f,::'xmewewm1v:m-1:-mac---xlgee.-.ez-EF? Page One Hunclrecl Se-v enteen . 3 . im ,. ,.,,:,,.x -an gary., ng:-qs, -, x ' A P 6 oy Q.. -V1 Pi! ,Q .. If Q2 is 1 N : 5' A A 1 f 'EL f -,-3: 1 X nf., 1 ' 'P . 52554 ,i 525.3-.iv rf? fs: 3512.2-3 we i ,IQZL i:,.j.g., 5 5,7 ,fzgggl '5-:cgi 551511513 32.11, Q:1:j:f:5: ,:j:':I,. X gr-2.-.x 'V :--'P' -'cv-:rn e--:-Q :v:v:1:f: Elia.. rI:f:f. ff:-12:1 , kfzezfz-. 'M '45-:rr :- '-:-45 2 wr-: --H, .. :xciff bgxy snug: :L-asa ,emit ::1:gr:z,s Finale .emu mae, .4 'Y-MP Crack Coach Roger Folgate had only four lettermen from his conference championship team back this season to form a nucleus for another winning aggregation. Captain Ray Forquer in the Sprints, Merle Millam in the Sprints, Bob Garrett in the broad jump and hurdles, and Pat Joyce running the distance events comprised the experienced material. An exceptional number of promising freshman and several men from last year's squad proved an asset to the team. Wlith the material on hand Folgate built up a squad that up to the time of writing has won two dual meets. Prospects are bright for another conference championship.- Evans, a sophomore, who started in his track work last year has de- veloped into a dependable quarter miler. VVuest and Parsons are two freshmen of who big things can be expected. They run the half mile in close to record time. Lindman is another freshman who shows promise. He has thrown the shot forty feet and also throws the discus, and javelin. VVhen necessary he can run hurdles and high jump. Newman runs the quarter 3- . 1 -' li ' --le f - -vs p: -. ' , - ,V '- A . - ' ' - -A I -- ' ff J Q - GM- e:p..m :-14:5 - . . -, .A as .2 H , .as 4 .,.1 -f A f--- 2' Q. ' 'R w-:Wa-:-:gs .. S f -:reef ..:-:1::-acrfc:-gf, wr 1 . , -- ' .J ' yrs:-1,,,,4.g:w. .,13s:' 'f V f -' ::,- , , ' s ff ,zsfaef Q - V f t .J 9 ' 1 Back row: Conway, Lindman, Boswell, Forquer, Napier, Vvarwick, Norbergf, McKellar, NVuest, Quine, Coach Folgate. Center row:-Graham, Millam, Joyce, Garrett, Rogers, Evans, Fee. Thompson. Front row:-Gaiser, Phillips, Vvurster, Shenefeldt, Cartwright, Castle, Shields, Parsons. i-'iff7'5'1cM A-ffiix-, '7?9? Y4'ii'N '. fir' - '- Asmcfzswrzxgz-:-: . A 1ff'w'S 'i Tiifa- '- 5' I' ' -Q. c:-:,:-:'mm:'::cN':vzQ:1::c-e:4 2 . . , I . .1--l 42 -- .- ,r-hx 'f'-l X,-,,.,., an ', . r -f H . , , , 5 - - -1. ki in--.5 -steam 'M its m. .w ' Q 2, ' w.. 0 - , , ,Sf - -,:3w.,1 Mxa.,.,..1,-3 T2 , -3 X .F-,-f-N---. J x and , 'LS ' jga birisaiw f ,g 1 f yi jig 'gf n . C . f K, , . , , ,, . . - .- 3 --Q: , , Z, ss, ,' g-5-x ,-R151 -ig!-., 'mewzccrgd 4 'A'za1:-wasz:-g'.' ,urn 65iE HiliZJi6J 'Eighteen v x fe 4 S - 5 ri :Q . v ,, A ii . if 5 'S K: 'A ,ix vi' X4 57 Q if ta 'fi :S .j ' 5? ii 1 fe ill- Essay misc ,J ,P 5 fee zegssl 2 K if .L 5' itw 235152. 3:5555 ,U Q? sssif 41 t:siiff2 ' 5 I , K . 4,, 1 ' 'V Q-:asagzs ig and broad.,1umps. Quine has been bothered with an 1113 ury to his foot but g 1' 3 1 K still steps out to lead the squad in throwing thc javclin. 'lfhe most promis- l 23 ing freshman on the team is Merlin Phillips who runs the hurdles and ' 5 ' 'S : K' broad jumps. His time has been excellent and there is every reason to be- X f :I -' lleve that he will break Several records before he graduates. '55 Norberg is still another freshman developed by Folgate. He jumped elif- . . X 10 foot 9 inches in the pole vault agamst Puget Sound and also placed sec- fy' ond in the high jump. Boswell is the best vaulter on the squad soaring fp? . 5 L'l:j::l ,' AVf::F3 Q gl, ,'-, - 'sffe,b 4 1 l gfg- X. 5, ' 5 Q A, ' A i 5 Q ,. . ,V Q A 5 i ,.,. W A 2 . ----- i f- 9 . .. A H .,l. H ' .. i 21 2 f . ' ' g .,i, 2 'f-- 3 : - fc -11 ,.. -Q::,,,:f,1,5, ,,j---Q. ,I-ff - - -:'z.f'ii - ig-2.12, .,g:'f:,s..-.1 ..,,. 1.,W.,, ,, 4 2 . I :sg 1- V vi: : 4: E l 'f' -.,:'3 'i'.i:f:,g2ia93y::'izitiilf' V' :f ' -:.e.s.:g.: usa... V V' :E:afgZi3Q:Yj if 'fx 1,3 ,I '-f-, .' fn, feis 5 ' : ..v, . ,,.,, , 1- f fin.: -- .'.::....a.ea.,.LuL,...:Az..-:Q,.,:vsefzuQmzgas.':'.-,rs,.m5gafr,-g.:2. ,:f,,-s,. ',2::1'.f- :yrs ' ' ' '- 11-1-ri -'-Im. '2 .K , if For V Q XVuest Garrett Millam . lips C N em 1 , MARY OF 'i ., .4 Wa- flaw. l am: wa .d,M,,m over 11 fe ntly defeated the conference champion. Shenefelt IQ 'ard dash: ' 2:2 and Rogersrds time 10:,i'ce in the distanc events. VV3.1'YV1Cli and Conway 'iff' 'Q . ' V . 'i if throw the 'miffitf Ccfrdon Mauser runs ln the dashes. is 1-3 Fr'-x' - ---- ' is I - . il 1 N gf 5 ig ' Probably the most outstanding work on the team this year has been 'H V 6 f H2 N ' 1 e .. - - 1 A l'-5 done by Bob Garrett. He smashed the lVh1tman broad Jump record la 151' f gg, W l . . . . v . fl 2 5 'inches by a Jump of 22 feet SDM inches He also tied the Whitman records 1, .' , , 2 if F i- in the low and high hurdles! with 25 and 16 seconds respectwely. L e ' VL -.A , .ffaiflifi fic - 53914 iqwrmwaiesf fi, gear ,,-1-:fa Q . ' .,,.,Q.1.l5,:sWQ?f2f:sf3f-pfofsfqfjfy W A3552 gi,l?,?F?,:q Ml.. 353, Z 1 , S K A . I , 7 Q, .9 Q I 'f .-J4.-A-..:,,....qf.-..L..' J , , A ' r,: ,'--15?a ' ,:: 'tvs-sau.: - ' ilk , -Mer-'em--4 '--A- im 4 f' L -4' Q -, cv ' J, .rr , . if ff...-ig. ,M-.A 11.3 ,A z-1 1. , 5. ,Q ,. 1, 4 ii, 1 -Y 2 L 1 C Nj-5 1q'NA:1-xc.: Vfig.. -w..al-uma K rv. gg '.,f.1 Jiffy 1 L 7' ?x'7'Il5A'if1'? -' 'FM '5lfli'f,Q1' ffY,.l.f'ffEA'F'QQQlfQf.Qfif.ff1Q..-.Q,.fl-.'-.Qi'1 F .'.L-:ce-11-:1'Nrf:Ama:-:ozfsgsrmui-:za-'ozl-::::l:.v.e2'f,xi4w., ix.-M 1,-,ma -'-.-sew ax4'A-Wsfv5'mYS1- - ---U ee-+ W--V -M--L - '- Page One Hurizdrecl Nineteen X. -1 .- -.. Q v r aff' . if 3' X Q f .ma 5' ,rg ass, 5 mia 22:15 g 13- ' A- ' .. - .. v: nrt' fm 'J'M'17:Q. 'Si -:iii -iw-5 .- 1 Z, 52- I .bi 'f:Ei1. .5 Q., , . X ii, fmt- -QM PM-W' X. . A 4 ' A it : 1' ffl-.11 , v- 1 1 w v w u i 1 ?isi:sf':i:.:ii WW. SUMMARX OF IH11. W. S. C. FRILSHMAN MEEI X K, , ,,,,, s :J-5-zge.-:sq Mile: Hughes, frosh, fir-st, Joyce, VV., second, Shenefelt, WV., third, gg' 'gif time, 4f:fL3.1. iii L32 it . Y, . -H 2, E55 100 yard dash: Kelly, frosh, first, Borquer, VV., second, Millam, W., S' . . ' 'ga in third, time, 10.5. . it ig Shot: Lindinan, WV., first, Hill, frosh, second, Hansen, frosh, -third, Q, I distance, 37 feet 72 in. Q ' ' 1: -Q Q - iw fit 440 yard: Turner, frosh, first, hvans, VV., second, Newman, YV. . sg 1 :gi I I V 1, ti 12 -' third, time, 52.11. Nr, ,fi x ' . ' . . -'gf' . 0 Two mile: Joyce, VV., first, Rogers, VV., second, Inions, frosh, third ,ff N, , 7 time, 11 :08.6. iiw:-1:-wi c Pole vault: Lainhart, frosh, first, Boswell, VV., second, Barmeir and Henry, frosh, tied for third, height, 11 ft. 6 in. -ra? Discus: Hein, frosh, first, Conway, VV., second, Vifarwick, VV., third, .-'L' cas distance 114 ft. 5 in. 120 high hurdles: Garrett, VV., first, Ancheta, frosh, second, Phillips, P 4 'W., third, time, 16.9. I iliigi' ,- if js 'Q-. if R :QQ Si if .K s ::, .fi-22.51 Mg.. t--1 ,-. . i-, 5 5 i N Y S80 yard run: Clarke, frosh, first, YVuest, W., second, Parsons, YV., Q, 22 third, time 2:01.2. E1 . . . . . . 1 37 gi 15: High Jump: Lainhart, frosh, nrst, Norberg, Lindman, Boswell, 'W., 5, and Morgan, frosh, tied for second, height 5 feet 6 in. 3 , ' 1 . . j: I : if : 5, 220 low hurdles: Garrett, VV., first, Phillips, YV., second, VV. S. C., gf g Q : :L . . - V f : :fs if third, time, 26:2. 2 553 1 1 1 45 5 ' - fr: fs 1 5 5 i 1 fi ' if' 3 ? l Ei Sli 5 El 5 T55 2 4 .,.. ,. . -V its 2 2- -2'-I - P1777 K 4 12 ' , - - 'ni .1 1 1 -:cz ' ,, ,zsf fr :fi - '22 1 .' ! fc . 7' ,- 43 fr .if fs: -1- e q- L - ,.. X , ' ..,, fi fi 155255: iii ' , ' I 1 Q rf fm- H ' iz 4:51 ' Q 1+ ' -V fiufnirlr' , , ' . ' , ' 't - ' Y '- -- . - 3 I . 25 --si 1 ' - ....i 7 ' -'+A if:-fl-.f . .f.+'1 'fm off . ' is f 'E 2, 22 -. -, D I W 1 . : I 1, ,' The relay team-reading left to right:-Newman, Forquer, Millam, and Evans. ', E 5 ' , 1 Q I 'I 2 Si I f' 'Q lr if f' Vi? tfftfvcacxw ftfffzsazxarwgx - Eixffax? 1, 7FVlTP?ifrwwgwwfwwwwwsy iiL,':'l'fjfr?Z 5i2,fmls3Ci iflifwgii, 'S 'rp'-' fi? : V '-v','1.-f'sff'w '2.ffr- f - ' ky fp. Sli V C-gf ' Q- 54 ,Q 5:5061 , ' 5' ' Uh.: 1:2 b, .1 3,91 -J, - ? 'uni ,xg e 0,3 VB, K :L lv.. 4 . ,, , ,nz , ,Ay-: I, -I 1 fs:-1f ':j5::m: 2: V ii 1 ,xxx 2:.'Ag,m,4:j,r .... ..-T--iii, 4 i,'u'i.,,,A -l:3 3:2-Elf:imsmffxggV:QQ-flzdciiaizzgef-:iclttdlsi-xmziifrtda XMWK5-2 '91'.1Q,J?, g1is5fbJaai3asLi:isaisa1l:.3mw:oaass-sl-.esnbzz-.smo:15:4Z-1-.ufsiai Page One Hundred Twenty -m 'U ' ' -a .,4f' -1- ff' ef .- . . 'mme IA: A7 N. , 1 N P: 22 2: f ff 4. f E7 My fs: . 0 -v H A x 'f- y 2- 1 ,Q . P- . - X' .1 'sw Q-fix., gg est - if '--wf lf U . 'N HW' ,X 1- 'Q Q H - 555 arg . ' '- 5353 4' U4 ,hi V. ., S ., L at . - :fl 'a '- gf-eh! 5 225' 1'-C, N Vw? - ' L . I . W . l , ' - ' ?'-J 4 1 ,. gy? 'ffl .. ' dig . 5 .Q 'S rj' H ...Q Kglxtn .V-25 ge Sli Y Si'-ygb 'Sl' ,g.,,:uR:2, 2: -. i 220 yard dash: lxelley, frosh, first: Mlllaxn, W.: second: l orque1', VV., third: time, 23 flat. Broad jump: Garrett, Wh, Hrstg Lainhart, frosh, second: VV. S. C. E.: if third: distance, 21 ft. s in. ' Javelin: WT. S. C. first: Lindman: NV., second: YV, S. C. third: dis- Qi, tance, 151 feet. lg 5 j' gg Relay: VVon by VVhitman QForquer: Millam, Newman, Evansj, time, ' 3.32. 5' at as ff 23 N- 115. .,.,. f FJ 4 . .. 1-- ' N lk rf' Ee? IE.: V' fl' k In -X5 .f 5' ,.x His? It W M- QM . , A V :-I- 1. , , 11.5-'iff . aa ...Q- :affff-:P rg. , . f -fr . i it 1. ,iv ,Q ri: 473i Q.: s.,..:if,,:.:g::ig-.51 u s, :V , ' Q ,9 .a, ' 1 f,'affg:, W 5. sr .Q ,., 1 . .,1.1?T'f' 1.211-' ::., ' -. if -1 5 ,,,.. v I I Ii ...,, I . , . . .L L it E 3 Q z . ,. 4 1. ...M N V J ,V -,.,.,...,:, I 4 53 S' 3 5 Q: , f gf: ,. 1 2 1 3 1' , .- 515 1, 'Zi 5 4 1 1 3 sz ' -1... lt ' if -1 - as 1 i , f 1 I 1 f ' . :ff Q -f.f..- 1:0 if 'f fl ,Mg -- 2. ff' A -:-t-!- 224' EM' 32325 Philips- Norberg Evans Quine my Q.: .S it . al SUMMARY OF THE COLLEGE OF PUGET SOUND MEET .4 W2 W gzearuzag y . Q . , , . yi 100 yard dash: Forquer, QWj first: Millam second: Iatturn: QC. U yi is P. SQ third: time 10:3. V - 22 Mile: Fassit, QC. P. S.j first: Joyce, QVVD second: Schenefelt, QVVQ J - N , Pu Ni if 3? third' time ILALL - E 3' ' . ' ' .. iffy? 4 Q 120 high hurdles: Garrett, QVVQ first: Pl11l1PS, QYVJ second: Boothe if :I . . , , I' l ' QC. P. S.j third: time 1.6. 3:5 ' LL' ' . ' . . ', 1 gf gg Shot put: Lindmvan, first: Generic, QC. P. SQ second: Napier, 3 ff' - third, Distance 440 feet, M inch. E S 5' . Pole vault: Boswell, first: Darrow QC. P. S.j and Norberg, QVVD Q ,.' nf tied for second: height 11 feet, 1 inch. ' 5 lx I tl if :Y . 1 5,. ...f.- 1 Izalfigi :TTL vig. gcc 11 ,59 1. 77 ,. .. l3i3i3f. iii? ill Q39-7,551 Q. . ff -we Q oQ5'9'nfY',l315,' .A-,Fo 'QHUZ' .,:,vv A iid' iff: I C, 1 .:::::.. .. I ?. ,,,gM:Lq:.. ,-L '- -4'-'Wi z - 3' tw ZEJQXA-grgrg as y . .f .wsu l .ve fkwl. .1'4,,-Qfsg3,,Qa:,,.v,:,,Q,,Q. 4,13 N 4: Q QT? ' 11 5, ,,f:5U.g4 N : V f M ' f , , . . 1 , . , . . , , f, ft .H . - .1 ...I :.,.f..!. .L-.9 S .. . H N ,,....,.x.A. . lg . .- ig: 'TQ iw , fs., Any .' 'TTZT . . . ' 5 H ., M432 1:3.,2:.s5ggc,:g,5.-g,z4s-a'Q065Mi -12'52?? ' S ,:..,.:w' vE4fm51QsScwcoz:cs.zoQ4'z4ca4aeaaenazw::e+avsdscQs::4,- Page One: Huvzclrgtll 7:'QfJ67llflIjrO1If:' f fifiili 220 yard clash: Forquer QVVQ first, Millarn QW'j second, Tattum QC. 5, P. SQ third, time 22 1-5. Two mile: Passit QC. P. SQ first, Joyce QVVD second, Schenefelt third, time, 10 141. ' High jump: 'llattum QC. P. SQ first, Norberg second, Lind- , man QVVJ and Mozier and Darrow, QC. P. SQ tied for third, height 5 feet, i 6 inches. I 440 dash: Tattum QC. P. SQ first, Evans QYVJ second, Newman QVVD I third, time 52 :3. I Y Discus: Genero QC. P. SQ first, Conway QVVJ second, WVarwick third, distance, 124 feet, 5 inches. JJ -D .. X , E - -, ff fl r . : f f f ' fx 'V .. '- f X f' 7 ..., . , -,-fi' ,M b ,Li-aff' , tg: A QX V M 13:b,..:,:,3f, 2 . 3 f J I U , .... . , 1, , 1 i Q . .P N ,g . .33 ,Q J 3. Mr- 1 li ,..,.. :M , 8 1' .J v X ' , 5,13 tl ,' 'V i 4 l s ici ' f' I .,,A I x.,. ,V 1 A.. Q C-. f 3 ' Q ,- A ' f . V , X fl Q -:,, i, EZ., - .,,., vii, 1'-'rim-A .,... :Q ' IL r, 5 - 1: 1- .,.. ,:a::: .Q , f V -ffif , '24 : - fiji Q 'f' - ' 'f' - ' ,.,,..., - ' ' Q. V. , 5 - f , fm .,. - j - .hu 3' ...'. ' , V . '- 1' ':, V, ' ' . A . .,1f' , ' ' - I lkfwfvf- - : :gggaa .'.. . , JW: -r I - . ' ' ' Lindman Shenefeldt Rogers Conway Broad jump: Garrett, QVVJ first, Phillips, QVVQ second, Mozier, QC. P. SQ third, distance 22 feet, QM inches. QC. P. SD third: time, ...L 220 low hurdles: Garrett, QYVD first, Phillips, QWVQ second, Boothe, On' 880 yard run: Tattum, QC. P. SQ first, VVuest, QWVJ second, Parsons, QVVQ third, time 216.114, Javelin: Temple QC. P. S.j first, Purvis, QC. P. S.j second, Quine, QYVJ third, distance, 163 feet, 6 inches. Relay: VVhitman-Forquer, hlanser, Newman, Evans, C. P. S:- Darrow, Boothe, Purvis, Hendedg time 3:4+3.3. Page One Humlrecl Twenty-two . if I v5.3.5 Q 2 1 A Q 53 . .5.5:' 11, Q t . , , , 4 4 V af i 1 ' ' c CDen's Cenuis Y The men's tennis team, composed of Captain Ahearn, Stephen Pen- rose, and Wlorth Oswald has won two tennis meets so far this year and are picked to again capture the conference title. The outstanding player this season is lvorth Oswald, a freshman from Spokane, who ranks up well with the best junior players in the country. In every match this year he has 1 shown himself to be the best tennis player ever having played for YVhitman. The most notable victory this season was the defeat of the strong Uni- versity of VVashington team. Oswald defeated Langlie 6-1, 6-1. Penrose was defeated by Newkirk 6-1, 6-2. .lack Ahearn lost to Plummer, 6-13 2-63 6-3. The doubles team, composed of Penrose and Oswald, staged a comeback in the afternoon to defeat Newkirk and Langlie, 6-445 6-52. Ahearn, Penrose and Oswald took Litchfield, Minto and VVhite of VVil- lamette down the line in straight sets. Penrose and Oswald had no trouble in taking the doubles from Minto and lvhite. Matches are yet to be played with Wlashington State College, Univer- sity of Idaho and the Conference meet. l'Vhitman should come out victor- ious in every meet. The freshman team is composed of Clark Emery and Kenneth Davis. They have a meet yet to be played with the VV. S. C. freshmen. '- 15 nv- , I .. , tg . . it - . - .I .- .- '. :VJ 7 of - ff-mn az G f' 1. :5 - 1 ' ,.,. . 5- 5 f , -. we af - aw! we w 't ' ' - A 1 ' f.,,. , g,1.,-1 , 1--, v- I - A f ' 'j- - A f A . . - 'kr y' . ' , ' ' f 'ra 'Q 'Q fl-.V 7' ,fx gy :- -:-aS:.-..,e--:.i4-fr-wv-.5 'fs-'few - 2:11 1 -ffoqaa ,, .yrs A441 f,,, .5 A V -if J V . '4 a,'sff?1s fifragfz W- G 1 L f 1 ' , . 4 6f93wJ?Z'??4yf,., H W ,Q , - ..1.1m'ff.'f .,-fa map. gf-as ff-ac, t . . ' . Penrose Oswald Ahearn li R M U ti? 3 1 ,N I Wg-K4 FK 'fviut Q. 2 .- T4 - K--xc.. immerse S1 f ' 1 N Bw-a,....33llt 4941- M 1' . 1- 2 4 S 365-154 ,.i,:,5:,Wm V5:,.7?, gui. -4 .U , . .1 -fxmaaaoaf, . Hr, 1 5 1. , L . If-:c-f-Q,2'21 --ga , . ' ' 2 5 :W ' teams-.sau N, I ,:r f , V 7 4 . X 2 ' -Q .H 5 r tn 1 v x 1 I . -,, V wi ,f ,...-v ...-- . . .iA,,,,,f.-,H .i,.i,,m.rf 1 Vs, 1. . .. . . ., E , -1 fc- -- 'A Q' -. - i:.,rfwr41b.g , 1-' 141:-.-:-1-.1-''f-fJ 'JJ-'IM'-21 Page One Hundred T'wenty-z'h1'ee ,. .w 75 li 5 55 Af .17 3 if. .X R1 63 J If f: isffclv 2 ' 5, 7 o fi. CTTIQ I l S Q I l I US . wiv-:Llf.13 I-551-X R65-ix PRENTISS CUP PLAY 51 Miss Marian Jenkins, playing her third year in tennis for VVhitman, sue- Z, 2 . . - ' cessfully defended her title to the g f Prentiss cup by defeating,Miss Mar- gi jory Nelson who is a freshman. The Prentiss cup is a perpetual 'N Ez? trophy awarded to the best woman if if tennis player in school. It is com- 13,53 peted for in the fall and spring terms of each year. - ' t, as gig VARSITY TENNIS In the one tennis meet held this year ,ix Q for women the Whitman team, compose J 1 I ed of Marian Jenkins, Marjory Nelson, 9 'l1'1S , is nt - and Edna Burke lost to the womenls x tennis team from Wfillamette University. Miss Nelson defeated her oppon- :Q ent, Miss Nunn, while Miss Jenkins lost her match to Miss Findley. In the afternoon the doubles team, composed of Miss Nelson and Miss Burke, 5 lost their match to Miss Nunn and Miss Findley after taking the first set. ' Mrs. Borleske has worked hard to develop a' good tennis team this year. 1 ,gg She was ham Jered b f the loss of Eunice Mar uis who was the mainsta f of Q 1 3 . , , , . , the womens team for the last four years. I'wo freshmen, Edna Tlnelke and Helen Gray are also on the squad and have worked hard all season. l Q i .FFF iffinzii Sf-:'5f-VQIIXEQ fi VK .. 4 2... 5 I :ff A J I , l . lj 5 l . 5 --: : ' C: - i fi? H I ii 2 is . wr as Jenkins Gray Burke Harmon Nelson Thielke 1v I-3'X'v315C45 .6-cscrqpszq ij,5s:pc,::3a'3-.:.:gjq, Miz?-,.,, 'M' 5 :XP q:1mg:a.wsfs:g:sf1E Ngifmp I- 0, ' ' a 353' Sszff'.:La1-2-:wie f.'Qr' Hl,1sf..2...f..w.,f:T' 4 J '-1: ft, ' LG: 46297, ,,q:5., Q f .ik ,:f,gfT.f 5'g : ff' xl 7- . ...,. . 1:.:.1.1.-1, .ez-:b V: : ' .3 V. :..gfzdf-,+:x-1-ss:-L:z.Lx4,a.zi.:f:t Page One Hfwnd1'ecl Twenty-four , L I 3 jg- -. .A wi, ,-4 . 'J '4,.,.ss- . ' 55- ' '- - ' K x'gxc 'I l Exsm- xt., x Q A N-.. .........., .. ...- - ev .. s s I Us 'L P '..-,...f..' '-'-'P-vwzizkzbbirziuaax .zax-1:-:faxes-awe-.-.-. lax. XI? TX D- , N xx K Ti-it K 1:4 -.Rial J! jJ Fm Mk? M45-fx? S,-4' fw N LR.. X YY G QL ff X X X ygf VUII, . . YK lu ,VIA 1 -fy, ' K-XX. Hx if RL..k,......,, F .-- -' F. .. I X ' 1 x. f Q , saga 1 1' ' ffmgfiff. ' 2 X Q , ' f . ,. . -' 'L x ' L, ' 2 ' fi f -L 1 iff' ,,,, , J '1 an . L5 A in , X . ,, XXXXQ XX , Y, 'Z . NN-Nifimb jf , Z' f NH GE TLEMEN! Cand What you run around Withb The artificial phase of this volume now having been perus- ed, We deem it opportune that you should taste the dregs of re- ality, so We would like your Z PJeO II Ill 1,10 a 1 X ff I' 25 55421 ,- ff.:-xxx . . QQR , ixxm ' ,ag 1 4 I XX . gf I 2 ,,,1T 4,,fl35 2-,f ff -' faff Q' my AM In Y 27? ZW f ' QQ, ,I in vi f. . ,- V -,1 myff ,f a M V f ggzg: , , QQ-- 1'j , If fi Nfwg:3?fif:' 247 , i. - .A X ff f fo! ZFX E. , ? 7 ff? E ff' ff f V I ,azz 5, .,ig 5 4,,.,, if, X f, if X RM, Eff j 'll ,j f If X ' 1 r lj ,J 4,11 X A in , L gk ff f-.Z ff! '?ff 'f ff ,I f It G ffm! .W v fl 7,1 Qflf l 4 ,f .2 2 f f 'ev' ' Xuan 'f Af 4f , f 'ff' W' W? f 1:' ' ff ,' p ' g 2- ,' fVQ.,x if 1' ,. ? 1' . ' ,f 1 ,.,.M. ' Q'A,- 31-LW 1 77 K 'Aibf v . 9 ' 1 ,-'ff ENKX Q -J - if X f f fy! '4 A - ' EY- j 'Xi - xg? ' --Zf j ff ,ff ' V ff . X I if , ,A '-'EP' ' f'fiffW' 1!w.'1i ' f Z , , f 'X K W WM 2' A- 517 fy, if iii ,-gf! ' '. , ff-ff, ff ff A ,f ' fm ' 2fiZL1i:3Q.1L.12y ff Q fic' f' iffcff 1 l Q , 7471. M Zfrwffi - - :A , . 'Q,1i.Qf--',f 21'- Page One l1uV1L,zl1'ed T'we'11,Ly.sin: x x 5-' ini , ' fff 319 swxgkyg yekbr Qfyi X Xgx-,N , 'fx , - .M 'il gif H' 1 W Xu X X-fi 575 it 5 Niki 1 x RQ N -X 6 Q N ff' x f ' ': KSN :Q ' if NK E R Q Wi A Q5 S . sux E 4 THA KS for your attention. You may now go on with the story-W N P 1- ft f- , . 'T -605'-:im Ex K wli . :' ' l My .311 xxx J Q, 1' . f f xN .. . . Aiwa. ff M N W hy did you break your engage- Af Y' 1 - Y .PH Nh ' 23 ment uiti that sehool teaehei. ff X ZW . .9 .. -. 'iz J AA rillm l E. I dicln't show up one night, and WI l Nvgllgiflh gf-S she wanted me to bring a written Cr m 'f .Wi excuse signed by my mother. J fy- .... .r.i1ll-,,',..,2 r r' Y : AX . Mila. V . 1. .mg Hera Com -' the 'I-'gm Boys! YAY! YAY! YAY Y' The above, children, is a. fafxsimilfx of Robert Myers on his future home- stead. -Mr. Leonard to Evelyn Clark- Now Mrs. Bell, what have you to say concerning this discussionn?,' Joe College didn't want to go to the dance but after he went he found that he was the life of the party. Everyone was laughing at him and his jokes. He wasthe center of attraction and he had a wonderful time that evening. Imagine his embarrassment when he returned home to find that his shirt-tail had been in the breeze all evening. Such is life. Page One fr'IL'lll7'I'I?ll Twcn.!y-s0z'cm . Page One Humlrerl .l 1U01I,ly.e1.ghb .V . . - xW.,.x.J:s Q, 4 ,e.i.,..,., Www 1 g., -- ex-A-,M mwv. .. we-zo oz'-:far -. :if-f'-,Ace N ,gzjggxw-. 'N A fig: s 7693? Q59 if f' 45:15 X 5: A N1 ' 5?-W M4715 -Y C-151 if'-L '25 P3236 X .f' 42? '35Zt'. 2251? x -:A filifh Q .asia te? 3:12:11 ear 2: Q img, app ,1 2215. e-1252 :gif gf as 254: , 1: 'isis yay:-it g .f we 2::1fLg.:s.. iw 5 Q43 wake' 'I ' X sais: 1, H 513. sift sw mv: lf '5 -X Am-x 5:22 :JN .- t 'fe Q' ml 9355-f8'I H to . J,-f....,f s 4 Q Wi, .,m..m:, au,51w,ww.-Ws:. -an VM i I OUTLAVVED if This particular college graduate tried to crash State occasion Ball minus his soup and fish. The keeper of the gates pointed out a sign ieading Guests must be dressed,', meanwhile giving the gent the bum's rush Y I-Iayj' he said, 4'can't cha read? wi Cri Jes twir Ds the 0'u f who the hell's srnokin0'?i , 3 1 an . 2 y ci . -f ee ee ac- , A 'l - ROYAL ROAD Corpsrnan: Certainly, you will. ,CCF X N -5 1-1 J l A sign cleaner fell off the stage one day and injured his hand. A week '- later, when he was getting better, he asked the corpsman: Say, Doc, when this hand of mine gets well, shall I be able to play a banjo? 1 Sine Cleaner: Youlre a wonder, Doc, I never could before. I A BOILED DOIVN LOG OI' 'II-IL f':Q -'fy' -3 Z ' YEARS EVENTS ' A 5 Septj 24'-First game with Chen f If S B ey Normal. 27e0, for us. l' A5 Sept. 31--First conference Game 4 5 with Linfield. 12-O, for us. 4 M Oct. 8-Gonzaga Bulldogs 7 0 5- Q31 fly for them. 'ff L Q! Nov. A11-Sophomore Play- But fn' , ' xcif 1... H fD5iC.TEg--f: Lei and Izgg Man. A CSec page 132j Nick IXIeng'e1 training for the Olympics in 1939. I call her spearmintr-always after meals. 94' -X' W -X' W'e Shall now favor you with that old ballad- I'm sorry I made you ci -but your face is much cleanerf, LOUDER THAN VVORDS A She: You remind me of the state of Venus. He: But I have arms. , She: Really F . 1 5 I f igff.i-'gwaeifffzk -f ffixfi 1 . ' 5 f f . - , I .,.. A., .x.f. J. :' ,... ::.,' Q . -X f ,!5l:ACm, firming N.-:fi -gg-'Q m,:,E,1,a, flfwkwnaia -.2 ., :-.pp ,Y 'straw' f 'fide-f4m55w:95w,m How would you have liked to have gone to Vllhitman College in 1863? This building used to stand where Prentiss is today. Diary of a College Mamie Day 7:30 A. M.-Gets up an dresses, brother Casters, pants, brother Sling- fishers' shirt and tie, brother Oysterwaltz' shoes and sox and his own gar- ters. 7:50-Eats section of a whisk broom and drinks cup of colored and boiling waterg picked up the wrong stack of books and starts for 8 o'clock. 7:52-Stops to bum a cigarette from brother Fishennwhiffer and at 7:55 a match from brother Bloke. 7:55-VValks down Isaacs to finish smoke and meets Suzie Sazzen- berry who dropped out by request last term. Has a chat in retrospect with her. Cute li'l skirt. - 8:00-Makes quick decision to go to class, looks at tower clock and notices that he has five more minutes, so continues conversation. QSee page 1301 Page One 1:I1UlCll'GLl 7'i0ef1lyAnil1rs : mm-T . . - pref -1 421 'z nl Rig-1 xg A 1:5 31, 9 ':':f!, :':-5.1: Sic -Q my :3-rs: safwg If Vg, LG ,iw Rf P. Fl-Lis-. wwf - in Am,-v'r I Musa, .ag-sg. ceases .-arm QStarts on page 129D 8:05-Decides to go to class. Strikes off across campus, takes last drag off cigarette and flips it back into the street, starts to run but is out of condition so resumes original gait. 8:10-Stops Mollie Makemtaker and borrows a match and 50 cents. Chats awhile and hints for a bid to the Lotta Gabba Formal. Decides he has no chance so starts for class again. Stops to chat with an early track enthusiast and discusses the times of the different runs. Saunters toward class room again, realizing he is ten minutes late. 8:10-Decides to arrange for tardy excuse before entering class room. Goes into office and writes excuse on grounds of a sore ankle, obtained in track. 8:15-Limps into class room. S :2O-Tries to grasp the meaning of the lecture and fails. 8:25-9:00-Finishes previous night sleep. 9:00-Picks up another stack of books and starts to another class. 9 :03-Stops to read bulletin board. 9:07-Decides to see if he has any mail in the office. fTwo letters await him, one from the board of Deans, notice of delinquence in studies, and a bill from the Midwayj 9:10-Drops both in the waste basket. 9:11-Dashes in a hurry to class at Billings Hall. Falls down steps of class room and attracts a lot of attention. Receives a bawling out from Prof., turns a livid red and sits down. 9:15-Borrows a pen from Bill Balderdome and a piece of paper from Milton Minkelscratcher. Takes a few notes. 9:2100-Draws cartoons of class-mates and Professor. Passes paper around class for approval. 9:25-Paper collected by professor. Professor asks to see him after class. Turns blue and wilts down in seat. Afraid to borrow more paper. Goes to sleep. 9:30-A short test on the text. Borrows paper and signs name, then hands it in, and leaves room carefully, quietly, and crimson. fSee page 1371 ,qw :frass- - - Ut. - 'f'i-- I ig' .' ' 1 c - S ' -ei -:vzw. 1:- N .,.' 't. 'N ' - . ' T. -I :tm 'WWW' ' , G ,..W.. , MKA12 1 aids, . ' , . f ' f ff, ' i ' 'Q 'Qnffcm 'srzzrsizi 2-: V. xt A Q , 4 Q41 9 .Q .. ' . , p .A .1-,..:,,,., , Y ,E -g ..,., ,.,,., L if M M2559 W B EEMS i-r.nrLE' Y ,1 .f ' mugs. mmf ' -' V, -sfwweonasaemigy ,X ' 4 LI Lmms Fok ' 7 ff fl ,O a ,I mmm. 1.5 , fi f' Af . X' r fr I WANNA J fi, I . K. Vt lg DRINK-A I f - XM vm-wan! , f-' , , W 0 , - . P , 5' . '-Lmfue BENNIE f eau-pu wane buf V J- .X F::2.,:A':A2f-'xtfm X - . fl r - 'I 'Dm A ,N 'A XJ? ' DOWN W1 FATNGHS ffzasfafz . 3,771 X X - ' , , . 1 1 NX x 5 X l. Wrflfgxg X -'EARLIE . .f Eff ,-X ,Q lxgw., X EE ' .x KI, ' MAKES HKS -:xl ,FM G. , 1-1 , 01 . ., MST I :J 2+ . 1 -,A-f -gg Za s Psscu fo me .N .1 'Gy , ff' - l WAS HANDS M6 . Asrkvmor-xER z:,.g fo, g,l,,,,hU kms Yauwe ofoo.W6N HC ff- -SHALL Nwgfvf' C5 ' 421.1 Nemo :na P91125 I f' urns G5-31 Qmrggyqg 'U MYER l-ic sfvofreol H15 T I UNCLES PIPE Ar SIX 4 mourns ouaj ,G X - , 'HERKME . - Q' 'X M-l'AS5'f 1 -BZQQEOQT , - I OF3 YEARS: X fu sur Ll-r1-Lg AGE- 3 I ' ea.. ALLEN ' 1 ' R 1 S L f A A I Suuweo ' f f ' 12: EA ,,,.. AKQNUEQQ o ,Q EARLY AN , 5 J .f i A5622 .uk Q 4 Te.. 'mass' f ' - 9 MH HE -,---- f . was G ,., if YooN6 Qvsnv QR 14 ', A ,. ' 5' ' ,Q LLRZLE meunm .,' - OBS NEVER Us 'I AMO' AMA5 . Af-IANA . M I5 f BCQULO ser emu: K- V.-' 6' A 56 5 Toaqi HERE ..- 1 :J 4: A N515 pc,5,,,6 secfm- , Us if A SNAP sun-r ATTACx-ANENT' FHS GRGAT QCEQLLSERVAUON K mmf OPEN SFACES Wu.L1e LEA ' ' A A QEARNIE RUBY Tai? ' . -f JETS T522 A TNS- . 4, BEFORE HE - , v Q' couho -W f, rA,.,4. f A3 if 1 ' 'Q X 9: BH-L r5:.eAm4ey I 14 A A A Xi if IN 1-HE DALE - . . u ,, OF CON ' Q' 9 I ' Wal Trfvrl-121111 ,A 1 5. 3 'X1eaf-ns Jaw-wwe X ' mu.sR 1 -,A Q X 1 fn f 1 : 5 Z Rlg3ELi:?fN5I4 p 1 ,- 'WA - ' ' . . Q , Leo uu ruR6Y L l ,. MWARO X 1' N fo N ?ffM'T A -X L' ' lx ezfonsuc 'E'l'2n ' 2 0 6 'I T HAROUIS 0. . K AA N 6 RSC .1 A a . ED .- ' L ' Rfsrwsy Rfffmfg , ,U 'l ' my LEG ,DC f FEGFAEEEN - LAPHAH r1Qr1uR11cE1 ,f I Page 0.118 ifilnrlzleff YTlm!y our PRATT AT .BEGINNING OF GLEE CLUB TRIP '1YVl1y the extra trunk, Fleliarty?,' Flea: Towels and soapf' if' W 'X' 96 BUG HOUSE FABLES At Fraternity House: 'AHave a cigarette fellows? Fine, Phil, meet my pal Al Truismf, Chorus of Brothers: No thanks, we don't Smoke. et a a+ VVell if it isnlt old Phil A.Iltll1'0lJlSt.H 'Well Sam Artian, good old Sam Aritan, how are you? fdxffxfx O CStarts on page 1281 Nov. LL-Blue Moon. CToo had it J did not die.j ! X K Nov. 5-C. P. S. at Tacoma. 7-6, for us. Nov. 11-C. of I. at Boise, 12-0, mf for them. Nov. 23-2641-Iorne Coming, and a good time! - ., l g, ff v N- x L, . i f xii: I 4 22212553 f 1 X J 'Q ' I it-fl 'J o ,X rf 2 J 5,113 ,+V ff, , tk? X XExf1l 'l 'AQf,ffg , ' M ' - ' :K E Q 'T 'I' 'V 1 :ZE ' A ' . ir, f --u i L3 Nov. 2fL-25-HPrince of Pilsenf' and the Floodf' ' QSee page 1341 v9i 't N AS SUNG BY .YAKE AND MAHCELLE THIS IS XVI-IY I-IE IS LYING UNDER THF, PEACEFUL SOD Jake: By gosh, Joe, I can't imagine what ails Mareelline. Friend: Wfhy, what's the matter? ' Jake: YVell I kissed her last night when she wasn't looking and-and- Friend : VVell? Jake: VVell she kept her eyes closed the rest of the evening. N -D? '55 N ' FROSH PRAYER Oh God, give me strength to get my lessons every day and if thou canst give me that much strength, give me enough not to worry about them. Page One I-l-wlidrafl Tlw'l'Ly-Lwo The First Glee Club Trip Before the days of VVOIIICH Sufferage, women, no matter how excellent- ly they could warble, were not even allowed to carry the trunks for the men composing the club. This was also before prohibition and the club was as ai body used to park its solo on the little rail and toast Johnny Barlcyr-orn with a flagron ,of nut hrown ale and this quite frequently. Wfomen were later installed as a fixture in the club to act as a reforming influennee rather than to aid much by singing. Nevertheless they are learning. Below is the personnel of the gang. Back row:-Geo. Marquis, our burser, nuff said, M. A. Kees, Sect. Chinese Y. M. C. A., San Francisco: Cecil Vifade, Lawyer, Bandon, Ore.: N. F. Cole, Pastor Cong. Church, Kennewick. ' Back center:-Arthur I-Iaverback, Stockton, Cal., M. D. Wfalters, Realtor, Los Angeles: Geo. St. Claire, Spanish Dent. University of Arizonag Carl I-Iaverbaek, hi eo. C Qlidlioiitz-Ed. Chittenden, Govt. employ, Seattle, Dr. Harry Task, Butte, Money C. A. Palmer, Realtor, Yakimag Geo. Eyre, deceased. Page One clretlWT'l1.i1't:n-t7zv'ee -. I -N is uma. fzvfqq. 4- .5 v A . X. . ., .. 2 4 X v Y Magi: 'sitio 925235.25 55' Erma-L.E5f3E5jD fc.,....,.1?P?Q 5. jg. 3.-Y X . vii S by I. .QQ S f5' F 52 P. W'i'ii-' fffmw, PENROSE JR'S LAVV OF 'CIGAR SMOKING .4 sl . 1 . I 1 .5- ,I The strength of a cigar varies inversely as the square of rts length. ki :. it C ' 4 Q. 2 -39 96 95 yr 5. z J I wt :fi ' ? 2. , . . Tl 5 The Y sa f that VV21Sl11I1 'ton threw a dollar across the Delaware River, but Q1 'g S: l if' 3 3 . ' 31 XL thats nothing for a fella who threw the English crown across the Atlantic. Vg gf 1 ,x, 95 94. 95 2 i P: 2 :Yi it 1. I i Terrible thing happened. I swallowed my collar button. ' ' Not so bad, at least you know where it is. X. L. . ae ee ec- ee Ii., .3 Y:-. 1 K Judge: Speeding, eh? How many times have you been before me? Q,,,,,,.,,g.- Speedy: Never, your honor. I' tried to pass you on the road once or E twice but my bus will only do 55. . Q ee ee as fp B. V. D's are the last thing in strip poker lf 7 hifi Zi-5 'mmf '55 225 ' is E w ,7 :' ,v,.. ack up to page I . 225 ' W N . , 'wa ' . . I . V1 p f DCC. 2-.fflll-ee dram atlc club 1 . fm ' fi 2' hfigffff ,f . 2 i .55 .55 Dec. 7-Cambridge debate about 3 a A Las -Q 't' i- .. ,. 2 l Efil . lvomen and who Won? 5 2 E55 S Jan- PW- S- C. at Pullman- 2 e if 19-12, for them. f 1 an 9 U of I at M0 S COW ' ' 1 ' ' ' 21:1 '4 5 ' f 1- ' - . 27-24 for them. gjfiznk . 3 - ,:'f2' 1.12-g' ' 3 j Jan. 10-Gonzaga U. at Spokane. E 43-27, f01' US- 3 C366 page BSD as famx-5:21 5 .9 ,E 51, if 44- TRY THIS ON YOUR SNOOZAPHON E 2 21: 13 There was a young gent from Havanah. if Q Got caught in the floods in Montana. .5 As he drifted away, 53 2 His sister, they say, 2 . . . C1 2 it , Accompanied lnm on the piano. 2 Q 33 il if E 4+ 'P+ W 99 S E 55 3: I ii . . 23 Y I 52 He worked in a marble quarry and he took a lot for gramte. -- ' Y . A?f4't??E '?g ..gf'f7f1w.. ,,.-- .T A X 4- if is gzzwfrrguwmerff if ffl-if-M '?' .-c5.'. -:fi gg.:-' 'WA 1- - -' f mf'-, 2 - --AC' 'ft ' 1.-.9 MMM..-'5 D ...Q -'ve-'i'e:n a-r B 5 ,-.g41.,7.f.,,,'.., .Ji pjmjf' 27.5 ,'l.::.y-gfsrmx ,I , I, A Y i --f..yj.,. 1' ,M H- U ,,Q,.,.WQ tlgzblmlifyf hgh ..nJg.3y.:..,., ,,kk a .2 L: 1-1 :-ga::-c-5 -zfzafetziffz 'asf-:':vssmzLz:fd2te:kQiZ1 h S5f5 1f49'ii N Xy..S.lf!'2 L: Ewmxaw:-xzsfazc.: zz-:-av.-ga., .-'az if Page One HU11fCZTEd Thirty-four 1:- tl ilk XX GG! Q Z6 NLM-F SAID SELDOIVI SAYS THE SAME THING Q TWICE g 100 ere ..,,,NwQ :F xgsxxxex X Q Q Xl T 'eh T, mexi- OC Nl P9 1, I DDU DU X 1 Q ' DACDAB -L 1IIl1'1. Awisr-I CRACK is AS sooo AS THE LAUGH ir cvoxes '1- xQl U K ---T -ld A-All ' V ,. ill -fm. iii tl-.ER X, , .-XT f- EFA A f Q55 . ini Q . i'-raft-i YS S -9-will F 11' Zeb A . I N- X Q-1. m- ,VIV X .K . I 1 N 1' A YE ,g .g.. ' ' 2 V 6.-. X. - N X if if K fi? 5 r5lMlfff.lwl 'Q' l , ' -J .Qil3qi?1fll.'f.i ' . - , 7 6 .xggylg , , . 1' P . 'I 311.1 - 1 Recalled the Next Century VVhen I make my million teaching school, I am going to hire some gen- ius to write the best book ever. The chapter headings will be the following 5 gems of suggestion spoken to me by members of the YVhitman faculty, or by I extra-wise students some time last century: 1- WVhat do you think ? -S. B. L. Penrose. 2- Good! -Otto A. Hauerback Qlet imagination tint with tone-colorj 3- To succeed in working his way through, a man must be willing not V only to do his part, but more than his part if necessary. FBenj amin H. Brown fstanding on steps of the new Memorial Buildingj. LL- Let's see, just how is that? -YV. D. Lyman. 51,4 Keep at it. If you can cross Ceasar's bridge, you can do anything in Latinf'-Helen Pepoon. 6-'WVell, I can't just say as to that. -H. H. Brode. 7- Looks as if a weeding out is about due in this class! -VV. A. B ratton. 8-if I always have my plans made Eve years ahead, but I'm ready to ' change at a momentls noticefi-Ross Brattain Cto a group of harvestersj. 9- WVhen you get stuck just say 'Gewesen', and go ahead. -eHeber Ryan Clast century limit withdrawnb. 10-HI-Iello I -Dorsey Hill. -Ca.l'0in C. Thomason. Rochester Institute of Technology. Page One H'uncZred T7zi'1'ty-five IF ACCEPTANCLZS WERE TRULY TRUE Mr. K. Adams regrets, that the fact that he let the flat iron burn a hole through the seats of tux pants, will make it impossible for him to accept the kind invitation of Phi Mu for dancing June 3rd. 95 94- :XL AL The lyuehing was beautifully executed. -E6 66 96 -X- He came home and called his wife a little angel. Quite pleased she asked him why he thought. so. Because, he said, you are always up in the air, and you are always harping on something, and you never have a thing to wear. Call for Doc. Lyman. -is 11- I'm in love and am loved. Happy? ' No, it isn't the same woman. 'X' 99 N 95 Generally speaking, women are generally Speaking. She was so philantropic that she took moth balls to the circus to feed the elephants so as to keep the moths out of their trunks. Wg E . .-.-fxfzf' QWQUM ,pf B , . V A VOTE FO GRADS QW 5 L ' x ,'!', Dust thou not remember ye good Ki., U' If KSN old daze when VVhitman used to win 'UV . l ball games with Karlson and Beck fl 17' H ' as batteries? The picture to the Ml lf, left shows three good reasons why Eglxfm these games were won. fDon't D ' Fx' A consider the purp as a reasonj of s ry! f.-I ff '- fliggaty hu 'null -I ll: -zz 53,1 i In 'XT-if fllmy' JN-ylfffw Page O-ne Hu71Cl7'6lZ Tlzirty-Situ 'NOTA za L E 5 in 5-M-,f E L E M i 4 i 2 I ON-iDRES'.f i L ii g. ii .zz 1 . v -i ff 5 ,. 4,1-.L ,I W. W 1 N -' ' 'X 'JV' 1. E Cl..2z6 W ' . ow? Bama-Y 61- - e II . - . . --.,,Qj48R7 E7'f. .il CBacli up to page 130D '9Z351St3lItS toward library with resolution to study hard till chapel time. 9:40-In library, and talks sweet nothing with Buela Bunnyhug. l 10:00-Chapel-Talks with friends and tries to find out who the chapel monitor is. 10:15-Sings the wrong hymn, but is oblivious of the error. 10:20-Dashes out front steps badly in need of a smoke. Bums cig- it arette from brother Bungwhisteler and swaps stories with the smoke gang. f 10:25-10:35-Says I-li! to 67 students and Coeds. 10:30-No class, so feeling hungry, adjourns to Midway, first bor- rowing 10 cents from brother Mulligan. ' 10,:1LO-11.30-Chews the fat with friends, bums smokes, kids waitress, Q.: plays phonograph, and creates general commotion in Midway. CNOW turn over the pagej Page L - - -A.-'f 4: -'NTT 'wives E224 xFa'f'-13:5-:1'AqK:fN7-raw -N ,,,. - . ..X.x .1 - .-Q., . 4 P 1 1 fl 1' 1-fs ' we -- 'elf we .Af S ,-f :ce '-:-:1:f: 792-C' -1-za: sw I :D 15 . 4 ...cg-3 5:,:::5- L'-:GS L-if: Q-'Ip :gc-rv, ':,:::9 -1-.-2-:n - -5 7 . -8 pi---'-3 ,g.3.:.:: 55:33 xv-Q:-, -Q:-::::, gm? .:::::::: E H: L X f - -.-xv 1.1: ,.-.-,-1 t-'-::-I er Sr.-a Nay lr - 1. my 94:22 We .6 vez Tiff? 5z.a..i:f3i:.' :E 6 1 N -fmm-11.4 :mi .GM--rags 21525: Kfffilffi - K f H:-Iv. 51:54. .Y-1.3 I .-' 3..v., 3:54-v ,f::,:g.- V, 1- Ig ' 5 M: 1 -1- sg-:-:pi czozlx- 3 '-.Q QS: ,-:Wax :-fi:-1 .N-:vs Y '--:9..':fx 3.11-..1:.+r ll Jan. 27-25, Jan. . 37-26, Jan 57-27, Jan. for us. 1 QBack up to page 12-U. of WV. at Seattle. for them. 111-O. S. C. at Corvallis. for us. 17-Pacific at Forest Grove, for us. 26-VV. S. C. at VValla WVal- la. 112-21, for us. Feb. 1 and 2-College of Puget Sound. 119-19 and 55-27, for us. Feb. 6-U. of I. 112-31, for us. Feb. 10-11-VVillamette. 39-20, f'l'urn to page 11165 C'l'urn back one pagej 11 :31-Remembers he has a class at 11 :30. Bums a ride to Memorial Hall and goes to class. 11 :ILO-Another test. Does a lot of head scratching, scribbling and bluffing. lntermittently gazes at ceiling and writes on paper. 11 A0-12:30-Continues bluff and previous action. 12:30-Leaves class room, Qand booksj feeling very hungry and kinda sick. 12:35-1lVonders how hard he would have to Work to make Phi Beta Q kappa. 1211.0-Decides he cloesn't like that fraternity anyway and gives up iclea of making it until later. 12:-15-1:20-Smokes and sings songs at table. 1 :20-Bawls out freshmen for poor grades and spats two frosh on the general principles. p 1 :30-Goes to the library with brothers. 1:35-At library, realizes that he left books in 11 :30 class room. Goes to get them. ' QGlanee across at page 139D X, -Q-www-vp? -,.--rftzfwx P.---Tb eqzqsi-:.m-.1-le-mpg 1 ., zrgrfgwx v BYQIE R-'12, 2511, ,gfgcf f -a.z::s-:sg-ceSe:z,q.::,i:':,-xo::-:-1-siesizs-:: . 7 , Q fjgfiwt-1619231 'J 1'-pf l9.fif112:Z','!.3 ,Z v. 'L f fi, :V ,il , , , N... U ., ,bs - se-s,..,,-Z.-I -3? f-5.1 -qt. H ....,,.Q.,,-IM, . , ' - ' 4 X - LL. P '17 . JZ' 3 .53 1 ' I u ,I-. A . , w I I 4 I, :,,..,.-,V QK,fQ.m4.1p S.: , .,,..,.,,...T....y...-.. 2 . W... - V :mf--f 1:22 ---:-:-sz-.-1-1w2.:::2-:JH2.-. 1Qs.f.'.-.Vrf-:Z-.5 - Page One Hmzdrecl Tlzirty-eiiglzt , . . 1 o 6- ,X fc 7? 9 1. N 1 4 X. il .1 X 5,1 15 Q.. 5. ,S 5:0 6. .1 if -, v E: EN. ve: QE s. 2 E -w 1 4 14: 1 :ms A: :af L..,1f2:5-:':': ::Qzm:f,.,g :g,eg.v1:-so:.-,:.w:.ui1:f:-:4-M fs. THE HEIGHT . .- 1 1 of - 11 , or DESCENTH 3 ' file r 4 -35-11 l as ' 1' 4 ir: ' ' f ff2ax0'4 , if tr 9 0 tt f .j 4 ,I 1' r-- .5 fault ' ' 1' l '.'!ml1 J .- 4 I . - ,- 4 1 fa: -.1 - - 1-sf- L f ,. '-. at .--- - - fm i .f'f . lf- f ? . .1---vw! ..f -' - 'va-QQ: 0' I If 1 ,nygrlifgl 'fl , ,if f '- am?-f. f f C 2 f'Hfj'lM' I l ' ' ' ' 4, 5 'W' - I - 1 f -, P ' 5. ff:' 4 'ii. ' You CAN . 1 fi, 0 ,Er xy, .fQ4.1,i . it , READILY M -E x i I' 1 W ll Xl! SEE W5 'llltllfll tuiuul THE W 0 COLLEQE PHASE '- lilhlts- IS mv cuss DAILY QSee 138, etc., firstj 1:-LO-Bursts violently into class room and finds a class in Ancient T Poetry. Turns red and stumbles out of room. 1:45-Again looks for mail, reads bulletin board annd decides he can't study without books, so adjourns home. 2:00-Plays catch with brothers at fraternity house till 2:30. 2:30-Goes out for track. Runs around and gets a pain in his side ' so retires to shower room. 2:55-Rides around town in brother Murphey's yaller Ford. Picks up girl friend and goes for a long ride. 3 220-Bl0XK'0Llt in left rear tire, twenty miles from school. 3 130-Discovers that there is no spare tire or patching fluid. Rolls car V to side of road and rides with girl to town on a road grader. 6:30-Apologizes to girl friend for hard luck, escorts her home and re- tires to dining hall. Eats hearty meal and reclines in easy chair for a smoke, contemplating the strenuous day spent. 6:45-'Receives telegram from home folks, advising him to come home. 4 6:55-Packs trunk, wondering, what it's all about. 7:05-Bids goodbye to brothers, promises to pay all debts next week and leaves on the 7:15 train. i V QThasallj Qeggs-iffi A Page Owe Iluvzclrgcl Thirty.-nine NEXVS ITEMS Oli' 1939 Mrs. Daniel Gaiser, formerly Miss Dorothy Hull of Hood River, Hled . divorce proceedings in justice court today against her husband, Daniel Gais- er, on the grounds that he consistently brought visitors home for supper without first calling her up. Mrs. Bob Garrett, known to her college friends as Miss Catherine Og- den of Boise, joined her husband on his vacation to the! Milton, Oregon, . Banana Festival today. They will both rest for a week, and then will re- turn to VValla Wlalla where Mr. Garrett is employed in the Vllalla Walla Amalgated Short Snap Biscuit, Cracker, and Frazzled Wlheat Company. , . B ' 1 ,aa 9 -5,33 kj: 'L' ff -'-Qtr iff' r 'I ,ly , , g f' AN xi- 7X' x fi' X 5 ,l .EE K KA 'I To the left we find Wfhitmanls Five Fizzical Failures in 1939. Up- per left: Beverly Means as a perfect model for Fogelquist's corsets. Cen- ter: Thelma Shepherd as the fat gal in ,l'i21l'I'lLll11lS four ring show. Lower right: Mildred Vllilliams, plump lit- tle physical ed teacher at Dixie high. Lower left: Jan Van der Vate, leading song and dance man in Ack- erman-Harris latest hit, lVl1at Price Gloria? Upper right: Paul Anderson as Mr. Wlu. Miss Betty Daughters and Mr. Harold Fleharty of Wlhitman College announce a trial marriage which occurred August, 1927. They report a very satisfactory union and say that if everything goes well they will get ' hooked up for good. Mr. Stephen B. L. Penrose, Jr. has opened negotiations with the Hap- py Home Matrimonial Bureau this week, Mr. Ben Goodman has applied for a writ of mandamus, ordering his wife to quit buying dinosaur eggs, simply because they are cute, and the 1 payments! are far apart. Page One Hfzcml-7'ed Iilorty -1 CSee page 11140 firstj Mr. Judd Kimball, Mr. Don Rennewanz, and Mr. Bob Myers have established a batchelors club. Mr. John Forsyth, Mr. Ray Forquer, Mr. . Carlyle Roberts, Mr. Tom Amos., Mr. Keister Love Adams, and Mr. Bern- ard Molohon are applying for membership. Mr. Floyd Barton and wife have opened up a. brand new Bowling al- ley with a sody pop stand in conexshun. Mr. and Mrs. Tom Leake motorplaned over to the Dixie Orange Festi- val yesterday, where Mr. Leake, prominent inventor, will put into operation his Leake and Co. orange extractor. Mr. Don Peter and Mr. VVorth Oswald have opened up the Peerless e Shine Parlors in this city. Mrs. Lyle Prickett, formerly Miss Hildegarde Patterson, announces that she will hereafter not be responsible for gambling debts contracted by her husband. QMore on next pagej Page One II'Llf'llfI7'0fZ Fnrly-one -.-v vs.-M qv.-. sex: -wer: -wo:-vi . N 'kzggizi P 5.5 ff7'1:f1ERE:S:-E 113, ,sc ?, , 25: C .,,. CSee 1410 and 1411 firstl , Mrs. James Clark is suino' Miss Helen Bullock for alienation of her D husband's affections, according to papers filed with Judge Tuffy Ellis. Mr. and Mrs. YVilbur Eckart have rented the S. S. Leviathan for the . summer, in expectation of taking the family for a vacation to Vancouver, B. C., where Mr. Eckart has important business. Mrs. Hank Taylor filed divorce proceedings in court today, against her husband on the grounds that he usese her tooth brush to shine his shoes. Mr. and Mrs. Pat Joyce left today for Arabia where Reverend Joyce will lecture on the evils of extensive footracing. The Literary Guild recommends their latest book, Bottled Trouble, by Mr. Charles Esser, illustrations by Richards. Mr. and hfrs. Alex Bell are now teaching in Timbucktoo. hfrs. Showalter Lynch filed in justice court today proceedings against her husband on the grounds that he loses all her money at the pool and ping-pong club. The regular Monday night sewing club will hold its regular Tuesday meeting on Friday instead of Sunday, at the home of Mr. and Mrs. Pete Meckelson, to discuss what color to whitewash the fence around the prune cannery. . Qlt stops herej F My nmol ? TAKI MI' W fl , www ws L' Doc, CModern Surgeonj-Hows ithat patient with the mule gland op- eration this morning? S Nurse-Not so well, Doctor, he ff, kicked himself unconscious last '21-YM sf gi . ,J Ni - ' J A .. ,E .3 E ll: .5 , EJ -'ff 1 . 1 nywkg g W nf. 'I If . , ' t I night. 7'4gs,.La '- ' 1 .1 i s '1.K'l.f: ' 7 X 1 r I x X X vs'-L' D WNW wrzvffiwffs-nazi: gc . , ,, fp-:vm f ? iff 'QQ 2 fs - ' fe ai .: .3 3 , -3:1 . f . - - IC f, ., ,-5 -1 4.21 ' , , . --ar'-fnfi...,.,f ' 1 ..,.-, sf 2,5 f .mu ., .. ..,. ,-1.a.f..wr,....--We-. os f --Av. ,, ,i .at--. V..f.4.s,.v..e,..t...,m . A.. .M - - ,arf ' Prrgc One Ilumlrecl Forly-Iwo I S IHIISTICZIITED ISAIMI IW HIS COLLEGE CAREER TURNS OUT T0 BE A ELOE BY DON PETER I 4 le -I J . . I., it E I . 'Z , 'FTW I I LII WELL NICK, AT LAST I'I I GOING TO comes: T0 FINISH HY EDUCATION So I cmv ear A sooo Joe. I'I I LEAVING Tonofmow X , maxi. I- Ars.. COLLEGE IS A GREAT' SEEN THERE. I L PLACE sm I mow, we E . . G. if eg 'ANU WILL YOU STUDY HARD AND 6000 BOY? WRITE TU NE EVERY DAM BE A SAVIHY, AND come HOME T0 see me AS AS You CAN. I'LL M155 You A OFYEN LOT 5Ar'II 'IY DEAR, II1 GOING T0 COLLEGE MAKE GOOD AT ANY COST I SURELY UILLIHONEY ' TO '-U ha LLUL XWNWITIVWV I f 'KV:IWIr1l j5!III!IxI'NI - I- I--.qIII I .II 'a ff IIIKII GMX, ff UIII qw Q .I I I I M IM THE'FIRS DAY ON THECAMPU5 5 9 A f I f f I III', ,' 'Be 'N 45' 1: Q xp -1 'B 4412 I 0 Ra GQ if mg 'ifq E Q, T it v ' m Y I ,,- I 4. fwfyw .R nag. I , .it-A Img?-I r .c Le, 2115 + af +4 if , II-,I 5 I Lf, - - ,x ,QRZWF a2'CEf'+'Lcf X f EEN G! I I NTI' Ng El k ? sae, 'L ,gh 1.9 00,1 my V riwgiff' qw V, ' ' X5-NQ77 ,W -5 9,5 'QLD , fy vaio 'gps Ydmsli-ss av f If I If ff' 7' 'Cock I 2 -I -I f uf S5 i rw me If '16 , ew -X I I QL Gp I 'Y T' Mfg 0424 ,IN WING , ff! fx 104, ,I N L, Q' 'W' -1,.W If I wg Q . IIIIIIII Qfskfos? '7' i ,I 2 V' K '-'V S IW' Q3 ix is 23:9 V V' I i, ,i I,f5'g,p I:g,:3II,Txx X-Y i 5 5 , . -x Q 3 1 I-L E IMI' QE Im - ' :Kg W I A . 1 . ' 5 f fm A - - :L fr, NN. mlm xiii? .uf MMA N 1- 'IU 1,1 . 'IEHIQ f'71f7'g :f'2I'? K f' f Y mc 0.6 Nor. rwmur MIIIMI- eg, M, FFL' A: X I I 6,9y!,y,lI Z L E E ' QQAIEYLE ,.A.,,. . ...Q . I I 2 I I I IL W of I ff? Iii ff 'f E ,,. I, f xx i f 'ITL ' W IDM, 2 AIZZEGQ ' Ei f Deans . ,-' - -'V' ' NEI 1i 1E?' - - 1- - ' I . faf.2.1Q,,, I, J Ib-H Q5 ' Ll J-I .- 'E - ,L , N Oodfz' -r xy! U ef3f ' iq A Wpv fn 3? f.-- ' Il 'T 1 In N0 -:Sf ,411 If ,,. N ' I ,. wifi? , if I , , I I 'N ,.,5S.Y5f.f.Ff 4155: M: R ?-ITN II ' V -N WK: uw -J-'14 ,J'.:.'-1 ,Q ,Qu , F51-IA.-I'fj1519vI 1 i - -f.- ,y .sz I, DYNANTS 411-P :3 my XIII: - IffW 7 12 - 5' Y.. 'VIII' 513233 ' y' ' , . E ,.II N 1, Z 125125-Q ' I NEXT MORNINS - - - ,MII K IIIII- .ff V Qiffiflwif QW' 2 .f II ,ff a ww i s WERE Paoun OF oua DEAR 5oIII. 64 gg 5 '4F,M ww Si: me I I'iJ?J5IHIfi!ZJl'FTS' fI gf I, V, L f 51-,H-,. V J 47 I 0 If A AMIIIIIIII f was ,J M 0 ,, fi 'I - rpg . II If 2 0 Q ff , 2 I un, M .I .II .nf J M, Q X I Q ' AMIQIL., .fltgmr g AN E ii, if K j y , - Annilh-. 'F Q- I In QQ ' My f' C NEI ll ISS? ZZ'fS1'.IIEQ3',TZi ai. ' 3527 , 'W ferday. He intends 10 nw dl 'lj If'-L' I mx, g1ar12?Ii:Ines5 here R 5 'Hiiifv - A, -I I -mme mel. , - - , I. , m .,. IQ I, C 11 21 .IRAQ 'P W 'I mg I mn. K, - 1 IIIIIIIIIIIIII 5' 'II frail! .5 . DON U55 ,'r'?'A P11110 One jjI'IlIlElI'bfZL vlwllffu llnw XVI LD NVE ST Hotel Clerk: How did you get in here? Hard Egg: .Iust blew in from Montana with a bunch of cattle. Hotel Clerk: Wlell, where are the rest of them? Hard At the stock yards. I ain'd as particular as they. N it 45 5? PUTTING HIM ON Hlllhich do you recommend-the fried eggs or the omelet? The fried aigs is a month old, so ye'd better take a omelet. They ainit ' no in thatfy ' THE LIMIT She: Wlell, if I frive you just one kiss will vou Jromise never to ask for I P U . . . l anot ier one. I-Ie: You should know more about your kisses than I do. f l' wx I, . V A , jeep ' JQQMV5 wi ey' -i . ' f , - law M y p W SN 'I 6- 5' X' ' I R+ An early glimpse of little Chet !fQ4',k,x - Maxey, showing how he got to hat- ! Q ty Xxx llQlli'i,ififf ing his teachers, and got off on the ' li , f 1- - K' ' . . vt X X , I V K, wrong loot for Phi Bate. - EU N ' ll .' I 5 I ly' fl at 7 i l f i V l I ' lflizpwi' lf I-I IC-VI LLE TRAFFIC lst Hic: Look out, you nearly drove into that lamp post. 2nd Hic: I thought you were driving. SEVERE . . . . . . . and after waiting two hours I broke the date with her.', ae -ie a Dear R-Ir. Joke Editor z- .... .. Bly dad is a second story man, my mother is a chorus girl and I am a Phi llcta Kappa, so you see I have never had a chance to do anything really bad. I have often wished to become lawless like the other big men of the campus. Could you please tell me the correct procedure? -Hard Harted Harold Dear Harold :- IYC suggest parking your car near a fire hydrant. - Editor Puvyc Ollie Hrtcnflrnrl I7orly-foul' A x 1 ' Q L 5:5 Qi . 1 if .f ws ' 1 'Ll-Yer' 7:-:-'J-,y J '-'-'ig Vs-2: MY' 1923 3'Sg2':gv1g 5' 'gjfr :I-If ,, fy 4.1.-'il Ima-, ,A .x my 1'w - iv' tes fawf., r1:i1tfSsf1?5- , .. . ' I. op,-11-,gf-ie.-,.4., sy . w f-Z V, 1 , VII ,,:1tiff.,.s1:wy3, V f - y . V, , ,V V, V ' i - ' Q eel. -... V Q ' fflt T- w I '.:.2'.fi-P E2 55 4. .- ., i' . V 'gif Q 9 x, f.g...,s - .ef-X 0 ,. ,,.:.,f ,.-.,--.e,1-- M ,, -:ff--.,, .-.-fi.:-2 , 'fu-sf if--133, :sy , .r- N, , -'-' :A .X ,f:.'g-'3:24es5,,s,,51::V V-l:VV:.H:i ' '. umm. .A I , 1 z ,A '--', '- - '2 ' M . .,.,. ..,,. . , .... sw ,, c A,,,, l V A - lf,-,, .-,..-..,..u,,. 03:1 -1-fv , ll! fi1:5f.:?:1af.'.i::2411.31 we ' -iw' - .. 11-A -f Tftl.,.11..':-::,:v.: ii'3' ' -- , 11: ri ff2'f'2., ' , 1- 'EY Yfffiiim., .r'f:I,'f- g5f3,,:,:.y5'1 W' 1-Ev 7' 'EE-'I ' , ' .. f riffs:-:aff J ' 1 -V i. V 5 g.,. .V ,. ,... . ii, -eezilgi 33555222 ' - QB 7 f . 'P fix. LM-ifafizws' 'fn i 4 wifi' -. f s l . u fi - :.ae4e1?ifQ?4'fff 0P'ff2f'V4!'5Tf'fa fiff1i l 5 1 ' fs '- ' 1 ,fge y --W . -1, . I -gif? A' .5:e'5?-- Qi-'fxuC1?g5ffQfB-S1555-fezfsi' ,if . , H E . , t L , h a . L fi.54T:V1f.,,,,,gfgE,,gg5',ex'1LVhgymtwtkgxf V VV N wl rfeii ' ' i1'?bz.f-swf's?,'5fZe4i21'f9M'7 f Z 'V i - so v Vs'-fi-'V ' . ' A L 1.5 M., .L N ' '-L'f:': ..:,. V Qi 'J A ' , ' I ' A 1- ' j P P INSIDE' .fir 5 If , W . .O u,T.S 1.05, The Come Bach Pete and Bill were interested in the same girl. Pete had a date with Molly on one certain day and decided to take her to the big hotel and stake her to a big feed and dance. The two boys had long been rivals for Molly's attentions, but Pete on this evening resolved to show her a better time than Bill possibly could. The evening drew on, and during the course of the day, Bill found out that Molly was to be entertained by Pete in this most royal manner, and in this most voluptious and extravagant hotel. He set his brain to working and resolved to not to be outdone by his rival. He put on his tuxedo, prepared himself in a most meticulous manner and set out for the hotel, early, with the intention of securing a table near his rival and his girl, where he could dine in truly exquisite and Kingly fashion, in- eidently giving himself the opportunity of watching the couple through the tail of his eye. Bill realized that they would have to pass the head waiter's desk before entering the dining hall so he stood at attention by the table until his friends should appear. Before long Pete and Molly, arm in arm, gaily entered the hotel, dotfed wraps on the arms of the butler and proceeded toward the din- ing room. Pete's eye encountered Bill standing by the head waiter's table, Wisliing to play a joke on his old rival he tool-: Mollyis arm and they advanced toward him. As they reached Bill, Pete politely asked, in a manner indicating that he was utterly oblivious of the other's identity, Pardon me, but are you the head waiter here? Bill, slightly taken off his balance by so sarcastic and presumptious an onslaught gathered his wits together and replied. No,-Oh er no, Iim not, but I heard him talking a while ago and he said he didn't need any extra helpf, Call for Dr. Lyman! V 1y:3KQl,4fC'-S75o?2ir-' 'PMP , l:g.14.-3 Rf 'F ff Z-26' Ai- 'si C A' t '.ia:f-:ii-a.:+1fa:- 9 r.-,Q gh. -, -' ,-F., ,. 5 ,I in , --.l,.e,.,M,.gf l , -. ,gp gig:-.1,?pcs:ta,lt.1 ,,'.,V1i' 'Qa:,,Qu5V,j, 5-':xr:.m:iiV .D-VW: L V 1. ,Q . ' .is '43 2' 1 .ggi , 2. ,A ' ,fl 1 ' we f Vw V V ' .- 'v I . Z5 - , . - . , 1 '-,aafsrfi 3 22142 71 Qi'-af:. ,.1a.r:if.-7, H:-:v,::2 fri, - Page Ovw J1'lL'll-flfdll For I y 1110 A TRAGEDY IN ONE ACT Scene: Dirt road, 50 miles from nowhere. Time: Eastern standard. Dramatis Personae: Hubby, Wlifey, Little Bobby, and a balky Rolls Royce. Hubby Ctruthfully for oncej: Hell! Out of gas. VVifey fdespairinglyj: Oh, dear, what shall we do? Little Bobby: Don't let him kid you, mother. He said the same thing just before Nurse started to walk home yesterday. 1,155 N fgxx-1.. ' fail' CBacl'u to ao' 138D Q1 dj 4-yj.,--L: X P P se Feb. 13-U. of VV. 45-33, for us. Feb. 16-U. of O. 29-28, for them Feb. 18-Gonzaga, 37-19, for us. Feb. 26-O. S. C. 39-27, for us. Jan. G-Lecture on the Park by Mrs. Hoskins. Jan. 20-Phi Beta Kappa senior election, ffor women.j Jan. 30-31-Miss McDonald's music lectures. 7 Feb. 2-Wfillamette Glee Club. Feb. 15-Idaho U. debate. Feb. 17-March 1-Y. YV. C. A. Leadership Course. I March 2- Trelawney of the ' tix, 5 'Wcllsn and ? F F 5 W, ,. Hi . .V-M-Sllmflil ll--V QA.. Vw' ' -- CLXI01-C on Pagg 14.93 TODAY AND YESTERDAY . Jones, a gloomy individual decided to turn over a new leaf. He went home whistling, kissed his wife and the kids, then proceeded to shave and clean up for dinner. Wfhen the meal was over, he insisted on washing the dishes and sang lustily as his wife looked on in amasement. The job finish- ed, he took off his kitchen apron and found his better half in tears. YVhy, what is the matter, my dear?,' he asked. Oh! everything has gone wrong todayf' she said. The clothes line broke and lct the washing down in the dirt. The twins got into a fight at school and came home with black eyes. lN'l'ary fell down and tore her dress and, to cap the climax, you came home drunk. M -X- AL 9? Kenny: Yes, live always considered Anna Lou a perfect beauty and ,a nice girl to boot. She: HYou ought to be ashamed of yourself. . ' -. ' i 'T Priya Ollfki I'I'LlfllCl7'0lZ Forty-sin: -X Y' LJ I ali O ' ' My h A mx . , QW1, 'f' '-QQ Lf, AR I fy i Wi QL Charlie, The Middle-Mule, Noah VVe were going to give Chuck and Noah a big spiei, but when we went ' to interview them we decided to leave the rest of the page white, as a syrn- g' boi of the purity of their intentions. Page One 1?f1m1rh'erl F'0rl-y-xarml, TI-IA'I S JONES Prof. I: Is Jones a brilliant student? Prof. II: Say, he can't even answer where , without lying. TAXING HIS CAPACITY Fresh fto genial gentleman with whom he has walked up the hillj: What are you? I'm a professor of economics. Professor, eh? Ever walk with one foot in the gutter ? f.N0',y Ever make a mistake and hang yourself on a hook? No fr 1. 1: n Ever 'throw yourself down a clothes ehute?', UNO ,, cz Youire a hell of a professorf, ? F ? ? ? IVha't is a pessimist?', A man who wonft milk a cow because he is afraid the milk's already ' Sourf' Q Bobbie Osgood and his gal in the good -old days, settling a hot argu- ment over the question: Did Esau sell his airship to Jacob for a pot of beans and were they of the Heinz or Van Camp variety? I DON I' hIy parent's told me not to smoke, I don't. Or listen to a naughty joke, I don't. They make it plain I must not wink At pretty girls or even think About intoxicating drinkg I don't. I kiss no girls, not even oneg I do not know how it is doneg You wouldrft think I have much fung I don't. -Dedicated to Charlie Esser. Dr. Parsons: VVavne what is a vacuum? . J VVayne VVarwick: !'I've got it in my head, but I just can't explain it. .. . V, Page One H'u,ncZ'1'ezl Fo1'Ly-eight 5-:gif 55 55, '355315 '-315 at X ,il F, .. . E ,,..g:,L,h QEQEEQ .A- . 5:55:33 i .fl . 1.1. , M -rsh 11:5-1-' if Q H :1-j:5:w 'Y '.x:gg. vigil! 53, gh..-W f , fi-1+ lf:-I H if Q 'f' Q I , ., ,,,. ,... mf,-a1,ggg3f5:,.s-V: 'L f j---35: :rj-5 5 Mr' X ' I 2 'i9RfQ55f5f:-xr' if ' Q'I'urn back to page MGD 2 ggg-:ig-5552315-gfrj' ,lf si-hj.i-..:.T-.--jgif . March 11-Initial appearance of i- Q. I ja? Elle Czlec rClub. I K-. Mig :fp p April 0-Debate with Pullman. X .I -ar, -N-W . -ygzs ' A' f:'fM'r .,-,mai - ' . , i April 9-Phi Beta Kappa Junior fflection- CMOSHY for Women, of y co u rsej .::,.,x.Q April 12-Student Body lnlcc- tions f01' group- . 1,3 April 17-WVomen's League Elec- ' . 7 N V 1 tions. W i April 27-Spanish Vaudeville. ' r I May it Faculty Play' of bday 8-Choral Contest. 7 I , V fThat s all to datej , :favs-ff.--. :rv-s -v . -fr '-f' ,- . ' :fry-, ' f .. Boss: Now come along and Iillteach von how to milk the cow Binx: Seem, I'm new to it, hadn't I better learn on the calf?,' 96- 96 -36 96 4 The other day Art Jones dashed in to the N. P. just in time to catch the gas buggy. He made the ticket window in a series of slides, skids, and jerks. 7 Quick! Give me a round trip ticketli' 1 WVhere to ? B-b-ack here, you d- ' M- 96 '36 'X- t'Did he get over that 'puppy love, affair? No, and he's led a dog's life ever since. 96 Ei' 95 66 Isn't that your roommate over there kidding that colored dame? 'I f'Oh, M' gosh. I just knew he'd make a fool of himself if he ever went '52 out alone. He's color blind, ya know. 96 it 'X' 'Yr ff American in London fliftinv' 0'0od-sized l apple you have? D D me onj: Is this the largest London Fruit Vender: Put down that blooming grape. 2 96 91' 94' 95 THE MAIDEN'S PRAYER . Dear Lord, I ask nothing for myself, but please give mother a son-in-law. I ,W-t.,:.: pfzgzffa X ., ,,. My eg--else:-:rw ff. 1 .1 V5 j,IQ'1., Vg-I .3c::1', ish' , V f ,, c. .s.fmi.:.,J.f 1: :pdf 5115 5-'af fam, 53: :Q-Q-rwrwvqw-'-1 M'--1' - A GI -F.'-ilwrrfivi? I' i5lf.Tff'i5f'1qs tf2'r'iif'Q ' 'iff' 2 -:fi-ff Q . .Q .5:,g,,2,.g.,zzi ai 3' 5 Lumix 1 , . . lil- ff fl ik 1 . . . 1 , X mm 4- 55 -, - - f , ,L ' . -f t ' 1' ff 4' t, . .... 'I 1......r.rL:1-a,-, f 'a 'rw' X ' Page dialed' 1211-cirracly y-11 NOT GUILTY Magistrate Cseverelyj: The idea of a man of your size beating a poor . weak woman like that. Prisoner: But, your worship, she keeps irritating me all the time. How does she irritate you F VVhy, she keeps saying, 'Hit me! Beat mel Just hit me once and I'll have QQ you hauled up before that bald-headed old reprobate of a magistrate, and fi: see what he'll do to you'. - 95 X- 'X' -if- If she sighs with half closed eyes ' The while her hand you press, Don't think she fell, you never can tell. It may be biliousness. 95 it '55 ii- Doctor: I donlt like your heart action. You have had some trouble with agina pectorisf' Bob Myers: Yeah-but that isn't her name. 40223322 lygowf Filla Mupp, one of the pledges Q 6'0 6'E X-Lung, ,K over at our lodge, says his idea of Ta V' really hard luck is to stay up all iff?-:E night making out a crib sheet, and VV then hnd out when takino' the quia 1 f that he had learned the Dthing so gig well that he didnlt need the Siieet. ' '15-Af - -Coll H- '. llll a I egg umm HAPPY MEDIUM George: Boss, dat quart er likker you gib me was jest right. Boss: How do you mean, just right? George: Ah mean if it was any better you wouldntt of gib it to me, and r if it was any worse, I wouldn't of drunk it. it 96 N' -IG NOT PROBABLE Civic Manager Cgiving rules to college graduate accepted for position of driver on the city garbage wagonj: Now remember, you ain't to be a-eatin, all the time, either. THE ULTIMATE b How's your radio?,' Fine, wonderful! Last night I got a quartet and tuned out the second tenor. -59 -56 96 M POINT OF INTEREST Tourist's Guide: Wfe are now passing the oldest rum house in England. Tourist: VVhy? Page One Hunrlred Fifty . .f g :fix I F in T, me e . TQ X,-fl K I '-.5-1,1 I V fm isa .K fl? ill 6 9 . .-- 'I . - W ' p . -:EH If I I r ess. . W f E we GREAT MAN ALL I OFTEN 05 - mow WE E -O ev-llflsllld-'eil ae 170 ia 1: STUCK Sir-that bill is counterlit. Wfcll-isn't that a hell of a note. TO RRR IS HUMAN 'iIVi1I you marry me in spite of my trouble?l' What is it F Falling hair. You darling boy! To how much? A P TLY P U T M. C. B.: I'll bet you are ust crazy to kiss me. C. BI.: I'd have to be. SHORT STORY One of Irving Cobb's best stories concerns an appraiser who was sent to j a home to appraise the contents. The entries in the appraiserls book halted when he came to a table on which was left a full bottle of old Scotch, and then continued: One bottle of old Scotch whisky partly full. The next entry NV3.SZ One revolving Turkish rugf, SO DID WE Yvonne: W7hat would you do if you had five dates with a man, and he 17 never attempted to kiss you? Paulette: I'd lie about it. TO THE LETTER Judge: YVhat's the charge? Cop: Impersonating an ofHeer, your Honor, he took a couple of bananas . from a fruit stand. DOWN AND OUT Maw: Hey, VVilliarn, get your father's hat out of thet mud hole. Son: I can't maw, he's got it strapped under his chin. - ' 'ea . , . Page One Hundreml Fifty-one AW7! Hubby: YVhat's good for my wifes fallen arches? Doc: Rubber heels. Hubby: VVhat'll I rub 'em with? N 'X' 96 16 SELF DEFENSE A small, nervous student walked into the grocery store. 'KI want all the rotten eggs you have, he demanded. W'hat do you Want with stale eggs F asked the clerk, hear Fleharty speak at the contest tonight? S-ss-sh,l' hissed the buyer nervously, 'Tm Flehartyf' if 96 96 if are you going to .Iack Shea: l'Vould you like to take-a nice walk? Lola Stone: Wfhy I'd love to. Jack: Wfell, don't let me detain you. ,f , ft fl' U, -I x zf, ,H Here 1S our own Russell Blanken- l 5' sl1ip's ancestors, pleasantly Qyes, ,V yes, go onj settling the question as X to which will have the most influence on his ambition, to call him Russell V f'rg,P,5, - Reginald or Reginald Russell. .9 Q ef ff I l DEEK Obadiah: Brown got kicked out of school this morning for cheating in an astronomy exam. Joshua: VVl1at was he doing, copying from the fellow in front of him? Obadiah: Naw, the professor caught him bumping his head against the wall. -ie x- ee ee The oldest joke is submitted in the form of the shortest poem ever com- posed, entitled Fleasf' The poem follows :- Adam had 'emf' Mrs Clancy, yer child is badly spoiled. Gwan wid yez V' 'WVell if you don't believe me, come and see what the steam roller did to itf' LOVE IS BLIND She Cafter a quarrelj: Leave this house. I never want to see you again. Go this instant. He: I have one last request to make before I go. She Qsweetly, oh, very sweetlyj: WVel1, what is it? He Cabruptly and brutallyj: Before I leave for ever, would you mind getting off my lap? Page Owe Hundrezl Fifty-two .Vg w,,. I FORARY y giusrlsabfzsas ,!' ' -. f i?E 5354? Irv I I Y' f ' , WV..,,EQQ 7 iff? 121'--25 .-RLS, . - z.. 'av-A f'1f 5 , , .. .5 , ,T - '5f,.'i. . ' 5 'N -' .. H Pzimvasss EDITOR or wAffz.VA1'P24,.. f V CRACHA-:L. lWAz.1.amQ el YVAIT A WVHILE Hall Boy: De man in room seben has done hang hisself! Hotel Clerk: Hangedliixnself? Did you cut him down? Hall Boy: No, sah! He ain't dead yet. PEROXIDE ! Sylvia: All my ancestors were blondes. The Other Half: Then you came from preferred stock. HEARD IN ZOO LO V Dr. Brode: Now, for the first day we shall start off by naming some of 1 the lower animals, beginning with this young man in the first seat. THE RIGHTEOUS ONE I went to every single lecture and I took my own notes. I didn't hang around after class and tell the professor how much I en- joyed his course. If I thought the section leader was wrong, I told him so. I didn't go around crying to any readers and tell them how hard I stud-- - ied and how nervous examinations made me. I never went out for a smoke during the finals. I never took a last peek at my notes when the questions had been put on the board. ' I I never took any re-examinations in private. Yeah, I Hunked out last semester. OPPORTUNITY KNOCKS BUT ONCE Pretty Thing Clost in the big cityj: Oh, sir, won't you-take me home- Young Man: Madam, I'd love to-but I can't. In live at the Y. M. C. A. GULLIBLE You've got an awfully big mouth, haven't you ma?,' Wl'iy, no, dear, I don't think so, why do you ask? 'Cause I heard pa telling nursey last night that you swallowed every- thing, z.:q,s4zi345' V ,V E, Ax, .T .FL 5 ' ,-.an-15. , -.ilu-1' ' 2 '4f'Nyi AV-1' 2-31. ,f ya 5-:H S1 1 If-1 A fav ., - My lg, J r fewer- f v .. 7--i fi . .. I Iffzcy .xgnzg M-iVVggV V V J 4: A VV V V V V V V VV L .VS u..f.Vg 51, V zzmsr. VV u,:,V N. ,3 51 V 1 1 V 4 1 V V 'W ' ' 1 J gl '. ' ' , M.,,.... J. , ,Y ' ' '- x-V-ups-1-ru, 1' . ki i- , , I -, , -. . i, V, fa- . , - I - . V I . Page c572iiZNili2'Z?1fLzi'2EZiiEii?kQL1i7iQl2E5 MONDAY AT EIGHT Prof.: Mr. Jones, what are the different kinds of marine insurance? Art: Yes. Prof.: Yes what? Art: Yes, sir. CORRECT Bad Eye: As we ran through the cemetery we stumbled over tombstone after tombstone. 'I' Moby Dick: Ah, lad, you were in grave danger. -3? 9? -B6 '75 Prof.: Tell me the way to preserve meat. Noah: Putting it on ice, sir. Prof.: Wfhat do We call that? Noah: Isolation, sir. HE DID b Senior: You should place your hand over your mouth when you yawn. Frosh: Wlhatl an' get bit! :es iff E+! T5 , 'M HIC! HIC!! tl f'.i.fQ li MX. ,M Here's Madamoselle in fray Paree X And dear Miss Euhlingfer out on a Ula!! bl U l 5 A-I ll spree. C1939j. D' xlft-1 JT B' 9 ! llr D! Lf 'I' , - : U I Vkixgfv Biff ! ' CONCEITED He: Could I have a date tonight? She: Yes, If you could find anyone dumb enough to date with you. He: VVell, I'll be around to see you about eight oiclock then. GROYVING UP Little Jack: Muddy, you should see how I have growed! Mother: Grown, Jackie, grown! Little Jack: The hell you say, why should I groan? STUNG Iyd rather you wouldn't- Aw, please, just one. But what will mother say if-? If I take just one, your mother will never know- Oh, yes, she will, she has all her cigarettes counted. -if l 'unn four Hlfllilillil Jlilltli li -1 lluS motion was receive y Ding: This tonic is no good. Dong: YVhat's the matter? Ding: All the directions it gives are for adults and I never had them. N if' 'P' 'X' SVVA'I'l Art: I'm so glad you like the painting, Ruth. Ruth: Oli, it's perfectly lovely! But you must let me return the frame. You see mother does not let me accept valuable presents from gentlemen. Casting Director: XVl'1at was her pantomine like? Assistant: 'Why, I didnlt know that she had one on! 96 95 99 if BUT HE VVASN'T l'DoeS your husband still, walk in his sleep? HI should say he does. Last night I caught him hanging on the window ' shade. He thought that he was riding the blindsfl AT HIGHBALL JOHNS Ike: Has Mr. Smith been here? Mike: Oh yes, he was here about , an hour ago. f,gSf v Ike: Was I here with him? Q6tllj.fjffi11.. I fQl I as x as Pk ..-fzzigtgi Eggs 1411 fig HONOR SPIRIT SQ 5-EIT Prof. Q in chapel: This exam is 5 f.f4g? 'f ,005 W will be conducted on the Honor Sys- S5: .25 , tem: please take seats three apart T T 5 3? ga Pliflhlllm and in altemaie Ezowi 5 , S 9 in rovuv ' ' 5 458534'-m.1?5m-- THE BOBBY POLITIC 'Qgfl l M Did you know that women we1'e in f 'W' 2 'ffA politics many thousand years ago? .ff-1,:'3XQQ':E wfgfqgfh No: where did you get that? W 'I' my Vlfell, it is stated that Salome's is MAN IN nniitut PLAY: d b the house insists liuilv itlni with loud applause. BOTH Q I-Ie: Pardon me. Has your dress slipped oft' or am I seeing things? She: Both. vs af is DANGEROUS Hot: WVhat happened to your voice? Shot: I strained it last night singing through a screen door. '35 9? Sf' 96 ' 'nit that too bad? So you didn't like the jokes, eh? Well, well, ai - i -Y ps..-,:. Page olie''l'iIviL3'1Qzli?5zzi Fffffyjiw 'Macc' A5421 U-EV' ' A ff5 'I'5:2,3 'Q'- f'15? 5?fEE:-.V 'WTF' NY ' wr:-1-bs-fc-. -rffflfii 5 15 'c A -:-4:55, C-151,141 V 415,155 QQ, if--:Q g.:g:C:- 2::.,3j-, E955 21 5 u 3 A .- gg. fg:::.,q:, 'qzgrx , g, 'j.g1w. '-.1-5 - , 1:-' 1 12512111 x:gi5,5g:j-ga' 511511 , :- gt E '- we sea '-'+' Q- 512525 g 1 1 Hi . Q gg' 3 5, Q m Weak? tx.. , . -,., . -1 Q, ,.,' U ,. KJ lr ggf.: Q 5:- 3 2: 1 ., 0122 cg J c, 12 pw r: ' - :E r' E 10:1 8 555'-' F '-2 ' Q- -'jf o- ' 'RvNv41.5 63K2i5R-Y n f -- - :ff f 225 1 S H Es' Q4 593 ' TW Q? 1 ' 1 FE 2 2f ' E E5 Y y u Z5 g 5:1 'V 'Q 8. K S5 N 41 Tixnu-:4-:-si-' 25511 E., ' Rik-, 45:- 0 o Q jf' p wa11latpu Subscriptioniglonor CRQU 177: , U 1,-,aa - w E13 av Kappa Kappa Gamma ......,.....,,......,............................. ...11O per cent Qfed by Catherine Ripleyj fx 3 . 1? 55:7-: N, .e. ' Theta Chi Theta ..,..........,.......,...,,............,,..................A... 108 per cent QLed by Selma Tontzy Delta Gamma .A..........,.,,,.................,..,,,.......,...,...........,,,.....A 105 per cent ' QLed by Nelda Newsomj Phi Mu ....,. .,....,..,.........,,............,,,.............,.............,............. 1 00 per cent CLed by Vaughn Haskinsj I in Q 1 17: '- 4:2 T1 : , 5:3 I 1 si rv ' -: s :- A Y 2 1 5 1' r I V Q2 x I I-5 .5 , ' I 35 1 4 .' 5 g: 'Q ::. N Y N , 5-:cmarxa ggsxc-:-gag, qv-. . ,cp ggwiwwwwisff ,Q-111.2 ,Q-,-:rea -1 ii? ' ,rf - ,gp 1,4-,ffm-, -.f- . 1.' Y U ,, . Kyawq tm' , 1 f Q: zen:-a:awwwavy:-1w-swaaxgaz-:f.jqo i ., ' 5 lifes' m'g?g.v'fS, Qqf ggi 97793 - ' - ,, -Q5':Q ?'5'5'97f'-t53S:'5:35 3f 5413 K' yfew - ' 1 , 1, -. , - 1.1 -,ay ,z --V., -.x wc: wa 1-Hzvwf. ,Q-1, g:,,g.5: ...I 3 , 1 Y. , A ' -, N f , H F, - . f - J -r.. -,L Q .1 ',.- . .we X-4, W. '- .wf,,.' -f , - ,,',:,l,,-.W-fb,-Nv,C l ' 4. 63' QL ubgfwwiblx 7x,,f.,M,.zt4:..J A' L-is egg Y J-, awe, Z.,-.,.E.F,4.... ,, K , I lv lg ff, . Wxzbwg 'yi 1:- gwvm'.-1 K' xi H 5.3 fi :wif , Q Q2 3, . .3 L 1- . ,V .1 1 '- ' : ' J 'Q ,f,. ,r-,' ' P '- W ,,.. ..4..,:.. , . - . -' - 1 V-5,..,.1f.,r ,fra A-j--1 '5'1 1 2 , ' C 5 L ,H-E ' .f.uQ:1:f-:Q-:-:M531: ff Erlezrgff- siviffxtffi-fhfi , f-Sf. X. 1:-2QMo1:er.:1xf:,:: ogsmll-:aus-rmuivzzcs-: sm Page One Hundred Fifty-sim - 1929 waiilatpu Advertisers The Midway Pantorium Dye WVorks Gardner Sz Company The Blue Lantern A. M. Jensen Company Eversz Cleaning Company Clark's Book Store Union Bank and Trust Company Ludwigfs MeCraeken's K. Palkenberg Star Laundry Davis-Kaser Company Inland Printing Company Empire Furniture Company Peopleis Shoe Store College Inn Payne-.Iayeox Van's Cigar Store J. C. Penney Company Tallman Drug Company G. H. Sutherland Company Pollyana Cafeteria Young and Lester Shepherds Smoke Shop Baker-Boyer National Bank Independent Meat Market Moreman's Tonsorial Parlors Spokane-American Engraving Co. Sherman Paint Company Shepherd Bros. Service Station Beck and lfVinan,s Grocery Croxclales Confeetionary Miller's Studio Wlhitels Haireutting and Beauty Parlors. Page One Humlrefl Fifly-swan
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.