Westminster College - Blue Jay Yearbook (Fulton, MO)

Text from Pages 1 - 136 of the 1922 volume:

f.. . -. -35:41,-, f T5 4'-f 2,gf :ir J , I:QQ-22.32117353-li,'E 'ZTI'2':5Zi':fJ?ii5Qi x2'11f-'inf 'QTET ' K A' ,, ..-4 111, Ann X- - I '-3+--5 ' ,p 0- -V ',',n Av'-Q Y,-1 ,-. U, . ' N' .' flifji' p , I, X s, F' N ,,,..., ,- . .. ,ii -Y--' - ff? v -2 fx F- 1 , , .L 'x .H 1, v 3 ' MC E. J! A .M 9 1 xi .Jw 1+ N 'X I a -H, , ,f 5. EWG' J 1.-4 , 'fr -5 .v T. .Rf ' f I c Q .75 lg 4 Q.. .1 fl. , 2 ,, iq 1- ff-e f A ' ' fvii. r na F! D 1 ,fi 12 f 1 L N MID GONTINENT PUBLIC UBRARY Gem: Ewyi' LN' EF 'fcrvi .L ary 41 Jwni f 5 n anevaenhe E 13 mf' , . .. ,.9 f , ,Sc-. h Faq-11 V: xv . uv... 0.11. . : .1 ' . 1 lv' f 3? -Q . f- 'ITM .5 Home Eamepsndan-ae Maman .FA I Cl., Z Hag. wa, iff ci n rt - ld :-.n..m,-4 -V ,,....-Q.. , A U 3.2-' x 1 '- ' 1 v A Q.-'jj ,.,'fyJ4 , .- .- L .. g ,Q- ,Q ff, -A Q92 fn 475 L. .1-:vf 'gffv5 v ' -f. F X.-.W-.'f',. Sn 1-X 4,-'Q ..'h'x?v,1!i,,- - 4 -, '.': H ,- ,.,,-A A. i 4 Q as EK Efgws - 4 jg mmmWilll mm1s1n1nn lililHmlml j A H HD G JTRNENI' PUBLIC' LIBRARY , nik: 'TH-HIE 4- HEQQ2 Q BLUE 0 JAY V f ix - J. EVERETT BENNIE Editor-in-Clzief STANLEY P. CLAY Business M cmagev' I 0 W 1 IV SLE MID-CONTINENT PUBLIC LIBIQXRY W- muuvyyqgqggqryrlqflllqmfgfyfgfglvynulu FJH5 CGNTENEPET PUELFC LEBRARY , -A zz., , 6' mn If-:gy 81U..cca3 LxL.raQ F fn T 1 If 5-J. I 1 gg fiiww-Eng S5 if n A r annum -1-'E' VOL. 22 MCMXXII ese ess 1 twill The Blue Jay of 1922 opeus its eyes upoh a Tflfestmluster larger thau euer before, tu size, lu mflueuoe, aucl 'lu po- teuttallty. It is thehfouclest wish of the Staff that it may fltttuyly assume a place tu the ouuzarcl march of our Alma Mater auol perhaps, 'll'l'L some small way, augmeut that aolvauoe by brluglug the true Vffestmluster closer home to those who hrteuf her of olol, and those who are to huouz her 'lu the years to come. rfikl THE0 noaaa Q BLUE O JAY VS? ll Ummmmmm Illlllll llllllllllml Illullllm lll lu nl. mmlllllllluulllllll ll IIN' IV' I I 'pi' ,n w ' Hn,,,h I I, ,--- :xi ullhgg?---111 '--. , Iv-1.,,, gfl ll llllllllllnx h W :. :ilk iiinnIIlUW Ilplgj M g l 1 M an h t' 'W llliill f Hill N , -E J pi if X ' Y 'N : iii JL - E l lt ' , s ' i l . . i , 5 ,ff Dedlcatlon 'Ji 1 : -K I- h 4 2 2 'V' To the Aliimiti and Frieizcls of QW E : E I W'estmiiistei'. L 5 lg: We, the Staff of the 1922 Bliie Jag, E iii cleclioatiiig this 'uoliime to the gf Aliwmii and Frieiirls of Wfestmiiistei' E College, hope that each of them may accept it as a personal maiiifestatiofn - E of our gratitiicle to them for having 3 E For we feel that her progress is clue, 5 E izot to the 6jf07'fS of any oize person., ll S 3 Q 9.4 fb Q LQ 5 Cb Q 31 31 CH Q Q Q Q ? Q bu- s- . ve. S . CID vo- Q Q4 9 Q nalzzl 1 E 5- E but to the oombiizecl altiiiistie labor iii E - E her behalf on the part of the Aliimm E E and loyal F?AlG7Z6lS. Mag this booh ie- Q ' main as a lasting mooiiimeiit to them ' anal their clevotioii to Westmiiister. 'fi J nuiu 3.5, llHlllllllllIIIHIIIIIIIIIIIIIIllllllllllllllllilllllIIHIIIIQHMMIIIIIillllllllllllllllllllfllHIIIIIIHIHIIHHIIHIIIIHIIWM I QQQMLQ-1 Westminster Hall 'He Building one Royal Road fOL6'Cl1'UjDg ' I ' . ,, ,, K5 .xl ' vm., 'e ,..,. ' fs: ' f vgfe.1vm73gz5B2g , egg W fm ,y ' I , b,V,,,,5J,,A.,,,3,,f . ,,, .ff M, ,532-fr, 4, 954 qi 43' K 1 ,5,1g,?3?1., .. .. ,sim 1 3, ',.j,:,L I nf., ' Q 'f '.-3.:.Qi2Q?1 ,VILA-F'-1,. . X7 5 1?-sffi fl , - gf hz ,'-A-a . -qw-wp,1g,f'PA 0' 121 ' XT . 593 ' ew 'kay f': 'l 3: ,.,4'v5.Xf 1 1 :Z M, ,, A , 'fain f. A., 4 Swope Memorial Chapel Where Westmins ter wins debates Science Hall '7lze Old Columns Restored in 1921 Reunion Hall 766 Home of' the Dormites Washington 'West Mansion 7126 Home of the President FSE: 'TJHIEO 11495242 0 JBSLUJIE Q JAY . ,A . ...bv PRIEST FIELD F nik: , THEQ 11195992 Q- IBSILUIE 0 JAY 1 Q2 1 0 o s F 2 Sk: TIHIEQ 11499942 f- BLUE 9 JAY 5 ' ' E. E. REED, M.A., D.D. President I QQZQL-3--1 rikn + T11-HIEQ HQJQQ 0 BLUE Q- JAY V GEORGE BEATY SWEAZEY, A.M. Dean V I Q - I iii P TH-EEO IIQJQZQ Q IBSILTUIE 5 JAY Q e JOHN HARVEY SCOTT, A.M., PH.D,, LL.D John Harvey Scott Chair of Mathematics Endowed by the Alumni DANIEL SHAW GAGE, A.M., PH.D., D.D. Potts Professor of Philosophy and Bible Sausser Professor of N ew Testament Greek Vs Q 0 1 Jikx THE0 119992 0 BLUE 0 JAY 2 JEREMIAH BASCOMB REEVES, M.A., PH.Df': Liberty Professor of English Language and Literature i Leave of Absence 1921-22. W , Q I 1 GEORGE BEATY SWEAZEY, A.M. Dean and Charless Professor of Physics and Applied Mathematics 0 0' FSR! THEO HQDQ92, 0 BLUE 9 JAY '39 COLIN A. MCPHEETERS, A.M., PH.D. Occupant of the Callaway County Chair of Education OTIS MELVIN WEIGLE, M.S Professor of Chemistry 1 I o- Q. I rim 1F H-HIE Q 11 9595523 Q BLUE Q' JAY e V ALEXIS BENKORI, M.A. Professor of Modern Languages FRANC LEWIS MCCLUER, A.M. Occupant of the John Jay Rice Professorship of History and Economics in Memory of Mrs. Wm. E. Guy A of rif f' . K . O 0 I A FSE A TIHIIEQ 119212 -1 BLUE 1- JAY A 5 X ...--,,.-,.-,,, ., -..M ! I ? ! HARRY COLSON HEATH, B.S Professor of Biology f JAMES EBENEZER PIXLEE, B. S. ' Coach and Director of Athletics WILLIAM JACKSON HAMILTON, A.B. Instructor in History 4 Elected March 1, 1922. r i Q 0 rim 'IFIHIIEQ 11992422 0-.IBILUIE 0 JAY I 5 ' 'I I 1 MICHAEL DAVID BURKE, A.B. Instructor in Mathematics LINCOLN BARKER, A.B. Instructor in English I 5 I , .,V-. ,W Wm 0 0 1 I 1 1 5 5 1 I F I If ii 'I ii S 5 E S4 s. H 5 11 I 1 51 ,. af? I 2 , FSE: Tmmongafaa 0 BLUE JAY 2 VE? MRS. LEE W. ROOD Librarian STUDENT ASSISTQANTS Biology: J. A. PARKER, '24 Chemical Laboratory: H. R. HARNER, . E. M. CRUMP, R. E. KISTLER Library: J. EVERETT BENNIE, '23 7 JOHN RENOE WESTBROOK AB Instructor 111 Latm if--M. '24 '21 '23 I O 0 l I L ME THEOHQQQ C- BLUE Q-q1IAY '39 The Class of '22 LOUIS G. SAICUER OFFICERS Prrzsinlewf - - - LOUIS G. SAEGER 'Vicff-Przusirlrflfl - AIJFRIEIJ C. BOAND Mmnlwr Pz1bZ'ic:aM0a1, Board NVM. O. SAWYERS Jlwnzlfw' Allllwiif' Board Hmmr H. POWELL 0 G- 1 riks THE H9942 - BLUE ,JAY 3 THOMAS R. R. ELY, Kennett, Mo. Beta Theta Pi, Philalethian, French Club. EDGAR M. CRUMP, Fulton, Mo. Philologic, Chemistry Assistant, '22. W. MAURIGE BACKER, Fulton, Mo. Pi Kappa Delta President, '21-'22, Skulls of Seven, Mustard Seed Kernel, '21, Phil- alethian, Publication Board, '19, Fort- nightly Stair, f22, Y. M. C. A. Cabinet, '21-'22, President, '22, Debating Team, '19-'20, June Contest, '19-'20, W Club, Athletic Board, '22, Football, '19, Vice- President Student Body, '21, President Student Body, '22, President Student Council, '22, Class Historian, '20, Delta Sigma Rho. LEE CARL OVERSTREET, Fulton, Mo. Phi Delta. Theta, Delta Tau Gamma, Pi Kappa Delta, Philalethian, Publication Board, '22, Editor Fortnightly, '22, Glee Club, '18, Debating Team, '21-'22, Foot- ball, '18-'19-'20, Baseball, '18-'19-'20-'21, :athletic Board, '20, President W Club, ALFRED C. BOAND, Fulton, Mo. Skulls of Seven, Philalethian, W Club, Baseball, '19-'20-'21-'22, Captain Baseball Team, '22, Athletic Board, '21-'22, Class Secretary, '22. 'f I .Jjkl dh THE HQJQQ BLUE Q- JAY 5 WM. WALKER JOHNSON, Mexico. Mo. Phi Delta Theta, Pan-Hellenic Coun- cil, '21-'22, Pi Kappa Delta, Delta Tau Gamma, Skulls of Seven, Mus- tard Seed, Philalethian, Blue Jay StaE, '21, Y. M. C. A. Cabinet, '20-'21- '22, President, '21, Treasurer, '22, De- bating Tearn, '19--'22, June Contest, '20, Secretary French Club, '21, Stu- dent Council, '21-'22, Honor Roll, '19, University of Missouri, '21. MITCHELL DUNCAN, Fulton, Mo. Delta Tau Gamma, Philalethian, Spanish Club, Publication Board, '21, Blue Jay Staf, '20-'21-'22, Editor-in- Chief, '21, Fortnightly Staff, '21-'22, Business Manager, '22, Class Secre- tary, '2O. A HIRAM H. POWELL, Perry, Mo. 'Skulls of Seven, Student Council, '19, Athletic Board, '18-'19-'20, Football, '17, Baseball, '18-'19-'20-'21, Captain Baseball Team, '19-'20, W Club, Class President, '21. LoU1s G. SAEGER, St. Charles, Mo. Phi Delta Theta, Philalethian, Presi- dent, '18, Y. M. C. A. Cabinet, '18, Honor Roll, '16-'17, '17-'18, Treasurer Missouri Student Volunteers, '18, Class Secretary, '17, Class Historian, '18, Class President, '22. ELWYN BARTLEY HOWARD, Beebee, Ark. Philologic, French Club, Do1'm Club, Track, '21, Glee Club, '22, Class Sec- retary, '21, 0 I ' - fi Tram-Q nomo A IBQILUIE A JAY - Q? L. M. BALTZELL, LaBe11e, Mo Pi Kappa Delta, Philalethian Piesi dent, '21, Secretary, '21 Debating Team, '20, Honor Roll, '20 21 22 CARTER SLOAN, St. Louis, Mo Beta Theta Pig Spanish Club Fort nightly Staf, '22, Pan-Hellenic Com mittee, '19-'21-'22, GUY M. PITTS, Mexico, Mo Baseball, '19-'20-'21-'22 Chairman Athletic Board, '22, W Club Cheei Leader, '22, Pianist of Glee Club 22 WILLIAM ORR SAWYERS, St. Joseph, Mo. Kappa Alpha, Philalethiang Pi Kappa Delta 3 Delta Tau Gamma, Pan-Hellenic Council, '22, Publication Board, '18-'21-'22, Fortnightly Staff, '22, French Club, Winner Dbbyns Oratorical, '22, Second Place, '21, Men's Club. LUTHER B. MOSER, Fulton, Mo. Philologicg Westminster Academy, '15-'16. Ex-service o- ' o- ,:W'RXx . V-TE H ?THEo 119199 -5 HILIUIE Q JAY 'U The Class of '23 l'.I:l.lLlP C. BARKER V OFFICERS Presicleai - - - PHILIP C. BJXRKER ,SGCV6fCtl'y-T'I'0ClS1H'GI' - MORRISON MCCIILII Member Publication Board CHARLES B. GROW Member Athletic Board PHILIP C. BARIQER I -o- -o- 4, I riks TIHIJE noafa BLUE 0 .JAY J oHN O. ROBERTS, Clarksville, Mo. Kappa Alpha, Delta Tau Gamma, Publication Board, '22, Fortnightly Staf, 21, Blue Jay Staff, '22, Editor- in-Chief Fortnightly, '22, PHILIP C. BARKE11, St. Louis, Mo. Phi Delta Theta, Philalethian, Vice- President, '20, Y. M. C. A. Cabinet, '20, Athletic Board Secretary, '20, Football, '20-'21, Baseball, '20-'21-'22, French Club, Pan-Hellenic Committee, '22, W Club, Class President, '22. W. DRAYTON LEWIS, Kansas City, Mo. Kansas City Junior College. CHARLES B. GROW, Fulton, Mo. Delta Tau Gamma, Pi Kappa Delta, Publication Board, '22, Debating Team, '22, Winner Essay in June Con- test, '20, Second Place Dobyns, '21. STANLEY M. WILSON, Mexico, Mo. Pi Kappa Delta, Philologic President, '21, Debating Team, '22, Vice-Presi- dent Student Body, '21-'22, Student Council, '21-'22, Blue Jay Staff, '22, Dorm Club President, '22, Vice-Presi- dent, '21. Q Q I riw 'IPIHIIER 11493992 0 BLUE 9 JAY 3 E FREDERICK R. ROSSER, Fulton, Mo. Philalethian, Secretary '22, Mustard Seed, Glee Club, '22, French Club. J. EDWARD CABTER, Fulton, Mo. Beta Theta Pi, Spanish' Club, Foot- ball, '19, W Club. ' GEORGE E. CoRNWE1.L, St. Louis, Mo. Beta Theta Pi, Spanish Club. JOSEPH BoT'rs, Mexico, Mo. ' Philologic, Basketball, '22, Dorm Club, French Club. - J. EVERETT BENNIE, Fulton, Mo. Delta Tau Gamma, Mustard Seed, Philalethian, President, '22, Spanish Club, Publication Board, '22, Fort- nightly Staff, '21-'22, Editor-in-Chief Blue Jay, '22, Y. M. C. A. Cabinet, '21-'22, Vice-President, '21, Secretary, '22, Clerk Student Body, '22, Class Secretary, '21, Assistant Librarian, '21-'22. I 0 Q I r-im Tralee room 0 BLUE Q .JAY 3? WILLIAW SIMS RIXEY, Fulton, Mo. Director of Westminster Glee Club. MORRISON MCCALL, Fulton, Mo. Spanish Club Treasurer, '20-'21g Class Secretary, '21-'22. JAMES B. MEGEDE, Richmond, Mo. Kappa Alpha, Skulls of Seven, Pan- Hellenic Committee, '21-'22g' W Club, Football, '19-'20, French Club. W. TRAGO GARRETT, Fulton, Mo. Spanish Club, Student Council, '22g Honor Roll, '19, Glee Club, '22. HOWARD B. MCCUE, Fulton, Mo. Kappa Alphag Philalethiang W Club, Track, '21, ' ' C- 9 I r-KR: 'IPIHIIEO nemo 1- BLUE 0 JAY - K 3 R. E. KISTLER, Fulton, Mo. Football, '18-'19, Captain, '19, Assist- ant Coach Football, '21, Athletic Board, '19, Chemistry Assistant, '21. Fmsmwoon WHITSITT, Odessa, Mo. Kappa Alpha, W Club, Basketball, '21, Captain '21 and Captain Elect, Basketball, ,223 Baseball, '22. I HOBART R. FULLERTON, G1-eenup, Ky. Phi Delta Theta, Spanish Club, Centre College, Dan- ville, Ky. , Cincinnati University, Cincinnatti, Ohio. RAYMOND SWEARINGEN, New Bloomfield, Mo. Kappa Alpha, Washington University. n 0 0 u THE Q 11 992412 4 BLUE 9 JAY Q' I 0 0 1 r'-ik , THEO IIQJQQ Q IBB-ILIUIE 0 JAY ' L. V - ani ' , it J 'o '-in A 'tv f , - , , ff Q., an , I .Y ,.g, ,E a n - , , I I v X ' V , ,3,QyH, ,V ,f, - - if-f ' x , Al, ,LN , , . p W , V I .nfs 3 - Q I - , V ' V , A3--. xfr Lin V, xgniluijn ,-'A , ' 'Z 5 . A 4 1, , my qi., K. - , Q W ,, , K- X ' M' r ug: 2 Q ,Q g A- ' V A ' '44 I y A 5 .f:,:.f 4. Masq TW 1, - Nr,-e. 1 -, 1' A ' , f i gfiv'f 2 is N 6 mv - . f , . 4 P QM y 4 V if VV 'XL' W- . E641 .fi V E ' 1 a .P ,- 1 .A ' 1 V , N, A viifif' ,IV ,XI l gjlgg, - '9'.ixQa, A-1 5 ,1 7 ,,,, A H ,Spfffq , Q .J-A 'Pj 5 p ' , 5 Q15 ,, ' ' A ' ' 1 v 1 . I - .'.,, , 4 Y' fp. V, W If ll A il 'v ' V 5-1 nf ' -.L 'Y - lt' Q 1 1 ' 1 : f,vk:q44r I t f ' ,J N ' 13? -5 ' .RZV ' ' Q I I f ' f -cliffs :Q 1 D V. ' b V - 3 X .g 5 ix Z, ',-,,. i , 1 , I In W I 1 . i:? 4, .w 5 , .y,V 1 , . W , . . V, - 5.51, f ,iffjfgd Viz- Lf, 'g1 'x ', .ff , , 5- ffij, fig., iZ9lf Z Q Q Gif , ,, 'Yagi if 1 J-9' ' 9 0 1 I f L Z - mx: - Nm-.-mv 1: M sr, O L l.n'f3.L. ITHEOHQQQ Q BLUEAOJAY L V b The Class. of '24 O FRED BELL MONTGOMERY President - - t - - FRED BELL h MONTGOMERY OFFICERS Secretary Treasurer NEAL S XVOOD Member Publtectttooz Board - - VOLMER FRIEDHEIM Member Athletic Board - - - KENNETH V. BROWN I 0 0 I .rim 151145:-D nomo 1- BLUE 9 JAY 5 , ROLL AUGUSTINE, ROBERTSON HOWARD MILTON, JR ..... BAKER, THOMAS AWAYNE .................... BEARE, WILLIAM KELLAR .... BEEDLE, EVAN PRICE ...... BOSS, HENRY ELI ................. BROWN, JAMES RANDOLPH ........... BROWN, KENNETH VAN RENSSELAER BUCK, JAMES BOYD ............... CAREY, WILLIAM VAN ....... GATES, FREDERICK WILLIAM ..... CHERRY, :KENNETH MUNSON ..... CLAY, STANLEY PATRICK ....... EBERLEIN, ROBERT PAUL .... ECKLER, CLAREL PERCY .... ................Boloomfield, . . .. .520 Pearl, Joplin, Mo . .......... LaBelle, Mo ....CheSter, Ill ...Laddonia, Mo ..................Jackson, Mo .....................Perry, Mo ..................NoWata, Okla. 5577 Delmar Blvd., St. Louis, Mo. . . . . . . . .Route No. 6, Fulton, Mo. .. . . . . . .508 N. Pearl, Joplin, Mo. . . . . .522 N. Moffett, Joplin, Mo. ..............WellSville, Mo. I 0 0 I . . . .Route No. 39, Warrsnburg, Mo. Mo. LSE: 'TIHIIEQ TOQO -A BLUE 9 JAY, Q ERWIN, HARRY KIEFER ...... FARRAR, JAMES THEODORE ....... FRIEDHEIM, VOLMER HAVENS . HAMILTON, HAROLD H ........ HAMNER, LONNIE WILLIAM.. HARNER, HAROLD RUSSEL ..... HARRIS, MAURICE HERBERT .... rj-IASTINGS, SAMUEL RODNEY ..... HEIDBREDER, ARMIN DIEDRICH. HOCKEMEYER, FREDERICK BURY .... LAWRENCE, HARVEY TIOE ..... LYOHE, TORRIS AUGUST ..... MCCLURE, GEORGE SINCLAIR. . . MEREDITH, THOMAS OVERTON. . MEYER, ALEXANDER MOORE... MONTGOMERY, FRED BELL .... MOORE, GORDON ELMO ........ MORRISON, MARION FRANCIS ..... MOUNT, DONALD LAWRENCE.. NEWBOLT, WILLIAM CARL ff. ... PARKER, J OSIAH ATKINS .... POWELL, CHARLES 'LESLIE .... RUSSELL, EDGAR DEE ....... SCHRADER, GALT ............ SHELBY, JAMES EARNEST ..... SIGLE, JOHN FESPERMAN ..... SNOWDEN, OLIVER KIERSEY ....... SWEARINGEN, THOMAS RICHARD .... THOMPSON, HUBERT STILES ..... TURNER, ARTHUR LEE ........ WAGGONER, WILLIAM HEIJRY .... WEIR, HAROLD BLAKE ....... WHITE, TEDDY M .......... WILLIAMS, GLEN ALBERT ...... WOOD, NEAL SHAOKLEFORD .... ..................Kennett, Gray, Joplin, .....243O Pennsylvania, Joplin, ...............,......Fulton, .....................Richmond, .......................Nevada, .Bakersfield Route, West Plains, ........................Luray, .....................WellSville, . . . . . .Route No. 5, Fulton, . . . . . . . . .Route NO. 5, Clarence, MO MO MO Mo MO Mo Mo Mo MO MO MO Chicago, Ill ..13'7 Elm Ave., Webster Groves, 344 Lexington Ave., Harrodsburg, ....................JameStown, ........................FultOn, . .221 E. Jackson, Memphis, . . . . . . .Route NO. 2, Fulton, ...............MemphiS, . . . . . . . . . .Route NO. 6, Fulton, . .5840 Enright Ave., St. Louis, ....................ElSbe1'ry, . . .4358 Maryland Ave., St. Louis, . . . . . . . . .1747 Broadway, Joplin, . . . . . . . .1102 Broadway, Joplin, . . . .Walnut St., Danville, ..............Danville, .........Odessa, ...........Farber, . . . . .New Bloomfield, .......MemphiS, .. .....Walnut Ridge, ................Benton City, .5061 Cabanne, St, Louis, MO Ky Mo Mo MO MO Mo Mo MO MO MO Mo MO Mo KY KY MO MO Mo MO Ark Mo MO 9' 0 .. A my , E WH AM A LQ-'1Il1I'lIIITQ0 119929 0 BLUE 0 JAY 1 .ln ' I an E4 1' , ,1 B - I C I W fs -f - QWG , GJIYWQ y , .2 Qu' , Q ji iff . -YH A ' ' ., 'f .'ff, W,EA-13 -'iivv ? if??-: . f 'fi-mv '4 kwin fx -jf? ' ' V , cfm ik' . Q , -J up - -1.,-Nw W, A 4 W 12:1 M Q - ,, 1. ra-fu fra: 11i1Lj,ig14g'-H Q MM, 1 K-'51 N .- .. 1---. iilyg K 3' ef fx1,t5- -X .9 L gf gf F W V, nhi - ' . . ip X Q f A . ' mf' ' x ' '- 34592 gf , 'T 1 mf 'ff' 3 53 ,, ,tfr'r?'fJf51ff',x ' H' - 1 ' .. w wf 1. . . Y ik lift ' 2-, .. 'iii V . , , ., :,, if may W, -,Q ,W 51,4 ,. H, . w',..1,,.,gg.,,., ,R ,,J.,,,.,:,4..,f. . Q, 3 1. ffiifv , - b3f?:4f ?rfIifm ??3ra-A g-'f1T'lP4-',f5 ,Th - -f , ' fi -rizrar Z 11e'.g,., Lis? -i ' ' N' Ls- . 54? 4 7 . sg f ,f g34,a7?H1q14:,Q, - f 1 f -'f 439: '1 1qzr4,z5?f.?a' . g5,.QzfQ+1i'1:b5f,,., ,,.. 1 I win X -5 1 22519 151533 , ' 1 rLXx'!1' 'v.k' -f: Ku . TR ., ,,r . - . 1 2 mei ey.-51kFf1.: f V . , V P ' 1'1v2b'L?fUf '11, 'f',,fLL'Y29 ' - A, f - A-- -g . 1: - - 5, , .1 r Ziff? , '. '-. Hr? , W'335v 131 ff ,Q 3 fl! --H. .g4,!.'q,f f1f-r,y.', .,gg,.?54, f 3 i n af.: 5, was-Ee A, an :1 Ni, . 'f f fv ' 'pt'fi?'rffz-W? W? - , .. f f' .ff-5, Aj, iffigx. f2.'1yli:'Q5Lfy.:- , j 1 1 M 'fi??ifg:i,wf ff' 35312319 ' x , K ici? ' Q K 4giQZ,w , .asa fix .f ' P V 3 ' ' .7 fi . 1, e,w,1'a ,gm Q, , K fy , , 5, A y ' f-f , , ' 0 ' 7.1 ' w, ww 3 2. ' -da ' an '- ,J--A r' if T' 'A ' J.HNVlnJmullcr QQZ., .vim The Class of 25 l A A I A 4 I Eg . iff THE 0 11 9942 0 BLUE Q JAY A 'r A at V Q 1 Af' it A I if A :by A , A .' 51 ,f H I. .fi ROBERT DEXVEY MCKNELLY M OFFICERS 5 Pvmesideiit - - - ROBERT DEWEY lX1CKNELLY See1'etary-Treasurer - - q EDGAR A. PARKS, Jn. 1 Member Publication Board - A HENLEY BLAIR ' Member Athletic Board. A. J. BRONVN 3 ' l Q 0 1 E l I A' 1 x if ! , '- I I l ROLL ALLAN, ROEERTP .... BALTZELL, - LAWRENCE ALPHEUS. . . . BARNES, HOWARD ARF. . . . . . . . . . . BARRETT, EMMETT WALDO. . . BEEDLE, STERLING GLENN ..... BETZ, JOHN RICHARD ...... BLACK, CLAY COPELAND .... BLAIR, HERBERT HENLEY .... BOTTS, THOMAS WARFIELD .... BOTTS, WILLIAM ASHBY .... BROWN, ANDREW JOSEPH... CANNON, WILLIAM HUTTON. . . CARTER, HARRY DALLAS ..... CAVE, CARL SANFORD ...... CHOWNING, JAMES REID ...... CHRISTIANSON, LLOYD CLINE .... CLARK, WHITNEY FREDERICK. .. CLAYTON, ORA GLEN .... ...... CLINE, HUBERT DOWE ..... ...... COTTRILL, HERBERT CHANDLER .... CREECH, BREVATOR RICHARDS .... CURRY RUSSELL GATES .....,. DARLING, .JOSEPH HAMMOND. .. DETWEILER, OTTO LEE ....... DEVITT, EDMUND JOSEPH ..... DRUMMOND, VICTOR WARREN. . . . . . . .... Pinckneyville, ...................LaBelle, ...................Laddonia, . . . .705 West Broadway, Sedalia, ....................Laddonia, .........................,..Pacific, .........................We11svIlle, ....1214 Elmerine Ave., Jefferson City, Hill, .......Mexico, ....Plattsburg, .....Fornfelt, .........Perry, ...Holt Summit, ......................MadiSon, ....608 W. Lincoln St., Savannah, ...................Savannah, . . .1415 Byers Ave., Joplin, .............McCredie, ...Savannah, ......TrOy, .............Fu1ton, ....................Fulton, ..............Route No. 7, Fulton, 1414 Balmoral Ave., Chicago, 54 Grove Ave., Woodbridge, New Je EDWARDS, PRESLEY WILLIAM .... ....... 1 0 Kingsbury Place, St. Louis, EVERSOLE, JAMES FRANK. . . . . 1: Deceased. ........................Caledonia, Ill. Mo. MO. Mo. Mo. Mo. Mo. MO. Mo. Mo. Mo. Mo. Mo. MO. Mo. Mo. MO. Mo. MO. Mo. Mo. Mo. Mo. Mo. Ill. rsey Mo. MO. EVERSOLE, EDWARD THOMPSON. . . . FRISBIE, Hg REED .... . . ..... . FROST, JOHN ERSKINE .... . ...... FULKERSON, FREDERICK MONROE. . . . . GENET, ABEL MAXINE. ......... . GIESECKE, JOHN WILLIAM .... GILBREATH, GLENN ....... . . . GILPIN, THOMAS STERLING ................ GRIFFITH, JAMES LAFRANCE. .. GRAHAM ROBERT IRVINE GWYN, ADAM RUSSELL HAIGH EKIN HALEY, ROBERT JOSEPH, J HARRISON, JOHN FRANK HENKE, ALFRED SALTZGABER HERNDON, BEN GILKEY HOWDLI, JAMES ELISHA JACKSON, CHRISTOPHER ALLISON JOHNS, MARTIN ALOIS JONES, HARRY PAUL J ULIER, CHARLES WAYNE KERR, MEREDITH LEE KISSLING, ALBERT JACOB KRUEGER, ALBERT CHARLES KRUG, LEWIS STEWART KUHN CARL HENRY LAMAR JOHN BDRKELEY LANE, CHARLES DENISON LEVITT, GEORGE GRAY LONG RICHARD NORTON MCCLINTIC EUGENE SENTRE MCDOWELL, ARBIE C MARTIN EDGAR E MARTIN TRUMAN JOSHUA MASON RAYMOND BRADEN MAYER G FREDERICK MONTROY DANIEL GEORGE MOORE, JAMES H MORRISON THOMAS KIRKPATRICK PARKS EDGAR ANDREW, JR PLNN, GEORGE STEWART PENNEY USHER HAMPTON PICKETT, JOHN GARNETT GUTHREY RICKENBRODE, HOLTON ROB RTS ROW1' THORNTON B RUSSELL, FRANK WESLEY SEEBURGER, HUGH VICTOR SMITH JAMES ROGERS JR SIMONS, AUBREY HAYS, JR STARRETT, LLOYD GEORGE STUART MARION FRANCIS TAPPEN, HARRY BROWN WATERMAN, JAMES HENRY WEAVER, JOSEPH UPTON WEIGHTMAN, DEAN EDWIN XVELLES, WILLIAM PERKINS WILLIAMS, FRANK LYONS . . . . .CaledOnia, ..............WellSville, .........,.........Plattsbu1'g, ..........809 W. Sixth St., Sedalia, Mo. Mo. Mo. Mo. . . . . . . . 610 E. Twentieth St., Tulsa, Okla. 1004 Moreland Place, Jefferson City, ... . . . . . . . . . . . .800 Sixth St., Boonville, ,..........................FultOn, Perry, Montgomeiy City, Route NO 3 Pans, 1500 W Main St Jeferson CIty, MO. Mo. MO. O 0 403 W Poplar St Paragould AIR Fulton, Troy, Fulton, Troy, Peny 607 Moffett Joplin, Memphis, 2306 Paik Ave, St Louis Kennett, 313321 St Vincent, St LOUIS, G1ego1y Landing, 5072 Raymond Ave , St Louis, California, Route No 1 Fulton, 4160 Lindell Blvd St Louis, M M M M M Wilson, Kan Troy, Mo Pelly, MO Odessa, MO OKean Ark 1324 S Boston Ave, Tulsa, Okla 609 S Denvei Tulsa, Okla Richmond, Mo O355 Peishmg Ave St Louis, Chester, Oo Cheiiy St Jefferson City, Stet, Louisiana, Troy, 52 6 Watelman Ave, St Louis Miami, Avalon MO I M f Ab IOS Apaitments Little Rock, Aik Chaileston, MO St Challes, MO 1448 Madison Ave Memphis, Tenn 5477 Enlight Ave St Louis, MO 6503 King H111 Ave St Joseph Mo Peuy, Mo Woodbudge New J61Sey 406 Jeffeison St Jeferson City Mo Savannah, MO Mound City Mo 3716 Cential St Kansas City, MO Sllex, MO 1 1 1 1 .....................................,.. . Mo. , .................................... 1 1 ' M. 1 ..................................... . , M. , ................................. . ' ., ' MO. 1 If 1 1 R ...................,.... . ., , AW' ............................................... MO. 1 1 1 ............................................ MO. 1 ' 1 1 ............................................... MO. 1, 1 ................................- ................ M O. ,Mo. , ' Mo. 1 ................................................. ' MO. 1 ............................. . . ',MO. 1 11 1 ................................................ MO. . ' . ' MO. 1 ................................... ' ' ' ' O. 1 ............................ . . ' O. , 1 ............................................... ' ' O. , 1 .................................. . , . O. 1 1 ........................... ., . O. , ,....................................... - ........ . , .,.......................................... . MCKNELLY, ROBERT DEWEY .......................................... ' , . , .........-...................... E . . , , ...........................-.. . ', . , .........-.............................-.. ' . , , A ............................ E ' I ' ., . . 5 , 1 ............................................ ll. 1 1 ' ..................,.............. 2' H ., ' O. , ......................................... Mo. ,I 1 .............,........................... MO. P 1 1 ................................................ Mo. ,W ...................... 8 '- . . ',Mo. 1 - ...................................... ' 'MA 1 1 , ' E ....................................... , MO. u, ........................... ol ' ', ' ', , ' ' , ..-.................... - ' ,, I . ......................... 'I' ,, , ' , ' ' ...................-... W ' ,, , y . , .........................-................-... , I I ..........-......................... 'I , ' : r-ik: THEQHQQQ 0 BLUE Q-JAY 9 , -:human -..,..,.l. ,.,,,...,,,-,,.,w,,, .W,,,,,,,f .,,: l..,.,....q...X..x.,-.-.1-rvufm,..--W 4 .A-, ' gl' Y 711 1 U lr V.. 1 Q ' I I ' ':- x --R 'ii I le - , A , .ff ,A ,Q 2 . - 1 I- I . I V ' 1 i A Y ' , ff, H ,M L I! sig. hx If 4 ' l Q 0 I E nik: T11-EEO HQJQQ 0 BLUE Q' JAY 5? X -rf The Student Body W. MAUEIGE BACKEE OFFICERS Presfidevfat - - NV. LIAURICE BACKER Vice-President - STANLEY M. TVILSON Clerk ' - - J . EVEEETT BENNIE President Athletic Board - GUY M. PITTS 1 Q -V 4 L r-ik: Timmgneee 0 BLUE -,JAY '59 g The Student Council The first of this college year a revolution took place in the Student Body, resulting in the abolislnnent of the old constitution, and the birth of a new one. By the new plan tl1e political strife, formerly so harm- ful to the interests of the college, as a whole, was done away with. New the Student Council, the governing body of the students, is appointed by the faculty, two niembers being appointed from each class, and one from the faculty. The menibers are: Seniors, XV. Maurice Backer, XVIII. iWalker Johnson. Juniors, YV. Trago Garrett, Stanley M. Vlilson. Sophoniores, Harold H. Hamilton, Lex Meyer. Freshmen, Presley Edwards, Robert Dewey Melfnelly. Faculty, Dean George B. Sweazey. I 0 0- l I rim 'IFIHIIEO 119912 Q BLUE 0 JAY 5? . : D o 0. ci I l 0 0- g . rfiki e V- '11r1H11E- 11999 - BLUE Q JAY Q? 1 The Young Men's Christian Association Until the organization of the Christian Alliance the latter part of this college year, the Y. M. C. A. was the only definitely Christian body on the Westiniiistei' campus. It has always had as its aim the serving in any way it can the men who come to this college, and this work has in the past taken, for the most part, the form of meeting the new men as they come, securing for them a suitable room either in one of the many homes open to students, or in the dormitory, if their reservation has not been made, in helping those who wish to pay part of their expenses to find work, and in the many ways needed by new men coming to Ful- ton for the first time. 1 . , The Cabinet this year has endeavored to keep up the work as in former years, although the yearly budget was short of the mark set as the lowest possible figure on which the Y. M. C. A. could operate. This year we hope to have the full amount raised, and the work of the Y will be larger in proportion. Three men were able to go to the Hollister Conference at the close of the college last spring. It is hoped that a much larger delegation will be in attendance from here this year. The men who went last year were VV. Maurice Backer, Wm. Walker Johnson, and J. Everett Ben- nie. The Association wishes to thank the people of the Fulton Presby- terian church for their financial assistance in sending our delegates each spring. These conferences are perhaps the greatest source of in- spiration open to the college men today. Vile are glad to have had with us this year Dr. Lampe of St. Louis, who conducted a week of meetings, speaking each morning at chapel, and holding a meeting there each night also. We feel that these meet- ings accomplished a very real good in the student body. 1 1 ' mm '-f..m:mf.:vz.-1:-:.v:1u.:-z .wwe-,-. . 3 11 .:: Lv'm -E if 11 it .1 fi Qi E :fc M Vffil TIEIIEQ IEEE -A BLUE 0 JAY- Q' The following men compose the new Cabinet, elected this spring: P'l'6Si6lC'lZt - Vice-Prcsiclent Secretary - Tl 6,CZS'LW'67 - Faculty Advisor A. il. BROWN i . WALDO BARRETT FRED XVINI. GATES J. ATIIINs PARKER J. FJVERETT BENNIE HAROLD H. HAMILTON LINCOLN BARKER HENLEY BLAIR IJEX MEYER V The Old Cabinet, which carried on the Work up until the election of the above men, is as follows: President - Vice-Prcsiclemf Secretary Treasurer - ' f 'HAROLIJ H. HAMILTON , J. ATKINS PARKER VV. YMAURICE BAOKER J. IEVERETT BENNIE JAMES P. HICKOIQ XVM. YVALKER JOHNSON FRED VVM. GATES LEX MEYER r'-iko, THEQ HQJQ422 Q BLUE 9 JAY 'Q-'J N , ,. Delta Tau Gamma An honorary fraternity for upper classmen, who have been chosen for exceptional ability along the lines of literary activities, journalism, and scholarship. ' . Delta Tau Gamma stands for the advancement of the highest ideals in journalism, and especially in the publications of this college. In the past, the editors of these publications have been chosen, with few eX- ceptions, from among the members of Delta Tau Gamma. mor Row Charles B. Grow Lee Carl Overstreet Mitchell Duncan XVIII. Walker Johnson BOTTOM now Wm. 0. Sawyers J . Everett Bennie John 0. Roberts IN FACULTATE Franc L. McClue1' Michael D. Burke ' W. Jackson Hamilton 1 Q Q 1 44TH I 4 ,44 44-4 4' 44 4 444 4 4 4 4 '4 ,4 44 Q44 4 4 4 I 44 4 4 4 4. 4 4 4 4 1. 44 4 4 4 4 '44. 44 444 44 4 4 4 444 '4 44 4 44-4 4 34 4 Q 4 444 4 E 4 4.4 4 44 4 4 4 IV 5, 44 4 44 44 4 44 4 4 4 4 4 4 I 4 4 4 T 4 ' 4 4 4 4 4 4 '44 44 44 45 44 444, 44 4 4344 4444 4 44? 444 , V 4 1- st, Lag The Mustard Seed The Mustard Seed is famed as the organization that puts on the Blue Jay Fair each year, and uses the money raised by its Various activities for the promotion of athletics Or other student interests. OFFICERS AND MEMBERS Kernel ---- O - WV. MAURIOE BAOKER f WVM. TVALKER JOHNSON Main Brcmches - 4 EARNEST SHELBY LKENNETH BROWN FREDERICK ROSSER STANLEY P. CLAY FRED BELL MONTGOMERY VOLMER H. FRIEOHEIM J. EVERETT BENNIE 1 Skulls of Seven Founded in the Catacombs, A. D. 802, by Charlemagne. Enjoy- ing an uninterrupted existence since that time, the Skulls of Seven is preeminently a secret society of dreadful mystery, of unknown recti- tude, and of problematical business. Confined 'to no country, time or creed, it has on its roll the names of the greatest of the earth's great The members of this order have all proved their Worth to lVcstmin- ster, and their election to membership is their reward for work in stu- dent activities. ROLL XVM. XVALKER JOHNSON I'IIRAlVI H. POVVELL ALFRED C. BOAND LEE CARL OVERSTREET XV. MAURICE BACIiER JAINIES B. BIEGEDE IQENNETH V. BROWN LEX MEYER J + 6 14 w ll 5 lt I I I A fi !! X . , x .N L'AllianCe THE FRENCH CLUB ' Professor Alexis BenKori is to be congratulated upOn the splendid Organization of the French students Which he formed early in the year. All French students Were eligible to the club and most of them took ad- vantage of its Opportunities for enlarging their vocabularies and enjoy- ing its good times. The meetings Were held in private homes in Fulton and the club is deeply indebted for the entertainments enjoyed from its kind patronesses. 1 OFFICERS President - - VOLMER FRIEDHEINI Vice-President H- - THOMAS O. SAWYERS Sec1 etary-Treasurer - - ARMIN HEIDRREDER A PERSONNEL AUGUSTINE, ROBERT BAKER, TONY BLAIR, HENLEY BROWN, KENNETH BROWN, JAMES CANNON, WILLIAM DETWEILER, OTTO ERERSOLE, ED. EBERSOLE, JIM FRIEDHEIM, VOLMER GIESECKE, JACK HAMILTON, HAROLD HEIDBREDER, ARMIN HOWARD, E. B. JACKSON, ALLISON JOHNS, ALOIS PENN, GEORGE STUART POWELL, CHARLES ROSSER, FREDERICK RUSSELL, FRANK JOHNSON, WM. WALKERSAWYERS, TOM KISTLER, RALPH KREUGER, ALBERT LEVITT, GEORGE MAYER, FRED MORRISON, KIRK MOORE, GORDON NEWBOLT, CARL SOHRADER, GALT SHELBY, ERNEST STARRETT, LOYD STUART, MARION THOMPSON, HURERT WILLIAMS, FRANK WOOD, NEAL kf' . i 'La Constelacion An organization composed of the members of the Spanish department in Synodical and XVGSl2111l11Sl1C1' colleges, under the leadership of Pro- fessor BenKori of lVestminster. The society aims at the attainment of zz higher degree of proiieieney in the use of the Castillian language. This being the second year of the club, the programs and meetings are of great interest. The outing enjoyed in conjunction with the French Club was particularly successful. OFFICERS President - FRED BELL NTONTGOMERY Vice-Presiclemi - J. ED. CARTER Secretary-Treaszweir. . - GEORGE COENWELL BARRETT CREECH MCCLINTIC BEARE CURRY MCCLURE BENNIE DARLING MEYER THOMAS BOTTS FARRAR MONTGOMERY VVM. BOTTS GARRETT MONTROY A. J. BROWN GENET PARKS CAVE GILPIN BOSS CARTER GRIFFITH ROWE CHERRY GWYNN SIMONS CHOWNING HARRIS WVELLES CLAY LAMAR Y-' 'Q I1 I I II: I 1 1 I 1111 I I I L 1 ,I FHEJ L 21111 THEOHQQQ Q BLUE GJAYL- I , 1 Q I I 1 1 . 1 1 X I , I 1 1 I I I I 'O I . THE DORMITORY CLUB , OFFICERS Presficleut - - STANLEY M. WVILSON Vice-Presicleut A WVM. K. BEARE Secvwetary VOLMEP. FRIEDHEIM Treasurer - PRESLEY EDWARDS MEMBERS ALLAN, ROBERT P. FARRAR, JAS. T. MORRISON, KIRK AUGUSTINE, ROBERT FRIEDHEIM, VOLMER MOUNT, DONALD L. BEARE, WM. K. HARNER, HAROLD R. PARKER, J. ATKINS BOTTS, JOSEPH HARRIS, MAURICE H. RICKENBRODE, HOLTON BOTTS, THOMAS JACKSON, C. A. SCHRADER, GALT BOTTS, WILLIAM JOHNS, M. A. SHELBY, EARNEST BROWN, JAMES JULIER, WAYNE SIGLE, JOHN F. CANNON, WM. HUTTON KERR, MEREDITI-I L. SIMONS, AUBREY HAYS, CLAY, STANLEY P. KREUGER, ALBERT C. WATERMAN, JAMES H. CHOWNING, JAMES R. LEVITT, GEORGE GRAY WHITE, TEDDY M. CARTER, HARRY, D. MAYER, G. FRED WEIR, HAROLD B. , 1 CATES, FRED WM. MCCLINTIC, EUGENE S. WILLIAMS, FRANK L. j EDWARDS, PRESLEY MCCLURE, GEORGE S. 3 , MONTROY, DANIEL G. I 1 1 , I I I l'-' -o- -o- ' I I I 1 1 1 : 1 1 I I 1 I , I I I I 1 V- 1 'III- WILSON, STANLEY M. rim ...md W Trims reefs sister Q JAY-- '-59 The Dormitory Club Founded in the year 1921, the Dormitory Club began the second year of its life last September under the following officership: President, Hiram Powell, Vice-President, Stanley lllilsong Secretary, Volmer Friedheimg and Treasurer, Ernest Shelby. The purpose of the club is to supervise its social and internal affairs. Under the above manage- ment the club proved an exceptional success for the first semester. A never-to-be-forgotten party was enjoyed and many things which added to the pleasure and comfort of dormito-ry life were promoted. The next semester saw new blood in most of the positions: President, Stanley VVilsong Vice-President, Wlilliam Kellar Beareg Secretary, Volmer Friedheimg and Treasurer, Presley Edwards. Under this regime social affairs Hourished to the extent of two unsurpassable dances prominent because of the unique and novel touches which dis- tinguished them from just ordinary dances. 7 Dormitory life in all of its phases is enriched by the bond of the Dor- mitory Club which wields a potent factor of lVcstminster spirit into an active and practical organization. One of the many schemes for for- warding Hthe welfare of XVOSt1'I1l11SlIQI'H which originated in the dormi- tory was the broadcasting of personal letters to eligibile high school stu- dents urging them to make Vwlestminster their school for the coming vear. If 0 0- .-1 I .ujkn THE Q Il 9942 LBJLIUIE Q JAY El THE GLEE CLUB THE ORCHESTRA 5 0 ., rfikx FIDIHIIEQ neee -A BLUE Q- JAY The Westminster Glee Club This year's Glee Club, the first in a nuniber of years, was made pos- sible largely through the untiring eiforts of RiXey,,and right here we want to say that RiX deserves a lot of credit for the organization he turned out. It was a success in every way, as the press notices from every town in which a concert was held will testify. After returning' from a series of four concerts iII Missouri towns, the club was invited to make another trip, including the second time some of the larger towns they did not make the first tour. Only the pressing duties of college work prevented the second trip, which, no doubt, would have been even a greater success than the first. Tenors FREDERICK R. ROSSER LAWRENCE A. BAL'rzELL CARL CAVE VV. TRAGO GARRETT ERNEST Second Tenors HENLEY BLAIR DANIEL MONTROY ARMIN HEIDBREDER VOLMER H. FRIEDHEIM JAMES R. FRANK L. WILLIAMS WILLIAM K. BEARE I Basses GRAY LEVITT GALT SCHRADER HAROLD WEIR E. B. HOWARD Bcwitoncs CHOWNING SHELBY Ofrchestra Pianist, GUY M. PITTS Saxophones, HENLEY BLAIR JACK GIESECKE Violinist, WALDO BARRETT Cm-net, JAMES R. CHOWNING Clarinet, WM. K. BEARE .... ,. ,X , -,fl . ft .-. f ,,,s Z 47' 45, GWR? 5 ,M pin ir . 1 ,A N A we . 4 x 1 8 H? 5, -'.- , . l A A .rw ez: - ' , t, ,V ,, ,., ,J 'fl ,-cd, . ..4,1...i, V A, SIMS RIXEY 0 0 Jii i lFll'lllE4 1199292 Q BLUE 9 JAY Q V a The Blue Jay Queen A To one of observing eye and with a mind in sympathy with the mind of youth, there can be no doubt as to the location and boundaries of the Principality of Youth and Beauty-Where dull care is checked at the en- trance, and the frown of VVorry gives place to the smile of honest en- deavor and shining achievement. In this happier landia peculiar political situation exists, in that there is no distinct dynasty of rulers-the Queen is chosen by popular vote- yet this is a principality, not a republic. There are certain qualities, certain attributes which must be possessed in the highest degree by the one chosen to rule over this most peculiar realm. Fortunate are We in having among us one upon Whom the Gods have bestowed in royal degree those qualities-beauty, charm, Wit, grace, which with intellectual attainment and executive ability combine to dis- tinguish a Queen from her subjects. Our choice is made-Miss Ruth McCoy, of YVilliam lVoods College. May our every effort be directed toward making her reign one of happi- ness and success to Her Majesty and to 'her Willing subjects. I 0- o- ' I -rv-.'.'-. , ' i,,,Q51:LQY1,g,i,,i,,g-Sv'' 4 I fy' W :+'.5:?ZE ftgjggggfglgfgflwwW3ip3fj5?,gQ5,:2 , ifgfjvfqh.f,,f,f,j'!fQ. A-LLJMJJ.-1,h::fL4f3'32iQmf2: X im. ,:3.1ig,.f wizny 1 - MISS RUTH BI,COYI, THE BLUE JAY QUEEN .. f-m,,-..., ,E,.k..,.,.LA,.--......,,,, W W . . W4 'A ' 4' ' DVSX! I TIRIID - I sara - IRLIIII: - JAY V The Christian Alliance For a long time there has been no organization of this kind at XVest- minster, and the need of it has been more or less pressing since the Vol- unteer Band Went out of existence here some few years ago. Shortly after the Student Volunteer Convention here this winter, a1I agitation to form an organization of that movement was started, but not enough men were interested in foreign missionary Work to Warrant it. Finally a group of men interested in various forms of Christian Work got to- gether, and with the help of John Paul Jones, one of our alumni friends, and Prof.', Barker, outlined aII organization to suit the needs of all. With a charter membership of eleven, each filled with tlIe optimism of Christ, the Christian Alliance expects to do much for the Kingdom. The stated purposeof this organization is fourfold. First, to foster the mutual fellowship, provide for the coniidential exchange and solving of the mutual problems and questions, and to promote the general con- secration of the men in Westminster Who are planning on Christian work. Second, to endeavor to assist other men in the school to a pray- erful decision and choice of lifework with a view toward enlisting as many as possible in the service of the Master. Third, to eXert as much influence as possible upon men preparing for this kind of Work in prep- aratory and other schools to make Vlfestminster their choice of a college. Fourth, to dedicate itself to the spiritual Welfare of TWestminster Col- lege in any Way in which opportunity may present itself. ' OFFICERS Presiding Oyficer - GALT SCHRADER S 6C1'6?fwTy A - - - - KIRK MORRISON HONORARY MEMBER LINCOLN BARKER CHARTER MEMBERS FRED WM. CATES FRED HOCKEMEYER KIRK MORRISON VICTOR DRUMLIOND NVAYNE JULIER GALT SQHRADER -A. R. RUSSELL ALBERT C. KREUGER LTARION STEWART HAROLD WIIIR GLEN WILLIAMS - At the time of this Writing, Aubrey Simons had handed i1I his appli- cation for membership in the organization. ' I V 0 Q r-Tk: V THEQ-HQQQ Q- B1LtU1E 'JAY I 5 Eiiierarg aioqgvfc-2-1 l s Trims need to BLUE 0 JAY 39 WILLIAM ORR SAVV YERS p Dobyns Oratorical An oratorical contest is held each year to select the orator who will represent VV6SlLI1'1l1lSlL61' in the State Oratorical Contest. In 1910 a friend contributed a thousand dollars in the name of Dr. VV, R. Dobyns to provide a prize of fifty dollars each year for the winner of the contest. The man receiving second place represents Westnuilister in the capacity of committeeman at the state contest, and the third prize is five dollars. The Winner of this year's contest is Mr. WVII1. O. Sawyers, who Won second place last year. Charles Grow and Stanley Clay tied for second place. r-TE 'nj-QEQ 119929 - EFIKJE Q JAY 9 The Publication Board This body has charge of the two VVGStl'I'1lIlStG1' student publications, the Fortnightly and the Blue J ay. The board is made up of one man from each of the four classes, the editors of the Blue Jay and Fortnight- ly, and one man from the faculty. Senior Class Junior Class Sophlomore Class F'res7mm1z Class Editor Blue Jay Eclifor Fortuightl Faculty Member YVM. O. SANVYERS CHARLES B. GROW VOLMER FRIEDHEIM HENLEY BLAIR J. EVERETT BENNIE LEE C. OVERSTREET FRANC L. BTGCLUER r ay? 1 k fl U2- li lx! 1-v rim in A WQPHEQHQQQ -1 BLUE QJAY J LN , gf 1, , , ' W re Off Hlghtl 'E gf: -- Av rf I v . ,. t K V Pj In I ,f ,kv . ' In 5 M A WCSfm1US'tCf Col lege , ' . 15 J 0 . X Fullofn, .Missohx-i, Jan.'flSg -I ' , So. V YS FRQNL C , Ad , Vai, vi I I 1 ,'?'313. A' T, rw.: Us . S121 2 ff l .i'l'3 -, , mes' Kwai K V',, 57 I? MMV, N V, .fa 'zw '-mul : N fb? U98 FQFNKQQH .Signed BvUh+Shron6P m S!fi,QflgQ!.,.L1Qg7QQ1gy1i,9n.1Aggies' was aces x , . - 1 liieijgi- 1 A ' M1'Q: 'Mn' ,'.V 1 ' '1 all 0 he 5. 7 3 .. 1 A V. :Ei W .arf .,,, f .7 I - ,PIP A ' V L I 1 ,v,k ,, I r Viz, 3, ,,,L 1 l l xl il 1 9 I 1 rr c rim -A Q-T11-HJEQ nenaa Q BLUE Q anal The Westminster Fortnightly 'A magazine devoted to the interests of the students, faculty, and alumni of NVestminster College. It is a member of the Missouri Col- legiate Press Association, and as such is in a position to report to the students of Wfestminster the doings of the other colleges in the athletic conference and throughout the state. The Fortnightly got off to a bad start this year, the business manager resigning on account of ill health shortly after the opening of the col- lege, and before he had had time to secure the necessary ads' to put out the first issue of the paper. Plans are being made to insure the early commencement of publication ne-Xt year, however, and the Fortnightly promises to be a real force in the life of the college, as it has been in past years. A The Publication Board has chosen as the editor forthe coming year Volmer Friedheim, and as business manager Stanley M. VVilson. THE STAFF ' Ectttor-in-Chief fiirst semesterj - CARL OYERSTREET Editor-vm-Cltief Csecond semesterj - P JOHN O. ROBERTS Business Manager - - BIITGHELL DUNCAN REPORTERS D01'mit01'y - - VOLMER FRIEDHEIM Beta Theta Pi -. CARTER SLOAN Phi Delta Theta USHER PENNEY Campus Editor J. EVERETT BENNIE r-TE THEO 114999 -A BLUE Q JAY V The Blue Jay Staff Editor-iii-Chief - - Business Manager Associate Editor Sport Editor Y. M. C. A. Editor Siiapshot Editor Life Editors 0 I J. EVERETT BENNIE STANLEY P. 'CLAY BQITCHEL DUNCAN USHER PENNEY FRED VVM. GATES HAROLD R. HARNER STANLEY M. VVILSON JOHN O. ROBERTS 1 Ti p The Debating Team Under the coaching of Prof. Franc L. McCluer, the debating team has enjoyed a year that is unusual even for the NVestminster team, which is accustomed to victory. Six straight debates without a defeat! That is the record of this year's team. The three new men on the team proved themselves worthy of their selection, and the men from last year and the year before showed up in even better form. The Wyfoining trip was a new feature in the debat- ing schedule, and was also a decided success. At Laramie the question was Japanese Immigration, the other debates were on the Closed Shop. The record for the year 'is given below: Our Men Held at Date Opposing Team, Decision for Meyer and Fulton' April 3 Pittsburg Westminster Johnson NOTIUZI K C't . . gfgqtfgi anigin 1 Y' April 5 K. C. University Westminster D ' ' L ' W . gijfstiggt arzlillign yo April 7 Univ. of Wyo. Westminster G' , O ' t' t . . lggd Jgjisoiqee Fayette Apr1l12 Central College Westmmstey o 1 t- i A Vefiliijonand Fulton April 21 Colo. Ag. couege Westminster Grow and Wilson Fulton May 2 Culver-Stockton Westminster THE TEAM STANLEY M. WILSON LEX MEYER LEE C OVERSTREET CHARLES B. GROW WM. WALKER JOHNSON STANLEY P. CLAY President Vice-Presiclerwi Secretary Treasurer Presficlerat Vice-President Secretary Treasurer President Vice-Presficlefnt Secretary Treasurer Philalethian Literary Society OFFICERS FIRST QUARTER SECOND AND THIRD QUARTERS FOURTH QUARTER W. 'W. JOHNSON CHARLES B. GROW J. EVERETT BENNIE JAS. T. FARRAR STANLEY B. CLAY H. H. HAMILTON F. R. ROSSER J AS. T. FARRAR EVERETT BENNIE G. FRED BTAYER F. R. ROSSER JAS. T. FARRAR SRU 'll ll'lllE0 1199292 -A BILIUIE 9 JAY 'S9 I The Philalethian Literary Society This society holds the enviable distinctionof being one of the two first literary societies west of the Mississippi river. It has continued to func- tion since 1854 as a Society for the free discussion of prdnic questions and as a means of training the student members in the art of debating and public speaking. In the past Philalethia has upheld a reputation of the best, both in the realm Of intersociety contests and in similar events open to all. This year all but one Of the men composing the NVQ-Stminster debating team are 'Lethiansg last year the entire team was composed of our men. . The Open house, a famous feature of the year with the society, was Varied this year from the usual program of essays, Orations, debates, etc. A minstrel show comprised the entire program, and was put On in its entirety by the members of the Philalethian Society. The show was held in the Swope Chapel, and not since the graduation exercises last June has that building been SO well filled. The many and unusual feat- ures were the cause Of much discussion and praise. Plans are being made at this time for the entrance of a squad Of men in the forthcoming June Contest between the two literary societies. W. M. BACKER WALDO BARRETT W. K. BEARE J. E. BENNIE HENLEY BLAIR ALFRED BOAND STANLEY CLAY MITCHEL DUNCAN PRESLEY EDWARDS ROLL JAMES FARRAR VOLMER FRIEDHEIM JACK GIESECKE C. B. GROW HAROLD HAMILTON M. A. JOHNS W. W. JOHNSON FRED MAYER LEX MEYER L. C. OVERSTREET J. A. PARKER F. R. ROSSER FRANK RUSSELL W. O. SAWYERS J. E. SHELBY FRANK WILLIAMS NEAL WOOD I 0 0 I Presiclerit Vice-President Secretary Treasurer Critic . Presideut Vice-'Presideut Secretary Treasurer Critic President Vice-Presideritw Secretary Treasurer Critic K Philologic Literary Society OFFICERS FIRST QUARTER SECOND QUARTER 'THIRD QUARTER FRED WM. GATES FRED HOOKEMEYER ARMIN HETDRREDER JOSEPH BOTTS S. M. WILSON H. R. HARNER S. M. WILSON ARMIN HEIDBREDER JOSEPH BOTTS ALBERT KREUGER S. M. WILSON E. B. HOWARD KIRK MORRISON ALBERT KREUGER FRED WM. GATES nik: 'IPIHIIEO nemo -A BLUE Q JAY 3 I The Philologic Literary Society The Philologic Literary Society was organized in 1852, shortly after the founding Of Westminster as a college. Growing with the college, sharing its successes and its reverses, the 'Logic Society has become more than a mere society, it is an institution, endeared in the hearts of all who have enjoyed its fellowship. The men who organized the society were imbued with the idea that well-rounded education demands more than the mere pursuit of knowl- edge gthey believed, and rightly So, that to be a man of culture demanded the ability to stand before an audience and express thought clearly and concisely. Striving ever to maintain this high ideal, the 'Logic pro-A grammes of today reflect this spirit, which has been the guiding light through the society's seventy years of service. VVith the conclusion of this school year, there will be left in the an- nals Of the society the record Of another successful season's work. Knowing this, the society looks forward with keen anticipation to the coming year, when new and greater achievements will be added to the already long list of the triumphs of the Philologic Literary Society. 4 BUTTS, JOSEPH BOTTS, WILLIAM CATES, FRED CRUMP, EDGAR ECKLER, CLAREL HARNER, HAROLD HASTINGS, RODNEY HEIDBREDER, ARMIN HOCKEMEYER, FREDERICK HOWARD, ELWIN ROLL JULIER, WAYNE KREUGER, ALBERT LAWRENCE, HARVEY MCCLURE, GEORGE MORRISON, KIRK RICKENBRODE, HOLTON SIMONS, AUBREY STEWART, MARION WEIR, HAROLD WILSON, STANLEY O 0 l I rikl L THEQ nomo Q BLUE Q JAY.- Y S? f1.elUf.f C19l.1y,,tf, 'VWW2 Order of Debate Degree of Special Distinction WV. MAURIGE BACKER Order of Debate - Degree of Proficiency - WM. WALIKER J OHNSONl Order of Debate - Degree of Fraternity - L. M. BALTZELL. Order of Debate Degree of Special Distinction LEE O. OVERSTREET Order of Oratory - Degree of Fraternity - ' WM. O. SAWYERS Order of Debate - Degree of Fraternity - CHARLES B. GROW Order of Debate - Degree of Fraternity - STANLEY M. WVLLSON Order of Debate - Degree of Special Distiction -- STANLEY P. CLAY Order of Debate , - Degree of Fraternity - LEX MEYER 0- 0 g I rim T THE- 1191929 - BLUE - JAY 3? Pi Kappa Delta Pi Kappa Delta is a national forensic fraternity, founded at Ripon College, Ripon, NVisconsin. There are now 55 chapters in the United States. The purpose of Pi Kappa Delta is chiefly two-fold. It provides a graduated reward of merit in collegiate forensics, 'thus giving encour- agement to and recognition of proficiency in the fields of oratory and debate. It also furnishes an organization of collegiate debaters and orators that aids in bringing these lines of collegiate activity into the prominence they deserve within the colleges, and also aids in bringing together the representatives of different colleges over the country in a spirit of fraternity that adds much to the interest and pleasure of in- tercollegiate contests. Vlfestminster College has the distinction of having the first chapter of Pi Kappa Delta to be installed in a Missouri college. Missouri Alpha chapter was installed at Westiiiiiister on April 26, 1919. The installa- tion of the chapter and initiation of the charter-members was performed by Dr. John M. MacArthur of Manhattan, Kan., who is ex-National President of Pi Kappa Delta. The charter members of Missouri Alpha chapter are F. L. McCluer, J. P. Jones, Howard Kelly, Jr., J. R. West- brook, E. F. Kimbrell and G. Garrett Grant. - This year's debating record of victories adds materially to the glory of Missouri Alpha. Four new men were added to the chapter roll this year. Missouri Alpha of Pi Kappa Delta is looking forward to the years to come, con- fident of her strength and security of position. I 0 0 I -Vik: T11-IIJEO 119942 4 BILIUIE f- JAY 1' fs? ' owfi-1 M V, s., Q-.-.sun - . 5 ---.......:... 1 1 FSR! 'II 1I'1IIE3-' 1199242 Q BLUE JAY , Q . I-KWQQQ-7--1 he ff f ll'IH . W vii! W fl 1 M' - 'if it , . 1111.17 ' ' ' iff- Q 1flI1!-N 3 A -1:5255 I ge-is 2- T. A. LYCHE Captain and Tackle Captain Lyche Was considered one of the best tackles in the confer- ence for two years. Always fighting, he put the courage in his team. Lyche was playing his third season with the White stockinged Blue Jays and it is fondly hoped that he can see his Way clear to be with them his fourth. THE 1921 FOOTBALL SQUAD W GIH-LIL 11- C5 6562 -0 'HK 'II EMD fo Hn KV Fgkl THE - 1199992 - ELUET- JAY 5 LONNIE HAMNER fFaty Guard Fat was one of the best guards in the Conference last season and he rightfully earned the honor. This was Fat's second year with the Blue J aysg if his home town can possibly exist without him he will again don the Blue sweater with us next fal . J. E. SHELBY Captain-Elect PHILIP BARKER QPhi1J H alfback In his three years at West- minster, Phil has developed into a fighting football player of the highest type. A tack- ler that puts the conlidence in his teammates is Phil. We predict a big year for Phil when the football season rolls around. Shelby has given Westminster two years of aggressive, hard-playing football. He was rewarded by his team- mates by being elected captain for the 1922 season. The Blue Jays are fortunate in having as brilliant a leader for the approaching football season. O 0 I V-TE TH-HIE Il 499942 BLUE JAY S P CLAY CStanJ Fncl Not even the 1efe1ee got alound Stan It can be safe ly sald that Stan was one of the haxdest tackle1s m the state What he lacks The 1922 season ought t find Stan makmg 1115 thud yeal as a Blue Jay a tll ulnphal one T O MEREDITH fTommyJ Quaatef and Halfbaclc F I' WHITSITT fF1eetJ Halfbaclc He ca111es a Vely app1op 11ate mckname because Fleet he 1s, especlally when he 1S cauyxng the ball Fleet W111 make the 1922 season Ins W111 also make It a mlserable one fol opposlng teams Hes flom Kentucky need mole be sa1d It mlght be safely added tho that when lt came to the old ight and gut Tommy showed mole than h1S shale He has plomlsed to be wlth us next telm hls thlld 1 v V 1 '- . in A V 1 V ' ' ' weight he makes up in ight. ' seeond and last one but he L 1 o ' I - ., I r-im 'Truim Q' Home fe BLUE 0 JA.Yp 'EF K. V. BROWN C-Kennyj Halfback Kenny played his second year like apveteran. Being hampered all season by in- juries did not dampen Ken's iight. We hope he can be with us next year. A C. W. MASON fCyh Halfback ERSKINE-FROST Uackl Guard cmd Quarterback Jack started the year at guard Where he acquitted himself nobly. Talent will out tho, and the last two games found Jack calling signals in the backfleld. If Jack does not' develop into an All-State man next year We miss our guess. A bad ankle, numerous boils, and other ailments dear to alfootball player, did not keep Cy from making a name for himself as' a backfield man. Cy will be with us next year to make his second year a glorious one. ' offf 1 I. I F il, Vik: '1r1H1n-39 room Q BLUE Q- JAY '37 O. G. CLAYTON -fB1ueJ End Blue made his first year a big one. He was never known to miss a pass and very very seldom did he miss a tackle. Blue did not out- weigh any of his opponents but he often outfought them. v J DEWEY MCKNELLY fMacJ Guard and Center CHARLES UD. LANE fChar1ieJ Center A credit to any team's line and sure death to the oppos- ing line. Charlie, playing his first year with us, was a fast, snappy, and aggressive player. Great things are ex- pected from him in the 1922 season. When it came to plugging up the center of the line Mac was always there with a vengeance. This was Mac's first year and if the Arkansas mosquitoes leave him alone this summer he will be back next year. L ., .. E. J. DEVITT fEdJ -nik: T11-IIIEO HQQQQ 0 BLUE 9 JAY f M G, FREDERICK MAYER RICHARD SWEARINGEN CDickj Eullbaclc Halfback Freddie was our plunging fullback, and seldom did he fail to make gains. Tack- ling was his forte, and few men managed to elude him. With Mayer back next year, we are assured of a nucleus for a backfield and we hope Wcslern sends more like him. Dick, although light, was an exceedingly ine broken- field runner, and seldom did our foes solve his elusive style of running. Dick played a consistently hard game for two years forthe Blue Jays. Eddie added much to the Blue Jay offensive by his ability to boot the ball nearly the length of the field. Fast and heady, Devitt made an excellent end. It was easy for him to nab the passes out , of the air. We hope to see the lifesaver back next sea- son. Resume of the Season From the standpoint of games won the 1921. season was not a success, but the season was a success in that the team fought hard and long in every game they played. The team met the best in the conference and put up a good fight with all o-f them, the scores with one exception will prove that. No alibis are offered, the Blue Jays accepted defeat as only Blue Jays can, beaten by better teams, they acknowledged that openly. However, when Lady Luck smiled it was not uponithe Big Blue Team. Breaks will occur in any football game and it seemed that the breaks were invariably against the Blue Jays. Injuries were al- ways prevalent and at no time could the best team be putagainst the op- position. Then, too, the majority of games were on the road and against the best teams. Under all these perverse conditions the Westmiiister men never made a whimper but went ahead and played their hardest. In summing up a football season it should be noted whether or not the team backed out of any games, refused to playthe best in the con- ference, quit when the score was against them, employed unsportsman- like tactics, and whether they accepted defeat with a smile. When all these conditions are met and answered the Blue Jay season was a suc- cess, and brought honor and glory to old Vfestminster. Q 0 1 E 1. l l . Ai t. ,i ll r E k Q l li i li ., . f s l 15 5 5 if 4 'E F 3 fl 5 T! jx TBGEILJ , fl I le ,E .. FLEETWOOD WHITSITT fFleetj Forwarcl and Captain Fleet of football fame was the captain of the Blue J ay quintet. Speedy, shifty and possessing a 1'G111211'k3l3lC knowledge of the game, lYl1itsitt was undoubtedly one of the best forwards in the State Confer- ence. lYhitsitt was highpoint man of the XY9St1I1l11St01' live. l l r-ik: T11-1115 logo Q BLUE Q JAY.. Q JosEPH Borrs Uoej ' Guard Although this was J oe's first year at basket- ball he behaved like a veteran of many struggles. Joe, although not as tall as his op- ponents, composed an important cog in the Blue. J ay defense by his aggressive and steady guarding of the local basket. V. W. DRUMMOND fV1C, Drummond was one of the best floor men to be 'seen on the local court in some time. He fed the other men the ball and did so in great style. Drummond is due to return to the Blue Jay fold next year and we are all hoping he will do so.' 1 Q 0 1 gjkl 'M-HIE: Q- none 0 BLUE Q JAY '-S? I-I'UBER'r THOMPSON fTommieJ Thompson alternated at center and guard and was at home in any position. A good floor man and a cool player, we predict a great season next year for Thompson. l B. R. CREECH fTroy5 Creech played almost the entire season at guard and certainly gave a good account of himself. Many of the scoring combinations of our opponents were broken up by his speed and aggressiveness. Q 0 1 J'-ik: TH-HIE' 11495942 -1- BLUE 0 JAY Q E CARL KUHN Although not quite a living. telephone pole, Kuhn always 'got the tip-off on the opposing center, and this fact strengthened our offensive greatly. Fast, and a heady player, Kuhn made an excellent center. GEORGE GRAY LEVITT fKansasJ Although from Kansas Levitt played a re- markably fine grade of basketball throughout the entire season. At his position of running guard he was given ample opportunity to ex- hibit his ability and acquitted himself exceed- ingly well. I 0 0 1 r-ik r r 'rr-limo 19942 Q BLUE Q JAY V OLIVER SNOWDEN Speed and accuracy in tossing the ball through the basket are essentials for a good forward, and that is what Snowden possessed. We hope Snowden will grace our courts next year. -. HARRY ERWIN Although Harry quit school at the begin- ning of the second semester, if he had con- tinued he would have undoubtedly become one of the best guards in the state. Big and ag- gressive, he was a big factor in the Blue Jay defense. Resume of the Basketball Season U Starting the season with all non-letter men, Coach Green's team, notwithstanding the games lost, was indeed a success. Witli the eX- ception of one, Captain WVhitsitt, the entire squad was held back by lack of experience. Despite this fact they gave a good account of them- selves in every game played, and could always be relied on to give all that was in them. In lVhitsitt, VVestminster had one of the best forwards in the state. His great speed together with his clever headwork and accurate eye made many points for the Blue J ay five. Much is expected of this team next year, when after a year's experi- ence, they will be invaluable in the making of a championship squad. I Q 0 I l jd DEA L L ' iff l i LP, if: ::llWiiMf '1 ' , A1 A ,- -' ' fa mxxkww , --, Q ,- JY. - p . V 5 .1 A x f---11 f J -' A mi - -:H 34,53 ALFRED C. BOAND Captain and Shortstop By his rnatohless fielding and qualities of leadership, Al Won the captaincy of the Blue Jay nine. This is his last year with fhe old col- lege, and from the start he has made it look as though he will round out the year with a championship team. as 1 -E rfikw - Q 'lPll'lllE Q- 99242 G- BLUE Q JAYo 15 Q 1 5 - ' . ., k A Z 'vvv .X t - A. ' -,- if 5:5 ik' 6' - ' . ki tiff , 2314? 2 Qi I 5' 5 . ,. 5 1 Gila ll 4 15 f . 1 1.3 . f i 1 1 F Q , i , 4 ? Q E 1 f 2? ,sf 2 1 Q 1, Eli? it W., f pf C' E 1 '2559' aft gf ,gif , V -f eff Q lagflgillgllgi if Q4 Q. K 112-l ll ll . ll 3 i - V , 'F u, sl ,l EF 9 l ,-,fir f it . fl ' 11 ., ::- A ,, fi In Pitts, Westmin- This year Usl1 has This is Phil's third ll stei- has one of the best been shifted from sec- year at third base, and lg fielders that has ever ond to first and is hold- he is improving' with jg graced a ball lot. He ing the bag down like each appearance. if leaves us this year. an old timer. if il 'l l l -I 1 1 On account of the rainy season, the selection of the men was made too late to allow their pictures to be made for the Annual. I O -o- , .. .,..iQl e ri-TE 'IFIHIIEO 11999292-0 BLUE Q JAY V Resume of the Baseball Season Owing to a late start on account of the unheard-of rainy season, Coach Pixleevdid not have a chance to size up the material and give it the practice it should have by this time of the year. However, with four letter men back, he found a nucleus around which he built a team that is to be feared by any college team in the state. ' In McKnelly, the Big Blue team has a moundsman of wonderful pos- sibilities. He comes with an enviable record, and has always shown that he is capable of great hurling. At the first of the season, he pitched nine innings against the Cadets in Mexico, allowing them only one hit. Backing Mac are two pitchers of known ability, namely Long and Howard, who are expected to give a good- account of themselves before the season is over. Meredith, who is catching his first season at WVest- minster, is showing up well. The infield, built around Captain Boand, is showing real class. Although several colleges in the State have discarded baseball from their athletic curriculum, the Blue Jays will find plenty of competition in the schools which still retain it, and it is not at all improbable that the first team that Coach Pixlee turns out will be of championship calibre. 0 0 4 The W Club The NV Club is made up of the men who have made a letter in any sport. The club is active in securing new material in the athletic field, and in regulating the activities pertaining to athletics. These men are eligible for the nicdals awarded by Prof. J. B. Reeves for combined excellence in scholarship and athletics. ROLL BACKER EBERLEIN MGCUE BARKER ERWIN MCKNELLY BQAND FROST OVERSTREET Borfrs HAMNER PBNNEY BROWN, A. KUHN PITTS BROWN, K. LANE POWELL CARTER LEVITT SHELBY CLAY LYCHE SNOWDEN CLAYTON MASON SWEARINGEN CREECH MAYER THOMPSON DEVITT MEGEDE WHITSITT DRUMMOND MEREDITH rfiks ,L THE0 HOQQ -f IBSILIUIE 0 KUAYL 'Q-'J Athletlc Board of Control The Ath18t1C Board 11as chaloe of all the lntercolleolate athletlcs 111 XVestm111ste1, and legulates the 1113.115 affaus pe1ta1111nb to such con member f1 Om each class, 1 f acuity member, and the chrector of athletlcs KELNDTH V BROWN A J BROWN ALFRED O BOAND GUY M PITTS PHILIP C BARKER PIIRAIVI H POWELL DEAN GEORGE B SWEAZEY JAMES F PIXLEE Coach 1 N . 10' C . ox. H . . 'I I . 1 1 h I r . 1 1 . . 0' - tests. It is composed of the captains of the various athletic teams, a ' ' z z 1 C ' - ' . T ' . 7 . . 7 I 1 a In ' . J. ' 7 rikx TH-EEO nose Q BLUE Q JAY y 'V The Cheer Leaders H b WVith Guy Pitts as the head cheer leader, and assisted ably by Harold NVeir and Volmer Friedheim, the Blue Jay student body had a corps of men who put every ounce of pep they had into the job .of turning the stu- dent body into an efficient noise-making machine. In a position Which demands an unusual amount of personality coupled with real hard work, these men succeeded admirably, and the vote of thanks of the Blue Jays goes out to them. A I Q 0 I 1,1 'x i 11' F 21-5 5 : 315i 1 if , . I i , H 1 1 1 1 'T 1 1 1 I . 1 , V 1. 31, 1, W? 1 '1 QI EY, :N I fi 5 ! 1, I 5 1 1 1 1 1 ! 1 1 Liu rim THEQ 11992 -f B-HATE Q- JAY1 ' 0 o- fi THE Q' 11 QQQ ff BLUE ' JAY r f fW,,ff',74N' ,,q21f' ,'QfJ 'iff gf Q f ,w .riff ffa- f ff . X, Mzfgygfgfgy ,.f ,aCQ:?pf! I V f-4 ,sow . ' !ff'5ff 1' wi f f o ,f x. nf' glfx 1 1 I 1 ffalf' A ' , . 4 . .1 ifjfff' IJ j,9i ,, g 'f Q , Q' iff. xx x, - ' WJ,-ff f f N ' f , 'fy - s -9,1 A fff tb- .126 fifkfffitif-f-' 1 -M492 X A fa .-x x-1+ .-v!'39-.47-M !fd.',Q:f9fmm4f4'-vp-,9 s' 'JN' -- XA X fifx XxX'1-'-, xg ' s AQ7 -X ff 1 . F . - ' :al +f ,f - -. . -'f x fw k wf y 5. XC W xXse4gv,2,g1h.-2-H:ww: X . , - wig. ,, X QS2, ,-235511-.f'-1.'-QK'r LV' .1 PX 1 - fi,-naw M, 4, f 2 X P? - 1 2 - ii'Q:?f -'fzf-UF3 1 '54 :J . X f -3'Z :fQf1-,-'-GY'-Q14 ? S X A M 1 5'?1.1ilfR f 1 xv f- 'A X ' , ' . LL-1 12110 -fy -Q , - ff' k' Lf W QE .. aw fm' ,:X. ' ,f . .. rj T X y Q :-Q41-.fW'91Q f n, :QTY 'fi L e.QZiiA.N51-.--mfr , E N. 'j f fx - f Q - 2 fl 5 ffsgf X 1? ' V X - ' . ., ' 1-.1 1 .- xx ff H ,, ox aff, An, fl. lf X 5 , ,gi L, 36,55 1:55315-:.1:.-AE . fffffk-' ff .K M if ff my M- 1 , X Zga-uf-vf . - ,. k ' nuff- -'H H-f' G ' f4ffL'f,3f Z a , f L:: 'Q' . ,dv f if , l , M , f , 1 6 ,f .... V ff' xx J- - A ry- . 1? ' Z 4 ' - vQ Ifi H- ' .' 15' 'Jlifxlgf X jf' 4 F' lgfh' ..:. -4- K 5 ,Q 5- - 1, - -.- FR TBR IT 9. 0 if , I EI I I W I Ii I ! il 1 1 1 P I i A V J'-TE i'lPll'lllE-R noofg f- BLUE 0 .JAY W? Beta Theta. Pi Founded at Miami University, July 4, 1839 ALPHA DELTA ,CHAPTER Placed in Westmiiister College March 5, 1868 A. BAKER, LaBe11e, Mo. W. BARRETT, Sedalia, Mo. CHAPTER ROLL LYCHE, Chicago, Ill. MEYER, Jamestown, Mo. T. A. A. M. B. BRADSHAW, Marshall, Mo. F. B. MONTGOMERY, Fulton, Mo. E. CARTER, Fulton, Mo. W. C. SLOAN, St. Louis, Mo. E. CORNWELL, St. Louis, Mo. H. B. TAPPEN, Woodbridge, N. J. R. R. ELY, Kennett, Mo. D. E. WEIGHTMAN, Mound City, Mo P. HIcKoK, Hot Springs, Ark. N. S. WOOD, St. Louis, Mo. D: LANE, St. Louis, Mo. PLEDGES R. CHOWNING, Madison. Mo. J. F. HARRISON, Fulton, Mo. FRATRES IN URBE H. GRANT J. R. BAKER BAKER TERRY E. BAKER N. T. CAVE DR. D. H. YOUNG A. MCPHEETERS W. F. RUSSELL A. D. WILLIAMS o I 0 rim 'JF1I'II'IE0 H9912 Q BLUE Q JAY ,fu , 4 . A gg A , , 1452 :M My 3 , .,- V i Aa, w-Q S .,., ' fy V 4 Q., V4 J-' ,f 31:94 , 2 -. ' , 4 ig NA' ' 'Q .5 , V - L 2? Q ' Q , JDK . ' F 'I ,J 5 F . . x , K e X ' 2 - ,X w , 1 e , M ' s 4 ' A W ' , v s uf Q G F- , 5 in ' , I S , . I , a l 4Q A Qi . o -o- I .wiki Q 'Er-IIE Q IEEE -A JRILIUIE Q- JAY., 5 1 Phi Delta Theta Founded at.MIaITIi University, December 26, 1848 PHILIP C. BARKER, St. Louis, Mo. HENLEY BLAIR, Jefferson City, Mo. JAMES' B. BUCK, JR., Bloomfield, Mo. STANLEY P. CLAY, J oplin, Mo. ' PRESLEY EDWARDS, St. Louis, Mo. ROBERT P. ERERLEIN, Joplin, Mo. J. ERSKINE FROST, Plattsburg, Mo. , HOBART R. FULLERTON, Greenup, Ky. A. MAX GENET, Tulsa,'Ok1a. THOMAS GTLPIN, Fulton, Mo. J. H. ATKINsONA D. P. BARTLEY OVID BELL. S. K. BLACK MISSOURI BETA CHAPTER Established, October 27, 1880 CHAPTER 'ROLL ROBERT JOSEPH HALEY, Paragould, Ark WM. WALKER JOHNSON, Mexico, Mo. LEWIS S. KRUG, St. Louis, Mo. RICHARD N. LONG, Troy, Mo. LEE C. OVERSTREET, Fulton, Mo. EDGAR A. PARKS, Louisiana, MO. USHER H. PENNEY,- St. Louis, Mo. -HENRY E. BOSS, Jackson, Mo. FRANK RUSSELL, Charleston, Mo. LOUIS G. SAEGER, St. Charles, Mo. PHIKEIA JAMES R. SMITH, Memphis, Tenn. FRATER IN FACULTATE DR. COLIN A. MCPHEETERS FRATRES IN URBE E. C. HENDERSON T. H, VAN SANT . O. H. NICINTIRE W. B. WHITLCW C. A. MCPHEETERS S. W. YANTIS E. A. ROBNETT S. W. YANTIS, JR. F. M. ROOTES I .A A rim THEQ HQJQQQ, 0 BLUE Q JAY 5 , 'C' . 6 4 K ,f'w,V F , A - I v Mx M ' ian - Y Y 6 1 'elif hui .- .b A X, fi 1Ib n ,nine ,, ,D up J ',. ' ' ' Z ., ' . - ,--ww,-1771 - . ----f - ,X K N a 'Ffgi , fi ' R, I . ., . , ' . g, Q H 'V X 4 MS. 'if fm Q., 1 . fi . 1 '3 ' . A ,K k Q. o- ' r-TE 'JFIHIIEO 119942 O BLUE 0 JAY 3? I Kappa Alpha Founded at Washington and Lee University, December 21, 1865 ALPHA ETA CHAPTER Placed in Westminster College February 5, 1890 CHAPTER ROLL A. J. BROWN, Plattsburg, Mo. KENNETH V. BROWN, Odessa, Mo. HUBERT CLINE, Fulton, Mo. HERBERT COTRILL, Savannah, Mo. HAMMOND DARLING, Fulton, Mo. REED FRISEIE, Wellsville, Mo. ROBT. GRAHAM, Montgomery City, HAROLD HAMILTON, Fulton, Mo. LONNIE HAMNER, Richmond, Mo. BEN HERNDON, Fulton, Mo. HOWARD W. MCCUE, Fulton, Mo. M O. JAMES B. MEGEDE, Richmond, Mo. THOMAS O. MEREDITH, Harrodsburg, Ky. JOHN O. ROBERTS, Clarksville, Mo. WM. O. SAWYERS, St. Joseph, Mo. I RALPH B. SIMCOE, Fulton, Mo. HUBERT THOMPSON, Odessa, Mo. WM. H. NVAGGONER, New Bloomfield, Mo JOSEPH WEAVER, Savannah, Mo. PERKINS WELLS, Kansas City, Mo. FLEETWOOD WHITSITT, Odessa, Mo. PLEDGES .THORNTON B. ROWE, Little Rock, Ark. CLAY E. BLACK, Wellsville, Mo. FRATRES IN URBE H. L. CROCKETT A. HOCKADAY LEE M. PASLEY DR. E. E. EVANS J. B. JONES ' E. H. 'PAYNE FRATER IN FACULTATE PROF. FRANC L. MCCLUER I 0 0 I -ku- 'TIHIIE 9 119929 BLUE 9 JAY K Q . 9 1 ,r L x A I .A-E...i Stk Hi .. N w V' ik, - X it K' Q -' fi 5' fS 'f,1' L f 1, 1 ' ,, H fzi fi w f ' -...-.4-,Q,..f,., ....., i 'Q fb 70 ' 'f i 'K -' T 'f - ff' ' b V I My 3 0 0- ..,,., Erika 'ir-11-EEO room Q BLUE Q JAY U The Pan-Hellenic Committee Each of the three fraternities is a member of the Pan-Hellenic Asso- ciation. The committee is composed of two members from each fra- ternity. The committee governs fraternity relations and promotes good fellowship between the fraternity men. i . E KAPPA ALPHA WM. O. SAWYEES JAMES B. MEGEDE - PHI DELTA THETA WM. WALKER JOHNSON PHILIP C. BARKER BETA TI-IETA PI I ' CARTER SLOAN FRED BELL MONTGOMERY I Q 0- l rim lv THE9 H999 Q BLUE Q JAY '59 I-17030-T-1 , nik l THE Q 11 9929 Q- 1BaL U1E Q JAY Q 1-QQQQM-2--I A 'JFIHIIEQ 119942 1- BLUE 9 JAY . . .i n wsfevsfbwgir . ,.... !,. ,rf .EJ 1 .. x .F Z. -1' Q. X '-T-,-vi Ei ,.v1,fs!'- .11 Wit?-'ff :-v . in ,f 'f 1 ,::52w.e.QQr1,zf . Nag v-'Pa A-1' .?...5'FF ,1':1Qwy:,.s.m .ga'im1wg,.' . iss- - . .mir . gf..-9e.,.g,Q5.9.fr:v,J.f,E,g fwqf,f.-0..9mp:- f-ywcgff -, ' .1 wa. -.565 fit 9.. z-W? 1i'2f52Tf?Pf4'f'JG2,ii3l19'ffi1gY..' 'S 7342-- 1 ' als- , . .sk ' f.gh,6...i?-Xiwv:a1.a-:-Si-s.,!w:.ffiff fe, - 'fgmxv ,141-9g'Efe'2'. MIR yi ' QfQ1-4.11.9 wp1-4,35e,wme1...4.g5 .,fi' S, , 6'4'99v . V '. 3,5-1.-gp Ai' M g. . g,,.,.k. R'3if4f14,?f5fi'4g51'iW:E-i,x..:v5'5'9-.S .ey - ri-Q ' - A:-av .-r.. 'f.hw51-mg-:'Q'J,1,ywy aw--,., f 1-'p ,' A... '..-12a 7 -ws. .fa - ,ul N .31-1 A kd . y wail., 'Ef3W'i-Q1 Nz! .. ,f'.-a- 1.-.frm-fm-4 554: - .f -4 :I-A, N +1350 . - -9. v Q- I A. - , jivxf yi., -.1'U.,N,,yg,-,.1'..g+':w6-Af!-ugf'-.:g,7v- 4,.p.,:m- .1-. : .,,f1g....-'.'-,W ,L ig ,... .Mg as ' -.0 v 5' u 5245- .f:. 'g-1-ibwtn-Je. :i2f 1'2...:'.q4-.fi i1f-wf W-- Lf-'H x 7-rQ,'-Hwgff-'v ew- - ' - ' -4 3 F59 .fwmv '-9:1-rqgffiqifeggvffigfxqivam,. g-sff4r-1f::r,y P'-'Ni'5-.- fs-.ff-fd .' .. 1 ,. iff? 1 .-- , . ' - J- 1 ,.. ::. -- -'. .. -, 'Vie-'1r.-A .5 ':- v i? ?f.9S'Q3zf f2Y1f5-fi xi':eFfif1.f-.fQi.f5:VLz- JEEP' 0' QE-. 5fc:fSaz fSl's2?-3i? 'r5?'fT6-1:'55S2f2 Ja?-. -1-'52 . 'iQiP.' ' - NET: mu' ,fe ,iw-'S-gf,f+ ' '53 A dh gs-5. -wv.,-'----.wifgw-aa. 555 1:w1'mf-N . -,?.fM.ff, 7.1-f:c,'i':3f4f. 1 1 A 'f-fr-2-x ---Hbibzv' 125- .5'Q'f'-.1 . '13 '-:f.. xg .H2?Q:'S::.-2-fp:iQwL,w-3'ff1r1rf..-.w'.- '1v'.1'-txvl f .rGfr'fz.Q-'S1L'9-'x- 5 N511 X':' -4 -, - 11 -mgv mf NPWLZ' '-I-'-.11-ali-1. 'ag-fr. :nk-E' 'f1?f'V-77-'. MW- Q .QW --. A 'f . vf- di-: YZQ, w Y 1'g4'iS'yq':g-fG4f.',.f3'-.--15552555 -MJ'-f-1gE::,v-1.-ii: 1.-3.1.-f4.'1,,g'z5i:S' 'EQ-.2'12E!Hg I, - ,iw 4 SSW. ,gfq:Z1'3K,Q,.A3..'4.-f,,3g...w,..,,f,.-,.1.,, -..,vXq4ge.'.-..,g.pQ .. u --rijf.,-,-,.q-1-.-fa-y .vsp -if - I as 'g'w':'f wi-' A-1-smiviflaifzz-fa:Me-..3:-,fbziwfa.-af-f-Eff.-41-f vN:.'f .:.'4w::-e,f.f-:ffiw HS 'wiv Q 'Y-fin' -...em..'-'Awewwwn-,.Y3qftf.:-L21-2-w:x.:1-+AfSff:F'a.- :-1-.v1':-t.-'w- f-s:x---f 'wL-S- L' has 1'6- :sail -Q .,,, .1 9, , .ff , - . ,gy -. h...1 ., ,-,-51.2, . '25 .1 '- 4-iiif ' . S f' 'S .fii'r' .. - H351 .Q iw 1.5.2. 9-Y' f' 43 f'1'f:4 1 SEAS' ,T5 ' Q N QQ:- , ,YQ5, Qi. ,::. ,155 ' ? ' .5 z J Bl A55 ,., .. ,, . .. W 55:9 Y-rv' . -if ' vffw P ua.. .,':,u1'm 'YL I - .5 . .543 , Aggtzfp -Sirk .'-Hifi. -:f5s'tZ1.'.'?f.. . . . fi . .:?L'f ,L---1 .-.:-w.x. Q1,,.- .uri 54.52. - , .-, MEF- -A .. r.l7.f.'--541: ,. .:f.'f'Jf iffy. ' . fy Ag.yQ:1g.Q.'ff-4-33,- tj Q:, fj'g1-f5?,:f'95 T3 1134.3-,:,5-1 f' g?3g:1.v-:i3g,2,1 22: ffrgfglh g 24.1.5 '- zqigzgt-2 -. -45.5. f .5 if Un. ,1f11f,5-.sum-rg-'fafg.?: iam.ksf.2u M2gigf..-e?cq1jwZ,4f.zf1.i- 1.-511.1-1 2:-:cg-.-'G my i:1f2.'5.5ai5b1.i..-3 -- ,-L 11-,..NS,: --4.-5-fi-, -1-ig-fin!-.5-Q,--41-Swag! .-.lr :?f7.5:.f.-1-L'.a wff.-1 '31 -:,9:.,. -pb 'Y.-.. .i12:. 1' -15.1-gy,-.-J' ww ---.-.3--.sn 4 r1 'nf'm-.': F UQ.. ...,-,,., .,,,,., 9. ,,.,,, fa X. ,.,- .., . ...J .. ..,., ,. ,, f- W. ,.1..,L-. ., L1,r.v..a ,,,.. .HBTQLL A 4 f, ff?.g':,aF . 2 1 '1- 'lias ',S? +4-2'-'Wi'JFL-'LW ' ' 'm'-1f:WQaq9m..-'f.'.3- Jf1i::Jja2-wt-is?:::T'.-2,2-wwfSmzzl'E.-':af,1'.:Q-Q114:55-.1f'..f-.',:'..x Wh-f'3' ' 'T'--ffiSf'?f'?W,4l' mfwff-155'-Z:-f:r fkY'H1's 215241:fYL'-.-'-f1::f'.'6.:'W-fxQM'-- 'It1'355-ul-:-2-.9i-'3 'Q-'-'-'-ffm-..1 , 25 - 122 .mf3::55.Mgi?,5ZCx 33W33j7f5fjg.5'5.A eE,3f:ij.45j.i'.'!.!YIQ3455E .faq..35j1j.3-3.5.13-A-5I6:5 4... .H 511.595,-Q il ff- .51-,fivvfx -I z',1'1:..ea..-A r. :J , 3.35.-,:'.,.g-1 'gg-W .--. -f -1-Q gf'.g.5,:.,:.g,.-3 yszi- y-11.5. 2: ,..-hi 1 , 1-lmftf .1 4.x,f,1-- 1 X--.... ..1--N..--..-1... ,-,',m.- mx--,.. ..h,..,.. 1,--.-. -1 N .mm 'zz-3g5,g,g4ng1Q..,qf.1,E,:..51..:5..,r15.,..1441 ..:Y-gg....,p:.-.lg..g1w' 4i.g.Rx.-:QQ gig.: -ggi. 1.0.15-.Ly'f.,yf-,1-.: -E'f.'?.f'fs?5f:Q3E5f'f +:fit:z-pas' f?.xe....:.-1? ff rfaifi' 'f?'.feE5 ' LQQ'f1E4'gg.',-'f -ij'1'f55-4:7'.'?'fIg 431- Q,iff'.gg5,iG:Q...kQ5,?j3!151 15 '- 'if:.?'fji4z+ WSE? 'Wffii-uf 15 1115? iff- 2 1'-1.32-ft'L'S if '- i'f1,7 s1'.??f4'1kZf33712 fx-: - R -3ff: 5'T ' '-315.Q43-?i'.,.a?1rFQ5:if,wgi,v1 Qi Q': , .5 npr Yi 5.11 -ai: ng 11.jv.,:?g:- ,1..g-QQQQ.: 2-.Q -.ff Q, as-. ff. 1' 'Q ri'--.fgiygqiy ivq--g5pf.s,::5iQtE,-, -.3 ,, f,.,j,.'i, ,.'F.,.:s.- 314-fir: 'gg em f.f,'- -5. -. I..-X242-9..'.y'. .1' ' Cdv,X'x1 1x-fy: - P.-frZ.1j.1:?.'EP3 d'ff- vi: Q 'fa-3121 .1 -1-.Q 2 f-'. '-1:--3 - rxpi : Jil? 1 -3 ff .: -. 42,0 - -- wwf- - 'L .1 -. W-.-, 515- 1:9-1.-,,.'.-Jw :-,1g. Z.-'q.j:': -:fin -1.1, Q. 4.-.,?' 'if'sLiS?fi1Z..firiefiiitff PQ 5:15 .W-ii-f4 rKe'sQ ref- 35-f.. . 1:3 fr 3. -1. ffl-' 4 Q.: 2 1-' -.i','.lf3ff.?2K.Q 4:f'-'L'1' i--vxygy Q5-gg.13-.X'fl-f16,:5,'p.. 15. -ms if-'X' 4 . '-I1 .1'a- R',:'Q'L .- .-.r --.....- -- -, ,-, - -,L .., ,xii ,- ,.,.,,-LN. H. .. 1, .., '-.,, -. ..-1.-,r 4E',.'g,21319-3Li.X:Q?1E'f, -Y113:lqg,Lx.'.1l1 -v :lar :xx-22. 5-',,g1f': .'e,ff.L : 1' ' .' ..'4-.1-Jeb L--LG! 11153211 1.-mfs-2--1-:-.'rA va-- f.-- - x-, ??.LfG-N, R., .'f. -,1 N., 3--: .'-'-- ,r- ..'-.-:Nq.1- 81'ia4'5Qg,w-ff2:,f. - .1 an 1' .-. .: .-wr pig'- N r-re' 1: 1 -1'-FFR: v-L -+:-L.HN.'-'lf'-J - -SM kv. ryfmzf..1-Fw'...-..yr1-r-.--,.-.-mm. 'f..4rQf.:4!-.41 '-.-: ,- -'f !-3.4513 f. .1111 F L' ' '.' ---:I G1 qi 4 z'-1'-5 --, 39,5 .'.,x'ay.:4 -. .' fm:-3---:,f-,'-A-' 9 0 W I nik: i Trainee node 0 BLUE Q- JAY or V Why do we call this section Samples ? WVell, we might reply that anyone can' ask more questions than a wise man can answer, but that would be inexpressibly rude, and not so good, either. But you know what you would have thought about anyone who would go and put the heading Humor in an Annual. I'll tell you just how it came to us to put this name on this section. We were sitting in the Greek's puzzling over the thing, when here came Willie with one ham sandwich on a plate. QYou know the kind.D Well, right off the thought hit us-the idea Samples, we mean. So we went right off home and put it down. No, of course, we didn 't forget to eat our ham sandwich. I Q Q 1 r-TE THE 1119199 BLUE JAY MAAA, OBJECT LESSONS FOR BLGINNERS The boy sees the mule W1ll tl1e mule SGIZG the boy? P01 haps How d1d the boy get here? He start ed to bum h1s way to a foot ball Came But l1e d1d not know that there xx ere Ma1 1nes 011 the ma1l tra1ns H l1as slept all mght 1n tl1e far mer s mea dow It 11 as Wet there A frog sat on h1s face most of tl1e mbht knd some one had told the boy that bum mme was ef fem 1 nate He would l1kc, to see the per son now He w1ll have to bo to tl1e town and tel e oraph h1s fath er for some mo11 ey May be he wx 1ll r1de tl1e mule S1 Der Marry me, honey? May Bell No S1 Der Love me, honey? M B N o S D Wlll you k1SS me honey? M B No S D G1mme back my chews111C, ,Dum M B THU1Ev Vfwgmm Reel RIGHT Mrs Tattle Look my dea1 There comes Jlmmy downsteurs YV1lTl1 powder on h1S lapel and 101.156 011 l11s sl111t fr ont Mrs P1 attle Yes P211 tl colored clotlnnb Purple Cow 3 9 3 F 1 ffl'- ' 1 N1 1 ' n - ' - 0- I ' 7 '- ' . 9 I ' . - , - o 7 I 0' . f - r ' 0. - - - Q J - I ' - 0' r - -0' ' , - ' - - 1' ' . . Fl? ll? HI? ' A ' 1 . Q O . . . .Z . . . . , . . . , - . ' r 1' 0' 0- . . . - f - -- . ,. . . . Sl' Pl? SF , , .. V . . . , . , . . . . 0. . 1 D . . 1 '- ' o'. , . 1 . 4 ,-.. 4, . .w . 11-1: ' 1 tx is 11 'll 'ull rim firimieo renee Q BLUE f JAY mf t A PASTORAL POEM OF THE SOUTH SEAS 'W After the manner of our friend, WVordsworth. Exemplifying l1is use ti of the commonplace in life-the dull, drab, everyday happenings, which are usually left out of such things as poetry. They are in this case, too. li li 1 i . ' 1: lx , -ssr it gxig fs we -, lt + I li fft , 3 J t r OUR HERO AND HIS MATE I. ' Down upon the South Sea Islands lived a cannibal and wife, And the husband swung a wicked club in times of war and strife, But he loved his wifie dearly, for he only had the one, Which was quite exceptional among the cannibals, my son. II. Now this pair was very thrifty, as most Cannibals were not, For 'twas easy just to slug a man and drop him in the pot. But our hero saw that leaiier years were coming to their shore, For the missionary market was not booming as of yore. III. Now in former years the preachers and the pastors and the priests Had most always formed the motif of the South Sea Island feasts. 'Twas a proverb 'mongst the cannibals that they were firm and pink, And possessed no bitter seasoning from smoking and strong drink. IV. - Thus among the more exacting, haughty advocates of style 'Twas established as a precedent, and known throughout the isle, l That to have the least pretensions to the cannibal elite, One must never be seen eating aught but missionary meat: H .l 0 0 I E .rim THE 0 1195992 Q JBJLUIE Q JAY W? V. In this little point of honor, which to them was very great, None observed so strict compliance as our hero and his mate. But at last the dearth of preachers flocking yearly overseas Made a scarcity in T-bone steaks and other cuts that please. VI. - Even in the higher circles hunger soon became so sore That they flung their honor to the windsy and thought of it no more. Lion hunters and biologists both shared an equal fate, - ' That of furnishing these shameless ones a well4filled dinner plate. VII. And at last there were but two upon that island in the sea VVho were still affiliated with the Social Registry. They had never deviated from the straight and narrow way, Though lank hunger gnawed their inwards, and grew more acute each day. l 2 :MX l X' g O' f X. A N 32 T W' at t h tkv i 455 0 ,S f ' 5 M 3 -'B 'v, J- Yi at A 2, .ez .Ill LANK HUNGEE GNAWED THEIR 1NwAEDs AND GEEW MORE ACUTE EACH DAY VIII. Though they tried by all the intricate processes of the mind Only two unsatisfactory solutions could they iind: A First, they might sustain themselves by eating nuts and dates and figs, Or, they could eat common laymen like those other shameless pigs. I Q -f 1 .rikm frii-1115 Q renee, Q BLUE Q JAY e W? IX. But our hero, once upon a time, had been the very man To declare he 'd rather die than be a vegetarian. Classify himself with monkeys and exist on coconuts, And be cut by all the cannibals within the near-by huts. X. And their plight,'upon the other hand, was every bit as bad, They would have to give up every bit of honor that they had. Under such alterrible disgrace they never could exist, For they'd learned as high-caste cannibals to loathe a scientist. XI. . ' So I'll be quite frank, my reader, and submit the case to you. Having never sailed the Southern Seas, not many fellows do- I-Iaving never seen a cannibal, nor yet his ebon wife, I'll be hanged if I can tell you which they 'd do to save my life. :lk SF PX' ' I XNOVEL SPITTOON PRCMOTES ACCURACY ' A Montreal barkeeper became aware of the insanitary fact that his patrons were deplorably inaccurate in long range shooting. In vain he put up a sign reading, A miss is as bad as a mile, and when he urged short range firing, he only aroused their indignation. One night while sleeping off his own stock, he hit upon a device. The target arrangement shown in the diagram was put on each receptacle, and prizes were awarded, one dark beer for bu1l's eye from length of room, etc. So readily did customers enter into the spirit of the thing, that he was able to institute penalties for out of bounds,' ' namely, one blow of a five-foot plank. This instrument has been playfully nick- named the board of health. ' 3? 'lk IK' Facetious Old Gentleman fto barefoot boyj: Say, boy, where did you buy those shoes? . Barefoot Boy: V Didn't buy 'em, sir. They're home-made. . -Cracker. .4 ,..'- I E r-TE 'IFIHI - IE 11 QD 92 'Q - JB LIUIE - J Q9 AY HEXY THEREISIPQ 00' wmv Have Q W mc, 'N Xl' T 449 A You1HERE! 0 0 SEXAFDM 9? 94 . ,- 'Q ' Q e- -f-- 2 ' D an 3 'Z '21, Q ,,, S - +4 . fx o'f,,,f22 fu -- . ??4s1 m I ' 5 i711 Q nga f:,Q1 'gyr- ,J 1 'E -ftww' ... ' , SZ , WY, IT BILLONGS Tv WHOM To neck DOE , 5 HE MS -T -31 Q Summa? 1' - F , Qi?- fsv 6 I .1 -x,,Z-15: Y Il Q2 Ag' .-I.- , , ,.., .ic F ' ' WHA. Q5 7-V Us . 31 4 165, xewnrz, mg ' - - SWITTX HE PLAYS 5 .01 WELL 1NTo THE 9 H lg Q7 NUGHT- -3- 2-'L...' 5 WELMWELL, A LL, ' 'J 25' - - -A' V L po x g H - Q 15 . Q Q ff2,,,fH1fw,, ? x - Z rf' dll M2 , -l U '- f-o-'Q' M' n f Yr. Wnm ' 2 X-X Ill 1lQ3! .. T0 Hgggmim, 5 'dvige - .fHwv9ER-5'-- 6 0 1 I LII I II II: II Ii Ia Tiriieoiooo Q- BLUE -:JAY I I HTACKEDH Customer: I-Iovv can one tell the imitation pearls from the real ones? V, Salesman: Ah, madam, you do not tell-you keep it to yourself. I assess : I No. 1 from Hester Street: Say, Abie, vy don't you pull down de vindow shades venlyou. luv yore vife? ' , I I No. 2 from Hester Street: Vat? I No. 1: I say vy don't you pull down the vindow shade Ven you luv I . yore vife? I saw you last night! .' ' I A No. 2: Ah, de joke's on you, I vusn't home last night. II . I I I . I ' 1 N , E I f I I I I ' gg CI I . I Iwi f IIIIII I I ,AM I 5 I i H xi , L- Helene: Oh, Bill, I know you've never loved anylother girl. You kiss like a novice. Bill: That's where the art comes in, dearest. as as as D Counsel: Now Where did he kiss you? Plaintiff: On the lips, sir. , Counsel: Noi No! You don't understand. I mean where were I I I you? Plaintiff fblushingj: In his arms, sir. -Voodoo. it SG Pl? 1 Bullet Ito Sawyers, entering latej : When Were you born? ' I Tom: The second of April, sir. I Bullet: Late again. : I ' I I I - - I I I, I I I I . I t lik: 'IPIHIIE-'IIQJQQ Q BLUE -,JAY W? HAS IT EVER HAPPENED TO YOU? I Broke, broke, broke, By thy spendthrift ways, O Girl! And I would that I had the dollars It cost to give you a whirl. O, well for the bi1lionaire's boy With his fleet of expensive ears! O, well for the wealthy lad Who smoketh imported cigars! Broke, broke, broke, And royally trimmed by Thee. Now I surely hope that you stick with him - And never come back to me! -Dirge. 'K' HX' Sk Fellow Dubs: What kind of a sensation does it give you when the woman you are with says: Oh, I must be in before 10:30 tonight or I shall have to be in early Saturday. fAnd you haven't got a date with her that night, either.j -Lemon Punch. Q. 0- l I rikl Tierra:-anoeffz -1 JBsLU1Ef JAY g YS? :ev H ! K ZJN X x, X xwk X ,- .- .... ii 'f - ',,' 1-13 A f 4 Z i .r ii 5 5 2? fag 7 , f - . . I V f ' ASSASSINATE HIM That fellow is famous. ' C 77 He was the fellow who accompanied Stevenson on that voyage which Stevenson wrote about in his '-'Inland Voyage With a Donkey. p -College Mercury. V as se as u You 're going with me to Tim's dinner, aren't you, dear? But, Jimmy, I haven't a thing towearf' Oh, that's all right. Tim has steam heat, you know. fe +CoZlege Humor. ' PK! SF SF ' THE LAST PAGE V . Eagerly, devouringly, they gazed at each other. Slowly, yearningly, heireached out his arms, and then with a sigh, dropped them to his sides again. ' ' 'i'No, no,' ' he groaned. I must not-I haven 't therightf' ' V Why, why? whispered the girl tenderly. We were 'made for each otherf, h And then they made for each other. ' ' The End. -Puppet. I 0 0 l Vik: THEQ H9942 Q BLUE 9 JAY V Q 1 QQ 1 ' 0 Y 0- 4 S nodical College STANDARD JUNIOR 1. CCLLEGE Fulton Seminary 1850 Synodical College 1871 Synodical College has completed fifty years of distinguished service to the Presbyterian Church, to the home and social life of Missouri and to the religious progress of the World. She is entering upon her second half century of service with higher ideals, better and bigger equipment, and the noble ambition to render a larger service. Her doors are open Wide to the young Women of Missouri, who desire a broad and thorough edu- cation in a cultured, Christian atmosphere. For Information, Write to p Synodlcal College Fulton, Missouri Test Questions ' -were used by Mr. Edison to select ellicient men The following fest of an 'eficienl college was not prepared by Mr. Edison I 1. Does it have a strong faculty? 2. Has it a worthy history? l 3. Is it strong financially? 4. Have its graduates been successful? 5. Has it a high educational standing? 6. Has it a stimulating environment? ' 7. Does it deal with its students individually? 8. Does it offer a sufficient variety of student activities? fl Has it a progressive policy and well founded prospects of increasing future use- fu ness. A A ' 10. Is it a Christian college, placing emphasis upon the fundamentals? I f you wish a, catalog write to , WESTMINSTER COLLEGE eilliam Woods College Fulton, Missouri - A Fully Accredited Junior College for 'Young Women Two Years of College Courses leading to A. A. Degreeg Four Years of College Preparatory Coursesg Special Departments of Art, Music, Ex- pression, Commerce, Home Economics, Physical Education. 55-Acre Campus, Modern Buildings, Gymnasium, Natatorium, New Academic Hall. RICHARD HENRY CROSSFIELD President Presbyterian Theological Seminary Louisville, Ky. v REV. J.OHNg VANDER MEULEN, President Able faculty. Modern curriculum with practical training. Home life for students. Libraries of. 200,000 volumes accessible. Courses in Uni- versity of Louisville available. Expenses moderate. Session begins Oc- tober 4, 1922. Write the president at 109 E. Broadw'ay,,Louisvil1e, Ky. Thaw-LACE HUTEL .. Special Attention to Student Parties BLUE JAY ACCOUNTS SOLICITED AND APPRECIATED A , , 0 A Home SEIVIHQS Bank The Barbie That Cares for and Protects Its Customers SPARREL MCCALL, Presidents ROBT. PRATT, Vicefresident J. B. SHARP, Cashier p I Roni? A. MCPHEETERS, Asst. Cashier THERE is Satisfaction in Comfort ' C and Comfort in Clapp and Thompson Shoes , - - V., ,..f4.., . A .Wu I ' . . .. . ' Which Are-Sold By Payne, E? Henderson Court! St. 0 Fulton, Mo. Famous Shoes for Men ostorzicms ' Esslingerfs Booterie, q , N 7 Fultows New Shoe Store A ' Callaway Products- . , Frozen Cold Ice Cream and Pasteurized Creamery Butter -Made in Fulton by THE WHITE 'EAGLE DAIRY COMPANY THISostore leadslin Quality, Value H r . and Low Price. Comparison erndon' I 3-57101. will prove it. Satisfaction Guaran teed. Furniture Co. J A M 9 S A Presbyterian Theological Seminary Q Q Presbyterian Church, U. S. S. Authorized Ford Dealer OMAHA, NEB- Fultvn and Auxvassel Rev. James Marquis Wilson, D. D. Pr ra c THE HOME BAKERY Where the Elite Gather -Where College Folks , i Eat, Greet- and Meet! - ' ' Blue Jays, Trade Where You Are Appreeiated . . .THE HOME BAKERY MELVIN J. FRANK ll W. EARTSIEST BACKER I i 1 s l 1 l i l l o 5 l I l is L P, F F4 E f 7 I 1 i s l 1 l 1 I1 F HOTEL HOXSEY European Plan Mexico, Mo. Come and See Us- Callaway Hardware Company B -Always Welcome Tompkins - Christian-Alexander DRY GOODS COMPANY A ,,, .J' We Keep College Class and Fraternity Pins R. H. Pearce DRY CLEANING PRESSI N G AND REPAIRI N G J, Brooks Brown, D, C. Ph. C. Palmer Chiropractor Fulton, Mo. . Charles 'M. Wilson' Grocer Patronizing us tis like making love to-a widow-you can't over do it Backer Brothers Sporting Goods V Grafonolas Sonora Phonographs Bolton-Smith Drug Co. Adept at giving the exact service the college man appreciates . Fulton Bottling Works H. T. DOERRIES, Proprietor M . Fred Bell Superintendent of Public Buildings The l-luh Tailoring Co. DOUGLAS 8E GARVER The Most Reasonable Prices in Town The Fulton Hotel R. F. GRIFFITH FultonBilliara'Parlor Cash Buyer and Car Lot Shipper Of MASON MCCOWAN, PT029. Poultry, Eggs, Wool and Hides Fulton, Mo. STUDENTS! We want you to feel at home in Wolf 's Cafe A service backed by years of experience in catering to College Men , GEO. WOLF, Owner and Manager 'fi Mr. Glancy The IVIARQUETTE 18th St. and Washington Ave. St. Louis A Refined Hotel for Your E Mother Wife and Sister 5 Single Room with Private Bath -52 50 53 00 53 50 '54 00 E 't tb th,d l ,-52.50, 3.00 ' ' St L' Double 53.56 s4.oo'ss.oo '-156.00 5 Room without bnth,nin le,51.50, 52.00 Room wx hou a out e -f 3 4 Short Blocks lrom Union s lon nunluuumnunluuuuuwumluuulululluuuummmumnmummumunnumn GLD Westminster friends who have made this store their chosen Outfitting Establishment, realize they made no mistake. New Westminster friends who will in- vestigate our claim of selling Clothes and Outfitting' of special goodness, will not be slow in mak- ing this their Outtltting Establish- ment. We ask for an inspection Neukomm Clothing Co. 509 Court St. Fulton, Mo. THE CALLAWAY BANK ' W ,-' f Clistablished 18571 ' X FULTON, Capital and Surplus .............. Resources over .... I .............. MISSOURI A A S 200,000.00 1,000,000.00 THE OLDEST AND LARGEST BANK IN CALLAWAY COUNTY A The Bank That Served Your Fathers and Grandfathers Calland See Henderson 8: Maughs Clothing-Shoes--Hats-Caps-Furnishing Goods The Oldest Firm in the County The 'Best Gift Isa- , I I BRUN ,S W-IC K --The Next a Brunswick Record V Wymore Brothers F'aZton's Largest and Most Interesting Store ' A Dodge Brothers Motor Cars Sales and Service HARRY R. GILBERT Q - rfzf: mem- Phone Motor Sales Company A Fulton, Mo. Here 's a Recipe For Ending any Westminster man any time in the day Go to the THE BUSY BEE ZICKOS BROTHERS Gtto J. .Lutz Grocer and Meat -Market 10 W. .Fifth St. Fulton, Mo. T M. L. Guthrie get Public Administrator Fulton Callaway County Mo. LOANS INSURANCE W. ED. JAMESON LWRITES FIRE-QINSURANCE Sells Callaway County Farrnsancl Fulton Homes Jameson Building Fulton, Mo. . . E Suits Made to your measure and taste Prices S25 to S65 H. Clay -McGregor Fine Tailoring St. Louis.. Meat Market August Alke, Proprietor A' Fresh and Smoked Meats, Sausage and Lard Glenn-Mayghs Motor Co. Nash Leads the World in Motor Car Value K oontz Sc Palmer LOANS REAL ESTATE INSURANCE How About Your Eyes? If in trouble come to us-two Registered Optometrists BOLTON JEWELRY CO. E The oza Reliable Tugkel-'S Chris. Hoffman Transfer Line .Phone 540. O BAGGAGE Comfortable Cars, Careful Drivers For Wholesome Milk V Call 1632172 J. B. Britts' Dairy T. ED. CA RTER Groceries West Side Square Fulton, Mo. Frank 85 Curry The Store That Tries to Please Flowers for- . I M Banquets, Forrnals and all other occasions 3 A MRS. GEO. HQ TONEYL Fulton Steam Laundry The Home of Soft Water ONE DAY SERVICE Phone 86 Fulton, Mo. Flowers for Every Occasion- I , ' E All orders given special and prompt attention J. MORRIS DAVIS Agent for C. C. Wonneman and Sons, Mexico Florists Ofiice at the Callaway Bank Phones--Day, 181--Night 639 Berghauser Hardware Company The Best of Everything in Hardware The Fulton Lumber Company Q The Quality Ya'I'd Where you are assured of QUALITY, SERVICE and FAIR PRICES on ' all building materials Sixth and Nichols ' C. M. ETHAL, Manager atcon Sc Collerr Books, Stationery, Sporting Goods, Magazines, Pogonlar Books Court St.. Fulton, Mo. REED 85 SON HIGH-GRADE COAL-Screened and Mine Run We Strive to Please ' W 1 k Lain-Myers Drug Co. a ter Bac er The Recvall Store The .Quality Grocer Cigars, Cigarettes and Tobaccos, Films, Fine Candies and Stationery he First ational Bank FULTON, MISSOURI , T. P. HARRISON, President E. C. HOLMAN, Vice-President CROCKETT HARRISON, Cashier BAKER TERRY, Ass't Cashier Capital S3100,000.00 Surplus ?'0100,000.00 W. E. BLATTNER 8? SONS LADIES' READY-TO-WEAR, DRY GOODS, SHOES - I i A Good Place to Trade 1 Judt-Harris Hardware Company ' V I ' ' We Try to-1Please -- Phone 141 Nichols Street LaCrosse Lumber Company We are qualified to serve you because of the fme quality and the great quantity of our stock and because of the economy which our customer's find in dealing with us. LaCrosse Lu mber Company Phone 130 Fulton, Mo. Millers Worley Ball sz Neal ' DRY GOODS COMPANY . . -- Plumbing Home of House Furnishings RUGS DRAPERY -and Electrical p Work Do you wish to find a Blue Jay Are you searching for a Willie Are you looking for a Semmie 0 If so go to Pollard's Balcony Where Everybody Goes DELICIOUS FOUNTAIN DRINKS-LIGHT LUNCHES-BOX CANDY Pearrc's Cafe ' I have had 14 years experience in ESM pew,-Te, P7-Opyietoy high-class hotel cookery, which ac- counts for our exceptionally fine . ' .3 1 cuisine, so appreciated by our patrons 403 COU.I't Fultgn, MQ. Gifts That Last R. D. WORRELL JEWELRY CO. 119-121 S. Jefferson St. Mexico, Mo. The Fraternity Jewelers of the Central West Class, Club and Fraternity Pins, Skins, Banners, Stetionery and Novelties Special designs created and made to order A WRITE FOR CATALOG P I PHOTO I STUDIO Fuuo N. Mo. Photograph, and K odak Finishing WE solicit your patronage and good will and will give you the most of the best for the least. ' A. Ag GRIMES STORES CO. .V Fulton, Mo. riwontgomeiry-' ell DRY GOODS COMPANY ' -iil..-. e ---- A store full of high-grade merchandise--Ladies, Ready-to-Wear, Trunks, Bags, Suit Cases, Carpets, Rugswand .Draperies The Callaway Grocery - HOME OF BATAVIA FOOD PRODUCTS I E O' The Better Gracie Foods Phone 128 or 129 Fulton, Mo. High Class Printing? -Tl-'IE GAZETTE, of Course! S. CARSON JOLLY The Leavens Jewelry Co. GROCERIES See us for Special Designs for ' , Class Pins, Rings, Fobs, Eversharp Lunches, T0bUfCC0 and CWUWS Pencils, Conklin Pens and' a High- Ccmdies and Soft Drinks Grade Line of Jewelry. T. HARRISON GRA NT Life Insurance Service ' Phone 37 ' FULTON, M0. Grant Building Pratt's The Gem J. R. PRATT, Owner and Manager ROAD ATTRACTIONS-MOTION PICTURES I Popular Prices THE S. R. YANTIQ MILLING COMPANY Manufacturers Winter Wheat Flour and Corn Products and dealers in Corn, Oats, and all kinds of Poultry, Dairy, Cattle, Hog and Horse and Mule Feeds Wholesale and Retail J. B. Cfludej FENLEY, Grocer Fancy and Staple Groceries and Fresh Meats We solicit your patronage and can assure you courteous treatment A 'Ziliiiiwi.I..z.itijiiiiiiiiiiiijiliiliiiJ:':tTL1TL33121222iiiiE?::ii:pi3.1J.E:3wX , ' Q' D . f..-i:M--w----MM1jL1jj:'jlj:5g1:au::r5.QgL1-I52-31-4X5'5L1'i'59QEf0E:,'x Nw?,E55:23::::g':r::at::::::::::::xx-zz-:.z:L:zrqzcnz-:::q::F-.ggfrqgfgrxrgifvegw. 'mme - 'ffm A S: 3 XXwMiY'v:M,.Qxm Xiim. Qim Xxwix KQXXSXXK QYX YQKXQN QNX SSXSN MQW, A XX W if gli- .- .. :1:f: .- 12.-M. .-me 5. .. X , h:5aff?x.i. viii:-bw 5 F Q 1... ' igirleigxwi YL N 131 :fx ------' p ---RW .,v..-,.Q,,, N-.V v ,,,.,, ,WWW 15 gi Q.: I ....... ..... X A is .,.,, , A,71 ..... ,Q-S .,., . W... ,Q , , , ....... .. ,N iii -1. J:::z:: I , 13 -.Q jg: '1r::1,,g Y 1.5 2 ' Q' i BURGER IDEAS q l , Bmw DISTHNCTHVEIQHR Bomas EI? QJDEAS fini M-War dfZlZZ16Z!di0W Mc Q14-frfybjarc fic if rcsudwbafhsfakzyfkog1fAzff5r!afza'g0crz2svzce4J 3 W . ' . , , 5kac01zcc1W5ana'aQ:1EQa1d-:a.rl1z-dasyizzfydadcfhlydw III 0fMc de 122176 zzr mea Glliif'-IZIYY ozzfafzfzua! '1 I 5 ff EXFE IENCEMHSTE c AFTSMANSHII2 AND Trnz rn som, Usa ' wav ,- A , safigighl' wig aiq coorli IITIONINABUKQEKCONT tICT'a'o ,mf ,mf fo Men s sill.. NZ: f A d If . X -, ,x'::::..w '-Risky, 1 nec au .2 u c a a ma ana 0 our Q HSE jgkflff-+1di57fxJ Z -- 1 fy 7 Eli' if 1,2 3 1 V Wrzlc 11:Syf7rIDEIIS xl , ' ' ' A? , , F QVQ 'D img , w gg, BURGER ENGRAZVING co. l Qfggg Bosfon Bfciggf. Afizzaas GH? 3 s -M -4:2 'Q Wa. :: 2-.'2E -P -- .2.....,...... z.z......Y.. z1.5 2,,.. mf Q ' f J' - A ' ' .. - ,. sw2' l .'-. H - 'f va i----' ,' ix lwrgghax ' X 1 f Q . .---- - Q, . A: , A A1 1 if-r Sb xx. Y ,..,-1-P .1 N .. L.-:QI 5 X A FF F - .-' ' I . A J--f 2 ' I 1, 1 f - L -: -K inf :Nu ,gd X-XXNHNE X25 - If ' are .4 . 1 ., . .-.. 'A QQ N, . :QE ' 1. I ' -ull I 4. f 'Y : '- 'J - -Q54 -X ' f 'V 'f ffaylu' ' f . Q' -2,314-, 1 f 1, Yr 'FRG X -' ' I1 g ' :gl ' 5 1 - .Aff if .... , --PWS Y ' .v.. 1 . V X I .1',,.h X . . .J . .M .. -,., .- H- - V K 11- . :V , - avg, . Q ,,. .W ,4,.,,,l , ,, , X. . l, V , ., V . 'X ' 2-11.-' X ' A' , in ggi, ., ,V ., , . 1,5-..:7'-,gfj'fE3 .1 15, M , - - .-51.4 -i,:'k.f.,,, -1- , z' ' ' ' 1 ' f E- ii F.-V1 V- ' V 1f'?XV1 iE, iff ' , V. Q 5 f -ff 'T,.-fgmflij,23:-3-Q4g,i.?2f7-V'V?1:V,Q:l3'jf.L,.Q,, - V 3'-' Ulf' EE'-5.41-f1fE'9.Q 'TPETI-if: 'L-IPQXXW 'Hb-ff: V-2517 . , , ,, , , -,, ., V' V,V,Vg,+.1V:7: V1f,2fff.,,,:p5' -rim ' ' 1 , 'Z i ' .' ' 1 'T '34 -if f:Q.'.ge 'l fGir'Df'Ef'41v'f Fi-5'iE'f 51' ' 1 V nf- f' -'f - i'VV:w:.45.k,!,..1.,l-Jrglfmri,uuignvr fn '-KH.-3 ,1..+2:?5',,f7,L--Eg mi- z,,U: . um- QV , ,yfgg-,.g , A-'-,4qr,1-,151-.:V':V'--: ,-L-1-555 L.',,'1i:V.z'Ta' A ff :gg-.u -, 3 a1, m1.,:.-il -.A-.jg'l5'1'5W.,'if .:--fvw:z!v,Z's.k:,:. 55-.5 ?f.1ff:.:- 1111 va ., -Nw , fy V U- .. , ,,,,.g v5-Lrg...,--3353141'173-e,,d'.,5feQQf 'fiffgugf.V.1fy::.a fgfpip ,V V .r Q,,+-1 1f-4321. ,I 3,fyV4f41vf551.I:arfFr-511X'-Fifa'f31595543-::.i??iflmfaESiiui. V' 1:1 4, 'VH' L- '.fa1if5?f?-if?-V516227 3.V1Y ,apilv ' N ' ,, , , wuz.w-Ffrw:.Q:E.eV? Jin-.1'f..1LgLfzi,1.s 5' V, ' ' I ' F f ' , 7915 if-' 1'fii:f'--'4Tf5if.ifEEfEf52,M25-g?fg1P3iEfV-2:?fV5,3?'V:?-'-Vf'f.s.'i. !1.:f 5 4 f Q 1 Q'-iYTl 'fffiii'-.i!?'m'5!i2''Q'M E??.'4fV57f3Vi'-9f2'2Yf3V:.ff2ifl 1 ' 'zV!gQ,gf,f ,,,',,f .-,ug,,,, 7 Ar. 4 .X'z,:x'1fe2f,x2,z1:' V' limsli'-'?5Li53i'i if MH- W'- , , W,-1 -1' I , .V , X, , - -:H ': . , U :,-1,.x - .N ' --if A , X 'Z' 'Z'-'Yf,fNf'V'-':i:15'Af' - Ga! :T f' ' 1551 ':- :u..,.'..'r?j':f K if: V 4.5.11 .'VaV521:.f.-If! 4 , H ,fm gx., -.lp 93. V, 5.,,f.,nV,-X,1- 1..-.:-V :V----. ,,fg,,, , I pq-3, ,V V. ., AL. V , J 1f?,Vr,. 4 A ' .w ' 'ff Saw 1-A 1- 21 .- 1 Eifiv-' 11- 1 U -E ' Vp f EV- 5 .. ., -1 W- ,ny V- .Y . 1 . - 4 1' .V V I. .,.L . gm, 'V V 'w3Vg'V- V, V nav'-,-,.f-:VV-'.-. .gglhg -JV ,g,-..,f,4,..- -6-- ,. M , , 1 ,A f , , 7.7, V , .. T735-. v I-L .. Q , '1 43 ff- -51 ri