Waite High School - Warrior Yearbook (Toledo, OH)

Text from Pages 1 - 248 of the 1925 volume:

il --4 N .,, V--.W pw, f we ,V -' gg --'-www-my '11-QL'-'A-x'gv 5f:1Hrw '-'Mfigs lv- KV' -wwf V V .-1, - V . V- ,,. VV ' 'f1?f:vfP--sf-V:-V-.Vff,V.T'f??vT E V . V gV '11 f.fN1.:f'1 ,Q - Q-V V Xa? , V L, .. ...VV .Vn,.gJ-,VV,,.f4m4:f,w . -gig-HV ..,, .JVM V1.. 5,94 . 43, ','W?V'i,g1bg ...V ,VV-.1Sf.4g,VeV,3Vf, V wwqfigik -.f-WVQH. J ..V,-IV-,,,., ,..:. ,M.,,..,, f L-1 f f- .1 V,-' V -Q 'V V 'z-'aV-'ff' ' ., 1 V' VV. V- V- .,V-,,V VVV,.:1fV..,V.:- . . . V . A .. .4 -. ' NV if 1 -.-1.5 V, ...V A.. P-, V1-Vmsaw-V-n.V -V .V VV x ,. V,-V-1-uf-12 - .:.., .V V .-w . V-LA... -VV -H - .1 --'- -.HV . mv ,- V .V-Q.. ,- . . www: 2 . .QV.-E-.:Q.5c,.545:5J,5,g,..,V5-.-U?5,AVx.'.g...Vg-.Y1,,.VV V . , '1 'm :F ' L 1 A 5-in :f .1'f':-Q--'FV' 3225245 V:. ..1 TP-2 - Q - fx 3V'.w?5' 13 4 V, 1-1 V: .1 ,I V fp' ' uf f.x-1-r 1255, 3.,,f5'-az-, I V, ' s - :iii . Nqr Vi x:1.V'1xEh.k 1, ':..fV15VVVG-a tkg Q... W- v . , ' .Q Q 'f 3,3 -V: r V y- .JV ...mv A V ' ,' -'.- wg: V V qv: VV- V -V- if - -.Vf...,,f.-Q... ., 'VL . ,V . ,., .,,.,1, V, ..V..a., V. . .V ,sq ,,, , ...N-, V VV. V .V - , .. z . if , I . wif' , V-,g..ViV,-. ,-...,, - . ,...-V .-..,- -2,-., ...H -1 -f fVf-V- ,.-1 --4, -., -. -V . VV,,.. -, 1,--V- .- - ,,- ,. , 4 , .V ,V . K Q,-J., V-,fx V. f' . -.-.Wg . wgmv-'VV i15VsV:V1fV,e ' 1.-Vigwfs ' ' ' ' 'A mf:.a2e:fwV1 '.-Vr',V:af..1:r.m V. V ,,, . . .,w..u. V -VV.-VV..-V V- -f . Vw. M- .V Vw . .V V,.V..4, Tb?-.,gV-.Lvr dx :i4Vg'5.V, -.VLA--a,.f.,V,, -, QQ . ,, 5,-1. mg g.z3Qf,V ,-.V ,LV FB,-4Vm.QiV5 -Q ,Vm J- - I..V,Vf rw V,,..V.1y X A TVETEE fiii w sf,-32 -- Vfesi y, . ' Ar' - - ., f 'VV'fV-VV-H.+f't V n- V- VV' rf- fea 7 -31 ' VW. Egg' Mig. -'FE ug. -',,V 3' A' V VVJ,1f j1-il ., ,. . ., . .. EV Ig ' ' EV F V+ 42.4. 'J iff .Egg g f.. .re mis. ' ,312 - V, A-4.15: .. . . , 5 Vw-an -,.- ., ... ,.V.,sVg.. . , - . ,,. ,V ,, ,Vu Milf? -iv. .5 f. KL-Ls f 'P A hp.: -f' ' P ---5.1 2. -1:25111 .V '-l1+f:5 j',1:.1?T1- 'fa?wfeVqV--:V-f' -if . , -a'5.57,f?iZ'.s.'Vz.15V' V V ,IZ 4.3. V 'V ff ffgz-Qligf,-4L2 IV '5l'i55. fi.'.jiFf:i.k - 'V,,,g., ,X-V..:.,V.-r.--2 1-, 4. -VVS-, V' , V 4 ,' -g,5,:-5,5515-'I CV ' ' ' BSP? wx 'CH 5 f 1' - . . 134' . -,VV Q ..V. --MA V, U U.-Y' V -51.5-'k.iiqqvn117-'-1:12 3. a VL- ?'.Q3 JV, g 4- R1 f J 3451 gg, 4 2 V fx ' fi V., 1 352 QP , xl W ia-:iw kiwi V V -15.2 -qi --VL .mm-1:7-V. 'mf :,,- , Hjfl - V f .g1f,. :mfg-V:VV,:sV VJ.: , fwfeg. N3 -A-.-ff -' 'V F - fu- 5. w - .ww -wal -'sf -.-SEV... Qigffgl'-gif' 1-,:3fpk3:V ,7i,V -V.-V - 'ef' 'A fs: VM ---V V' 431- 5 V 3 -- . ' , VV 1 V - qi' jg 1.4 N V-'15- -N V139 n.-3.-Vw MV -Vfvkagnw VV Vp 3 J, 5:45 ,gi 1 V V .SZIQQ V . . ,V.,,., Va., VV M.,-VV:V , qw, V tags-, 5? wwf? ' ... f- .fm .,V,.vgag-'T' :Vw-1V 'V . .... V. .., . V, .,V .g,,M5gM.+xV . .' . -,,V,,,f.-V 1,Vp,,,,VyY-+.f.:f.4.,1VV--,pu , f . EQ- fb H .... , W , ,.XV.,,?..t. .,, ..,. A ., .E-it si aj. . .x -45:5-1 - 1 A '-1 . . AV, 3' Q A V , ef 'Mn . V-pf VL VV -eV '. ,-,f..f5..5 '- , ..- fi., . , .Vw -Efvtgi ' 21 ? r a-Erui. 1i,,.V . Jw-Qsfv' , , '.. - 'VL V 1 . -'ra 'H ' ww .N V V- Emi- - mm hr.-gg, gf--2 is V5?3IF4'? 'Z W 's:g'vzl'- fi? TM V V ' ' ,,V.3,:q:V,z5-Vc-'-V , in V. f 1 .- V. V - ,Sv 9 ,W s '15 -., 5.1. ,L 2,-,ni V.-gp. .fm f-if f- ga? 1.9. 2 2 X53 ' stwkw - . dfx+:'VQf1 '- af -1 ye- 'gg' V ' 'Lf 1 . ., V- 1 . -V ' ' -'g 3.-,, '.-2-?Vi.4-'2.1 .5555 Pj-4. 4 Q?'E'k? ffffvgr' Bgzaie.. 1 'mn -- 'L 212: 55,21-,fwllig j,,g5i,,: j ,fig Lf' , .V,f2kVVi-1 ..VL, ' if '. ..J1,:V . . .sv 1- 'Lf' .? 11JV. 'V-lixf, 2.-2' -'-:VHw':-?f:1'- V. '. .csv . 31 ggi, ,. 51- r 4 14 My HV. k 5 x e am, -V ? 45 . ., j.,p,,, 91 212' V- Vi - gif -V-. ' ' '+V ' 1i.afV+f..V ff: ' . s .Hi 1 A , 1-1 142, V ' --1.-P .V ,gVV- QQQQ:-!Vea2mzV2, V-Q,-V-I. ff. . - - - V., V rf V ' :5g,mV, '- if .-f.-M,-V H .-' - ' Y J ' 95594, ' V,dt,.V,-A, - 551359: ,V 'V V 45 , L - ' 'V -53512: fs A ' 4' 2' 1-V V V . :ff 5 I'-5fV57?,6Ji' VV. V Q 1 : :. ,. . V 'VV ,,J-gsm? I in ' Q.. 5: x 1:0 V ' NV ' ki 'F..V 11.5, ' ' fx Q, ' ' - 350.5 f-'Y'3E51ViK'+Q1,-:Z fr- J' ,. V ,ir--e-V1-1 3 1 41 Q V V.- V, V-4 12 ,V . Args.: , gp ,X 1, ..,.n:W, V V. .V V .. if . , 4.s5?ef'3?.V-xx .Vr .V .Az .. 4+ V L V...V4f ' '- V- '23 ,Q V ' .Vp fm, VV,,g,4w,5Vi V - Q11 l'f 3 iv.1 W2 f:QV A nf Y- V V- Vw .Fm . wfifay we ig- :A Q V W 24.3, iq.- .5 -f ,.,,s,:.rV V, 1 I- - , ,V S, . ZV' 1 -.iV'T1 :V Lf:-...l 1335, '91,-' 43. ,N QSM.. VV ,V , 1 V ,. 1, V ., P R MQ. 1.53153-5, , . ,N V.. V 2 9' 'rf 5 X S. r' . , -?V'-,V '1jgVy:y1'- V. lf! .ai J , ... ,pf , V ..- V . 2513... ,. ,h -f---5, ,Fw-Vt. V t f gm, , I -'- -5- h..,.,iV:' S.11g if 1. M. 1 ,m?.-5iV.1iA,g,q--V,Q!gQVf-if -er VV ' ' ' tlwrzeg Vfaihf' V2 Vs V' 'V 3,53 A Tl S- .- w was V M' wt? -Vw H Q 1 .V V ,V RJ-,gilz-Aff. ' if . 35.,.:Vgm:,,5,:y5, g V-.:1.:f:V'W't. ,QL-1 V1.1--' -MH-,uVjef.r 4553 4 -YwfwVf1'Kffz2'ff-:VV-V- 1-'V'Vgzfig A. .Q Vw w g V 'V ' ' -???3sV 2, ..-V5,,.VV5V V ,, . .,A .. .,wV,,, WW. Q., .,,.f,. , , ,A 'L -fiigfmf-1 US' 'lsfza'-V91 MN V'VV L 9, 19' V ' V- Q -- '-r .H ,v.FV ' J1 :W .,-1.4 EW'-- 'f .V ' L . -1 ' - A A- . V' . . ,V V F - V. VV :.V-w-- 4 VVvzf.Wi' Va- ,f 0,z'Vkfa5qyQ5EK vim Z wg 'W v new 25+ 'Q 5 if f V , -. mm Qxafym -2251-V43 is ' ' .V1- 1' ..V - vp-i3i.w':V1:,:' .V:,g:: ,,.: x ,' -V -Vf 52 .+-V.. .. Viv VV . ,V,.1V:' 1 V , V -' .V fur V':.,.1:: V Q ' H' 1 V sw ' F' Ax E Z mpg Hier 685' 5 f an sq ,mmxwa i 2? 73: 1 X55 N1 Mx ,M 440,555 ,I 4: ,HIT V . Y f eigiwkg QV, J K' 32, rx GQ Q: 6' U-w fVff'I Vz.7fV hw GK 1 is wwgi V . 1' Q 1 ia M-. YM af, 4 V ,x , ,QA . 1 30 X 'QV ,aww gui, V-F K 5.5. X gi . AMN? Q4 Ju, gg Wqqm ,SRM ,M V. Vi 'Qi VV 44' CV. 'hi L W5 Vg W 'W . Vffx V ' H? 'V F0 ,, V ,. ug an - .1 VM K V is R ' V, F , 5V Jiffy wh 4j as Elm ' V ,V V .V N31-f- rf-1 4 ff .. ' VV Vin.. P J f v .9 -VJVQV -3V . .- V. is .rg 5.2- ,,. ii fs- ,V LifT:QQ,Q'T if: , ? V : gm ,f Ht, -ww? -Q ,me . 2 - 'V -'Y WZ? QS! V HQX ' , V-gg. wfizgis Q Div- .V -- '-.V---:. '-' :vu-:af-'-'ff -. . .fx-f.-'J ...iii :Viv gfff'--- Wff'1w ?f'fi-V ' 'J-ff'f't i .. 25394 2.7 . . 4 . . 'Vs A V 'T f ' . V S 1: 43 9.1121-fV ' 1 V- '-N'i?-'Aww - 5.-sfjii -: 'fV Pjf2-lgfgg . 2415-Qs: ,. V I':,.:.Z,.:V'7.16g1,V5?g 351155-'.,.,.-,Y .ea J nv 2 :fr-. V +,,- -V riff Vg . ., !... - . - A-V Q Lg- .-z ... Ll tv 1 .V . . T ..A-4 .. . Ve A:f,V,.'3q?1V1:'-.-4 mar '51 'E -:Iwi-N -1, -M., g- Vw- .-, -.,..-.nf-,V, V . V 1 -Nw XV:-TV,-'V gf, E -,p3.VV ,V , Vx' .'.1 V.e,.5.V ,V I -'V -fl ,,g. -:wx V-V -:.1g::.- ' ':': ' V - V ...y .V , w ,, V . V I, ,S .wif V635 ., V, sz N,::i,V,VV,,.,,wQf.,,.3. wg, Vjmw mfg.. gi.. Sq , ww .,,,..f-.fuiifijziff , is ., cw , V , M V J -W' up 1 1 px' f vt-MV Eli, R 4.5 , Q A . , w V:-ww .VMVV WV 2 .l QL- .Jr saw., -S V ,.g,V V? 12.21-V' - me '-,V-n:,V'g.n.g, A-.qi g '. ., V ,V V , ', V -Vv V - 1 .V H . ff. - V. . Q VV. V- -V ' ' ' V 'V' Vw 2 6 if ,,V:g.pe:E:f-V-.V -S., V. VV V VV ,V . VV..-,,VV,.-.,, V, VV, VM.. xi JV,VVj,V+ ,,. V Q ,J . V,V,W, 1 , .r 'M ,' ' 1- V ,Y sm rw- +V. VV f' ' wav-w'rVV-M M '.2-211. ,:V51V-1m4:.VV ,V .+r'Vg:f'-. ,, 'mV .'- VV M V, V . Y if- Vi. wM -' -5 ' VV. lv: ' Vg -F -V,.. .-+3-'-V , ' ,-,.V-.J -.fg'V,-,V ,-4 -V ...- M -2. , M V ,, V, .. VV ,. f5,y, .' VV , .mu , .,, Z1 If .. V.,vs.V.. - Era..- knew 3,354 V532 'gary' 1 V f f iff! mid -Vile-1.53-,cz E-4 yF g 'T2 -2.55gfg3sV1. -it :uw- - g --'372 ,,,.-1:33 '95 '4 ESQ? VV V- V , V L gsm 1. ' .,, .V . 3142, -. 'fgg QV. -55,3 iff: . - .1 an ,VVQ V ,, iws-agar Q 35-YJ' sl 15533 Iggy Mr 31 sg -1, ggp: A951 V- ' ' V-2' -. 'ff' Q, fbi fa. 5 asf-.. ' -AI . V V . 1323- -'ib5:,L Ef'Ttiif'f'1'fi15U: f 'F: ' . V-f V513-Q-yjiiigci - 3,135 'gnu' bs , ,g .4 , 5.5-G.: ,.,,gV13gw ' V ,.'.,,. Ei,4,.3,i,,M, 'a 3 , r ...iw ifgfaf r.e?.',.i-Ve' 'QA Q 'Q get. 1 'ww MV x-1' -N'-' K' 3 V V Eu. 1 xvns 'fm 'c HQ' f Hfpywgllik ,lg , V. as W ww ' ,135 U I V fw1?,1M , V V H. 'ffgkif-1551, 9. L ,gm ,pw TS? V., 5 4 V N 4 a,gg'fi'.4f,'M' V , .4 . . -se-V .Vie Y-L-a 1 : VV ., - -Q 5' 3- V, aw?-N V F '. .2 fi- : gr.- fi? .VA ' .. - f ' sf V:.fexrf+w.e-fs-as f ' 'l f V..'2ff?f2-krfv-. 12.11-.V ?ffg,Q?5 .,,. ..,-4--X -V- .V .Q B' 6 ' ' ' K ' ' V ' KWH: 5 5. gr.. .XMQVVAA . IVV '5i?l'VV .Vsgu V2 'W' fi T19 :V-'42, Q: 141 gilffkqf :Her 3? V -Vgmia V-feel. . , ,V,. V ,. .,... A..,. V, . ,,. H, -V .V -,QQ 1-lr. ST V.f xii' 35.-fgefnfj-'?-:-aiiecmgi-353- ,, 5.4 ' 4'F...1 'g-xvitgsf-Viv, -1325 -QI!! .355 f-fl 322, . yi F'?..: '.' ., gf R gifs .WEE 'if V h ?'1'g,:'fyi 'iq M W Yi f '23 gf - aa 1 WF , V '- '-L: V Awfi-,.V, L .,-. -fviffsarfi u'1': 'Z' ' -'if-'V . 31,551 ' - za! V- -.4 'fig ' Vfrw,,9,i?f:ai-.gr '-a-gf.V:rV - - we ' A :,'fs.'-- SVBVVMVQ-3'.,V.V.Q-a:e,..g..'mY.'r::V --V .,.. ,W . 5 g, 355535-V, '. .QLQ3 :,.:'nQ51-Q-:'-' ,315- 1 V-jiiw .V-H V-'L , 'vs , E' . V ,Fe . A-1y 'LPV M.. . V., VV, 1 Vw 1, VV .- V,..5, V, AK , 4.VV,:fk-nes W' 5.VV-.15 .um ,314-V a:M ' 1 ., ,V' ' , ,.:. J- '- .1 .j'+,4.'-,f-gfwf-3 , c-V1. 3 V1 L3.yVff .T 2' V 7-7 155 : V' Egg., Ziifffsiia a f5EZ??f?T3'1l5i'f.2f'i'V '11:M?'V'r5? 1. 'VIEW fff 'Jia -, - ffii,-L212l'if'52EgV1'..1 VV. . 121: 73:51-N5 g3w,w,WV..'f,., E ..,.f+,-,..,V5V.ma...V-V, 41-z5..QVfVf'zV,V V- Viffmfffif V-gd'-iff -f VELMV-A ..-V - ,V ., - V . . . fiirdi , 40- ' V f Viva f . iff- 4291.5 V.fw:5!fr'i?4 -' V ai-3 + 3wg,' j'gVkyg3g.fg::.1:1VV'vQ Ffyjgakggfitl-I,V'- ' ' Ai rn ?'r ifw 'www ' SP .-2 4 W 53 wwfm VV- -V Vw., wg MV My VVMW. . V.- VJ-, g ,L V. :eg gg'-fs? 1' i Y 1 1 f'FQST:V.Q f ,' . .1 'S I ,' f'f,fn'f ' -'Lf' VL -1 -. :F ,. ,V,..VwV. , , .. -,, V.. , C' 7 g--'cfm 43 VV '?'5?27:V'V' ,QA-1' .--f,.,a.-':V . .-.- .,,, ,T H , ,V. ' A 'lf an 1-Viwiev ' gn' Q' y 'gif as in in 5, s f Y' V , , 1' '31 VV I fl 'A 'NL at .ie km' 9 M K, -.J ,Q ' J X-.--53? V V V , ..eVV. , V, ,LV VV 1 if 'S' .- V I Q -' if- Y V gg, . R55 ZW: ,JV VCL: V gz?i.,.fVea3Vzff-55 1 wizffbf ei 'ff ' ' -' N x,1-mi . Av ? iff: if 55i '. ,W 7- Qjfk- 'f ':: 'f fhi4Vff5g'g23Vf1V1aR:fQ f ,YW 5ViV-i:5j! z??-f?i1Vi'Qvftiffsi H33 - V . Vw V -V . V1- V .V ,. ,.V'V:-:via .r.e.VV: 5 ' W 4 W 3'i'+fg1:V.V,, '?V:l1WQT':2i'2'iV9'i-fK?i1'71 ' P PW ' J +V gf QW, V .. .1-1. ...W V. VV. VV V .V ..1. -. , '7m5 L1V- .NV 31 ,Vg Q1 W, 3, A rr ' 'I 4 ' :V , N Q f-Yr? it A ,Rza gig? S 8 L V. 'Lv -3.31 V A 4' A ' Q .V P Qi i jg- 'aj V, f- ,. Q 7. .3 Z.. ' T 5 3 f -. , 1-F 4, gw P 4, .- 1 5, vi JQVV 3 Aa 1-Vi VH 1. V V- -gk ,BN If , .V .1 . . V. .5 -My mg . ,V:f ':3Wf. V rw 14 1 'a lma ,, Biff' n ggxax RL A T A 'u QV L Q51 'lsw 'f ff 'f W-wif -5- Ri -f'V i1--fx V- . , 'iff' g Q :M X51 .V , 45 ' CBM ,. -V D 'Ja k ML Sim V QV Ev fag- ,V :ifufe ina'-, ,.. Vu 1.-,f.,w'+ m Q 'V V.. V Ep, qt. V52S5w'1-.-- V '18 ' G ,gr--QW V V55 wi 4125154 , , 'I ,, ,1V:7g34Q.jvg s.- A V , fc - - M iyfl H f 'wfzwfefav ff -' .V-'A - V sbfimfz -: QV , wr-r F. Lkigimyf-' 5v.,w.fp, ,g. qag:.,f 5.-:,,.-:V-n:-Vw f V,, V. . ., ,,.Q ..-,.,- VV any 4.5 .. if Vy. -Vw. ,-Vfizfi.-Q f--'.'MVe15f.: ,.,e,..-.V-ff .:,.::':rcP 1-rINi ff3'1i ggi' VQffFkfifv.f:'-.5--.ifesziifg 4,1 t, 1 - Q tiki. gifs-3iVQ1' :i mg, V V:, W. ,sf wx .51 -.Vg-7:5V35Qgg,Q:2a?Q1w,ji I -:V.:ga,:g.-j4,y,'f,:.q.,q:V Jr: V ' fu V'viii...2s lf'9'f.1,V,53g,,gg2,55 V .Vt ,,,.-V - ' .f wi? ' ' 55159 'gk' , ,,-pf' Q Y Q xi 'wb ,,,.5.V:w ,V 3- Iv G ML FY Vs 'H .QV ' 2, lzinfg V ,V V ' 'wif ' - 25'-may 5 ZIX f Vf1,:V, V3 q 'if?j pl.: -551,g.1.l,,- - Vbgiig -1, -nz' -32. ii. 1 V 4f,VE35':'3V',,., , '95 flfvif. W ..,. V f . ' ' L' -4 .,-.iamVgai.f522.,aQ-12: Y ' V' EM S. .. 3 ,gi Q , .,.. N Q ev? V34 - 1'-1 'D' TE' gif. E ' c Tiff! -2:V..V-zlm-. VV:- ,Vu.p.:.:5i,ffv..:Vf 1' 'f+'L'V -V. 4 ,s V- .V ,k BWV QV 15' V. .VVV.,.V,-Va. VV V-mi,-., Q ...V -r-a 1 R L im., Wm W . V V., Q-r .1-if Q QffS??fF':'f?' ,HXVV6-ri L? af v ' ' a 'f:1W '3i?' '- V-7? - - G'E'V12Vfi V 'Q'.vQZ.Sf,r, ?f3'1 f,1 i i'3, , V- g-- .L K ,V : . -,- A, 4- v. -t.. ,4,A. we-...,. st.-A-.J--V ,nn '.X, V V-u - - ,J , ,. ,-:I ' 1 V V, V1 .-LV--HQ b , 'gl' ,.,-Vzswg-. 3.541-Vai... V,V, , X T A, V. ...gy ,- . . .5 . V V., , vzhx V.,-si, 13 .V -wh, V- ' zpffff' 45-59 553 A W?f' ' E' 'gpg .. i-wg V -ff 'LL .. im .Q , W M M-R.. 5 3 A V,.,..V ., . V , yy, .,, 'fad V. ., V51---M J - 2 .. re- -2, Qgfif-1,55-V, NSC' 'Q 3 Vi-S-'sm .VE 1-.1 1-' ...W Md -la '-- 1- . 1 ' ' ,.:- 1-'e -V.fV,r,-5 Sf: , V, , ,fi-s.Vf, r- T ' fm? ' ,sf . , QE' ew -. . K., 1 .HIV .5EQ,za2?'-eq'-55...-e Q-fx -, Vp.-555 V-+5225 V 'V rr -V . ,gf . ' ,:,',V,'V.a.,5V,--1. . ig, ..- f -5V.ayVV...f1 4-,gag 1' b V 5,25 V Fix' Vg? V mm-r'l4a ' 'WZ 'fm -if 11 ,. 2 ',:'1:' 4 1 'Air' L. .4 'Tw-L4'..3-'ZEVI5 V,.f1-if-ffm. tfgi-2:-5535'V2.,j..LV1Vpjgg.-'fa ,., ,g .. VVV, 1 31,-A,-..,,,,,-,A.,,,VV, ,,V., lg.: - . Vg-55,8 , fm? , ,, cm E. wmwgwga af? Aw L Va. Af. , V V, 3, ff 4,1 .3 yy 5, ,L mf r Q -' 1.1-2 A+ . .M ffl? V' f fav , ' , ww 1 'Vp-1.1! ,V - ff, 'Fa-3.2 5' 1' A ,VE A-V52-.'1 . . nf-imp. V..-V11-5' ,Q---qs: .mf - E-ix 552 af .:,,ii5 X Rf! 4. ,AH A11 :AL , L M fAR. fr, 'fwmgf aff gb . ' V V. , , .59-AT. V,.V J, .V .V , ., . . . . . f ,M .,.. ,F wg. 4,1351 11, - V' , ,, ' K2:Vse5sa2g'V - 'rim' 9432.21 A- 12 Wm I 1' 'Q V - A V.. V .V , 5 , EE V :V if .-fs, .V1 -1VV V ,,y VV- VV. V JV . .V ff- V , ,',-V:fVV.- V qggmgg Q ,V'5V?f'fj , . , Vgyia . P, , lang. , wi VV- X - -V+ Wai'-'V-' M ' ' W an-.5 - . - .gf '- - V 'rag' V4,4ny44-K-.4:V, f.'V:V5f.g,,' M, ' -' ,wg y'V 'g?4fsl'4. ' gm 511' -' , V+ ' 4 ge N--Vw , 'V FM. .iv 6 f fy-f -:rw 3 '..,,.Q5,3g .V 'xv 'K ? 'H 'V -x 'A Vu ,.-,- 1 A K .3 V Q. V-'R' 'N 3 5 ' wi . ,--afih--JqVV .5153 7325 Vv59ffu.f5xf21V ' ' f'1ff +' '5?:m5x5'35 3VA'Ef' ,Q V . V V,-,.V.. V , .V ...V H., 1. -., .4-V12-V: -' - .Q -.5-S-11:-:V V -3- .H f'- R:-.'5':V:. 432- ' 1a?I,?i5 Q . , ....,,.. -QM, V ,.,. VV,.... . x V V MV.. .,,. .Q V,,,- N... V. ,V V. , - 1 ..V. . .04 -Ve V , - f m.,-.:..:g.V.,A..,,.-,...., .VW ,.,...4.,l:....,1.-V.:.L .,.,5r'V:'. F.:a4,:,..g..,,,.V-4m-.1a,.V-,g.5v- ifQMw:.I,fVWfi-gqgigwgfg.-g,f,Q-4.4,-,f.1.f-.VV:fV,Vw.-M r-V ' r f1 ? 'ff' 15--'--V1- .VV..:' v .V, V- M1 . -ff: -V 'f.,f VM'5ff '5.r' ,Vw-rp-,am '1..2f-f m' M? 'K --, , --,, '7A?Q i--P-,f'rE:?' Mg:- VVM, Q ,V ,.s. .,, VV I 5 3125-viyxfc 4 fin, ' R' ,Q H553 P Z.. .- - --,VV Ng 4 -Q al- 'iegyq V, ki --..Fzr .E-' -1 4: ff1-1-rfV.Vff,..V,.,j4st1V ..VV,. 1-V ,:fV1L-e--f':...-,g.-'--3.-VV'-A,-.1 aw . y ,Va-fs f,.,a.,.-V .5 -, fini.-2' V- .mf f2'fffi-ffafw' V. '- N' gfflz: 521-2 Fila VJ:-1. VV? -fV55ww:fam'fxifiegx-5.zf.uS'-pzfgmggggwggzgggfgViifj--5:3,3 . V -. ,rr- V .gf . V x- .V.-VAL.-. .V-V.: VV wfws . 'f-V2 4'mV'V V- . VV- -..-new . V: . ,V..fV ,ss Vwgn 'wp-: Q5 wg- .Vw ,- 'A V.VV.,j5y:g.V' V.1-,g'g:,Vg'g2Q.Q -V .,..V,,,Q5,gg34..,Qm.f rkmi 5.54, ,ff ,wig .f+'Psm,in'2g,,' 5.,.gEM..,,e..g afa-TF VIH Z '.rQ5f 'fi'd-5i?L' f?f.51Ee3,ffl Wlhfw' ,.-.. , eg., .Vg-.Q . Jf,g.V,.fr,.,V ,AV ,V -. .1 QwVfV-.'JV.,ga,.yg,2: V,.7 V fy., A . .. 1 ,A , . . V . , . Q ,,. ,K ,V,,,,,,V,?,,.,. - 'ln z .?+QV,,f .2-e'f,.2Vf. V , , 41' ,Ari vw. .. .f f.--.ef -f.,-QV-.val-V PJ- ..ngjV?1VV..,Vzf..v..51V.:.'-.. V-.Vining- , . 2 .4 -1 3-2-aJf.,'if,E2e-V-VQV-,61..,41?. 4 'iftwa-12.3,-5237. ,T-,-V'5iS-.gif-V.4': 5' f- Vzi 3:4 5-94,1 ,,.V.LN..X fw ' 'VR ' 'fJm'- .WZ V: 'Zh , gy. fg,V,Vm3g39'-QV- V mn .V ,VV , . ., MU, V A Vfw'f?'iEfiV7 EIL FL-.'.'5 5f:L ,V-,,., ,, i,,5,,V, f 35e1QEQ,.V3.g3,!yV...,V5V.NV,V. Va'-.fn when, . -V, 1-QV V.kQ xr - ' , GTC 1.-wi12.fQ'EZ1'Wilt-itN3fFs,',V 2??f'?:,4- U 4, V f ggjgwm V 5 :Q 53:-Q-,,Va.'.4?wwg,,. X G-NFL? C43 ,1- .,Vy-59 :Qzhaf -S+' jet: 'J swing -' -V 3... .5 sV4vs-955935,-Q f - 5551 NJ-fm it -653' 'W V-1, uf Q4 gxfh, , V-V pq, 'z.,,q2,n, V- 1-53-131.-V - VV .f .fu-A' V -..-.: ?1ff- 173' ,...,V- ... H, 1 V 'V 1 A W 4 V 1 V-VV., x V V14 V-L-:Il V ,.- L--?..VIV,. V,4V.Vga-. 43. VA,,.V V.,-,,V5J-.. , V -,,,.V.V,,.,. , , mi, V CYS -- :fm ...gf ' VL, .1f.! 73?- R 253 .'k3?.'f1 ff 'ff-f?1iVek?HQ - ig, 5 '-2575 :mf -,:.. -- .. . V. .wfi-n1G!',' 'x I ff? VVV.,,w.V .VXVQNVVVV 2,-A WQQQHQQH4. ,yj .,gaew'l' n 3,ggv-559' ' - gr,-Q5.if3ff-.34 Vf?f-:M .V-ya .. Vg:-fe' A. . .zgnwp 9, :V ,S -' VV ' A V.V,V..V1,g-. VV1V:5:uV'WVVsSu,-.ga ffg--f..-were , ' -.45 gif I-,7f,2bg.,wg5ZwgWW-,.gVggg,MZ5-m,:f541V,.AM,k,,-...Wh V,33F,neg,.3 'V5friQ?a'rs5:- f1!?s?V .- . fy ,, .:1,?fWhV V525.imgfVV.193'?1'gfsV::13-1V?':.L,1'21 -BQBQMMKV .15624.1155QVTLQW.EEK'kjfi'm'Qvfgf.V.f7'w1V1-Mgr,.-55f5V,Vwi'p-'g'g5ffj3' '- f- ' - A' 5 V J 5 1' VV ,J w -fic- ww wa?-? Vw' qw' -aff f sim' 54' ,, fJ',:,7 E? E fair-f 4 X ,fifnu '? ,, ,qv wgggfif ei-'Y f 1 FA, I ,iw . g..-3 f ' , - 241 - 2 .' gd x . 'as :VVV, ...rg was 'Q J ' . Ff. - 5493 ' Q -11--,-ff ' g,g?.,',,,-. VV f .H f-'fu-21... J 5. ,-,agp Van ,,1 ' Vp.. V V- ,, ' .. V lr 5 V. -.V W, ...V V V ' f yV.'jV:V 'f VV,.,b, ,: V ' , f,VfV'?f L. 1 V: , ,VVgV5VVV ,G' V ' ,Af - --. .Qp'9.,v , . a,,V ,. . NVQ 23.'39gyr-Vwfif. sr. 5 E -.VQ,?e i2r7, il HV- F' -' YQ. 1 '55 5 , '92 I ' L ug. ?' 52' pfg' ' 4? 501, V-,ge 551.55 D? f Hg' Liam 5 1 35231 aw a'2f,,5'f11v,p1z'? Qi , . V.,, if W abw L v+S'3fi.i.-'P'-MJESQ Kg, A-f-.fri-Q' ' '55-5 T .Aw5VvJ. ggiffgi- g 5 fm? . ... 53: VV. ,,i,.:a, r:,,,fgVi .,. KL 5, 0 . A .V VA: i5ziv1.5,,,5yL5:,g,-1,-- 19-g3:,l:V,:.,..M F, V. 4, :Fr lifts.. .,-.57-A-V QV..-,-.-.. -sgjm., f -'L -ww.: 2 ff fi-'V if I 5 '1yv K f 1 '53-v,'7 jfs' , :iff V It 'V fini.: HFB4, V-- N.f5f High, 1,x'f1f'43ew!'?:ZvYLh 5 -P' 33 ff ,, 1.+Va5?A gf: Q ww? V -'-'-N V an ,A ' fm- ' V ' Vg 'V wwf , +V,.V. Vqyl, 2,54 fy..-f.:,,,, -.-.- . V . 5- - ..w,ff, -. , .,,,,-...,V,,V.,.fg V.NV,. ...T ,.- V V.-V,-Q - 94 f Q fa' 'J 'ci?fif,Jl gafiyh' in '55 if 52. ji 9-53.21 Q-',.rff'sx-'WK 'Y geafidw: xf'2w.f'-xw i-az? 2'-ww-J' .www 1. Skyway, 'Lx' 'V' L ' -' 1' ' f'g 'P f' - :Y '. .'V'f. '-V .5-V1f: .':F':2--iz' .1 'i 4-T-Va, ' '31 Sf V .+31.:V.'2V' -bl V, .x-'Q--1: ?4l '.. .L L25 : '-V A1f'1,'f F ., .Z 3w','-5'f'..fQ- 'V' 1 .- 1 131.3 ffgif 4Q'i3 ' P if-2J'9e. ' i '57 ,'A'- 455.54 m.. fl5ig,5i:i5i3,jf,,-,gigI ' 4 '91 .g ri,h.,,, 9 bg-I 61? 4 Nw ,gh wfksiez Zn., Y Q. ' gif? 5,wg,?'7 4, if uf 'N ff -X fi? asf? ! Ji ' -af 5. '. . 11381: f:4'I5'5wV.fff-.IfV-Qg- Qf:5T2.f-V -wagwf ,, 565,-V.VV51a,,.,,fVf' -1 :VV-V-Mf Vfz-wfifif' 41. . SXQCFVQ VVV' l 5.5, V V- 1 if 1 A f .V.. .ff - iff: :fi-535:-221 gf V 1 C M ' -5' '-'L '.,. -s wif mVVY' f'f'. ',.. Z. ' 1 R ' ewnrl I ffL,f. ,f -V , , 'iw ' 232 ffri.-1 . .V V..t. 'Q 1 .Vw VV - 'vw f'-W ff -V pm' -1V Viv' VR. ff -Vff-?.f'.1V'f1-ffVVf'2f '-'V aff' ' Q w-55? I ? 2fg? 'f6'F,qj3A 'Q ,V gk 1 xg 49,5 ' R 34.6 A ,M g -V RWM efqffh -'Mfg ,3,z'V2 3Vi,g. .ah -995 Jw Ve. 229 ,sa 1 wk kr Aymxgz S4 TV A j-7 if ff -M . f fu, flag - 1' VV f' V-' W'-.rv ,V . ,. .- - , ' 1 4 . 'VVVVV VV. V VV' ,, .VV Faf-Q'-n.'.-W 'a5 L'-9:'e:rf'V:wWS X 7792 'gh A 'f ' W V -Wx f -?W:f3'-wa fg W5 WES--WV-'fW'i miz --nm U- w W, Q .g',w5gi, f 'xx ,Vg ff l?'g'.,V.s..z..ff?v'Vf-'ff-. W- ,sp f'V'.V.V A wuf'-'-rv. .,- . ., VVV',:,'VmV',Vw.:1. 1 . . ' :V ,,VA-. - '11 'A .1 'Q 1, , V V Vg, -1V yt- .V 1 ' ' -wig-,,-4 754. ,. .gm .Fi-V if - V-2.1-Q 134.4 -5.25 51, .V.:VKfs5u---f' .,,V..1iVVf,f' 2, M. - Q ' Ma g .55 '43, -5.525 ,Ag L vii, - Vw . V, '- f .w . -Vw. -.-1f.f.:f' -' - '-V-V-ff5'V f5 f5'1'5zfEf-9562, N . J.: . V wi. 1. in -0 'gif--1-'W'fV-'Vf'-M my W V2 'gil-'V 1- M if .5 21, ' , sf-K? W 231-Vi,-. .sl AY - V, pwm., 'D' if Y .S '41 -eww. 4' NYE. gQ45iv,5:?v?5?J'fXjilQV, 2 J' A jp. ' -' VV MV K' ffiiigimlf . f' ' 33321,-1 ri V :N-. 3 935 f '- '-, V1-FQJVV ., '1::':' -.f-4'-:f-5:1 5y.'V'-Jw:-53: 1 .f 52' ,-3-E. 5 .AEE 42' 1 1. 6' jfs., .ltfjxgg .5 .1Ql f'?fW1S,Mf 'f4 M, .. ,. Va gg., Q, -F V .Vg VJ V,..,V,Vaf . ,.4,,,,.- V, ,, , V ,. ,. . - V V A 1, V I- V, V, mn A :L wt. V ff .,,, I uma Y, - 1'-.V :pw-me -V wa- ?f -P.: 'swf V na- Q52- i qxg ' 1 gf '11-.g::.r,:3. ., .. if-iam ' .V .. 'V -- 'V f- - V. W9 V, , , if V V . f V -' -f f' V W .W VH WM -.2 , :Eb V. QQVKQ gVvwfV?fi' V ,i -, w'j3,Jf::2. .wi ,pn f.V,ty..,,.,i?2wJ W9 V VV ,, , ,V ,V 9 4, gf, -fp ' 5 ' Q 6 ia. 1 Y! 13 'xg ay Y V. xg r, r iliiif ,sb ix? we , A , .. J, .5 .5 V, . , jfe' ff 'Tim ' 373''li- f: fif '-?25WQf'?Vf5fQ:xiii -V'-7:f?2wF 1?f-' E 'fmivlf .Lf,.-V:-y. -... . '-.5352 '5Q?'?.. Vfmna :mir 339' fEf',2?f 55-.5 .'5ffqifV.:ff5x: . , V k nr VI .. :- ,if+iQsV 'f.'fgVt-swa g .,,, easy was ' Q ,J 4 ik? gi,-gh' L ,.. ,pa r W V. V V-+V f'-55 -V '1 Va .M wi. -VV V- V . V 4 . , M51 J: 2- ' ,Vu-n a gfggxxaf V L V., .V . , mm., iq-.,A , ,Q , , -. -V ilfsixur- fi., V.Tt,...,.,,,,..g. V.V.JV.,.4 ,f- K It ' 'f Ci .gfZg2' --Wig X '4'r'ffi?'f '!'3f' -'-s'1f- ??' h:f ' 4- ,: ' gy ' :f?Ve?21?-'ai-, 'Eff 5 5. V, V 'V I f V' f. V ' .. 'W ' H' ' 'VF-iilerc-ffm.. ' .: . fi - .V, -a 7:f-fseifgf' V ff ' 5' ' 4925, ,. jk .ff ggi! 4g 2 I .f ggiui g?5 5, '35, u,y ,5VAV- V ..V .VVV--ff-,Q 1 V- - A M V , s .. .V.,5.- V. ,JV ,-y. V-,L f...f Vi , - L V-V .1-sk :V- 1 ' '. V M-,QVQVU Q 'ig ,, 4 ' fi v V e w gp V iv- 47 l , ffm V V Q Wfli Zig? Vi:.tg,V 1 V 1555 K ', W V. MV . , Vw 6 P .L m V LF . M .QV . GV ' 1 1 .V Ve 'L A ' V V 'fl' V Lf-1 V- -V...V:f-,.,V .4 'V. V,Vf.:VVz TV, m..v1VVQ,VVff i . 'f 4 +V 2 ' ,5 if Q, A V f Ve-El if M , if - , 'Y VV? . - - ,V-.1-:Ala .,,-if f ,. . I 2655 1 2 .51?:,'.afE- ' 'V V .w.,gfj'f, V 2 '25 ifk V -?c'32f1gl,3?w?g-,X J' -gf V f2VVVV-VVM2- - -fkxnirfr .Vi gm, gms .. - ,V V - . - .fm QV V.nWHYmV..V?v'1E ...im Mg, .,, Vf .VV-1:3 .fe gg 1 ' ,- ff?-z 5 1. lf , .f5V .,1Agi - E. -.V V :V 1 ' V .hVjf.W, - - N V , ,V, sv: V V, ,,-F ,gw N - -. W. . M MV V, 4. 2 Vw ' 'f V11 wg.. V 5' fww-Q ew V. f VV WW bf . VV'-'V-VV! 1,9 we V' hw- VV -12 'V' ' ' V V -QV bg V. ' fr ' Lim :9.v'1y Q-gn W :H 'J Trhfaf 'ww L 'H vim 33 4: -M ,Q fu 5 4- mv M..f?:-aff USS 'V' -W . , .. V ,, V!-Gia . Q M Q4 w VVVf '.V:,.wV--.-- ,, , qw. V UV,-V. VV Vv M, . 41,4 N ,V-NJ., ,Ay 4 4 V , ., . -1 A V-we u-V,.l 4 , V--9, .V-W V . 1 .F , - .- I ., .H ag V. . ,V V 1, 'rg-T :frff 'p??,5f..--1-2.4 Mft, f In -, -'-in -- H ,. ,' 4' .+.i-QTQQMVLV Wg'-f.,.v 4, Q, N: 'E ., - -L'-kr' -,. 1 ' -L.: , Vf: - -. , .V ii! 'ff .Vw V: fgvjk- 5. 1+ f--l ff, Q 1 .gm V ' H V , V yn., s .g EQ? ,Vw V 4 jxepsgf. , 5.5. ,2+,V.c1p,?-2,3 xr 4, ,W -V55 - f me W, .3 w'5,37g5ig5.'- ufwgg- ,V , ' -, ---, .V V.V-,X , gsm .., Vg. Ve,'.f:1,1fVVVVV. 2 .., V-V w ,V ,- ., .. 25' V -, .- , .. ,. .11 -V 51 55-f'xi 'u zf:.. w-2'fawV,- .-?'fV- arm,--ggmf V Evra. ..: V- f 1221-fm. -1. -V - V -. -V V V-V-f a. -Veg-...2V,,..,-4. -V iw H 'f .F 3182. V-fs?-V355-si-VG'-+f1,V ,sq-.age r.. Wiqxays V al . -'W af-MMVMV-V-A.,-r V.4ww-. V - V .V '- .V- V--my-Q,. P' A . 56 V- '1 aVf- 2 f '- wo ' ' 'HT tv' -Q2-2531 'tlfff-:V-If' .gif . 3 '75 FV - v ,wr A . on f 1 - ..V V . '55 . l as ff' . '11, -Q -F 'C-6 .,:Vi??'-L?--H . ,.', '- '? V f2 V ? .- ' -.-V -- 94 'V.1-ii-11-51. ffrgzffa, V ,. -,ff.-Ain-'34, V? -nf F JI.. . VP -L, .ff V Q... f . 'W - , , WSW 6 5' -' If . 'Q Vu ,fi-., MVS -ff 26 'M' nf f' 13' .pfpwk Vtxqyw , ,V fv3V.,'1 , , . .V A . ,VV 3:41 , mf '12 Q gf 4 Wx wi M viii? I M f f2VVVVaQ -mf. ff.. SH fr. Z, wif n ffgx 've-.im ve fl f wc 32? WSW ov Egfr .Q -Jaw fr f- V,, . V. V, .V.:..,-V, -, .. . V .V V-an A , ,... , . 4 .V , - V V V , ...fx M 1.. ,:v,, , . nglwL:w-V gg- X -,wi img, jaw, my. ' T we -. 2-V.,1-5. ' K 5 N bfi mm af- 7 41 M nm 1 ,V,vV.Sx,i-V .w ,RV eg.- aggvf ffmquvw- . -V i 55- - V 'VV ws-. :ww pw.-'::e2 A .Mgr ,.t.,V, ul-' ,V 'Q V, E:'E V 4 ' xf1' , ' '2f'V1' 'f. , ' V' 2.',,,., ' ' VV- 1 1.4-1?5f 132-f 4 'FL' W1-.Fw ,. 4 VJ VJ? ' WL .V -' '? '3 'V' 5101 ,V -,gf.V.V,.VV.V. Jw:-1 'V.,VVVV,Vf Vim-V, W- V -- V Veg- , - . Vg, . V. iw ,VV f' sa W3 H 1,1 'HIM U R ,wg 'K' 5fiw 7h',,Q'7fSf Mii !3f:1fE,'f 2Gf' TEEN V?g5,,?5V' 't i ff-' '-QQAVT ' iw 44' ' 'f'1'fL ? V'kLF2mba5 1j,J3g5Q?e-'QV -5gg5jf..QQ.:- ,ffm - 'ff V J .w ifi Ab 3? V-413' 'lg if-, w w ,K 4? V 'Q . my xf V ' V V-2 PM ,- Vw. V V aw .. ', P21 :Y V Vg , 2 . --1. -, .V ' V V 1- V ,N . f-i'f7viN'm 'afgtwd 'W JVJHVV VM... , 'wa-'W 4'N?f3.xmq4g: . i . V gVEfef5,Qg4fg+,h,E3:-A' VVQQAW Q Q .V V, . ..,,, .-VVV... V. ,V V -VffVVm-V.V.VVVV.VM,,,,,-F V ... . 1, - .VF V, --.V-.ri-Vw--.-:.., V VV V- V VV N -. ... .,.-.. ,V.V - ww. av.-V' JV.-, V V-V V - ' W 'V kg... Y. V ,V 12 Q-Pi? Y X, 1 ,k..r..,-,VQVQW V. QL- , VV W QV,-:,g, ,V , V V fn f .VV ,, .-' ,V V. 13,23 - yi min- ,V VV? WW V- - - f 2 V A ' F' in . KR V V 5 wwf. v V. v. , gi iq F' v g' 6' V' I 'F iff? V E, V .V . . , VV ' V.. BV V V n , ,- W 53:- 5: Vmgfimw' Q if AWP,-Q.. fm- ff V' fi'-V,VV V K xii? VJ-42.2.1 ZW' 'Vx-N ' ,Vw hir. 2 fiflff-S'-pf V f ff L... ,fl:f .f-s'!'k'5'. w,V.,-,,,:'f Q.. T V .1 J. JW gn VV,' fzV.Vf . V V V- ..ifBT5rn.f . T: 'Y. t5 2 2'-'ff . VV.:.'f:2rVV:- 1:22 Y W' 5 ,,rFQ?f'L-KSQ' Vigilu' 'J X LZ? f K '-4443 ' f fa? P2 -5 'X-5 9 ? hi -1 '- K+'-1 f 9 ,V ,V ?.1'?f ::Ei'E':VK?fa?? '5E?V??t -ff - aw- V GV' .' -P , 'Q .'gVVL,:'V..f:.'ff'?f,igF' 'Y' es' ? 2 f V.gf,f5 W4 f P T mf' ' iw Q . V .V iw. 'V ' ' 15 5' V'- V4 3 M 9 my V Lf gi! -ff J Sm Q. r V. V 121, .V - ,,x,g,,,' .gf Q f f, f i ' V 1- f- ffff- hi'321,' 2'-Q , .. . '- .fii-:'Vf:Q:.-.,fVf?f V - 11101 V ' fbi, 1 1 V 1 V aygxg, ip. -5 .32 4 , J Q. f.- 4 aw..V,,,V3ej.V,..z..c,7.V,jX?V, ,Q ,wiv uf-2? H L '4 'f r' ,f Q' 'PLM ian -, if ,x 4. , A, 5 'ly 5-,Zi Ve' w, .+ ' if D' Y ' Pg 3 F' f ' y' ? A Vi 1' 1 4. 3 9 4 1 V 1 13' 'iw 35, ,F N f N' , JDK .:'f65w:V:t35f-5629V.,-.2f,V2?,eQ.'fi.'57xg- 43 L ?b'5?53'fff,,?3ff?f :vf A 'imc-'Q ,ww --WY -:V-2' --.1V1-Vw-,,y..ji-f,V,.VQ1,gs,.-..:,Vg Fygi'jf.5f? V54 V V' , Q ...E-qtw,.,g,:i.V QQ.. ff'-,,,Vf.-f31,,r:-.i1W'i?2.V,Af, H1553 .5,-3.,f'9:.e: .V if- V'-r. , mf 25? A . - Va-Wjfuufxg ,ksyiiu fm, 1? is ffggxm J, is , 5.f.E'?PF' gkjf.Vgi33,?V- ,xiii qN??g5pNdf95E,?g.w P 31. 1 L75 V . 'WG' '5-EET, 22-5V 4'4V 'l TY '-, HH W K-Pg W 9 VL? V- if 29' 95 'M M if-Q 424. ' 331 '15 kwa-V 3 'YNY'-V'.f f4if32fp'Jn as ' ' ,,V ,. . VV :fr-,QVV-1 .- V?-V.,5 EM .Vu ,- .Q .u4mS,Vw:gE-sofffrjy.. V+-5 V g gan ff wp -V -M, V Vw. . .VV..,g,V A..,.V f .g.., :J ffgsff- iw 'H Fviws? 1,721 Mf af 'f lf .d'N ',., fxgygfm' gg bf Q,xM-V ' s5M'S1f 2123 ' 'fi n-Q ' 5- ?.V. '7'iifV V,iif . V - L' - 1.V- . '--,2'-5'--1'.4- 3, Lie? . T - -' - ' 5454-':,':L'.'?,a .21--Yr. V: Q1 Va , .. : V-.4 g---5,,xf.--11,f,,,- ',7..5.-4. if f, 2- . V. , V Vy, V L- 1- ,j A VV ff , ,rw-ap, V-, '- .-1111- . K .'.3 fy, V -Q V . , V -.iff 3.51 : ?fFV7'3'i'kW'LVi,V-, '4'5?'fF 1-V uVf'2f'ffl5f,',, f Q Qui ,. 5 1' ' 4 5- . E11 34. 2919 'ff..'l:a. aw-V iff! A M 'Y' ', r V F23 f5!35f'? J '7' ' ' Na+-1, ,.V V.V,.f.,,-V -V-My VV,,VV-,,V.,... I , . le' 3 . -V ,Vy,.-VV Vv vig.-je, 25:1 5' -V. , A3 . -in-3:5 f:V-- 1.-9 P' VV V W V ull 1 gpm d5Swi23+R,..,h,, Vlfi-gag,-'fag WMM .L ffm-iii .4 :..Ml..m4.i2fi-Iamy: Ja- fa us.. 2 V- 1-'-V115-V.f fv. ,'V2.fLfs:m' :Q.521V'gvf'a9 ., V-,-5, V ,, . -,fa-WV -' VVV,,.VV VV A-Vwfx :4Vg3V-,gg , ' '-...'Vf'11L.g.J:ILL...:.4...-V1 Llggifm 2 ,X v Q1 3' GN QWEE X my QM u wi K-,W h g fla g---Ik Ewwy ' ,..'f'g for 231 N- Q ,EX X Vf 7' ' ,N . . , X , f W Q E THE E gm in HDLEE AN GOLD 19935 D . i Q xK ' 'Q . f 11 145: nf n 1, ,4 , 'E X 2' fiwimf -Q ,, 52? 1 I I 15 ,is 1 X 1 '1- F. f ix Q MW M ff, ,W if M W ' ' x s ' i' L I Wx Xf4f:f,a 7' X wh K. - . .1 . , 'ILK ,, 7 'fr' . ' M1 F , ,4 K iwi? '4 Q W 1 ' f 'TQ': IN- 5, I 2 ,gb G E C011 HICHT E 1 2 BY E E 49 HELENASNUVEI-I EDITOINN-CHIEF E E g ag 3: fy fb J . --Ezinfffffwsk f f, uf. ff' ff K 'Q ' bfi' ez V 5 'Ak , !,1 EFlg:E , Q 'im 1 , 1 Kg, X I u K 'Q , Vfif V I -Q-.,,, ,, ' 4 I V 1, 1, ff -F4 i V .mm , f - , - 'R v ' -.. Q , .1, ' ' V' , .01 . ' AG lrmn ..,,,,.,.,-Az. , ,V .. m -f 1- . ., IM WWW, P5 4, C no J , - ,V I --. l ,MQ I .r W A .. .wf X19 IW .1'fr 0I-5, ,. ,il f I ' . Y , K f ' ' 7 2-.fm '5 - . I Sdn, AN .M . AK 4,44 Z9 1 x N a - :L-mme-v:n,5 . ' f ' V f e7T,f 'S W . f --fs! f ' .1 -' :- J , - 155525fkEf?e:y252j53'r5-,,.gqgfff W 'W W'M2F525fa52i'-5.-2 .mir---1: zczffgllv I -, Q 6 - Q2 - ffl .jllhlb A.- 'Xl , - ' : 1 ygxf- I 'xi 13 'A is f M Whw VW ' TEE 5 PUQPLF GOLD DUBLISHED BY THE E SENIOR CLASS OF E WAITE HIGH SCHOOL E TOLEDO, omo. E 1923 5 2 ,rig X !1g'y X'fl ' 2 f 19525555 2222 'W TH? UE kk AG..,H,.... Z -..X f X C, X9 i - C 'siT5,5fX K+ - ' f 'fs t A YP .iks X xv XAQ .D ,il 1 i V , gs gs , llwsess 'Ip ,- , fw 543,-gl' ' 7' ' ,ily ,sm gi 1 -1 if 'A T 'X7L'1 We E CD66l1Z'CdfZ.07Z .E E E E The annual board gratefully dedi- E E cates this eleventh edition of the PUR- E E PLE AND GOLD to Nlr. Severance, in E E recognition of his vears of faithful service E E in the instruction of students. To have :E- E started thousands of Waite pupils, as E E freshmen, on the right path in their high E E school life, is an achievement upon which E E a man may look with pride. hlr. Sever- E E ance is keenly interested in the affairs of E E the school. His readiness to assist in any E E cause for the upbuilding of VVaite is too E E Well understood to call for comment. E E VVhat better way to make public ac- E E knowledgement of his Worth than to E E dedicate this volume of the PURPLE E E AND GOLD to Nlr. Severance? S E : E E 3 lifzigezzgt' -A A FRQD, if ,ifrh 02152117 2 at as P iiii xSi 1II' 9'5ii K 9jilLT:?j'silA'?i, if Eg. ,,.b ' 'il 1 ragga, H gbll l lr, F. mi ,.., l l si Hula ' l, 1, it 4 X 3 - A ssy . 5355 my 2 'X Q 'Md Xbzs 'VA- L. fl- hvsg r . -. sway, .1 g f C -L I . Q, Sw . Q lg -:P Tl ,P ' -J nm x I , fkf , ffnfx' 22 Q19 Q ky C , 9 R- XX 2, N Av ' f f . 'f--. N X fi 5 '3 E E a E E E E E E E E E E E E E E E E E 5 E E E E E E E 5 E 1 Z 5 E f ufg!.C0'ig, 52 G-if 2' 73 ' 7' 1 4' Ti Jf i fff2 ?Z? Q 1 f' gf -.,5.LwZQ,., I I ' 7 ,fu fj-In fv5bQW1z W f- lim' mil d X M1'. M. B. Svi1enz11z,'e . X L is ,ff A V Jfzlzual foam? LDV! ORIAL D111 ARTMLNT Ldilor-in-C hie Helen A. Snover Aworiate Editorf Burnap Qole Helen R. 'I anner Organizations, 7 , , LaVonia Knisely ' .hflargery Best Athletics, , Roger bhelles Girls Athleticp , . ulia lalrner Socialnnu-, ,W , ,, George Bates Yenas Hartman Lomics--,.,,, B We , new Art llditornw W , on cn, WH Affiffflllff hlargaret Brangan Virgil Eckhart Arthur Geoffrion Catherine XValeh Business Klanager H ,, , ,, We ,Ralph Heinen Advertising Klanager, ,,,, , -Horace Coy .451 1.5111 II If lfredcricla Hansen Dean Overniycr Alhert. Birch l,4n'in Kerr Secretary-Treasurer77 , , ,H W , ,c,, , H W Xlary Wheeler Typists W- , , 7 ,, ,,,, Hhlargaret Davis, Helen Powell Faculfy f4dz'i5er5 Generaln, W ,H , , H ,,,lVlr. James Pollock Financial, , H, ,,,Nlr. Klerritt Nauts Literaryc ,,,.. hlrs. Alice Allen Artn, ,Miss Flora Carpenter X 54 1 9 A f 1 f I f 'X i ll l f 5 X n . f K fl f f -f' f ,ff fr, J '.':p:..fag-zz , ,5,, W tt.. l A 'Z fri! I iw P L v ,t,, I, ff .-4' ,X -44, 1X f V X f ', 1 V ,'a4,..4g' i elsif W' 'Ml f'Z ' ' , 5 K fwlu 5 lisiiih X A . l 9 7 u 4 ' 4 3 4 J. W if IQII Wlff 9 J D l 4 QL: --Fri, F: i -- WY Y . kfl,ni?1 U guna' 4' .- .-L ' 1: F F r- F F Un u anal e r - as if ,u ,E e as s -eff X ' YW sn 'P tw s Xxx XX Foreword lYith the purpose of inspiring Wvaite students to a recognition of their heritage as inhabitants of this region the Annual Board has esswyed to portray picturesquely the history ofthe Xlauinee Yallev. In addition ithas endeavored in his eleventh volume ofthe Purple and Gold to record the events of the school year, and to furnish a pleasant reminder of thc days spent in Wlaite High School. x X N 4 X X b XX 5 X X, f XX X Xl N 1 f an X t.. j f xx X X X 56 X Q52 tfftf X it 5 X X s X lt -tb J x K A 1 , , ..., , Q , if as Wt - t, harm- ,nt,?: ' X mir E E : E E E E E E E i 1 E E -' : S : S 5 5 I L E : , E E 7 ' E E E E E E - - 1 1 : E t cc ,ss E hf W LQ M-Xrlgvf Q fur ftoDEUE' ,MEQI qfw -I ' Kg -J' -fr Y ,gli W jr is ,-Lhazgeflf ' i Q M f l ' l J , 1 ' - J V 1 l 2-if-A -,.- Q - A ... W W l -' 11 -mlm' X -- - ,':Q,4 'F '-.,, i llIllllllIlllIl Q 5 4 '!i Y!'Ei : Wm--illi' l 'Pm:lml 'lllvmlmw' ? V E i ll E E I l E E E E l E E Content! 5 E E E l lXIaumce Valley E E ' ll Administration F2 E lll Classes E ra: IV Urgauizatioiis E E Y Activities E E vi Aihlciic E E YH Humor E E Ylll Advcrtisemcins E E IX Aulograplis E E E E E -J ii -i .J LS S .J ji :s if X i,, is N ' A Lv... X lx . . 4, i f QA 5 H- i,,,1 ,:,:2. , ,V ..., ,,.. . .., Inhtmgsggzigggzhgsgi P iqqxi P r- 2, + - ,W 'V'-:-.-?' P ' ' ' 'if''f1 ffff'f!P1fvifiiisfmfNffsiakggg-iiig'4552ist:.'-' T- -fffxfwfli f'+ if ii ljff . s , is e - WT- s ills J will ls ss sf 4 ig 1 A My fN e , 'J I we A M-1 - x M Pnl' 'I l ik F J if f wmsmv 1 pn .WWSHQ-EEF? ' ' -' 7 2 e we E E l I 5 E my E 5 ' 1 -' E 'tJ::'E7'L3.: - ? f'-.lr I 5 M N441 L 1 L E L L E' EJ I4 2111.4 X, ' lik L - Y C j ,ffgv5yziii'kigggggfigunvM ,, 'mmm in - .v.. I uf- '-29 he ' W' ' YW f f lF f.'ii.fx 1'T217:,fE2:fZ?1:Qeiif3.:.ga.iii'L'EiiieiagiiiieeselfillW'iiiiiiiiiiifgiafmH - ' H ff -,igfge e 51, - e S ... , ' H' '4 A e e we ee emu: e e ,W1I1e+ f Je 2 L Ji M BRHNGAN X4 Maumee Valley W., 'fflvzfiir 4? ' wwf? Wald ,, ii 74 ,- 71: 5 fi 'iJ4gg-' if 2 M ': J' ff.-'.. 1 , 4' ,-ftk ---'-' -X 'Xa---J if-ff' ' 41' - lt ., 5. 411 ' A .,.:.. af: ' 'Q' f 'f M Mis ' fa V M541 5 ni, ng ',4g:mN.iqv--I-A-1, K vi-V .- ' aw, .,,,,f ' Kiln- -' f 57311 y In p f-4jT,, ,fy,wf,N f- . 4 ' f ' 'Q 31 1, ,mf lun., lvl, W ,lj ' 'Y ' fgb' f ll l ' l i T t - ' l P 1121? , -ffrfww' iw - y- iff iii, 'l . . , , , 1 Trologue It is a matter of history that even before the landing of the Pilgrims, the region of the Great Lakes had been visited by French explorers and traders. These early voyagers were followed by Lasalle, who built a stockade at the Mau- mee rapids, and passed the winter there. From this time on, both French and English pioneers established trading posts, and claimed the region east of the Mississippi in the name of their king. Then followed nearly one hundred years of warfare and massacre between the two rival nations, aided by the Indians. This stage of the turmoil was closed by a treaty of peace, in which all the land east of the Nlississippi passed into the hands of the English. After the Revolutionary War, the invasion of the Nlaumee valley by the white man was so rapid that the Indians, seeing their land disappear by unfair means, formed a secret alliance to exterminate their foe. Affairs became so bad that President Vlfashington sent General Anthony Wayne to protect the frontier and put down these Indian attacks. The little army of Americans bravely began the subjugation of the valley. At Roche-de-Boeuf, now the site of Wvaterville, they adopted a plan of procedure, after a last attempt at a peace council had failed. Slowly General YVayne ad- vanced down the Maumee until the lndians, under Chief Turkeyfoot, made at last stand at a spot where a recent storm had felled many of the forest trees. Today the scene of the encounter is marked by the historic boulder, Turkeyfoot FWL, a N A - 33- , 1 lf,pfvf.5 .f ,. w'1f 'YfP'T..e?2. 1-.Zia-'ff ' A l ' -'sf - 'fart ,' ' ,V '-74- r -fliliwf-1' ' ' weak - 19?4'TQ'il15iit1WWf'f.:s4: '42'-'f-2l 't-fn. -ff: 1' we Ce ff - e ' e ' ,itfiwcb '1-ef f . 1- :def ,-My 4 - . W. 4. -'rt-.W eldlgtfiqfiw N .0 ,, ' luliex- L'2-'TQ L ' - f -T T 2 51 4-. . . ' Y-- - . ' ' -- , , K W -,Q-ef rwfg a-tq.f,Q-.L. TigQf. - -Q f -15,3-1: if :fr vt -'a T Q, 'Ti-'T??1 ' ' '--- ' ., ' 22555275 ' 1 ' ifhaffl' :.. , ',,. Y-, f er.?i-52'-??g?i3tfa-Qi' i -f T Agf? .q f'T' l?-1: L- ' '- - ,E 4-1-frf:i:gg2?1 ' ' ' 45-,Y 1 5' I ' '1 i-.?.?- Q' ' B . V ::+iTY1-ei FxoeHE-Ds- BOEUF 9 fb will W 'fs 1Ze1b?!liff'.L92 25 Mm 1lf4.5?ifW1l'1vfff, qifsfa' s at 1 9' 1-f-13'11g+w-fwa.4.ff',a11lfll'!0l iw-'Axis - c Ti ff -14 1-. --r-aft. :ge-f'zf Mr'?l 1- 1-1131--M -11-wazg422 i21fZi:1l15I1Zill, ,yi H, Q QM illfh 1-,rlf:??6:WffqZfQZ28,fi--,Eli ' 6 'QW lllii s. 1 ' 1?iy:w ?!1lWf'l1 5' i- 'fif 1ls1l.l1lZ,f' K if a ria - -- fm1.e11lE?l! TWA A --s,a,,f .I V N if 1- 'vim' Jews' 11- :fe .A,. S '1 if 1 X L if. - 12.11 1 , 'qw' 11,1 X JJ, ,fee f as ,ffm 1. 1 ' ,jf gififff ,yy be , fiwtvlieffl, fl' .fe .1 ffm W N .,l,,!11 ' 1 WY OLD SETTLEFTS CABIN hIiami, which he judged to be too strong for at- tack, and he built Fort Industry. The site of the blockhouse is now at Summit and Monroe Streets. By this time, immigration began to pour into northwestern Ohio, covered wagons were a common sight. Among these settlers were Peter Navarre, famous trapper, and scout, Louis Burdo, and others. Navarre found the Ottawa Indians occupying the east side of the river, one of their villages being built where VVaite High School now stands. The Bowl, well-known in Rock. The battle of Fallen Timbers, as the engagement is called, was so destructive to the red men that they were compelled to accept the enerny's terms, which included the surrender of tracts of land for trading posts, and the right of way between them. Une of these tracts is in the heart of Toledo's downtown district. After routing the Indians, General VVayne drifted down the river past the British Fort 9 f 4 ,V Lf , K Q jf ff' ITWMLZ Mg' .1 V11 ,Qc -. Z . ,kg ,feb 3 11 r V- 062 J -if M! '11 10 ,110 1. X 4 31111 .1 51' 112 f l I 'Al f f 1, 11t f1 1 illllf if 1 f LDEANjw1:,:3,,I,1,,11,:1 11 ,I 1 U 'ar Q lit-1 I 1 -Q, I W- 914' XT' T3'r1a1fI4 1 ff f 'l:, ,M XP X '1 ,,', I lfsfuif 'Q ,V ,jii,'f t-fi' J 1 ' ' , ii .x-sf I,,,.,xX.f?ir, ,VI ,, va, 1 2 'f,f'., 'A-NM. ,ral ' ' ,1 114 itxviwg f fo o t b a l l ,I ,, ,, , . . - 1' 1. 1-M, 24: I 1,',. 5-P1 ' , gt 2 , H, l1 1 s 1 o r y , ,,, 1fgA134,l 1, if w a s a 'W -11' if 11.fl Q?'1flXlf'1'1 MP4,-g 1' ML it 1 My 1.-31 W . I -+1?y1i'w,1f4 . 54,1 st ' . . G 'W 4 1 'ilww FIM' , d I C .l I ,, ,aj .14 141.1 1,3 t ...U ' V l 'Wil' ' s w ll 111 p. M W' i t l1 ' '1'-'A' ' W it 1. s' l s 5 1' I R Fe' il' E if 21 l We 1 Jil ,wt X Q -. ,1 V X,1..1:I ' ffm ,. y ., .,,. f' 1-1 s '- - 1 we--ff -' 1. ,,,a..4Q X, ,221-'nfs 57- Tj! , 1-1 s-.l ,,.,,.1-51,61 -S as -..sts 1 1 ' - 15' 1 ' 1' , N in I KI , fl 1 it il! - by 11 ,l, ,,3g i,- -I rea- 'e eeee e i1 v-..q.ffv be 1 U Sw- Y ' ' ' f ni Muir 4 VVAITE EOVVL the YVar of PETER NAVARRE I 1812 came another Indian uprising in the region around the Great Lakes. At the RIaumee rapids, General Harrison took per- sonal command of the army of the North- west. The massacre at the Raisin River, the two sieges of Fort KIeigs, and other his- toric conHicts show that this territory was saved to civilization through a pathway of blood. Fort Nfeigs was the rallying poi11t for troops, the storehouse for supplies, tl1e Gibraltar of the Maumee. lt rolled back British invasion while Perry was building his fleet on the shores of Lake lirie. It was to General Harrison at Fort hfeigs E that Commodore Perry sent his world- ' 5' f famed dispatch when the British ','v lowered their colors at Put-in-Bay: C, We have met the enemy and they ,my -T T are oursll' All honor to old Fort Meigs! , h .- lf :dv . lg M- ' m f, A 1, 1d.Aftertthe. depgatrlatltion of peace, , ,l,5,1?fL!fff -I ,lvl so iers re Ll.I'11Htg f Heir gornes gavs fT,,,j,,f, -. gowing accoun s o e eauty an ' ll! ,fgwfl Ma. fertility of the hfaumee Valley, its CANNON FROM PERRY5 FLAGSH' P forests, and its game, so that immigra- tion to the region increased steadily. The history of transportation in the Valley centers about the development of trade on natural and artificial waterways. To make one's way through north- western Ohio in the early part of the nineteenth century was extremely hazardous. Besides the danger of encountering hostile Indians, swamps and almost un- broken forests obstructed travel. River and lake shipping was made easily possible by the abundance of timber both for building purposes and for fuel. It was only to be expected that the pioneers should take advantage of natural resources, to establish and maintain communication with the rest of the country. The first craft to ply the Maumee for commercial purposes was the schooner Black Snake, Jacob Wilkinson, master. She sailed up the river, landing a number of immigrant families at Fort lyfeigs. The first steamboat on the Great Lakes was built to run between Buffalo and the foot of the lhfaumee rapids. Launched in 1818, the W'alk-in-the-Wlater attempted to navigate the Maumee river, but was unable to get farther than the mouth of Swan Creek because of the shallowness of the water. This proved a great disappointment to ' her owners who had purchased a tract of land V , below Perrysburg, and had laid out a town which was to have become a great commercial 4 ' metropolis. V, X, The history of shipbuilding in the valley ' . begins when the sloop hfiami was launched at 'A , I, K Perrysburg. The town, for years afterward, g f ' A ' was important as a shipbuilding center. The X, launching of the hffiami was the beginning of a j ' Y ' great industry which reached its climax during if the World VVar, when the Toledo Shipbuilding Company took the lead in building Lake ,f Type vessels for the emergency fleet. The Nliami would appear like a toy beside one of the leviathans of our inland seas. f Until the completion of the hliami and , ,,n,-, l IWEQQ Erie Canal, Toledo was little more than a te .J ,Ji malaria-breeding impoverished town. The fi ,, - . 1 i AF - f , ff,,f,. V415 , , 7 . fl vp waterway rapidly developed into a great M -TJ- ' --,'-' - - W thoroughfare of travel, as many as 4,000 boats FORT M965 MONUMENT clearing Toledo in one year. hffillions of dol- W,IIIl I , I' In ljn A ' , 'ml Ur, ' N,-N, ,ii . 4 ' f X cm 'AA A X K ff . ' wt QM? ,ii My A .fred-fflx! Xilfef' cfm . ff -- V. f 'I 'f ' -'11, .ff f fmt' 'E , ' - - f at 'WV' II .' 1' Q -- z 5 'fiyik' f f 455.. I 4 ..-v 5'i3-,jimi rf I+' ' .7 ff 1 ffw A ' ., gf' . A .. ,eirqf L: 2 . I 5fi'KTi . ,-5' ' , 5, ' ' u TQ. Xcljli 'f ,', 'ffl '1 Q- ,Z fx ., U, ,,,, f I , 1?y 'j!44,,,,l'. ,f . H., l af I fy Z ., . FIRST RAILROAD IN NORTHWEST TERRITORY larsl worth of produce was transported and the passenger trade flourished. The journey could be made from Toledo to Cincinnati in four days. Transportation by the canal continued to be prosperous until the coming of the railroad. Since then several unsuccessful attempts have been made to renew the old waterway. In the last two years the only remaining locks opening into Swan Creek near Erie Street have been filled up. The story of the canal is past history. The pioneer railroad west of the Alleghenies was built and operated by Toledo business men. The road, constructed of oak rails with steel straps along the top, ran from Toledo to Adrian. This enterprise was quickly followed by others, con- necting Toledo, as by a huge network, with the principal cities of the country. The 'fKey to the Maumee Valleyv is now the third largest railroad center in America. Commerce and manufacturing go hand in hand. VI7ith the growth of com- merce went the development of industries of all sorts. Only a person of unusual imagination could have lived even as late as the Civil Wvar, and have visualized the Toledo of today. The great oil refineries, steel mills, grain elevators, ore docks, and manufacturing plants make the Maumee valley a center of industrial activity. On the south shore of the bay is located the Qhio Standard Oil Com- pany, which refines oil from wells a thousand miles away. Seventeen of its chimneys, each towering 200 feet into the air, are visible along the skyline. lnnumerablc cans of oil, bearing the image of a sacred animal, are shipped for use as incense-burners in the temples of India and Tibet. The demand in this . - ' ' TC , ' 1- , rx mfg ,. ,. Q fr g A .ge fy -, if- J ,K-Mya ., -5-.M 453 5 75' ,Q ' f E55-diff' ':. 5 , 4 5 -'E ' 'N .. J ' f fl e e ' 1.x , 5112 5555 ' E. .L ' sq '4 f3Q ':59f3f ' . , - , -1-ff G-4 . m e -'-t ef if - 1ifgf2 X e 1 fir?-M ii V lf K Zc Y V T FET' ' EARLY RIVER STEAMEQAT nr ,X .-, fi M 'N T Z: v r . r ff 4' .li Q 1 ir I xkxv 1 f 9 , .xiii X , fl: ,Q N N , 1 4 MS ' r Av ,f X X W 1 X 1 fl N l 'J 'f L47 illff i dy N In f ' , ' , ISL! .l, fna 'glam Jim, vs, if llf2 'f'w fi f , Al I ill' f :-Y f - 5 P4-. TT1' ,rg3: ' ' MQRQQSON ' v-fm:-rE's HOME Amo 1-HE ceo ELM AT MAUMEQ country for oil in all stages of refinement, is beyond the liveliest imagination to conceive. Two of Toledo's suburbs, Birmingham and Ironville, remind one of the great steel towns of England. Huge piles of iron ore along the docks give promise of steel bridges which will span ehasms in lands beyond the sea. Freighters, leaving their cargoes at the ore docks, carry away with them coal from the mines of southern Uhio. Each car of coal is lifted and overturned, emptying instantly its entire contents into the hold of the vessel. Up and down the river, grain elevators are a common sight.. Equipped with machinery which scoops up the grain from the vessells hold, these elevators can unload 100,000 bushels a day. The needs of the wheat-producing and the wheat-consuming countries of the world are met. In the production of vehicles of all sorts, Toledo long ago took the lead. The first company organized for this purpose was the Milburn Wagon Works. From this modest beginning has grown the automobile industry which gives the 122 , , Q f M 2155 , V ,Q ee , . hx Ju ! ' fsW6 ,,,, 4 I ' 13' Maia? V 1 LL' f l i f lildiil , it . .Mimi 71,1 ,,,4,,l,l,,.,, i ?f,,:1.fWa,,!t 115 Q QL ff' was gf. 4+ fs Et H ' fglf 1 ff? 1530. l H El r lszz iaiail, A if 1-,..,1,g,3:f: ff f.: fn 0 ,. X 'In Aw. lp, o,,,m,t,e XM. X f y,,a,u, , fy My VN , 'Q p counv HOVSE L MAwMEE.O'-H0 X, , V. l L city third place in the output ol motor cars. One of these factories alone covers l2O acres. On thousands of tables throughout the country, Libbey glass is to be found, and Ford plate glass is in the windows of numberless stores and houses. The bottle we obtain at the drug store was in all probability fashioned by the Owens bottle machine, which has revolutionized the bottle-making industry. And what Toledoan has not used sugar from beets grown in the vicinity, the price ofthe product depending on the beet plains of Europe or the cane fields of the tropics? Do Belgian folk like a cup of coffee? Perhaps the fragrant bean has been roasted and prepared for distribution by the VVoolson Spice Company. But industries are not the Whole of life, Toledo, with its up-river and other residential colonies, is a place of pleasant homes. Nor is the city adequately described without mention of the three, million-dollar high schools, and last word in educational structures, and the art museum, unsurpassed for the beauty of its architecture. The Nlaumee, which here flows darkly to the lake, is bordered along its upper course by productive farms. It is a far cry from the unbroken Wilderness to cultivated fields, and much that We enjoy is due to the staunch pioneers, who came to this region to found themselves homes. Ask the smiling valley, and it will tell the story of the brave Who slumber there, ask the shining river, Whose waters were stopped With the bodies of the slain, and it will speak of the heritage given us by the past-a heritage of which every loyal citizen should be proud, and which he should earnestly strive to perpetuate. ,4-. hx ' r i f ' A ' my fr wr- A ' i- vffi-,-:'fi M779 ff N W ZW' fs1,,- - . - ff, ,:,.'?9Sf' 'WJ . at X -. ii, . 2,2 'wifi 'qty .c.a,t, wa . L Wai' s wrt, ch Wag ft iq tv, . - . . A ,af , ,i 'g.'.1w ,Messe 1. wff,fg7 ,,:g5P- ,,,1-. If V :iz if be a. ecsaff-:wwf 95 . - ,,1-,. f- , v , wal: '- -' -Q 57' , '1. it 4-.1 H of 5.1, I I ,-g,.,.,. .ALL '.f:.f.,.C, ,ii-fr. , cgi? F5 . .14 .zuttyw pw, if ifefafyyii. ,' ,ig fl. ,, V X , If ,,,H, , ,.:, 1 7- - el iw W1 f'ff.. 1 W?'f' ff il , Whplkz w ' F2 X fy f i Airs. s fi4'lfiff. 'd' N46 fir fm '1'LJFHQE.Y'FDOT' ROCK Z!7Z6,J' Harmony In June the emerald eopse is filled With melody the thrushes trillg Tall, nodding daisies lightly sway, VVhile butterllies among them stray, And glistening dew the air distills. ln eveningis sky the stars are spread, The sunset, rosy-hued, has fled, Pale moonlight fills the trees' arcade, Steals softly through the dreaming glade Nightis holy henison is said. 4lWa1'y Krcitfq, Original Embankments, Fort hleigs In Summer In summer When the skyis alight With first fires of the dawn, rose-bright Yon tree stands out against the sky, Graceful, picturesque, grandly high, A pillar green: a beauteous sight. Years distant past, behind these banks 'Gainst Indian raids, our fathers fought Here bravely stemmed the British tide, Turned back the Indian, some here died. A priceless heritage Was bought. The Qbver Lazily the river Winds its flow Beyond low-lying islands, sunset-crownedg Along its margin nodding grasses grow, Sedges, and tall, spiked eat-tails, richly brown. Vlihat though the shimmering waves delight to dance 'llhough shady banks invite, though mills arrest? To lose themselves in Erie's broad expanse ls still their destiny, their doom, their quest. 1 fig The Cay The city's droning hurn ascends, Smoke-spitting foundries roarg Tall structures loorn against the sky That speak of battles sore And real. This roaring train, these rows o Close by The river's surging moil, Where freighters ride and great Bespeak the sweat of toil. f steel cranes bend, The Fridge With grand, majestic, upward sweep on high The massive bridge its parted portals heaves, And like a bird with wings outspread, it cleaves The skyis deep blue, where scudding clouds go by, Wihere fleeting birds the summer winds decry, And, scurrying down the bridge, a vagrant leaf Drops through the gash where water interweaves Its How, and there engulfed by waves, it lies. A momentis pause, the o'ertowering monster stands Then silently begins the downward trend, W'itl1out command or visible guiding hand, Descends, the portals meeting, end to end. They join. Wvith heavy thud the great draw lands, While hurrying crowds and noise of traflic blend. if in v'n't Jlforrzlfon . fZWm'!e High Safzool The morning,s brooding silence clothes thy Walls, VVhere rosy beams in crescent harmony Enhance the grandeur of thy symmetry, And Loyal the persistent echo calls. Thy medieval towers, massive, tall, Quaint doorways deep Where light and sha Invite the eager youth who love thee Wellg And 4'Loyal still the laughing echo calls. dow dwel X X XNRX XX Y g xx x X X X S , X X X X N --.. XXXXX,Xx X Xxxx N X xxxxxxxxxx xwxxxxkx E '- ff- b Q . i'N-M' xirrg ,K XR . H llf - h. ..K,,K Q H ,. .,,,, Q Xmwxwwwm in iiiiiivgw ,ki Q S .... ...K,, ,,.i1111.1.,,KK b . . A Q ' ' ..l1Ql,11111i:1jiiiiQ - -..'. f b K . N ,I ....,,. 51, knkg X E V5 E v-QM S -... .zuxkfrzkzxi t L- - XA . mx - g g l: K - N X A Y ' - ' T: T?ff,, Ns, ' :xl A Q A i : ,,., X . N K -jg'-,ig , dmc limi Stncgltflwm 3 Z 5 2 2 2 f , ,,..,,, .NA .A...m. .A 2 5 E Z i f 5 1 5 5 2 i 3 i 3 2 ,.. 1 4 4 f 4 Hz ..L .,... .1 i 1 5 i Q - ----Q -N 1 1 H - -M M-.--.....M.1....Q.:.M.M.W,.g , 51 'f f E fs is s A fx E lf-55 if Q ? ff X 4 X 5 X 3,5 i X. 5' 5 N gy o UQ B X - . N Q 3 w I-X HQFQBWQ :r 5' Q rn S' E+ Q X 2 Q 4 f-f 3- m - H 1 ru H CD K4 0 Q. N :v V-Q. Q. B 5, Q 5' 3- rv 2 E - S-A 3 Q 4 gy. S ro 2 ,, ' -. f-+ H cn K4 :J U, E-3 vxwj L Q 3' ' O, 3 Q, O 5+ 2 ' ' .3 5 . -1 -' :1 X gahqs gg H 2 f I 1 e O 2 Q22 5 2- B 5' : ,S U S 2 2 U1 2 a D- 'Q X as UQ 3 2 5' 2' 3 'Z Y , ra 2 f-+ ro ' UQ ,Q RQ- VD SH 5 2:5 2 O a 11 0 A :.- s Q? 1 D' ' o -' E-2 ..... r., :r ru ,-, U' CD 5 ,QQ ' 'D fb E, 3 fb ff m Q Egfssf l ff G, H O D' D cn id 3 Q. H. D 9' G- Q H' SD 5 rw 'f QA gg.. E' I3 p- 1: f-- Q . -5 fi 56? Q. G Q UA fsf JS-s., 3 Q, S U95 D 5 Q, o 2 3 pa mggawwgmc QD ggf 2 U9 KZ' 'V 0 O - v af g 5 F fp if sr Q Eager? 5 UD 52. f-f ru ' 5 V' 4 S ,wh - 0 O Q, S O E rn ml 3 3 2' H1 Q. 0 H- 0 3 s fi X O O 23 f-+ Q. K4 f F: C H D C D' 4 . ess E-' ' C0 rj FD 5' -' Q D' E,-f .ff 1 Q ' D 0 ,,,, D gd ru im 13 QQ 5 PQ U, A ff: 3 cr SD A N N' 5 'x fb FU U' 2, Q 'U sw U2 rn E-QL -N .. N. ,QFD 5 Q' F' 0 K4 I-,Q V' ' 3 -1 '-s Sv 0 5 l I Tx 5 52223253 D. '-' - ffl? x 2- ' 'D 'D ' 'D ' xx. 5 XY: ' Rf f ' XX X ' e 'Q Cf X 1 . vb HH S QQN4 . v . S 5 Z 9 ',,-1 f, N if 'f---' - Tia ,... ,fgfw Sf' W fxm-O'w J 5 ff , J W ...,....,, 'f A-gg, ,,,, mx fa' Qx ? 1 A, uf A f 1 5 MM Y- ff? x ,,,. f.w,,M,,f If ,IE My Z, . , Q2 . M , M ,V ,M , l 'f'f ff . um, M X f ..., -wf' V-.. 2fMgg, ,ffwx M , f ,uh fwfmf, rm-fx'-J --9251 -V 5' --V rw---' JY1, ,,,, z,fwf1:ffZ..1f:Q:ff1mff:.,,m ...,, f 4,,f:,,z,.pmi:ccmfwmummwwfmwmrzmm,zwmwzn,,,I,','ww',w.,MZz..-..fvmmfmm .,., - ' ' ' ' ,,,,,,,, H11 ' 5 i.1ff,fi fiilif 5, ...,, , . .... t , ' 71112 f 21.11112 z : ,,,,,. ,f ill ...-.., A Q32 , 1123 S 55511555 ggg ,, ,,,,, 5 2 ,U111112 ! 5 V ,.,.,, f ----- 2 ? , ff..ffff2 VIIII mi ,-' 44 3:37:53 ' 53153 W6 , x ,.., 1112 f 4 5113351113 ,,,., a ........ 3 ,,,,.... 2 Q vv ' 1 511:12 Qllllliiii ffflfi 5 , g ' .,..,. ,. ..... N1 5 ? .,..,.,, Z ?'jjj 11113 .,,..... z ,,,..... fwz yirzzzg f 25:31:15 2151 3 ,,,,, IE ' UW' ' g.L.' 4 f ,.,,,,,, 2 Z ,.,,,.,,. Z Q ....,,.. , 51111114 , , ,,....,, 4 f .....,, f 151311113 W4 ,.,, ffffflf NIR. CHARLES S. RIh.EK f--- ' - - 5 S'I1f3F7 I7lff?71dK71f ofS6l10ofI ' 4 gfffffffj W Twen,lyYsevcn 1112 E 2 1 Qfffffffff - 4 Mm --ff'f MW- - ,ww nf M' ff' 1 f' MHMW' ', .,,.,.,. ,W f fff' ,ff f f A ,.,, fl Mffziilffifffff' f 4 . ' ,... Z ..., O ,,.,,,. . .,., '- ' ,Q,,.,-, ' ilfzlyjwmwwffffflfff ,J-U'LJ:2wwmfffmwgMI2fW - ,,.. W .,,,,,.,, , 'ZL..,jl,,,,,.,, ,,,,, , ,..,,, 5 - Wf 'F f f 4 1 2 4 v ,M . ma 1 2 . ....,. 4 ,,.c.,.4 eww-4 J r V i Z 2 l 2 Q al N11 1 A...W..... 1. M f-af--,M -K., 5 57 M 2:1 N,..,. fe- ti 1 , N, .M Al!! , H11 ..., 11,,f'r1f..f we , -W Q1 ,I J ,, W fk ,,, 1 'Wf '-fl 1-Wfuflfw ,,.,,.,. , 0,32-.mkmfw11fwmnewifwfwatmafiirmglwmam..-1Mfmm.,Mm.1:wmz1wm.,mm,Lm.:gnmf , 51111111 53:15 i ,,,...,, 2 if-W5 ' fllifjf l f Ll 1 g1:11L2 2 iiiilifi 1 Qzifxjgfi 13153111 V 552253255 2:1113 5 ijjjjjjjjj jjfjflff 7 ,M ,,.,,.. in-M ga 5111171 gig gfffffig l 31111122 . d 771 61 Qi 06.6 ,E ifgli 1 flee r L i itz: 2112 A distinguished man has said that the service Which labors ij illliffll for the interest of others, Which confers an advantage, which i iffffffffi benefits Which avails is the foundation of all ro ress. 'N , ,... , 7 7 , Q ..,,..,, , Nlr. Pollock believes in this kind of service. He lives his . - - - - lnlffi 1 5555.354 belief every day in directing the affairs of the school. 553353 1 Most of us do not realize the magnitude of his task, but we gffjffffjlg 1 cannot be unaware of the spirit he brings to 1t, nor of his desire - f ,M11 to assist every student committed to his care, in becoming a , s 111.43 helpful, self-reliant person. His discerning Judgment, his , 5 IIIVA wholesome sense of humor, and his Ullfalllllg optimism are 3 .,,,. 1 ..,,,. M ..... . . . . 2-'mf Q essential factors in the development of Waite High School. gifiiiii 5:11113 t 51111216 jfffffffj ,,,,... 5 , , 21 ..11,, , 513323 5111111111 QZZTQ fffffffff 3 ifiiffff? 5 3111151315 , A,A,,,,,,,,, 1 ...,.. Q 3 ffffff 5 L ..., .115 5 .,,.. 5 Y l 1'wenty-eight 31113 f --fa A 111, ,11. 1 1 1 1 11,1 11,11111,,,,, 11111 11 ' 1 111. 1.1.1 4 'iillffffj ,Aff --151' 1 .111 ' - qv 5' 'fzf A f 1' 5 Wffffzfiffi' C1 1 1 ..111 1, f r r 2 2 5 ,,.... V 4 y ,Q ' 'My' we N M M fm' 'XI' 11, 'QMQAA K Q , 2 2 Y, N' , ,211 1-F5 x., 'f 'M'?fC'.'l'7?w'fj Xx,,3,,fCX-J w J 53 ,U f-. . - uf J X k.:,..,J 'J ipffffff , hk,,4'xJ'1 f-'-fmvf YL ff-if K7 ' 1,1 M I , l A .,. lr fd fl ,.-.,, .1 , L -' - f ,Q W,-X 7'-M wwf, vf' W3 M, ,,,, , ,. ,... LAM L-wwf -f '- ' f---ff. I 324 1- .fx .,,,, WW Ffffrf ,LL .fzlffiww-1-M W' ' 'Z' C11 , ,, 1' ffflfflg gn---a . E ,,.,.., 1 ,, ,,.,, . Q 1 1 :iii 5 , ..,,, 5 ,,,,,,,, Q 3 ,,,,,, 5 NM... 4 1 lfvf '-ff 5 Q ,,,,, .2 f -f,'- e f,---f ' ?'1iiii1 21211115 X 'fJ33::., Q '-- Mi ,,,, all ,,.,,, . kjjjj j '----' Y ,,,.., , 5:21 , 5 .,,.,. ',,. 2111111114 ?5555-1 ?:i1iiL., l ? ' 1 4 I , ..,,,, I ,,,,, 5 M,,. H, I illlffff g,,...' ...., 511111 .,....,, , , ..,... ..., Y ,,..,, Ni ? ,,,M.. ....,,., 5 ?i3i:.E 1 jaw' 1512 fig - , .,.., , 2113 s wwf LN .,,,. g E111 3 2 5 , ,.,.,,.. ,M , QW 1 g.M.,.f ,UW 35 ? .... I ,,N, M Q A , ..,,., if , ,,., ki ,...., .V ? MH i ...,.. 51,3 .,.W,,, ?,, 5373 g . , :fri 4? ' I 4 .f.f M-2 I 222223 31? ? y -----f- gflllff nj 5 ES A POLLOCK 5 5 ...... MR, IAM . 1 Q ..., ...,,,,, 4 - 9 ,,...,. ii Y -' f - - ' Prmclpal. .,,, ' , + ,,,,N M. E 1113 y 3 , ,,,,,... 1 l E ,...... 1 Q 9 ,,,, 2 ,, , f ,, 1 wen!!! 7'1 f g-W1 QIIIQQ ,WM ,,,, .M .,.w.M,h ..,, MM ,.,..., ,,,, ,,,,,. tfzyw .,,,,,,, , , !'7!j5' M ,,., ,,,, MMM ,,,,,.,, ....... A 'M' M,,,,33gZLfff',. f' MW cr ffaf ---ff 5 fwwaffz--'g':fWz ,' , -qggiilff f . f,ffflf,.f-- gf., ,, ' ' . 2,1 1 .,., gr' V gg, .,,. 1 ga--N'f ffm 2 ' Q , iw 4 , any ,,,,, ., .. -' A 'AIVI V M, .1 .. . 1 JR ,WW Wa, mffffwww w+'f 'W W ,,,., , ,,,ix,1,,,w,,,W ,... ,,....,, 0 I., 2 A ,.,,, g in f .. li ,. I , 'i 4 1 ' E 5 ..,, ...J at 'V x 5 W, 9 ........ 4 v l f ,, .,... 1 3 I ,.... sa , 'f'fA V- ws ,gm 1,,. .-.X .5 , . . s i i 1 1 i 1 1 5 I , 4 4 ' Y .., 5 ,.,..,. , 5. 9- I 4 z ,. f E., rs 1 5, W 5' V ' , 1 s 5 U f 10,1 .J ,Z ,,,, , f . ,fy fy' 'f 5 N .i'-fini. f'7YS'ME YQ IX' N Q KW f' ' if! '65 f ,.,,, 52 f f W .... I W -fff'f.,f f .,.,., 4 ,,L. .,. if -3172 V W , , ,, 171554 5.115255 5' 2 ...,,,, ,..,..,. ZQIEEE' Q ...,,. 4 if, ,,.,, 5? rd ,,,,, I I ...,f.f 1 2 , ...,,,,. 5111 5 ' ...... l Hifi l 1.555515 v' f- 1 . . . - . . . Zig ,,,,,. Miss Wickenden Nllss Wemp bliss Daring 9 ...... , T W1 tif' T W, ,,,..,, ,gi 5' E - gfffffffj j55::5555f z ,,,.., xg 511111113 5 ? 55555533 i f ....,.. ,, ,Mil 4 gffffj X T' F yfffffff he Ofife ora? 1:1113 Q 712 1 ' The first inhabitants ofthe hflaurnee Valle left us va ue indistinct 2 Y 7 1 V 537 records of their experience. Archeological discoveries or rude pictures 3333 scratched on stone are the source of our knowledge about them. ' ' l ...,,, -2 ' f '-- . . . i'5555555? A But the story of events at VVa1te High School will go down in history 2-333 f a clear, distinct, indisputable record. The reason for this is not hard to f iff, flnd-the office force! Because of the energy and diligence of lyliss ,gf lx 5313133 Wickenden, Miss Wemp and Miss Daring, Whatever is, is recorded. 5555553 They can quote statistics, offer valuable information, locate lost 55:55:15 - . . . . . i Vvfv f art1cles, solve the insolvable-indeed, what is it that these scribes 535735 ,, ,mi N, Q of the office cannot do? ,jjj L , ,,,.,.. , 5, Q M j ,li Z 5 Qffik Z fffflffe , giiiiig 5 Izlmy l I - ,,...... i WWW ,,,,, ,W .,,., ,,.,,,,,,,. ...,, .,,.,,.., N ,,,, 5, 5 f ,,,,, 5 f ' ' 52245 K fwiif L fiilliiillfiwlfffiiii 1 ,H-'15Il? ' 5 -- . 5. ' H f ' T V' ' 1 .,,.. ,uf 5 ,,fg5551 '5 ' ff A. K , 1 ' H ii ' X if f 1 5 4 5 1 6 i f Z . ,,74f,Li,e,,f:,,, nf-W 'ff,. w1' N -M '-.W f,,,..,,f.,? ,,,, .... .A If xm ,M xx , ,, . ,,,,, U ..,,,,, if ,,,,.., , ,U . , K , j -'N 6,.,,,, ..,, 4 . vfyjlfgm-X ,df Mf g If j 2 iW 'N 'w ,fg,,f...J vx . -,fm,,, fe f 'Hz 'I fi, , ma ..,.,,,v,,,, , Www 5' ., fs . f VK ' Wu. Vvvr, L J fr 'X 4 m.fw f 'E '--v,,fWf- fin? ..,.. fm...M..:fQ,ff5,,k:f1m:ffffm ,.,, df'-f f':::,w:...::z' .,,, 1 M1451?mm4.rzQ-,nczbffffm,fm.fm..:Wm.,1WM::f1m..wmffE:mf,lz.mw.,w.,,Mfff.,f 5 5 ....... 1 ...., 5 -Q Z ,,f i 2 3 f ,,... , K .,.,... J y 2 , 4 1 I'. '. ' In ' -v gf'-,'-f.x.' ff.-X-, -21, 1' ',::,.v:'1- Q Q -- .47 s' r A ,A , 2 , ,xml :'f.,' F 2. ,A 5' fv.-: ,g, V '11 --if ,L '- :QLD 3-51:-'-,lewg , ,, 'ff -A 'fx .' ,., 4 4 1, , - ,Z 50-511 --.qu---pfff'--f ky. . ,f 1' j .1 -, ,Hg . -f-f .1 ., M- - ,,.'g 4 , ,I nz... . g. '-, ..- .,, 5,.,,,f, ,,. .g 7 f' ,,,x-,,-,,,tg ,- '-If-'Q--WT-,.,LgLL,',-, --H 7' ' f ' X fz., ' - . -- f ' I , -.3,'5j:.:,i', 'f3Q.g.-,fr ffg-. ,Q PM ' , ' , f f 31, ,,.Lw'-g'.,1,,,6 ,3 ,',jg:.,,.fv,-haf. g . 5 . A ., .1 , ' .,':-' iff.'f.f.-.-1J:-,,lf 'f af-'J ..:-1,- f A ,,4,.3, 1, ,f .. 1.111 ff.,p, 5 if .4 -gi,57,:,-, f,,.3 ,j-,L-L, I ,. Q' V 3 ,Lp N1 ,j,4.I.'w 'A ,Q ' E i4JfZl!?'I-2571511'iw?f1,3ff, Q-7: .'1'l if-'bfvffi . .' . -- 4112 S 1-' g,'T,f.'f'-fl?1'1FJ.fJ..ij,--' wg f - -:,fLfjf,g7. 'iff fxghz ' -'bb .' ff- .ff :5 ' Asgffi' Q:-59 'jj ,'.-.1,','f g.' .1'5jp1f.h -3 .2 1 I ,. 1 ' y - 4 Q ' ffl? 3 4 ig :k ,'.j+'v:'.,-'-NT ,J .-' .- -v - Eg.-1 -, - 4 , ' , , . '..z.x .' ..'- ' f ' A- ,-' , . ' ., ,,,, mfs 5 ff f,-f, nu: -.Z ':'.. ,' r ,XX I! A x 3' K'-.pf 5 1 ,-v,'5'..-4. 1J l: - f W'-. .'x', -- '-f- . .4 , --- - .5 H 4 1 f ff-f':'Vjf:ff,'lQ'1 f17l.j 'S:j: -3 :J' - ' Y A , Y.-.'3 X FIX.. 'Z' 3.-kif':: .,' -' 5'-'pi' ffl .fff5,f3x,fZf2Q':'Q'? : v Q .' -4 -f -if-'7 'TL-i7 :V V' :sin ' I? g -.M 'xlf 'fp,,--fnizlfv .a 'N - - ' 1 gg -, 5' .g. A-'Wg 'H . Q1-.mf 'ag-'.'.'N.-if' ..- f -1 fa , ' -, . 1 1, ,rv-,I f :., :,:1.L, ,A , f. ,, 1, 4- vvrv 1' ,-1 . fy 1' 'X ' 2 4 SNS'':1:'W'Q'i?9fLvj 7,5 'y 1 J' .1 fg ,Q3. .f,',. N ' '- , .jg f:,Vi:mVi,:.:1,25 :fy x j 1 ji '.1:l:s,':.?,.:'.-L ...., paT.TA..', 'T ' ,' 11:-,Puff :':,. 1, ' I -:.,:-'f',ff'f4t-fi n,,',-A-1' N 1 . ,f-- ,0,.y-'wv.v,. .za ' A- ., Q , 1 ,,,fg.,.,,s .A - 1454--5'-b, - 1 x 45'-,.g1 , .- 511123 5 .ff 'Tri-.Stl-,2'f?'p .4- :v:,, : , - z 1,13 '1ggp,f.r- 1 1-3 1 'v- ' 5 I 'f3'.'w',f 5 , :, 5'iiQ','.'g:.i4 f 1' I'f'2...Q,.j'Zf 5'g, 3, - . ,. .,,. ,V ,., ,. M ,V . ,. A MRM, .L,. n my , ,.,, MM ,V af b jfj-:1'I,fL'a ., ff -lf ,jig A' c 1, I 1 4.-jg'Xi',i,1 'gi - fi fri. f,-Q '- -,f f-' ff f mil -'L. 2r:i.f'fi Q., ,' I i 75.1-.'Q -pf. .giiiiiii 1 .3 ' 1-gk' jfg ' , '- -' 23'-Y1'fJ-Q -2:2 . 5 Q . . .. , . .. n . . - . ,. , , , . W,--A , 4 5 , v ,y awn s V- . f ' ll' J fr I 4- V , ' ' -7,5-Y 5 Z V f V , , f , 5 ,,,, f .L f V f fffffff fd ,,,,, 5! X. ! ff 4 x .,,. I 1 N, ' 5 Xx 4 , - 1 ..., 5 , , 1 I ,,,., 1 1 I - 2 , J ,,,,,, ,., 2 . ...,,, 4 ' Mi . f 3 ,,,,, 2 uisoemo , 73:2 ,. ....., M n.. ....- -I 2 -1 3 2 ggififig 1 ...,,,, 5 I i gfffffif jr '....,,,.,? E f ,.....,, 5 , .,.,, M, , iffffflff V -,... 4 ,,,,... if 5 ,...,,.. 3 . .,,. , , Z , ,gi 3 V ..,,,.., 5 'MY 3 ji Q g .,,,,,.,,.,,,,, --VVV Z ,,,,, ..,,.,,,,,, M n,,,9,,1M ,. I f ,Wff.fwvf 'ww ., ,,,, . ff ,f f , ' ,' f fd!! fl ,ggnzcxvfi , - Wfml' f' gf f , Lf' :wiv .7 3 , f , , 4 -Af, , . . . ,,, .vfy 3--y,ffwf,,w ..,,. ,, ,yylwfw ,,,,,f,w -g ,,,,M,, W ,,,, ff ff If . ,,.. fe'-1. 3 f 'V . il: We f fa M 4 'X f 1 NV' -212.1 ...,.,. f lf- . i N1 W1 1 , ' , ,Q I , ?w7-lim-M7 lm, ,- jf jun! in W, ,.2.,,.,,e,,,! fl .. gk! 'fl n . ..u, ,ff-,A 1' , A y 'f 'f ' 5 ,J-M , Jill.. an ,f - ,, 5 l A H aff , MM I Af Wu? ,f. , ,W xl wwf M X... ,fi Em. 7 eu f ., T il ,- ,HW 7 X .W M JW, fM,W,fwm.,Q ,... V m,fW.W,,W:,,,m,,m,Z g,,,,,,,5y,, ,,,,, ..,,, .... 1 fagwm1me1fm...Wfu..Jmmsgww1meffl.fm..inwzLmMw,::.fwLm?,.w1,,u,,,LW,mNf.mN.f1mmEsw1:2siwf,mw,19c':g s - -W 9 .... ,af i 1 f f 2 Nlr, Baird Miss Beecher Mrs. Allen lVIrs. Alice Allen-A humorous lady who consigns our manuscripts to the waste ' basket. v Mr. Walter B. Baird-A carpenter of no mean talent. Nliss Helen L. Beecher-She delights to help, and overlooks the praises with a smile. fi - , . i ,giiiiiii 5 ....,, 5 -- 4 f W . .,.. . ,. ...., 1 , W 1 ,,,.,... if 1 -b-f f 1 ,,,..... 2 ..... iii l si E f-f-- 42 1 4 iffffffffl Mzss B merger -' l 1 '-- 6 , ..... f' , iw-fe r .,,. as , i........g , 4 , ........ 1 A: gfffffili 'Q ,..,.. Q I ,,..... 2 ? .... M, 5 rms .Wa 1, awe 1 Miss Fon Boerger-She chases little pills around the grass, and calls it golf. ,,,4,,,, 5 5 1 4 ,..-.. 5 I 6 2 l lXflr. Wvard li. Bricker-I juggle figures with ease. 3 , .,,...., 4. . . . . . . 'Ms il lVl1ss Pauline BroWnfZealous guardian of W31fC,S literary kingdom. 211123 5 55:11:13 Nlr. Russell BroWn4ln old Madr1d4that's Where I learned the art. ZILQ lXlr. Lee L. Canfield-wHis courtesy is free and fmeg his dealings fair. g 513:13 fl ffffli if-w 4 ffl A . 5-Mag 23115 1 233 l l if-Mi 1 5:35 r 5 ,.... .ar l lN'lr.Brickc-r Nliss Brown Nlr. R. l3r:vwn Xlr. Canfield ..... 1 7lflil'f.lf-fII,'0 iiiilfi , ,,,,.,,, 2375.13 E M,N,,s.....N.. ...W MMW.,.i37,,,,,W,,,M,N....,:,7yjj7a:,7.,,,,...,,,,z,,j7..?,.a fl M ' f ,wwfcw ' ,, ,. 'f . . ,wfff ,f'.,f' ,f ,X V. ,. - ,- ,,. ,, , X ff, fi, , My ,, I., ,,,,,M?4-'-'gf-wi? , I ....,, an ...,,,,., ' ' 3 ,,,. fwwj.,-f ,.f-',.f I V . 1 ,,,, I H 5 ,,... ,..ff - , M . A '-' ' ,,... A fu f M .,.. '--' f .... ' Vvfai f f f' 2 f 5 , W , Wa... , Mmm , w,.,,,M W ,,,,,,, ,M ,WM ..... M ...... ,MWMW . .,,,, ,,,,,. ,,,,.,. . ff f , 6,-it .. 14.22 fin ,.. --N F r -in ,--if-N, x ...... ,.L2WI5v.:HL I V L., M f . f ...X xq ,F .f I A 3 va 1 h:dW,,..,.,..,.g ,Q ,,,, fx. gf -X 5 1 j 112' 2 ':1 'D W l 2'-ff Wf -W-R 5 ...J I Y 51 ffwjhz V-J 'Y' ffl 'wftwf af ,Z fall T its , ,,,, , d f wwf f ,ff -: , M A ..,. 1: ,.... ' l l ....... I , ,,..... A 111112 2 ZQIQQIQ 5 ' if .E , x 5 Z x z -4 4 ..! f 'Y ? 1 2 , ziiiiggig 5 511111112 ,,A.. 3 5 1 ,,...,, I ...,. ...s f 4 . ,... iffffffffi f 1 3..,,..4 11112124 53:12 g Miss cdfpdllldl- Mr. C. l-1. Collins Mr. J. C. Collins Mr. Coombs 3 ,..1.11ll Miss Flora L. Carpenter- Nature I love, and next to natllrei artfl llr. C. E. CollinsfOf mountain camps I speak, and of Denverl Nlr. C. Collins-Yol ho! hol and the Purple Hurrieanelw Nlr. E. VV. Coombs-Conseientious and friendly. he proceeds with llis plan. Klr. C. C. CoontzfA city man with the talk of Findlay. Miss Mildred A. Cdwellkfidd dt the lads and lassies admired the likes dl lldf. Nliss Emma E. Fenneberg-Versed in the Womanly arts, and proficient in busi- ness Ways. Bliss Ellen Foote-Small in stature, but big in friendliness. ' ffflfgg X i l 511114 ,.... 1.1 21:55:53 Y r 7 5 , . ......., . ....... . ...W , E 211122172 ' 51211111 575 ...... ...... gig , ........ l ....... 4 ..... .1 i f fi..' l .... 311111121 ' ' ' 5113 , . f ' y lfifvlvf , W V 2? 3 ....... 4 . ..,. , f-.M ,...W, . ........ 2 I . 4 ,,,... 5 .,,..... 3 l 5fIIf 6 . . iffflfffji ' 3 ........ g 3 fu-W4 Sr. 2 5 t..,,N,2 5 Qdmf 2 1 ,..s... ' ..... of 5 R i L ..... NJ .' . . . . . 1 s 5 Nlr. Coontz Mlss Lowell MISS Pcnneberg Mlss Foote ffljjg 5 f 5 Tllirfllf-llll'r'r' i 'i ,,,.,. ,,,,.,.... , ..,.,,,........ ....,. , , ...... , ,M ,,,....,. 1 ...... W ,,,, W, ..... . .,m,,W,..,,, 1 ..... . . 11 X, ....... ...... 1 I, Q! . . . X 7,52 V IAVIV 7-M I wif.. 1, .,,,7.,,,,,f !M'?,i,,,ffif,ff X! , ,,., , 5 f ,,... f Q , f 2 ,N,,Wf'ij,,fff ,,,.fj,.ff f ., 1 .gfragff 1 , W2 M-my 1' 'Q . ..... -..W ,ff f. my V 2 dd l -'d- l .'-AMW ..-f 'iiffffff ' - fy. . .M ff-f- .... 2- '--ff A ' 1 ..--f'W1g:1WfW,W-du W'fd-.4,,,,w,wm-,,ffW,4.,WM''H-1 .gWgN,,,,L ..... W,W...,.....,,1f.TL,, M f211ff '7 5,--.X ,w??KQ5'2i'-'fffifff W uf , -ff-' .f N ,.,.., X us f ,,.. 1 .,.,,,.,, , I , j f ...,,,, ,,,. 7 f 1- if I 1 1 W, lf. AVV, I ' I AAI, 2 j 1' ff 5,1 if .J 'vw ,., V' 'Q' ' N X 1 fiwfw? ' .. fl 1 f AAA ,Af - ff 1 fvff f' ,R W1afiffmm,vm.Nmffw..1m.m...g1ma..1.,1g1s ---,Ji--1 W.-I--.W Jw.. .,,..M sw , .,,,,,,, Z 7 ,,,,,,v 1 f L .M M 1 :jf I ,,.,.. , Zfffffflj ,.vv F ,,,. 'f 1 5 lyliss Gzirver Miss Goodall Mr. Grasuwrl Miss Griflitli 1 a.,!...z s , lX'liss Anne hl. Garver-lvhat do l like best to do? Everything! ..,.,., Bliss Josephine Xl. Goodall-The World is so full of a number of thingsgand l lA must find out all about them! hlr. John Grastorfgflutos l know, yea, even a Ford! Bliss Rlarguerite F. Griflith4 And French she spak ful faire and fetishlyf, Kliss Klarian C. HartfBlack are her eyes, and joyous her smile. hliss Elaine Hirthfllark eyes, olive skinfa merry person. hliss Ruth A. Hogan-!'l,m going a-funmakingf' she said. Kliss Lulu F.HoWard4She lives in a World of strange odors and experiments. 4 ...Ml r 1 f ?::: '5'Z Q ..,.,,,, 5 1f - M4 ,,.. M., fm 'VI' 4 HW., . , ' ,sg 5 ..,,.,.. 1 , i giiiiiiii --ff'- 6 C ,,,,,.., , ,4,,,,,, ifllllfiii 53553 v 1 111 1 111 l uue1ueee1 sf 5 5 .,..., .4 f .....,. Nliss llirtli Miss Hart Miss Hogan Miss Howard Tl:1'1'fy-four .... 5 ,, .... W,,N,,.,,,,,,,,,..,u,,,,, . ,,.,,,,,f,..,,,,,, ,,,,,,,,,,.w0.W ' , ,.,,,,.,,,,., , ,,,,W.,,,,,,y , X f '! 'Cf' wwf- f . f 1' ' X1 1' 'ewfwf - .' y W' ' . x -- 1, ei 4 is f V 1 Zwgiaifzr az . ' ff' I A , 1 qv, - si 2 air w:::::,pm'3,,z ' .,,. N, , f. ff. H fs fy 1' zzzzwfj 'wife - ' f . ' ., -- MW lllf 5 I- .... .,,,. U.,....w .f..,, iv 5 .J ,,,, .!.wwW,,,i...,, , A .1 , M, W.. ,,,,,, Www , ,WMU,,W,,,,,,,,MqM,W,,vW2,m,,, ff f M , ,,,,... , ,,f f 1 f Q ..-,. ,- lf1fM., '3 4 is We f 't- NNN M Q, A I I ,fufw 4 j hh 5 'H 'X '- 1 f' ij. 3 1 ., A Mx , 4 1 5 - .f, I . vw! wif ' W, y Z My 377-v,....,, me XXQJW! vs f f , f . . 4 ffff,i,z f .- . My fc -. .mmm f f 1 M A.1,Wmfmmfffm,,fmximgzwwmffwfffwma:Ei1w.miEi1m1.Qm.mmQvmzwmmWfmgz:, ? -- ' 4 g Qffifili Z ,,... g f Z 3 x i 1 2 f e Z iiiiiiiig 2 X 1 t Nliss jackson hliss Kimble Mr. Klag Miss Krueger 4 1 1 Kliss ljthel N. J21CliSOI1'PI'OFlCl6l1K in Spanish, and able to wield English to ad- vantage. 1 S hliss Harriet L. KimblefA lady from a picturefand yet, withal, a woman of today. Klr. Fred VV. Klag-Science, jokes, athletics, 'tis all in the dayls Work. , Nliss Bernice KruegerfShall I speak French or English? ,Tis immaterial to me. I Nlr. R. R. Leach- I predict presidential elections and financial crises with suretyf' Miss Ethel M. Lickley+She thinks, talks, and radiates health. 5 lylr. F. VV. lNIathiasfHave you a problem mathematical or personal? He solves 1 f-f fff 1 it. 1 ,.N,.,,,g I 2 1 ...mi , 1 .mf if , ,,,, W4 , ,.,,.,,Z if Nlr. Klerritt C. Nauts-A far-seeing man of today, with a pleasant and chivalrous 121111114 if l r QM 1 , f f'- 4 ' manner. 211112 l liizzzfii 5' ,..t,,, I, 57,113 f , . i 11111122 r A 3 ,,,., .4 E l Wi Y ffffffffflg 5 ........ Z1 A 1 1 Mr. Leach Miss Lickley Mr. Mathias Mr. Nauts .4 Thirty-fir rr ...,,,. 2 I i i 5 ,hw ..,,,, y ,WW ,,.,,,,,,,,..,.,,, Z ,,.,Z.7,a,,7.,.W, 4 ,W M, ,aff ff ,f , f ,,,w ,f' ,ff ff , uf, if- 5 f f f . , , ..aftjfffw,W1'agfWff:57:fH1':,'.,,, , .... - , f , ,M ,'f ,,,1'f' ,,ff'f,f' f' . f 'e fgghzcff - ' , fog 5 ,1,4.,0.,..:a,,,,a,f.1,,af,:.:ve,,.,:: ' ' fa, ,,,f'jQ.1- ' ,J V --f- .- ff 1 . , ,. ,, ,Q 2 'V -'--- ,. 1 -' ,-, 'ff V ---f- 'Yf1ff ' ,, - M .. jf ja ff--f--f LM., .1 -A-f. ' ..,., . . ,,,, Q ----- '--' 1 ,- 7 ' ---- f'-f' ' ' , May' 5 , JL, A H---Q 221213 1111113 i .,...,. ag i 4 1 si5ie iQs1f 4fia,, , ,.,,. 1 , --- , .1 H f, ,,,,, aww, ,,,, ...,.,, 1 ,., I Ii:-Nh of, X -j N--.X wx I, 4 , .4 ,,,,,...,.., , , , 4 I , , 5 ' . , f . .,,,,.., - rf V 5 i ' ff Sf! X Z ,. ,' ff 'WJ wi V ,I .df ,,, , , .W i..., W' ff, ,f !, hm j Sex X I' if 3 f 'YM .M It .1 , .W 2, Mfg! fm f J VH 5, 1 lf 1,5 3: xv Z I W W ,Wg 1, ' WW Q 1 ff' 1 7 'f'f4-4214 vuz.f:wfM'Wffu.s-LW,lwwfuwfsfwbfmiu-wwmAvwmw,zi1ww +fmxJagg fy f fy f W www.:.zwfwfmwm,1m.a,,mfm,,,,fm u.am,4,,.-., ,..,..,,..,.., H M -MW ,n,,W..,,,.,, ,,,,, ..,.,,........ , . H.,.,,N, .. N. , N y ....... 2 f 211211115 fllfi 5 i ' l 7 1 ' .... tl . It Wg 515. , ,.., 1111112 Z Rliss Nelson Kliss Newbirt Miss Paschall Mr. Price Miss Louise Nl. NelsonfHer dark eyes may be merry or sweet or sympathetic, but never angry. Nliss Kathryn Nevvbirt-A scholarly lady, a true friend. Nliss Alma Paschall4Her Wit is superb, her understanding marvelous. Klr. E. H. Price-VVhat would you have? I'll do it willingly. Nliss hlary C. Roache-Golden is her hairg roguish her eyes. Nlr. NI. B. Severance-Let us consider the reason of the easeg for nothing is law that is not reason. Nliss Barbara Grace Spayd- If I have done Well and as is fitting, it is that which I have desired. Bliss Sarah VV. lVaite-A little person who handles a big subject. 222222 A ' w Miss Roaelie Mr. Severance hliss Spayd Tl: iffy-six Miss Waite 2 i 1 4 5 ,.,, If ...Li j , ..,.,. 3 x .,.,,., , 5 ? 1, ,,,, Q 5 , ..... 1, ,, f ...,,, 5 2 , 5 i f 'fff ' 4 f NZ . 33:31:15 :i ,,.., 1 ,..,, L Z ..,.. 6 l . ,.,. 4 , 9:53 i 5, ,.,,,, ifllflil ....,,,. Q ,,,,.. 1,1 fi W4 f 4 1 5 ,.,,,,,.. 5 1 ........ gg ,, , X, 7,Z.7,,,,.m,,,M,1,7,5gMs , V , - 'fmhf 2 j' i ' wf :z'1V 'A' if V -- . A ' V V ,ff .212 f- W ff H ,, A ,. ,QF v , .,,, ,- V. fggms J , wf' fm wi, -I V f f ua. W Nj? -,,,55..,,...J.,,L1gg3 ---'- 1'1fjggw:' ,,,,, ,.... ' , Z M 'fzczawm WW - M..M,,,,, mf. wwf I - w.W,a...44,,. ,,., Wifmngn- .,.7,,.,,-,...,,,W,,,m, ,M .nw M.. ., ...... , , -4, ,.....,, 51 'zihifwfm H ,V gm .mx ,JZ , ,,,,,, Y, ,H M V . Vx: .,,.....,...,., 33' M W-N211 'gn .V - Q-Vx E 5 .jf 1 N- ,EXT 1.1 KV. ai Y ? 'wf ..WfM 'kQ 9 -M' iff' im -My--a1I'.,f Q-f j El , Mn.. J ,F ,wi .gig fav' VV MW,-wg M f fflfff V. 4 fn ...LL wi i -' elf V - 1 T' ' 'A-f M-1 7 - OWS N-emr-41 . . If A ,fb--A vf v'W ' A ' --'- W . .MV-VV. .,a.W...,.......... 5 I Z mm. .. ,,.. .. .,,.,.. ...M-,.,..ff--:auf LW, z 2' ' V p....4 , .,...... , . ',',,-I, 5 ..,..., 4 I 1 1 1 2 1 1 5 1 i f Y . Miss VVales M1-S. vw-ner Miss xvfigm z i Miss Nelle E. Wales-She teaches the girls how to be Well-dressed. 'i I Mrs. Maud F. WernerfStitch upon stitchwand the garment is done. Bliss Olive WrightfWhat would she know? Your Weight, forsoothl Miss Nieredirh Young-Young and fair and good is she. Nir. A. NT. YoungquistMA man who knows his duty and performs it. i x ! 4 .... f 5 ,,,, 1 5 51:53:11 Miss Young Mr. Youngquist. 7'h'irly-.w'z'1' n 1 , W-Hu 5---Z f ....... 3 , ....... 4 1 .... 3 ..,,,.,A f 1 1 4 3 ....... --- ' 511113 ii ,,,,,,f, E MW, ....... 3 ,...., 4 QV f ' ' ff'--ef 4 7 ..... 3 .... ....... 5' . .....,. 2 5 ..,...... f re-fi f i FW? 5 Z ? ' : .... fiflijfi ifffffii 'f 1 ....... 4 1:5152 .Wg , ,,.,,.,, V lllll f--Wx rf 2 W5 . 3 ..,,, . 5 , ........, g 1 ..., if llfl M , ...,,,,, , 2, ..,.,., J 2. ....... 1111113 Y ....,.,,. i ...,..., E 5.111113 Efifffzfgi 511155 ........ Q +V -ffff.f 4 1 2 y.N....f 1 Z ew---fe v-...WJ C ? ........ 4 Z,,..,.VJ 1 1 Z 1 '1 ,... 4 .... mg - .... M fijggfgff ,yf ,w.1fffZ'W7J'f'q4' vw ,XY . ff f f 1fW,Qw..M, .... , V. I ff f f V, ,,., , V... -. , ,. I 1 I, , ,,., .... . fury 7 X, . .., 5 ,,,, ,,,f M ,, ,f - A 'V wc.. 1 ,J 5 V,1,fsVgg:z9Ljl,,ff5.. '1--.Vf--22113, I- 'V A V ,,,..3,.,-f - V- - - f- , f A H V .... .,,,,,1.2yQff . , . , ,.. ,. A 0. V ' ' 1 ' , ' ,, ,A . ...,.. ...... V M ' ' ' 'X y ' ,gm V ..fQQjL5'VV.. ..... g.:...-...f:..-1-.f-.- W f H V ----f f f f A H - M ---. ,Wm..V.4M-w15,Z7,wf1,Mff.fHf...m VVV.. W,wmm.1gwW,,,,,w H if VVVV 'V V l f ' ...VVffc1f f V .2 in 1 ' . .... .,T.f:f,:,:.V-lm, ..: J! if'W,,,i...3V33?x,,,f f.,..,, ,....... ,- may o1,.128f,,MWW4i2iWAa- LZ W' ' ,wwf f H- .ff 'ZW-1 1-zz '---ff -xv V q,5,.,.fwmM1nsf,'wygwwgjggwiywf-M,mN4ffigQyiZM 'W'-wwf, ..V., ,.., .., WW. .V,, ........ W ,,,. . I' ffx V 2 y-0 VVVV 1 VM---4 g ..,. i ......,. i ,,,.,,,. 1 . i 11 sfffw. ' iff ? ..,.,,. 4 .1. . ...... ua, 4 -M.. M an .lig J jfjzuj VL ' f . ,f,,,i , .. .ar Fnmzlzjf lylr. Clarence R. Ball-From whom come melody and inspiration. lVlr. David Brownfnlrleet of mind and limb is he. Miss Mildred Burnse-I love my workg and next to work, my play. Miss Victoria Carson-Kindly in mannerw-a womanly woman. Miss Anna Commager-I will show you the right and wrong of it. Mr. John Ehrle-An athlete, a gentleman. Manhood in all its fineness. Q A Mr. W. Foley-vHe delves into the mysteries of radio. Y Mrs. R. A. French-A well of enthusiasm. Miss Grace Gibson-Latin I know and Latin I love. Miss Marguerite Hall-Intelligence, quotients are her daily diet. Mrs. W. E. Hall-This bustling person is energy personified. Mrs. E. Hulfer-Thoughtful and earnest of purpose. Mr. F. E. H. Jaeger- This hand was made to handle naught but goldf' hliss Clara NI. James--In her face therels a world of tenderness. i lNlr. O. E. Lutz-VVhat would I have about me? Boys, and more boys. lX Irs. F. L. lylathis- If it is worth doing, I will do it with a zestf, Q Mr. Eugene L. lNfiller-He doeth Shakespeare better than Shakespeare. f lyfr. G. I. Pearsall-You may know him by his carefree, sportive air. Mr. C. Carl Sterling-He molds the infant mind to ways of football. ' Miss Marie Nl. StollfSmiling eyes belie a business-like manner. 1 lVlr. G. V. Sutphen-This pleasant, smiling person is the leader of our Band. iiiii hlrs. Klargaret R. Van Gorder- A laughter mixed with serious stuff. Miss 'Wcrum-She waves the baton over our orchestra. 'Y Tlliriy-r'i11l1t 2.112 . : 5 ?- f- 1 e ? 32 .,, . ,, to ,.,, .W ,,,, fiiiiiizla ,aff ,f jf! X? , ,MWf 'w ' ,f, , 1 -A 1 I 4 -ff-- ::f'ff,.. H ..f,1::::g.. , V - 2 vgwlggf, M 2 5-g V3 yffma.,a,,,,...W-Znffw.Lwa, .... I 1. V J Q- 5 ' -------- iw ff' ..,.,,... inf. ff -, ' ...,. , . -..www 1. -uw,....a......m,,,q5y-n-a,16 ---aw-Mwuwws,-H-yum ----'- 'W-fa--W.-W, .... .,,,, f f V--.x f vw KL l X 3 fy, 2, A ig ew , 9426 X' Q QM' , .Wh :A W gx 5 4 WW MW M ,ff W 7 W 5 ff W Af! Z' , ,,,, , Z f' ,Z E . fa!-'H M mm ,V A' ' ,.,.. 1 Vvfl 5 V V 2 4 ,,, lzzzzzz, N ,,,,,,..,,.,,,,,,,,,i, ,,,,,,,, - '1 121 '1 '- ' 1 f ff, 1 ,... , ' sw' 5 ZQ, ,,,.,. ---f---' 1 f jf K' W V ,,.,..v V1 V 4 sw 5, f 4 ,f ? 1 f Z f M I , W' 3, V ,Z Clalsses L 1 - ,Mm , ,gfwf eq , ,... ., . ,L f -TW ,,,. if V- f Q' H 'I 5 T' '- '- ' liz- f lp. A 2 -fff ,,,f ' ,wi 551 X 2M'??f14'MZ3 f' jfj,! , N P-..,.,,,f :C iii: 'f ' f ' . JZ ,Ji , , .,,,, ,. 'Z ,ffJf!'? .547 - ,V ' !' f 1 ff M ff-,f fag f lr 11, If? 1 ,H lf. 55? f lr ,yfwm ,m5f,,mpm,mzf,w,,.m ,,,, ,,,, , ,,... ..,, ....., 3.3 ..,,,,,,. 1 y . ,.,., ,,,, ,Wim ,.... W,:,zm,,w,':,,.,,,WL.W,., w,,...1mf, ,:,,f 'nm::zm,z aW,wz P Folly , , f,,., , f -..., , , , ,.,, ,L-f.,f ,,,,,,, ,fff,-W,-,Wm W,wfm-Q ,,--f- w,m,,mwf,gzfx1fWm.,wMw , REIfliCl'0RY V '- fe -M M --M 'Mm'Wfw fffffff M f MWWN 'ffffff W N fff, M W-'W lllfllf -N ,.11,1.. N .M ....,,,, , ,,,,, LW, ,,,,, , ,077 ,,,,, ,,,,,, 7 ,,,,,,,,,,,,,,,7,4,,g, ,ffffff,f,,.,,,n ' f ,ff W ,, f ,,,,, V I X f -f A. V , 2 :mfg 'f ' , ff- Qf 'fu 141.1 im, , ,,.M',,, , f,a,,W.,, 4 V, ' 'ww--WM-M42 , .,.,, f 37 K . AW' wif 'ffl' 1,14 R, Q. ,f1, . 'gf ffm? gjjjjj ' '31 ,,., . M X 'fNx --OW M. 5 J W CU., ..,,,, 152-wgyuzgjl V --ff VQ?-W- 1i:z,.5 f Qi 5 'H M .1 ' 11, 2 4 115!'i2f:'3'W m,,, 1 ,-1.1.1 M 12,1 1,2 1111 1 1 ' 1+ ..,,,, ff x, 'I ' . 21 .,,,,, W 21111113 W 2 jffllllz ? ..,..-- 2 1 ,..,.... 1 51111115 f 111212 f ' 6 23331113 ,' f , . ifllillif f . 5:15:52 I L ...,.... 1 , ....... , 1' , W iffffffff P- 21 ,',m- , - ...,,. .1 1 . 1 Y LLL-,'L 11 7 ' 5112113 1 W5 ' ? N 'x iff? 2 NX 1 nw 1 . f . jx'-N -ml'QT1xQ' 511112115 -M 1 ....,.,. 1131111112 V- 2 .N ,,,,. -f Vtfyx - V f ,,,, ,... 1' :CX . A Zffflii Y S 2,115 - .Q 5, ' ' , vw 11: VS! , 3121112 k 4' I ,..., .4 R X x Qilijifif A ,qua , H3 ..,,, MM.: x ,........ f ff 51111115 V 3 X f H15 ml L ,,,, 112 A . E -' ,,,,,,,, J' 4 IQ , 1....,,. A , ,..,.. Zffllfli ...,,,,, 711111115 ...,..,. Z 511111112 ' 1 51:11:12 Z ,,,,,,., 2 . 1 . ,1 ...... X ' Do vnu BLM pause 'Co flkxnku 1 I OP Ream: OF Knowledge Fav Beyond gfxfxxi 3 n V 5:13:73 'Cm YSMQW, Ganrmg Brmbq 51122225 , ..11.... . R 1 OF L--Fe 31111113 1 ....,,,, 5 gxiizxg ifffffffflf 5122111115 1 0 .1... , 1.1.1 1 SQHHHCCDIIQ 1 ' 4 2 i , ZIIIIIIIQ sm -2f QIIZIZZQ 1....1 iff? , 1 'U 'T 1 2 .,, 1, ....., .,,. . 1 ?f N'1 ,fy 7, 7,7 1,1 , X 1 ,111, A .. ,1 . ff' f f f ,,1,, , .... fy ,1,.,Ma:11Qip.i,,,, dj ..., ' H 1 ' ---- '-- pk. ' 1' 1 if 5. - . sv aj W 2 2' ,wfffjifff - , 1 A ,,1.,,, S I ,.1. .,.1., ' 11-y. ...' 1 ':'1:':-,511-. ,1,,.,,4....,..,. - ' 'I-iw! 1 K, Eff' 12221 'LI 2T'ff'lff'Z11iZ',..wf' ,,f:11::::1:,ff V H 51? f' ' -- f .W...,zzLf'i7 V H-225335 Z ..- w,. Q-1 M M--. f 111 X. -11 -L ,,... 1 .,.., .fhmiww-if, Y -M32 K 'X w x, ,If 5 M3 NV' e.l......'1waf 3fj7 '5 -JRIW--3'7L f 1' , ? MN ' f ' J 15 2' l 'N - I 1 J 'Vw bf '- 'l1k K1 1.11 ar R1 Q--'- 'M W ,fl Sl ,,., f- .fx , 13 'wffl 31'rm'.'f'fgf111f'h '5 fm ff W my E J ff 1 fm f Vffm- J 1' 5' f 'rff , 'ff 5 ' fl Am' i!x 13,-Mmm ,,,, ,4,1wfZ:zL..,::Q:1m:w:L.w:mx...r:m:.cm:,,4:.':up,..m:.zg-,p1- ,,..A, glillffffi 2 2 Q ........ iz 1 x ...., N 3 'E t 5 , 2 S ,...... , 5 ..,..,.. iz., 5... L., . L ...,.. , f ,,,, 1 E ..., 1 Q 5 ,,,, t 1 I ...,, l , 1 ,,,.. Z 51111114 1'1 E ,,,,,, ..,.. , 1 ..,,,,,, , 2171112 5:33112 1 f 2 2 ,,,...,. 5 2111533232 ..1,, Z lfffffjfi - 1111111 Z ,,,...,, E ,,... 1 5 iii? ill? 2 l2Q5l ?:f1 5115 ' 11111 ' 5:11:12 ' 5 ,.,,,. 3 , ,,,,, jg , ....,, 2 ffffffg ' gm? 1.11111 E 211111112 ' , 1 ....1,. ,,... f E g 1 ...... 1 3111 31111 .,,. f Ml f 1 ...,.... W - y ,... 1 ififffli LLL? 3 THE SENIOR CLASS 1 5 1 U 3:17 5 21:15:12 2 iff Motto--1 1 -Prospice Colors - -Flame and Gold l 221222225 511111112 2:11 11-1111- 5 5 .,,, 2 Qjjjjjjjji 2 liiiiiiiii l --' Lynn Johnston- 1 1 ,,,....,,,, - 1 1 - - Prendent lfllf Hazel Blair ,.o, -1 - 1 - 1 1 Vzff-Premdent Margaret Davis- 1 1 1 -Secrfmry 4 1 Ralph Heinen - 1 1 - 1 -1 1111 Treafurer 1 ' Eugene Field1-- 1 - -Sergeant-at-Arm: 1 lfllfffflf Forly-two 5 e --'-- - fi 51,1 1 7 ...,,,,. 5 51 3.71 l 1 1 ,,,,,,1 1 ...,.,,,, 1 1 1 1 , ,,,,,, ,,,,1 - . 11 1 1 1 11 , 1111 ..., 1 1, X1 1 ff ,,,1fg.f'ff ,, X 1.,, , .,... l- 'f-' ,gl I 14 f W ff1:j11ijf 111 ,ffffjflf f' -- 2 21.7. 13. ' ' .'..... 1 ' f f. ff ,,,, 1' I 'f ' ' Q Wff':i1f? 6 j AYVI 'b ..lT5i2i:g,1.,1,''fif:::z:,,-1 1, .1111 .,,. ' -1 3 1f1111z,g:: ,f1f?f 111 .fll 'f1f::'g?E?1jf1'111 ,-uf, ' , ' ffrff--',f J ,- , 1 i ,Q Q. 2 i 1 i 2 5 L i .,,,,,,, 5 - , ,,,, ,,,,,,..., ,.... . M l, ,f--. -f ..,f ,uf .,,,, , A ' Z ,Q If ,,,.,,. 1- fax-if A ,fr ,, .. 5? :ff .. W. ,... llll f glilfifill 2 i , ,,.. III? A 1 Y ,, 5:51:13 gifjfifg 5 5 ffffil 5 'i 1 z 1 I Genevieve Adkins-Her lips Were formed for laughter. Helen Ardner-Guardian of the exchequer of the Zetaletheans. iififiiiig Kenneth ArnoldfC,aptam of the Purple Hurricane -a real leader. 5111112 . . . . . . . . 5 Nlarion Babione-Here comes oun Lochlnvar Z1-I'lCl1I1 I Cr IS it lXf'l21I'lOI1 on , Y g ,,,,,. .i 5 his motor cycle? 'f--V-- Q , .,,...,,, , - ,iiiigfiif f Alexander Bahls+A gentleman of quiet tastes. 3335552 VVilliam Bannister-He spends most ofthe Winter months in his ice-boat on Lake Erie. . Y , 1 Xlary Barnes-A golden haired athlete. h lz1r'orie Bzxrnswell-I ride m self in Work Well done. P Y , ,,.,,, ,,f fr ' . , - .... V , f .,.,. H 2 . ef ,ff f .,,, , , ..,,. .Af-ffm? him ..,.,., ?f .4 -.1 - Muze vfffff ef X f ' :::mmx'Wmf,,f,,.,,.,,u.'--W,,pm.wmmwm,,,,ffw -3-'-5 w,, h'j'f4 -,--- A ...,.,..W....N,.,W...W 'Y Fnrly-lh FP k ff f 1 f ..,...,, N ..., , V 17 5 M,,ff,l,,,f aff 151' ff f W f ,ff !, H ,f 1714, - 1 gf f , 2 i Z E V if Wim K - , .. .... ,. iV -- 'Wa cm- fwws. 'xv A ,-1f 'A-FW .W ccig, g':..ia-..,, f , ..5,..,1:Llf - C. K gg W '--N 4 :ff , - M- .... Zwgy-'53-f f ---- 5 -1 f lg. , e 2 2 A Q fi ' -- 3 N, - ff Q! VN ..,f W! 'wawsn V ..,f H Q --.-- 1. ,.,f -V--J lf' 3,3 ,, J, Lip! 7f 'y'4., Zw-3 1 'WE I, rx ,-t ink J, F .... f Q I '.,,,,, ,,.My'4'q4 fg,gm:,u1ZM.1,fmp...Ac.W1mi.,.::w::..: fa .... ew.,::1mf:Wwxy,4z,WW,M.c.:MacawyxmwfwLa.wm.w.Mf1:..:.:mam ..,. HMM .... , I ,,,. ,.,, . 9 .... 5 , .,,,,,, 5 , ..., f 1 i 5 ,,,.,. ,,. ...,,,, , 1 Y 5 if 4 1 4 r ' s 2,5 ,,,,,,,, A I 5 v 1 i l 5 , ........ 5 1 ,N ,..... Z ..,,,,,. , ,,,.,. .5 .fi ,,,,.,,, . z,..a.W.g Dorothy Batchelor4A dainty, prim, immaculate little miss. George Bates-A deep booming voice, and an honest heart. Fernette Baurf-One of the few who have not visited the barber. John Baymiller-Golden is his scholastic record. Florence Beard-I have taken unto myself a mate. Edna Beers-Valiantly she struggles for order in the library. lvlargery Best-Art editor of the Retina, and a member of the a busy girl. hflyldred Bitter-Faithfully she read the scripture to the Peri's. Fm'fy-four annual board 2 , W If mf . ,,, 'Z' 'ill ii! ffiif ' zf' ....., ,.,, . ' ff ,,,..ff:: 'V A A ...' . 1 f Y- 1, -,1 Y, ,,.i .5 ..... c,,, . I f f , ',.:gwfwwwwf, W.W,,w.mfwWmM,ffw4 H jg ,,,,f , - ,... .M,,'Z.lW, f f JA, pfffzff, ua wiv. ,.,u S. V, !,...,Av,a.N ..,,,,. w,., f f N X.. 5' K' f I NW f ,,,, Q17 .,.. Mg! f' L-. A y 3 A f ,Mt U 0 ff ii A . ,, W 2 f ,V I 5 af 'fam ,f f ,A, f-swlquf-2 5 wi V y ,f MM. ZfW 1 Miff 1 ,Axim,a:ffiZzfaQmw,mQimff0'al-,mamma,MWJ,,W.fgg,..A,,mf,m4:,fwu:m.f,mf .... ,,,N...1 1 AW 3 .f.Af as? -7- s 511:35 5 -2 iflffi Coralyn Blackford4'Who,s next? YVith the curling iron I have special skill. Hazel BlairYVice President of the senior class, a pleasant little lady. fwif Arthur Blake-VVith equal dexterity he rhymes and draws. r fvr' WW: 1 Fred BlanchardfPaint and brush, and he is happy. ga ..,,,. 15 512115 f Cecil Blank-I will do my work, but not without my toys. -ffff 4 f ....,,., ? Z 4 I I ,..,...,, 5 Sarah Bolton-VVho shall fathom the depths of my mind? 3 James Boughton-His recreation furnishes shoemakers with business. i Nlary Breesefrfhere is nothing I like better than a talk with a friend. l orIy-fire f a .,,yy,y, A ..,.. ,.,,,,,,,,,,,, ,,,,,,,, A A A iiiii ,,,,, AA ,A ....i..iiii ,,,. ALWAAAA ,,,, NN,,,,, A I ,,,.... AVV, VV.VA,,, l uf' 7 -IM,,,,,,f1gi1igfiilillAA,,f4577! ' A7 AA'AAA, -f ' 'Z AA -AAi7'1l3Z3 fifgzzfff' O A , , , , ,f.,.A A - , , ',,'.ff f.ff . :KVM l rl-lfbvo' , ' ,'7?if: . v ?5lQh2?f74' '71, A ' f-jg M ,,..fff 'jf.,.- jp 1 vi X A,,, ,f ju, .A,AA ,.A.,, A A.,AAA ' f 'iZ1TZCJ?'?22f,A 2 ,,,., ,hive V - - Ilia ,,A,,, A 41.1.3 V -ff' ff K '- a1 f-ff' ZW JP' ' 'z A, 'WW , ,, AAAA ,,,,,W.w my ww 5 A,-aM.,1f,lWhW,1a3,,,WW,,,. f 'WW---h--- -'W ,.W.,,,...W ..A,,, ,.,1f., WAW, , V V . ILL a.-, 1 f N a --f-- ., ,f .-.W ww V f ---- ' ii f 3 f 'a, 'm 'lCC:f 4 f' 1 5 25 4 4 , - a, V. g 1 5 ,.,f J 'Ajuxf X -'Je f Ji!---7 Yr Z s..,,2a,W,, ip f 3 ,753 , M' M ,. ,XE . ,,,W.., , , 'Q ,. M22 ' ,, a Wm-, WV- , , V .2 f ,fa ZV r VVIQ jfwfif, .VM f' '- 1 -.H A N F, f V ,Jr 1' 1 f' f' 412 iV ,I I 'Wea V f'--' , 5, f Q ,, fy, V - A A V f fwa.ffg,, .1 N , , ,V Q ,f 4 ' ' vw JffN4w.+.w,4:Qm:1:wu. ::fm:...m:,m,a.:::1z:,,zz.f:,mgL.,g1! f ,Ame:wuwwumw1uW1.ag wz:!.:ww4:m..wfz:s.:7pf4m:,mM4L,.wwe.Jme1wem,:m1:7M,zCxw,,W46, f r f 'A 4 E ,,,,.. Z ....... 4, 2 5 ..... 1 i 4 1 1 i .,, an z E 1 5 S 4 X 1 1 1 2 3 ? 11111112 3 Norman Brennerfhlath. I know, and languages I know-and faith, what don't I know? 1 J Vivienne Brentlinger-Quick and clever is she of speech and pen. 5 , 3 i Gertrude Brim-A demure, dark-eyed maiden. Helen hlargaret Brown-Foreign languages I desire to twist upon my tongue. Helen hlinerva Brown-I am not interested in passing fancies. l Grace Brubaeh-,Tis well to make acquaintancesg 'tis better to keep a friend. Xlagdalena Bury-Rlany a humorous word has fallen from her lips. Henry Byrnefllm never so happy as when Ilm dressed up. lm-f,v-sim i 51111115 1 W,a,,N,,M ,,,,...,,,,,,, ...,,,,,, , .7 ,,,,,. 7 ,,,,,,,,,,, M M, W4 ,, f V , 7' , , ,ff ff ff! 'e - .qw f . , ,ff , ' ff 441,213 L f mn' , f , . .2.Y6 'f4 fef. . , f H V V .. 5, ' V A f V Wrfzfif fe X X A A ,,,., V- ,,..1w.jWW,,,,,V,,-UV.-W - ffww -- WM ..,, ff-:W V ,i VK 4 1 l ,...,.,, -. Na f 'fx'-O-Q fe- QC 12 2 ---1 ---- 4 a--N---4 3, ..., .55 4 ii ' 2 2- -'-- - s l .,,,, f 1: s 2 we H ,f ' Nf- , 5, , V., -few ' f 2 w.afg3yff.fMf vw F? it x.,fu,,,,.,f if 45 M ,ll ZW ' fl . , ' K-3 Crew h., ,Q f'1,,f-M' ,,,, f' I ,js 1 . nk . ,.-.w.,fw? iff' nw, 'x,.., gf'-mv ' - rg ' 'QQQZ .3322 ' I f A V f 3 5 ? fi 1 222125 Ziff T Tl l 31.11113 igziiif E ,ug Q 2 l ' l 2 ? ..,,,,,, K James Carr-Student manager of ?Ltl1l6t1CS, an able man. Xlargaret Chisholm-A librarian Ilm a-going to be. am , , 2 W: 1 Gladys Colbertfhm dolng my best to look hke a SCI11OI'. H' li E 5:31:11 . . . . . 352:53 i WL .,,,, , Dorothy Cole!Fa1r-halred, and round, and Jolly, she radlates sunshme. ffrf iii 2 Glen Cole-P1lot of the SCIIIOI' H1-X. Look on mv works, ye mlghty, and . ' gwwg despalrf' 553135 5 . ,, .iiiiif . . ---- 22 i l Orvllle Cook-I l1eW my Way through hardslnp. , ..,,,, 3 jjjjggjl hlaude CorderVgBooks I en o and muslc IS mv drverslon. 4.l.- M 5 4 . Y, , M, Horace CoygChief ad-getterv for the Purple and Goldw, his persuasivencss gg? produces results. 55355 S For'ly-s1'1:r' IL 7 l ,,,. 3 ' 'Ei ,,,,,,, ,,,,...,,,,,.,...,,,,,.,.. ,....., , ,,,.,,,,,,W,,,,,,,W,,,,,,, W,,,W,,,.,,,,,,,W ..., N .,,.., .,..,, .. ,W .,,, , ,,,,,N,,,,,,,m, ,,,, .., ,,,,, W,,,7,.,,7..,,M,,, l 'N'l 5 - .A A fylymr 'K 'W,,,ff0 ff!!! X, 'x - .,.. , ' V. f f ' 'f gif: ,,... :,,,. I , 1W,,,,,,Z5jii,,,,iff lnqjgff - . 7 L W5 9112 F , ,4 ' - , ' - ' - lf fi ,,,, gf f My O ,1 ' y A. 2 'l-V' 4 A ' ' .W-H1 fyf1'fff'g:gavw'w,,Mf-Hu ----- ---- p:wmmf,yMh,.,f-fw - mg ,ggi --- W -'W ...I . mum.. ....., :,, hT'ff'r 1' , if 'f X f' 2 -, V ffmavff-, , ,..,.,..,, 1 , 5 H ,, , ,N , ,,, 1 ,.,, ,,,, . A ,,,,,,,.,,..... , I ., ,, I A U H 1 X s J W X f---'f ' ' ai 2 5 '. 'f ' lf f Z f , ff' f , '-ff ,Wf . --'ff' f 3 1 K, . .,., f ,J az 'cj V a..,,,1-...Max ,., f f ,Nw , H K ' 9 f- . 'Z C 'ff ff' 3 I--LW f-4 Q 'i 'Q . ff: ,, M wa, ff' VW ,ebay V. ., f- fi wi-2-'Wa fl 4 me 'ff 1 .... ff.. 'f-.f ffm. ,Wy ,V f ' ,, ,...., 1 V4 N--Jw' ,ef f 'if ff ff- a .1 we 1 .... .. i ,,,, i a ------ l 4 2 4 4 f 2 1 4 i -fs , s ,,...., L . . . . .,,,, .. Errol Crausevhflercuryls Winged feet are his inheritance. ffffff' Gertrude DahlmeyerHDiligently doth she search out facts of history. Anne Dancer-A merry, gay companion. Coral Dannenberger-Her interest lies in basketball. -----f Harold Davis-Spick and spanw-a manly man. lvlargaret Davis-Typist extraordinary Earl DeVine+I am full of good nature. Eff? for the publications board. Laura Dean-And oft did she stand on her head in the gym. lifrzi. Ful'fy-v'igfht s- ,,... ' .4 ,s f 'f ' ,H f I .7 ,,,,, Ny, l ' f l f 1 -V 1 ..', 't ' iffffffi' ,. f ' I ,.,. , ' ' lv' . f ' 4 , ' 7. . ,,w,-w,W,,,f'..H. V- azfwmf. W,,,,,,fff Q 114- ff . f 'Qi 'W??:f:ff .MZ Eg., ,JV i I .. -. 15 xv .M f-er - V, mare M-H .51 f 1 1, ,1 1 1- N , ff' . E ,G 4 1 ,,.. 1, 2.1K-.,,.f1x-in K N15 , 'f 1 V ' f fy:-W lff- 1 . --ff-- , f - Z, , ug, 1 144,,,i3:j11l3,f-hx ,fe ','.,1W2,,N,E lf, R-'L f fs, ,fm ,fs ,---If-w..,fr 1153 f I'.,M ,fm .3 ,, .,., , .1 1 1 f:.,f . mf-12 1 ff wwf, z -A 12 I 1 7 , ?Mswf,z,,mf,,mf ' AmmanW1wMem.f,Wm,1mmm,W,meam?g1wM1'mMmmWmwwL1.psaeem:.f,f:..e.'-.ee -4 ? .,,,.., 5 , re---1 '4 Q ---...f A 3 1 14 Zfllfl -Y 3-74 ....,.. 1 3 ,tjiffg , ...,.,,, 3111111122 3 , .... H1 '1 .4 .4 i 11111113 5 1 ..,. 1, , 1.111113 2 1 ,,,,,, 5 1,5 E , 2 , ..,, 2 Q ,,,,,,,, 2 Z ,,.,,f 3 ,,,,V,,1 5 .J 5 115, 1 f , ,.,. .... i flllilll 5 3111111112 5 ,,,...,. Q f 1 2 5 A -I f f x A 1 f 2 1-4 ,J 'K 5 ,,,,,,. 5 5 ,1,.,,.. E, 31111113 E 3 Irene Dickinson-Whate'er I do, I do it with a zest. I Frances Dimke-Oh that I could always dance! Beatrme Doyle-A thoroughly dependable, hkeable gxrl. 3 Irene Doyle-With her gentleness is a persuasive charm. 1 9 ......,, Q 1 Creta Drury-My interests? I'll not reveal them. 5:11:15 Q Helen Drogy-Tall and dark, a pleasant gxrl. Jay Duhamel-I am not a doer, I would have you know. lX'Iarguerite Dunkle+'I'hose who would know my talents must take time to End them out. I 2 2 511111113 Forly-nifm 3 .1 11111111 1 1 111111 111 1 L 1111111 1 1111111 111 1 111 11111 1 1111111 1 111111 111111111111 ' 1,. 1..,. f'f?f'l'f?f 1 '2'fWffz:111?fi35' ' 4 1 A111 i I I' .11y Vvrvv 1 1121::1f:1f1'1 ' ,.,,. ,.41ff111::1f1 ',, 11' ,L ,,1., 'L ,.,,' Q 11 111' ' 1 ' ., 1-...z if '33-ffm '1l 11e l ,,.- 1:A411111::::11f11'-?E?17' M - 1' 1 '1-1 ...,1ff 41751Wffm-.W,,W ,,,, M 11111' 4 ,,.. --2 ...... ,,W.....Wg'::W ,,,,,, fm, m,g,,fggfgMf'W1 ..,V , l f,g,w:,,iC,!! U- A .m-fkg, Q, 15 ,f V, , ,,,.... F- 3 ' i- W 'Vx ef' im' ., f ,.4.1,x2L,,,f 1 1 .... '.. X. ' , W f ..,.,, fl ' ii , 3 N ,, 1. ,f f .1 . ff I j , . M vc, 2 1. - ' 11,1 ,M 1 n,,.W,,f ' ff Hg ,V 1 ff 5 f 7 if 7 wa., wa , Ueazfzzmw.-1 ..... :zzz .,,,, -gWwwM...uwz1fw -zz...-M ----- ww ,Z Clifford Dunn-And the things that he thought of, he did. 'Vx ,ff We ,Mi 9 ,....,, 1 z 2 is 2 :.,,.4 2 ? ,,,,,,, , A ....... 5 ifiliili f IIIVII' 4 2 i ,,,,, 1 i ,,,,,,, 5 ifffiffl ,....... 5, ...,... 5 5 i 5 Ma, 6 5 1.,. 1 g 2111375112 Q...,,l 5 emi 2 Q,..,,,, wet 2125 WE Q . Q 2 Qfffi , ,,,,.,.. , gflfffllf 2 Q T 4 i f ...,. ,..L:L:j 2 5 fffffffi gl fV-- 2 , ,,...... 5 5 ,,,,,, . ,.,, ,,., 3 L .....,,. gf 5 C ,llllll 25 lm .,,. 5 s i.,.... 4 , ...,. .. , e ,, ....... 4 V J .,,,..,. Q! L... .... , ...,, - Elsie Dwiggins-She pounds out jazz with dash and speed. igjgjj Richard Dyer-Plucking word from the ozone is his hobby. 1 Virginia Dyer-Shades of Barney Oldlieldl How that Woman drivesl '1 l 'T . . . . ZIIIIIE jf Erwin Ehrsarn-He lived at peace with all mankind. 53355 F William Elmer-He guards the shining shekels of the Quill and Dagger Society. Lillian Elsperman-Hal lXf'ly hair has grown an inch! Donovan Emehf'fA knight of the open road, when lhere's a chance for a hike. ,,,, izziiiif 2117112 Q Fifly I ,... lfrfv , .,.li, 1.,,,,.1.. f ,fff W 'fififfifii iii? f 11.V .aff '1 ' 1 l 1 .',, -'f' ,V f f ?1ffQf1'1Qfl ,..,, 1 ' 5 ...,..., , ,....,,. 91. V.. . 0141 -- z X 1, - 'N4 1. .. 'x XA I ,.....,, ..... . an .mr f, 'I - Q' Nh fffwf ...Xxx A xlfxz ,., 1- , .... 4 L ...... A ,, ...., .4 Us , .2 ,wwf ? ? ,,,. M., 5 2 ,WHA i..M..z f C,.-...c..,7m,,.vy'- V '--- Naya gy '- 'L N M 1' Jfll-W-ff' I' 1-fl f CN. .,.,., Qflflli-'J Y' fflafg f ff f,.,.,m A fn .W ffm ,W ix JN,,12,. A In . Q ,,- M .t H f --11 , Eh 7 it 1'-. ,.,,f M, wif' 3, -N f, ,. . 1, r.,l, f- . . my A Q ,, ,IYX ....... W 65' - :JA 81-aziuw , , ,,,,,, '....... ,,,,.. 4 5 ....... , 1 ,,.,.... 2:11:12 ef ,ff fa f--W if A ,,, l A : 1 222225 ' m , ,...... 5 iifffl 1 'f f f .,,, 4 1111111113 , ,,., ,,.,, 3 ,.A,..,, 3 11.11, ,....,, 5,1115 y ,,..... Q .... ,WE ffifffil VW 2111111113 V1rg1n1a Everett-She IS refined, and sweet, and studlous. 'ffffffl . Helen Ewlng-Collectxng football sweaters IS my fancy. f lf ....,,, EW.. f llllyyl 3 , , , , , 5 ,... Harold 1'E1I'l1I1g-lVl6 tl11I1liS I hear h1s moolng saxophone. Fadvva FarranxShe hides behind a busy brain. 11111111' Q Eugene Farrell-An athlete of no mean repute. sf Lum' , , , I ,....,, 13 Nl ldred Faulkner-Thls llttle lad could make a success of an th1n . Y 8 WM l Y- - - iiizga Q35 hugene Fleld-Sergeant-at-arms for the SCHIOTS, Where found he that school- iffflffffi g1rl complexion? VVV Arthur Force flle Waves us on to cheers of victory. 5 2 .M ....., 5 L .,,, 3113 ,Wa fm--4 Fifiy-0116 'e 'W'- 1' V -- '1 1' . ,,,,, ,,,. W ..,.,, ,M ,.,,..., ijju ffupgg ,,,,,f,,, ,ff ---,,w W 1 ' ff I gf' ,V 5 ..,, 1 , ,.,, I, I ,f f,,,f'jff ! ,11, 1 1 ,...,, , if W.. .,.,,,., fm ..,,. . ,,,,.. 1 . .,,.. w....M..4:1':4:i211,,.,,,..T..,2QLf?f:L.., 5fQ1. ff:-ml 1' X ! I X f ff f , af hx ,, .fy-M.. f W X 7, f,, .1 ., . ? my Q I I ?hU ,M.7JZLJml1JJffldf!MM7Ilcfx::,,:M,,LZZM:,.,1M!z..:M.L'r!MJi:7...., f :Ze ---f ,.,,,.,,, '42fi:.i!fgf,, .. .. .. ., ,,,,, , .,,. W., i ---- N-Ms. ,, is , f X fm ., ......, , 2 .f V' f .......,,... -: ..., ., ' I 2 g f 2 4.. .... 1 7 , xy V2 -. ., X 3 ,.,,f --,J -'ff ' Z ,. , Wi X W ,,., y 9, ..... 6 ,Alf ,, ,,,,... 4 i l l ..... ff W., i ..,, ,,.., , li f .Z 1 Anna Foust--I hold my Words in check. Hilda Frey-My thoughts provide my entertainment. 3171117 Barbara Frye-Winter sports are my delight. i Y 'f Arthur Geoifrion-A Heet and cheery lad is he. ......, . N ,,,, of 1 Otho Gettings-He is apt at the art of photography. f 'fl-f'f Regina Glasco-Quiet and retiring-a girl worth knowing. Y .,...... 5 y ..,,.,,. Z William Greiner-An opera without him for comedy?-Impossible! Marcella Haas-Mirtli and motion are my life. a ,,..,.. N, W ....,.. 4 f1 5 3, .,,,.. ,J ' i ......., J Fiflgrtwo .,...,,. . ,M ........... .. . , W, .............. , , .,,,,,,,, , ,..,.,,,,,,., ,,,,,,,,, . , , ,,,,,.,. . ,f,5j:7,j7,,,,,,W,:,,7,, 'M fa 'fw' ,f' if ' ..,. ...... .... f f ...ffeif f , ' L ? ' ,.... . gif ,., 2' in ,,,, f .... L2 f H' f . L f, ,,,g,,j'i f 2' K f I . 4, ,Mx W, ,.,, . .. ,... .... ' ..,. ,, ,.,., ,.,, ,mfr -V 1 wee, eww .r , , 1 .. .. ,WT,,.,...1-'f g:zvwWWf.,..'..u ,mywmwfwff -- Wg . f.zgf,1--- , V.. 4 xg. ,,,,. 3 -f'.'f'1lj'iQf1ff1 M r .-gig 5,2 4.41 .K , w X-l 0 .. f.'..., . r t I L ff- f ,,,.....,...... -3 5 f, 7 ,xx Nfl' Wm , X X 1 if . A - We ciLt,,:x..w --X. . M- f'- . . , if J at Ni.. 'jfffje . .1 1 V. --'ff .WJ X-W.,-R J .J 3: gi M., ,,,, ,adj tc, -f f fl V? f' -fx, ,,...,, 'ew-f TTI V 5f7'?ft'q A f 'w M- W .. fx-,FXJW fn-f'q'a'n in ,I W-' --'e:r-:-- A V ---' W ww..-f-1.2. ' ,..., 5 ..., ,,,, ,.,,.,,, 1 4 1 1 ,,,.., s Genevieve Hagerty-A lady becorningly garbed. Ervin Haines-Would you have mirth and jollity? I'll supply it. Edmund Hansen-A youth with a plentiful supply of common sense. Fredric Hansen-From business men he extracts ads with ease. Fannie Harris-Her interests lie not in studies. Hannah Harrise-French and Spanish I continually confuse. Zenas Hartman-Art editor ofthe Purple and Gold, he wields a skillful pencil. Esther HartshornfVVell versed in housewifely arts. ldifty-f1:.1'er: gs. 5222225 1 5 5 2 7 ....... 4 ,..,,..4 i ..,.... 5 4 -Z 1 4 . ,Z 2 ,,,,, W g 4 Mi 'wi ,Wi . ,,,, - 2-H'-ei W.. , ........ E 1222.2 f .,..... g . 1 2 -..... .4 . ..,.. .4 C1333 . ........ 4 f 1 4 ,Wg ?-...4 .,,.......M, ,, ,,,,, ....... . .,., ,w,...,..,,, M A lrrqddd AAIA AAAAA ,AAA 4 A ,,,,,, , , :V ,,,, , .. JIZZYQX fy., 4ff:f..W 7'TW'w. .,,. ,.f ,- , X ff.:-., N. ,M 'Lf' X ff! , f f .,,., A f . I I ful., -V , '- 1-:pAff f' . ' 1' 2-5 Dir-yW,.,.4.2,' f . 5, .... ,,,,.gjZff ' V. , A it -- ffl up ffm- Wggzfif. ' , vfv'v -1--- 2 7 .... ' ,we f--'-- ' ..:,:1,,ff,,M W ,,,0,,,. 'vkffffwuff : Wwm..fW,.,M.nq,Wmgffww,2f,g','4,,44,gwfff Wffff0-f'f:..g3W...,',M '--- '-w ..... . W, ,.,. My '. W-V ' I af--.x Q 1 f 2 ,..,.,., 2 l i 2 4 9 ....,,, ,, f v . M: 2, .,,.,., 4 I -4 , ? '4 ,.c,,,,1 M, V 5 , , , , ,A ff-,rs N 1' ff 1 ' ' IL,,,,.,:,2 Q - ff 11-,Qf1 f5':i' f , A W w .M ,f'xt..,. 1 ,J if K gfi.fsJ Y- ,E M' x..f.s,w,f , uf W W gk, fl f- ft -wf : 'nvf-4Tf, 'vM2 f' fX1,l'X fi wfawf ik rfwy Vvw ff ::,,:::,1N.t.s,:2if?ZWV ' l f 2 ,...... gllfffiiiif ---'f 3 T , ' 4 222222225 . A ' ?:1tL':L3 VIVVVI 3 2 jilillli l illllllffi 353333333 2 ........ 2 ififljfi , iiiiiiif J 1511323315 5 VV,,,, 33 2111111122 2 ffff222 Q 3 ff-----2 2 gfiiiiii 222222222 L 2137323 g 2:1212 f ----- 2 Z 22:55:52 li .,,,,,, QMS L-M' fm: WIS 5 W. ' ! 212113 ffl 3 .2.,.,, 2 l ::2 ?..f.f,,.i M . ,,,,.,. f 4 , ,,,.,,. l iff? k- 511111115 2 ........, g,.,.,,,i f .,2,.., 3 3 ...,,,,, 3 ?::::g::5 ' Clyde Hederman-Jolly and stud1ous, a likeable chap. lllllllili , ,.2,,, f Joseph HeferleMTall, and dignified, and unassuming, he knows whereof he speaks. ' 4 fffiffl 4 Florence Helder-She performs her tasks conscientiously. , f 1 f Ralph Heinen-He handles the funds of the senior class and directs the fortunes rzrzrl i .i .,,. fi 1 5 4 f of the Ret1na.,' f 533 51:11:15 3:33:35 Raymond Helmke-He hath the very build of Lincoln. QQ Minerd Henningsen-I think it Well that mildness should attend my tongue. 2 v 23557753 Qljggggjggg Ann Herman-I laugh and dance my Way through life. 2 ' ' 22'22 35 Elda Hessman-If you think I am a Woman of one talent, you are mistaken. E STL 'VIIIIIV I ....,.. flllllfffi 3711132 2 ,,,,,.,, g'--v--1 tyttg 21111112 5 9 Fifi!!-four 2 i ,,,,.,2., , P 2 2222. ,...222222 277 2 2 - 2 ,ff ' ,fy y 2 . 2 ......., 2 2 ' 2- ' 5, 2 A f r 1 i i 1 i 2 4 , awikft 2 e fff--- 4 I Z f Z 1 6 .,,, 5 .. , ..,,...,, ..-M ,,,,- , ,- 'aff 14 f' 'fx-a..x 7 f' aff ml We ...,.... vL5?2?3i 39?i?fi7i21:1- f A V 2 - ,fl y 5 mx . 1 My V, .if ,MX -WX Amp! .J ,,, Ms ,IL .,,, 4 1,1 ..,, 2 'I 7 wwf' ei? fa 8 JW , ,..,, H TTQMMNVU .:,'f 'fff'Nr fm' f' Www W ,izzffl I--X fm-fl'N JW 'H'f e'f nw iw? JW M-' Y! qv PM t ,, 4, ,,, 2 M, , , gg, ,. ,, , , , ,... I ,...,. ? ....... 5 E ? 7 ,,.,,,, E 4 1 1 Y f 1 ifiiifilli f af --'-'f Q 4 ?w 3 , l I , .,,, 4 i 1 1 fffffg 5 'Y , , , , Y , , -.. 4 f l l if ,,,,,.,, 4i Herbert Heuerman-Seldom heard but always doing. Margaret Heyman-I have a smile for all I meet. Louise Hibbs-Merry brown eyes and a heart full of mirth. John Hilty-Oh how deep his thoughts must runl Mildred ,Hook-Sweet strains I draw from my Violin. Esther Hoover-Size makes no difference With one's ability to Geraldine Hopkinsfl am interested in the affairs of the World do things. Glenn Horsman-Good spirits count much toward good living. I ,,,. 51:11:11 Z ,...., Ui E: eg 1 5 f f .--.-. NI. .,,,,,,i 51, .,,,,,, .3 ..,...,., as s A A 5 i rf? f f 5 , il 2 1 Lfl!!'fiU9 51:1 5 ,,,, .ug .,,.,,.. WM- ,,. , ....i.... ,.... ., ...... .. HMM ' ff' 37'f7 ' ,fY7 ' ,,,, W V ,Mf 'iil3f ',ff' ,Aff v ., .... .,...,. . - ' -4- .. ..,,, .... V, .-,fha 2 Za zggzizr ' '- ' jgzzamggp- ,M 5 ,.,, ,MM ---'- f, ,gn ' 'f . ,.,, ,,,ggg- '-'f- ' ,mf-gz:i,,'4 ,few ,,,,, ...,. 3 .il ' -f - ' - M N. , , V- , ..,,..WM,,M ,,,, ,Hi ,f VX 4 -1 Z 2 I .,.,,, 4 Z i Z Q ,.,...,, Q 4 i 5 f 1 2 1 , i Z .. lvty M1 -'.-'4'-vl, ,iv ,M f ,,.,,,.,,, f '55-.xxx 'W' W iW'af l,,f J' Rh-Wai..J if-J AV fly, ,JZ fn, ,M N X, ffffffl ,W ,. ,, W7 , f f . f' A V i f i' ,, f in f I ,fmlff ' ,.,,. f , 222222223 1 211:15 4 --4 , f' 25-Mei fl 5 ? 'fl 9 f 5 f 5 f siiiizii 5 ,fffffffi i 3111113 6 5 Ruth Hueuefeld-This little lad has ersonalit lus. 5 P P 5 Nlargaret Hug-An exciting story? I Will read it any day! f Chester Idczak-I hold no grudge against any man. ff'f M 'Q , Arlene Innes-llrn Hitting here and there. HOW much, think you, do l ac- f complish? f .2 - - - - - . izffffflg ,-,.... Etherld e lrvvln-Leader of the AlChCH11StS a chemist 1n the makrn . ....... 2 5 , .,....,. , 7 ,,..... 4 5 11:11:15 . . . 11212 2255555552 Marguerite Jack-Her talk rlpples on lrke a brook. 55 5 Qjitiiiii' Venita Johnson-My days flow onward tranquilly. Lynn Johnston-Lynn of the cheerful grin-our peerless president. X , Fifty-sirv .,N,, 2 3 fvfflil 1 -VVV 4 1 M, M, ,,,,.,,. ,WM ,,,,,,, M ,,,,,,,,..,, .M .,,,, We 5 .,,, N ,,,, M, ,,,,, :i,?Z!7,.7f,5 ...., -fi :ff Via, . J ,.,., 5 ff N ,fi f ' ,,,,,,. Q ,, f 5 wmifaffwa, N' wi , M. . . . f - ---- - M rg.. M f f-'f V f M 5 1' ' i M 4773 '- f-- 571 'f f -f ffa?figi:2..., f if 5 '-'ff .Mfh-..,,. I V' Xml! f i Q' X. .' j'i','.f .x -,,, ,, ,, ff' uf ' ' if if if-.'...,,fW, N .,,,f., ,, fy di! ff if .,,, u, Ig, fn. 2 'f 1 7 f 1 .af f..., fmfx fe f tf -fi 'W ?F 'f J '---J . ' Clara Jump-I hold that friends are jewels to be treasured. Viola KaiserMSl1e can ask the most questions! Ralph Keller-Ch sheik! VVhere is thy camel? Kathleen King-Her beauty is delicate as a lily. Mildred King-A neat, Well-mannered maid. Ella Jane Kirby-She is the life of the party, With plenty of mirthland fun. Helen Knapp-A mass of golden hair and a disposition to match. La Vonia Knisely-Youth and beauty and kindlinessfthatfs La Vonia. 'VN I -if 'f '1 2- '--'f 4: ....i 1 ,,.,, .f----- ,fi 5 1 ..... .5 5 ! 4 1 r - '- 4, f -fff- --4, t ..... 4, f ,..... i3 ' EW'-Hz 21 M1 9 .1 s W... I M. ,,., 4. 3.-..,,5 5, ...,.. A , ...Q 5 ,V Zfffiffllf ' -1 1 - y ' ..... z ,... 1.5 tg ........ , .... ...g 15 5 ......... ,z ? n Z a Z ,,,,.. ug ...WA 1 f , ....... ,gf Q.. ..,,, 1 ...... 4 .N ..,. 2 V Z pw., , ws :jaw f I f ........ 2121111112 2 Q ...... 1, ttf reg i f i ? ' is 411:32 3 5 ......,, 3 , , 5 ...1.... 512111113 La...,.f Y 53:11:15 5. ...... 3 . L . Y 1 4 1 1 f I 5,1113 , .....,,, 2 Z F1fty-seven .-..,.. 5 , ..... M. . 1 ,,,, N, - --'W fa ffff V -W fsfa V . llf- .... 1 1, 1 .... ..... X f f , 2 - W ..,, , ,. ...... ,W ..... ,,,.ffv ffff' f , ,,,,,..f5j179'ffl1'f ! ,IQQI ' I L -. Q ' f ,.,.. . ....p sf ..,. 1 mf -v .. rw 1.11-ff . tcm! V' 1. .' , f X, .... .1 jp,-.M ., .f--. 1 ' . .,.. .114 --' .L ..... ..a,,. 1 -2 ' ,,....,,-ffy ' .z W.f'gW., H 'tu ,525 +-, ., f gg 1.,,a,,,,,,,,,v,,,4.,,a,...,,.m,,iz,,M-.....,.,Q,3,,,,,55,, ...... ,,.w..a....,,,..,.....,.,u ..... W ,..... .,,. - - mf--V f 2 333' gJ4fm,f,,, Ki. '5,,3 M I-A-.mx M Z 5 f r i 433, .,.. I Z 1 3 i Z ' f 3 3.5 33 y .... .wi is ' L- ' 1 t 3 1 2 l 'I e ,..,,,., 5 2 r t, ....,,, 3 f ........ 3 ? Q. Ia 4 i gl: 1,1 f 1 gg ,,...., l J ,.3.,.., f 2 1 1 1 t Z 5 Q i i 'f :X x 3 i f 9 i . ,Z 1. fa 13 3: 2 .ai 5 i3 1 'I 2 f-fl 'Q 2 -4 '4 5 z 115 3 ,,..,,.. 1. 3 ....... 4 33.344 -- ..., , JZ ...,,,....,,... ... IJQLJ- I 'xx' X' xx 0 mv' '5 ljjg, f fy. , 3 MX 3, 33,fs33f, ' 33:3 M3 .,,,, ,I ft33x.J V- , ' Vvff ew! 3 3, 35 .Kim ,. ,W fvW MT :fw , A ffll ,.. fnfwsfrizr 3 fVA f' f'l'-M3.fMff JM ,,,, Zfafwfnfllffifm .,.. ..,.,, mx ..., fm g Elfffffflf gggggyf 5 gill' I 233333332 2 52333 ..., ' 5 ' 4 3 , 3 z ,,V., ' igjfffffi f 1 2 ,.,. 2 ?,IIIQff7 Qfffffff 5 3312225522 i 77752 f 1 3 f ' , 5 iilfffff 3332333 5 5 i'i3L1133, i ggi 5 ' iffffff lifffii 5 iz ..,, ,.,, 5 Qfjifff , 2 1 ....,, 34 , 5 511:15 f yi 333:33 f i fflfffi ? ,,,, ,S ' ut ' i 13: f 53331 3 T ..,,...,, 13 l 5333.333 5:33313 Z f 5333332 2 f .... iiigigg 3 -----'- 1 H 13333335 f 1 4 1 ,,....,. 3 1 'fffffffl I 1 hlary Kratky-She does not merely dabble in verse. She creates it. Q ' fflfffffr i 5 Arthur Krogle-By my cheerful countenance I do a service to men. 1 3 25333 Hilmar Krueger-Over hill, over dale, I rattle merrily. 12222223 3 2 'f l 1 lim? Clarence Kuhlrnane-If it be business, I'll answer 1t. 3333335 , r x il Theophllus Kuhlmann-To turn my mind in upon ltself IS my dellght. 3. 5 2333333333 'vff' H-2 'v 15 ' Fintan Langenderfer-I came among you as a stranger. 1 1 fill 5:13:34 -' Lillian Lavender-My desire is to go to the root of things. A 5531: '3 1 Ruth Lee-President of the Pericleans, senior class hlstorian-21 glrl with many gggggggyf E f ' f interests. fffffifi ' i ,,,,, 5 g f' 1 jjj? Fifly-eight Q 333 33333333 3333 3 333 33 333333333 3333 33 3 , ...33 33 3 33 3 ' -ffv 4 3.,f. fi? f YW ffff ffiiiiiiifffir !,3.-f':f55'7 3 - 3333 f 5 lifilll gills: 3,,,3 f if 5 1 5 . 2 5 , silfxif t' We X N 'MEL , jr MQW? If 2 yi M f' f 'N NW Mtv-. 5 V' '--- -M7xW'fi4'fiwZf ..,. Aja ii , rm! 3 -.J ,J 2 A If 'ugh 'N'-N ..,,,, f,jv,j'f..f'--J V' ' . ' if , ,jf gf , V ,I ,tm llll m ay gfmtqggjyhai fi, 1--W ,X 2' A ,Jak A fi 13 3jF?fgg if-N, T ,x,.,?fp,f-. , 'e H -w 1-A'-f'-Lung? '-'- W ' -4.:.e -1f1,.avfwK::-vw -2-4-M -1, 'bgs:,,.r' --'- ' f 2 2 ........ I f 3 ......,. 2 iifllilff 511112 2Q.Q.j1li 5311332 i 3222222225 f - ' s .. ..... 4 X L .....,.. 4 1111.115 X 1 ZIIIIE 5 7 g , , ........ , ' 5 .....,,, 4 H - ' ffff E 3 g rum. 2 -Q YLLIZQQ W ,, , , A,,,, ,,.M,.. f , a....,..1 f 1 .,.,,... , , , I ..,...,, , ,Q 251, .,,,, 4 2 g .,,,,,.. 4 -J V, .......,f , .f ,,,,,,,, f iifiliilg ..,.... 4 1 211111112 Z ..,..,., , 5 ,,.,,, 15 , , .... , , , ,,V, i is ...,,, 1 2 1 1 J E ,,,,,, ,E r 7 f ,.,.,,. 5 ' ., ..,,, Q g--0-mf ,,,..., 2 ga flllll Q f - - ,,,.. 4 2 4 2 4 ,,... .4 , .,,,,.. 3 1 lflilllf , .. ...1.11, 1 A ......., 2 -'- We - .,.... W4 'i uw, .... W, ' ' -'- ef 1:51:53 ... ,.,, 3 4 ' 1 2 f ' 5 ...,.... 2 i.a,,,,f ififiifl , , , ...., Z ohn Lehr-,Tis foll to ive ever ' thou ht ex ression. 2:1115 . Y 8 Y 3 P Q ,,,,',,, 5 Q Q 5 f 1 Raymond Lewis-lVIy interest lies in sports. 1 Leslie Leybourn-His liddle's full of haunting melody. Edgar Loudenslager-Shall I hum you a tune on any old theme? ? 'W'1 Marguerite Lupton-Who penned those graceful Words? 'Tis I, in truth. Donald NIcClure-Dramatic Don, fullback for the Purple Hurricane. 51112 Noel MeClure4President of the Engineers. Joe lXfIcGoldrick-In sooth, I will hurry for no man. igggggg 5 , f 1 f WM, ef- fffff 4 ? -- H .....,, 4 , ,,,.,. ax 7 . , ...,,,,, 4 Q ......... Q . . ' 1 1 zfty-nme A ..,,. f- , ,,,, 1, lL,7,,,, ,,,,, T , ,..,, I ,J 1111 . if f ff, MW, ,grgxrf My, 7 A ,uf f- .1 f M- f ' I i , A X , 5 . f Q, ?,,w3jjfiff3jfffff Wqgffl' I4 ,.1,, Z Vlvl 1- .,.. ::. . :l.'., L-V 7.3 N I I if-1 .MMQA ,fa ,Y ',f 1:.,.,,.,,,f--' ,lMy,:::jifi I? ,. fff- - .A.,. ...,,.,. 1 ---- ,.,,.,., 1, ,,., aw -I I ff -f'f- ff ' ff ff'V ww-.,.,. 151: 1 '1' ,Me -I-gf?2,,lL'f,V-fame--f55',.I ,,,1....,11M,1,W::f:31f:ZfL,i .,..,.. TJ...geQi.?'f1LQ,fW 5 5 .. . ,-N f x fr, . H -1 fmt- 'H fr ' fgzmiifmf - . g,N...fg,, M f 'N 'X V ., - f - 'W-. 'M' - V ax w . -. 1 K .yt 'M 5 uf g . c,,,.-,,l.x,,,f,,,f A Wt.,Xr,f3 gf tt. ,, 2 'Q f. 4 J 2- X 2--. - Y .f ,J wx W! kj' m..,fxR G My ,Ml pw 5. 3 f,...,! V fn V if ffl ,. ME .r,,W.. f, , 'f if y ,,1:4.. 3 fm, , ,,.' Ve f f- mf-7 C fu' f , ,N f'M,i'm-.Ji fr-f ff fi .,,! WW vf W .... ..., ' :Qxxm ,,,. .t!4'S,1fffwwM1,932.:zu4:m.mwwazf:m,mmmrmw,f4:1Mww5mmLppww4 ,,,, mm .... 2 iijiiiiiii 2 ......., f ' ' f 4 ' 2 5 1 - 2 1 ......., rf ,MWA i Y Y I f if ........ 2 1 .,,. ,, i 21111115 4 ? ,,....,. I x zgn ...,.. 5 - ff- E 2 , ,....... 1 , 1 , .,..AA.A Q 5 Z,,,,,,,,' 2 N l 1 ffm! f ? 'S umuj Z f, . f 2 ffffff , Q 3 1 vfff 14 1 f 5 ---- Z .....,,. g l l .... 2 1 2 ...,,, ,4 - , 2 5131315114 l g ,..,, 2 ,,,.1iiii 4 2 L ,,,,,. I ' .4... 4 .... 11113 2 2 --'- flff 2 p ,,,. Wi 2 1 '-f----f 4 2 1 -ff ' - Z l Q ,,....... E 1 f -'---- 5 , 1 ,..,..... 4 3 , 2 f x f f--- 1 1 , ......,. 7 A Z James lNIcGuire-He gazed into the future and sought our fortunes out. Senior g class prophet. Scott McLeod- Scotty,' is a good scout. ,t .,,,., , 5 1 ------' , , 5:15:32 1 22222222 Ruth Machlup-At fasluonlng a costume I am deft and sure. 31212 3 l , 3352 2 Thelda Mac Vay+My ser1ous looks bel1e my cleverness. 5375552 5 . . . 2333333 5 Glenn Mart1n-Outfielder for the baseball team, when he 1sn't aggravatmg the ?iiiiQifQ2 3 5 531312 saxophone. Qi l 2111113 5 Edith Marsh-How good a thmg It IS to l1VCl 2 Harry Maza-I am small, but I am a man of purpose. Henry lNlellrnan-Pass on! Disturb me not! z 2 s 5 'f S- . 4 2 .... My . 1A.- 4 ., Vfvfv 741:13 f , , ......,, E 5 ,..,, E ...,,,,- -. .. ,, M ,,,,,,,,,,, M ,,,,,,, , W ,,,, , . V ,,,,,,,, W MM .,....,.. ,V ,,,,. ,,,,,1 W .,Mm,N ,.,,., h ,,,, ,,WW,jjy,t ,,,,,,,, N , ,, ,,f' ,ff ff ,ff .... .,.,. 3 wfffufaifinafff' .,,, -. ,. ,M ' ' ff! , ,,,.,f,f2'f'Lf'lQLZfi f , v dh few !3?t':'i1:--W-fff:ff42-1,-ffm... ,,.. , f jfC' f ' .- , , vrgpirff ' f M r f-E, W' M,,.,,,,' ,, ., , Q2 .Wwe 5 .Emu , YM . cf: 1 .. A , Mfg., 1 f, ,gif X f ,Q X f ,,.. , , ,,.,., ,, . l Wmwmwwmmww-3' ,W.....,,,W. A, f ' fl ,yy ,.f..-.'a9Wgfifff4:fff . ,.uX , W -N . 2 f 2 1 1 ....... as 2 r ,ii ' I ,.,.,,-.X 553' , x., f--.f .Kg I, X, f , .V V,,, .,:,,,,, I ff H a , 5 X, V' f ':::z,,,x f' a.. Us g 'M .,,, ,,y,.,,.,,y ZCWHWE fl: 51-2 5 f iiwwff ' f ,.,. 1 -..l X.!'2 fn' if 5 1103 4f 'r'1 f f 1 ,,.. fM,mmw,WfwM.:,,,..mmaeawz,animal1rw:mMw:::.:w0h:2:.asM .... giiiig 5 f Z 'il f 4, ' 1 fl Y 1 Z 1 1' -aa i 1, ,.,,,,, Q 1 Q .,,,,,,, gg 1 1 Alberta lyletzger- Give me a book and an apple. cries she, and I shall be content. ' ff ff'f I Dorothy Nleycrf-Her laugh is low and full of melody. ,....... f Phyllis Millard4A witty little miss. 1 Lorain hliller-He holds a post mortem on his Ford every day. Cloyd hlills-Others have been small and have accomplished much. , ,..,..,. ,g . 1 Frances lXl1lne4Serene and unruflled, she pursues her Way. Benjamin lylinder-I will take mine ease-and who shall prevent me? llelen hloenchflf you will but give me leave, l will smile my way into your heart. f S'I.z'ly-our W ,,,,,,,,,,, ,..,..... ,M ,,,,,,,,,,,,, ,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,, ,,,,.,,, - ,,,,,, , N ,,,,,,,,,,,,,,, ,,,,,,, , ,,,,,,, , ,,,, W , , MNMZJ ' . 3. ,, , ..,. ,.,f fffr ff igsifffiff' ,if 1 ,jf If ,,,,.. I H f L m',M,,fZf,,,,fil',,,' M127 i . y .,,,, . f f . if H1121 fi-wi. .bf ,, ,' .fl I 1 ,,,wf'L,,f'f - A A ' . f ' i - 1 fvv- 3 ....,. ,,W.W:::,,l.,,,,W ,.,,. gss.,.z::-!, s f .,.,,,,, 5 if, ,,,:.,f1:f, .1 QW? 'xy N ,V.,.,..,, 4-1 an ,M-V-if N xx, 1 .....,,. 4 5 ,,,,,,,. 5 ?...,.. l 5 1 ,,..,,,, i ?...,..i 5 ,,..... 4 5 ! . ..., 1, 5 9... f L ,....... 5 , . Q-M Q 111531113 1 ....,,, 1 ,... ..g ..., .3 4 ,., ,.,. Q ' 4 y ......., , ,,,..... 3 E was i em.. -'-f 4 , ........ . 1..f 4 4 P .IIIIQS 5 s 'NE f M113 iv 3:1111 ,,.,,. ..,. f1 ai TR, wf f El RN -'ff f:..!'ff'1-f' 32 M ,f nw '-Y ex ff i,..W1, . , ,,,. 1 N wfffff .1 ff, fm, AV., swf, 51.121112 3533733 .,,,,,,. il 51131112 5331? iijiiyiii 1 1112222 ....,.,, 3 wi ifffffi f ff 2 Q ,,...., 3 ..,,..., , 2 ffV'f-- 2 .... .3 1 ,,,,,,,, i y ,,,.... ffjfffffj 1 -,----f . 311152 H1113 l ?w-3 3111? 21113 513115 211115 .....,,. i ..,..... ..VVV--- 4 ,.,,..,. i . all ffl flillllif F A i ii I i L 1113 iiiiixfl Bessie Molnar-Mirth mixed with serious stuff-that is my life. W ifffffl , , . , Nellie lXfIoore-The soul of Wit and sprightliness. . . . 1'-M gffiiiig Renton Moore-My serious rnlen is but for camouflage. gl 'f-'-'- 5 Elizabeth Nlorgan-Always talking and gay, I am surrounded by friends. 1 ......., , ,WM lfliififg , , , , 3:11:13 Dorothy Morse-A Joke book IS one of her precious possessions. iii , ..,.,., 4 e 1111 M Q 1 P11112 Henry lXf'loser-A man of good sense and sound reason. 1 l ' 511111112 Howard Nloulton-He oes his own Wa unmindful of the crowd. 5 f y? Elizabeth lXlouttet--l love the noise of a crowd, 2 ,,,,.,., 1 L J g .....1,, 5 S 1'11 512122122 1 '4 , ,,,,, ,M ...., 1 ,........ 1 iiiifiiiii C34 5:22 Simi!!-L'1:ro 1 ........ I 1. 1 ,,,, 1.1 .,,,,, 1 1 ,...,,.,,,,,,,.,,.,,,,. N ,.,,,,, ,,,,,,,,, N ,, .. 1 1,11,,, .. 1, 11111 G .111 111 ....1 1 .WM 111,,,,,,. jf:7,,,,,,,,W ,,,, , !:1,iC1Ww.., 1-,.. '-- ' - ,ff ,fi 1 1 1,.. 1 .. ff . 1 --.. .. - . 1.1.. f 1 L l1 bf' fA? 5Zf:., 1 5 'E fQ1111,,,.-ff ..11.1.1. 11..1 '1' 1- ..11.11. Qgff' 5,316 W 111 f 1111v -f M- -f-11 V 1 v'V- 1 1 ...1. 'ff'-,iz ' ff- f-1'1 rf ' . 1 1... 5 .l1,,,,WMwff'1WW'-,wM1..m,,WW,Wfw , www mmm? ...... .,,,11.. .111 1 ,, ,111,.,1..WW.. .11.1 M ..1M..1.1 H ,I1 1 3,-X l i ,H 1 1 . t Z f ,.,,..., We, F 1 1 1 i W4 1 E 1 . ,,,,, 4 5 ri MW, 4 2 ...,.,, i 1 - f'- 4 s..,,4 1 , ww, ' 1 5 i , ,... ..4 s -.., ,V,,,,.,,A. .W M re '-- rw we 5 15 We - im,-fem.- for QC ,fn ..,f Qfk-,,. 2 ' Nu,,f jgjj vs ,x it ' X-.Jk,,,f A 6: ,px ff' . rv A Wh 'iT,f'J V.AA 7 P ' ff 2 iiiiltii, liiiiiij 5733 , ,,,, ...,, Z i, 2 i 5 , llffiff l Z V,:,,2 A z 1 g 2 l 2 , 5 ,,,. 1 Q gziziizg f 1:3 f I 1 2 , 4 , fl ' illlifilf l ' lifllllg igiiiiig 5515 5 Q 1 l 5111215 l 4 ...,.,4. Ei iiiiii f ,,,.... Z 3 i 1-W5 ' , , 'ISE 9 E .s..,.f 3. 5 ii'i11i 3 ! Fred hlueller-He IS clever with his pencil. emi x ...,..., I , Ruth lXlueller-Scales and chords are not monotonous to me. - 55:11:13 Hazel lNlurphy4Secretary of the Glee Club. , QM1 E ,,,, i . . 1 5 -'-f Lowell Northrup-Wickedly he toots the slide trombone. 3 ' 51221112 , . . . . 9 ..., of g Fern OvermyerYLearned she is in domestic affairs. Klayme PaulsendShe endeavors to hide her cleverness behind a quiet exterior. 5333: , Florence Perry-Would you have comic poetry? She can grind it out. Nj Mary Perry --'- fA lively little girl who speaks no ill of anyone. , gziizii QZJJJZQ ,,...., 3 Sia:ty-three '-wan. '77 nah, -. ,www--..........,,,,,ffwWm,',f1, ,.4,,4-muy - - , ... , ,. .. l 1 . ,,., W ,,,, N .. ,,,,, W ,,,,,, M ,,,, M ,37,,,.M ,,,, M ..., i , M ,- ww. ff -., ,V -,.-wj r ,,,,,f ff 'iif' M , ., 1' A A if Liigilii ,,,. ffntff V, 'f'fl3f Mf..Me:fS5?'f' QF ,V ...,. ,,.,. , .,,,.,. 1.111-., 1 ff fl3l7?'?E'f yi? s . ji, '1:.:::1TTJ7'::p,.,,j12,.L.'f- Ms : 5fi57fgLYf l,X JR --.-V -1 f--- ,, E -N.,-WW--.m,W, ..., L ,,., ,... ,mu .,.ff.,M.f 5,-,, A,-q,gLfg!f11,,, gm, W, ., ,I 1, X V, 1- f' f 1 5 ....- ,1. ff , : Q J 4,5 1 ---- -1 if ,,,, 11. , t Q ,,,f My Q X ,1 ,1f,,f,.! v- ff. ', ,Wi W-7 5 1, A fm ,.,,,,,,, , , ffff, f , ,, W, , f , V if --7' I WJ 7' fvwht 1' ' N 1 ,--. f '1 Vf 2 Z' if ff' U 2 fx- i . X W J :7MmM,,m:fmmQ.J,,W,ffmwwmMinhf.Z.w,,3aww5L3Zim? Jammu,:::11u44a:.z,ee,.fLw'f 4 .4 e 2 ' ......v 2 , ..,,.. if 1s z 1 1 1 1 1 1 Ernest Pfalsf-I live each day fully. , Isabelle Pfefler-Her voice is sweet and her manner pleasing. I ,.... ,,,,.,., Althea PhillipsvVVhat I do not today, I shall do tomorrow. Viola Pierce-To juggle quadraties is all my delight. Ruth Pilzeeker4Work has no fears for me. Kenneth Pope-I would not harm a living thing. I Russell Potterw-I'm what I seem, as those who know me, know. Helen Powell-President of the Zets. She makes the typewriter hum for the publications board-a willing worker. iii igiigggii 2 S'i.rfy-fuur frlll L12 5 W, ,,,,,,,,,, , N,,, , ,,,,.,,.,,, ,..,. 1 :Cy ,,,,,,,,,,,,,,,,,,,,, X ,V,,,,, ,,,,,, W Wx59:5,,L ,,,. .,, A ff wyVi,1.?f:,' I 5i,,f f if gf Arlll .....,V f , f'?5f,,t7'j at 11111151 ' f ,H M, NQ,,,..,,,N,,l.f'2M1 1, V 3 1 ' f- :.1,i,Q, 'H 1 . 1 ,.,,-MAH., f ., 1 y 0, .,,. ja, , ., Q , f f , 9 W,,ufM, f,,,ff,wf,Wh,,W, ffff f- ,,,, V ,gr ,Mya M f-,-- 8 ..,,, W, ,,,,,,,,,,,,,, 6 1-.X l . , , 1 5 , .... 4 Z Z I z 5 x . f '. 3 . 2 , We f 'f 'vs f ,ff - f -N f 22 ,--. M f 1 ji , 3 '- , ax ,p 1 A f..,.A.,,.N,wf Zffwnfj W fx K f ff f ...,, mi..,u,,mziymi,13wff:1fg:f-- '- f f V ....... 3 ,...,,, 4 51111112 ' 5 fe 'Y 5. ' X V W5 Doris Price-I would be a literary woman. f ----- we ,.., Wg ,,,,,., 4 David Pugh-In radio is his delight. ,.,. , Wi Julia Palmer-Girls' Athletic editor for the school publications, she is never too .1 V ,,,.,,, f, busy to be accommodating. Evelyn Reed+Small and vivacious and clever-what more do you ask? Sl-Nw-4 Gliver Rideoutffluburn-haired, clear-eyedfa man with the soul of a poet. Clarence Ritter+VVho does not call this Wandering cavalier a friend? VVIIII Huldah Ritzrnan-If she Will, depend upon it, she Will. f f--' auf l 4 . ri 52112 Grace Roenickfljresident of the French Club, a lady of words and deeds. I Si.rI!!'fi r fi ilifjlf ,,,,,,,,,,,,,, - ,,,,,,,,,.,,,,,.,,,,,,,,,,,,, ,,,,,,., M ,,,,,, .N M1 ,,,,,,,, - ,, ,,,.,,,,,1, .,,,,, ,,,,,, 1 1 1 XYZ? ..,,..,,,11, ,,,,,,,, J .1M:,3?1jZ fm .,.... ,. ,lwifgg ,v , ,,,,M,vf'5f1, ,5,,,,,'w:ffr-5 ew-15-qw-,..,,, .qu , - f , A ,,,,,,fff',,,,,,ff ,,,,.,f ,,.jj,,-f . '. Y ,MHZ , - 9 L , 1 Pj 'Haw-af-,,,,A uf fflwf-l2'w,,, ' ' i 1 I V f ..,u- ., , u' .. ,- V x , .um . 2. , , ff . y-1 , - ,NW ,, , . - 1 iw-up .. 2 'ff V 2,..4,:7ff2?f af' 1 I' ,ff f Mft XML .. fy , f wpfz., S f H L zzczwmf vv' ., ' .. H, 2, A , . ,. , , ff If , , 1 . 5 ,fm ' - ' -' V1 f 11,114 4-mf 2 ,.,, ,frwz V :S if ,- f- f x iv W H :::1zvyww,,Mf,f-I ,,,wm,,m,., ,,,.,f,, .. -- ,Y .W ,lf -,W ...,,,ff -Q fff-71 W .... f ., 1 f IJ 3 K 'Z ' ,,,,, . iimffzff, .qw li,,, , , .,,,,,, 4 L 3 -, f'1. 2 4 i f i 2 . .,.,...., 1 W., , ....,....,,,.,, W.. it ZH m W- if M, f- W5 N? We 511 ,.,....,, 1 S111f?+sg'g:fw.gl ,,,, A f ff . If 1 ly! ,,,,,,,, 3 ,f W, J 'v I ' ' ,u,.,,. af X, 5-MX f I V' ,,Y,,,,,,.k0 ,,,,.. V M will X, llll EV ' ff V fa W4 ,,., 6 uf., f mu y Jfxwwg if ,.,. 21131132 g ,,,, W4 ,W g,.,.,,f ffijjjgi g A 4,,, ., Dorothy Rornstaclt-A keen mind and gentle words reside in her. 2 .----f'- 1 , ,,,,.,.. , Agnes Rosie-I can be persuasive, if occasion demands. George Roth4He tortures the bass viol, and calls it music. Gerald Rudolph-I am not too diligent With my lessons. Martha Schafer-Ambition goads me onward. rw-nf . . azzzzzff Leatha Schatzke-Her Words are shed softly like leaves in the fa 5 ,....,,. Clyde Scheanwald-Double-jointed, 'neverythingl 511' Lorenz Schenek-Nly bent is certainly not toward chemistry. ff Nifvfy-mic ,,,,,, 4 Qgijifg ., .... ., ....... ,,,,,.,,. ,,,,,..,..,.,.,,...... ,,,.,,,,,,, ,,,,,,,,,,, - ,,,,,, ,,,,,,,,,,,,,,, ..,,,,,,,,,,,. M ,,,,,,, , , M , , f yayy r do e A fy i V... A 1 ., f V, i ' ' W' - M ' ff -rf 1 if X I -'--'- ' ' 'L -n..,wf.,... ffwvfw' 1 ' W'-HWff.m,,,,,,--f wW,,W.u,Ww' Maw Wag, x 9 y 1 , 2. f-. '---- ---f-- M --fo--X f ,.f', M 5 - 1-1fl'7fN .1y 5 QfQ,giiSf '3.1.. r' Xb 'M 1 . .,,, ..., .... uf., , f Q , 7' L Q ,j :Quai 2 1:53 x - 5 - 44 ,uflv-Wk' .J If Ei kx,Mfv:u,j'f'-,f.,.J v. '- 1? V XM f f 4- , -V, f--... ,f ,Q X !'f'f'J' N' 3.5 rl , ,. ..,,J,f,N.f-m?,xfm:,,,Ni J ln. MK yd fl. fx vim Ju rmfsx f I3 K- Jw.-X' ' ,1..,fiwsf-.rd .2542-3mmgfmm:m::Mw...M1egwvw-vf?42wf-u.+Kxz:L-wifvwNff.3b'-L- W -'2-asain... - ' . ?...-,i -if---T 5, N.N.. 4 , l K ' M ,ffifflff , gjiiiiig Q K ..... , bb-' me .V ' I 4 ,..,... , K r is ri Q 7 1 liiiiiil, ifniilil 2 7 ' Z . 3 3:5 2 ' ef' 3272 Il 3112112 Opal Schmitz-Beautiful things appeal to me. . . . 5 Cla1re SchoHeldfG1ve rne a horse I can rldel joseph Schuller-Have you a choice bit of news? I would hear it Without delay. 'N Roger ShellesfSport editor of the Purple and Goldf, a pleasant, chuckling X person. 5111 James Sherry-lf you will question me, l Will answer you. 21:21. lVlerced1th Schroder-A vvhlte-clad nurse 'tis my desire to be. ' Nlae Seldell-Her blue eyes laughed and danced W1tllJOy. lXlLlI'l6l SluhanYA sklllful lady wxth her needle. 1,3 1 f 2 5.-is , QM4 1 Sixly-sewn pm? I 1. ..,,f... ., ....,. ..... .,,,,, - , ..,, ,,,,,,,,,, ....... , , ,, ,,,,......... ..,, , ,s ssss snns s or ,,,pppyAA ,y,yy, s s gill 1 ,K X H. ..,,... J , X -- bi, ....,, ,Y -. f,.,, 1, llll ?j.i',w:f:,f',,1:iWr ,!,',,.jjf5y A ' 52 , ii ffm' V W' . 'wr W M.. u.,.W.,M.,,, ' if--A Z to MQ., '4 I f ? X in 1 f WE I 2 Q f L 3 I ,111 .,,A ,na ,......,,..,. 1 .,,, fi ,I 1, ff fn 3 My f i WVV. 1 fr . If wwf 1' CL,,Li5Ql,1,1,,1 If f 7 7 I ' f ' 5 1 f 2 51 ,,f he J V' :af I 112 may r nf, , ,,,, w ff, 4 J 1 . - V... W , ,, .f iff? , fi '1 Q1f14, ef,-mx f' 1 if ,..1 f 'a,w'2.11f'e 1 Nfl W f 5: 1 15 . X he WW1 ' 'v -Lf ' ' f f?f' . f'? L! . 1 .,, ,,1,,,,1, - ,,., .411 .. 1. 1 1. fZ ' M ,,...L -1,,,. . W 11.,.,,m?w-a.1- fa ..,,Wfvf-v- 646.1--off fl , f .1,,, 1 ,w,,'x1 1 , im 1- - wf,m.11www1:.f:fa1.,a...Wa... . ..... 14.rz,...,,,a.i'w 1 1 1.1. 11 -ff M- m----w--- VVV, -xwL..1,.1m.-.wx:wa1.ayaaf12 5 511111112 2 iliiliiiii 511111112 - 1 ,,.,,,, 5 1 f f 2 1 giziigiig i giiiiif 3335 5 ? '1:iif ? 5 2 I 211111112 ' 5 2 W E J W: we-fi Z 1.,,1,r15 3 -- M4 1 'f'-f i 211111122 1 2'-' 1 .,.. Q . 31114 1 f'ff'f l ,. ,... 1 .. 3 1 f ?11111112 5 ---- mf i 'f ' 1 ,,., , .,,,,... 1 1 ,,,.,,. 1 -- ' Q r 1 1 ---f-- Q 211111112 !' ..,. 5111111113 g 1 1111 MWWf0,,11,,,,, ,M 111,1,,, 5 S Ji z 1? , ...... Z Ralph Snyder-He coaxes speed from ancient Vehicles. 1 Doris Snover-Music is my delight, and friends are my joy. Helen A. Snover-Editor-in-chief of the Purple and Gold. VVhat more need we say? Marguerite Soncrant-As exchange editor ofthe Retina, she keeps up an amazing correspondence. 1. Annabel SpeaksMA girl with brains and a cheery manner. Harry Steele-As guard for the Purple Hurricanef' he was a tower of strength 2 -f'.--.f 2 on the line. Edith Strahleyvl must confess that I am fond of fun. Gerald Stienecker-With ease he olerlooks the common crowd. g J f g .,,,... My l Q --if f ZW 1... fi W 2 ......., 2 , 1 1 9 -W4 1 .... gi 9-M4 , 1 ,1 ?..,N,..5 ,N 511111115 Q-W4 1 rw--ei Siiiiiiii i .,,,,.. 5 fv,, 4 4 1 1 Nirfy-ffiylll V 111111112 ..11111 3 5 ,111 -----.-- VVY- G ------ f ----- 1 11111, 1 ,mm 1. -,-VV-------- 1 11-1 V 1.111 1111.,.1 ,11. 1 1 N ,1111 ,.,.1111 1 ,,.,,,,11,11, M 111, W., WWW ll'W l I ' ,ff ,Qfrff ff Fa f1 1 ' i if ' X f , .. ., , 'i' gf 1,-f' fi 1 1 X- 1 5313 --'-f 5511111 f V-fwiiiiiff f ,,11,ggfZ 1' 'K ..... f 11.... . 1.1. 5112 lf. 'Tig ,A A A 55550111 F3 X f 'I 1.1. ..1.1.,1, , - '- t:1.:..::1:.1:::::i11'm' :Z-2551215 ' . L 'Z11Iff'. V 1 ' f ,gifj M-1'f'1mMWM,N-I1--1, .... '-f' '+aan,fJ,f,.'ff 11m fW f' 2 i 4 i 1 Z 4 Q tgewiwmicgy ,N W H I 'nz fmf-3 ....,.,.,... SK l2'l: fx 'M If '-f- -V f N ,,.. V, V-Q 4 if Q X, M a1g1.s1,,,g-e- .sts ai 1, V-af of aww ' 11, 2 af ,A fnfmf vs ,fl ,. www! Z6 ,. 1- 1' ' 53 . 'we ft., IH - ' rl' fgd, . flu V3-f' fx ,,,...., 'swf f'sf w14-, 'M - ,,, nurxn 1'-fe-f '3lTe f w,!1--N fra 'f-' -fx: H--4 -'H 't 1'1 11 - 'eww ff-- Mfr-'gage'-aff-----f'- li--f'1-1 wwwwaifi-'-w-f fir:..L-.-Ldngzewminf ' 511111115 Q11 illfilffi 2111113 5 fffffff 2 , ,.,, ' fffffffi ! ,g Ilflfg 5 S ' .. 111111, 5 11111111g 5 5 1 , f f 1 2 511111112 2 .,,,,., , r 5 ' , Y 'f ei 2 3 2:11:11 1 Qfwffff , 5 i 1 1 1 L.......4 1 1 f 04 Kathryn Sutton-My future is in my keeping. X Arthur Sweetflf Doc says so, I'll believe it. Joe Szemetko-Diction swift distinguishes me. Helen R. Tanner-A wizard at figures. Secretary and treasurer of the Retinaf, Charlotte Taylor-Her bronze-gold tresses belie her dignified bearing. hlilo Taylor-He directs pulsating harmony. Robert Tweksbury-President of the Forum and of the Student Council- l1ere's to you! f' v f f Dorothy These-I will put my thoughts on paper. ? V 21111113 3 ..,,,. Siwly-11 in 1 Ziff A M1 .1,11 1 1111. 1 ,1. ,11,, ..,, ,,,,.1111. 1,.., 1 1 1 1 1 .1... 11 1 Quilt 11111 1111 , .V f 1' ,,,,,,,,,f:f:p::?iiiiif ' v , - , 1 R 7 t W' 6' 'U 1' fl I J ,. .. ...'.:1.i: .,,f, 3:55341 'lv ,,.. H 1: pig? gI5'1 , :3,,,E5 V AV f gy, 54- .,,. MQ' 1,2-I A, 51 XM llrr V,,,,,ff M,,,,,::j,,,f' . F.: ,.,. V ' 1 ..,.1. 1.,. 1 1' r'--r -gp ..., 1.11,..111 ,.,,.,. '5--Jef 1 'xii .,:::5 ff'?f' MM News ,,,,, XFN, 1 if if . -'V'f 1,1111 ,, W1 ,1,,, 1 ,,11 3 Q f:i,,1.f'e' y M 1 5 11:11:12 William Trotter-Studious and thoughtful-a perfect gentleman. 111111111 1 i 1 i z 2 Z M1597 .mn .. 4 IIVA WM -5.1 4 ,Xb 1,61 .M f-xps R EM f, g if Mfsj -V, cg-.. m:Ne.113u:' QQ Qyxx 1. I .., ..,, W N I C , l , x 1 f J if 1 -' fc ' J 'vs 11,1 mf Wk Awmjmf 17, 5 K-.N-:...! .2 -- 1 ' 9 , 1 ff 1 , f f .fn H wwf' i7'j'W11f..giMffffm fe f '1.f1 I W , ,... fSa,,f'1..!1z f aF'x1f 5 ffl? 1 -V , I W 1 1111111112 -'- 4 VIV. fV 1 111111111 ililflllf '---'-' 1 1 Vf'f'VV- 111111111 2 1 111111111 f-1' 1 1 2111122 5 1 1 1 1, ....... 1 3 ZYIIYIIZ VVV'-f E f lmlfiffi 1 11 if , .,..... 1 ,,,,, 1 ----' 1 1 1 ,....,. 1 1 , 1 1 gg ,,.... f'---- . 1. 1,,. .4 1 1 ..,,,,,,, 'V'VV' 5 , l Zflllllfl 1 ' 4 3 . 6 . ,,,... .1 ' 1 ,1 ,....... 1 11 ,,,,,,,, 5 1 - 1 , ',v I i 1 ,,,,.,., 1, 11 ..,.,.,, 'W 5 Q ,.,.,,,. l 1 lflllfffl 1 ------ 5 1 .,...... 1 1 1 ' .,... N.: 1 ' 1 1 1 f ,,,,,,., 1 1 --ff1-f 1 Ei L ,,,.... 1 1 1 1 ---f'f' . 2 222111113 1----'-- 1 f ,..,.... 1 1 vlff' 11 Z 2 ,,.,,. 1 1 2 1 ' 1 1 ...,... 1 1' 1 .,,,,, 1 H .... 5 . 1 , .. .1.. is 1 22112 111113 11 .,,,1,,, 1 E5 1.1-1 1 11-12 1115 1 5:1112 1 1- 1 1 1 if 1 1 yuan, 2-H-M-1 p ....,.,, 1 '-'- 1' ..,,,, fum 1 gg ...,,.. . ------ 1 , n , ,..,.,,,. . 1 1 r 1 ig i 21112113 fl ,,,.. 1 1 513 Z 2.111113 1 1 ii ,,..... 1 ?,. ,,,.. .5 3 1. ,,,,., f 1 5 11112 ai , 1 1 ......, 1 I ,,....., f 5 N 1, ,... .4 if 1 ' if I .1115 43312 1 U .,., g g.. ..,,, , 1 E . 1 ,,,,.., wg ,,.,,.., 4 1 . lNlildred Thielman-Frivolity and l must strangers be. Qilliiliji Dorothy Torgler4A radicalist on the tax question. . , ..... .11 1 1 1 fff1f 1:31:51 ,E 2 21:11:51 Ray Thompson-Daily he makes long journey in the pursuit of knowledge. zitiizzz. ' 1 v 1-A 1: ' Z.. ...,.. 5 1, 1 1 11... s Christian Thomson-I will not flaunt my talents in your face. zu 1 all s 1111 Y 5---14 35 Q LTI 3 B FD, : H H C1 2 'U ET if :1 i il F 5 UQ. Q. r'f O E Ph hh :1 0 X4 Q, sw S 5 Q. oo O :f ' :T '52 Ui 23. IT P? FD ' Q. :H YE. 1 1:q:g::::1 Clysta Urban-Wliere are campfire girls, there am I. Mi 1 y 111111.11 ..--1-1- 11 1 .,.,., lr ' il 1 ..... 11-We 1 ,,,,, ...,. 1.5 - ' 1 , 1 1 1111111121 1 1--' f1111 'f'f W1 1 ff-f---- ff----' 1 , 1 -----11 :W-1 V ,,..... .1 1 1 '--M-4 Seventy , 1 ........ 1 - ' -1'f11' , .,..... , 1 . W ,,f' l L-f'g.f' 1, . . ff'3f1f 1:',1ff 'M ,X . , I 1 I 11, .1 ,,,, Zx ..,.,..... ,Wi-11.1.1 .... ..-,-Zvmixizl lvlv- H 251 4 ,1 15' .iifigjgiyl . . ' 11,9 I 3 A Z..ZjZff'7'fiiZ1...,...,1 Lp.,5,,f '- - M,--fjjjjji1i,.f2'gZ'N Qxfnjk, . .... ,.... 1 We ,.,,.. ..,w...,. 1 ---ggi? II11 '1-1' 5 .... ..,W.,,..,,.:1fLf,1,im,M,. ..,.., 11 1.1.5. 1 M-1fff,f g,..R 2 go, ,'2?'?Uf:f,, N WQK xi 4,2 ..,, ffm-. N -'-- 'VV-- 1 9- -2 ...... f. We wtf 'K hw W. 4' .ff . M E:gp.,,,Q3.g2g, -53.1133 fr ci , , '- E ...J .J if ' 12: -..,,,,g.,f'f,f,.,f vs K2 9 wwf fs W. 23 f. ,A. ' KN- f'fl,r 'wX X .,.. 5 A ,ff rx fs,,gfx.,,q ,.--5-X F '43 J '--.V a f -.M !f '! t -v--var: --'- ' I--K1-----M-ii-M11 ww:,,mmip's-tfgihvw hmm-.vw g ilffffllg Quin 21i1iiLi.2 gi: ..., 4 Z l 211112 fgllllijlfi ..,W.,, 5 l ffffffi E 2 i11l1lll1,g .... g 2. , i, .,,,,. ,Z ,---v---- 4 ,. 2 i l . i f '-'f i' ,.,... 3 3 is ,....,,. 3 5, s 2 6 i ifffffffg g l iffffffffg 1 gnu llll . f ,f,,f,, i 5 , 1 ,... .... 1 1 l r ' 4 1 ,...... 5 2 5 5111113 f,..f-' 5 1 .,,,,,,, ? ' ' 2 4 ,,,,,,,, 5 ..,.,,,, 1 1 .. f- - Z z ,,,..,,, Q ..,.,.., 2 5? ,..,,.,, s ------- A .K ....,,., 2, ,,...,,, , ff f . , . ,.,.... 4 '-----f if I 9 .....,.. 3 --5 5 5 .,,,,,,, , ,...,.,, 2 I -.....V. 4 r Q wi W f - 5 ,..,.. , . 5 ,,.. . .g 2 , V V I l lf Z Md ? .,,.,,,, , E 5 we--1 2 .,,,,., ,E '--- Wi ff ' aw-N4 E .,.,,,,. 2 5 VM 4 1 . ...,,... 5 , , ....,., 2 i , , ,,,.,.,,, 5 ....,,,, nf 5 5---We s if ,,...,, .Z 5 5 YW-, f ,,....... , Y f 1 ' Lffffff ' ' ,Y ,,.... , 3 , 1 Z 2 x 4 y ,,,,, E fiiiiiiig 1 lklalcolm Webb-I Will furnish alibis With ease. , 1 Wllllam VVertZ-Donlt confuse me with Wilson! 1 iii? ,,,,, Wilson Wertz-And don't confuse me with William! 2i1L111LL.g - . . lflw if illlllllili Edward Welsby-The smallest boy in the senior classn-but maybe he'll grow. 23937 . . , . 52254: Mary Wheeler-An enthus1ast1c Zetalethean, a good student, a girl With many friends. A William Whitcomb-A stage-manager par excellence. i , John White-President of the Q. D's, a. public-spirited man. , ,,.., ' . Seventy-o-ne Q ,,,,,,,, 4 Y ..... .4 iv W... ,W 1 V JJ, Jr ,, ,,.ffff l .ffffffff 7 f ,, fc,-A-..,gF,,. X-f,j,f',f if if M,,,,.j,,ff ,,,-' ffj, Wfff4f:4f:QigZf E f 4: ..,., W',E,, ra f , 1 1,,,,,,w ',,,,,ff ',,,uf' ,,,,fjf,-' -- V f -V Y 12:07, w :iq , ' :pw ,'1Z':L '- 'fm' . rw ,,,ff:f'f ,.,,, , '--- lf ev - WW 'W fx ,N ..,.,., .,.., ,.,,.,. 1 , .4 ---ff I ...- ,WW,,.::flg:i..LiW.,,M.T,..2QZf:1g.f7 ,f gfx fl 1 ZZZTQ wziiififfz fl - . ,,4...z,,,,, .a .,.. I .,,, , JZ K CZ: N.,. 1 Y K, ,,.. if .MN ww Ulf 5 J fs fl Jjjxmxx fi, M k ? .Ng M A.,, ..f,,f ' ,af X ai 'M w.... 1i..!f.f---J sf- rig ....z. ..., , ,,,f ,UIQ ri yan f i ' f' l f fAAA f i V , A ,A ff .,A, fa , f' fff' -'J f,ff,,f:i, ,f,, QM,ww5gQfM.L,Zm,:,2m?i'.,,,ML 1 .,.., L fmzzmmcyamgzz I ,,,,, Z f A ....g 2 2 Florence YVhitmillfThou speakest in easy fashion. Lloyd WidmanfHe wears a calm brow, no matter what befalls. Alvin Widmer-Custodian of the magazines for English VIII classes. Paul Woodman-I know what I think-and I'll tell it, if need be. Ruth WoyamefHer dimples make us willing servitors. Lucile Wunderley-Small and full of curiosity. Frank Zalirlyglknd oh how he loves to swim! 5, .... 25 ...,.... 'Z if-We f , ,,.,, 4 Y fiiiifii 53111115 a.', l ' ' Z , , 'f ' 1 2 f ....,,. 3 - 2 2 in J 3 i 1 9 f iiiiiiiiii ....... 2 1 5 Z ew H Swmlly-f11'n 5 f---f--- 5 Z, ...,.. g , f 5' 3 E lllawamww ,, .,,,,7, ,,,, X, f I Wflfwfv fjfff ,f ,ff ' , ,M ' ff' KD' V f , , ,... , ff-ff' V J , f I ,513 g'gM'2u-5--ffq-5, M , V f' ,f ,,,, V .V .' ziyyzff' Q, ' ff, f Q Q f f 14., , . wazffnfn ai f f ' ' fr-, ,, , -- .,.,,.. A 1 - , ,,,, ,, .. Mzzdzil, 7,55 gin - ifmji, L, ff f 4, ., f '-ff ,V--3 '-' -' 1 --Ami : 1gi,,N,,,,,y,.. f . ,, H ,,,, 5 M 5 ,Ya , I vf ,,,, 1 f . 55 A a -xt ..,f 1 ' X' ' I j Z 2' ' 1 5,017 V X If F ..,, UM ,I S ff f W M f mlyffi ' f A Wmmwfgfm.1,mef1Zm6:,mm.m,,,,- 1.. fyemp., Sezzjorf W1'ih0u! yJZ'6l'Zl7'6.Y Howard Barronfl would not stand in any rr1an's way. Lois Calkins-Her tresses like the tasseled corn. John Petcoffflaast master at the art of crossword puzzling. Klargaret Sutter-Pleasure is one of her comrades. Russell TschappatvHe produces -lovian rumblings from the Harry Wiheeler-His southern drawl captivates the ladies. ENTRANCE OF SCHOOL drum. Nwrvnly-1l11'1'e 'Q e ' ' , , fe ,gif- ,,.. V - f ,f f Q - - - --.. .. wif ' 1-1 A X721 ff , ,, .... H V, ,,,,.. , , ,, W, , ,.., , , Q A ' - .Wfff--' 'W !:C1:vfwwfwff4 f- '3a::f:wM,,,,vW, ,ww ' 11-'S I W---f Hr ' v - '1 m-'ZWWWM if--A f ., ,.,f-WM., f , f...f .1 f' , 4 , 9 mbaxwfwf WM-wiv, ---ff- W -M-.MW-,,,..M,,W .,,,,,. ,,,,, , K f 1 , 2 'N Edith Strahley Chairma11 hlary Barnes Laura Dean ....,,.. , 1 ,.,,.. 4 Virginia Dyer William Wertz 4 1 .... M, , 1 VM., Baeealaitreate Sermon George Bates Q, Norman Brenner Nlary Wheeler Ella Jane Kirby Chester ldczak Memorial Committee t ,.,,,,.. I M ra fn- M .M 4 1 M ,M if l 11,1 ,af QQ gs W me n,.. ,ggj iff! -W , 7' If , 'af' W ,Aiea I .fe ff'-aff' f: 'MW44ii '?ew f 'nf 'Wt W T r-am as fi -it t'Ww.,1 M 1 .. , , 1 1 . ,, ,i. , 1. 5 1,1 ,,., - ..., fmfeee:.,.g::::11p,1,:a:te::1.:MW:,ft1 W 31111332 33333353 iiiiijif 533112 511111113 5 f 5 SENIOR COlVlMlTTl1,ES 221122 ,..,,,, 1 , i Ring Committee 2 Ruth 'Woyame, Chairman John Baymiller 3 1 1 Motto Committee 1, f Klarguerite Soncrant, Chairman Harry hlaza Gertrude Brim I 2 , f 4 S Color Committee ' 71 ,,,.. 45 .1a..., 5 , , H5 , Vanity Dance gfffffvfg J f 9 -----.. 4, 'A Glen Cole, Chairman Margery Best James McGuire 2 1 'Clit Chriftmaf Party - f ,,,,,, .4 1 1 x 1 , ,,,.., A 3 1 4 , Phyllis Millard, Chairman Helen Snover Donald McClure wut 1 as 1 1 mi ,,.,..,,,? , Ting Elizabeth Morgan Horace Coy 'H 2 f 5 U, , 3517 . iflllllffi 3 fffffi Prom Committee fVVvfff'- 1 John White, Chairman LaVonia Knisely Donald hflcClure Doris Snover Zenas Hartman Hilmar Krueger fVVfV... 4 Ann Herman Arthur Geoffrion William Elmer Banquet Committee 5 Hazel Blair, Chairman Myldred Faulkner Etheridge Irwin 5 Mary Barnes Helen Ardner Donovan Emeh Zenas Hartman Announcement Committee Julia Palmer, Chairman Viola Pierce Glen Martin Milo Taylor 1 1 t Clay: Day Committee Wi, , 'iiiiiii James McGuire, Chairman Charlotte Taylor Horace Coy , Z ,,,,..,, E 4 wwf t 1,,1,..a1r ef Hamlet Committee if Eugene Field, Chairman Myldred Bitter Joe Schuller Helen Powell Arthur Force Anna Dancer Chester Idczak Eurydice Committee 1 IIIIVI 5 Arthur Force, Chairman Elizabeth Morgan Arlene Innes Mary Perry mi , Barbara Frye Otho Gettings Harry Wheeler igggggjj a 2 11112 l Y ! I Ralph Heinen, Chairman Ruth Lee Helen Powell Badge Committee NVilliam Bannister, Chairman Bernard Gladieux Ruth Lee Q 1 w Y 5 ,,,, t..,s Commenrement Committee ,..., N 5 5 mme i Kenneth Arnold, Chairman Lorenz Sehenck Eugene Farrell Clara Jump Vivienne Brentlinger 4 5 7:5 Seienfy-four 5 g,,,...i E . -. M,W,.1 ,,,1.1 ,,,,, , 1111, W W ,.,, ,M ,,,, N ,W . We ,,,. .. 11 We ,focff ,ff f .,,.,.,,,, , 1' 5 I iW,,,,,,,w511,,,4',,,' M4, V V 1 ,Q 1 1129, I 1 'I I H 1 1. Q ' M -- 1 f if A gi 'f ' ...ff'ff:::f55 f' ' fine .1 A . .,.,. ': ....,,.. .-- W? 2-1 , ip 7 1 v 1 ft 4 11 ,,,, , . ,pa 1 we . time -eff' '- ,, , f f 1 a 1 111,-1 , M11 . V, . ,v wee, ,t -' -f '--- f .. . , 5- 141 s, X 'f'e :::wM-a,W,,,-11-1'1 -'Hg .1.,. ' ,V emi -'X gf X 1. -again:-1 aw ,t,,,,y, 'afi'-vgxxx 1 1 4 1,,.a..., 1 . 1 y ,...,, ai L ..,.,.. g y 5 , 1 1 Z S 6 1 1 i i N .,V,, M., ...,, .,,. .,,..,,, , -, R 4, ,, f1---fQ Ha. 5 'vs :.Njg:11jT fe- at , 1 , J 'J ii., X -- ---- f .1.,Jif-J'---J V' 53212 j 2111112 l 1 1 --'f-f' rl t 2 Y 311113 1 .,... 1 a . . 5 Unseemly 111 their haste the days sl1p onward, , .1,,,,,, Soon shall we say farewell to dear old Wfaiteg 1 Fond visio11ar thoughts are sur in forward 1 .,..,,,, Q5 I 1, Y 1 , I g E 1 . ,.,,, 1 mpatient, we, to grapp e Wlt 1 our ateg ,.,1.1 2 1 Pause, then, and in the misty dream procession Of all the shining hopes for golden morrows, 2333, Be mindful that the past Will always livei 5 5 Our one sure possession, f ' And every deed of future days but borrows From sources which our school life am l ives. P Y S After the years have fully fused and melted, 1 f And cast our characters in different moldsg 1 After our youth,s illusions have been blunted, I And life,s vai11, fitful glamour no more holds, '- Will she enfold us then, our Alma Mater, XVill sl1e be proud to welcome us and say: Draw near, my true and faithful cl1ildren all- Every son and daughter, Z 9,,.,f.Ii , From me your loyalty shall never stray, 5 Reverentl ou've rallied to m call? gzzzii 5 Y Y Y ,,,,,,, , The hurry and the bustle of last moments Will quench, mayhap, our poignant grief the while, , And pleasures and daydreams will be atonement For times when there's a tear behind the smileg A liven as the hour draws near for our adieu, ,MEEEE2 E VVhen silently we wander through the halls, Wlhere every blemish has its own dear talee- , 5 We pledge ourselves anew Z ....... To ive our best no matter what befalls g , 111.11 , To seek, be't far or near, the Holy Grail. , 5111112 2 -Marg'uerite Sonrrant. Seventy-Jive vw 'ff' fl ..,,1,, 1 1, .,1. 11-111, 1, , ,M ' f 1' 1 ' 1 MMM! 'mlm an lf., ,V ,.Y, ,.,, ,MM 'M,i:,,,, M! ff 1, ' 1,1.1 1-,. 1 r.1, 1t r, H ',jflf 1 ' ' sff?iiii 9sl?lYi4?-.m3':5'l?iaaa,. ifiwin N .f Q .sax-wi K 'nj - - ,.,,, M . . .4,. 1 N, , , w 1' M... 4 ' ff -.fn h - ' M A ' 1 2 , cr, 11 K Q, 'rw M f 3 N' in 7 A YL 1 3' ,-2 If fl ' Jw 5 ,h , ,1 1 : f-'H' ff' ,I . . f' .. -W... s, V v E Q 5, u ,J 3, .... an, I ,.,' , W! , J t ......,, ,.f ,f Q., -7 S ,5 V, I., , ,. ..,,. , , ,wp J' .::f.. . f A .,,, f f X .Z..:Mf,ff:f. X KY ,f,,ffm.im4::v 1 , CLARA Twenty fleet-footed years had raced by, since that June day when the class of '25 had been turned loose on an innocent and unsuspecting world. Doc', Heinen and I dozed on a bench in Walbridge park. The chill morning wind toyed with Doc's,' ragged beard, and whistled through the holes in my thread- bare coat. W'e were hungry, desperate, Hbrokef' Only a month before we had been the pampered star boarders at Ruth Lee's boarding-house in Findlay, but with the coming of Roger Shelles, efliciency expert in the management of boarding-houses, our care-free days were at an end. We had now reached the place where we must actually go to Work. lvly dreams were suddenly disturbed by a warning whisper from Doc, Oflicer William Trotter, pride of the force, was bearing down upon us. We arose and walked swiftly down Broadway. At the corner of South street stood the palatial residence of Lynn Johnston, leader of the radical faction of the Anti- Everything party. Remembering that Lynn had always been the friend of the downtrodden, we lost no time in applying to him for work. VVith considerable misgiving, We ascended the steps of his home, and rang the bell. Horace Coy, splendidly attired as a butler, reluctantly admitted us. His air was a trille lofty, we thought, as he led us into the parlor, to wait until Boss,' Johnston should be at liberty. And so Lynn had come to this! livi- dently it paid to lead the Anti-Everything party. Our reflections were inter- rupted by the reappearance of Horace. Svvfnly-si.u ,,, ,,s,,,,.,.,,,,,,,,,,,,,,,,,,,W,,,,,,, .,.,,,,,,,,.,,,7,,,M7, ,ff ,f -3 ..., f I L., ' ,, fff' ff v ,,I'?f::f' -,. ' ' f 1 7 -,, .wma 1 .Hy fy ff f .,., , f ,ff f if V - 3:13. ,... f, fran, .,,,,,, f ,.,,,,,,. ,W,,,,,,,,f,,w,,H W 15 .wwyu , , .. r X -. 'QW' mf, ,W-1--. x 5 f f1x.,.iiifi,.f,f M f'i' 'Rik 5' ,Alf L 'vi 1 ,W,1az.,Wy,::j . -2531, f QC U 1 ,I , I 9, , , Z, .,,. VV... 3 .M I ,X V, V, .,.,,l ,f ,Wy 1? f 5 ,QQ ft N- ,... 5-4,1 .J ' m..,x in :. ,fi UAW!! A Qckffffi S443 '-J .. 1 Ji., f . , f ? i7'W Hfw4fW 'ww fo- f '. .W 1'-.clwafz ww f' 'W ff' ,f hh V 'I ' , ,..,. ..... , A f rw, r -'-f--f 4 2 ......, Qi lXIr. Johnston will see you, erigentlemenf, he said, and we followed some- what uncertainly. Could this pompous bewhiskered person be the smiling Lynn of high school days? lVhat changes twenty years will work in a man! Boss,' Johnston recognized us at a glance, heard our errand, and grew violently enthus- iastic. I have it! he exclaimed, slapping his knee. You fellows can gratify a whim of mine, and do me a service as wellf' And then he outlined .his plan. YVe were to gather information about the class of '25. No expense was to be spared, and no conditions were attached to our undertaking, except that we were to return within three months. Bly secretary, LaVonia Knisely, will give you the details, added Lynn. VVe were highly pleased at the prospect that opened before us. NVe would do this job right! Our talk with LaVonia only served to make us more en- thusiastic, and joyfully we bade her farewell. We accepted our hats from Bar- bara Frye, the trim little maid, as we departed for Donovan Emch's auto park, where We meant to sit down in an obscure corner, to plan our itinerary. Wie decided first to canvass Toledo, and then to travel to the ends of earth, if nec- essary, in order that all of the class of '25 might be accounted for. Having been without food for three days, our first visit was to Bill Ban- nister's restaurant, The Greasy Spoon,', where We seated ourselves at a table. Frances Milne was just about to take our order, when the kitchen door was flung violently open, and two struggling men staggered into the room. It seems that Lorenz Schenck, the ice man, and Art Force, the chef, had been arguing over the weight of a cake of ice, and had come to blows. Marion Babione, Lorenz's assistant, and James Sherry, the head waiter, flung themselves into the fray. Presently the disturbance began to assume the proportions of a riot. The din of battle was too much for the temperamental, high-strung nature ofa fellow diner, the Reverend Oliver Rideout, and he ran from his table calling for the police. His cries were answered by a dashing squad of police women. Sergeant Phyllis hlillard silenced our attempted explanations with a laconic '4Tell it to the Judge, and with the aid of her assistants, lyiarguerite Jack, Edith Marsh, Grace Roenick, and Opal Schmitz, she hustled the entire assembly into the patrol wagon. Sf' 171' n ly-.W rf' 11 1 2 g...... 2 .ZZ 5 'ilfil f 5 , ,...., , E -ei .A .,... ,QIIIIIZ iIII i , .... , , , ...... 1 7 1-'--f- ag I Z f 2 Q C1772 i 1 A ' .ffffliii 51:11:15 ,M ,..., , , 5 ,... ..., 5 5 9. .,.,. fume -flflf 1 ,W ,... I , ,. ...., 5 ' 'f E 4 i 1 ww .,,. , , Q.. ..... g Q-'Q 5 i.,,.z., 3551331112 ,,..... H 1 ------- -42 .,..7,.. , ,. fi , . 'X . ..,f V i! 'iif'f Af 3, , IIIVVY y fllfrll Y I 'dlll 1.11, ,W ,iijjjfjifflj 'V-Ilfrrlff, fi I ' it ' , f ..,,,.,, .,,. fgzztxzifigfiiif' 0 fc f ,,,,,... ,,. . ,...., '.'.. .....,.'.,.,,, V -v'- . - ..... Z ,,., .. ..,,,, L ,,., ,lfipflai 'J - ff-i -z 'w ' f ii .,,,., vf.. 1 :.:W,,.W,,,.,,...,..w v..a,w,.,Mm,,,,,,V,W,,,,,,,.. T ,,-WM-7..,,v0MLgxWMM ...... .,,,,,...-.z...,...V,, .... ,M ,,,....... . . .... D , .s 5 ..,.... i if-W1 . . . ,1,,,, X, 4... ,.,, , 4,5 um -N... ,I xl f...a.,k,-ni Nm gi, .,..,....v X ...-uA 6'-..1-xlgx M. v ,,., , ,....,,.., fv-. Z - i - ' ,,:.z,,.w Q 'Q , y 'W' -eff ,x.,.J f 3 be-ffl-ff if J Y Hifi ,V A ffl ,,,, ffhfl 'f W mfaf' ' a I a ,f'.,,,,f2 , . y., Tfjfjqj ,N ,XJ f-an N f ... Q., . AA. - fiiiiiiiif Lili, 71115 tijiige Arrived at the station, we were hauled before the Honorable Judge -lohn , White. The Judge heard our explanation and decided that Sergeant Iyfillard had acted a bit too hastily in our case, adding, however, The sergeant is to be I . . . tffgffg complimented on the alertness with which she discharges her dutyf' As we passed out, Judge White assured me that, although Phyllis had a mania for ar- l inf resting people, he had to humor her, because she was invaluable at selling tickets , ,,,,.., 1 ' . i 311111122 for the social functions sponsored by the police department. ffflffffi Our hunger still unsatisfied, Doc', and I went in search of Arlene Innesfs Hot Dog Palace. Here we dined undisturbed. The service in the establish- Z C1113 - . T., ment was superb, and the music rendered by George Roth, Milo Taylor, Otho Gettings, Glenn Martin, and Paul Woodman was nothing 'short of ravishing. 9 .,....., g If K 1 g... 4 1 4 M ..., 3 .5 9 V ,,.,,,.. 5 ,,.,.... 3 y.. J v Txx X X It was now time to turn our thoughts to the improvement of our appearance. We scoured the neighborhood thoroughly, but were unable to find a single barber shop. What was the answer to the mystery? Suddenly Doc called my atten- tion to a sign acrossthe street: JOHN BAYIVIILLER, Publisher. We entered ,. ..,,... ,Mug QZZZZLLJE 5 ,...... .5 T113 Z 'E ..,,, og the shop, but John was not in. However, Arthur Blake, his assistant, could tell us what we wanted to know. He explained that, since Noel McClure and Jay Duhamel had invented the MECHANICAL BARBER SERVICE, Chester 7111117 Idczak, the barber in the locality, had deserted the tonsorial profession, and was ,iii now conducting a class in advanced Spanish in Zenas Hartman's exclusive school for young ladies. He told us for our comfort that we should flnd a Mechanical Barber in front of Harold Davis's Meat Market at the next corner. We thanked Art for the information, and started for the Iron Barber. Carefully we crept up upon it. The device strongly resembled the penny-in-the-slot gum machines of our high school days, except that it was much larger. Doc was the first to . . fffw insert his face and twenty-five cents into the apparatus. While the machine ,ggq clicked and whirred, whisking off his beard in the twinkling of an eye, I amused myself by reading the ads,' which decorated the monster's exterior. Jim Carr's health soap used exclusively in this device. .,.. ai Cutting blades supplied by the James Boughton Co. ffffffl The statement that the Carl Bahls detective association protected the machine was ample reason for no onefs tampering with the money box. ,Ms Presently the Whirring stopped, and Doc,' withdrew his head, his ragged hair and beard trimmed with more neatness than any real barber could hope to Swrenfy-eight , .,,,,, - ,,,,,,,, M ,.,,,. , d, .. ,..,..,.,,, - ,,.,, , ,,,...,,.... S. . ..,,..,,,, .... l ,,,,,, ......... ,. ,,,,,,,,,,, , ,.,,, . - .......... I . X, 1 af ff ,ff4iZ7'fi f - r f' We an-wif: 2 rf f nw, -----. .. ' . ,. fC,,.,..f ,,ff ' WE f ,,. 1 ,-.. .,,,, V ' f :fl f' ' 2 .5 i2 'LfL111.,.a-f ,,,,af1:::1::ff1? ' Q 'v'i' f H ,,,,, ,,., '-rrv-v' N . ., ...' f.'f'.fQ'QQf,:l '11--11111111 rr-r 3l'f?????5if3f '-3-5330: 5 333 1Z,i,1i,,7'm'. -f 7 'ztiiiiiiifflw ...... if ..... ,M......,,,,.l,,f..u ,,,, P:-fqj. mir...-13 ff, ' l l 5 f f K f- My ,,,,,,,,, fe. we M 'g1f'1 y 411111 V' f 'fG s K if'-Q, 5 -if . X M c,....,-...gm.n: v -fer.. ff QC 1 1 H L 1 J Diff 1, Cz- --- J K A ' , ' if J 'W!x.,.,.fc5' ,f is ref:-J fl J V fu ' . VM ff' 'ff' 4? s ,vita s..i,,,,'- Kg? fx. ,f L,,w-.M M' M ,-tying J, ,swf J, J fav e,-Y, ,,.. a z:4a1,..1z:::u.pr:.:xgL,.,.11-Z5 -4Linn.!,s-.:.m.f-se - ' :,,.c..4 duplicate. And now it was my turn. Accordingly I inserted my money and my precious head. VVhile the mere reality of this machine was astonishing, the completeness with which the atmosphere of a tonsorial parlor was carried out was amazing. A phonographic attachment supplied by Clarence Kuhlman kept up a lively line of comment on sport, politics and local gossip. Clouds of tobacco smoke and a shuffling noise to represent a clog dance were the contribution of 3.0-4 51:4 1 .,,..... 1 . 1 1 ,...-,, 1 , ........ , , 5 ..,.... , I r' -' 1 1 ! is ' i , .....,, , , N5 , g 2 ..., 5 4. ....... 4 , 311:75 5 511:12 i ,....,, I, f ..... ,.,,.,,,,j 1 1 ,M ,,,, 3 f 1 V ,.... s ,s...n, i ...Wi 1 L ........ 4 1 L ...--- --ig 1 L 4 Henry Nlellman's genius. But all good things have an end, and a final snap of the lron Barber announced that I was as presentable as soap and water and razor blades could make me. Our next visit was to Bill Elmer's Elite Clothing Store, where we were fitted, as Orville Cook, the clerk, modestly informed us, with the superlative of the tailorfs artf' 5 We were now ready to pursue our quest in earnest. After much argument, we decided to visit the west, where men are men, and vote for lady governors. A Suiting the action to the word, Doo, hailed a passing cab. After a series of breath-taking skids, Gene Farrell, the driver, landed us at the Union Station, not the dingy structure of '25, but an imposing pile of brick and terra cotta, the last- ing monument to the untiring efforts of Arthur Sweet, Golden Rule hdayor of Toledo. Upon entering, we found an excited crowd around the ticket window. A huge Sign, 'fBUs1NEss SUSPENDED PENDING THE SETTLEMENT OF 513 STRIKE,', explained the cause of the disturbance. 5 From an excited bystander we learned that Arthur Krogle, president of the Engineers, Union, had declared a walkout because the Company had refused to grant free transportation to engineers, wives. Wihat to do? Here we were with a contract to visit more than two hundred persons, and the railroads were tied up indefinitely! We wandered aimlessly out onto the street. At Knapp and Broadway, the inviting click of ivory on ivory that issued from Glen Cole's Billiard Academy had a magnetic effect on our steps. WVe entered to find a fair- sized group of tired business men,,' seeking recreation in playing billiards. Ervin Haines and Ray Thompson, ofthe Consolidated Goulosh-Buckle Companyf and Gerald Stienecker and hlalcom VVebb, well-known for their activities on the stock exchange, were engaged in a spirited game. The staid restraint of business hours had fallen from them like a cloak, they were enjoying their sport with the M enthusiasm of schoolboys. s' ffi- f,,ryV,,f,.,i 112 A V. ..,,, , ,,,,., - .,,,. , .,,,. - ..,.,,:, . Q ff' t'f::,,,Z3gfxczfjiZ1f!ffjgiy lyggg ..', .-a-. .,...,,,,,,,,.,,,, 1 --'. -f 'rVr- ,,ff-f fff f,.-1f r -f ...... , ..,.... ig , ..... . 1 Z z---M ve 1 2 1 ' 4 ..,...a,4 , 5 5 '-Q35 ., , ,.., ,l 're-. Q , f , ,... . V f' f ln 1 M, y , '. 2 ...V ' ., ,,,, ,,,,, , 4 -f . . 2 f A f. ng f 2 4 U , ff' f ' -..,,f , X ff ,f 5 ,V Mx t,,.f ---'X ff. Wm 27, , ,fi ,441 5 . Z f . ,ffffw f' W H 0 'f ' X ,f ' ,f . ,W- ' ' f if ,..., f'X .,fz ff? 'X qfi-' ' f f f MM hazmat -4 ..,, :pam ..,, wi But even this entertaining scene failed to hold our attention long. lVe gazed anxiously about, unable to forget our recent misfortune. Suddenly Doc's listless attitude vanished, as his eyes lighted upon a calendar bearing the words, 'SCOMPLIMENTS OF THE AERO CO. OF AlXfIERlCA.7' Allan gloated DOc.'i UVVC can fly to our classmates! The gloom of our late disappointment was entirely dispelled. VVe would spend the remainder of the day in celebrating our good fortune, and on the morrow we would purchase a SKY COOTIE, the speedy little plane that had made Helen Margaret Brown the Henry Ford ofthe areoplane industry. Securing a copy of the evening paper, we perused Helen Powell's page con- taining the attractions at the various theaters. At Helen Ewingis Lyceum, a melodrama featuring Fadwa Farran and Russel Tschappat headed the bill. At the GOLDEN LEMON, manager Eddie Wellsby had secured the renowned Anne Herman, Genevieve Adkins, Elsie Dwiggans, Nellie Moore and Hazel Murphy-bathing beauties. At the municipal auditorium, Doris Snoveris piano recital was offered as a treat to music lovers. VVe were at a loss where to go, until our eyes fell upon the glaring announcement that Frank Zahrly and Dorothy Torgler would give an exhibition of the Argentine Tango at eight o'clock at hflary Perry's Blue Moonv dancing academy. Eight oiclock found us occupying front seats at the academy. Presently the couple appeared, to the haunting strains of a Spanish melody. Backward and forward before an audience that gazed in rapt admiration, they swayed in that most graceful of dances, Le Tango Argentina. ' After the entertainment we stopped at Helen Ardner's fashionable Jack O'Lantern tea house. The lovely Japanese garden room in which we were seated, had been decorated by lylargery Best, an artist of ability, and the fra- grance from smoldering urns of Florence Perry's genuine Japanese incense, made it seem as if a bit of the flowery kingdom had been set down on St. Clair Street. Vile were loath to leave this fairy spot, but the knowledge that we must complete our arrangements early in the morning finally influenced us to depart. A few minutes' walk brought us to the Hotel Bolton, where, after spending several minutes in pleasant conversation with Sarah, we retired. E igfh fy ..,, ...,, ,,,, f X 77 fn. ff ff , I ' 1 W. wg. , '4 , f V va' ,112 -gm. fn: 'f'v- if - h , .igfifa qyv h ,,..,4 . f ,M illlfllg Y ..,,... 3 Y . -1 ,, ...... , -f-- 4 -ai 4 ,... ,,..N..z 4 y 2 4 , ..,.,,. ., , ,.., M, 1 4 A-4 ,. 5 1 2 1 i 5 5 f 4 5 E Z i Z 1 E 2 Z 2 Z I 1 ,pf ,,,.. gn, yyll V Mfwv EW? X -... f ,,,f,, 1 f 1 , 1 ,, W 1 f ! Bright and early the next morning we were at the Aero Company's salesroom. Here We received a signal honor, for Vivienne Brentlinger, vice-president of the , company, insisted on serving us personally. In the wareroom she halted us before 5 a natty looking 'plane painted bright purple. iiiifiv 1 This little Sky Cootie model, she explained, is just what you gentlemen 4 want. Needless to say, we bought it, and, under the competent coaching of Lois Calkins, the company's professional instructor, we soon learned to manipulate T the PURPLE HURRICANE, as we fondly named our craft. We took on a supply of gas and oil at Ivfargery Branswell's filling station, and, our lives fully insured with the Hilda Frey Casualty Co., we hopped off for Chicago. The iiiiiiiti, HURRICANE fairly ate up space. VVithin two hours, the outskirts of the iiiii ii 'WVindy City came into view. Creta Drury's amusement park afforded an ideal landing place. Although the park was closed for the winter, it was the scene of bustling activity. The , '::: : roar of unmuffied motors proceeded from a high-walled, circular structure bearing the banner: GERTRUDE Bnnvrs MoToRDoME. We mounted a fiight of stairs to gaze down into the huge amphi-theater. The performers were ' attempting to better, if possible, their breath-taking feats of the 'past season. Virginia Dyer, crouched behind the wheel of a racing Ford, was circling the per- pendicular wall. Directly behind her followed Genevieve Hagerty, driving a careening Maxwell with one hand, the other being occupied in removing a real or fancied shine from her nose. Shades of Steve Brody! Had these women no fear? Directly across the street stood the great barnlike structure that housed Irene Dickinson's CONGRESS OF DAREDEVILS. Into this we entered, wondering whether it were possible for greater feats of daring than we had just ' witnessed, to be performed. It was! In an iron-barred cage stood Frances Dimke, holding three man-eating tigers at bay, unarmed save for the power of her eyes. The poor tigers didn't have a chance! A rehearsal of DOYLE 85 xiii DOYLE,acrobats extraordinary, was being staged at the other end of the build- ,....,,, , ing. Far up among the rafters, as their trapeze swung in ever-widening arcs, Beatrice and Irene tossed the pink-clad lvfae Siedell back and forth, with the ease born of long practice. And last, but by no means least, was the Evelyn mmrryr f,2, If we 1 . L., ...,. ,,,.,,.,.. . . W ,... or ..,.,. 1. - ..,.,.. C I -'i' ' C1 f H .,.. t ' aff Hz 3''f''::f123,MvW,a,,',..v',, .... a,,,Mw.gmW,,,,,,w- W-..0,,., 'rf 'TfLIfi.,m.,,,,m f,,32Qfff1ffL. 'vt '-- . .fg:.., new-f-- 1 V. x 5 2 1 ...M f . 2 ' 1 J 5 .,,..,., 1 2 2 Z 4 f H ffwffw M... ,..,....., yr ,,z'i3r 3 We .,,,.., ,,,, M, if V , 3 ..,f Mft .,,,,, I my I! M -,,.,., .g,,,1C.,'--J 'VN f a . .i 3:1113 giitiiig fi? Reed and Hulda RITZIHZII high-diving team. These intrepid ladies were diving ' from the top of a lofty sixty-foot ladder with remarkable grace and poise. Lack , I of time finally caused us to leave this group of daring souls, and we sauntered , down the street in search of new adventure. , Y Presently we passed a neat little office, on the door of which was a sign: DOCTOR DOROTHY BATCHELOR. We stepped in a minute to see the V3 doctor, who welcomed us cordially. VVhen she learned of our mode of travel, ,ggfgfiggg she insisted that we take with us a package of the famous VV 8: 'W cough drops iijjlilg i as a protection against the cold breezes of the upper air. The tablets, she ex- plained, were the product of the VVertz brothers, who now rivaled, both in facial . . . . WU! adornment and 1n the quality of their product, the heretofore unrivaled SNTITH BROS. We departed, thanking Dorothy for her interest in our welfare, and turned our steps toward our 'plane. i W'e boarded the ship, and were soon winging our way to Dallas, Texas, where we expected to arrive for a late supper. All went well until we were within sight of the city. Then things began to happen. The sky became over- cast, the wind arose to a howling gale. To follow a fixed course was impossible, , , 211111215 so we gave ourselves up to the fury of the storm. When the wind had finally abated, we found ourselves above a wilderness of sand. What better to do than .,... 2 , , g ,,,,,., Ji land, and ascertain our whereabouts? Our arrival on terra firma was greeted by the whine of a bullet fired from the protection of a clump of rocks. As we were unarmed, our only hope lay in establishing friendly relations with our as- sailant. Doc raised a more or less white handkerchief, and waved it frantically. After deliberating for what seemed an age to us, our bandit came cautiously forward. , , ,,....,,, 3 . . . airs 2 Are there any women in that?', he asked, pointing to the plane. 33111172 l giziiig 5 Harry Wheeler! Doc and I interrupted in the same breath. Q ,.-..t Harry apologized for his hasty shot. ,,..,.., T thought you were some more of those 'movie' actresses,', he explained, iiiiiii a steely glitter in his eye. Those women bother me to distraction! But come f over to my cabin,', he urged. You must be hungry and tired. 1 We ate heartily, and gathered around the flre to listen to the strange tale that Harry had to tell. Six years before he had been the idol of Hollywood, and f Eiylzly-Iwo , lllllll . ......,. i, Q -iiiia'- Wm... .,.. ...,,................,,,,,,, .......1......a. V N,,, . .... H ., i 't -- ' .,,.. - V ..,.. V 'Z 5,271 V '. fffffffff ,...,....,.. N, iii Q , f 3 KVQ ,Q f .c X ,Z J, wwf.: ' . milf!-gi 2--J Y., . ' M- M fs. . . - - -' ----N' R, - . . F ' 'N-X Nw uk . : N-s I liil mxgfxia fu if X N! ff 77 I V r'-'F f 7' f A. W... if I , I U ,ig V' -. ,wg,,,,? '1 if- LJ . W .. ,QA ,.. m,1'x.fwff U: fe-f-'sf+'1V P ,J -XMIX-M fin .. , , , ,,,, ,, r ,V f , , 9 -, - - 4-Lmu.wfz:.aw:u.,nemurzuaw.:c.1Laxe,ae:.aL4.-zg-g.L:v.w:.-x:r 4f:.mtt.:::4,.x,.41:.5s.-M--, : ..-:wmyv---an-3-.11--Mrf-1,4-----..w.,J:,..,.--... ,-,.--W... z:-w-- 2- M, k,,,,A,,A, with his partners, Fred Seigur and Erwin lihrsam, had held a controlling interest in the GOOFCRAFT FILNI CO. But the leech-like attentions of the ladies had consumed his fortune. It was all very sad, a nice boy like Harry out in the desert that way, but facts were facts, unfortunately. Leaving the hermit to his own devices, we went out the next morning, on a tour of inspection. On our return to the cabin, we found visitors there. Big Ben hlinder, and his deputies, Hank Byrne, Piute', Crouse and Texas Dickl' Dyer were urging Harry to attend a celebration on the morrow, in the neigh- 59... f ,N...., Y v'--- N1 --fl w---4 l 'N 1 Z '4L'2 5 ,,.. i .,..... I 'f--'-- -5 ' 5 E , ,.,..,. 4 ..... ...g 5 , ......, 1 2 ff-ff'f ,',--- NH Q ' 12 ? -- -if r--Mi 52211112 Q , ....., ., , 1 ---- ei z ' r .Z i ,...,....4 4 f 1 boring town of Pistolville. Two-Gun Bob Tewksbury, Pistolville's new mayor, had declared the holiday in honor of the fall round-up, and had requested that everyone in the surrounding country be invited. Their pleading finally won Harry over, and We accompanied the deputation to Pistolvillel Wwe cantered down the townls one street, and registered at the Traveler,s Restf' Ray Lewis and Fred Mueller, proprietors. From our vantage point on the veranda, we watched the pleasure-seekers pour by in a steady stream. Long Hank Steele, mounted on a horse that had seen better days, shambled up to the hotel and dismounted. His dust-covered clothing bore evidence of a long, tire- some trip. We learned afterward that he was employed at Joe iVIcGoldrick's ' BAR 5 ranch, twenty miles away. Other clouds of dust proclaimed the arrival of other hard-riding cowboys. They dashed up to the accompaniment of their f popping six-shooters, .a reckless, hard-bitten crew. Unconsciously we shrank back to the inner side of the porch. Presently Art Geoffrion galloped by. giizzzzg l i Poison Art, that's mein he bawled, throwing up a bottle of Orange Crush ' and shattering it with a shot. I can lick my Weight in Wildcats any day. Ed Loudenslager, not to be outdone by Poison Artf' hurled his defiance at the world, enunciating each word with a shot. Pecos Edf, he shouted, that,s my brand, and Sheriffs are my special dietlf' As the sheriff was not in evidence, no offence was taken. The rest of the company dismounted in orderly fashion, not taking into consideration the fact that Ed Hansen perforated three neat holes in the crown of Gentlemanl' Scotty NfcLeod's Sunday hat. l i Iffghfy-111 rw i , ,,,, - ... . .,..... ,.,.......... . c - ...., .ssss c ...... ,,,,,, .. ,,,.....,, - M.. ..,, W l , , ... .. ..., wi .i,' if ,g I ...Q flf,V-1.i'Ii13 fff.fl'553121 zzz- QQ-QQ ,,,. ,Q..lf'fIfff: 'li li' 'fffi2111::11f5f55?f :Ty , N W ' 5 , Y ,,,.,,. 3 f 1 4 , 5 i r . ,ti . 3 . f-. f'- 1 1 4 i 1 f 'S 5 i 5 ...Wi ,.,.,, .4 gm If z fi 5 , 4 1 Z 4 at ,'? f ff,f,, , . . L'M -A ff A M. .,,, , 1 ,,,,, ff vV,,,,,,, , llll X ,255 'V V - Xf... .,.,.. 1 f .,.. -, E, .. ,., So far, we had seen no ladies, but now they began to arrive in large numbers. 5 Anna Dancer led one dashing group. From the crown of her gray sombrero to the soles of her polished riding boots, she was a typical daughter of the west. No less impressive in appearance were her companions, Fernette Bauer, Hazel I Blair, Carolyn Blackford, and Gladys Colbert. Somehow their presence seemed to soften the air of roughness that prevailed. The call to supper stampeded the group on the veranda, and we joined in the general rush to the table. After a well-cooked meal, prepared by T-Bone f Joe Heferle, we sought recreation in Fredric Hansen's Bright Angelv Soda Saloon. In Fredls place a spirit of boisterous good-fellowship prevailed. Well- dressed ranchers rubbed elbows with blanketed Indians, as they stood at the bar drinking the COCA COLA and HIRES' served by the perspiring bartenders, ,,,,,, Ray Helmke and Theophilus Kuhlman. In a far corner of the room, John Hilty and Minerd Henningsen, two bronzed and bearded prospectors, made good-natured comment on a game of OLD INIAID. Ralph Keller, Leslie Leybourn, Arizona Heuerman and Earl De Vine were the other members of the party. The revelry was at its height when the door was thrown open and a determined group of ladies came grandly in. In a trice the happy din was silenced. Their leader wasted no time in stating her mission. 'fThis unseemly carousing must stop! she announced. VVho was this who dared to cross these rough men in such a flagrant manner? Glen Horsman, who stood near us, answered our question by exclaiming fear- fully, BLUE-LAW MARY BARNES, by gum! f am, Then I recognized Mary, and her followers, Louise Hibbs, Dorothy These, Viola Pierce, Charlotte Taylor and Regina Glasco, as the ones who had closed Hank Moser,s place up in Snake County when the boys had become noisy. Fred voiced half-hearted protests, but he knew that he was a beaten man. In a short time the building was in darkness, and the revellers had sought their in lodgings. Doc and I wended our way back to the hotel where we spent a I restless night on hard beds. Early the next morning we arose and, after hearty breakfast of T-Bone Ioe's Hapjacks, we betook ourselves to the field where the rodeo was to be held. The day,s events began with Howard Barron's an- nouncement: The first thing on the program will be a horse race.', Ififflffzf-four ,... .J 5 , -t,...-.... I liill jqgfff '... f ... .... 11'if f all i . .a,,. g SIN if xx IW L ....... ...ii i 1 'E 5 ...,..,. Q f 1 5 - 5 . .... . f Z . Q ,H ..... 4 ,.,M,,, , f , .,..,.. 1 t, .....,. 7 , ,,,.,,. .5 4 ,.,... ,., , ,....... i iifffifif . f ffffffli f , .,, w,'x,,QAg-JJ' X 2.,w,.,ff,,,f,,,J sf. f 'ff' M W.. f', i57 .1 ...-.. The racers assembled at the starting point, receiving instructions from Russel ff Potter, the local undertaker, who was acting in the official capacity of starter. ,313 The barrier was snapped, and eight more or less fleet-footed broncos bounded forth amid the excited cheers of the spectators. John Petcoflvs steed led for the .,....., first quarter-mile, but, under a double handicap of old age and a heavy rider, the exhausted beast collapsed, and had to be assisted from the track. One by I ....,... 1 one the number of racers dwindled. At the half-mile post, the horses of Renton ' Moore and Cloyd Mills collided. Both riders were unseated, the force of the collision hurling them high into the air. A tangled mass of arms and legs, they came to rest in a tub of red lemonade that Grace Brubach was vending to a group of perspiring cowboys. When the three-quarter post was reached, only three contestants remained, who came into the home stretch on even terms. A few seconds later, Lowell Northrup's mount espied a sack of oats in a passing wagon, and lost all interest ,Q in the race. With the goal scant yards away, the two remaining horses ran nose to nose. It was anyoneis race. Just as the coveted chalk-mark loomed under gi the ponies' forefeet, Joe Szemetko,s superior strategy won the race. Seizing his mount by the ears, he pushed with might and main, forcing the beast,s head over the line-a winner by a nosel No conquering hero marching through the streets of a vanquished city could be compared with Joe, as he rode up to receive iiiii the trophy, a handsome copy of HENRY ESMOND, presented by hlartha 1 Schafer, the village school ma'am. The festivities were concluded with a splendid Q ,.,.,, ., speech by Isabelle Pfeffer of the local Women Voters' League. Q '-'f-fff Q We galloped back to Harry's hermit haunts, and took reluctant leave of iii him. Then we climbed into our SKY COOTIE, and steered our course for sunny California. lXIidnight saw us in Los Angeles. Though the hour was late, we found the city a scene of bustling activity. A farewell party in honor of David Pugh and Norman Brenner, wireless wizards, was in progress. Investigation disclosed that on the morrow they would leave for Alaska, to test the effect of extreme cold on their latest invention, an unbreakable rubber detector tube. We inter- viewed the Hwizardsf' with the result that their enthusiastic description of the proposed trip enthralled us. IVe gladly accepted the invitation to join them. The next morning, we disposed of the PURPLE HURRICANE at Finton Langenderfer's second hand store, and joined the party gathered around the Eighty-five I M i'ii If iitt tt't M ' tiittt' it eettt' e M' f ,iff 'i'i'e e .,.wtg:zm,,,, Kiwi., Kg, W? - Q., 1 V f 'e--M -,X '11 fm-. M ' fu 1. Q M f' X- '-M 4' , We all ..,,A.. znwgvg-'f fe ti , , .af W! L ' J ...M A' The-MfL..,! iff , V X fn... M., 17' , jf I I -.X fl f E' fWmiff '!i. Mft 1 -, f ' f jf f.. fv.,,f m .ff if wfm fn 'vi nf W I Vw 1 .,,,, ML.,.mZf.mf1..2f:::.a: ,,,. LZ?-..11-...mmMwa:.fa..::a.wa..waa:ffga..,.wmfmmf,,away.M4ff.v..:w..n..1...a..M....im:'..1..m..afMm,Ewaac:wsaa'?qyz.,v,?: Y ...,,, 2 -ffff 1 giant dirigible that was to carry us to the frozen north. We found to our delight that a number of Former Waiters were to accompany us. Fred Blanchard was going for the avowed purpose of painting the wonderful phenomenon of the Northern Lights. Everybody knew Fredis fine color effects on canvas. Cecil Blank, armed against all hardships with a plentiful supply of salted peanuts, was acting in the capacity of navigator. Two members of the party, Fannie and Hannah Harris, were going with the avowed purpose of satisfying their craving for travel. The crew, consisting of Helen Knapp, Thelda McVay, Marcella Haas and Fern Overmeyer, were all picked airwomen. The preparation of the food for the expedition fell to Esther Hartshorn, and the last, but not the least mem- ber of those necessary in managing the ship was Alvin Widmer, whose duty it was to shift the two-hundred-pound sand bags used in balancing the craft. His experience in high school at distributing magazines to the English VIH classes had been excellent preparation for his task. Amid rousing cheers, the ship took the air without mishap, and the city was soon far behind. As We passed over a sheltered valley we espied The Nfodel City,', founded by a group of literary artists. A fellow voyager explained that in this community Marguerite Soncrant and Mary Kratky, the poets, occupied the same vine-covered cottage. It was here that lyfary Wheeler, the novelist, had written her latest book, How I Get Away With It, depiciting the ex- periences of her varied career, and Kathryn Sutton had compiled a remarkable history of the Polynesians. The place was a veritable writers' paradise! Don McClure handled the finances of the colony. I was told he could count out change faster than in the VVaite High days, and that was going some! Oh yes! And joe Schuller taught them the latest dancing steps, to keep them in touch with the times. The public library in the Model Cityf' was in charge of Margaret Chisholm, although Geraldine Hopkins had an office there, where she acted as critic and adviser to the younger members of the colony. NVe would have enjoyed visiting our friends, but a long journey lay before us, and time was limited. Early the next day we were forced to land in Montreal to make some needed adjustments to the craft. The landing was no sooner effected than we were beset by news-hungry reporters. The first to board us was George Bates, who kindly ,,,, 1 gi ? ,. , . 1 ..... t .,,,... 4 .... .1 ,,...,., , .,,,,,. ima sw-W5 g..W.., ...., . .,..... . 1 ....,., , 222222222 ,...... , ........ 4 ....... .5 t --.----. 4 ....,,.. 5 x LIIIIIII4 ....... 4 j .....,. 4 a ....... 1 5 ........ , Q Q ' i 5 ' , , .... W., g.......A if 5 MMS pa, , ....... , ..... .. Zjffffff 2 3 ........ .,.... aww., s -----.. 4 'f'f ' 4 fm! 522122215 2 9 -.-. N. 5 E 5 - ua. Mi..- W... 21111115 1 .,,..... 4 Q, ..... ifiiziiiii g11:1::1:g ,,,, , ...A t .... ,sg .... j ...... 4 V ..... N., 5 ....... 4 offered to show us the sights of the town, among them Althea Phillips's Palace -H4 of Ice. The place resembled a high-class cabaret, but its beauty eclipsed anything we had ever seen. The floor, of pale pink ice, was divided into two sections, upon Eighty-six ', jiiijifij 5122112 , 1 ..... ' ' . ' 515:55 ' 21 1 ..f .' ,' p- fffff'f' f' 1 ' , 'y Q, i V... '- ' ..... 1:-'rw 14. ' 552 ,a 'Z .. H.- .... f'j,,L, ,, ' f f , ..,.. . ,.... .1 . ...... 111.-1-V. .... .... wif 71253 ' mf-f - if ..,.,... ' 1 j 7 ' 'N ' '--' , .iffv ,Wy all ....4 ,.,.,...,.,. .... -A 'f,f,...... , Viva f- .A Q 5111111112 2 .,,.,.ff if yyyyyff 1 ,,,,,,. Q ...... 1 1 , ,,,.. , ........ f iuffffi 2 '1 zz , fr ,....... , f .., 1 5 t Q .,,,,.,, f ,,,,.,. -'-f 4 z 2 --------- 2 6 3 1 .,,.,,,. 1 5 1 fffi ,,,, , ,,,.,,. .. W 5 ....... 5 I ?,..,f,wi , ..,,,,. , ...... .. 1 ,,,., 2 , ,,,... 1 1 2 ,,..,,. ,,....., , , 1 511111112 1 Y ........ , ,, ...,,,., , 2 31111112 L. ,...,, 2 ,,..... , ,....,.. , ,,.,,,.,, . Z fiffiiii f ,,,,,,.. g , , ,,...... f ' 1 ' Z giiiiiiiig ,,...,, , 5 5 1 x 3 1 S z ., ...,,,, ,, 4 ...,... -2'.?xjl,f., . -1 ,,,,1,,,, , ,..4,, 1 J ' N, '-'..W,..'jgMj...! v. a4anLZEZaaHaLQQnamamZQ?aigmwaaimmanxgaiaaigacflr ,liiifllg , ,,,..,. ,, i the larger of which were tables, where the skaters might dine, if they so desired. ' The remainder of the floor was slightly raised. Upon this stage,', Viola Kaiser and Betty Nlorgan were singing, Why Did I Hit That Guy? , While Venita Johnson and Clara Jump demonstrated Ping Arnold's football liniment. The ' gowns of the ladies, we afterward learned, were designed by Ruth Nfachlup. V'VVV , In the groups at the tables, Canadafs four hundred were well represented. Among them we recognized Helen hffinerva Brown, Nfargaret Hug, Dorothy Nleyer, Lucile W'underly, and lwfargaret Davis. lVfargaret's fingers, we noticed, were running up and down the tablecloth as if she were pounding a typewriter. The girls were accompanied by English bobbies,', in blue uniforms and ridic- ulous derbies. Next we visited Edith Strahley,s Home for Orphans. XVe found Edith sur- rounded by children of every size and description. Of course, she remembered us, and her offer to conduct us on a tour of the institution, we gladly accepted. The playground was in charge of Nfary Breese and Laura Dean. The skill with which the children carried on their games gave ample testimony to the competence of their instructors. In the building itself were the great dormitories, presided over by Clysta Urban and Helen lwfoench, who, we remembered, were two of the best sleepers the VVaite library ever produced. In the culinary regions, Elda Hessman and Letha Schaetzke reigned supreme. The experience gained by at- tending numerous weiner roasts in the old VVaite days was responsible for their efficiency as chefs. The titanic task of keeping the army of children in good health was in the hands of hluriel Sluhan and Ruth Huenefeld. If lwfiss Lickley could only see them now! The executive staff of the institution consisted of Florence VVhitmill and hfildred Thielman, whose duty it was to execute the fowls necessary to satisfy the appetites of the hungry kiddies At last we returned reluctantly to the dirigible, where we found the rest of our party impatient to resume the journey. After a short delay occasioned by Doris Price, who attempted to sell us policies bearing the title, Julia Palmer's Travelers' Protective Association, the flight was resumed. Soon the barren valleys and snow-capped mountains of Alaska came into view. For several hours we cruised about, seeking a suitable landing place. At last we sighted the large, open fields where countless herds of reindeer, 311111116 2 j, ..,,,., 4 i , ,,,.. f E 1 ..,.,,. 5 ' i f i 2 5 l . 2 -'1Q1fl',L' 2 2 ---f-f-- 4 . , ..,,,.. 4, 4 2 , , I , M .,.. N. . ,, fff -- is E we 5 211111115 gfififfjg I , ,..,,,,, infffffff . ,,,,,,,. , i l . 2, 5 ,,...,,. J 1 ..,..... 91111132 2 2 ....,..,. , g as ,M ,,,, 2 ......, 1, 5 ...,, , ...,,,,,, . e..,t,,! i g ,....... g , ....... .,..,.., 5111113 'f 5 iii wi 5211313 C f-mf A ZIIIIIII3 3 4:11115 1 t ,,,... 4 5 5 ff---tff f 2 re owned by Kenneth Pope, the reindeer king, fled wildly at our landing. A few 1 1 Eiyltfy-.s'rf:'arL f , ,,,,,, ,,,,, , .. , M, , ,, .... ,, ..... , .... .. . -M .,,,, .,. .....,, , , ,.,,,,,,,,,j, 7.f2 V . . ,..,. ji?'111fE'f ff1,,,-,af1ff11:fiiii7'' 1. fffaff Hanaaavqu--aaiaagfeaaaxfagwwifaff tfafaaaa Cf ,V f---'-- . H ,M ..,. , -, ,,ff, - V-1-fu., 4 5 if 1 wif - 235-,gfi . WI, A 1,,j.f1' -' ' J---fjjff f.'.5,' if 1 -- ...,.. ,,..,, 1 :rg f V f pg - Wzgigfifwffzf, f , wi1h7 Rf. 5 ----- 'ff d'X't 'f'1a. QQ X- x., 1 ff' 1 , Cu.. .,., .M.,Za.a:Z-gi . ...X,s'.t,. M3 f' h li X .Ma M XJ M! up! kb-N .,., gQ,,ji'fcf-f-'j WT' ,M i. . - M , ?yf'ff',C2 f 1. ,. ,, 2 2 f If f f 1' ..,, , ff' .nf f 'fif -. fm f' ' ,.,, f'N.,4'1..vf : ,,Jff f '-ft'-f' '42 ff ' ,Y ef if WM: fwfa afgawnm xv ,,.. ihcg:fzf.::ff.Qff ...., ,i1.LM...2wma:M.i:M,a1e2map.,,uu1:m,Mme.-' gL 4 hundred yards away stood the ranch buildings. VVe approached and entered the nearest one. There we found Ruth Mueller, Mildred King, and Florence Heider, the Deergirls,', in charge of the herds. After a pleasant half-hour spent in discussing things in general, we bent our steps toward the ranch house. Numerous teams of dogs parked in front of the place advertised the fact that Kenneth was playing the host. ln the parlor a gay company was assembled. Magdalena Bury, Marguerite Dunkle and Lillian Elsperman, dressed in the natty uniform of the famous police who always get their man, sat before the huge open fire, perusing a three-months-old copy of The Deadly Marksmanf' Seated comfortably on a fur-covered couch in another part of the room, Bo Ritter and Lorain Miller were heatedly discussing the relative merits of their dog teams, and the high price of showshoes. In the library, Harold Farling and John Lehr amused themselves by throw- ing paper wads at a statue of Etherige Irwin, world-famous chemist. They desisted at our approach, and engaged us in conversation. Through them we learned the cause of the gathering. According to the wishes of Ralph Snyder, a prospector who had struck it rich,,' a refuge was to be established for snow- blind moose, and the old classmates we had been seeing composed the committee in charge of the work. They were awaiting the arrival of Esther Hoover and Dorothy Morse, who were to report on a suitable place for the Moosery. Presently they arrived, amid the cheers of the entire company. The meet- ing came to order, and discussion became so heated that it was decided that the entire committee should visit the proposed site of the new moose park. After Dorothy Cole, Anna Foust, Virginia Everett, and Maude Cordery, the drivers, had forced their snarling, ill-tempered charges into some semblence of order, the start was made. Anna Foust, the driver of our sled, explained points of interest along the way. That show house over there is the bobber shop conducted by lhlarjorie Barnswell and hflyldred Faulknern she said. They have made a fortune by introducing bobbed hair among the Esquimaux. You see,,' she added, they make a double proflt, for the men wear their hair bobbed, too. As we passed a house constructed entirely of ice, Anna remarked casually, lVIyldred Bitter lives there. At our request, the sled was stopped, While we E igfh ly-eiylft . ,,,.,. 4 ,... , .3 , ....... 1. f--Us 11, , ....... 4 , .... -.4 aw., Q ...,,,, 3 4 .....,, . ,N ..,... , y,,...,4 4 ,WM f W.. , ,,,, , .1 ,.,...f.4 r ......, k , ....,,, 2 , ....,.. f M5 , ..,,,, 5 ,,,.u...1 , 5 g.......i .....f., 2 , ,.,. W1 ,MW f.,..M.i ami , .,...... 4 r ------ --4 r ..... ,MM .Wg Ii YM... .,,, ,.M,,.Ma ..... . ,,.. . , 1 ,mf-ffiiiiif 7fff ,, f 1 'V rx L 'ff' M ,, U ,,..,,.., Q' '- A A A X .,,.. 1 ' ia. -J ..... ' v'-- ' '- ' WWW 'f 7fgy' ,,mm-..fWfW3,,,,,,mwMfm:1fawq- ,,,.. ' 'E mga., ,,,, x ff---way---W.,-.W ..,', , ,m,.,..u...,...M,a. -fiffffffff kwa f ff- 1 0. .. .,,.. ,M I , 1 ,mf fill? , ..... M., , .....,.. 5 5' L ? Y ,mi ? Tri 3 L.. 2 l,,W..s, fwwf ? ,,,,,,, , smug , ,,...,, . ffff 5 , ,,,.,... , . 4 Z 4 ' ...,,,,, gs ..,,.,, Q 1, ., ...N ,.,, : 5 2111111112 I -i f 1 y,.,u..a r ff frrtf sa ffT '2f'Tl? . aaaa f r karaee r ,X 5 dashed in for a hasty chat. lXfIyldred was pretty well, we learned, despite the fact that countless aches and pains still beset her. 'M --ff 4 By the time we had finished our tour of inspection, darkness had fallen, and we did not get aboard the sky cruiser again until a late hour. But there was 1 no hurry, as Dave and Norman wished to remain to continue theirinvestigations. During the days that followed, we saw only occasional travelers, among whom were Margaret Heyman, Kathleen King, Lillian Henry and Alberta Nfetzger, who were engaged in selling electric fans to the Esquimaux. At length the monotonous whiteness of the country irked our restless spirits, and we gladly accepted the offer of Harry Maza, owner of the fastest team of Huskies in the territory, to transport us to Nome, the outpost of civilization. VVe willingly paid the exorbitant fee he demanded and, bidding our companions farewell, we set out on the home trail. Stopping at a small French village for supplies, we 1 were greatly handicapped in making our wants understood, until Annabel I Speaks, who was in the village, studying the customs of the people, as a help in , VVVI M preparing a new Text of the French Language, kindly acted as our interpreter. iam? At last we reached Nome. How good real brick buildings looked! How pleasant the hour we spent in Bessie Molnar's movie theater! The news weekly that was flashed on the screen vividly pictured the important happenings of the week. An intimate view of Eugene Field, secretary of state, welcoming lNIer- ' cedith Schroder, Nlildred Hook, Claire Schofield, and Ruth W'oyame, newly- 211111, elected congresswomen, drew thunderous applause from Doc and me. The scene depicting Agnes Rosie and Ella Jane Kirby and Margaret Sutter, marching at the head of ten thousand W. C. T. U. members in a monster demonstration at Hoboken, N. was impressive, to say the least. The weekly was followed by 1:1 a comedy, starring Christian Thomson and Hilmar Kreuger in Scrambled TT' Studiesf' VVe enjoyed the performance immensely, and though it momentarily fini dimmed our impatience to get back to the home town, our first visit on emerg- ing from the theater was to the ticket office where we purchased pasteboards for Eiffif Toledo, from the agent, Ruth Pilzecker. , The train, in charge of Conductor Gerald Rudolph, crept slowly up the Pacific slope, and thundered across the wide plains of Kansas. As we sped by the hamlet of Slowville, we caught a fleeting glance of Clyde Scheanwald, who fills the position of station agent, baggage master, and porter. 7535 Eightyrmue .,,.,,.,. Q M - .gy .,.,, -yyy Eg ..,. . .ff aauu aaa?5ew?Qaeweaaaa4W?fafQ3QLwe r 't X llfhx ,,.' ,e,,, 1 lvi 5 ,.,., QQ, .ga 5 , ,ffffcwfw-a ..:n-KL..-fgww --jg. A V W gm - ,., 'N-aaa.-1-si-59,454 .... , .,... 'A ,.,, ,,.,,.s.. am-'H 'f ,fx i 14 ':g!51f,,, 1 .. .,.., , fMm 'x -- 'A-'- - ,Irs ,...,. M f sf M--ws 1' ,ff , We ?111,-.,.:xa5MCy 'J fe ii ,fx M sf Wfhwkli MQ! iw NAM, .f K-Jj j V' ' :Z -uf' ,M ffl? I In J.:,,,,,fa:,,V,,fj.,.,,Wx Kim V,,, X x , .W A., A f,W,,,hJ., yt, W fm www! ,,., .A., We found Kansas City in the throes of a great reform movement. Having won in their crusade against the use of Bandoline and Staycomb, Helen Tanner, A Helen Snover, Edna Beers and Gertrude Dahlmeyer, of the city council, were conducting a city-wide crusade againt the use of chewing gum. Forty miles east i 5 of the city, Doc', and I, who had crawled beneath a seat to escape the ure- lillifilll formers, emerged from our refuge and prepared to enjoy the remainder of our '- 4.1112 2133332 journey in peace. Our respite was short-lived, however, for Howard Moultoii 5333335 L -..,,... Z E 2 5 ..,,..,. 1 f --- f 9 ...,, ag 1 ff f f 2 and his family of noisy children entered, after which all thoughts of rest were f,V.- 1 ...... .... .1 5 .,...,. 1 z IVI'- ' 2 I ,...,. , Q ------.' 1 ended. Matters were not improved by the fact that Lillian Lavender and Coral 51111312 -- 5 , , ,,,,.,,, , 5131 Dannenberger kept up, until far into the night, a discussion on the terms of their k-Nf' t ,..,.,, 4 3 .,,,,r .5 contracts with a well-known professionsl basketball team. Events reached a W4 g .,.,. W, few? , . ,.....,,4 jaw? crisis, when, early the next morning, Marguerite Lupton and Dorothy Romstadt, 1 U . i ,gifffg two drummers selllng toys and notions, boarded the train, and started demon- Wifi? ljfifffff ,Wg strating their wares to Howard's noisy brood of youngsters. The din was mad- 5:5553 i 2 dening, so that when the train stopped for water at West Toledo, Doc and I 5333153 J , ....,., 16 Q .....,.. 5 r ' ...... f leaped out, and finished the journey on foot. We couldn't help hoping that iiii' Lynn would find the account of our journey as thoroughly satisfying as the ex- , periences we had had in compiling it. ja. ..... -famef MCGu17f .. .... .4 1 ------ as .,,..... 5 1 j ......,, 3.,....4 rf. .,... iufffffff ..... .2 ff'---we Z .,.,.. .5 I yliiil illllff ?'N 't 3 1 ,..,.....4 ififfg t 2 g,..,.j ..,,,., 5 2 W t ,..,.., .4 f ---f' 53 .... 4 Y' ' . 5 ........ 4 F '4 Q ,.,,,.,, Wg 2111125 i-if . I ,.,,s..3 ---'f liziiiiiig 5 ---'f- 4 , ,uvul H, Y ,,....., , 5 ,,,,,,,, , ...,,., , '--- 151:13 ? -'--- 4 ..., mg j ......., 3 ,..., ,il 5 , .,,,. , ..4 , ....,,.. , , ir V,,VV 1, ....,.., hz .,,,. 5 - 'S 5 4 f X l f E 5 r 5 4 5 5 l 5 5 fVV ' , M , ...,,., f g,....,g ' Q --..v--, 4 . .. .,.,. 2 g ..., 5 2 4 ....... 2 Y , z y Z ,X :nifty 9 2 3 331331113 4 .... ...1 '-'--f' ' E ,,c,.W,,..,,,,..M,,, ..... ...,, ..,. WM... ..,,,,. .W W,,,,m ., , , ..... .. , ,,,. . i V ,. , . ...,,,,, ,.,.,,, W, X H, ,, r,,.,Mf ,fazaff fy -,'ff,,,w W? f2,,,,.?w - 1 We uf' , V- ,,f- T J G . 4 'f12.'f 'f V V ' f',,,,M,,,,W1m'fMz1i . A X .... . , ,.,...,,,, ,A .,... ,, ......, wgjijwi , aww, . A ,.wz,'affg cz ,,,, .. gg -4 . 'IVV .f.-Qfw .,.. ,lg '-fv - ttyyv W. ..,, , .,,, ,5111g:fZl1j5.,,,,.,L.,,T ' Wt '12-.1 ,, ,Q-.X r,4fg:il4fXf4t:,, 4 1 2 2 , , R N . fa ,,,., .,,,..., W., aa? 2. 11- N ,f -' '--sf' mc, xg f 'Y-A? 'va A,,,4,, V .3 ff QQ I ,X-at .1 gj'x..,,,Q In ' J ..,, Q I ......,., ,lj if ,J YLWY ?fZ 3 W i V- 'V ' 4' ,, 1 as liv- ftsf' fi ,fu--f WW ,,.. , V '- ..... ,ig ftifiiii l Q g fiiffi ' 'XE ,, , ,, ,. 112 A -- .. A ...... 4 2 X' T? 12 J A . 2 --' g +.' ity, ' 7, .-is Y ' .1 g ei-,, 5 x: Ar 4 .' ef : ,,' .,.,.... gg ,A i J 1 5 ' M 31:12 Q 41 -.1 'Ir - . 1 .,,,,,,. Z gi f'5iffif.5l?!'!? ' V' iN-j L 'iw 51 'MFA WWI iiitiii 'Surf Q5 ., 117,55 ,.f K 4 J, '- . ' - .'- 1 a J 5, - ' eg -- 4 if w U 4, ,gn I . ,- W , W f jffpff ,, W. , . ., W, 3 Q f ..,.-fsf gw .t ,. 1 . ff f1,,,i':4q'ff'7 fffyljg. .. A K ,. .fggpfg t . , ,: Q, ,.,,,,,7g . W- . .1 V- yy ' f 1 'N r aiaiaii 1 ..... .. . I I L ig, ,,,: 5 , 3 ff- . 9152: A s--4 ww- ,ff -1 Q 're ' -n - - -. Ma 2 . ,,.,., 4 , , ,,,,,. M, . ..,... , ....., , Little girls, small boys, all turning with eager faces toward the same un- ..,,,.. . g ....,.,, f K explored source of knowledge-Waite High School. Scarcely realizing the re- 5111115 1 A sponsibility of school life which descends upon the shoulders of all newcomers, but somehow feeling the importance of being even freshmen, we began our mo- zggqgz, y . ,.,,,, Ii g . Y 3 51111133 .i mentous careers. 212215 VVithin a few weeks, as the result of our determined efforts, the helpful hints aww, from upper classmen, and the guidance of Mr. Severance, we were able to go ....., ........ 3 Wm, , .,... 4, through our daily program with only a few mishaps. But alas! What a mistake it was for us to believe we could enjoy a life of ease! No indeed. Our intelligence 1 ...gt must be tested. Eagerly we surged up to the refectory where, pencil poised in Vfflf we -N ,M . I . U ,,,,.,,, 3 I hand, we awaited lvfiss Goodall's fatal NGO! And we went! We told everything ,..,..., 3 1 TM., we knew, and some things we didn't. What if one of us did write that the May- f -f.-f.'. T 5 .,.. ...J 1 flower compact is a vanity case? VVhat if another of our number insisted that the larynx is in the abdomen? VVhat if we imagined that a piccolo is an implement used in farming. VVhen averages had been computed, We proved, beyond a 15 . . . '4 '- aff doubt, that we were bright and shining youngsters. L .....,, 2 iiiiiiiif Then came the day when everything but football was forgotten-our first , ,,,,,,, , Thanksgiving in high school. In the annual battle with Scott, YVaite won by the dizzy score of 42-O. VVhat pride we felt! That was getting off to a good 3 . 1 1 start, much might be expected in the future. , ,,.,,.,, , Christmas vacation came and went like a pleasant thought, and semester ' 1, exams arrived to frighten our newly-gained knowledge away. But we weathered .1 ,zz N ...,,,, , , Anmty-ann J '-f 15 5 ,.,,.... E 5 , ,,,,.,, , , V ' 'S 1 H . ..,.. M ,,,,. ,. ..,, . ,,,, W? ,,,, 7 f f , ff' 1' ,f X ,,,f.ffz7WZ ,,.,.. 1. U , f-- ,-ff ' .fff ,ff ,f ff ,,,, f fff, ' A',,,,,,,,,,,4i::p.iff,,ff' ,,,,,,fQ'! .. , f .,..,.. f Q i. i ,,., ' , '- Ziff f ' ,,..,. , lf. ..,. T. .,., ,,,,.. . ' ' ' ' ' if 1if f , 33, ,. ' ,,,,,,...,3gg5:I5.f'f ' V X JVAAI ,.,, ,,.,.,,, V ., ' A - -fV-,f -f ,,fw:::--. ,.,, , w,555qa4wwfrM::fffm, 4.,. - sq 2 M --f- ....,, ,W ,M ..,.,.... W... A., n'.'4'-- 'f 47. '- 9 ,,,..,, if .13 if 4 7 5 g ,Z ,, E f I 2 Q 1 ' i 5 1 i f 2 2 f i 5 S 1 , ....... , a ,,,,,,,. , 411111112 L .,......, 5 1 . ,, s err t . M ..,f v,u.,,,,!AMj.,,,f 1 - IVVV ...., V 11,1-...f V- f' f the storm valiantly, and managed to garner a goodly share of those elusive ffffii A,s, often heard about and all too rarely seen. We were now a half step further i , on the road to graduation. hir, iffffffffl 3 By this time even the faculty lost their hearts to us. Such obedient children, ' they thought, should have a little recreation, and so the teachers of the fresh- liiiif men English classes planned parties for us in the gymnasium. Did we put them across F Even upperclassmen had to admit gruclgingly that our range of abilities extended from scholastic honors to success at social events. The affairs of the class of ,25 progressed, as freshmen affairs do, while sophomores continued to control our destiny. What! Final exams again? f Surely enough. One vision buoyed us up during this trying ordeal-the picture Q of ourselves in lordly sophomore land. When it had been decided who should enter this coveted territory, we scampered off to our vacations, to recuperate from i the first stage of high school life, and to meditate on our course of action for the i coming year. 2 Vacation days have a way of slipping by in indecent haste-of fairly evapor- ating into the atmosphere. September, with the tinkle of the school bell, called us gently, urgently, and we heeded its summons. This time we came, not as timid children, but as Wise sophomores, willing to torment the infants of '26, as we had been tormented by our predecessors. VVe might as well acknowledge it-we were Hlled with the idea of our own importance. The school? It was composed of ourselves! The idea of our own significance was further increased by the invitations we received to join literary societies, and be identified with the literary activities of VVaite. ,.,, iiitgjii Have we not always believed that physical and mental development go hand in hand? And didnit the girls of our class give a practical demonstration of that belief at the gymnasium exhibit which took the form of Dances of the Nations? Our boys, too, were taking part in athletics. Jerry Stienecker, Donald lXflcClure and Glen Cole, destined to become future football stars, were capably filling their places on the second team. In track work and in basketball our class was equally well represented. xi iifl ry-f trvf, ..... W ,,,,,.,,,,.., . ,.,, ,.,,, . ,......... ml . .... .... .,,. ,. I lld, , , llllii I . if A235 'i'31'g 77C7- f-. ,.. , ,,,, .,,,. . 1, fbi fx M f '- -XX-1 v , ...,... 4 --fs z 2 ,W ,,.. 4 ' 1 1 2 f i s J, 2 W4 2 ..,..,.. 2 5 5 ' 4 j f-M. N M ,N,, ,. ,I A .,,,f Ml, W ' ' 4 j C. mA,,. ibfg,1..J M ,,.,1111Zi, ftfiw The coming of September, 1923, brought the opening of Libbey High School glfifii, i and the dividing of our ranks. live assembled, however, in high spirits, and al- though we were reduced in numbers, we had not lost any of that enthusiasm which had always been characteristic of us. Henceforth we should be called by i a new name-upperclassmenl Vlvith this important fact firmly implanted in our minds, we trooped to the auditorium to hold our first classmeeting. lVhen i ballots had been counted, Glen Cole was found to be our leader for the year. VVhat better assurance that the affairs of the class of ,ZS would be ably handled? Our first chance to show offw came when the Seniors presented Rfr. Eugene Kliller in The King's Rivalf' Between the acts, junior girls, charmingly frocked as French maids, offered their trays of candy to eager purchasers in the audience. 'fXVhat a clever ideal everybody said. V, L It was, truly. And profitable, too. Our first venture had achieved us both fame and financial gain. j The big event for every junior class is the Jw Hop. For weeks the corn- mittee in charge of the affair is the busiest group in the school. Frequent con- ferences and hurried trips to town, and last minute ideas are all responsible for the bustle and confusion that precede the night of nights. Though some might accuse us of boasting of our achievements, we must modestly admit that we had one of the best I hops in the history of the school. The Woman's Building was transformed into valentine land, with cupids gayly swinging, and garlands festooned everywhere. Hearts for the fortunate, mittens for the jilted ones, and lively music increased the merriment of the occasion. During the evening, foot- ball letters were awarded, five of our classmates being among the heroes. But February had yet another good time in store for us-the junior mixer. Could anyone, who was fortunate enough to be present, ever forget the rare songs offered by Glen Cole, Lynn Johnston, and john White? VVe always knew johnny could sing, but we had never been so sure about Glen and Lynn. Those vocal selections settled once for all any lingering doubts we might have had. After all this, we settled down for a while to chemistry and Latin, and all the other subjects in a curriculum intended to educate the young. 3 Ni iif, fyrrltw if .... f2 f a...... .... , f fi4W212,M-WW -.,f,.f... W .:.. ' -aff -- f'---- 'f V ' 1011, MQ, -, , i fpfmf., . fjjjj ?3z..i5i...f f , .ix M 2' f 'NX YW 5 ,f , 've QU. .,...... .... fr- .QQ , N, , ......, 4 a , a..N.,,, 7... f E 1 sf v f.z I i ....4 .1 f 5 Q ,.,.,.,. 5, 1 ifffllj 1 li 1Q' 1f f -ff' f M.,1W., , E We , ,,,, .A,,,, rrgwy, , YAA, E ,,,, fff fi' ,M ., A .,, .,.A fa ..,, I5 fncvjg j ,,,. .4 . .... ,,, 5 i Lollypops, lollypops, get your lollypopsln The cries of the junior candy sellers, peddling their sweets up and down the hall, after school, greeted hungry students. This was another device to replenish our treasury, and it worked so well that we tried it several times. ....... fi The last event on thejunior social calendar was the Ohio Vilesleyan Glee Club 5222225 i concert. An auditorium full of Waite students, parents, and teachers enjoyed ,,,,., l the entertaining performance. Later in the evening we danced in the gymnasium which was decorated in the red and black of VVesleyan and the purple and gold of Waite. Successful? Yes, in every sense of the word. 3 VVe weathered the storm of exams once more, and found ourselves launched upon another vacation. 'We were seniors, now. We had to get used to our new dignity. We thought eagerly of the year that was coming. What a year it would have to be, if it was to surpass in achievement anything we had done so far. 11 The senior election is always an interesting event. Since the seniors usually lead in school activities, it is important that their representative be chosen wisely. Lynn Johnston, as president, and a capable group of officers have given .3 the class of '25 ample evidence of its good judgment in selecting them. The fall term was filled with stirring victories on the gridiron, the greatest of which 1 occurred on Thanksgiving day. It was then that the Purple Hurricanev fully demonstrated to any who still were in doubt that it was made of championship stuff. Need we say that the 13 to 6 score was just cause for rejoicing that evening ji ,,,,.,., -f- ' 4 2 2121113 5 , .....,, ,Q 2 ,,......4 ' i 1 2 X 1 Q 2 .ff.'.f' 1' Y . . . . i A'ffff-- s ' at the Varsity dance, given by the Seniors ln honor of the team? A huge football Q12 bearing the morningls score, purple and gold festoons, and a good orchestra all combined to furnish a perfect ending to a perfect day. 5.21.5 Christmas was upon us before we Were aware of it, bringing the annual 4' senior party to relieve the tension of study. On the evening of December 20, iiiiiiiil 5111113 1 we gathered in the gymnasium, which had been decorated in true holiday style with large Christmas trees, on which gleamed hundreds of colored lights. We were more than delighted to have Santa Claus, in the person of John White, visit us at this happy time, bringing the emblem of our class-the Senior rings. f 7 How we enjoy them+when we donlt leave them on the washstand, at home, and worry for fear mother will dispose of them unwittingly in our absence! But what is worth having is surely worth worrying about once in a while. 2 Ninrily-four .-f-.f i i .. ..... .... - ,,,, ..,, . ,,,,,,,,, ..,,,,,, ,. .... . i ,I ,, ,, ...,, .,,..,.. , ,, ,,.,,.,,,, .M ,.,,,,,,.. , , ,,,,. M ..,.,,, .. .,,, N .a0,,, ,,,,,,,,,., , ,,,,,,,.,.,.,.7.,W f f.. A f' .' if , A 'WQWM ,..ff'p9? 11ii'! ,632 ' , 2 .,.. ' 'Ti . ' f...w:1:111 , '.TII'j ' v .2'::1,, r--.. .. ' - 4: ' ' Zi 1if'fi'fffL.,,,.f,li43,3 Wim wp:c:::z::fLf1'W ' 5? 3 f i xl I N . 459. xi . M ff-.fN.a xg 52,6 fi pf-X.,-X fs-XJSTJM ff? ZZ!' fj,' hwy., -mea .1-.A-..f fvffii. fm. jiiifi Next on the 'ear's ro ram came Mr. E. L. Miller and his associate la ers .. 5 P 8 P Y in an excellent production of Hamlet Once more the prince of Denmark Q33-3 held with himself his famous debate: To be or not to beg once more the fair Ophelia grieved to see the observed of all observers quite, quite downgn once more the fiery Laertes avenged his sisteris death, unaware that in so doing he ......--5 .4 was plotting his own downfall. The presentation was given primarily to raise money for the gateway fund, but other benefits were to be derived from the performance besides replenishing the class treasury. As the presentation came just before exams, it provided an excellent opportunity for a review of the play. On Nfarch 6, we sponsored a concert given by the Eurydice Club. An ap- preciative audience enjoyed favorite melodies like Hhiinnetonkan and The End Of A Perfect Dayf' and listened with beating hearts to the fearful VVoofs of The Big Brown Bearf' The program was one of the most delightful that has been heard in the auditorium in many a day. The routine of duties continued for the next few weeks, with numerous meetings of the banquet or prom committees, and with repeated notices which read: Seniors must order their cards and announcements at once. Spring vacation gave us time to catch our breath, after which we entered the last lap of the race with more enthusiasm than ever. It was pleasant to feel that these remaining months of our high school career were ours in a very special way, and that we must get from them the most pleasure and benefit possible, for they would soon be a memory. In some respects, the senior prom is the crowning event of the year. Joyously we made our way to the Womanis Building, in our happiest mood, to dance the hours away to the strains of the Scarlet Masque Orchestra from Ohio State University. If we had been unaware of the beauty of the spring-time, the artistic decorations, lovely favors, and all our friends attired in their Sunday clothes, left no more doubt in our minds about the joy of the season. It was an eventful night, long to be remembered. Only one short week in which to anticipate our next senior festivityl The banquet at Lasalle's on May 16, again brought us together to celebrate the be- .Yinzfty-fire vs fwagizww 2-f-H1 . , ,,,,.. , . if--.,4 . ,mms 1 Q ---- me Q 5. f 5:2 2 ,rf '! il 4 1 ........ y 3 i , Q ,....... -'-' f z ...,.,, 4 is giiiiitg 2 3. ....... .3 5 r'-----2 . V- ---- -4 , .... ...g - Y ..,.... ag ,iiliiiii 2 .., ,.,, , 1 5 -4 ' '5 1 , , , ,,,... , ,,,,.. ag j ?::11i 2 LN ..... 511111113 1 1 S 3 4 Z . -if 5111114 , , ..,..... , , Efillllli Z g.....g ,. .,11.1 , 2:4 i. 7 ge--a . ... . Six? Z iffffffffi 5 5 I5 hill' , ,..,1,1 ..... 3 i 5111111 L , Q 5 ....,,1 5 2 ........ S , ......1 , , girl 5 L -f-.. 2 5 i ' ' s HW., , 1.,1 W, ffl g ..... , 5 . ,11, iiiziig 511111115 2 ......--- 5 ff-- fi f ,. ,.,.. 1 v i , 1,,..... , , , ,...... 4 in -- ri z W ....,,,,. M .x-.....,.M .,,,.,.,.....,.,., ......... .W ........,.... - ...... W ...,,,................... ..,.,,,,,,,, M , W., ,,,. ..M.,..,....,, ,,,,1 W. .11..1,..1111 -,.. ,,,,,,..,, N ,,,,, 7 M ,,,,, M ,,,,,, mm, . . i ,V M,,,,ff ff,,f,f X77 f' , . ,f-fs::.,,ff'i' ., , V1 ,,,- L,f ',,,f If 1 , , .mg .... d ,.. ,,., .,111 , .,.1, 1. , , ...af .f - . f 1' 151113411 W z g,'f wt':zm.' '-1 ,' -a ff ,ggzif- , .. 1.., f f'1.,,,.f 0 , V 1, .1,,.. f pa, .,....1.,..,. ----- ,-vq3,:!2....amw ,,,, ,. ...... ff. 0.551 4,1 .1 N---f ,wwf- f' .,-ff If-Y. wi- ' ..'-1' 2 'Q I Vdwg..,H...Tm,,,..,,,,,.,,.,,-.,.1,,.M....,h,,.,,.,,,,,m....,,,,w-V -- c ---fff....f.W...a......,....Wm.a-,....sm ...1..... W... c.-yy fade--1 ,Q is .Hg , 1 , 'aim , ,qififlirgi ff, ,ph ,fu-A - 5 4 ,Malff-1 ..,...,,, ,,.. I '71 , fe M- N-.. uw R 3 f ...,,. iiiifaipfii'-2 'f-f - ft ii ,,,f Q ...xii l'11 'f+a11111--32 1' Xfif--J V' ,, 1 M.. 11 Zffwfll sri W1 M JL. ,. 7 f ,J .ff yff,.,4i,j'jfMX J ' -f-f I fu f ,,f-, f' --vt ff -1 ,f fa, tx y vf 'a '- ftazuefw W--ww fa..fammJtw.N:gm,iyffeaff:7frmzzZ'g0 gag , ,...... , , iii -'f'f' 3 M ,, ,.,.... , E 1 ...,,., , , f ,,..,. ,, 1 ginning of the end. Wwe heard our doom pronounced in the class prophecy, we recalled past events in the history, and we listened to our class poem with pleasant Q thoughts about these four years of association which had meant so much to us. And the Annuals! How we gossiped about them, and admired them, and leafed 1 .14 2 L12 Q25 the pages over and over! VVhen we happened to think about it, we danced, but -'1 . . , the evening was so full that we couldnit find time for all the things we wanted to do. M, Class day is still before us, filled with anticipation. For us the Greyhound W., ..4 1 shall not make its way to Sugar Island, carrying the members of the class of '25 and their lunches to the annual picnic grounds. But we shall have an opportunity to prove that Sugar Island is not necessary to our happiness, and that lunches 2 If eaten anywhere taste wonderfully good on class day. , Z 14 ---1 The Baccalaureate sermon is yet in store for us. There will be inspiration 1 in knowing that, as a class, we are listening to the words ofa man who has passed this way before us, and is giving us directions for the route. We shall resolve anew to make a success of our lives. And then commencement! The event to which we have looked forward since 1,4 2 1 173 W, -4 ---i .. Z .11 --e 4 A f I HQ z x 1 i 5 5 1 f' we a ,.,,., 5 5 y .... Wg ' ,,.,,. 4 3 ,,.,,.., 1, 2 alll! f Q, ti 51:11, ,V , ..,,,,.. 1 gi L- -----f- i E ...1' 1 , ,.., sz. .,,,,.. Q, 1 1 1 521112 2 our first day at W'aite! On June ll, when we step out on the platform to receive 5 the reward ofthese four years, we shall grasp our diplomas with misgiving, Wonder- ing whether or not we are only dreaming that the prize is in our hands. There will 5, 2 be smiles which are intended to conceal our reluctance at parting, and there will 2:1 be happy wishes for good fortune to many a friend who has meant much to us .2 during high school days. While we look hopefully into the future, we shall feel 14 that, after all, graduation has its disadvantages, since it brings to an end many of the dear associations of our years at Waite. Hy Ruth Lff li 5 .,,,.,.., r ,.,, Ni llr' ly-six AYP: 'VVQV1 . 1 e1'1e r .,,,,1 ., ff'Tff ' 11 'llili f...11f1, 1 r 1 1 ' '1i1 1-' ,1,,1, f ..,,,, !i'i 1 , -H-.1,f4,,, ,. ,,,,. 4 2 N., i 5 s , ...... , f 4 i W if fr-.na M ff f- ' f .W,, ' , 2 i . , VV- M, WM, MM h-VV, M Wa, ' Z-.1 ' ,,, if Y- 'V 1121 ...,. , Q gill? f. + 211111112 2 hly Classmates: Tonight represents the culmination of four years of school life-years of ,E happy association, of individual effort, of valuable experience. W'e have come, 1 slowly, sometimes, but steadily, to the present moment, which should mark an epoch in our career. Old Waite High School has occupied an important place in our thought, and will continue to do so, but regret at leaving is mingled with the VVVVV , , pleasure of anticipating what lies ahead. Q We owe much to our school, to the opportunities we have had, to Mr. Pollock's constant interest in us and our affairs, and to the splendid cooperation QQ of the faculty, who have labored in our behalf. We are unable fully to appreciate, , now, the extent of what has been done for us, but at a more distant day, when experience has taught us further, we shall know how largely we are indebted to our school. 5 , .,.,,,,,, , I ,.,,. , , 11:13 1. ..... N 4 Q. e,,..,..z ' , ,,... mf 1. ..,,,, i .Wai , ,,...... 5 1 1 V ,,.... M31 a. .,,,,, 5 , ..,.,,., ,, Because we have attended Waite, we owe her a solemn obligation-the obligation to do well in what we shall undertake. Whether we embark in business or attend an institution of higher learning, what we do reflects on our school. I Will she be ashamed of us because we have not held her ideals? Will she approve F of us as citizens of a great republic? Will the lessons she has taught enable us ' to keep our feet in a world of changing conditions? 5 5172103 'V These questions deserve thoughtful consideration, for we are determined to i::::::::i i have what everyone seeks-Success. We owe that to the name and honor of A, Wiaite. VVe wish a measure of this World's goods, but most of all we wish the success that is measured in the service we can give to others. , . . . 21113 V VVe have found out, in these years of working together, that cooperation is f , 3 the keynote of accomplishment. Being associated on committees for the welfare of the class has been valuable training for us. Becoming acquainted in the class- 3 room and in a social way has broadened our outlook. Good Fellowshipn has been our motto. Allow me to thank you for the fine spirit you have always had, ffbfffl- 1 and for what you have made it possible for the class of '25 to do. hlay our associations at Waite always recall pleasant memories, and may L ,,,,,, the All-Seeing Power guide and direct us in whatever we shall undertake-that is my earnest wish. -Lynn fohmton, QS. , ..,,,, Ninwly-.vr'l'f'rl ,,.,,,,.,,, ....,,,.... . .... ,,,.,,,,,, , - e .,... 2 , ..,, L W , ..,....,.,..,..,,., ,,,,,, , ,,,, 77, llln, 1 27, ,fin M. J' f f 2 7 ,w L7 11iif ,fK! V V V r r ' 4 f if ,f g,f::f:fLVVf 112Vf ,.,,,,g::iT? v , ' MLC: f V, 2, e' 1 , V gi 1 zc :.g57- ,. , ., - , V ,HUM ,,, 1 V. V ,,,. ,... , ,,,,,,y1 , . ,,r,,,,f. ., V, ..,, VV? V- ., , 1. , H , -1-Lia-4w.,,',1fg ' f' il ,,..1N...::,...:-f , Vfff - - ,.:,:::, 'Vf-:::JZ4 -'sr W L '- -- VV .--- 1 l N151 - - iflffwfte. 'flz 1' TQQI.. W r , eff' , ., ,.,, ...,.., , ,Z. Ha, . M . .V .. . , f' -1' ,wwf -' W 2 '-- 'rf'9- 5, ' ,.....Wf ..., ....,, .Z J'LT f ' f ' -ij 'ZIV , X ,,,, - ,,,,,,.,...,. , .... ., .. ..,. .,, . ,. .K VV w3,L,,. . .fm-f.f.. ,.,,0,,,,,,1m,.wW ww -- 7 -.,,,,,a,,im , . .b'iQifEiff:7fff1 ,ms -J Q, If . -.wc--' 1 m- 'fm V1 ,f f - 1. ,.m..,f ...- 1, W M , X fn , ,cp I L 3 N6 in -I 14 ,.,,., f1,,.,,,.f J ,N , , R ,hw , ,jf , X vu .,,, , ,,,, 21 , .... w5,?,,. ,..,,, , 4 af- , ff 2 Q 1 f 3 v,,. ,, 'Q M V ,,, V my 1,1 ,f ,,,, 1 ' 2 f Z Lf? M'W mf-'-7 f' A - ,,,,, f.,.,,,,,,,1 X ,, 5 fvzj ' fa 7. ,. 4 fxffff , ' , ,A A ,fy 1, .1 4 ,Q f 1 ' ' f' rf ' 2 f' 3 V,-'W V - ' . -ff ff,?zZ1zcf:1-w.wwpewadzw-14-191451-1.-Nw2w..Y,fJf'-V-.ww--'-mpuuaww, LazrJ::.Mmraz.iew4:1tc4xifweaegz. ..., .,,,, ....... MW ..,,.,,, 4 ' i ...... :,,,,.,-J 4 4 1 ,Z , ...4 1117113 51111113 f- f'-' Mi - ....... 4 Y .,,, W 1 Q .,.. , , ....,.., 4 1 ......., 2 i111 ' , ,.,,,... 15:15:53 J 1 7 , ,,..,,, 4 1 4 Ifntrzmcc lu Gymnasium Nfrlrly'-r1glzl M ,,,,,,, . M ,,,,,,,,, N ,,,, ,,,,, .,,,,,., Q W ,W ,,,,,,,,,, ,,,,, , ,,,, , 5,,,Wf,,,M,w0,7,:,W , ff I, . ,,,,-ffffW17f ?w ,ff f r .,..,,.,., wmwgggfwg W K ,' A ,if l f ,f ,,,,f-f ,,-,-jief-1 f 4 , :3,- '4 ' 7 if 1 -'::,,p.. - f f ' 1 ' A -,K ? ' f ..,,,,,, f ..,,., Z 'Q W ' ' ' jjllw' fa ,K ,W,,,, r, yyvwvww, .W ,,,,. f, ,,,,,,,,,w f-'-- H wg lllll Wyyykzzzwgff, ,,., ,,,,,,...., ..fz,,, Wm., f. 1 Y i 5 , ? V ? 'f f i S 5 ..,, ,. r I .,.., .4 ,,.. N :Je Xxl-if - f .4 K N I J 'NN M f ff '13 M 221.3-Qff M MN SX ...J wffkf ' .1 72 ,H fee- fx '43 INN- rfb 1 YA--f A 110' 5 ,N fx,.f'x.n pg Fw' ,j,,,,4,.gqL.,w'- ML I ,- V,-x,, , w.!,.i595,32'? 'L 1d?4.:1 vars.. Q--sl-A-ff--1' ' ' HSA , '--- W- -A - A 17 fig -1- 1' .,, 2 .MM '4 7 ,1 ,,,,,, ? Q 4,,. . aj 2 ..,,,,,, 5 21:1 , 11111113 ,,,, 1 ig 5111117 4-4 A 2112. 1 21121 , .,,,,,,. 1 1 -- f' if 513, f 'ILZQQ 11:11:32 1 , fi 5 .,.... 5 '5, gg ...., 5 1 1111111 ff-1 - 1' ij ...... 2 f - M! 2 f iw .... 1 E 3 2111111112 ? --,---- 5:1113 , ?IIiIiIIQi ff-'nf 3 1 ?11111L1i 973 1 he ,,,,,, ,...., , fffffff 1 1 A -----.'- 5 Q-WZ 1 V ,,,.,,k. , ,,,...' , M--.- 1 . ?,,,f,3 ?N W Z f f--- --4 I 2 311111112 i --- ' 1 2' if 2 ,- ff 'V Z Ziiiif- I 5, EE A V23 i' 1' 5 ,..,.,,, 5 5.1-1 1 ?53?i 51111: , 5 5:11 1 Uh lhmorx 13.1, f W1 Bfyond 161,15 UGUU Hun 3 211111 X - F Q 37 E Q Jhsxdy noch. h?f5f5i'L own ' 112- I 1 , ..,, M, , , QMS LUSH, Qwslwnj fhc-rc. TIS Smxgrahxp. in N 1 Q 5111114 1 V r 1 o f' - ' yn-A 311111113 j X ,,.... ' am 1 0 5 52111111 U 2 fffffl, U. 553 1 212212 aww! 1 g ,,,,.,. gfms 5 , .,,.k 1, ,Z , s g K f W 4 2'f1I1I1I.' fu- 5 ....,.1 5 5 Zlffflff 1 1 i E' ' , ,, fu ff ,,,,, ...1.. M 1-'- ,V , 1 1 T ' 1, 1 ,,f',ff,f!jh. V 5' ff, V .5 5-3:3 ..,, ,,,, A , .,,:L--- 1? ' - 17' 1 I A .1 Yi LJ, I A ,5 ,Jgj Q Q gr! ' W A511124 .1iiE1,'x. .. .,,,. N5 A., Umzxk-WL .,...,. W. ..:::::::::.::::::1:I2f?Qf? ? 1 , . ' .,-- - ---' ' ',,,.,w-,v 1:n Mf 'X ff'-, rv ' 11 --111-:f-551-T-..IIl1gQ1Q '-'- klzfffffffiilii: Q Lf.. .... 'fif-9:14311 ' -, -M V- --' Hmm- ' ' ' M frwlx W - 'S '--+f'- ff- -'fx' ,.. 5 5 ........ i 1 s f ,12 rg! 1 1 ? ,,,,.. ,, 4 . ,,,, ,..4 , ,,,.,. N4 N51 x 5? M4557 .,f - 1 I VQSX3 no W, -2, ff W. K F-. xx A ,W ,,,, ,,....,,,..,..,, 1 . V ,,M, ,, Xu 4' ff f ' 23515 V. 2 .af ', X wx .,.,, .f ktljkhwnj f H 2 .,,,,, guy N ,. SMX ,W , .,,,..W 1 f Ivfv 1 ,,,, OW! ff ,ffm ,f-u f' V3 ..,, ,f 'M.r,, LW.. ? ,fl ff? f ,, ,,..,,, 1 WF! ,V his A fm 'W ,,,, , ,W ,,.. FT., K,,, ,... W M -4--Llww-V M - f -' 2 211' 2 ' 3 1 -M f s 5 5 51111115 21312 1 5 ,,. 5 ,,.,,,, 2 1 211111112 ff .....,.. 1 ' E 1 211111113 2:31114 ,E .,.,,,, 3 f 211111112 1 2 Ziiiiilif A 2111111112 1? A 2 511121, , Q 5 igiiiiii 3 1 gmmg A 31 1 asf rr 5 5211213 5111? al f 31111113 E I 5 ..,,.,.. j i11'Qff11E 5 5 f .,,,.,. 5 21113 1 1,1 .... Z I 1: 1 .,..,,., 2 ,..,,., 1 21111112 iiiiiiiii w Qliiiiilf 3 f ?ffffffff' ei 51111127 A 2 'W---2 rm- 11 i 53112 I 2 YW ' I 117:11 5 ? ....,.. 5 from si e Lmzor C 5155 3 511111111 1 1, ,,,,,1,, 1 .,,,,.. , 1 2 21111122 21:51:13 1 5111115 . , . 5555332 2 2 Frarlklm Whltney-- ffrf Pfffldfnl s 332 5 Dorothy Briggsh 1 ,Vice-Prefidmt , Florence Boycheffn ,SEC7'Efll7'y 1.,, ,,1,, 1 Warren Burwellr 1 1 , 1 1, Treafurer :Z-4 Qiifiiif Burnap Cole , - , ,Sergeant-at-Arm: mi Om: lluvlrlrrul I 511112 U 11, ,.,,,,, M 1, ,,,, ,,1,, 1 ................111.1....1.1. 1 ...... 1 ,... 1311113 A, w,,,,W . A .M fy. A ,,,,, ,f f'Z?gZ,ifff,f H, -11 ,..,, ' 753.1 .,,,,,, .,,. ' ' 'f11'1'f'1'1111f2?Q-A ' 1 -1 3 f 1 K ii 2'5 iff,,W1:.111,,4..i-3, lgfgjfu'1,,,,,W,g11:z1::.,Nffv- Q. 2 - .....,, 1,,, , . ,.,,., ---f ..... ,,.,....,,. ..,. - wif lfzfgig ' img: V- '---f- M gm.: - A 1 5,2 ...,N,,. ...,..,.,,,. X MQ, -,A 2,10 ., . .. .,., V .,., --'-' 11, 1 r VVVV x. W., .,..M,,Wm4,,,,,i,,Q,ffz',?rMMMrf-fwf.f4,,fWM WW .,..,,,W,,,,,MMm ,,,, f f yr hv fiifyf - !,,,..,. M3 fa ,asia I V as 'XV Nam f ' -X H ,f fy V w-. 5 '--- 5 f gil , 1 z . ,,.. . ......, . W- M, ny' ...J ,.,, -. -fff af , H! , ,ff ' W , ..,, an I ,f A f, Hit . ,Xi ,, ., , ,. 7 fzffff' , .1 ,, ,, fa gil f ,- f, f -W! 'jwi ,fu ,f gY,f--W, 17, - ,A ,-twink J, 1 -17,53 . y,f'sM-f JWW1 .,., .... X, - aw-f,,a,fsu,, , V, THE JUNIOR CLASS The transformation of the class of '26 from the genus Sophomorosis to the L genus Junioritis produced a singular change on the actions of most of the members. As is usual with students newly arrived at the status of upper classmen, the sophisticated Juniors soon began to View the queer antics of the Freshmen and Sophomores with a countenance full of haughty indifference. Then, when the day came for choosing their leaders for the year, it dawned on the class that there was serious business at hand. They proceeded to elect a group of oflicers Whom they could entrust with the details of making their Junior year successful. Their selections proved to be Wise ones. Y ,,..... QM ,,,, I ,,., WE rr 4, .....,,, 5 Q---W4 , ,.,.,.,, 5 , ..,,, Wi f ...,,,,, 5 ..,, M f '- ' i .W .,,, 4 121112 4 One lizunlrml One , ,.,.,.. 1, W ,..,,,,,, ,N ,..., , .,,,i ..,,,,,,,,7,w7MmMf57fy ,ff ' ,,f , if ,f ffff ....,. ,riff , I f, 2. , 5 in VW ., dfrgwa, .. 5- - , rv if V , rn ,W f .. fy , ' :YM - 5 ,ma 2' ' rw . 1 , ....., ,, . -f W' , . .,,,,,,, -V I , 'iziifz 25422 2.5, . ' ' f'-' - ':- fi 'fzcwmwfwf-W-ff -,,-,.... V ,,,:m,,,. W,,,,,-44, - A-Q ..,,WAMlv ,,.... , ,,,,, ...,.,. V 4'-Y f ly, .,,, i.,,..c,3 ,,,N,.,.4 , .,,,,, M3 2 m. 'ikffhfffff .. .. sxwwwa. U44 ,,, ..,, is .,,,.. , ..... , 3 M J, .f -..Xxx . A . . M C ..,.. ,Y ZL.x.A--- X -1, ., Q .., 4 5 J ffAf AMQJET 1 -fi, I- .maj C Q .1 1 -1 1. 1. , . '--- f. 2 . -M ..,,,f '-Wah kwin! ..,f iq 'gf ' N-.....,:1...! LJ H-J V fi . WNY M. A ayfdff' .. y. fi. , fx? a 3,55 ,, WI ,Ja V. ,.,, L ff Iii 3, ?,'f'3,,....Z ,P .. A Myywmv fm- ,--.v,q,., ,...m...f 4: g, mf Lab aw fqf,mw.1ffm2mQ42,l1fm,gmwmnm'f.mfg,.m....2,:m3.gZf..f,Z.::.w:ff:..'m:w .... 1 I ....... 1 , . , , 'i ,....., is + , ...,,, a ' 4 .,,,,,, Q ,..W,.1 5 2 .... W5 221373 1 a Under the efficient leadership of Franklin Whitiiey plans were begun for the 'r - jg Z various activities of the year, the first of which was the J-Hop. ii 'i'ii' On February 14, this annual event opened the social season of the school year. The ballroom of the Womanfs Building was skillfully decorated With a Valentine motif. I 1 From VVooster College came a well organized glee club on April 4. After .... their program in the auditorium, the college orchestra played for a dance in the f.ffff.f 1 , ,,......, 1 gym, Where the audience were the guests of the Juniors. .....,... tiiiiiif ,,,,.... 4 1 e- .... . ........ l Z ------ N 3 iz--.ami Q ...... I 31521552 L ..... giiiiiizig 2 y ..,,,,.. 42 , y Y i , a -...---- ......... 4 1 5 , .... W, , ........ gi 21111122 2 One lrumlrfrcl two ........ gi ....., .2 i y ..., ...i Q .. . .... . ,,,,..,,. ,.,. .... ...... , ,W .. . ,. 1132222114 ' X L ' gm W' 5 uw f 1f-- f ' v V, y-A, .65 ii f .vu .,j , 542 -f--f A '. 1 , 5 1 ' ' 55 fr I AAA. V . V. fvxffvf vw J f- re.--:Lz.:w,',,:N ..g ' g,,.v 'I ,, .... ,:.,..... M ,. J' M ,vf 6 f 'f fl ,. . rms ...,,,. i .... ..ffi'ifg12 H ' ff 4 ' ,,Z:ff ', ,am--W Himwuawm .... ...-.4 --fQa:.M.....,...a,,M 'g T,,M,,,,,a,..,c ...... .... ,,,,,W.a ..,.. s 1.. -V 1 V-.N i.'a,giifi5fff,, 'Jw ffifff . ,avi xv , ,... , ., I lu ....... 5 NV'-x I 1 f ,N 'al Q A J f' .' f 1 dj 'V-. W1 ,WX awk , .,..f pc, L41 a ,f f . A ff 2 'fa , N f ' ' V V . , fr- ,, . f f Sf, , X , -,,.Q,.f HK ffm, ff-A, f Ava mm ,V A, ,-.wifx Jw 1' -05 , V7 ,f WW., Q' 'ffffm ,... ,,,,,., 5 I 1, ,.... az 4 One afternoon, later in the month, the class assembled in the gym for an H informal party. Those present will always remember the good time they had that day. In their relations with the Seniors, the class of '26 bore in mind the Work of the Golden Rule and heartily cooperated with them in their social functions. On summing up the Work of the class of '26 We may say that, although there have been no sensational achievements, the examples of quiet industry, and irreproaehable conduct have set a high mark for the future Junior classes. z ,,,., , uf 1 3 . ..... 1 iii 2 ,,,,,,, z ..,4 ---- 5 2 , .,,,.... gg iii f .lffffffl Q g ' Q ,K X i Om' ll Nn41l'1'1l fllrmi X ,... 4 f ' 2 ,,,,WfMMMf, .,.... , ,,.,, ,,,,,,,,, ,, ,,,.., N, , ,,,, ,W ,,,,,,,.,W...,,,,., .WMM . 5 A ., A WW-W..a,W.M ..,., .N ,.,., . ,,,,,,,.. ,,,,,,,,,,,, ,,,, y ,,,,, ,,,,,,,, , , 3 ,,,,,,7,,,,7.., ffffffff W 0,7,7,.a ,f , , - f ,Wave 0.219.913 n , f , ffffgafaf ry, L 43,51 We I .., -- ' - . .grf fc! J 2' fn 1 e f.- 12,241 - yxwatwffr V f' ., , '1 unfff H' f,,, 1 1- ' g:1:':::',:g-c':vj,.g- ' ,wmakgfif ,Z , ,fre , f - V 1 , - ....vV , f ,. Awwf-',wfm,,W-,ful V t -WW ,,,, W,,,,,,,,,,,L ..., 1 1 Wizggj ,,.... . , . ' ffl V 'W 1 , fmrfi K, 41217 A rf:2W5Q,:fg.,,j We f mgfo 4 5 ' Q... .,,..,,, 1'z..4g-12:3 -f ali Qi. ,3 ,,,,f ,V jf MM ' ..,f ug S' 51 ' W--.n.,,f J ij-J ff? ., .,,.. 2N,.,,,,,,! 1 My 5 U f.' ale. f f ,, f ff I iffy fu- fy 1 ,. f 45 V , W M, :g,Wv?fvmvwfz,wmm:W2.,f:m4 z,g5,,, 1: ....., ,.: 1 ,,m,mW:1.:M,.mmZ,m,5...7.,w W wmzmwfzfzc ,, A JUNIOR CGMMITTEES j 1107, Mark Winchester, Chairman Clara Caple Frances VVhipp Ifdna Carr Thomas Beck VVilliam Thayer Wooxler Glee Club Conant VVarren Burvvell, Chairman Anna Mae Whitmore Nlinetta Schlagheck hflargaretta Roth Nlelvin Ward Bernard Gladieux LeRoy Bloomer ' Mixfr Harry Casey, Chairman Nlartha Theaker Persis Skilliter Archie Vlfilliams Gilbert Seigel hlary XVasserman vyll A, One humirezl four -2 i .,,,,,,, A W, 5 4 ...MA 5.,......i ff' W'WU' ' f'fff 'ff Wf f fffff ' ' ' ' ' mfg., -- -,-wwf, .,.,,,,,,, fmwfwff ,,,f,, ,,,, 1 mvffm, V... ,,,, , ,wffm ,ww fffmofnnhqyf ' , f ,,fi,f4,f ff ,,,Mfffg:c1vf M ' ,ff , ,. .,,,, ....,,, X' M 1 I ,, If L V V' 1 ,6 , AIAVA I , f 1. f' , ' ' -i ' .,., V :NJ 2 M: H l 1 I ,,,, ' ,, , f X -. .,.,.,., ., ,. f 523, j V 25555: H -.---- N 1 A .i , , ,, I' ,..V . ,gm .,... 744 5 ! 1 f 2 E Z S i 5 5 i yM......a ff ff X 4 Z 5 1 t 5 , if lfffflv 5 f BML l Q1 ow 5 ' ' Af k '. e - hc, i ' 'Chou hast '6wl'Xarc.IAeamed Key. X W1' f m . 2 - V .., -..: , .. ..,,. J - f,-- T1 f:-4 f-,-ww-5:gvrg11,:'f'E W :Exif h 5 ,,,.,,,, - ,.,,, M ,.,. ..., . - X. ,f f'-'f- V-fwm - ff' A 4 kv, gn. My-wwf .1 f' 4'- ,.. if -x M 4 ,f ffffff A if, X M - 1 J 'iv' JKWK' 5 ,Wx :J 155 N-Maf.,!C1 ' , 'W' 2 , ff f ,Ayn ,. A ,f ffW'fmf w.X an A ,WM--N,,x f U... fxvfx J, mm, ,mm f-ixg'f3 gg f 'N.,,.,,zNf f f' ' wff --'f- ' 11' ' 4' 1 1' 9-' ' M . 1-gf J W5 'W .' Q' . ' H ...., .' if ,v ' 227' ey --'.'xM ':.,N.M.1n - A:1am:n.m-avail ,,,,, -- '--' in-...r g 2. ,.,.. ,, ..,,,, 5 g ,,vv,, ,,,, 5 Ejlffjff ..... , ..,..,.. , Z .,,,,,,, 5 ..,...,. Qfifil A 3 f lf ...,... ,, f 1 2 f 5 ,,,,,,, , 'Q ..,,,,. 5,, Z, ..,,,,,, 4 5 ,,,.,,,, 2 L 3, ,,,.,,., 4 Eff ip, ,,.,,., 5 z 'f 3 gm , .3 .,,,,,, 1? 1 1 , .., We 2? 2 gg ,,,,,,,. Eff 'f'f ,.,,.,,, i ...,.... 5 ,.,,,.,. 5 i , ,....... 4 Z .,,..,. 2 9 ......,, 5 1 1ff-fAAf Z nd N fhou Famfst Before mace c .57 t morn ls had fn om hc , 1 , ..,,,,,, , Chrw Ulxdc Ch porlal Labaro-1, a ..,,,,,, 4 g --ff--f 0 unnor SYHP 2 ----- --4 'f-'vf ophomozfe r- ---- ? ,.,,,,,, , f f' -4 .,,.,,,V 1 .,,,,,,, g ? ....,... 3 Sopllwmcmre ,,,, . ,,., 5 ....,,,, 4 ? ,,,...., .w,,,, 4 'vs ?- T323 Q ,....., 4 , ,,,,.., 4 1:33:52 2111.112 5, ,,,.. ..g ,...... 4 Y ....... 4 X .,..... 5 rf- -- 1 g .,.,,.. ,Q ? 3 Q --f ' 's 9 1 Q-W . .... .., , ,..,,. Q-We P' 4 3,3214 5 'Q 4:11116 ,M .... 7 .Ml in 53 4 , A...,.. l 5:11:15 ,,.,,,, .5 ........ f .... W4 ililllf an-1 23535 Zfffl 5 .,,.. M1. ,M gf-W4-4 PFI 511, ? I 5,.-., xx, gm 5 QM W. gmm g----'41 QW-v-1 U in ,,,, 4 2592 QW--f-i 9 ---'- f-M-1 ew-f g...,,.,.2 MWA Q ....... im! ? 'M '! iztitftz , ,,,, ,,.... Q gm. .,,. I , , ,,,,, , . X ,lf ,ff 1 jf.. N 1, ff fs. ,,,, . ,. -- .ff ' ,,,,,f',,f f 3 X uv,'Hww1'f K ff ' ,f ,' f , ,IM ,ff ff! f ff! f' ' ,. ,-N 7, 1 f at f V 2 . 1:52 fA i ,,,' ,,, ..i, .4 1' ,,M-M- 'Mm,,,,wfjL7ff5 4 I, A .JV ...,, My , ..,. ,Y ,M N, , , gi... .....,,,., , y .fm . 5 Y .. . , W ,,.. , Cf V 40 Q f if ff.j5'f,ffw.:g3f3 AVAAII V! .,,, ' ..f'?mTin.f,lL.lHs .A.. 537325551 Lugfjf Q, . ,,,'n-4f4wf ' 'S wg,-,.n....,vn., w,,,,.-V. . 'V .fx j ff -N3 ' ' N L2 Q V' fm -f M 'x,., 1' --,fx , V We ,.,. Yffwjewgfj '- ---- WN, . ijflm fx' 3 1 xt ,V Q j ps ff X, ,CV .W D ax .fy , J W! '-Wwk A J .HM f ,gl 'X-V .,.,.. qfj - 'K' f 'fi' if ,.. l Lfmfgffff.,f,Zf:fw,.'f .... f.-mm:,,,:::1c:n1p.,.m...x ..,, g:W2,e.W2ZQmf,Z.mm,Wwmzwowm,fmfm:fW.,Mmwfm,4Z,mm1m.,Mff, ,..,. IVVVAA , , , , 4 'llllll SOl'llOXlORl'l CIMXSS In all the activities ol school life. wc scnvllonxores have already played an important part. ,Xnd Io show that Lhls xs no lclle boast, 'llools us overf' On the loothall iicld our men have given good account of themselves. lflmex' Xnnis, Pete Pencoll, Paul SllOCIHZ1liSYZlIlCl 'gbpolu Xenhrecht have played prominent parts ln Winning gridiron YICIOIWUS. ln haskellwall we are rcpresenled agaln by Pete and Spot.', On the track loam, loo. we sopllomores are Tllflllllg IH good performallces. Anmong the stars of the Cinder path 2ll'CZ Paul . , . , . . . B1'Cl1lllHjlC!', Raymond CJl21QllClIX. Paul Sl1OCI1l21liCl', hlmcr l',lJ6I'llI1, George Crewes and llownrd BCI'I1llZl!t'Il. X Iffll . .,,, Q , Iliff Q Om' I1 nmlrml Sli: l , ,,.,,, , .l.l WW, M, ,,,,...., M ,,,,, ..,,,,.,.,..,. MM, ,..,,,.,, W ,.,,, m,,N,,,WW,,W,,,M,M ,,,,,, ,W ..,,.,,,,,, .. ,,,,. ,.,. - .,,...,,.,,, N ,,,.,,, ,,,,.,,, Z ,,,,,,, N N ,,,,, W' ,,,,fffff'f'ff'f ,CV f ,l f f ,e.,, ,,., f f n ,, , . x f- I ,, Q M.,,,z,, ,,,, ,,,,, .13 ,W - ,l,. e,,n - l , , 'lll p ll ,l,,,t J V X 'wi 'q.::ffWW,fff,,f,--. J ,,,, f . 1' 0 X ' .ai rkfmfffa X' NW. 9 N fs? , ........ .... - Q A if-f -f'-- X f -...X xx -re, f nf . . sf- ,,,... 51.44,-r -nf . ..,. Qi.. fu fi fs, - 1, r . j 5'-A! , 1 D r X - - My BMJ'-..,,qX' 5 WJ f gi W...,...fQ,,ff..f'---7 V' I .,,f .,,,, ,F 1 :T Xl ,ffl . . ,W NW. A W 'I ff if ., W. , -1. Sky f I ,Z ff-.W J ,y sd., I vs, ..,, ,Z fy, ,I-.. ff ,J ..., N ,, W V ,-.W fa , f- 41 , .ev L., fwfr f f' f --vfr .1 'f X 2 :aff 4 2 ffff ' . WW?Z5Vf'W bf 1 fe 'f JW ' ' V2 , -2, mmm::..wmv,,.mr:ms.:1xx:zc.m:,z:p.:: .,,.. :smwfiw ..,. f L ---' 1 f f Y ..,,,., . .... 4 emma .. .... .4 i 1 Ent all the glory of the class does not depend upon the boys. The girls have a splendid basket- llllll i ball team. And no Wonder! Look who plays on it: hflary Knierim, Nlary Gonia, hfluriel VVald- vogle, Marian Rahmstock, Ruth McGinnis, Marcella Kapp, l.ois Berry, and Margaret McClure V ll.. . Atithe gymnasium exhibition, a picked group of our girls put on the Spanish dance, which proved to be a real sensation, and the clowns in the tumbling act would have done credit to Ringling Brothers' circus. On Blay 18, a group of sophomore girls put on an exhibit for the Eastern Stars, at the hflasonic Temple. But high school does not exist for athletics alone. Our scholastic record has been a credit to us for leadership when we shall become upper classmen. ..,,.,,. Q i iiiiiziii ,,,,, M4 ,.., ,wg . .,.,,,,. 5 iff? ' W5 ,,,. mi , ,... M, ..,..., ,,,,,. ,3 g---M--1 aw ---f- 6 .,,,.. M, ...mi 3. ,..,,.. C1132 Ziff 'xiii E ,.,,,, .4 4 2551555515 , V , ,,,., One Iizzmlrfrl semen 7 -------f 4 . , ...Mt ...,,,, 4 ,Wa . , , ,,,, V H ddlyf ddl, , f mfs, fm' .. . ,-f-,f ,.1'fQQff if' ff ' ,f Wfggffnf-5,4 'W f' ' rf fe swf, ,, - f' X f ,,,,f',,f ,ff ff I 1 ..,. f f .N ,,.fjff' -- ' f ws. V ., ,,,, fff-' A ff ,ffff:12 4- ,- ,.., . ,.... ' ., ,V ' ff ' Q, iff ,,,, ,,,. L ,1' 5 ,,,,,..,'fgf15f..f'ff 2 . f f,.,,f :, ,,,, , ..., ,.,.,,,. , ,11f,.1,..H.1-..-.Q-.V-. 41122244 ' ig Wifi?--p.'--f if - .fefiffiif 1zff'f,,, ' V.,VI,,,,,.,.,-...M-fffm,WW,mw:-1.7 -.azafxnwmmwmalw ' -----5 .,,,.,,,,......,aZf.,Q ..,, N ,M ,,,....,,, ff-ffl.-,f 4 i l 1 I E 4 x 3 3 Z E a 1 f 2 3 Z i 5 the school. VVhen scholarship medals are given out, our class has come in for its share of honors. ,-11f.. 2 We have been at Vllaite only two years, but we have made good use of our time. In the societies fff--- of the school we have a good proportion of members. Taking part in the programs, is preparing 5 r f 1 Z Q 2 Z 2 Z 2 Z 3 9 2 ,t ,, f c.. ff , tfrc 1 f, H f + .Hg , I ,X ' ' .,., i lm. Sf' f L 3 'W ' 1 .... fgggms gf - if 4 2 H, ..,,1 .,,,!- .,,,,,, , f' ' uf 7 ff E Q5 'w ,' X ' I 7 vw t ,,,,,N,,,f 2 r ffl: 'f mf wfiimff ' ' 'Inf ,, f'r,.,f m.fe ' f ' ' ..,, .,,, f W ' 1 t The sophomores give their hearty support to the activities ol the school. They are always among Hthose pre-sentw at the athletic contests, parties, dances, concerts, and operettzts. VVC have a representative, too, among the school Cartoonists. One of our boys, Williatn Dwyer, has already made a name for lumself in the city. l'le draws for the 'lloledo Timesi' as Well as for the Wvaite publications. XX e are proud ofthe kind of work Bill is doing. The initiative which We have shown so far in our high school career may he considered as a forerunner of what We intend to accomplish when We are upper classmen. l ,fffff b , One' Itumlrml rigfht , A j , . f ,M , V f ,We .fn.,,,-fnz1f:f:wwm,ff1f5'W ' 4' V ' I ' W-wffvf ,, ,f f X, nw fAy,,,6,, 1 f 4 ,, , f ff 1 'S 7,,,,,,7.,,,,,,,,,,,,4.,7 J fy ,,,,, f ,fff ff f ,, . ,,,, ?,.fW.,.Z, ,,,,..,..,,, V I .1 J ' f f L ,, , , f,,,1,g ff , ff Z.. I f,4,'9x , .W X , V w,., , ,' I f , 4, , , x f if x f ,f . i, ' :L f W, f, , V 2,1 f ' fx, X ff f - 5 ff f ,M f- Vp. 1, f f of V J ,X W-H fww ,4,vm,,f,,mm,.m ,,,, ,LW , ..... .1.?Mm4,ipZ'..:'fff1,m,,,,M,,mN,,,,,m,:,7,...fggm,My,m6,,f.wQ M.Mfff...:M.f.a .... 9 ....... , r ,-, 7' ' ?,,..,.g S ' ' G' '--- -1 Z L ' 2 L ...... I , .,..... ,, ,,,, 4 E ' 5 4 2 , .,., E E I ...,,,, 4 1 . ,,,, ,,.. ,,,, , M,,,,,,,7,W..a f ,f f f X ,f f f f' 71 V in .,.. ,,...,., 1 wmZy,55,,, f uv-1 f 'V , Main f' wwf' ., 0 ..,, ....... V ,.,,,.,. , . ,,.,,. M ,, rf, 'vii ' ' f , f' f-fff ff ' , ff . ,f ' ,, . 'WW 1- 4, -, H ' ,, 4: 4 X f H ' , ,. .ff , L, .fff,., f ' A 4 f' ,4,vm,fmw1 1 -f f 1 .f--ff' df'-H ,.,' V . I W, Wu., , W .,.. W. ..... ,. f 4 f X, Wcfy. -i 2 'Z Wi H faves - .,,, in fe-aw. w X' f , Vs .....,,,,. L7Mr.r -i - --'- - 'j1 !5z..,A f in xx A. . f . W, 3 W . . 1. 2 X V 4 2f ezn..j3 2. - f- ' 5,1 v. ...f ,Wi X..,fK, ,V ,f 2 ef x..,..,gQHj Q2-' -f-few! TZ ' W-7 5 , . -t ,Ms ,A fffff , Q ...lin ,fu 2 ,..., QM, ., M221 1 ..awwwwwwafr:-V-,WQJWMWM--M-H-1' .,,, 1 1-'fffw'WMzmfwazff:-ww .,,. 1 .f.-.f. Ei f , PM-W1 , .,..,. 4 f ..,,,, 4 H1 Q .....,. 4 'J x n i 1 The efYZldl'l'0l'l'11l71 Three bells. The auditoriumlw breathes the newest freshman, as he dashes pell-mell down the hall, followed by 1700 other students. A summons tothe auditorium may mean any one of a number of things. During the football and basketball seasons, it means that we are going to practice yells. At such times we begin with a lusty VVaitel Rah! to set the echoes ringing. Or perhaps we are going to hear the reasons why we should be on hand for a certain important game, or it may be that we have gathered to cheer the team for a hard fought victory. At other times we listen to a stirring Iallt by a representative citizen or a distinguished visitor, or we enjoy good music played by a group of artists. Vile have come to look forward to the regular Tuesday assembly, which is rapidly taking its place as one of the institutions of the school-a helpful one, too. At any rate, we welcome a call to the auditorium, and we shall long remember what pleasure and comradeship we have found there. Um' I: IlIl11l'l'4I fri: , ,..... i .4 ff . ....... 4 .4 , ,. ...... 4 ...1 9 .--...f 5 H4 M2 4 ..,.,. 3 Wg Q --fllll 4 .M L ,. ?...N,,, ...a 'i .J f .3 4 5 4 4 :iii .......i ? ::::::f ' iii Zig VZQZZY Ifffff? E Q 5 1 f 'Nj ,....s,. 5' l f. r 5.....i 5 ,,,, .4 NJ ...Wi 1 .MHA E -..M ami 4 Q .... M4 , ,,...... ,,,.,,, n .lllf M ,,,ffff. W 1 W N ,,,, ,iZ7W,,W ,,,,,,,,,,,,. X jjbxg W ,QA-.VM A, , M,,f'3Qf i,,, ' f 5 f Y U' :2?7'7?i wvf':ff'M 'z::f 1'.-. . , ,aff . 'Z f' 2 .. . a1g,mZ44Gf ' .' L 2 in W ww-M51-4,,,,,,,f2My..,,-.. :MH '-1 1 f 'f,,,-ff ' ,,,,,5gj,.f' V. . ff .z'ff1','t.f. ' 4 wwf ' J ' ' .mf - 1 ' ' X A ,, . ..... .. 1. , 522.1 3 ,fgg .... ,. mf, V 1, L, . . 7, f ff ..... 4, 'Q Ni . .,.. . . ,, ..,. M. .... f as 1 5 ,. ,. M ,,,.. N. ,-xnxx, , ,flffmf-75 x. 6 -- - f', QC w. X 5 ,J H 5 Cf K . K ' 11 Y M ,I 'N..,y 'f .J xx-:HJ KJ 1 . f 1' . ' f .rx f. fi - -1 -. . 'T ,,--,, If H, 1,5 5? -N ,r , 'I . 7 , 3 1 Nr... T' rn-My ...Q ,. , .A. , m.,,.,.QQ-2f3f:miiH,:.frmiVLL!.f...Jf?s.,.L aff - 3 ,.,...., i 21:11:12 5:3 ...,..,, L s-..4 5 ,,,. ,,,, Q Ni.,a.a.,L5..L,L1,i,a.f..1.1.l.E,5.L .Lx : 2 5 ' 4 Y 5111113 ,137 1 Z 2 ,.....,, 2 1 ....,, 5 .,,. ..,. 1 5 gLL1Li..,g 555533 , g .,...... 2 ,,,,,, ,L 5 f 1 ww-4 5 3 2 ,,..,. , , , Q sms ,.,,,,, 5 in-5 5, .,,.,., 5 5 ,,,,,, X Z Q-H ' 4 F4 ! f 5 QZZTLLLLE 51121 ' 2 3112223 Q 2,2 ?43 , 5 .....,.. ? ,,,, M4 Z g ,,, ,, ,...,..4 , 2 g f f 4 2 Q ,.., .,., 2 ,.., , f,i 1 ., ..,,,.,, Q r ......, ,u 5 , ..,,..,,J i...M.,, z .-..-.. y ,,,... 4 , 5 ,,,, ?,.,,,5 -f Q , .... ,-.- ,S g 211117 I ? ! 5 L----4 5 A ..,,,.. 4 E114 '1 1 4 , cf-3 1 ff: f 35612 5 iiiiiii' ? '---' 2 --ffflf 4 Elms S 3 2. ,.,,, 5 ' ,1 I 2 ' Q Freshman, 'Umm Qecjxnif Gflzmb 51 - , MW Q fix: LEXQQJ9 L.ongf35cenC, ' 5 3112223 ' - Egg , 3 G Reach The EJYUXK Of Lfarnmcjk fount img 1 5 . ...N M, , 2 ' Ou Fwrmv- Kz1ouAed5e Sfmt, H175 A: 5 E , 5 511111 ' W foward Joph novcbhmp ' H-- i by, . I of Q- rj W . fre Sh mam 2 kvff ' -535 2 3 5 --- - .... Wg 1 E ' Q ..... .4 ,Q , ,..,... 2 ,M 4 2 31:11:13 UM! 5 5 Q HD 21113 3 251 '-'A' 6 l Z imffffff Tum? Z im -'f' Cffffj f fffvfvv, 4- -f--k s 5 y -'--- 5 5 ,,.,,.. .5 5 f ffm V15 f giiiiiug 3 ?'Wi 5 L .....,. ,, , 4 ,,,.,. 3 r--mmf z , ,...... I , i 215:13 z ..... .4 , 2 2 ' , ...., 2 5. -.,-. .J -WM: 1 f 5 .....,, ' W , .... :K .A M, ....... , . , ...... ,,,,,,,, , , W, ,, .,.. ,.,,,,,WW ,, ,, ,,,,. WJ W. ,- Wu, A iw., V .f-'h.f,.,,f ',,f--- , mf' ,,,.. 'w' X! A ' V -f P , V AV.. 1 1-'ffm ,,M,2,,..,,,V, W5 f : .fff I rj .5 : 2, ' 5 if '- u, 1 +31f5:'f:'4' ' V-f: -fr'-ff-. - -4 X, ,Q , Z ?,f'jf,f.,1ffL',,,-'I' ,cy-f' V V ' 'I' . V 1 M. ., .iZ.'3.' :':::..1a i2'ei fm- 1 , 7? i IE fi f li - , 2 3 .1 -... f'.,fff V 1- '::: ' ' - fy ---f ..., ,. .,.,,,.. F'--V 52355-A his 'gi fn , .--Qi ' 1 1527 in '- ..,,...,, Munn ,... 5 ,ms ,W..w1j:1.,w 4,3 ,,J.T,.AZ M ml.. 5 ,...,., .,..,. k ., .,.. .f'L'.'fLjj V-..tg,ANAg1::1,:::--:a1-.-,1-,'-- QZTEGVV- ' 5522? ' '?iE12nLgTf'f: EW ' ,dfvffiw f A421 H --A-- ' ' ' ,, N.f,mQi5 '- ff '1LLZ-f f1f-W 55:-'?f,v N '-' H ,Wfm-2fWH': xffLff:mL,z---:- ffkm- I.. - g, 'Q.ug.5 '?Lwr'gf':Ij'3: --k f-- -,gilfv-' . --- .pf -..,u..,..,,,.. ,.,... rn:-'I-1-V- F1Wf'1 ' I' ff . fy '?Zf:!fWff , f . f .,., ,, X f ' 1 X U A ..., :avg ..,,, 5 I , N gy Q 1 V 'f 6 f 2 ,,,f H! , if X , .V jflyu! 'v- ' ,,,, ,,,,f 12, f 2 fy, ' f., , X., 4, fy ,,,, g X541 , f , ,, gf- ,. , 4 'f ff ,,w2f'y ,. ,, Cz, ff a ff Q, 1 ,fy , I ',.,.,,f Lfmg, fff- 1 , fwycfffgwm A f- fy, .,.f f , 5 yffw , ' few' ' ff: ' , . ,ff f,w'a::1M 1 f' Y ' 'e fi ' ' .' ' ,f ' ' ' .w:nm::f f ' f .f.ff,.,m .... 2 1 THF FRICSHXIAX CLASS The frfsshmen hzlye been in Xyaile only ax year, hut they are shmyhlg ll ehmss spmt that IS 2lIlI'3CliI1g zlttemiml, Xlueh of the time, so fur. has been spent in H1CZlI'I1ll1g.I the ropes and IH getung zlequuinted, and yet the youngest nlemberrz of Ihe KX zule family have found Lime for study. too. They have done well in Lheir Work and have made a good start toward keeping up thc standard of the school. , 1 Um' lflmfhwl lu'wIr'rf , X ,..,,, 0 1 fl f f , f f 1 f f f f , X -..rf-me , w,., ff-- M., 'ec ff - 2 ,,. fe X., A f 1:21 , V , -5 Z al 1 ,..,f 'v ,,,,, , A ' ' 2 jv,!f., -J 'VX y ' fa Y f ' .ff We f' ,. ffvz , fic, M, N21 2, .,.,... ef , ,.....,. 2 t 'mi f V , z-.uf , k N, , l The freshmen girls' gymnasium classes contain some real, feminine athletes, and the boys, football squad forced its Way to the front, early in the season. Under the direction of hlr. Sterling, a tangle of arms and legs became an organized group of young gridiron enthusiasts. The adviser system has helped the freshmen to find themselves, and to enter more quickly into school affairs. As far as the class of '28 is concerned, it , has been a busy year. and a prosperous year, and an enjoyable year in eyery way. 1 4 , ll 5 Y ' 4 W lf l 1 l iff fix: J e WMV' W ,, y YQ , .,,,, 6:2222 Ona h'llHIll'I'1l flzirlwwn ...,, gigiixgig ,, ,,,,,,,,,, ,...... .. .,,, , ,, .,,,,,, tZZ7,,,,,.,W ,,,, f X ,,,,,, ,M QV!! ,477 f Mft' ,,,,,. , f f fa ff 'fra 1 wh A . ,1' J fn f, f yf X Z 1f, 2jW1:7,,,,,, . X, jf fu! 'wx 'W ,, J, 1 V E, f ,, Q, f ,W A ,'E , ,, ,, W ,..,. , , . , f ,,. fy , W, X , f ., ,.,, 3 f,,,,g, f , , V, f M4 ,fw 1 gf, ,, , 7 4 x V f f 2 ffjf' 1 f iff ,. W, . ,M ,V if .?5'M',2iW' ,uw fi--14 -- Mm, V. mf:m,wmAf,,, ,,,, ..,f1fm: ...... ,.,,,,4.N,,N,..,.L.,,,h N. ,1...,..N.,W,,,ff4.f. MW M JVM .W M 4 41 M f uf Wff wx 2 , ..... ,J 5 .... Q ,J 2 E Z ,Q 5 1 W ,,.fA, , N ,,,,,,. N ,,,,,,,,,,,,. , ,,,,,, N ,,,.,.,. ,,,,, 2 7 ,,,,,,, ,,,,. Z , .,,f,, I , ,,,, ,,,,,,, , ,0,7,?,,m , ,mf-1,wg,,. ff- . ,,,,..,, ,,,, M ,, ,f ,M ,,,fffff ,,yf5iyi f , , ' I 5 ,W ,W ,,..f,f 63 K ' E 'f V l ,,,f,!,f V grf' U ,!, V, , ,... , f ,,,, M , X 5 ,,., ,,,, , fy, ,,,.,,,,. My ' H ff mW,f,4 , f , ,. Q Q ...., , . 'W,,,.,,, 'gazcwmwfwmf-, m,,,w..mfmwgwm,,,,,'fw ., f'W,W,4,,w,,,,,,MLV,fwyymfggfil WML ..,,. f f , ,ywn 1 1 ,,.,,, X ,M X 5 . , ,J v , f M f yfwf 2 f f f ,L amfga W2 f E 3. il, C: S-:lt QZ. rum Soi 1 ,.mun.e . I V r 2 Pi: I Q? 'E 31119 1 1 4 ln, LEA, 2. Q- : s 3 0 5'-, o : 7 X ' N 1 S00 , Illlllluk wg 1924--7925 lXIedals will be awarded on the following basis: GoZdfA student who during the school year 1924-1925 passes in four units of regular high school work with semester averages of l1Ot less than six As, and two B's will be awarded a gold medal. Sifsier-A student who during the school year 192-1-1925 passes in four units of regular high school work with semester averages of not less than B will be awarded a silver medal. Bronze-A student who during the school year 1924-1925 passes in four units of regular high school work with semester averages of not less than C will be awarded a bronze medal. Om' ll7IIIlII'I'II fiflwn, If f ,f ff ffff f f ff 0 I, , ,.,,m,, I ,, 1 J' 2 f f f ,. ' f f f ,f , X 1 , .,,, f 61 X I f ,, ,... ,, ,.., ff wp, ,,,...t., furr- 'N ':f't' .J . ,L .t.,.,A:. ' f- .ff ' 'f 213 ..,.,.,, -F Ilfl my ... .. , V P si , 1 -.,,,,,. yr, -7 .,.,,,f 1 'f My ,1f...,,,,,,J ff , A I. nw 5 4 V X JCR, ,- , ff' . f,,',,, ,, W-, g..L.,, , f, ily, I I! H, ,,,, , RMMZ- ,.,, Wm !,.. ff Wnwfv if Y ..., .qi ul rl Z J ,fag A iQ .... ,,,w,x,aw,.N ,,... M - W , ,... , ,-L Q mg,-fN.M,g.,.,a.,,f' ---- -'H 'W f-fwffffff-0'-w'wA-Mfgre-vw--11-N-1 2.::.L:fL,:14: fa.. ff 1. W r1--'M--M-- 'W --'f' Y f 1 211111125 5111112 riiiiiii 5. ..,. iiiziiiii 2 1 . , Z E ,,,,,,,. 53 ' e , ,,, , ,, i ......,. as 2 M, 5 GOLD Sf1zio1'54l6 John Baymiller Virginia Everett Norman Brenner Lillian Lavender Joseph Heferle Ruth Pilzecker 2 Renton Bernard Moore Grace Roenick Nlarjorie Barnswell Helen A. Snover E Anne E. Dancer Marguerite Soncrant ,335 i Irene Dickinson Helen R. Tanner Lillian Elsperman Mary Wheeler I Q junior:-3 Naomi Baymiller Belle Joseph Rachel Prince Sophomoref-'21 i Karl Brenner Elizabeth Jewett Luther Lalendorff Ethel Kelso Gerald Liebke Edith Knaggs f Andrew Popp Mary Knierim I Lois Baymiller ' Maurine LaLonde 6 3 Iola Benedict Naomi Lange Genevieve Beth Florentine Nierman A 5 , VVilma Deters Ruth Roper ffl Genevieve Edstrom Dorothy Schreiber ff Glenna Halter Virginia Schwager Margaret Slosser FfK5hWl67l118 3 Billy Basco Golda Cowie V VV- V Maurice Fleishman Dorothy Anne Doan f Robert Goorley Kathryn Emch ?iiiffiff V Robert Price Iris Fuire ' Lee Thompson Margaret Kohut Gene Winchester Zora Powlesland George Young Eleanor Rairdon 5 Ruth Arduser Margaret Robins 5 Mary Collins lvlargaret Wilson SILVER Senior:-12 Fernette Baur Ruth Lee Gertrude Dahlmeyer Florence Perry 2 Margaret Davis Viola Pierce Laura Dean Evelyn Reed Barbara C. Frye Annabel Speaks Geraldine Hopkins Mildred Thielmann Om hunclrerl sixteen ,,,,,,,, , , ,,,,,......,.,,,,,,,, rr.....,, ,.,rr,,r L lr. ,, viii? ,,,,s..r., i..s 1 f iif .ri,r r ,... 1 , Mail' l W .r,,,,, , f H vlvv 3.21 .vvll v:'. Ilvvvlll T Z llvllv 1 EVII ..lffg.'f lff' ffifluilx Vllll .,, -wwmfm-1-W-I emma, nr' :.::... uf ,f E570 -SW ig Nl 550 f i 2 , 4 , 'X at ...... 5 , .,,.... , ,.,, 5 f 'f ' 1 ,.,.,.. 1 Qfffffllf iw-ml f 5 , . 211:32 g .,.... N W-, -, ....,,, 4 . 'v...'rl'-' M V lx 2 , ...,, f---xx fm '13 in sag.:-M fi if ff M Nb! J ,N ulnnu 1,'j.,CJf,,,J v- ff Wx GW' A ff' -w.. Vffuw iw 5.-. f--435 1' am- 12.9454 z::fzs.T.:,mWf,4ga -N ww -4--- . 3.-. fa .ll -wif ' ' 5113333 NIEDAL LIST-Continued fu nib rr-6 Violet Brown Bessie E. Joseph Onnolee Clark Helen Masney l VV,f Mary Alice Fox George Wallace Sophomorer-15 V Francis A. Babione Mary Eggleston Richard Bruggeman Nlarie Krob iljjjji Robert Muntz Helen Kruger James Scanes Marian Lang Louise Bachmeyer Hazel Mock Y H' Alice Carstensen Naomi Myers gfiiiiij Violet Davis Margaret Sullivan Elizabeth Thomas F rexhmen-22 Clarence Beckett Iva Lehman j '--f Rolland Buehrer Dorothy Loomis I Kermit Klewer Theone Marti James Miller Alma Meyer Graham Smith Margaret Nloorheacl Lois Best Laurel Morris . Clela Cover Elizabeth Schnell Alice Diefenthaler Ethel Southworth Dorothy Flatt Laura Taylor Eleanor Greenburg Alma Thompson Josephine Haddad Gertrude Wiemeyer 51112 BRONZE S fni o rr-4 1 Carl Bahls Henry Moser Helen Minerva Brown Helen M. Moench William Elmer Roger Shelles Gladys Colbert Julia Palmer 253332 Donovan F. Emch Arthur Sweet Dorothy Cole Isabelle S. Pfeffer Ralph Heinen William Trotter Maude E. Cordery Helen Powell Lynn Johnston John White Frances A. Dimke Doris Price Arthur H. Krogle Helen G. Ardner Virginia Dyer Huldah Ritzman 211111112 Leslie Leybourn Margery Best Nlyldred Faulkner Nlartha Schafer ' jj Scott McLeod Hazel Blair Mary Kratky Edith Ann Strahley Harry Maza Sarah Bolton Marguerite Lupton Kathryn Sutton ' Cloyd Mills Vivienne Brentlinger Ruth Nlachlup Dorothy Torgler , ..... 2 Clysta Urban One lmnzlrwll seventveu g,M,,,,, iff? M. ..... ,... sstt at t ,,,,,,,,,,,, , V ,.,,.,.,,, it .,, ,,,, ,fgfmff Y , .,,.. y H A e-ai - ...... 't-t- , H fu, ., et, '!,.1...!,,,y, M .M ,,.., ,af-3 ,. .... . ...,.. ., s15ll':JX'Ns aa ,f 'ef 'le-Cm me f N-Q w- A..., .a4?:g5 zxagrgliaia rr- ii ,vw 1, w Meqa,::Q.D Nt, ,f jgw,a,.J .wx MJ! mfg! .J 37, Jia al-5 --.. ..,.,,.,.. ff!! X, , fe Zjzfxflgxffw 'i !,,, F 6-A, fit., I 'j' 'N'j.f.,f' yin-.7 1' I I f Q .,,, fN..,fm...f'z,f',..f- f sfS ' ' I f.: ' ' X ff 25..f.m...Lz.,m1f.gIQ.f,Lm:a :azz .... 1:5:z.zz.c.ff zl:LZ!3g?ZZf.1p:-.1,mf..M111.va,.3ZW.mmwwa-1ma5m,i..z-,fwa,,,mff .,., .... e1,1MM.m1. Lawrence Aikcns Milton Baily Tom Beck Jacob Bryan Robert M. Bryan Harry Casey Burnap Cole Harry Dunn Edmund Eberth Oscar Fiedler Cedric Frederick Frederick Hass Hobart Brown Herbert Clark Francis DeMoss Keith Denniston William DeSana Lawrence Eberle Charles Jarvis John Kemp Gordon McNutt Nelson F. lXfIoll John Popp Norman Sayen Roy F. WVarnke Donald Winters Alice Austin Elsie Bahnsen Merlin Berry Richard Bloom Robert Balbach Clarence Day Harlan Diehr Lloyd Huntsman Ruth Bolly Helen Bruggemier Gladys Bailey Helen Baumgartner Noelle Baur Louis Blackmer NVilma Bruggeman Martha Burket Addie Cadaret Ruth Catchpole Ella Daubner Dorothy Davis Ruth Davis MEDAL LIST-Continued funion-47 Charles M. Hatcher Harold Knapp Donelly McNutt Aaron Martin Dwight Motter Montgomery Powell Albert Skinner Harvey Wetmore Frank Wiley Mark Winchester Amelia Bassett Mildred Beier Elinor Brinkman Josephine Brown Alice Buck Mary Alice Burger Dorothy Anne Cole Bernice E. Culbertson Grace Cutler Emma Deak Elsie Grace Dwiggans Lydia K. Habib Helen Herbster Margaret Hornyak Sophomorfx-63 Vivien Bennett Helen Edyth Brown Laurel Campbell lVIarcella Cedoz Rachel Cooper Wvaded Corey Oleva H. Edler Hazel Fassler Evelyn Floyd Gladys Fryman Elizabeth Guss lVIarion Hansen Iola Louise Harder Ruth Harder Erma Herrich Catherine Hire Dolores Huber Stella Kirby Stella Kowalski Julia Kupesz Alice Maurer Marjorie Miller Elloise Mills Irene Molnar Frances Moon Josephine lXfIotter Elsie Navarre Mildred Peart Florence Pease Bernice Pytel Gertrude Rader hlarian Rahmstock F1'e,fl11na1L-77 Virginia G. Doule Thelma Drayton Alma Eyster Ivy Farmer Madelle Fetzer Loretta Goulet Lola Gregerscn Elizabeth Gribo Ellener Hahn lXIartha Herman Luella Hurren Nlargaret Irey Steven Juhasz Ruth Jeschkc Ina Kicher Ethel NIay King Helen Kitson Glennis Klingbeil Vivian LaFleur Doratha Larmie Gertrude Lau Thelma Link Anna Llo d ' Y Robert Luzius Carmen Lyons Aloysius Mauter Harold hIeyers Laura McEvoy Ruth Mann Edna lX'Ieeker Dorothy Miller Ruth lVIuench Nassar Nassar hiaxine L. Ogle Frank Ousky Beulah hfIae Osthimer Harold Pelton William Price Mabel Heil man One h'll'Yllll'l'lZ eighteen Juanita Hudson Mildred Jirasik Helen Klages Regina Knauss Esther Lorenzen Elizabeth Matyok Elizabeth Rudolph Blenda H. Sayen Mary Wasserman Vada Weist Kathryn Young Margaret Roberts Helen Robinson Mona Robson Evelyn Ryan Lillian Samborn Carmine Sayers Ada Schmidt Lois Schmitz Lois Shilling NVilma Slater Goldie Stewart Lucile Stilwell Mary Taylor Violet Taylor Loleta Widman Kenneth Reiley Jack Rounds Beatrice Rippey William Schupp Kenneth Snyder Thomas Stephenson Loma Sherlock Matilda Shredl Marion Silcox Lois Skilliter Thelma Stanley Vera Steinmiller Marie Taylor Elizabeth Unser Elizabeth Wade Pearl Weidner George Wirwahn Regina Wozniak Catherine Zeumen wa. 'vf-. KEN 2 f r fm., 41 I ,,..,.. 4 . i ,,,, 5111112 s, .,.... g ..... 1 ....,., 6 2 .... I ....... 5 3, .... ...Z .... 1 ..... . .5 f ----- Mi I ,,..,,,, 3 f .... . W: ..... 1 2 1 5 i 1 2 1 2 a , z a ,,,,,., f .,.. .3 ..,,,,4f1iW 'tw fit f ,ff ,su-4 , .. Wy, . ,- ...Wg : , . Kawai g aa,-:Nada -'-fff 1 .... ' 1, My ff J., Xf .f V, N ,..,,. A .,.., ' .T ...,.i , f J IKIIVA . -I, ,A,.. ,,,, IEAII V , .,,,,,,, 3 ..,..,, , ,,,, gay, ri .Jima ........,,..,,, Z .5 f . ,.., . .,,. . .... .3 .. . 1 . .. gs.. . Lf. .. .H ?1,,M.,,, , fc ,M , MTA vlvlv HMM ,,,,..........,... 'g,..aaA:H - l ,A,, at M .2 Wm 1- fffnz' ,MM 'ff H , ,,g. J, ,Wa11:ZZQWW-'ggggzvmwharxmffaas-,ml-H-ef-M-eg,,,Q:,Mffff 1--'-5 gage ,,,, ...... ,,,,,,,,.,a..a.,..a,, ..., , ,,,,.,. ,... . ,N ..... f'-ff f Z 1 3 Z W 1 H. 1. 7' ' X 7 ' V' ,fgf ,ff W x 5 f X tr . f , ,'f' V. fm' ,,.. , -- 'M'- ' ' .,if!L,.N.l 1, his ,,.,. A f 'X W 5- wr, 1 qg,,m ii 1 l -.J hwjlr., .,,, ,, -it A .Mx ff, E ,yi 212, ii' iffl ' VN , ff vw if . N.. ,,,, ,We ,f.s,, 2 A ,. aff! iff few f- M fu f My f f ,,.. A H' 1 .ff f' M-i for-fm -few rf if ' J Y' ff? gmwwwmmzw,widowgmwmw:,,m,im!h:,.img,,,14.,112515.,QfZm:LmWwm:N.mmm,:s:mL4:::x:ep..s..h.m. ' P 3 5' iifffffil ..,.,,,, Q ,,f1,V, I r ,,,.... 3 ,. f 4 My e , 7 l Z ,,,... 2 ' 2 , 4 A THE ART CLASSES vyyy All through the year the art classes have been busy making the necessary drawings, and j V ' painting the tip-ons for the annual. Many an hour of effort has gone into their task, and much Credit is due to them for the results which they have achieved. The Worlc has been done under the direction of Miss Carpenter. 4 J THIC I,ll3RARY The l,1brary1s a haven of refuge for those Who must Consult reference books. 'l'l1e collection of books of reference 1S especially Hood, having been selected with a View to the pupils, needs. Yvhen memories of high school days come crowding, no place will he more replete with associations than the librarv. '- ,L 4 fffffff Q lt.. l .Ziff 25:31:12 hifi 5 ,.,.... , , , . g ,,..,,.. 4 ,,.,....,Z One 11'lLIll1I'L'll IlfVLElt'6il , ,,,,... , .,,,,,,, 5 i mr aw'-Q4 ,, .........t1 ,,,,., , . , W ,,., ,,.,, , r,,,,.. , ,,,,,.,,,,,, M .N,W..m,W.4.W W X, :QW fl! ff!! If l X 1 5 V, ..,f- 4 I I f N 7ff 'f,,f Ziff , g A , ,,,, I ,-,' H - i fr .2 ,Q f.,,, , ,,,,,, '- ' - fi .,., ,,,,, , f '--' - ,,,,., l '7i 'iiiill ' Q12 fvffv f'f : 5I1f5Q,., 'Z :-. . W,,-,H ' ' :::1cvw'wWmfff-W f---- rw,mfrmmff,,,,Wm.,,,,ffa.- -- .T ewan.-,WW III, M ---f'f my .,..-f..,. WW ,,,,, , ,,,. ,. 1, 4 I ff- 4 ..,, 5111, mi,-sxysx ifgf 5 .,,, 1 4, ,. ..,,.,, ff'-MV.-A -xv K 1 H f':f 1-IW M g111 'ffaJfaJ 45?-M, .M C, if X.. X M 5 , J '- .,,,z,..,3 f A 15 .X ,V , ,, 1, . . M., X I 1. N ., -If 1-W--'21 1 1 ' 2, ,- 5171 WW 'M'-..,.c...J if VJ' ,, ,,, ,A wifi' 'F ,, 7, ff- ,. 13,1 f' f' fb .... 11 ' TW Vzffwf. fTf'w f ff V' ' 1 ' fh' 1f 2 f f f f' ' 1 X aw 'E 5' 1 '- Zlffffffi X A f , 3111111111 51.5 .,,, . 2 111211112 1' 11113 . 4 , , ff'ff- ,,,,.., 1 5 ,,,,,,,. 5 i 6 ,,,,,, 5 f f ' 1 . ,,,,..,, 3 . .,f.. 2 ,ff Q 2 f 1' , , H1 2 1 gffffffffi 1 AIIAIA , ..,,,.,, 3 2,.Zff1 2 j 111if1 ,....,., , 1 f--' M, 1 1 4 f , , 'ff' 1-5 The Hallway 13:33 3 f 1 , ,,.. r 1 1 1 1 4 ' 1 1 25 ' 1 5 .. 5 Z f , 4 , ,, .... 1 5, One 111111111111 fll'f'1I1-If 5 ,,,, g .,,,.. ----f 5 ,,,..... 3-Mme 3 1 1 I 'M ,,., J 1 1. ,.,, J 2 1v--2-,f.ww1fwf-- ,wvfwmfq fffv wf-'wa Mf,w,,.,wMf,w ,,,,.,,, ...M ,.,,,. .,.N-..M.,,.M.wW,mWMMMWMwwMw4aM,,,wMW.MWw.Mf.wWN,,,,W.Mw1.nf,ww,.-4-mf-MWHNWIN Mum ff.. ,, f,.. , mv., ,,,,,,,,,, f .......,, ,,,ff . 111,110.10-wfwimaf 4 1 F Wff !,jL,fTff if ,J If -M.. .1 ., ,-,ezgynbf ,, ,M 1 ' 'rg f 3,5 ,,,, ,,,, U 11 H ,, V 2.ff,fzf'3y3 121 gf 'f A ,, , 1 f 5 , 4 U ,, .. ..,, 1 ., ...., fn.,-l M, , 1 Q .1 1 ...,..,.. 14 .,.,..... HW, .. , M f-1 ,,:w f'f . . ..,.,.. . .... N r .,.. ,V Q .,,,,.,,, , - V-ef Q, 4, 4 2, .,,,ff' , ! m.um,,., M...J'i51Mz.5- 1'- f'1 f' ' 11' ff' W1 . fr-of ,1 1 1 , , L1 AAA, ,,,,,:1,,,,M,,3ZW,,,,,, ,4,,,, ,,,,,.W..,,.A-agfgyffavf -9 WL ,,A, ,.... ,W-1z.Zii5,?,,,,,,.,,,,,,,,,1,.Mm, -,Lu ..N.. ,,,,,...W..,,.,,M.,,,.. , ,,,,,,.W.. ,... - f 5 x 1 mf 0 A, f f f f 6f f X 5 ? W f A Z ,N A 4 ffyf S ZW! Q A fi f A,,, A ,,.,,, A AA A, ,.,,..V 'f'f 4 llll M .,,, AA A A ,,,,,, f f A Z IIIA 72 h ' Qffffii? ...W ' ',-'v ' ' WZ ' ..,.,, ,,,.. ,,,,,,,, AA,, ......... ,,,,,,,,,,,,,,,,,,, A .AM ,,,,,,,,N ,,,,, A .....A .N,, A A ' ' f A! ' A .,,,,, A 1 94:21.- I A ? i A ,,,,,,,,,,,,,,, ,,A,A AAAAAAAAAAA,,,,,,A,,A,AA,A,,,.,,,,,,A,,,AAAAAAA A AAAAAAAAAAAAA AAAAAA,A, AAA ,A,,A,,,,A,,,.,,,,,,AA,,,,,,,,,,,,,,,,,,,,,,,,,A AA ,A,A, A AAA A ,A,, .A ,,,,, ,,. ,,,,0,,f, W ,,,,A, W Q .,., A A f A ! AA W AAAA A A AA, A, r fff ' fm 3 2 , , Z 1 5 7 f fwff Z AA gf? A M- if Z 2 I .NL-1 f A, 1553 71 AA, , A AAAA, W, A , A ...A , 1 Ag AAAA AAA A 4 4 ' Z? ig Z' 'E M fi ' g Q 2 Zi Urgalmizalfticmms Z i Z ? ..,..,.. 5 ,, ..,. ..4 ,. . 2 Z E 1 .5 H,,,,, f 9 ,,..,.,, 5 5 Z , ,....,..g y Q4 542 , , 5 i ,,.,,,.,,,4,.., W. X. ,--fa wa, as 4 M if-M-efafaf if 93 V. .,f,,,fNW,g,w 55,1 M -'.-, 455mg 9 M M-I 1 , an 5? 5, x ff? A I ,,..TW.m i-.sw ---u M, ff? ,N f.r,,a,,t, .f3..,,,ffo.a 24 -af. 1,1 J i , ,,,W,.. f , f f Y 4 L5 , , . . I I 5 Organization! g 1 1 f g ,... r , if-f , One of the aims of every school organization is the making of good school Z citizens. If a boy or girl is a valuable member of the Waite student body, it is 1 ,-f'f 2 . . . . likely he Will be a valuable member of his community, later on. Happy, useful , people are needed everywhere. 1 f i r A 2 If a student lives up to the demands of his organization, he must take a f 1 definite stand on a number of things. He must be able to control what he thinks, ' what he says, and what he does. A hard matter, you say, and yet a good citizen 5 f 5155555555 . 55, .,..,,,, should be able to do these things. 5731 Ever or anization encoura es habits of industr . A ood standard of Y s s Y g school Work should be maintained, and no person may continue to hold office in ,lj f any society if he is falling in his studies. iq 2 Members of or anizations should encoura e each other deal honestl with 1 g g , V , each other, and be helpful in any Way possible. . The various society athletics have for the object the development of the bodies of their members. This year much progress has been made toward a wholesome interest in society sports. 2 n 1 I a 2 fffrf One of the most 1m ortant aims of ever societ is the develo ment of the 5 -,.. 2 ,5 .,.,.,,. P Y Y P , feelin of ersonal res onsibilit . The im ortance of bein accountable to one- 5 5 ....... , 3 p P Y p g 5 227111373 self, and, in a measure, to other people, should fix in the minds of students the 222255555 f 2 f '--- ' 5 a 1 f value of conduct. f f 2 , , ..,,..,. s.....,., 3 , 511111112 I . A ' l ,.....,, 5 Do organizations accomplish all these things for their members? Probably 3 555555513 ' - - . , ...,,,., , , , notg but 1t's better to aim hi h and miss the oal than not to aim at all. f ..... l , s , s , 5 ....,... 4 , . , iiiiig 5111112 5 25511515552 Q l Q12 5 f f 3 ' 1 flflliif 5 4 f gmiiffg 5 ..,., , W fiiiiiiff f 5 jig 01:0 lI'll71fI?'I'lI fwenfyetwo ....,,,, 3335 ,..5 5 .... , ....,, ,.,, 5 ,,,,. WMM ,,,,..,,,,,, 5 55 ..5.....5... 5 ,55, 5555..555 55 75,5 f HT' 'Mags M, 'f.ff?', I 5 ,M ,M,,,f f1f1ff5f 1iigil! ,,,5f6f z ,.,, A,-1 1 --33::::::.. 1 V 7, , , 3',ffLZCCfC, .,,, I ,,,:155,,5, r ,5,,,, 55 5 555555555 1 Vrr. .. 'rrf I- ....,. ':::z55255,:Z ,,,,,.. iz. 5' ' 5,15 13.41 'sity A--. X Z 4 Z It X ,.,...,. 'fm ,... ...tn I I MW- 'Kam Nw, , , fc A ,M Z. ,f I ? 'vs , 2 ,,,, ,F 4.31, ,.., QQ 1 1 f. V ,f ' ' Dfw- 'H' T! . ff 1 j v. 3 ht ,, I y ig. 1 XQA f f ..., ffl 57lWMxf 'f,7I3f ' 1 'Z f f 'Hr ii 5 fAZ?7 7'f?t n 'f+,!q ?i1 'Y 1 ,,,, ' 21111112 3 2 f-f 'f 1 Q t ,..,,, .Z E ,1 2 ,J Z 1111.15 f Z..i.i1i Q , 1 , 11.11.g 5 iiiifi i Z 1111113 2 ,I z 2 ,,,,,., 4 , ffffff.f l 2 Z fffffffi i 2 i . s v - THE STUDLNT COUNCIL U 4 2 Ojicerf , .,,,,,, Bob TeWksbury111 ,,,,, Prefidevzt Ruth Lee .1,, 1 1 11Vice-Prefident Helen PoWell1 1 1 1S.ecrfta1'y Lynn Johnston 1 1 1 1 Treafurzr' , 11:11:13 75:15:53 g 71113115 Z Zi? 5 '7 THE STUDENT COUNCIL The president and the secretary of the junior and senior classes and of all ..,,...,i 2 the other organizations in the school are members of the Student Council. The purpose of the organization is to stimulate the proper school spirit, and l to constitute an advising body in matters pertaining to school standards. The f-----f .5 business of the council is to find ways of improving conditions which need cor- 2211112155 rection, and to exercise a general supervisory function with regard to conduct throughout the building. The Council has accomplished some definite things this year and has dem- onstrated its right to exist as a permanent school organization. 4 i One hzmclfwl twcnfy-fltrzfe 1 ....,, 3 1 M H ...1111... L Q!!! , .1.. Ufjifffy. 11y,,,. 1 1 ' Y ' V' ' if f, I 'Af H ' film- ,,,,,f'gii- f - A , MVS: Ll :' ' ,.,.,,,. mf, ,. jwijj ,,,w'-f1111Zifff.f ' ' . W- 1...:,.1:,z'1.,::.:- L ' f.zi. li ' ' ' f,.,,,,,,WJ ., Qi? ' W- '3 . fvvvv 1 I,,,.,,.,Q.,,.g,.Zfgnv,MWffwff-WW---1vazppamwa-gg.,m,,g,wf:'c 1f-Mg ....,. 1,,1, ...., ,,,,,,,...W ,... 1, C1 ...,.. 7 , if ffffaff, fir - -YW ., get A We fd W lm I 1 ' Wi V' 1 llS f a x I ' 1 X., V,f'xW,,,., 2 ' Jug! j 2 gi .,.., M,,, , ,,- ,mf-1 lx Wt G .,,, WW Qfrfwhi nut Xlifs., f ' -- Q ,it fx -ful f f ,' ., Y, .,,, 3k..wf.mff..?1Zw.fmy f .,., gp::z:pmrr.,,1:.,,:ggi?.:ifWQZa?Z.1mzeJwmm.:mwMm::1twnzfimwmmmi2jwML.M..,,Mfff:,,K f iflfflff --.,ef-:+-- I i , 4 , 1 l , , ,,,, ,.A. . lg THF ANNUAL BOARD 'l'he annual is the real queen ol Nlay. Awaited eagerly, she makes her bow each year amid s iv . ' - 1 f - Holi s and Kah's ofadm1r1ng students. She is commented upon, analyzed, discussed from every standpoint. 'l'o produce such an annual as lVaite publishes is not the work ofa moment. Early in the fall, preparations are going forward which are not completed until months later, Klueh time and thought are spent upon the book by all departments concerned in its making. Every member ofthe annual hoard has given freely of himself in order to insure the publishing ofthe best Purple and Gold Waite has ever had. Edirol' ,Helen A. Snover li 11 1,10 rfaf Sf aff liurnap Cole Roger Slielles l,avonia Knisely llelen lanner klnlta Palmer Xlzxrgery Best George Bates .lrt Smjf Zenas llartman Arthur Geollrion Margaret lirangctn Virgil ltlekliart Catherine XValeh Business Alztiiagger ,.,, -N .,,,, W Y Ralph lleinen Advertising Manager , ,,,, qllorace Coy Hu ff7H'J.S' flffifmntf Frederick Hansen Dean Overmyer N . George Xvallace Albert Birch Lorin Kerr Secretary-'l'reasnrer, - , W, , -, , A ,,,,,,,,, ,Xlary xvlieeler l5'p1S1S ...ff.Y ., H, - ,,Alargaret Davis, Helen Powell 1 . -Idvtffrf ll1'1HC1D2llf-- ,...Yf..Y ,-Klr. james A. Pollock 1'lU3-f1Cl3ln, Mr. Merritt C. Nauts l4IfC1'3FY-f. ,Y.Y , ,.,. ,AIrs. Alice Allen Art ....--f -., Miss Flora Carpenter Une ltulifllwl flzwnfy-fnrfz' , ff ,,,, A ,,,.,.,,,.,,. .A ,,,,,,,,,,, ' ' A .....,,,,.., W ,,..,...... M ............, ,,,,,,, Z ,,,,,,,,,,, ,,,, L ,,,,, ,,,,, 7 ,, .,,,,,,,,,, A Allf ff g,Cffi,ff ,gf 1, X ,,,,, f' ,.,., it 'Q ,,,,,l.,.. A ,,,,, A '- ,,,,, M ,,,, V .,,, JJ A ' f , gcgnzwmwwffff -f-- ,W ff--- ,WHA ,,,, wm::www,,,,fwm -- jg WWW ,,,, 4,4,,,,,,,mL,fZM,,,MmgZW,X, .,,, M,.,,zmL,ug:j5W,g,,,,h ,,,,,, ff' 4 f jf X flf'ilf'l ief. ' Vfwrf-.,,, , ,, ..., ,, E1 f ' '--X Vx . ,ft X, ------ f ffvf' f, f M. ,' ' , J W' f .,,. 1 4 ,ju ..., f 1 2 . , , ,..., , , .4 F ,s . , , . 1 ,. ' x 1 if .... JCL! ' .f'ff.,,W,,,f gg! may 'y SR ,, , .l 4 'f .- ,. v- ,..ifL.,,.. . . 2 , ' f ' af ff ,,, ff' ,M rs..,,w..f2ff ,pf 1 -fr-M, fn, - ,f ,X 'wwf favs ' 1 few' 4 5 2 L, .. ,,,., ,. , ,,fz,Z45f2'Wc 'f ,.,, ..., ,,.zN..zx, . .... WM. --W W2 0-M.. ,, ,mtv-, ,mf ff WW 4.am..ffm-WWW.,mg,wfm.f,.W...fa,fm.,fAf. fmuf.-..yff sua ,... ., ..,,.. , ...,. ..,, ....... s..,,fa,,,.A4..W..f,M1f...,.m, .... ,,., ...N ,MMM af, ..,. W ...,,,,,, f,..1m ..., ...... m...,.if4W .,,,,,. J , s flfffff tifiii i R ICTIX A ROA RD The cooperation of editorial, art, and business stalls is necessary to publish the six HRetinas,' which appear each year. Contributions are welcomed from any student who wishes to give his pen a vigorous workout, While the ulletinan class provides the general news of the school, tts or- ganizations, and the doings of its athletic teams. The art department designs appropriate cuts, and the business staff wrestles with the problem of paying the bills. tt - 7. - t. - M A Cooperative labor is the password of the Retina Board. liditor-. , Literature,,,,, Oflice Boyh, , Organizationsn, Faculty l acts,,, Personals ,.,, Social, Xluntni, , , Sports- ,, ,, Girls' Athleticsn Comics, W, lfxcltaiigen, .Xrt ltditotp, , .-Xssistantsn, R li'l'l N A S'l'.Xl' l .lrl Staff l?u,ri'rmrJ Slajf ,, Ralph Heinen ,Dorothy Briggs Burnap Cole , , , Arthur Sweet Klartha 'l'healaer, Helen Brown N .Xrthur Force, Aloe Schuller , ,Xrlene Innes, Helen Powell ,Frances YYhipp Charles Hatcher N Julia Palmer . nfieorge Bates Xlarguerite Sonerant , , Xlargery Best ,lYilliztni Dwyer, l rt'd lilancltard i Z f e f ...ffl ' 5 1 ....... 3' .,... 5 .... 37111113 .....,,, , ,.... ..,, . 1 llll 5 t,.,.11:1Z 2 ,.,, Q f g f- is Q ....,,. gffifili 5111112 i 3 ,....,, z., ...., f .....,., 5252215 2 t 'J 1 l Business Manager ,, , , ,, , , , , W , ,Dean Uvertnyer 5 .Xssistants,,, H ,Frederick llansen, Pat gle, Albert Birch 12221523 Secretary-'l'reasurer,, , ,H , N , l'lelcn R, Tanner 'l'ypist,,, W, , Xlargaret Davis .llI,f'I',fCI'J' Principal H ,, , , Xlr. james A. Pollock l'l11'13llCl3l,,, Mr. Merritt C. Nauts Ltteraryn, , ,W ,h'lrs. Alice Allen .Xrt-,, , Miss Flora Carpenter Om? I1'1cmI1'1-tl tlrfnly-fitrc f j 2111112 A -. , ,ft f ..... f . ff .V f ' ,.., 'f .,,. f ., ' V ' C ' , ..1'f' ' . C Ql1l.,, ff:::.,,if ' nfn f . R A ...... f ....., 11 ,..., . 1515 ...,,,. , 3+f'f Y f , 1 ff , . wma... wwf -Q r. W,,W,f,,,,f,,, ,,n,, WW q,f,f.m6g74mQf..W,,.. .,,, M ...W N, 1 , f of .121 'Lfgi?Q1:p, ,NW tw. 3 qjjj ' V ..,. je , 211-Lan ,.., M f' ff' X 'N I 4 J, W' fv',-'v -' '-1 Efiyyu ...,.,, U K 1-. ,Vx drrff f 2 E' , 4 M , 1' fftwff -'I'jM'WW 'i5,1 'ZV' f' - ' 1 ff! ., f'v.,,ff mf2ff'?T'ir 1 f ' fif' 4'2f'7 'Z'r9?Zf9 1 ---H., 111002: V . IW 5 ,,..... 1 , ' f ,,.,. 4 211111112 2 V 2 FORUM LITERARY SOCIETY 3 ....... Founded 1905 Bdotto- , , , -Satis Eloquentia Sit Colors- T , - ., ,,B1ack and Gold Ojficeff 1 Robert Tewksbury, .. N ,W - . ,,. - Prefideht Rolland Gladieuxn ,, , Vicf-Prffident Bernard Gladieux T W VVilliam VVertz -T , Donald McClure , H John Bayrniller- ., XVi1liam Trotter, , Trfasurer Recording Secretary as 1 4,1 ,... Q .r.,, ' 4 , ,,COTfKJP071Li7:11g Secrztary 5 H-,-- . 5 Z Camo? , Chaplain T 2 i , ' 'HA' . Lorenz Schenck, , , f f wSgygmnf-af-A1-my l 91.111114 l 5111115 5 Q ,,.,,,,, Q 3 I gllllfflg 5:1133 5 5 .... .r.,,,, 5 21:15 3 V' 3, ..r... 5 1 giiiiilfg '- , ,,,,,... Q 1 ,,.11 i 11 ? 5 ,,.,.,,, 5 2111122 1 1 .,.,,... 4 ' ,,,,,.. 1 53111115 ' ......,, I , ,,,,,... 1. ? 5 5:11:32 EM .,.,.. . Q .... NIE 5 '----,f 4 s 511123 1 WJ -1 , , N 5 4 5 ..,,,.,. Om' ll'll7l.lIi'Pd !u'011fy-six T 1 ,,,. ,,.,. 1 ,,,, 1 W ,,,,, 1 , , .,,,,,,,,,, ..... , , ,. ...... - 1111? A , ,,,,.., ,,,, . 1 .,,, ,,,,,,,,,,1.,,,,,,,.. 7 ,,,,,,, .1 M ,,,,,,,.,,.,,, 7, .,,,, W ,7,,,,, ,. -,A .,.,. , XM., W,,,,,ff'f! ,,,f'ff-'ffifff fig 11,1 1 .,,, , 1 ,,,, 1,1,fff:f111l1Cf ' 1 wif' 1 , 1 f, iw-f? ' f ' ' 1 Ziff-f ' , ' f .,,, M-Ulf 11644 ,,,,, 1 ..,, 'zz '-'- ,',-- V 'If' 2 :gg ':2.f 5. WW, mmfym f,h-Mff-m,M::4,,W0,,M fu- 7 px -4 , - mf. .,A4 ,A.A,.,,, , . f--fp-as Z 1 1 s 4 1 4 , 2 5 Z 4 , . M , xzf - 1 llddl .2..a:v.,s..g v , ,X ...,, Nm, p 4 A V, 5 -'ff' ? ' WX Q....-.,,Z'1,.gyMC3f 'f '31 f ' U: , x A f Z. fl wr W, . ,WX ,M ,Q j4!'f'f K 1- W, .Liza ,fs , 5 212 f .gf 'ruff -tg Ffa ff A ,M f-..1-xfx f'--gf-we-453, .f --N. ,1 ww fem .,,. ::z::1a:,..m..:.:.:..,aaL:6ff' V 2' -Y-gf'my--Mywl,-Myff-111.-1-wmm:,...a,ff-meer-,Kx2::..w -f-I-...ii..1:....2.-12' ' fflfi , ..,.., , ,,,.... 2 l 2 ..,.,... . 1 ,E 2 QI? E f '11't 5 6 , ,,.,... r ,,,,, 1 5 .,,..... 5, 1111111115 glilliili , giiiixij Vlfffa f 2 2 ,... J 5 ..f- as 2 ffff he Q gm--4 I ,,,, Wg 3 k- 4 i FORUM This year the .Forum has maintained the vim and vitality that has been characteristic of it for the past twenty years. This has been clearly shown both by the peppy meetings and the enthusiasm with which the boys have entered into their Work. The football victories over the Quill and Dagger and Engi- neering societies show the all around development of the members. The initiation held at Grassy Creek will be an everlasting memory to the members, especially the candidates. The Blue Bird Frolic, the societyls annual dance, was one of the line social events of the school year. Both the favors and decorations were characteristic ofthe standards set by the society in former years. The Forum closed a most successful year with its annual banquet which was held at the Yacht Club Where addresses were delivered by prominent To- ledoans and members of the Faculty. .Q- Ozw l1un1I1'f'zI iu'rfnfy-.vrfrmz 1 1 4 4 2 4 N112 ...,,.,, t ...... .41 2 ,N .....,. f- f fe -'---- 3...r.,4 A ? 'Q rwi fl giiifjfg f--ff' g 21115 T ?:::::5 . 3 .....,,. we --A' 1 2 3 ..., 1.3 . iid,-f,,-4 ' 2 ,,,, ...Z 2111111112 r 'i fl f 5:11:55 .2 511112112 5 1 1 l 5 , ,....,,, H 1 ..,. 1 5 ,.,., g 5, .Nr , l 1 r ..... 1 3 L ........ 1 2 I . ffffflf .... E L .J rf-4 3 gwwg L. ,,.. .Ag i '1 5 rw-1 I 5 ..,..,, Q. ,,,.... ! 1 -'-- sz '- 1 1 r .,..... 43 W ,,,,,,,,,.,., ,,,,,,.,,,.,, ,.,... , .,r,,,111,. ,WW .1..,,.,.,,,1,,,,,,,,,,..,,,,,, N .,,,,,,1 W ,,,,,,,,,,,,, ., ,.,,,,,,, W an ,,,,,,,. .MM ,,,,,,1. M ,,,., ,,.,,,, W ,,,.,,, Z ty ,,,,, W ,,,,,,,,,,, ,, Z , ,,,r,,,777,,,,,,,,, ' 1 5 .......,,.. 1, 7 H ,,,.,wfiii?'fL ' ,fff , f , ' ta -- , , V- ,aw - V ig a ,.,,..., .,.,,,. .fM,,5 5 N ,my A, , -f... ,V ' ,.,, , ,,,., ,.., . .Mi -ifmf, v fu 2,5313 'ff if .,,. my-Lf' Mfefzff .... L, ....., fuzz,-,,.,:..:,f.,. 4 ,W-f z' H L - 1, , NM, ..... .......c..a.,W, ..., .,w,,,.M.,,, 1. .- , ,,,,M,... vi 1 ' M., M, .,.,....,,.., W., 'Fc Z S I f'--- -.f M'm.. '- , ,1'- f 'fi ? -hy, , ,... ,,,, - name ..,,. g Q, .,,. 1 A if s 'W 5 I f 9 --'-- ff-Mffewzztv f ff K ti. 1 .. ' ,J X J l ,.,, ,,,, f ' fix! We H M w.,yaW,,,f Q25 f gy ,lx f 2., 4, '42 W, . ,, 4 f fff,,i ,, . , .W Ja. 2 , f ... . f i 1 ef y ,,,,,,,, 5 1 ....... .Z 1 T Z 1 4 2 ----- v--1 1 i L .,,,,... 4 1 5 4 i I ,M Y ...,..., z l PERICLEAN LITERARY SOCIETY Founded 1901 hflotto- , , ,M - -Nulli Secundas Colors, , , ,,,, - ,White and Gold 0jiCE7J Ruth Lee .... .... ,... , . - - ,, , ,,... President fffiffffi LaVonia Knisely- - - ,,7.d... Vice-Prefidem Myldred Faulkner, , , , , W , , , Recording Secretary Ruth Woyame ,,,.. , ,, C07TKfpO11di71g Secretary Margery Best ,,,, , ,, , , , 7 , , ,, iTrm5urer '-',1 Helen Snover, , o W oCm5or Hazel Blair ..,,,, . - , , , Reporm' Nlyldred Bittern, , Y ,,,,,, Chaplain VVV, Ruth Huenefeld . ,, ,,,,. . o , ., - , ,, , -Sfrgeafzt-az-fI1'm5 PERICLEANS Softly the door opened. A young girl in her ,teens tiptoed into her niotherls room and whis- pered, HR'IOtllCI', are you awake? Klother was, and she was anxious to hear what her daughter 13 had to say. jjj Oh, mother, the Periclean dance was just lovely tonight! VVe do have the best times! ' f 5 1112 2222125 liillfil iiiiiil fffffff' ll ' g ,..,... X ' 'E One I:umlv'0rI izrvniy-eiglzt WW ,,,.,,, W M ,..,...,, W ,N,,,,, s,,, ,,,, W ,,,.,,, . , ,,,, ,,,,,,.., . .......... ,W ,,,,,,,,.,, X, ,,.Zi,3.,,Zj5,Z,7, ,,,,, ,, f i' H W 'lf fif'L r ,,,l355g,:4jj,ff' ,fziy , i -.-.' V. i ,.,, f ,--i ' f, f 'X f ' 'I 1 ,ffwzwmfffffffw ,,,, 1 'qt' , f M -- 'j 'x 1 1 I , . -r .N . N ,,,,,,. ..,,. . .. '44, sn ---w.f'o,,y 5 57 sf, I ,gjfdigg ff- gi Q-5 M ..,,,, f 'f1'f. ' ,cafe ff X -. .... ..fj..,fff,'.-J V f ,, f-fi ,.., ., ,,,,, ,,.. A f1 ffff! ,Z .vs ,, f--.A ,ah fe V'1'f I 2 ij f vv , m, va. -a ,H-A f W f'T'f 'W J --V ' Zfffffl giiiiiii y -- - 1 tiififii iiiiiig f ifiiiijl 3,129 51513 i ffl 5 'flfffl iff? .iiiiiiii 5 fifffifi A , . , . . lXIother's eyes were reminiscent, as she thought of the things the Peri's had done in '24 and 25, when she had been in high school. She had taken part in the programs herself. And then ivjyjfffi 1 mother told of the pleasure of learning about King Alfred, and the Anglo-Saxons, and the relig- ious and social customs of that period. She recalled the delightful ballads of Robinhood and his merry band. She had enjoyed, too, the writers of the Elizabethean Age. The Perl girls, she f .... felt sure, had gained considerable general information from those programs. How hard the girls had tried to live up to their motto, Nulli Secundasf' jjjjgjj Nhlother, did you have such good times as we do, when you were a Pcrifl' , , . . ...xi Q Awakencd from her reverie by her daughter's voice, mother began to recall the social activltles sg of the organization. ,1.155..i , HYVell daughter, Ruth Lee was our president, my senior year. That year We started things going with a spread. Then came a theater party. l'll never forget those 1n1t1at1ons. 'f How frightened the candidates were! But they lived through it, and were able to attend the 2 bridge tea given at the WVoman's Building during the Christmas holidays. As a climax to the f year's activities, came our annual dance, that never-to-be-forgotten USh1llelagh Shamblef' But zlifilill there, daughter, it's one o,clock. Quite time for you to be in bed. Q Just one more question, mother. YVould you have wanted to give up your privileges as a Periclean? xiii No, dear, not for anything. Go to sleep, now! Good night! Good nightlu And silence rei 'ned in the house. is .,.,,,,, PM--s 2 i ..., ,, ,A T a , , Q ...,.... 1 a v 'E 4 4-4 -- - Nfl p,,,,,s.4 'E J l .,..,.,, 2 2 ,twml , 5 .,,..... 5 ' ....,.. 4 , 5111113 ima l ' 1 , ....... 2111111112 , ,.,, W5 an-I-as . L ........ 2. .....,., 5 , I l . .,,.,,. 5 2, .M 5 1 WIS l 1 l Qlliilflfg I 22112 5 V if-W4 Z f-M --f'f 2 5- f One IlllIllIl'l'4I twenly-nine ,rm-2 i 'Wz Vwf M,,,f XL!!! 77 ' llvvl H WM ,ily !.?f,,..., NW, Mwjl?,,,!,, I! , ' f,..- , , 1 A, f..,,, ..,. ' ' V ' .,,., AW, .ff '5::::wmw,W,,ff,..fa,,,,,,,W7.....M,W'mWlWNW,,A.. ,.ff 5, .... M, .,,., . ,,.,.. ,,,,, ' ' H3 '1 :ff '7 . mx, QV, -3 I f'Wu..., , ,:n!'h '-'Tj 1 my ...., if' if , 3 I -,X 4 1 W Z 'f f- 'f '-'f XWZVZZIY f M-45:2-vw' ..., z ' U , ? e W! ,, . july! Z1 M2 .Jw ---v--f X aj--X v. .,,, ,,,,, Q ,f iw' nw , N , 1 1,1 'ff.,j:H iw-A-W ff' 1 l M53- F- f JY 3' , -0135 f 5 --.,-,. yf H.. N.: fvwa V, , f Q f 1 .A , 'M' , Wi,-,. , m..,.... W ,,. . . .,1:.,,..,,., .uw mf- l, , .M ,,,, ,Mh,,,m,,,,,,,,,, ff .,,, ,:,,,,z,,-,,-o4.Q ...M-,.,M..z4,f4, ,ev-4...-,..-WM ,..-1 an m.,.Jm.... ,-.x!eerr..,..-.,.,,..-...nw4..21svzfx'f7W,arff.,, . ,...... 4 1 5 .,,, .4 2 1' 1 ' fr 2 ?'111111? i ,.,. r . 1 i 4 4 I i 1252352 , A 1111112 5 QUILL AND DAGGER LITERARY SOCIETY Founded 1914 A Nlotto- - --Fratres in Facultate Colors- - .... Black and Gold 1 055687-f John White--- ------- --------- P refident Glen Cole ------ ----- If iff-Pfmdm - - - - - - - Recording Sfcretary Ralph Heinen ----- John Thomas Beck-N 1- Correxponding Secretary , William Elmer ------ Mark Winchester-q - - -Chaplain I 4 -------------Trmfurer Hz , ,,,.,. f 'M ,M JOSCpl'1 SCl1ullCI'--- - - ------ Repofiw' 1 W1ll1am Thayer- - - -Sergeant-at-Army 2152 g 1113112 11' 11 TT W 31115 1' lfmlql 1 1.', Q lffffffj Q 5:1111 i i,.,.,...fl . 2 ,,.,,,, JZ Q ,,.,,,,, 2 5 , --ff-ff 4 2 T -frl ws 5 .,,.,, Z .,.. 1 11111115 0110 llurldwrl Ihirty 1 ,,,,,,i fl , l 1 K-,1ff.21' , ,,,, f rrvf ,, ,,1,, 1,11 ,,,, A ' , - V ,,,,,,.,.,, fff-q' - f 4.::wmfmfW,,,.-,wff -- .1 -WWW ,,,, W, ,,,, ,,,,, ,V-7l,,,.,,,..,gfi5555WyMm ,HW .,,,,...,,,,,.. -,,, -V 0- ' 1 V' K V-..,t x ........,,.., w. wr-, ,mtfey - -ef H, rg flmiiz, ..,, , ,,:,x, .,... 7' f X VN wh 5 3 Ns QW,w,,1z,mE,,.C?4 ., 3 ,,,, al-.ai rf-. QQ I ? -X? . if -1' WxIp.cL,f M' X N-.,f.g,fcfa-J V- fjiby -,.,,M fs A Tjfffff' fe w SXT f' EW. ,.,.., - if 'i 'J'j 'is XM' is-mf fm' ff '-'XT' R .5 ,. f'.,l X r '17 w f 'JB Tiffin :mf 5 A' fx ff f'W ' .,... 1 J. M 25-1 T-1' - ' ' Q ...... . giigijiiii 51111, , , ,,..... , ,,,,..,l 1 f '1 f ----- --4 Y , 5231.3 ' ,,,,., 5 , .,., .5 x ,,,,, f 2 ,.....,. 1 3 f 5 i giiiiiiit 2 ' ffffffff i ZIILIIQE i I ..., 4 2 f illlllllf E 1 E , ......., , S f i 1 Z z 1 5 ..,,... 5 ,,,,,,,, ,,.,... S Z fffffffi i ffffi Z 5, .,.,... ,,,,,,, gi ....,... 3. .,,... , ,, ......., .... ,g ,....... , ,...,,, ,, 1 , t.,,s,,,g ,, 5 . , .,,, Mi? 1 QUILL AND DAGGER V , ,,,,, ogg f A group of boys who Wanted to become better acquainted with each other, and with literature, banded together in 1915. This year, under the direction of 'f .f 1 a ---- i ohn VVhite several interesting s eakers have addressed the club, including ,giiiiizi 1 . P . . . - I , Judge Cohn. The papers Which were glven by the members dealt with American 1 authors. .,,,, The Q. D's. took part in football and basketball, having as their opponents E 4 .a,,,,,, , other school organizations. The annual dance, the Stilus Sicaquef' was an 5 .....,. ,gi unqualified success. The gymnasium was beautiful in the society colors, and the company of dancers Was a merry one. The Q. D. banquet Was an affair of 1' late spring, which gave the fellows an opportunity to offer good Wishes to those i l f ,ms who were being graduated. The society aims to contribute to the intellectual and social life of its members, and to advance the interests ofthe school. W4 3 'W-all had 1 ' ..,....,, - 5 giiiiiii , '--- 5 2--W'-4 , E ,,,,.,, ,,,,. W , 1 L ....,,,, I 111121 ' 1 I 2 f 1 i ,,,, , , ,.,,, M , 5 , ...,,.,, ,M , ,,,,,,, 1 2 fgzzizif VQ 'M 2 .....,, ,1i11:i2 f 311111113 im! I , , ..,.. M, E , I f , T ,.,,,,,, gm , ,,,,,, ,, ,W 235:35 tiiiiizi Q '4 ,..,...4 --5 2 S , 5 511111113 5111212 , 5 . V , , 2 5 Z fm? ' I 4 ef-We 1 X 2'-'-ei 1 .,.,.,, , ,..., ,Q , 2 -1 5 , .,,.,., 4 s rf----M1 F Own l:1l111I1'f'1l fllirfyafnu' 5 , . 1 'Q 3.....a4 5 Vvvfl- ami? 'V ' f ,ei sf '- ' 2 f 1 1 I ,.,,. .4 X, VM fa-fa-M.,,,,,,, A V. W ...,.., tw, ,,,,,... ,,,, M ,,..,,.,, , ,,,,, ,,,,,, , MW MW g--M4 H V ' iff ff ff - ' f' ,,,-,-w2e??WZ'zs-,. qw. W., '- V f .fffW ,,.'f l 'i Q f' 1 f '2 ,,,, , , .... ,,,Mfjj?f'ff ' ,.ff6f' f js. M ' 5 , ..,,f.i:' ' 7' 1 f. W A V' 7 'Y ,fi'.,if': 5' A 1 . 1, ,,'5j15 ' if V ' if ..,. .,., HQ Q5 if 'fit' My V ,aff- ' Mfgfifffif' ' fy ,MQ1Nw.4, f- .... f ' ,, ,,., ' ' -,., .:::,,.:::.:.1:gg,-M. ..,.,, -'ima ' 22255515 fy - if ZLL ,,,, .. .,,f --ff' 'V J ..1,. ,..., fnwf ' J! I . 5 ?'1111111? Y 4 1 1 6 f ' .,1,.,,, 2 , 1 1,,,.., . 1 Z ,,,.,,, 2 if ,,,,,,,, gW,,.,4f 5 ..,. . ' 9, .,,. -4-Z 5 i , 1 ,.., 11 , 1 4 z 1 , 1 ,,,..,,, l Q .,.., z ,..,,,,1.4 1 5 e l f 2 , ,1.,.1,,, Y J e 2 ' Q . A if U A 51 'WV . .1 .few - ' ' ' ,F-M, Q' , M on ,1 . V I ,,,,. N ., , ,ff . j N f 11 ,.,,, 1 f11agW,, ,,,,V,, f 11 I J ', 1 . f :f 1 . '- L.,z:zm,1.z - f , A . 11,11 ,X 1 V f 5 V-ff M W ' 'H-.1.,,w,,.,M,1! 57, ,Iwi 5 W fe-, '1 A V 'f LVN 1- .1 ,, .t.Lw,a, X 'V 4 1 I M. 11v,,,,,N11,gMJi ...,,, ..W,H mm W, AW., ff Mg! I 4. 1 ,W ,11,w!,.,M!,Z 1,2 1. V5 ,f ,W M1 Vff.,r,,,1 f f ,A -f '- 1 9:5 f , ff ffidn ,,,, ,,,....1,,.,W W 1 ,,,.,., WL, ' qu .,.1,4,,,1,,,.1,v,,,.1fQ,,,........,.,M,-,,,,,,,W,,,,f..11.w,w-k.. ,Wg--,,1,11,1..,,,Zb5!er'.4J14g..1W.-m.izu44:zzasvz1r4e4,,zs55: WW! m:m.,wf1m1z:w,wwfzff.1:m.1zz1:m .,,, 1m1'fw-vf..1zx.M.1.. ...-1. -.,,1-.,. ...,. 11 1 11 1 2 ..,..,. fi '-'A'f' Z 522111.13 2 1 5 r 4 L. Motto 1 11 Colors1 1 1 Helen Powell 1111 H ke 1 ?11 111f 9 K 5 5 ZETALETHEAN LITERARY SOCIETY 3:5132 5:3 f 111111Niha1 sine Labore 111Nlle Green and Silver Ojicers 1 ,,... 41 .... 5 1 1 1 1 1 Prefident f 2 3 f 2 Q 1' Helen R. Tanner11.1 1 1 Vice-Prefident 11,1,3 Charlotte Tayl0r1 1 1 1 1 1111 Secretary g Helen Ardner 11111 1 1111.11 TTEGJUTFT Nlargaret Dauer 1111 1 1Sergfant-at-Arms Gertrude SaWyer111 11 1 111Chap!am ..., ',' g lX'lary VVheeler111 1 Reiboffff 5 ,,E5Z?f 2:..11:::i g ' l 1 1 1 4 W 5 ,,.. .15 53353 1 Q- -f', -4 12 911122 Q 5:2112 , z -fff 1 1... .... 4 1 211111115 1 5 ,....,,, gg 9 i .,1...,,1 1 2:1633 QE l 1 1 , ..,1,,,. , 1 1 ...,,,.. Ona hundred thirfy-t1I'0 T l 1 1 .,...1,, Mgiiiiij f ff ,fgf f , ,fy , 1 iz 11 ,,,, m 5' . ' W X ,V ..... .1 1..1 I ...,11 .... ......,,.,.1 11 iv L 5, 2g5wf1::j':L2:111x:ffggf1- if 11.1Z11 ff'-x f vvrfv www rrvrr W yyyyl. -..J Z' Q n- V ffklif, ,Saw 'ix .KW 4 Z i 2 1 if fi M ESlfjfff'f'-53' Pe fi ' fi 55f 's'-fQi.a.QJ-3 V.hA.... 5:.,,f5ffff V- IA A Zwiqwl Tw A in -X' 'yffff ,vw F F, f-,473 F--.Him if-.W ,,z, ,,., WW, ,..A, 1 ' ' 5 i 1 2222223 11352 ZETALETH EANS giiifffi .....,, A 1 As I sat in front of the fireplace that Winter night, my thoughts turned back to the happy days I had spent in YVaite. Klemoriesl How they crowded back into my mind! And foremost of all was the recollection of the activities of the Zetalethean Literary Society. Of course, the first meeting in the fall was a friendly affair. The program which had been planned would be entertaining, and so different! The theme was to be Art and the Opera. Through the courtesy of Kfiss Roache, each member was provided with small reproductions of the best known works of some of the famous artists. Then there was the theater party. Several rows of the Valentine theater were devoted to the lively Zets. The Covered YVagon,' was highly praised, and so impressed the girls that at the spread several days later, an ideal caste for the play was chosen. One of the outstanding meetings of the year was the interpretation of Aida, at which the other three Literary Societies were our guests. Mr. Mathias related the story of Aida, interrupt- 5 ing his narrative to play some of the best known arias from the opera. Q Quite another feature of the year was the introduction of the Zetalethean wrist band. It was awarded, a week at a time, to the girl having the best number on the program, the girl with the second best discussion winning it for the second week. How pleasant had been the asso- ciations in the Zetalethcan Literary Society! And how satisfying to have these delightful memories! X I:1::,,,5 5 fftt me 1 ' if 511152 jr Q52 T 5311? 1 l ,emi 1 i ...,, M! sffllffj f I 41111112 X Eiiiiiiii giiiiiijg izzzzii 2 E iifffli lifllfli 5 ,,,, xg 312212 Wai One humlrml tliirty5rhree ,,,,1 , 1 1 . .... ...... N .. .,.... ....., W , M..,,.,t .,1., 7 7, ,,,,, , ,M,,M,,,,,.7,,.,N , ,,. ,,,. , ,H ,. ,,,5fj,5ffff: , X l 3 dw ,I f MM,QQ,,f ff, ,,,,.,H ., f:-i1W'C2 l yr f 111,55 YQ.: .i ? gp., ,': 41'ffH .... 1' - - Z jyfxrhx IVVI yo,-I 1 '- f I ' , u,,,,,fff' 7,01 11,1 ,,f ., ,, .. I:,f?2ff?M4 f, ' L f L35 iff f 5555 -f-' ,fff':if ' ,.1.,,, 5 ,11, '1 H fi 1 ' ' 5 if f '-'- -f W' ' - ---- 5 Q.L1 'g::iif111f15555'5 v4f?2fi5ZZ..i1.,'feQef,,..lL..:,r5y?li .k..ZLf-M2214 ' IGH, '--- L. ...,f -..5 4 ff ' .:- iii-5- '. 4 'zz- 7'?. K. ' ' .w':': r e 'r:::x1wf'ff-+1f'ff5'f effesaf' --- f--- few 'E ,,.. nam, wg:-5,14 Msg..-Q:-'fav-' -H' iv.---- 5-5a a,,,..,, ...., ,, ,c,,,,,,,,, M ,,,,,gp,-LT ,,,, ,, Q. i ,ysx X ,,1, , f,,,. mf-, , f-'A- M -ex 'we 4' --,f , IJ W C211 .....,, rxuqugy .ANC lil li ,yn of ,J i J of M 13 k,,.,.,...1i..,f if-J i f- fffi ,. ., W 'plfflff' . M ...fa ff, 1 l KIotto,,, Colors , ,, Helen A. Snover, , , Althea Phillips, ,, Florence Boychell Helen R. Tanner, Charlotte Taylor, Mary Wheeler ,,,, Elizabeth Nlorgan, , Om' ,l'lllll1l'I'li llliriy-four' FRIENDSHIP CLUB ,, ,,,, ,Builders , , Blue and VVhite Cjfiffff ., , , , , Prefidenl ,, , Vice-Prefidmzt , , ,Secrflary , , Trfafwer -. , ,Chaplain , , , , ,, , Raportfr ,, Se1'gea11t-rzt-Ann! 1:2 'Q V i 5 fx , fam ff w,,, ,L gf we 211111212 5 22111113 2 Y Z l 5 E fff f'f z 1 r , i L13 Qiiiiiif E ' g 2222122222 Q i ,,,..... 3 . ? ' jffffjll ...J 1 , ,,,,,... 1.3 2 .MQ Q 5 wk ---- if : z f ,,.,,. ..., .,...,,,.. ,,,, , ,,,,,,,, 5, , ,aff ,f'ff',ff ,pf , M .ff ff, fl.. 2' , K ,.f 1,ff ,fjf - f , , ,ngigyw 3 , 'vid' ff' f vi , 1' , J '- 1 -330112 ,. Q fl ' ' 4-ff-f..N,,MW,,,,,M5,,,gf,,,,.ymh,:7 '' ,,,f ,,.'f f,- f 1. ' , ' .' - ---- 5 ' fff: f 1 f' ' li ,H 1 1.ffv9fi'52'2i 62 5 'H ' ' I f ' , lf' uf s' M, wa:-:::'1:m.1-f.Ag' - -W, -f , , ...., -, ,' ,ff- ff ., V , ,.,. . ,gm ..... ....... .V f -. 2pvwm,.m,d.,.a.w,'r::',,,,, -' - '--- N . 1 ' ' 'fgiiwl ,,,., ,W,.,,,,,,N ' f xv-,f ,GX f f 'wr ,,: V , 'I K, Q X., ,W ,,... ,, , X, .,,,, C wa., W .,.. ..,, W. M. 2 2 X K ,,., f' Q H ,,,,,. , f 5 .... 1 1 f , if .if f N-, llyr 1 f,,,i V . , V .1 fi-.W ' Z 5 f f ff JE 2, W' x..,,2.,,W,,f .,, ,W 'T H ju A 'ff hs., I--,ut ,. , 1 ,.. ' 'f ' Cy -w . -M, . . 1 '-'- 1-lm. . f- 1 , V2 f , IVVV f, 'Inf ,+M,uZw ',,,..,..,? 5,361 f X 1 IAM ,M E' lv VM f-twifgs JW rn. ,f ei . gy: if V., N.. M ,.,. wma:Maw,,me:.w,:,::::zz:p.Narf4:z,a,zM5252.Mak.aiu:ma:aw:Wfrm1,1Wm.,mmaf51:wwm11Zm,:fy.a.:m,.am .... ,,,, mz1,:..fg1,.,,ffmfm,:zw4:wAfa. f 1 1 K , FRIENDSHIP CLUB Splash parties! Plays! A banquet and-oh so many things to promote good fellowship among the members. The Friendship Girls have enjoyed themselves thoroughly this year, part of that entertainment being in the real Work they did. Of course, first of all came the meetings-meetings Where the girls gained inspiration for the things that Were to be done. Every now and then a splash party Was the order ofthe day with a pot luck supper afterward. During the year, Robins Irish Rose, a playlet, was presented by the corn- bined Friendship Clubs of the city. The party given With the Hi-Y Club, and the lylothers' and Daughters, banquet Were other social activities of note. The Friendship Club provides social and religious training for its members. It is one of the important agencies for the development of a high type of young Womanhood in the high schools. Um' hlllulwil Ihfrly ffm' w,NM....W ,,,,,.. , ,,,, ,,....,,.,...,,, Y ,,,, ,,,,,,,,, ..,., 3 , 1 ,ff f f f 'f2WWZ,W,,LfM, ., f-Lf., , . ' , ,. , f MM ffmy, , V I Q. ,- f ,--- , , ,Haag , V y H, 1 -'ff ,,,, ' . 'f7fLfL2 ima ff Jw. if ,,.,,..,f.-Wm., ,,,.,,, -1 ,M , 1 ,Y -V,Wfu-Wm,Wm...... ,f 7 ,,,, N 7.,.,,0,0.Jl f X f ,fy .ffff . V., .. If , 0 MUWM0,,,Wm,,M,f-1.-ffWm-uf1,LW,,4,,a f- f .1 wi M ti ' '-1510 I 1 f ef'y . -- '- A - We f 'rw 'fi 1' 4 'V' .,,. 31-M y ff -f.- V'-ii.. .L-M K il. J 7722. ' Nw .,,.Aa.,.7 K . , S W fr, ,V f, 3, , ..,. .. -.uf .WX wwf-R 2 Aj .J E ,z it R152-MMM x,,,W5Mj 5.1 ---7 X I N ll NNW, :, 1 V, W f M.. .Inf Xu, ,, ,aa ,,.,, fjwmxqfj fm fy, My f 43 ,, M ' 2 f wf , fi- Wy' f a z 'ff' , , f V , M f fwf f-'ff My f'f...:.:1.1 .... :f.N..z:, ...,. Zin ..... ,w4:,,,,,,,:g.pp.pv ,,,, ,,,1W,a.1,wMm::W:fmc1,11m5,.,W .... .aaa .... ..m..,m 55 f,.. L ,fe QMWZW2 .,, 1, ,f M., 71 5 SENIOR Hl-Y Ojficerr Glen Cole ,,,,,..,, ,,,...., ,,,,.,,, P r widen! Robert Tewksburyt-.. - , -Vicf-Prefidfnt Ralph Heinen-, ..,, , , .,,Szcretary David Pugh-, . , , , , , Treafurer , Wilson VVertz-, , , ., ,Chaplain Klark VVinchester . ,. , ,Publicity Donald McClure ,,,, .,..,,Sorial Wiilliam Wertz ,,,, , .,. Program Bernard Gladieuxn, .mdthlfticf John Wvhite ,,,,. , . -fwufic SENIOR HI-Y CLUB To create, maintain, and extend throughout the high school and the com- ' munity high standards of Christian character-that is the object of the Hi-Y Club. Clean speech, clean thoughts, clean scholarship, and clean athletics are continually emphasized, as a means to attain this ideal. One of the high spots of the year, was Dr. Nlahon's inspiring talk on voca- tional guidance after which all the boys were given an opportunity to interview some prominent business man who might aid them in choosing their life's Work. At intervals through the year, hflrs. Allen gave Bible talks, and Nlr, E. V. Reed helped the boys in directing the work ofthe club. The year's social program started with a Frosh mixer. The Nlothers, and Sons, banquet followed later, and the Hi-Y-Friendship party. At work or at play, the Hi-Y believes in putting first things first, in an effort to develop Christian character among its members. One hundred thirty-sir , W ,.,,,,,,,,,,, I :: I , ., . .,,, f ffQQff::::1,,.f.11::11V., ii ' inf -'i'-fi- f ' -. ,am ,,,,, . 'Wm ,..,. W.. ,H amw, MMM ff .... '7f ' M W' ' ifx Q ww, , ,....., , -, ,.., , 1 I LZ' fm, CZ... ..., ,VA HA T f' --X in 1 f f 1 :::2,.-- ' 53 .VY .,,f .MI -, , ' X ...Q ff l N'i t f.- MM? .... ,, 5,1 if -J V' A fc Q f' 3, ,MH ,, ,, ,M ,,,,. f, 7fj1ffff,fi W., ,,.g:z... , M. M ,V fV .fa f f ,.- rs,.,,frw. fb--fa--.f Og: 5 -',! ' . ,... ,333 . ,....... 4 gum, - 21122 f 1 Rolland Gladieux- - - VVilliam Gschwind- i f f , ........ , , . ,..,,.. . 511111112 Q si Q ,,..... 3 Q.,--.1 1 Wi 1 ,-., 1 K M? 1 ,W-M4 ,,..--K , ..,.... f - .. 1 UN l OR H l -Y f fficwf ET, gfifiilii 9 ...,.,, 4 - - - - - Preiidfnt - - - Vw-Pfmdmf - ,.,. Secrfmry i ...Y 1 Nlyron Hissong- . Raymond Gladieux-H - - -Trefuurer Donald Cooper--- -- -Chczplmizz JUMOR H1-Y CLUB The Junior Hi-Y has been an active organization during the past year. The Club started its year by building up the program along the fourfold development of Clean Speech, Clean Habits, Clean Rloralsf, and '4Clean Athleticsf ---- M2 .,,,,,. ? ..,,. my with each of these ideals being molded in its meetings. , ,,...... Q On November 7 the club held induction ceremony for the first semester at Grassy Creek, and for the second semester on Xlarch 20 at Wfaterville. 21:11:52 i At different meetings during the year the club heard Xlr. Pollock, Coach Collins, Rev. Nlotter, E. V. Reed, and Doc. Miller talk on subjects that related closely to the club s work. The athletic program was carried out very Well especially bv the Clubas A of the other high schools, , . , 'I . V V f., A uf ,,,.. , , X , , 7 f . basketball team which Won the City Championship from the other Junior Clubs 5 ..,,,,. .f Ona l111ml1'ml fh1'f'i,1f-xrflvn 2 ...,.,, ' - W.. V W., ...... , .- ..., - -7 ,,,, .. ..,. ff'- , Q lg-sg?':: '.:z:i:t?Zf, - tl ...1.jif,, .. V V f- ' 'ff 'V V .,.. V 'i1::1..-55:1 - , ,, ....,. f ,, ,.,..., M 2, ...... mmf t.L,f1..'.::' -M ,H f .LV . -V f-f ,M W .. VM, ,VW .::',V . .. ,- , , ....... .w'f::f.7fff--ff'3'g.wfff'wwm::fm.-WV ,,,,,-Jw uni M033-6:1 -Mg, ww'3f7-755' --w'..W:.,w ..,. ,,..,-wyfiflsiw .. .... . ...... M 2' . W ,fn MV.. M, ,, ,vw 2, ..,,.. 1 5 'S 2 5 ei i ' z ,A WM A ,-,- aj. wh! ws ,, .A,, x fue-an -M . .ff K-my -. C112 , Q ,,,. f .mx ..... 1 in , yy 5 1 Vs 4,M,,,,,,z,,,a5fVC, . ,,,,mi, ,ly f Q, K , , M' M, M,f'v..,,.kQ 'Jef j V... VL ,,.. AV 'A -vA ft. fem '-VAA NVVV f ?f,4eW,..WMi,Wf?g. ,... z.,mZffffi...f:m 1 ,,,y, A .1v,1m,,m:M4mW..m.mwfmc:.fM.1xm,m6-.,WMM .,,,. mf ,,., ,af :MM ,,., f 5 T? I 1 1 ALTOBICE ART CLUB I Ojficfm William Whitcomb,, C .s ,, President Nfarcella Haas , , v ,,,,,. Vice-Prefident Phyllis IMillard,,,., . ..., Recording Secretary 1 Nlargery Best- C ., , ..C0rreJp0nding Secretary , Joseph Schuller- ,. , , , . .. , , ,,Trea5ure1' Eleanor Majeslia, , .,,Cen50r VVilliam Dwyeru, ,, ,,-,.. CRKPOTIE7' , James Parrinh, ,Sfrgm1zt-at-fIr1nf ALTOBEE ART CLUB In the spring of 1922, the Altobee Art Club was organized With nine charter members. Any pupil in the art classes may join the club. The meetings are given if over to chalk talks and discussions of the Work of famous artists, With sketching parties at the parks when the Weather permits. At Christmas time, the club 1 ,,',, sells hand-painted cards which are much in demand. The annual dance given ' by the Altobees is always an attractive social event. ' At resent the membershi numbers lift f-flve and under Miss Car enter's P 1 P 5 a P direction, the organization should continue to prosper. 1 Um' lfnmlrwl lhirlgf-wigflzi fi vvvv 5111.15 5 ...,.,., if 4 2 M.. ,,,,,,...,..,..,,,,,,,,,,,,,,,,,,,,,,,.,,,,,,,,,,,,. .M ,,,,,,.,,, .WM ,s,,, W .u,,,,,s,, .m,,,M ,,.,,,, M ,,,,, , W ,.,,,,,, ,,,,.,,, , W ,.,,,,,,,,, s,,, ,,,, ..,,, 3 , . ,7,,3.7,,M,,,,...w7.W ff' ,f',,,f f ,f ' f ,, ,ff ff! ,,w,.,, .,,.,,.,.,,.,.,. M f ,.,,,,., , W, WW ,,,, I f ,wf ' wffiv 1 1. EJ fr- ' f W.. ,. ' ,.f'f' ,,f .. , , . 1 514,53 - 1 M' ,,..,3T,f.2,.m,..:.I H ' W,,,,1i - 1 . 4 ',.1 H E f', 1 1 f 3 , o ff7'3ff fe ' ' 5 ,,f , ., f f ., ,,,, 4 ---- ff- f 21f4'22f.,.. - ' f ,,., f fs 6 ,,,...,,.:.i,,,,W-W,,,,.,, W,,,,,,,, ,,,W,W,,,,,'fw 'E 'fvmfffWhfwfmL. 57hJ:....fff-,,s,,,M,:.,gHW, V' ,Z A 1 . 1 M X Z we -, 5 u -D ,, ,, u ,, .,. e. X ...,,A . f . ,.., R -- f , ff - I ws ugigmly jjgjgfkgj Q aaa, ,- ff f--. W- ,I 5 J ----f--'------' 75 .Lamb xx A , Q 2 ...,,f -ff S-...fy , it ..,.,,. K-X--ff V' 'z 'MW 2 fi in , f.,-. 1 iff' f' if f. if , -.df f1 'W,-fig: ,ff,',,.-fa fm ,,.,v,f.w,s wptf' it gy.. --ay fu, ltr' ,,,, .,., x .,,,,,.. 4 1--N---4 ,. ..,,. .3 . , I r ,- ' ...wi 4 --5 X 1 f 3 .....,,, , f 23115 1 4' 2 ima 1 ,,.,,,,, 5 Q ALCHLIMIST SOCIETY Founded 1922 Colon: Litmus Red and Blue .4 Oji-CPT! W1 Etheridge Irwin--- --- -. - .--President Hazel Blair ..,, - - - - Vice-Prefident Althea Phillips- ,,,,,,, Serremry Chester Idczak--- ,,,,,,,, - -Treafurer lrriiy ji John Baymiller- - - Sergeant-at-Armf 'jjj Arthur Kroglc- - ....,,, Reporter Julia Palmer-- - -Cemor ALCHEKIIST SOCIETY JLZLZLZQ 35:55:13 I ,,,,,... 4 The object ofthe Alchemist Society is the social and intellectual development of its members. This is to he accomplished through functions, lectures given by chemists, and essays by the mem- bers of the society. ffffffffl , v , ,,,,,,... 5 On a chilly day last Rovember, the society held a roast at Howard Farm Beach, as the 'Cifififj guests of Nliss Howard. All the guests had such a good time playing games and dancing that 5311-,gf they were loathe to return to the city. lhe organization was active, too, in athletics. The boys played football and basltethall, and 533335 . . . . 3 ,,,,... the girls did their best to cheer the teams to victory. 115:15 However, all of the time was not given to fun. The Alchemists took an interesting and educational trip through the Save Electric Company's Plant, to say nothing of other trips ofthe same nature. l,Vitl1 the coming of the end ofthe year, the Alchemists will travel dillerent paths, but always they will take with them the memory ofthe good times spent as members ofthe organization. Ona Ittmtlrwl lltirltf-1'u'im t .', ,,.,,, 2, .,.,.,. '1 we M ,ff 1f' ' ji' 1 Xf jf ,.., ,W ,H , ' ,ff f Vdly, f' ,ff 1 W,o,,35g11L,4ij,,fIf ' Aff A f ' f of V V V ...,, .,.. .. ,V my 1 Q ,LW 7-- 'g'gggy,5g1! , lg.: -Mft: 13 1 -,M - ,ll . , C L' 'V f --'-f fft- 31 .tffff ,,.,...e ,...., ,g 'iQLf,f1fN,,i ..,... 5 T W M 'Y Q...-.2 I ,,, , .I N.. , .rw .V ,,,,A . ,K X hc, 5 if J ' fL..,...,,.:y..,,!?-ZZ, u ..,. :QL , ,, If Z X, W1 WJ I'-awk' , WM! ...M ff jj fn, ,J vs .v M 55 . fi . ., ,, 2 ,mf , fa. ,, , ,,.. .,... .... m,,mz1.iffZ...:::::11: f .a1:1::u1.,,r.x..z ,,,,. am,:mcc.fMMme.w:::Wm,:.nW::::M,,,Mf,wjyM,zL:MMgf... .am .... Qffflfffi 3 ' f I ,,, ' a ,v,,.. H2 ,,,, 2 ,,,,,, ENGINEERING SOCIETY Noel NIcClure- , , ., ,... Prefideut Fred Hansen , , I Viff-Prffidffzt Jay Duharnel , ,. , ., . . ,S6'L'7'KfIl7'y George Lane, , , , , , , Treamrer Arthur Krogle, , , .,Sez'gm1zr-az-142'7rz5 ENGINEERING SOCIETY The Wlaite Engineering Society, after five years of activity is still going ' strong. In 1920, with lVIr. Sterling, lXfIr. Dannenfelser and NIL Klag as faculty advisers, and under the leadership of Victor Gauthier, the society made its debut among other clubs of the school. 3 ' Z t f i ,., .... Hg Following the organization of the IVaite Club, Wvoodward and Scott. or- ?illlQQQfl ganized engineering societies and Libbey followed later. ' Last year VVaite engineers presented the school with a beautiful etching. In sports, this season, the club made a good showing, having been beaten but once in live games played. On the whole, the Engineers have an enviable record. I Om' lztlflrlrrwl forlgf qll, L ........ I I W. W., ,,,,... N ,, W,,,,,,,,,......,,,,.I, ,,..,, M ,,,W,,M,,,..s,, .,,,f::4?yf .,. ' iff ' 1 ,ff 7 W W iff? ,- Q .... . ,,.,fff ' f ' ,.ffff '--- I ..,. ' -----' f K .- . f .. ,,,,.'.. ,.fWWf:fmm .,.,.. ,,,,Mw:v::m.mfwW..wMw .. -Y WL, 1 ,ZZ?1f57Ljf'W,,1ggg . ...W 1 4--U ,f X. X X, ,,,, C PM ,.., fir jjfl W,-v f r-f '-t Vx , 1 -if. 1, ,,,,, fa ai m,...f,...,Wf if My my F V, g, ,V ,, K f 1-...Ly ug 'lf-,555 ,gf-hw ,f f , ,., fv.,f'xJ2 j' 'ff ' 'H+ ,I 1' TVX WWWM W f f 1 .... .4 L .4 K2 Q Q lf Z CURIRlERCIAL CLUB Founded 1922 Motto, W , ,. .,, Carpe Diem Colors . , .Cherry and Silver 5 5'- onm czemugs - . C -Pfmam.f Y Kathleen King , Iliff-l'1'f,f1'df1zI llorothy Rahmstocli- SfC'l'f'fH1'j' , Edmund Hansen..,,- , .Y'1'eaJ1u'e1' Florence Perrye. . Rejaortfr Ruth Klachlup .Critic y CORIMICRCIAL CLUB i The club was founded for the purpose of making its members better ac- quainted with the activities of the business world. The programs deal with the lives of successful business men, their methods, and the various industries in which they are engaged. The advisers are Miss Hogan, Bliss Foote, Xliss Fenneberg, Mr. Pearsall and Xlr. Severance, whose kindly criticisms and suggestions have been helpful to the club. During the year several social events, including the SquaWker Squabblef' have enabled the members to become better acquainted. 2 Om' lzrrmlrerl furfgf-0111: , ...... . , .,.... ..,,.,. V ,,,,, ...ffgiflifjiil ,,,.f5Q57 t i t 1f t.,'. V ..1v ffl 'f 1z1zf:Jff'f .1 'rvv -' f1,-L an ii ig ,,...,. ,'g::i ,... ,lfff -.-, 1 1 jliiifd F - -... ' Y vvy- ' .....,. V' ff f.-, , f ,,',,,W-Wwufr ' dwg- lffzffuwmw f .,.. . . ,...... ...A WW I , ,W ,mf r WW,.,,,,,,,,,mmJ4gL,,Na.4MW,,M ,..,vM,,,,.xWW0,,,, W M. ,.,.....,.s,., ,... , ,M ,ku . jf 1 Y , , it u,ywff,,, ,,wNtqs'f 01:77 , - in f,.m.,7A,a-.1 .V f 2 555' 5. ,X neg' x,., 1, ..... .. f' -.W-Ny K gf if X ' , if f ijjjy-gf fy g 6 L .,, , ' X ,f - ,AA. ,A frg,w1 vs f 1 ' , fh' l W, vw. f f ,' ' ,, ' X f' , , ,, Aww: . .. Q -' --5'-' 1 , .. ., 5 W ,ff , ,,,.f ju., 112317, 1 , VI I fm , H! fy ind? 7.. ,, f ff, 51, . j M, Jaw, Maw,wmaf:.Q:msnwksfam,,Manuka,.ffwgfmm:,.w:fw .... ww1,mzzznpe..24.ma:5g,..!m2f122'MZLa.:ieLMfu--,m1:m4,-Ww.Lq.-Qf'--- -N '.www,.-,.M612Z.::r,M.,f,Ms7?,e-1smm..Emmzuafyzfrgaewgga ' E Wil? Z 9 4 4 illlliifl E 4 2 f i 7 I ? L 2 LE CERCLE FRANCAIS Q .2 xi Grace Roenick7 7 7 7 7 7 7 Preridfm 1 i Fernette Bauer7 7 ,ViCK-Pffffdfill Lillian I43VCIlCl6I1, 7 7 7Secretary Donovan Emch 7 ,Treaf1fre'1' 5 , Anna Dancer7,7 7 7 7 7 77ChapZf1i11 t Durwoodlvennenburg 7 7 77Sf1'gfa1zl-fzf-f71'111.f U 4 l I . N . , a - v 1 X ,.,. all L12 LLRLLIL 1' RAIXLAIS f'-:gig gli: I 5 I Le Cercle Francais meets every other Thursday of each month. Only fliilflf 1 - - 1 . . 5111114 L French is spoken at the meetings. Trench plays and talks on various subjects ixzgl are given by the students of the last two years of the language. The meetings which are closed by singing the 'ihlarseillaisef' are attended with regularity and L i 1 7 the plays are given with spirit, and are well received. Scenes from the various WH textbooks are acted by the pupils, who spend much time perfecting themselves 2-- f--ff fi 1 'A fl . ...... A in their parts. The object ofthe club is to arouse a spirit Hvraiment francaisel' 2211211152 among all students of French through the activities of the organization. 'Q 'lm' lllmflwrwl fm'ly-l11'n , 1 ,... 7... ...,,7,. 4, M, ,,.,, ,,,, ,, ,,.., , ..,, ,ff ,X f f L I '7 ' ,,. 'Llf ,,f iff! I 53223 ' 5ff'3:i,,,, ' , pil -. lf , a ,,f,.f7f., 1 ..7,. , f ' 7, V ' f 1- . gqwwaor as' 512- 5 1 ,lf ' ff ., f fm , Q 2 law!! ,, .' fzf N. ,, ,, 1 1 Vffv if-1 7 VV.,, MW7. fffvlvgf bp 1 . , I XM- Ax it M f-- f ,N Lf .,,f c 1 'vs f Qu ,,.., W 2 - gf5.1.., I e .mf I ',.., , fi ' , 1 '----- f.f..,fifs-ffrj -vi 'W i ' M! 5'.,, , ,- 14? ,Z ,V fy f ,fe fijjj' ' we f 1 1 fe f 42 ?'E ,f N Yew f W f 'f 'f ' ' f f 'm...,Mf,.Qm4,a f,,,Mfff,f,W,11 ,.,., 2 'Q 1 z 5 Rixnro CLUB J Gail Beelrnann, ,,,,,,Prfficimi Paul Kfartin ,Vicf-Prefidmz I Harlan Strouse, 7 ,N Sferezfary James Loomis , Tl'E6Z51,l7'K7' f fff'-,fb 4 5 imnio CLUB I A group of twenty members who are interested in radio make up this enter- prising club. The society, although organized only last January, has already ' made its influence felt in the school. Under the leadership of Gail Beehnan, considerable progress has been made. Through the efforts of the club, and Klr. f Iieach's kind assistance, the students of the entire school were able to hear the Presidentis Inaugural Address, on Xlareh -l. The meetings of the club were ' characterized by interest and enthusiasnig and judging from its auspicious be- gggggggjl 4 ginning, the organization should give good account of itself in the future. Om' llllnflrrwl fnf'f.rl-Illrwr K g nf ,fff Wjfefc' ' ,ff , f yr, ,ff , f ' I ff ff! f ' 2 'f7,r..,,f,,.,., ,W ,...., ,,.'ff fs Mx ' V,,f',,! I -- ma- fu 1,2 1' 3 W, g. ,, ,,.,, ' . , W'- l 1 f . .,., , , ,,,,,, ', f I 4 'Q f ,,,,,,,,,..a. , ,,,,,,,gy,1.:,,..,,,,,,,,,,,ff44Q H S ,WMM ML wM,WZvg5WW?,,,f,, .Maw-,,4g5,Wagg,,, -fll W, ...... ,..,,, ,,, f,. 4 , , ,,,,, sf ,,,, , ,f ,,.,,, my fy , ,A.M,,A5iJf,,j 1 , A 1 H ,.,,,,, f! f'jf'f 'Lf ,M ,ff '- V ,,,, 2 ., ,5-1,4 Z, .iyr ff. vi '752ff,,w f' fww ..W,. , W A-A. . 4 GLEIL CLUB , , fjffiil'E7'J Robert Kloorhead .. , , ,P1'f.fide1zt Florence Boychedn, , Viff-Pwfidml 'Warren Burwell . ,T7E!lfltTE7' Hazel Blair, N ,,,S6C7'l'Zfl7'3' iivilliam llvhitconib , Slnge fllzlvzngff' Klr. Ball, lj!-!'1'1flUI' GLILI3 CLUB The Glee Club during the live years of its life, has taken enormous strides in development. ln the fall of 1920 a nucleus of singers banded together, and began Work upon musical programs and operettas, two or more of which were to 4 be given each year. Since its beginning the Glee Club has prospered under the able guidance of Klr. Clarence R. Ball. There are ninety aspiring boys and girls on the roll cards at present, a large and democratic representation of music lovers. The girls far outnumber the boys, but the volume of sound produced by the male members atones for the disparity in numbers. This season the club Worked three big product1ons, Lass of Limerick Townfl Pinafore, and The Bohemian Girlf' The Lass of Limerick Town was an unqualified success. Principals and chorus carried their parts splendidly and a full house was enthusiastic in its ap- V ureciation. Pinafore U resented on lNIarch 21 Was e uall ' Well received. f ,,,, T.. . .7 P . ..i . X, . , Waite, with other high schools of the city, participated in a huge May Festival, when the Bohemian Girll' was sung. Wlith such an excellent season, and with a large membership from the younger Z classes the future looks bri ht for the lee club. a g g Ons llzlmlrrwl fvwfy-j'o'117' Tilt- . f 4 , C ,:!f5 'ff ! 117 'A fllf a i T ff ,f J W iff? . on if P., f 1 , J , ff- f 'f'2 , ,CTW g I 2 i 5 5 4 M f 1 1 3 ,., , ,,,., as., , t - I, ml! ' A My f A 'zax.,,x:Q,,M,,? M, vvv' I, jfffuj V, X ,aff ,.,,, ,,,, , ,f ff 1 M V --f 'f f f f , a. , .,., i , f ,, le f ..A.. 5 3 , 3 M Y,,, iiiifi 2 Y THE BAND Oficfrf Virgil Eclillartw, , , , ,,,, , ,,,, lJ7'E,S'1:dK11l 2 Russell Tschappet , , ,, , ,Secretary-Treasurer ,,,,, , 33111113 3 Lowell Northrup- , e,BfLz5mefr Manager j Dwight Nlotterh ,-L7.b7'd7'ill71 25:12 , Rlr. Sutphen, Dirfrfor li iiiiiii i 11111113 1111112 i Tl-llL BAND riiiii 51111225 The Band was organized in 1922, its purpose being to give training and tiff entertainment to boys With musical talent. Cn April 24, the Band gave a concert, With solo numbers by Nliss Virginia ,,,,, v. . . . , . gffiigifz Arnsman, of Scott, and '4The V1ctor,', a highly entertaining comedy. This year the 5325 band has twent '-six members who are students of reed and brass instruments. 5 a , 'l'here are also a number of beginners who do l1Ot meet with the class, but are , l given private lessons by lXlr. Sutphen. The Band has an honorable record of service havin la ed at all the foot- : 8 P Y ball games, and on other occasions when spirited music was in demand. One hffnrlf'w:l fur!!!-fi:-1' ,,,,,,,., .,,..., .,,,,,,,,,,,,,,,,,,,., ,,.,,,, 2 W4,:7,j,.2 ,,,, f Q .... V ' W,,,,,,7g3fj,,f' 1,47 y iaai 2 , 1 -a ,Ms f, , 4' V 4 5 1 Z 1 ,....,,, 5 1 ,,,,V V., ,,,.,.. , IAUII ,K 1 f 3 1 .,,, ' 1 ,,., Q X VV.. fy '--f so , ' ' J Cjffifzj ' ,,., ,., ,few f , f'f11.,,,,f I, , fvv, . 11, ,V I ,,,,, .. f'v...,,4w, fx Y fm, ywya ,... m,:M-aware. .,.. f.1fgm:..,::1::L1cc,,z: -K-ff 1 fMWf::fM-' -fefe---'WWQWLWWM'-ff f-ff V fA'...- fff 11111111 Z iff? 1, E 4 Z THE ORCHESTRA 1 if Ojicfrf Gilbert Siegelon Q 7, Preridfnl Doris Snover--- , ,Vicz-Prffidenzf l Emily Rairdonne , ,Secretary ' Leslie Leybourn-, ,, , , , ,, ,, , Trfayurer Miss VVerum, Director George Parkin, Marviii Timm ,,, , ,Libmriam I g i i,,i 5 2' , . E11 1 THIL ORCHILSTRA egg, 1 . . . 3-A g A The Orchestra has completed its fourth successful year under the direction . . Y- . . . . Yjjjjt ' of Nliss Bessie Werum. Besides the concert in the school auditorium on Decem- 53:5 ber 13, the Orchestra gave a concert in hilaumee under the auspices of the sopho- l more class of lXf'Taumee high school and has played the accompaniments for the I operas of the VVaite Glee Club. In lylay the high schools joined in a music X festival at the Coliseum. Part of the VVaitc Orchestra, together with a group from the orchestras of the other high schools, accompanied the opera The Bo- hemian Girlf, given by the combined high school glee clubs of the city. The Orchestra has more than forty members and has progressed steadily, ' this year, in skill of performance and in results achieved. Une li1lnrl:'1'1l forly-xI.U W ..,,, ,1111,1 .1., . - 11 ,,......., W, .1.,,,111,,1 N ....,, , 1 ..11.1.1.11.... ,,11 ,,,. , . ! M x , . Q, f f ,:2:,,Qg,,,g,,.a,W,a,,M1' - --'-ig V ff:f'4 X ' , Q,:,f N, 3 M f f 1 i Z ,.,f. ,,,, ,,.,, , ,V ,vyl ig E X .,., kj V ,,,, AUAA, j 'vw T . CCD N Wmnva Hman Scznn n: ., 1 1rgtBx'gS3i?3h1f. 9-9.9 ,V - - cu-c.b3 9.v, 5,Lti,ha,,, I lkiigx 1 ' 1 1 H I .4 5 J: : I I F I F l ' ' -T' I I - - I - - 2 on wnmHnaHScuooL.0nWnwe HlquScmI UNGQERIQH THRuTunT uma-N --W Efii ' - , n 1 1 ,f Q 4 U- Z ga , 7 7 Q E. .,s. Ha. -E. 4 j v if v ve-.zf w 7 7 il I - , 7 : Q us-' 22-wa ! na!!-sea? 2' J 3 '- s- J 5 'QII' I' I' - Y 1 - if-f -- ' ' -5: , qs: er-: - - : ....:- A H wa-vena, Nev - an rm.-Tm A oucH-Down suwsrms TIMEJ M ..,, 5'1 , :: T:: Ia: f 5 '!Q25 'T ug5u'n::.....,,f::.. Er V 7 Er 7 I ' . - 7 3 g AAAAAAV, f 4 pq 7 i 7 7 7 7 7 5 .A,A 1553 22:55:55 5 J . 5 b P P 9 9' 5 ' riff f f - -1 i 5551 Q W . Er E E F 1 ' ' 3 P . ' i , on Wmrz Haqu SCH00l3?ONwHlTE HlqnscuouLwenswuTHYw HLL THE 'rma,- --- Q lilf - I 1 I: ' ' : 1 bg I I 4 7F.F Y f7E..F f E57 ' ' 5 ' ' - ' :H -1 - - f 4:2E,i1z.'r::E::::::':::.1'.:: -... -.. -:-E5??.-f..- 5 ' I' Y' H - ll 1- ' - - T - . if ki V l . D P P 1 I , 5 P II. ' H ' A U - - iff: r I : . 'A' ' : K X gjjw YIGHT' FELLOWSIFIGHHFIQHT! F1c.mfwE'LLlwm - rms-A Gmac- - ' 5 ami ' ' i- ' 1 -ln 1 ::El-Fungi:-11: Z 5 J 12- 4 , l 1 'f5'.!E,iE1EEii:EE:.-EEE' , - -- ' ,,,,- , ,Aw W, hh.. .. is . 4 7 W' 7 W ' Fifi!!! 4 iw- 'H if ' - 1 -35.55555-E gg '- '-ii -Vfffi 241-7 . -0- Q . K 2 OW 1LIll'I1lI'I3ll forly-.wrffn 2 jlllffffff , .....,,, i 5 ,,,,,, 4 f ff 1 ,,,,, , ,,.,., , 77, ,.,,,,,,.,,,,,,,,,,, ,ffff I f',,f ,f ,.,,, , ,,.,,jZ ,,,,.55,f 1 ,,,, 'T ' , 'A ' f ! :vw f H 753517 VX Q,-S? ' x XA Wm X 1 f f J N ff... , , f ,...,, XM ' e W VV.. , , , 2 4 ..,g 4 5' ff g 4215 ,......... xv w.,, ,yllll 1 Z V A , -df ..,, ,f --,', I f, ' M7 X 5 M ' 11,,!'f.f '! 'YN -. ,V ,,,,. ,.,,,, f f .,,, ' I f'7,,,,,ff' ,,,ff '7, -.,, .5 X ..f, VW ,.,,, -vix ' 4 xl -nf' in f'2,.,,1w X ,yf ,,., I Y--W iiiiiiiii ,,,, 2 I I 0 I QQWQ , Qfyfaz 7 0 OM wie Iuhgfi 3 Etmnsu-In A-R N-Burma Qlmvnsmt P Lll't.bhQAyb,WFwn- ...., 1.5341 4 ' F4 1 1' l ' I I , 'I ' ' f iq, - , 1 '- 1 4 5, EE ' , - :E - 1 r ' l ' L0 - Hu. Loy-f.uvuLo Wn.TE- HacH 'We wuu, av-ea , aa' -- ww- I 1 I l j I 2 J q 11 I Ev -an as fx 1 I-nr - I lrg 5 Tl ll V 'lf-l'l ' ivan 1 'll I I ' l I Nz , ,..,,... 5 , L V V Y Ml HE W wr v-V sv- an a yr if oy- Fu. ' Lax -r HL, 'ro on.n I me :qui E ILL E ER, E---' f L L 1 N ,., f ' 'i I 'L : ll - - I . - C- i' V I ll 4 'H'l71IQ'l'l1IV'Q-'-P. V l l-'ISQQQIIIYPI' If-l'f' Q1l'llYlI1lKl,llIfK,l2ll'LHll 3 IK Q PC- - l, ,M -'I-Fl' LD- ID' I, IIIJ-'KI vn ' - -IE ull: X - ' :I HI, I n ng , , .-..,ff f ' ,re A- n Y 1l ,, I L.: f 'WKCKE Cla.. A A Q , , Dar, F uf: i ' vi W, i WW A V : 'Hill : i-YW 'IAQ---:Q :U - In -2 I I -u!i:-- iiiiiiif -H'-fees!! as as - ' f ' Ig 115- 'QI' ' Ir., ' W : ' lv To - HkR H1NORRNhHi.RGl0 - ,RY Lsoqefn -nu.- Q. -rY........... .3 1 1 ' 4 f ' 2 J J J X ' fi .-1 .fjlifl lfflf -Iliff , ,,..i, lf 2 1 7 , '- g 2 P ' -- . Q, gli! ini , it, Y , , ,I v, 1 .llitt I Q 1 V , ' F 1' , l I ,,,,,,., Q 3 To HER ,NoN- on PANB- HER !Gllo--RY,wPupf,zTn,- Dklw- I-W1-Y' vow- EV'ER- ORE, . I : ... - H - A H b - 521223 f Y Q , f1hZ.lf'liK'h..ZlL'fKf . IE ai - - 'il :maxi 1,1 - A-E mn- KT ' UPF 7iHl-V -Q! in ' 5 . W.. Y, w ' ll' 1 It K' Ill' ,Q 'X'l l-, If In ? 'M'i . .. , ' I: Vg... I V IJI1-.1 52:3 5 l .' al 4 1 I- ff' if f y ' 1 P 21111112 I 2121111115 1 , ' ' , X 511111112 i '1 ' I 1:.. ... .w...-.:' - ' b fi E , 1 tlmln ln! lll-1, -lI IQ 3.112211 5 , B , ' I-, l gn I I 1 Mizz? 24. - 3,2 .I ,gi E::::::::Q 2 QLQIQIIQ 2 One' llumlrwl fo:'fy-fiyfflf I ,,,,,,,, ,,,,,,,,,,, ,,,,,,,,,,,,,,, N ,,,,,,,,,,,f ,,,,,,,,,,,, ,,,, M ,,,,, M , M ,,,,, , y 1,,, , ,,,,,w.W ff 1, f ' -' '- f' A f' ii? . A V 22 ' ,. , lilll V ---. ..., A 5.5.1.''::,:,1,.1...1,:-111-v,1-,- ' E ig lL33 i' , f , V f ,,,,,.,,, L :m,WW,,,,,,,.,,,,., ,,,, 1, ,,g,,W,,WmWWu,,,,.,,, f'-ff .4-'fy'--WWZZJZZJ III' l mi ,,,, ff'--W. ',f 2 5 2 1 1 if . 19 . 4 1 ' ., ,M ff,. , ,,., .,...,,.., - , I In W, ,,..,., M -.mf ,uf ,Rf I' ' 3 2' '-R Alll i. ,,,f V- 4 F f' ff ff M MZd 1111. M f A 1 gf!!! If fi' .EA 5 fm 1 A rf 'Y , ,,,.,, , f L H. , ,. ,KWH , f' aff' --- ....- W, , ,I I , 12, ,I--rm., f A x - Q M-A vi 'fl ,.,, Mzmmwm,m:lm5ms.,f.fmp,,.lamvivilifilfmmgwmm.Hemi::azz:1:,.z:s::r4:.:nM.mc4ff?M -wwfuff--:Ll gllflllig iuggggg f ! ! . - gfyfa , QCWQ 70 Ola' wie Pbgfe P 3 .i- - A , I M. . 7. 'I QT ' J 5 ,IQR4 - ' 6? U . I E V X I WE. Wm. 'YIQMTFOROLIIWRITE HlG,n- lscnoor. , 'EVER 3E Smonq nmol muerso TRUE - I 1 ' 5 5 fi ' ' fl 4 fl 1 1 I I F J IQJ J b J 1 - - 4-J I - 4 ' C My lt III F. I I t ,.,, VI ' V V i I 5, V V V 4 Wewni FIGHT req ,ouawmri H4qn5cHom3'Ev-ER BE smmmq Mu lmue, So mae - A - 7 1 ' 2 in I . - : , I I I , : -I 'l -A In-nl-ETElf2.'2i'lH-5I3lI5 iF1'5IZ15, W - I l - l all mul ' : Q , u L. l 1 I pl I A . 12 ',', 1 1 W , V V x ' I I I 1 I I X ,,,, 4 I I 7 p , 1,5 ii , - Il I ' 1 l . l . lp I 4 W augur- 1 I al- -al- an F 5 E runnin- l Iil I :ln -5 ,I I Q I Fl I. I f 5 P P P :hw Y E l , 1 Ili ' -ii Il ' I fffff new, ln.. 1 - Z1 11 nr: r n .qv ' i , I I 3 ug-I-Inu-nl :nl llT l ff LF I , .I un. 1 I -rl 7 I n I LeT -.-...nLIgLoYnLTuou'WmTE -- HlGqH,WE'LL oo, ogg assi 'FoR,You 1- I I 3 1 1 5 , . f 1-sumti. - ' J 1- 1 1 :rg . 7 , un-up i ,- 1 1 I 1111!-Q1 11 f-f f 2 gg QI. I 1 I u av:-nu rrzi H V r V 1 r , r a P 5 I LOY - In I ITO om wma M- Hnqu, we LL' no, ougieesg FUR ,You 1 - Qfffg . ... 1 ' -' ... ! A 7 - - 1 iijiizzzif o - , I , 5 E - l . 5 A Q I 1 ,VV.V :ruin-:un-l:rrJl:1l'1l,1 .11 1-'1--.wgrgnnnnnn-srrnmz-ta. . 1 . ,-lv: 1 n Z5 ff,- 5 r51gl5 :ia:?lI.ml:rp-9-rx1::'1nu:lI::1llg:5 :iii ,..,. i 112 n l' - -nz : ' mx ha I I 'V '. . I A f'v'4--- I ' 9 fy 9 5 D ! I 5 , :, f III I I I 7 P 5 3 5 5 I gi 2 I :nu-13-lnxizssg , . II: I - 14 2+ - 2. - zz P 5 5 , P a V Y One hundred forty-nine 31111115 M ,,,,, , ,Wi ,,,,,, . , ,,,, W ,,,. I YW, ,,,, ,,,,,,.,,,,, , ,,i,,,,,i:7 ,,,, ,7 L ,. f A fi '! rip! W - f f, i 5 .,,, A WfffIllIfZi2l',:mg''lfffi' V ,fc1iT7f ' W 1, , 'V A LT : - V f ,l .... ' ,, ,.fjjjfffv- ff, , f f ,II e 1 2 ,wf,Uffz',fa1,,- 45,1 M, .u x,,5 ,Wi M , ..,. fm---,mm -.bl 121 fum 'A4' 'W'ff2,...i:2l..,.!1 1 ,hx .,.,,.2.f: K X X 1' -if , Mx V CTLZM ,... 721-Mwwzjj' V5 -W-15339. fy' fi ,E mi VJ rffzujln, a My MM ,,j.f!mj WV, f' 2. . 143 - f--.M , ,ff Zjf 'f N213 - E . . ,www fn. f 4 9f4'wm 1 W f .fi , ff '-H-ff' ' f' f f 'aff ' if 'W ff L ' ,,,, ,,,, ff f' f ' f -f f:,...:: ....,,, Mn,in:W1,.:m.:m,,:mapp,,7 ...., WM .... mega.: M'fw4:,wm1:cw,,wx, 5 1 1 , , 4 M TW E Fwmwmi mmm GQJLEJ ' Egxxlrmkislou nx qi!! kg. 2 ' 1. ' - 'L 'N fx Qiiaiiiilii. lhlfl, ' 5 V : V h1ElFJn1l I l- . 1- f D 4 'vu :Il- L 4 351 :I .7 ,L nemsrompun-Plgnnn RsnEs1nnaGpu,nNn mis T0 'mf SQNWI-WE 1-WE: win- 4 j ::f::,:.51'E- ' f gl- E E F - 7 21711. I, - I - 1. I2 I I V I - A f 3 JE 1' , X 1 5 m ' Elly!! . , I Q ' I 'Q r ' n 5 IIKEIIL A f ' l IK I -- qyljl 1 J- E . : J - ' 1 J I - - . . 1 5 . Fuinr mTneP R'?'f.wEIl mqm FMUHH Q'W f'lL FIGNT-FDR MD W-are Huf-1N2--- P . ,. , V , 9 H ' ZH 1 I' I ' I 2 K. E- ' V Tyne. U . . I . 4 . 0 A 4 5. 1 f : n-4 f I :r:la..4 - 1- V 5 S H . . V I :a --.1--: 1 Hn-cm Hen COL-Gps, foenawo enum HEHRU mmm- nwm'ny,r n ww? f'fxvrf3nnTrSv 1 . 1 I . HH REEF E' 1 U 'W ' ' ,U 5? j- 1 ,- -A Q - 7 ' I ' I - . - ' ' 4 6- . . 3 . HFRESHTME tiouy Anno, nears 1'-vrne Sugar.-wg Love : will ,EE-2152: -:: ' 1' - ' - 'B Q pl - 7 , 1 v ' - ' ' . 24-2-5 I, Q 5 DvS,alna.V One ll'M'YI.41l'I'II fifty .,.,,. 1 WNW, . yy' ff WV fl ' ,nf X ' I I ffl, lxif , ..,, ' f -V .V . r- . 3 .,... , .-wus ' :wr if. . 1 Ilikfivmz 21, f, ' v 'M' f-1 4 f' , f V' '- .V ..,, 5 ---v- yQ1:7ffiv..ffZ2f,,,.f .,...... H2155 Lt: v w --qfqigff w,mfffx:::f:wxM-.4,...z:,,wrf41f:fwm,1f,4. 3 m,,,x,fm,,,W,,,W,,,,uqwwmzblikf,mv-4.,,,,n.M,,,,wW,,MM ...-ff WW--- ..., .W-W, ..,, N 1 V1 K Q gif' A 3 ' x E X 3 5 W. 5 gs gg, K 5 i sh KX ,,l E , Nglgki ki --at-WNW QP, 5 'E w ' Q ' i , N E wi xx as X KQQ Q . X Q 5 Q 'g-,f,. K, .. ..,,,, k,k:,V, -- 5 s Q , x,xv 5 xxxx N NY ig , v A is JJJ, JJQ Q b K S? ix ER iiafr -z.. I 2 X ls f :,, Q-N 5 'iw A .::,,. , ...,,, , LLXV, ,,....,, ',',,L b 5 M E : --2' - I 3 NN . W N ., ,,,, ,,,L, V n - N, Sr, 1 S I .:,,.,,.,.,k ,lax S QN ..kk xxxkx x,XkX xxxxxx - : Q si Q J Z N ' . www TY Nwg . 2 1 'gg qv z , S ix R , XxXX,, S E253 -: -, A 'S - si: iiqgwg .isa-sw :x P A Qtiviatoe ,.. ..,. 1, Z VV,,, 9 ,,..... 4 a 2 , ..,..... ,g .ir Z Y 4 2 l ,MW L ,... Z 2 ..,, 1 i sc. Wfifiiwfm 1, ,AAA 1 A.,. .M 'EXT-fa.,f3 .Vx ,fl in CC, Q4 K f Mt f. , T IWHIQAT -. . - ...fm f' vw' f M sr f fr X ,,... .,., ,,.., Z .....l g iff 2 , ....,,,, Our S ' z 0670 0 5 AA M ' ', 1 3 ......,. 1. We are resolved: 'M ' i That high school social affairs be given for the enjoyment and Well-being of the T school, and not for the entertainment of the public. , .,... M4 15 That all social affairs shall contribute to the Welfare, good name, and proper spirit of the school. That we shall be unconditionally responsible for the good conductand success of our undertakings. 11115 r That We shall adopt a Wise economic policy in the planning and execution of our social affairs. i iiiili Q ,,,,.... 'I That every event shall be properly chaperoned. That afternoon parties shall be for the benefit of Waite students, and persons not members of the school shall not be admitted. That adequate police protection shall be provided for the safe-guarding of our guests, automobiles. l , ....,,,. gi That men unaccompanied by ladies shall not be admitted to evening parties. That our -social committees shall employ every precaution to protect themselves from criticism for extravagance and poor judgment. , ...,, 'iiiiiiiii Q That We shall strive to obtain the general participation of our members in every J event Which We sponsor, giving as many as possible the opportunity to uphold the high social standard of Waite High School. iIQIQQ1l One hundred fifty-two 1 11 1.1 .11111 1 11 11111111 1111 1 11 1 1 ,,,,,fff'f ,ffflfffff fjf 1, A V I AVAA ' 1, V ,l 777i'!, . V.....1.111 1: 1'-- .111. 1 '1't' a f-rl 2 i11ii'Ij ...... 4 grfrdlff' s if X v..,..,1.. 1 ..., .H 1.,A ,, , ...,.,,1 1. ..ZF!W?:.r 1 .7,f:jj,,lW i T I .uf A ,,,i.,,,,.,..,. .w,mm::m--- -I---ew-er-Lg.. ,1,A- - -' 1..s..: ,111 .,,.f1L,. V-fc ,.-1a.e1- ,,..s,..,,..,.,,,,,,.W,,, , .... ...wwf ww 'Ye' N v:,..f1f , W 1- ff MQ., M f ya. . ,r f .,,, ,,.., ,f ff ,. V V,I' J v,,.,Z,1,y i , .1 ' f ff ,Y , V ff ff J Vw f E for ff- l if l f f ,rf . 1'- JM? ,f w'2 l f f W ww f f ffffmfmf ,,,,, W f,,, Jafwhf f ...f,'Wm:.i.. -fff ..-fwmv.iiWag:af4awcW,,ay,x, ,.,,, S ' f The Dearest Chum was right that day last fall when she predicted, 'fl just know we'll have a circus at school this yearf, Surely enough, no sooner had school begun than social affairs were in full swing. ZET-Q. D. PARTY , 1 2 On lfriday evening, October 7, the Zetaletheans had as their guests in the liulton Street home of Xlrs. R. l,.'1'm-ner, the society advisors and the members ofthe Quill and Dagger. There were games, dancing and stunts until the clock raised its hands in protest. One young man illustrated his method of preparing for a date.H Another gave his inter- pretation of HLast Night on the Back Porch, and yet another chose to demonstrate beauty clay. The Q. D. orchestra played for dancing. ,,,,, Z 5 vARs1'rY DANCE During the fall, the football squad had been Hstrutting llll its stuffn in the Bowl, in true championship style, so that by Thanksgiving, the HPurple Hurricane had made such an impression that We were glad to spend our last cent for the Yarsity dance in the gymnasium. The room was at- tractivelv decorated for the occasion. Winning plays were depicted on white canvas-purple and gold warriors 1 tirelessly laiclted golden footballs around the balcony railing-and an immense purple football bearing the i morning's score hid the Riverview Nighthawlisu from thc happy dancers. COMMERCIAL CLUB DANCE .Xfternoon dances, too, are always welcomed by the followers of Terpsichore. On Decem- ber 12, the Commercial Club gave thc lirst of these, the SquaWker Squabblef' The entire school was invited to attend. SENIOR CHRISTMAS P.'XR'l'Y ' . .,.. The frolic was still a recent memory when, on Decem- , K W ber lil, the gymnasium once more re-echoed to the sounds of youthful jollity. Lovely Christmas trees, gleaming with colored lights, converted the gymnasium into Santa Claus land with Santa present in person. The jolly old fellow sang out our names, as we gathered joyously about the tree, and placed in eager hands the tiny packages contain- ing our senior rings. How we admired them and chattered over theml .XLLIXIXI DXNCIC The .Xlumni lollowt-tl the Seniors with a holiday danc- ing party on December 22. Lighted trees and tall candles were used in decorating the gymnasium. Nlav all alumni endeavors prove as successful as this onel One Ituntlrml fifty-three H f ,.,,,,, ..,,,,,,,,,a,,7a,.a . 'i f ' f ff! -fffffff fffr. I f f f ' , iff ' ,ay , ,,,.. , f ' f f fc' V 'f' ggcvqmww ffffffWw,,,,,ffa -- jg 'mZ4..mN,...m,jQ ff IQ V 1 2 i s 2 if Ki! 22, fa ygffavw W mm .xf.fMm.,.m,,f M 1 1 ,,f.,.,,Lg1j!,'zJf, D may- f.c5,9 A ,,..,, ,Q , , . , .,.,,. A N. ,. ..,.., W.. 1 , wa rf' v , pa, X l H -.Rn 1, lii, W ,a,,.,:.2 ,.,,.., 5 N. .-J., A ff , 5 T I --K' , C..s..,.,,,..4-f..1fwZ:'y 2 ..f. s W. 'j:gz,,W I 2 - i 2 2, , -, nj 1 ,, ,, -.. D .M I, , , j X of .J ' ...J ,J 3 1, a f M T ' Q H3 fl 72 UN f ,,-,. , ,f.lL.,,0, ,Q -. 2 , fan ff' f M'.,. f ff rm f ...,4 1..!'7 f f f J' . f W J Y L 2 1 .fzfaffl 4' .... aa,,f,m.fW..WM...ffW.f..fm...mw.,2m,f,W 1 ...fai.m:a..:...f PICRICLEAN BRIDGE TICA During the holiday vacation the l'ericleans gave a delightful white, bridge tea at the Toledo VVoman,s Club. The score cards, with the Periclean emblem engraved in gold, carried out the society colors. There were many attractive prizes well worth the winning, and dainty refreshments. Music was furnished by Milo Taylor and his orchestra. IIANILET Ilamlet made his appearance to an enthusiastic audience in the auditorium on December 10. Iylr. Eugene Xliller, as the melancholy Dane gave a splendid performance. The play, sponsored by the senior class, is the only one of Shakespearels works to be offered in the city this season. Those who had studied the drama in the classroom especially enjoyed the presentation. FRIENDSHIP BANQUFT I lower petals in profusion hung from lights and walls in the Y. YV. C. A. Cafeteria when the Friendship clubs of the city held their banquet on the evening of January 30. Yvaitels table decorations carried out the theme of the evening's program, The Dream Ship Sails Tonight. A veritable 'fdream shipl' from the Nlohr Art Galleries formed the centerpiece. Tiny gold and white boats were the favors. Boys from the Hi-Y clubs served very capably. llelen Snover spoke for Waite on t'l3anners Unfurled O'er All The Worldf, JUNIOR Hoi, On romantic St. Valentinels evening, the Juniors gave their annual Hop in the Wiomanls Building. Valentine colors, red, gold, and white, were prettily' combined in the decorations. Smilax festooned the balcony. Dancers in gay attire made a truly carnival scene. The Hhlobile Melody 1Ien's', orchestra furnished the music. Q. D. DAN Clil Two weeks alter the llop, the Quill and Dagger literary society gave the Stilus Sicaqueu tlance. lfaeh member wore the society tlower. The society colors used througliout the room achieved a striking effect. A black and gold striped canopy, huge quills and daggers, giant Q. D. emblems and a new arrangement of lights, were among the clever ideas introduced into the decorations. The programs deserve special mention. The covers, of chinese matting, bore the Q. D. seal in black. The inner pages of black printed in gold, lent distinction, especially as the Q. D. song was to be found therein. EURYDICE CLUB On Xlarch 7, the senior class was fortunate enough to secure the services of the Eurydice Club, Nlrs. Zella Sand director, for a concert in the audi- torium. The club gave a well-chosen program in- cluding numbers from Aida and Hfra Boheme, together with such favorite melodies as 'LTommy l.atll' and 'fThe l'lnd of a Perfect Dayf' The audience showed a line spirit ol' apprecia- tion, and the number of eneores must have been satisfying: to the performers. Toledo is fortunate to have such talent available as that which the Eury- dice Club can provide. Une ,lIlllfII't'll fifty-foul' , :.ram:.s'wazmmwW , ,...... , ., ,,,,, , ,..., , ,,.,,,WMm,7,,,W ,,f , I , f ff ,V f ,....., , fm: I , ..., ,,,,. f f 1 ,,,..f',:ff5f? I V' .f v , I2 , f . . ' ffmg, , 1 f f f f f , W, ' w.W,,.,,fa,,m,.rfa,L.-wfgffwfffafimz, W I ' ' ff ,... ,,,, 5 , 5 : .. l 3 5 i ,, f ,vvv ,.,, ..,..,, . ' f' t , ---'- ff'-- f , 2 -. A 1 , .f jf- ,,.,, ' ' , ,.,, ff ,X if 5.1 ff AV , . Z ' f , ,, '1 --1. ff fs ,,., 'f't. ff, . f---, ff ', f Jaw wfff f f f,,:f 4 fnfffmf, J,,,, .iff f,,11'f ff ' ,f,,,,,,, W f..m..,M.,f,fmf a.M...aa ,ffnfff 1. f a..Mff.:wn:,1 ..ffff. , .,.,..,4 PERICLICAX DANCE Two weeks after the Q. D. dance, the Pericleans entertained with the Shillelagh Shantblef' Iiven the green and gold tickets S in the shape of a hat carried out the spirit of the occasion. Irish lanterns hung about the gymnasium and decorated the enclosure which surrounded the Riverview Niglitliawlasf' who furnished the music for the dancers. Green and gold harps standing at the entrance to the chaperones' room tempted many a youthful musician to try his art. Green and white drapes were at the windows, while shamroclts, pipes and hats did a merry jig around the balcony. During the evening, little AIiss Lillian Newton gave a solo dance. W'hen the party drew to a close, everyone agreed that the Peri's ' had lived up to their usual high standard, in the management of g their annual dance. flflfl 5 VVOOSTIQR GLFE CLUB ' XIany a senior longed to be a unior again on April 4. That evening tl1e Junior Class brought the Wooster Glee Club to the auditorium. After the concert there was dancing in the gytn to ' music furnished by the Wooster orchestra. The students enjoyed the privilege of meeting mem- bers ofthe club, and offering them true Waite hospitality. Z III-Y FRIENDSHIP PARTY The IIi-Y and the I riendship clubs gave a Bacltwardl' party on April I7. The guests j came laughing to the Y. W'. C. A. with their clothing on backward, the games were played back- -N ward, refreshments were served backward, people Walked and talked backward. In short, back- iiiil 1 1 ward people felt perfectly at home. Certainly everyone had a jolly time of it. f IVORUIXI DANCE The Forum Hliluebird l7rolic,', April IS, was the next event on the social program. A huge blue and white canopy was suspended over the dancers, blue lights peered through at f intervals and tiny songsters in Wicker cages strove vainly to drown the music of Kalt's orchestra. Bluebird whistles were f given as favors to the guests, and dainty programs made pleasing souvenirs of the occasion. ZET DANCE The last of the Four Litf' dances was the Peter Pan l'attcr given by the Zetaletheans, April 25. A lovely effect was achieved by using flowers and petals in pastel shades. There was a great canopy coming to the lower edge of the balcony, and a smaller one over Taylor's orchestra. Xlyriads of flowers were scattered everywhere. A fountain was provided for the chaperones, room, and, best of all, dainty grey-and-green-tied candy corsagcs were presented to every girl. The dance was lovely, and in every way at tribute to the good taste of the Zets. hlore power to 'eml One huntlrvtl fifty-five M 'f ff at ' WWW 'fff,A 'Wh ,.,f,,,,ff WW ',,,,ff ,,,,,,,,,,,,, 4 Zffff .,, A ,,, , 'ff ,jf N Zig ......,,.. f X , 1 ,, ,, .t,' Q, ... .,.. X f U. ff . f V ,af Q' I ..,... A '. .,... 'r f , M fffff' W fflt X ff. f::,f,, V ,:. f 'A'. 'W' 'Q N. ' 3 ' RW' fn V fr ' W -.M 4' lf 5 J vs fg1MM,,,7x.,,42tfZ31 '. ,.,. gn,?,.fjgM I , W! wji ..,.., , ' ,sf ff' 5 .,,,ffH,2,! 5 7' ,.,,..,,,, , J QCIINW iw? ! I f lgjg, , , ,.., . ff I'f'M yyf ji ,WW f'M-ff' ,... fa-.,,,W'a. f -f f f f ,f ,, X MW ymfw' 'Zffafl Wwmi.. :min 7 4 ' V 'fm ...., fffff,.fm f .,,, , ,.,, WK.mff1..:,..,g SENIOR PROM The final dance of the year was the Senior Prom at the VVoman's Building, when the good ship lXlayl'lower set sail with all hands aboard. The chaperones watched the festivities from a miniature lighthouse. Life-savers were given as favors. During the evening the captain and his mates came ashore and mingled with the dancers. Landlubber mayflowers were strewn about the hall and were used in the daisy chain bracelets presented to the girls. The splendid attendance, good music, and a spirit of happiness made the occasion one long to be remembered. SENIOR BANQUET An event of May 16 was the senior banquet at Lasalle and Koch's. The banquet is always a joyful affair, for on that night the '4Purple and Goldw mal-:es its appearance. The class history, poem, and prophecy are read, and the president of the class makes his farewell address. This yearls banquet was quite as lovely as those of previous years, and, when the evening had come to an end, and the quests were leaving, each senior realized that this was the beginning of the end. CLASS DAY No more will occupants of river-front rooms at VVaite, gaze wistfully alter the retreating shape of the 'lGreyhound,y' as it steams down the river, bearing the seniors to Sugar lsland for their annual class day. This year the picnickers sought a new playground for their outing. The famous Greyhound plies no more between the island and Toledo. However, on that long- awaited day, the graduating class proved conclusively that there are many ways of spending a delightful day out of doors, and that most ofthe ways are known to seniors. GRADUATION June ll, graduation day, the day toward which everything in the past four years had pointed. There was joy tinged with sorrow in the hearts of those who, as members of the graduating class, took part in the program and listened to the inspiring speaker. Speaking of lifels great moments, this was one of them. CONCLUSION During the spring there were other delightful affairs such as the freshman mixer , when presidents ofthe various school organizations explained the objects and aims ofthe school clubs, the various annual banquets ofthe literary societies, the Altobee Art Clubls dance, the Mothers, and Sons', and Mothers' and Daughters' banquets, and other social functions. Yes, the Dearest Chum was right when she said: I just know we'll have a circus at school this year! -illargfry Hari. Ona' ltzziitliwl Jiffy-.s i.1: W ,,,,,....... , ,,,,,.,,,,, j ,,,,,,,,,.,,., ,, ,,,,, A, f f f 1 f f Q. , ,,.,,f f' f f . . 4 f f Q it .12 -zffhf f ,.i,. . f 1 ' f f f , f4 f X f , X , , ., . f, ,amz , UW, f fwffw ,a,,,,,w 5 MW 1 W, f W ' .f .i'- h,H+Hr,'H .V R KV V f-VN V V VV VVV V ff fm f ,V X E X N-. 3. ,'yW,,3g N1VVf V. ,,.?'x. ,3'f'L-- fi' QV 1 T M . f n ' 'f 12,1 -Mr' 4--7-M - , . V W, 2 My f 3 if V1 YN N lv xN,2m...f 15, f ,U If j? F, W ZH, fy! f V,.hW!,,:.:.fffff-,:,,!Zf'jfff., fm ff-u,,' W Nga M f, JK JV, f fm, f' -vt . fi ...V 5011.-. f'-rw ?J3p:2z?ffmmgwmf:2wM.:5,1m::m,4wm:4.mLmM.i,ug,..Sv,.wfffmfQ13:Qm,1:-wg. mfm,.,mwxL,.:::::pp,Mmg,z:....d4c64f4' :,::erg.:y,-...m..V,,..4f-uf'--H-'N---mn.:--1'1uMz2:L:nu2w.::w1-1 Ng' f'Nm4 Q,i1iiii'E V A . A . . ,,,, 4 .MJ ., .,.,... QW' 4 5, ,,,, , 2 ---' Ma 3 ? ,,., , eff-----Q , f '--- 3 f ' x ..., ...Q E 4 7 gm- 2 , ,.,..., 2 5 f V f z...,M.g 4 , L.. --.- 4 s iV.V.4 a ' 4 Q'-'ME 5 I f 51:23:13 5 , V 1 Z f 311111.13 5 f g 1 1 'lfililj f ' 5 ffilliii- 5 ? .,,.,., , , 1 1 ..., V, ? E 5 E ?-V--4 Q W4 , ,,,, W5 3 5 ,.., ...1 Q ,,,..... X .,., 3 , V42 1 Y ez 1 6 I z Z :JJ 2 ' 5 .,.:::2 1 y. ,,,,, ,,g 2 Q ..,.... l ,,.,..,, 5 f f'- -'1 f , ,,,,,,.. ...., ,,.,,, W? ? '-ami i-....? , in ,,.,, 5 r' f----- . 1 ,Mme 2 f ,.,,,, Ns g 5 ,.....n, , sw ..,. 2 5 4 , , , sma 2 135:54 f 5 Q f amz ww, 4 VM , 4 ....,,, Zz g , mm! g MMV 1 E9 Z 2 ......, 2 2 f ...,, .Q ' f e Z g 4 :EZIII 5 1 Z 61:74 f , ..,.., V i i ,V 3 ' 2 ..,...,. . Z Z 5 ...,..., 5 ' 1 Q ,.,,,,,, 5 Y i ..,..,.. 2 . . 5 5 .W ..., 5 Q fw-'Q 5 1 V a ff- ---- 4 . g ,V bwg 5 . , ....,.,, 5 4 Q, ,...,. 5 , QW , .f 5 , , 4 1 , V , ,,,,, V ff: , , g. ..,,,, g 'a WQWW, W,,,,,W W ,,,,, .,M.,.........,.,,,,,,,,, ,,.,, WM.. V...... ,. .... WM, ..WMW,,,,W 2, ,.,,, , ,, ,,,, , M7 ,,,, V' .f f -f'ff55f'iE?? f'L,,.Mx.,V - , V. a5I?ii g,f .,'1-- ! .f f' ' . ,,w'j1lf ,,f' f' Q ' f f527?z1-2-wfwym1---fvfff-ff... 'f , ' ',,,Vwf'jj2Cfff '',,,,VV'f' ,,,V5g:fff ' 1.4 V. 2 ' ..... 2 .fmjywf v 3 I f'f ' C' V 3 ,.,,,. ' ..., V , 1, V' ., ' .... L 1312 z .iL122:',f??,, - 2. 14 mjjjff, V-M ....,. -, f - ,..,,,f 1f-. V .,,.,.,.., M V, 'L2,.1:,1ZN,..fzmfw,,fy ,.,, ..ff,-V5 V -V,- 1, ipA..,,...4v,w,:,:,,acig...' 2,111 f 'f ' ff' f 'V 171' ,fwfr-:.--,Z 1 , .. ., .Mem 'fffgggyywfwwfffff-f:V MMV-.,m..,,,..J:fm,4,,gfWm.,.,W44 2 ,,qW1v4,, .mf-,.v-.,,,..,,,,mx'kW . ..V. V..mwM--V0..,.V,,,..,,.,.,.,,NM,,, ,... W 'V -- V wyfiiffffrlyf E. W., ,HU I, ' f 2 ,vy.4,,,:w ,.., if f I ' If f 5 A U , , 2 2, - .,,,, AV , -L 4 , , , I , ,rg z . , 1 'Wx -,,f W! my 5, f , g .amy 5,1--7 ' ' K .,f',,.,,,,,,f 3, ,f me I ,v Ji , ., W, ff. ,. , 'X ff ff! ZW! , ,, . '- ,- Z ' lf! 1 , fy J f'V MAJ. 3f N., f ' f' 1, H , A,W,,,,ffQWfW , ,H I ,.,,f '1,,,f z f' 1 'W' f' W3 i ' ' , f :W 'ff' ff 'WW f f - 'f '- 2 H e 5 wwf A V f 4 4 I 2 V ,If 4' ,, ., . wgy,:f,-:f1w,m:,m.W.11.m,gmwmn-1,.:m.Lm.mi,f.mp...f4.:ffz1wi..151wwml:1..1mL':f,,.y,-:fwz .,,. :rawN.ze.L.xc11:1566xN4Q7AzA,aw.1mzw1,WwwWWmum41-m.wmf,,g:,:,py,zuw:m,,MZf.,,1yWhm , .... ma1,,wfN1fmfm.wz,n,.wmh:.xwuwpg 2 , f E 1, .,,, ,,,, Eixxzz ' 5111111 iiiifiifig i , ----- ' 311112174 1 ,. ,,,,,,, 3 3 2 5 ..,,..,. E ,img Z 171122 P-W ---f 4 g 2, w --- E 5 ,,,ii1i,2 'iilii . , . ......-.g ,T J ,Wz , ,,,,,,., ,,,, , ., A ,,,,, ,,,, ,,,, ., f,m: 'W, , I f fn, f ' X , ff 1? f' , ' f' ff , ' ': ,,,,,fMff' ,V jjjwi : , Zfffzgy' K ' 5 , ,:w7fqfW- - f , ' , ', 13 - L gg ff f ,,,,MWfff,,ff- 1wWff,,,,,,WM,,.,,M QL, ,,.., ,U ...,.., ,,..,, f .,,, ' 'M f x 5 v,54QnQ,?,y,5i57I ff N1f'S3 f WQ2.N.fEL1 ..... ...'f'?'ff, M f N3 N X' H, 5' .v,f , X, Nf- 4g1p,.,,,,gmWfg5gy .F f1- Q-. 5 11 1, 1 , , .,. 3 .N A I. f, -.,,f ,WJ -x,.,fgR L ij .nf ff Z 5 gy M- -1 ,J if V-7 Vx fi 'fN'W ' if ,.f FM .Y f' ,, ,iz , , ., 2 Z f fff ,A Lai , M 112- ff- IM7 ,, J, H,.N,Jf1,'yf K:,.,,,g?j ':w-fn ,f.. ,f',,.f H I If ru. ,uxvlm J? ,.-.4-N. ZA -413: ...M 7' ,1'L,,,.. Qfawfm ,aim ---' , 111:-,-mmf ,.,, Y ,.... .... 191mg.f.f::,. Euiw::awa., 1 2 ,...... 5 V ..,,.. ..,. 2 , Y f ,.,,,,. 2 5' . ,Mg 3 ill i f-1 Q 511112.13 j ,,,.. f , ,,,, sf' 4 4 ..... 1 L, v --'- ' ,f 1 1 Q , ..., ' ffl v f 4 . . ,,,,,.., Y Q 1 ,,,,,,, 1 , Q ,,,,,,. ,,,, W1 H1 4 F Q 'ff Q 1 ,, ,,,..,, 1 , Z -------- 1 4 ,,,, 2111112 .,,.,,, 45 21:11:15 2 7 Y ? ,.... Q Zfffffli 5 f ,,.,,,, 1 5 , ....,,,, , 5 ? ..,,. .3 511111113 ., Q ff-'-'-- 3 Z ,,., gk '- ' E ' 311111112 QW ---- , L Alllllllc , ,,,,,, , 5 ,,,,.... QM f---ff 211111113 f 1 L .,., E. .,,, wi ' gh, ,,.. .g - 5 ....,,., 5 tv- I ,..,., 4 W- 2 - 'V'. , , lllvlv A Y .... , L, ...,. 2 W'-'M I gl ...... .4 52111112 ,,... 1.4 ' f ,, 2 x -- -'-- 2 - 1111? , I . 4 , L 333711 ,, --v-.f 4 3 4ZW,.,,,L,, .,,, ,.,W,W ..,,,,, N , , 5 .M ,,,,,,,,,,,,,,, , ,.,,, , ,,,,.,,,, ,,., . , ,,,,,,.,,,.....,1,,N,,.,..,,., W ,.,,,,,,,,,..,,.,.,, ,,..,,, N ,,,.,.,,,,, M N M,,.w1 ,...,,,,,,,,, W ,,,,,., W 1 ,,,,... W ,,,. W ..,.. . .M ..,.,,.,,,.,,,,,,,,..... 1 ,,...,,,.,,,.,,,,,,,,,..,,,,, T 7 ,,,,, 1 ,,,,,,,,,.,,. ...,.,,,. , ,,... y ,,., 7, ,,,, , ,,,, ....., 7,1 , .,,1 , ,fa 1 llll f . 1 Ww,'fs GfW'f':'v 1 ,..,., ,::::.. , z f , : f fgppfff' ' 1' uf 2 V ,,,..,.,,ffmw0..:7 Q '1 :V -ff- ,, ,,,, j,f H Wen '-'f f -ww-Wffffw '-f' 1, -f,-- ,::,1.mwn2w:,WWM,,-W '- -q '1wLgggqffi21lhmJ V -f'- W--A ...,, ,N 117441 f , , , ., w,,,,,,. wwf-W V 5 f 2 2 4 3 1- :3:f,3, .,.,. 3, 3 3 f 1 'z -3 ,,,, if V' N 5 yy 3 X W- 433 ,,,.., '. ..f, ,,,..., 3 Q 5' 23- , 3 ma 3333! '- fu' 3 3,1 Q 33 H4331 if-ff W' A P .,,,, A ..,,,,,, Z! IW f 2. 3 M33 M3 3 3 f f' f' 1 2 3 .1113 ff- 3 f- .... 3 -f X ' '72 51 ww 344131331-mmm-Www,-:ffl-WI'ff-wwf--W---whfM-:33:c441cm3,3u3333vmmi33z3wf3WALQ333,.333mfr:r,iwfLxm,z2:w,,uZ:, iiiiiiiii '... l-li 5 ' .,,., 3 --.... 3 3 2 231333113 I 33,,,,,, 5 V ....,, 3 ,,.,,,, 3 3.Vf 3 3 VAVI .III 1 X 5 ...,,,, Hz Ifflfflfj 4 ,.,, J 2 3 ....... z 3 5:73335 :iz 2 3 3 3 We 3 2 .33 3 , ......,. 3 4 733332 332 i ,,,,., .3 ,,,,,, 35 3 ,,,. 2 2 5 23 ...., 5 3 ,....... 3 3 3 , ' f'f ' if 3 ,.,,, 33 3 ,...., 33 3 ,,,.,... ......, Q g 3 ,,,,,. 33 ,....,, 3 5 ...,,,,, ff ' 2 ....,.,, 3 3 , 4 3 2 ...,. , ,.,,, 3 , ,Q I .,,,, 33 3 9 f-f'f M! i ..,,,, J 5 ws 1 5:33:13 1 2 ,Z ' 5 1 fl i 3 ..,,, ,,,,,. 3g ' Z 3 ,..,,,,, 3 ..,,.., 3 iw. .,.. i Q ....,., 5 3311132 2 Sf, ..,... ,... wi S ,,,,.,. 4 5333.2 Zfflif 3 ......., 533333332 2 i ,..., 35 5 Z 3333115 Eflllflff 3 ,,...... 2 ......, 53333.31 Q ...... !.3.,.,.,Y , .,,,,,,. 3 33333, 2 .,,.,.. 32 LM afffffi 2 j ....,,, 3 L Mi 2 .,,,,,. - 5, ,...,,. 3 5 5 5 , .,.,. 5 .,,,,, 33, ..... WWW, 333333333 3333, ,,,.,,,, 3 333,3,N,,W3.,3.3,,,3,, W. ,.... .3 3.3 ,,.,,,.,, 33 M, ? H1 f 3 .,.., 3 7M Mmjiyw , lwfm. 3- ,,f ,f .3 '-A.. H' 'ff' 1 3 1 U., ff j 3' f -3' ,,3,f',ff ff ,f, 3 g 3 .vi A 3:13 E 1 V: ,.,,.. AW:x:I:H3 ,3f Vj , I ,x33w,j31,,!,3 3 AAAA 333435, 3 V 3 ,lf 3 3 5 3 A, K . '- ,,3.3 3 3 --. Z ' M, 1 i 3 V' '1 .13 3 3 433' fffwfif V ' 1'1 ' 3 , 33 3 J ,W ' -V 3 4 5333- 3- f-1 36 -.1..33 3333, 3 frenz: ffm ' ' 3 .333 ,ff 3 f . ZW,W3'3w ,ff ,f3,3,g:Lzyrz::Wmfww,MMw 3 ' H A1 QVMTQZLLL .33. ,mL,,,9gZig!Y' 'zfj::::::X5g5fZi7ffiQfWfa2Q::. '---ff ..333 '33 ,M W1 ff'--ff ff i 4 1 L., U A V 1- Wh f MW M .,,. 'M ff N' '-Om J .,,, . , ,.,, 33' If . I 5 -X! J X .mx ,,,f If kx,m',-'JA'1fJ'.,,f 'vw ff M S f ff ,K ,, , J fa,N,, Aww! F ,W , Q W. H M' fi f L' .512 f.Jw1 --fwf 'Wh J -N-,x vw Pm mm www A 1-ns .ff MJ! f--- fwvwfgvwb--,fmiif Y -fgqgpw., 1 1 E153 :MH 511132 g--W1 51111113 1 ,,,,M. , 1 W1 '-ff-- M: ,....., 3 5111112 211113 31111112 311111113 N fm'-6 ,, ,.,,, 4 ..,. .4 fun? , ,,,,.,,, 311:13 31151113 51111113 I ' igiij , 5 ,113 ' ms ..,,. r 'i gm. .... if ,NWW4 we 2 ,----' l ifiizg iziiq , ..,. .13 , ...,.,,1 3115 ,, if E, P gy ..., , 1 ,W .,,, 4 Wwg 51,11 iw. itz g... .... 2511111112 QA -I I 111, sw? ffl? QM-4 M4 M ..1.,,.W ,.11 1 ..... ,1,,1,...11111 1 ,,,1111 1 , W,,,f-oo, fm,-, ,fam . ,. LM' 5523115 f',..f f,' f -1 J - U Q, 5324 - V' '1 .vfv 3 534 M, '1 ' 1':-1 ,W 721. 2.5,g.:..: ,.,, 3.42 V-I ,,,, 0,4 ,Wa 1 iqwf, V, ,.,.,,,...... ., W 1' Wm. - f hr V s .f-f' 'f' . gz:2,3jL ,2. 1 ,g f A, ,WM-j-jj',,,,,f W 1 w1..mi ' ' ' 7 ' VW ,.fff ' ,ff :1f ' , ffl, F., , 1 W, 4, 21 ,,,,,., ,,.,, ,,.. 1. 1' d,....f1g::,.,,f 4 I 1 wwf W ----V V '-' '-1 M --'f 1 WW V1 M ,W zfw. M f Y 'ff'-4??w-ffm. ',-- '----f WW -1-f,,.., L-.W ..,. , ,rw ,,,, .,,,,. ..., nm ..... l.,.f,.N.. Z ffx 1 4 .1 I i 3 KN QD WM , ,,,.,..,, , ,ff 1 ,W M , .,...,.. if f X' N, rgj ' ,immwhf f-5 fum, .---v-- wh, . ,f ff , ,f f 1 M -- - 1 f 1 1. , my' I X ..,...,.,...,,, My i ..,.. A3 A W i J V W, uf f V f i if MQW! nf S N 1-'ff'MfMf Q! ,413 41 , ,. M Z1 ,,,, , fffff , H ,, W. ff'-. Q ,. ff f fa fi ,f f J' fm. f 'gf' 'ff f' 3 Z: 1 K5 ,J W -'f VM? f -- - vas- ' ' ff. f ,f .,,, , ,, ww ,,,,hM,,..,,,,,H,w,,,J:,-.,.. 5 ....wW,J,,15w,.4g-M ..w,w,.,,:,g--..A..,,. ff .,,,,,,1-M1-- ,why ,MW ---- ffm,5MMmMfg::fwLL,,,,u1f ,,,, ,mN...H...W..,,Wz4,,,z,,, , I , vw W , ,wwamv ,, 4 ,,,.. ,W .,,,... yiizgg , ..,.. X I '- ' ,,,. 5 -..,,,, if 2 ,.,,,, , ,,,, 5 :H Q .,,, iiigfiiii .,,, ? ' 3 2 f,f,,,., I 'iiiiiiz 2? ,.,,.,,, , if IIIIV .,,,,, giiip, 5553 ,... :ig i ,...., A .... , ,lllvrl 4 5 , M4 . , , 551513 5 ,,,, Q 4 1 ,...... 5 - 3 Q 5 I ,,.,,,, M 5 1 f--f'ff 4 I ,.,,,,,, 2 if 'fff Lwmj z ef 'f-' i I ,..,.,. . if ,,,... .F YW' E IIAIIVV y ..... W PM 5 ZITI , 5 ....... I M 5 5 ,,,,, H, 1 .,.,,,, i W ..,,.., 5 'Af ,, ,.,, ,W ,,,,, 1 'fc 5.,..,,,,,,i Wm, 1 1 'wwf X ,, ,..,,,, 4 , .,,.. , ., , I ,,,...., , , ? ...,,. ' I iff? ......, , , 5 ,.,,,.. 5 ,,,,...., 5 in ,.,.,,, 3 , , X J , ..,,.,,g In ,.,,., fvvr s fi I 2 1 ...,.,,, 1 -----.---- ,.,. ,,., . ..... ,...,,.,,.....,. . ,,,,,,,,, .... Y -Y ,,,,,,,,,,,, , .......,. .,,.,,.., M A ......., , ,W ..,.,,,,,,. , ff ff f lf!! , ,, , A 0 .fm ,..,.. ff ff .f ML f X f ,,,,fff'1,,f ,, f' 'Q W, x z 5 ,W-f-2 Hf w,'f5:?fz'e-A. , .,-- ,, f v ' 'l?f,7f'?', ' L ' 2 - ' , , ,,,, , ,,. 7::, .,,. ,,,, ' 2 .,.. 5 my ' .c 11-533, ' s . 'f'I. wg I 54, ,, 4 ,,,,,,, V ,, ' ----- ---'-- ' ' Wm.-W gd, 1 Illlrvll gi ,, .154 ,,f,,,.,, ,ff 1,1 ,.,,,,,,wf 1 ,f , f ,W.,,,,,N.-:,.:Z4,W,m,,W,,,,,,u ,'gv-wma., .,,.WMf'- --W? ,W .,.,, , , .,.. , ,,,,,,,,,W,,, ..,. ,M ' ,Wm ff fx 1 ,i ,, ff, fcz'-43-f ',w 4 , -, f-. ,,,. .,.., N ., X4 f' XR :nf 3 fin .,.., 1 ..,.. rf www, Vlvv I ff ,f ,f , ' 1 'VH Q,,,..-.,,3:2Wy-'Kg f 1:71.-T 4 HX , 1 2 J ,H 1 pf 1 'M-N w JYJ'-f Y' ,, ' W N M'--'MW' I' ,, ff ,H a f fxvfm 5 uQ,.,.i.Lf .sffzfm-Mzffw f --VVV V 'Y -- ffm' -'-M 44.3. . ..... Z sv ----- 1 g..,...g 1 ,..,,, L ,.., A .,.... 3 ' E . 1 3 ' ...... 5 I E ,, 5 Z W , ,,.,. a . iffgiiii E f 2 ,J 5 1 5 F ..-V-, 9 1 ftirlii J 5 5 , 4 Y ,..,,,, 4 5112172 5 91121212 5 2iLi1i1..2 A ,,,. 5:33 1 WA l , ,,,. V .... mf ' .... W ,...1 5111... s ...,, , Q,,,...i 3' 5 .,.,. J i ,.,. ,... 5 Q .,,,... , ? LMS 2 3539 gjfiiifjii 3: ?llQ'f7 5 QM--4 5 2 --4 Z , 3 Q I 1 , 3 , ? 'i Z ..,. W3 , P4 5 , ..., mg E, , , W, ,,,, . ..., M .,,,. ,. M . M53 1 M ,,.,..,,,.,, .,,,, H ,,,, M ,,,, W ,,,,,,,,, M ,,,,,,, my ,,,, W ,WM ,,,,N , - W, , W ,W , fjfyyuwnizy lff, fi ,.,.,, -, ,f f If 'Q ' ,f- ',,f ff, f , W, .,,, A ' f ' f'f M K,-if M44 H2,Zg,,3ff .qv , rua W-E Q ..,, -'wwf . , w 5 c A W-+w,wff-,frwfw-T. , , V . ,,,,f-5,11-1 , X , f , ,Y gf ,... A V. W ' 'f ' Cie 1 4 '1?fl53 Z ' V ' V 'fn ., , xfwnf , ,g- ......, .5 ..,. -425.111 If-W r M M ZW- z.. ,Z ,W,,,.,,1,, ,Wm --' .. -..,,,Wm,4,,W,,,4h..,4if,,,,,,,,Q,g5n,.,,f,f,.,,A,f.,.',,,mW,,,,,0 V ----- M--1... .,, .... M m,,.m-.. ,... . ,J X f 1 2 1 1 r X I Q f 1 1 1 2 . f - ff ' A971 .1 ..,, ., 2 'ax 4 .X ,, f . N L, ,,,.,.1.,A.,, K, ,,,,. .,,.., , ..-W :ya M351 W 1 -1 w I V !,,.,! - 2 K ,.,, hn.z.,.5.,, 4 v 4 , - '--' .J ,gg -f f Q . a . f ' ' , ,,1f ,V ,Zi ff 3 ,V - 'M 1- A Wf zef,,,,f,2 ' ,1 202 1 MW, . ,,,f.. f-f.,,,,. ,. ,- fff flffffj v f. ff WHL' mv f 4:7 7 -f1 7 ?'fM E fli. ,QE ffmwff, , fi, IVVA M ,,.f WJ, my ff. f , .1 ,111 W4 Mm, ,mf f L fg, W , WM 0' f M ' ' ' ' , ' 2' bevy iffy V ,,,,' ,,,,,,,.l, .f,. ..,.W.-ff.,,,'2W'. Q,N,...1L.,h,,,,W ,W--M.u..,,,..f:1...,.,...-,lf-41-V-M10 --ff -f-- f ,-ww--f---'Amff fmeagfzuawfuicmv' ' ,wgdf-wm.mzm1w.,,1m,::w.,uwf411,1:w,,zfwm.f,:fm..ff4.1zv.f.m,f1xfzmz1,14fL...11J1.,..11.1..L,,x.......-11 W - - 'M -lf Z 4 1 -- -if i'11i1Z f ,p s f f , f f I X Y K g ,H i1111,11i , 11 , ..,,,,, ..,..,V 1, 2 1 ....,. 1 5.11113 5'III1Z1'j Z 1 'a 51231353 3 2111111112 1 ......., ,E , x ' 5 il 5 , , , 4 5 LJ1, 1 1 7 --'---v 42 V ,,..,,, Jpi ,, W,,,,,,,,,, M,,,,,,,,,, ,,,,WW,,,,,,,, ,W ..... 1' W,N,.1 .... ,111 Wm, 1 1 ,,,.,, , ,, ,,,,, , ,.,,N,,,, ,,,, .,,.. ,W ,W ,,,,,,,,,,,,,,W,M ' f I fffff 12-1 MH, , , f ,ff ,fx f 1 ,fig-Ma-::f,,zf.W,1 .,... if 3 ,, ' ,1 f , ff- .1 Z 1 J f , X ,z , f . 4.11 4:11-IM. . 4 .e f W u 'Q-M, f wma? VH -L f -f ,.,.,, . A' 1 ai: , s 5' I -2fs?W21,.,',' M ' ' - ,J f ' , ...1 I . ,.,. 5, .. ,,.... , . 495,15 . ,,,.1 1 , ,Q ,fu .t 1, .. .,.,,..,, . ..,.. ,,,,,,,, , ...,.. V - 1, ,,,, ,.,,,.4-,Lf ,,,,, ,f ,,,, ..,, 7 1,+fffW,,1.1,11bffm,,d-1,1 .,,.. W fy. . f. ,...f' . K M,,,,..W..,,,111Z,,,,w,Wf,,,-'ff -- ., -m,,,,,1W ,.,,M,-1,,,,..,W5wm,M1, v...v .,,,,,,M ,,.,,, ff 2 fm- rw ,.,...,... ,wx flfhgifiziz Wm KW'-N fmxwx 'N .M x, 5'1 -L.,,,t:3g'3-V A JA -L C., ii A , x -X? XDA MJ , 1'-1 21- . 'X-:Lf r'J2 ! YN fl' . 9 ya , V- .rf fffm 1. .. f' W' 5 ff. . - . , 'a rw . wr- , 111111115 gif, g1.1.L311g ' - 1 ,..1.,.., ,.... 2 i i 5 ...,,.,, Z 1 , ,,,,,. I ..,,..,, Q , ......, 1 1. ,.., 1 1 ...,,,,, Q ..,.... 4 , 1. ,.,,, 4 5 .,.,,,, 1 , , ..,.,,,. ,..,.,... 1 Q ...,,,.. 3 , .,.. 1 ,1..... ,,., ....,,.. ,. ,,.... , .,,...., , 1 ,..... 1 ..,,,... ,...,.. , 5 ....... ,.,.. , ,,,,,,,, 1 .,..,,., , 5 ,,,...,. , .... ., ,..1111, 5 ,113 1 ...,,.,, 1 , ,,,,,,, 4 , ........ 5 ' .,..,. .2 ' ' ? 3 3 1 1 5 ,,,,,.. 1 g ,....., f , ,,,.,., , ' , ? ,,... N4 1' f Y .-...-.. 2 i x , llll ,,,,.,., 1 g ..... J ..,,,,,. 1 3 ....... Z .,,.,., ,,,..,. Q gm! ?,W.,4 gwwg EW, ,,,.,, ,,,,,,.. g f ,.,,.. 5 .,,,,,. Q .,,.,.., 1 ,,.,. M, 3 ,,.,,, .4 ..... M5 ,.,,,,,, y ........ 1 1 ...,,,, 5 ....,,.. 2 ,,,..,,, 5 21:13.15 w' - 2 f H1 1 , ,,,,.... 4 , 1 1 5 g. 5 ,.,,.. .. ,, .....,,, 5 ZZILZZE Q, ......,, 2 I W4 f i,.,...4 ..,.. mg Q ,.... ' 5. ?.,..l7 f ,Wi ' ,I 5 .1...., X .,...., 4 5f,,,.,4 a. .,,.. .1 g .....,, 4 ' f -'f ?...,,,qN i....ffff Q13 L.,,.2 6 5,,,,.,,,g, M., 1... .... 5 ...Mg 4 5 ?, ..,... 5 ,M X , 1' ---' 4 ---M: 5... .... 51115 , ..... ,A 1.1, ,,....kf ,.... 231221113 W-M1 K ....... V L Vlll 12 V'W i ....-, -2 rw , ---- We f-M-45, 5, .,,... 5 ,HMA y ..,,, 1, ? ......,. 3 L ..... ,J ,,....,4 2' ' if gf ------- 2 5.1 ..... ., , ....--. . W, 511121 g .,..,.,. 5 ' 2 5 ....,,., i ? .....,, , M14 1 ....f... im Q, ,,.,.. gf: VV. f.... 2 ' V... ' f ......., ' - -- - .WWA .,,.... y .,.,,... 1 , ......,, 5 .,,.,,,, 4 ?,, .,.,,, 5 1 ,J ,f Y ---'v-- - I ..... N, 21.1.1115 X 51:13 em--4 -'--- ..--. 4 2 ........ 1 .NM 1 ..,..... , f ..... N.. .... 1 ...... Wm, , . -- - V fffffffffi ,,... .. gms ......., 1 .... 1 , ,ml 5 .,....... 1 ami . . vw PM ' , .... ,,,,,, .. , W ,,,,,,, ,,,,, A i . ,1:.., ' ff V ,... ........ - f , ,ff ,ff f ' , , ,f '- ff' ,f T ,lf 1 ,Wifi I , ' ?,.,,.,.f5T5f'ffff ' ...aff - I f .. f -,1, H ..,. . ,... - i:,..1 1 1 H .. .. 1. , L ...... 1 ' fi-::..::..1y --V.Vf ...... . . 1' '-1--11 ' ' 1 f :fig W 0 f f Z- ,,,. . V-3 f.., wh. .,.....,.. .,., ,... . 1 .71 ., 1 A iv, . M- 3 -- ---' Wm ,M -- .ff ,HW ,,,,.ff' J., ,gf 'ZA . 'f-f' . L .. , ..,. H, ,.,... ,- U 4, 5. ., 'W . :2 f -va W, M b5h..,G..1l q ff fy jr N 4 1 My -1-H-AH-ff-456' - '-Nmy 32.5 K ' is 5 z fx , , , ,-..,, ..,,, , , I -'mf .mf G ,,1 U Wm-N.f:.,J if-J fx ff. ,, 'fi ,, f wwf' , ' , ,, fn ' 1 ff M3 , fn .Mimi ff 1 W f,,,m,,,f, ffm , .... 1' ' . ...,, ,. In fzwf ,.., m,fM,mf,f,,f,..fmp,lyz1.flff ,,... f ,,,, 2,,,ffmL,f,1i ,,:fQ:w. .... ., ,,,,,,,,m.,,1m.:,.:M,.:m1,imZf.,,M,zL.w,,Mff ..... mi..maaa,,: .5 ,iii ,.,. , 4 , 4 , ixzizitii 4 4 , ,,,..... 4 9 ., ,,,,,,,, Q 5 Mm, ,.,, ,,,M,,,,,.,,,,W,,,,,,,,,,W..,W,,W ,,,,,,,,,,, MM,,,,,,,M,,,,W,,,,,,m,,,WM ,,,,, .VW M W . .qw-W, WMM N, MMMN , ....M,mm. W ,....,.,,.,,,.,,,N.,,.,,,,,,,, , , ..,,. i,7,,,,, ,,,,, N ,,,,,,. ,,,, 7 7 ,,57.,:77,,W,w,,,V,,,4 ,cf-,f'.,, ' ,f ' ,fff ' f f' ' X ffrf Tzwmf-7m'f'i:'wiv- -VW, ff' mff' 2 4 f f ' fi , , ' -f-ff-, f f , A '. X - fi ww ,,.. ,,,, ,,gg.:,g.,,.w , ' 1' ,,.:g,::,,,W,,,,m,f,.x,,,,,,guTM ..,, g,11g5v3'm3,gg ,,y,g:fi...,P521533-,,,.,f45fg 3' ,, QQj'j,, 'f ,V Z 1 . . .V . W ,.nf,,J,gg.W,,5gw,4i::QW ,.,M.M,,,,,g,,,,W,,m, M, M., ., , 1 V x 1 4 2 y ,. 1 'llffrv msg 6- -5.157 A , ,,..,,,N , ........,, ...- 5, Y- w., ,W-V. ,W , , 3 M fl ,,,,V ,awww . .. ..... ml, fv 5 2 4 1 j M----JPL-'Zf Z1'f 'f f '1 L 2 ,, Q za .E ... D ax , - A , 'uf -W! Mfg ,xwj-J Z? ge M- ,.., fp! if f ' ' 1: W' 2 ,U ,jf 577 . r - -X., ff 1 -W. , ' ,- 'T -fu .,.L2,.. W. ,H f- fx iff wwf 'K jf-g,,,y-N fees A ff! ,1 -1, W, ,,...2,, f ,f,,X,, ,Mfmr 4: J.. - ,g I-M ,IM- ... , ' N' ' fr. 1 Y -N, .f, , yy, V ' 'N ,, W- 2 yy ' -:av q, ?Q?m?uwmm4:mmf:Lmmmmff1,m,panama,:,fm.:,Mmmnfff?Qmw,w:nm:.mmnw:.:-- '-f:::1--':- Wm, l -' f--ff M ,-U - - 1aE,f,t.,,g1-., 2111111312 51:11:15 4 ,... 1 i 55111 1 .,...., .... ' 1 Zfl...' V 4 ,, ...... 1 T , ,,,, ..... ,, f ...,... ,,... , 1 ..,,,.., AAAA ljlfffff 1 f 511111312 4 I f - '1f 4 , ,.,,,.,,, f 2 ..,, .,.s , 'ffffffffi 2 , ...... Hg 2 .,.... 4 .,,,... 5 -V,,,- ------f' 4 F ,,,,, 3 ,,,.,,,, ,M4 , ,.,,,, 1 iw, ww, ' 1 1 2111115 ...,. 5 v---- f ff-1 f 9 .,..,, ---ffff 4 ,, ,..., 2 e '-- --- ' I ,V,V,V, ,,,...., 1 l , ,...... , 4 , .,.,, 1112 1 ..,,,.., , 21:11:13 9 ,,,11. 4 11.1.4 gl 5 fm? S lllf. ' W4 3:11113 , iw? ,,,, f 5 2 ,.,.. 1 ,..... H2 2, 4 EW -fff-' 4 5 ...,,., ,4 1 ,,.., ..,, 3 S 253551511 W2 Q 1, ' ,,,, ,wg 1 ,.,,,,,, ww? 5 21:55:15 7.11211 f fffffffffg 2 QW. 2 5 .,.,..,, 2 L ........ 1 f-Mme 1 5 ..,.. xw --f- I 5. .,,.., f 5112 ....,,,, g Z 4 1 111111112 4. .... W4 f 1 Q f--- f 1 Q f--... E 2 Ms 5 I 5,,,W.,5 5 ,,,V,, , ,,,,...., f 51151: 2 L .,,, am .,... 5 2 4 5:1 .11, ' .... Iii .....,, 1 1 fffffffffg , ..,, .05 ' 4 1 'mf , QW., . A , WM. .,,, W WZ? 1 1 ff f- , f- f' .' , ,,,.MQ7f4yjjf ,fy ., , ,I If -fffff Q 4 . f - ww. 110252211 Z , V f Www- - 2 'f 4,4-5 zzfgE,1: 2ff f'3' f, ::1'f7wL,, ,-,...ff3,,- 1 f , ' ,,,,,,f-ff' ,,.'f' ,,..fQ.ff . f I QA A- 1 -1,2047 - 5, Hg, H 1 142021:-hz? '2 4 -H' ,,fg,.ff' y ,,,, - ig -'f ' r 1 W- .wwf-1 1''mfcrzavwuw-fmfm-Wm-4,2Wv::Mxmfww.Nf,fvw ' Q 'i -----f A' .,., .,,... , ...,,. ,,:1zy,'f.,, ' -V , 6i7'ff 1 Vn Mm, 4 ., -SW M- W! . '-f' V, , '1f fu 1 1 fffxwga N' f f NN 'AX 4 s J N' 'V VMXWQXWJT: f Q' ii , 2 W W1 X 'KV-Wfa ' .J N' W Rx. , 'Y -'---J AV ff N ,, u ,,. 1 ni' , 3 , ,,, f-V W , f V QQ, ,, v I 1 rf' fy ,,., , , ,ff,,,w A : W ,..,Mf,u yn f-W, g' y fzw 4,M,,,Z,. .,,. ,,,, lf,,gffZ..ff,if.,3f.f,..::,:w ,.... Lf. J ..., 1 V...m.,LZALW:pwf.,mf,2ffm4-.-Jwffzg,n,,,wff .... f f ..,, 1 Q 4 , ,,,.,., 4 4 . A ggftjjfg f . ,,,, .,,., ffff 'Me T553 2 ,MQ + 4 1 ' . W , 1 1 , 4 , 1 3 L. ' ' ' 5 T ,. , ,.,. W1 ....,., g .,,,.., j JW I M' .V..... ,M m....,. V V , ,,,, ,,,, T 7, , ,..,,,, 3,7722 ,,,,,.. , ,fe , V. , V , ' ',f' ff 1 ff. -.WW 'ff M I, 2, , ,f ,jf N,,fw ,, f V , gf f ,. EV , V V 5 I ' ff, V f V V 1 ' . V V-ff, ,,,, ' V V . V. J ,lf , V ':. ,5I,7?5z ,X - '- . I ' WL 1 2 1,1 f'-V ii-ng, . , g,ff,47yf1i5f ie ' ' ,,., V , ,,., f , - V r f , ' im Ve V ,' '- -, V, ,, - f , fn-f ,Q - :fam LJQEJ' ' if Wig- Vs V --- V V' ,..,,.,N.,ff V ' fi -. ,. ,,.. ,,,..-,,,,,,M,V,,k..,,--,V ww. ,, ,1 N .... 1 , .q.1,,c,..,..... ,.,,.,,m4x N.. ,..., , , J f f 4 V , Nw V ..., ff ...4.. .W W... ,,.- V, ,MV-1Wfffav--1f.wf,,::,,,..,.L 'ff- WW,,,,,...,,,,-W,...,,,,w,,,,,,N .,,MVVV. ,, - V f ,Lf-. y .... g, .... N ..... 1 3 .....,. 1 ...i ' 4 g, ,,..,. 4 v -lllll 4 .,,,..4 T' 1 9 ,...... 4 a -..,, , 9 ..,,... 4 wma ,Mme 5. ..... 4 pw! z..... sa V... ,.. Tiff fl Z.- .... 4 . ------- Z ...i gms. 9 .... ,. - 'h sf. A -.J kj f-.,,,f.xjMWJ.,.f if M. h...., ,J if-J V' f Aw fa ,,... TW r'if 2251? f'-2i . ' 'M-. ,., nsmf. wwf 'n?'f5mTfff52 : '--nfs-gklxww .,,, ,,,,, -.11Q ?fff5f? Calendar Sept. 8 Wie're back! The 4'ums Haunt badges labeled '4Inforrnation.', 9 The class of ,28 an eager, bustling mob. lO hir. Pollock, '4Can anyone conveniently change from the first to the fourth hour?', 5 11 The annual jamsthe book linel IIVVE 15 Still dumb, but happy. 18 Signs of the season: Posters and season tickets appear. 19 Girls gossip while Mrs. Woodford talks to the boys. 20 Giggle, giggle. The Peri's attend the matinee. 22 Glen Cole appears dazzling and resplendent in a gorgeous plaid jacket. 2-I A new star appears on the gridiron! Oh so tall and thrillingli' i ilill breathes Helen Brown. Q 25 Zets watch The Covered Wagon. Q 26 Candidates for cheer leaders perform acrobatics in the auditorium. mf 27 The Hurricane begins to rage. 29 Did you subscribe? Oct. 1 lWembers of the faculty drink tea in the library. 2 Lynn of the cheerful grin will pilot the senior class. , 4 Detroit Northern is vanquished. A, 5 Angels and ministers of grace defend us. Unsats appear. 9 Oh girls! Pictures of the team are out! QTY llfa ll The hurricane blows Woodward home. i iiiii 13 The Altobees a-sketching go. 15 ,Ray for Franklin Whitney and the Juniors! P122 16 Wie meet our advisers, and they advise. 17 The stationer is on the job. Enter bright new pennants and clever canes. 18 Carey crosses our pet goal. 20 The Alchemists initiate - oof o -- ohl 21 Lady Retina makes her bow. 23 Zets blossom forth in new sweaters. Very original, Zetsl 24 Witches and goblins frolic with the Friendship girls. ZS The wildcats are tamed to gentle kittens. i One hum 1'f'f 1 .mfg-nine i l WW- . Y Y W iifflfff' 'i ' ' f l'7fl?'Q7' I f -- ' f ' 71' A f lf. a liali 1 1eV- ef-T:' W. '.., 5 4 ,M fa.. . Q '- A -,fWwf ', jj ' jfn-...fini q: 3 .,.,.. 2 jf, ,M C, if- '1l'W 1'-M 4 rf' 1 ,P 'W ge- - ' tiff' ' 'ulhftffisz C in 1 J V. ...J wjiwx' Aw! .af 1,9 fr' h'fff c...,f ---.2 gk? I vv,, , jj? , I 2 V, ., :,,,,a, I ,H ,,,, Wh W., .M ,fin Qi., N rm' my ,A -47, Fifi.. ,mn ,Aww if ,MW X ..,, 522521 2 .... 5 ,.,.,. Q, ..... 5 giiggg 3 CALENDAR-Continued 1 1 2 7 f Q if 1 AIIIVAV 27. Alumni organize. One good step to the front. i iff . We are done in bronze-2Sc for a Waite badge. jiiiiiii 28 . 31. They take our measure for rings, and Steele outmeasures Johnny. ,, ,.,...,. ..,..... ,. tffrrirrg ffflfffli Nov. l. 1 want to be in Tennesseef, sang the lN'lemphis eleven, after 1Vaite ff ...,.,., 2 5 3 ---f. ' had romped around the Bowl. f 9 ,,..,,.. J ' f- '--' . . . . 2151173113 3. Seniors cock a sophiscated eye at the camera, and refuse to believe in I2 s f ,,.,,... , . . ........ if 1 f the b1rd1e. 2 ' 5 , ,......, . , . .,,,,.,, 1 Q ...mg 5 i 1 ' ' 5 I ,,....., 1 ,,,,,,, f , 1 4. Georgeous Waite stationery fills us with longing. ..,. . 511:12 6. At last those clever Forum belts arrive. 2 we 2 5 ' 5 5 1 ..... 8. Bloomington's passes almost cause us to pass out. f 154 ....,.. -. 3, 4. t ...... ,g ......,. ...Wa . H WN'N 10 . Doc Heinen is editor of Retina. 1:1112 5 11. Armistice day, but we got shot by the camera man anyway. 12. Oh, see the pretty snow! Q 13. We defeat Peru and meet the Lass of Limerick Townf' Z S 14. We forget! 15. But we get another chance to bring our money. 17. At last we possess the precious pasteboards. ,Wag 5, 1 5 EI . 1 , 18. Don't you admire those Peri jackets? 5 -----'- 4 i 20. Q. D's. lose their lemons and the game goes to the Forum, 14-O. ...,.... ....... . Zets adore the dark eyes of Dick Barthelmess, and munch lollypops. 15 su... ,.. ...... f 1 ,,,,,, 1, 1 ' 23. Lorenz Schenck begins using his cane as a weapon. ..f--- z 9 ..,,,,. if ,.,,.... 5 ff: f--f H-g ........ 5? 25. Alchemists nearly freeze on their roast? f..-.- 1 5..e...g 1 26. No lessons, no sympathy, no nothing. 27. Victory, turkey, and the varsity dance. 25222222222 , , 1535535 Dec. . Friendship hangers, triple-coated in pink, blue, or white-for only a 2 '--f---. E 1 , , 4 4 ......., 2 . 2 11131311 dime. 3111111 ,f , , ....... U, 4 4 Y -ii 3. Dot Brigg's Egyptian dance, a feature of the Zet--Q.D. spread. 2 .-..f... , 61:51:11 2 iffffffli 4. Senior chorus: Goodbye three dollars! 2 5 ,..,.... 4 1 ....... , 5. We learn of Aida under the encouraging guidance of Nlr. lXlathias. ' 1 5, ..,...,. , ', fi .,....... V gas ifffffff 6. The Eastern Stars fade out in the Bowl. 3 if 1 .X ,? ,,,.,... , iiifllilwf 8. We hoard our pennies like misers. Subscriptions for the Purple and 1. A ze ----- 1 Gold are taken. W fi 4 10. Helen Snover heads annual staff. zz ....,.. ' 5535533 12. Squawkl The Commercial Club dances. Y , 31113111115 1 ff One hundred seventy N, .,.,,,.. 2 , ,....1. ...--.... ,... ....... 1 1 1 1 ..1 -1 11.1.1 WL ,,,,., - ,.,.. W., ..,. . ,W w.- ---- My I, 1 1 ff 1' ,W aww.. Wffff' ..,f'f,f'ff' ff 1 M , mf.. ,ff ,fff . ,f ,ff ,ff . . 17 N77 f F532 ...., , . f ..ff'17f f ' ,, . V Af ' f 11 ' ' f -V -- . ..... - W' - f ' fm- .- , , ....,. .... , .,., , ,.,.... 1 ...,, .,., ' ilg,?,g 1 gn , . 'gA,,qfagg,',,, ,f m35jj j 'j':1'1, ,.,,, . , .- W., 1 1 5 x f X . , . ..,... ,,.. ug ,014 , , , , 9 ,Mmm ,,,,,L,Mg. I, .v,,, , ,.,,. , , .. ,... 3, V , w,W,,,,,,,,,,,,,,,11:s17w4,wWil-Sialliiwff .,...,,,,,,,,.t ..,. ,,,,..,,,..,,,,:...., .... . -...,,,.:1.. H -V 1 VK 14. 17. 18. 19. 21. 22. 30. Jan. 1. 5. 7. .wmgQfif5eff,,, Knfff 310. ,,N. 2 -, ,X fy 2 XV -. f' CALENDAR-Continued V' Bevans' pets entrain for Qregon. f A world of glistening ice to slip on. 1Ve refuse to play snowball with Portland. 1 Santa, in the person of Johnny 1Vhite, gives seniors their rings. f The Athletic league does antics in the gym. ?e The Alumni dance in the gymnasium. 2 The Pericleans play bridge and gossip. 1 , Recess and resolutions. We return to greet those golden Hi-Y sweaters. Sophomores allow their goloshes to Hop open. 10. Seniors present Hamlet-and Laertes. 22. The annual board begs for snaps. 24. Doris Snover isn't going to freeze again, while she looks at the eclipse-not for 100 years. 26. Ha! Cramming was not in vain! 30. Friendship girls banquet and Hi-Y boys serve. imm. Feb. 2. Tardy? Sign and report. ,,,,,,,. 1 , 2 7 ili. M. 5. The boys are busy filling out blue question- 9,,.,,N r .... .. 1 3 ...s..s..s N. Vi ss X 2 l... xg f KN? X 55 S as . sq,X:i:s55..?i:J .... . Q1 3 is . li 54' fx Kuff iff: lf Lt 'x 1 4' 'DY 2 Z i 5 l 3 f Z Z 1 Z 2 f 1 1 Q S Z 1 5 Z S E naires. 2 , . . giiiiiii , lfllpse Ofsuf'-JM'-241 7. Helen Tanner has lent of com any while she 1925. P Y P . ya llllr A pastes snaps. z ' 3:1117 9. XVC will graduate without posies. -- 10. lX1r. Nauts entertains the Annual Board at a silhouette art . P Y LM X 12. liven the heavens wept today. 3 13. Akron wins the Hhoodoow game. if ffifi ' 14. The Juniors step out and hop. 17. Want to be a success? lWr. Cartrick tells us how. 19. Pop corn for sale after schooll Yum! Yum! 20. VVoodward adds another sorrow to our list. 2 21. The track team shows its heels to the enemy. 23. Wlashington, first in war, first in peace, first in our hearts. 1Ve get 2 1' fs the day off. ' .... N., 4 24. Beautiful discordl Yfe attempt to sing in the auditorium. 26. smug sicaque? 1Yot,s if mean? 153355355 One hundred seventy-one 2 113351525 i ...,... 5 V V . . V V ., . ,N ,,.. , ........Z 1 T.i 'f,,,f I, If ' yr ' ?f'f'5I w:c - 'fit ff if ,W f'i 1jjCff . ff'f' f 1 iii,-7 if A' 5 fi di fe if ' f1l 'f f'ff.i.u.,,.pf ..i' -f f- ' ' 1 f .... , 1 1 ,,,,,. 4 5 ,. ,.,,.,,, 5 . . Z ,W . . ...., M-, H, ,A.AA ,fe-..- ' X 11.., 5 W- ?::,-.:f?.qfi1g55 ff' at , . -.1 ...Ji-...Avi LLM! ...f hs. Q..,,, if-7 iv ff' 1141 ,. .fa ,,,,,, frfwxff-11ff 'g?frs ., A f-.cm as -ffn . ., f- .xv gifwa ,,,,, :mg...2u..:mz1.mZ. fam..a1x::.ym:...:::zwaLLx:2.: ,,.,., fM2.:zc111:.w4:mnu-am.1muw.,mwmi::mwmz:r:w.m.::unmm.nMn: ,,',. .,,, ....., 2 lldddly ,, .,,,,,, , , ,,,,,,, ifiiiiii ' 12 CALENDAR-Continued 25. Muellick leads his gang to victory over Scott. 27. At least Bill Bannister looks as if he were working for the dance. 28. We dance under the Q. D. banner. lvlar. 2. Boys kidnapped! Three Henry Esmondsw are taken from the library. 1 3. Mr. Mathias advises the seniors to use their motto. iiiiiiiii . . f 'ffr'f 4. We hear Cool1dge's inaugural address. 6. The basketball tournament at Scott. h lff 3 5 . . . . . 7. Woodward beats us, and wins the city championship. Eurydice Club l ,, sings for the seniors and their friends. 10 11. 1 f 1 T , ,...... . 1... Mary Perry has her hair chopped again. Why weaken, lvfary? VVho's going to Findlay to the tournament? 3. ...... 35 4 ...... 11115 1 1 ......,. 5 1 ...,.... 11 1 1 N ..,, .4 ai 4 2' 12. Set your standard high, is Mr. Pollock's advice to the Friendship .--' :pg Q 1 girls. 13. Whitney digs up a horseshoe. 14. Coon sits on it. We f1ing, finale and jig at the Shillelagh Shamblef' 16. Perhaps Mr. Collins's hairpin brought the victory. 17. Who decorated Miss Roacheis room? 18. Ha! We get a chance to use our Christmas umbrellas. 19. The boys drink in Coach Stagg's words. Wish 1 were a boy! :ly 20. Hi-Y journeys to Waterville for initiation. iiiiiii 21. The track team races at Ann Arbor. Wasn't PinaforeU just gorgeous? 23. The Periis lunch at Maumee River Yacht Club. i 25. Oh hum! Only three days of spring vacation left! 30. Girls prep for gymnasium exhibition. 5 31. Miss Kimble receives fearful and wonderful information from the quiz. i 2 5355 iffffffffj April 1. How many times were you fooled? j 2. Helen Snover gets a rest. Annual material is in at last! 1 3. Athletic girls display much skill. -1. W'eren't the VVooster boys good looking? And can't they sing! E ii 6. Wie think this is hir. Nauts's birthday, but we can't be sure. i 7. lt was. 5 S. Vivienne Brentlinger admits that these spring showers are hard on A i her curls. ffffffifij 1 1 ' ow hundred Swenry-:wo ,,,,, ..... ... . . . ........ .W - . 1 ...... 1 . .......... - M 1 . ...'. ,. if . C iiii . . ...,, ., .V 1 , .f fffxiiiii liiil iii i f gif! iii.. QQ '-nfnffsgfz, - .,.,,,,,, ..,. M nn- R -M 5' wa- p ,-. QQ 1,3 ...J V! Q ' , f Y: W kxh-fLNj QJ'..J Vs fi ,fn . 7 ,y ff xl' , 'W a I f V. ..V 'f ff, .fuglfm me.Jfm,za2,.1::L....z4Lz4g.1..,aec4r14' - 4.-:iwan-Mm-----:Mfg--ff------mu..,:.V-A--www---:fam--w-1..,1nmgJ.:L.f,.f.--L ' ' ' ff e L ,..... 4 2 . ,,,,,, , 2 i,1.1L2.n . . . .1123 2 33351 CALENDAR-Continued g 10. NVish I were a bluebird. . WMM E as ..... 5 : 11. Nlrs. VVerner offers bargains in crepes. ...,... 333' 13. Easter eggs appear in lunches. rrA.rAr- 4 17 Oh joy! The Hi-Y Friendship party! gm! , .....,.. 5 ' 4 1 , ,,,,.... 4 king , ,,,,..., , 1 7 2 is The Forum finds the Bluebird of Happiness. 333334 y.. .... 4. , ..... , 3 X ' 20. Chester Idczak gazes longingly out the window. Spring fever. 22. Seniors begin to look sad. ,Ziff 24. Band! Rah! ,,., M4 3 ya.,,.,.,! f 1 25. The Zets stimulate the terpsichorean feet. Y 28. lX'1rs. Allen plans revenge! HDOCU Heinen slammed her Knight. 30. Gnly 32 school days left. Aiiii I lV1ay 1. And winking merry buds begin to ope their pretty eyes. 2. Friendship girls and mothers banquet. 5. Edith Strahley heeds the call of the movies. iiiii 9. The senior promenade. 11. We dig out our summer duds. 16. Senior Banquet. Jimmie disposes of our future. 17. The other classes envy us. Z 21. Sign my annual, please? 25. We get paired off for the final parade. 29. Looks as if we really would graduate. H, Z June 1. That racket! YVe practice again. E 5 3. Exams. And we dare not flunk! 5 6. The general windup. 1 ----- W4 Z 1 .,., .... 1 7. We listen respectfully to the Baccalaureate Sermon. S 9. We acquire new clothes for our stepping outf, 1 ....... 11. We reach the goal. 12. Farewell, old Waite, as alumni we will be true to you. f--julia T. Palmer. ijiiijii i ......,. 5, 51 1 Om' liumlrurl sevrfnly-ll1r'1'e .4 i ! ,,,. , 'ff-- ., . ..,. . ,, ,,,. . ...... ,,,,,, ,,,,,,,,,,, ........... , , , ,,,,, . ,,,,, .,,,., , ,,,, M ,,,-. Alll, , V Alll I ,VAIII A , W., J, 1 f 'if' .,.fwf.,.f'f.., ' - ,ff 7 W'! ,..,fgff'f f3f.,f Z --'--f ..,. ,aff J A 1 . H 1 fgfinfygl . - 2 W W,,.,,,4W.1m,,.gf fe g,,,fg,f 1 V A V ,.., . .1 I :pf-f ffff' 5. f. . I '. 2 WJW4 1 f. 1 ',j,g3jyg'. , . 'fzzfigffififg -ff, . '-'-' M j UM .1 K ,,.,.,,.ff'fg1LC.ff .5 . , 1 1 v'-v.v -. ..... 'Q fff if 1 H5112 -V Z ' ' W .1 ...f'i.,fL.. .V ,,.. , W. ,W ,,...a.,.,,., ,,., M. ,,,,,, --!....ff'7'.... ----'---- 1 ' - ..a. y....,.... WMM , , , , ff -' ...MW 'W' ff N w'-f ff--- 'mf- 5 e'w.,wf....w-.ug-farm-a4,j,'5-,,'ff-3-v'f+-Mavwq-1,,,,.',,, --f----.W--........W .... .....,,,,..., ..., ,aw .,,,,,. ...-..., . 1, . -5Li:5jr5,5, i I ,555,5.5,U '55 ff . - . -5 I fu.-.5,vf-., h f .,.,,,., 5 y X NW., lf f I' -.5x xy, . ,,,. A M' - 1 f ' --7 4I'171, '11Z! i ' bf ' 55 ,5 5. 5 Z -fx 5. f 5 J 5 ..,.,, ,,,,.,, -.,,,, 45 1 15 .. ,,,. .,,, 5 ,.,, ml I 5- , f 5 5 ...,,f HM! , . 5.57 X 5' f21f -W M- jfmju--7 'Vx I2 if 5 1,7 -'-' 1' ?.5 5. 55, .5 ,5f' 4? 'WfQ,? Tl .' ., -5. ff. ..Jg2.,. ff-5 , 2 2 .5 ' ff? f 5.11.5 mf! IM 51' ,,V h25 fam' ' f 1 ,.,1 f '- fz Z 5'-5-f N f' Wi 3: '. 'M .f 'W 'ff HW1 5 ' .Q11111i 2 5 5111115 5 5 51111112 V .,..,,, i L 4 2 ,,,, Q g .,,,, Z 4 5 5 5 5 4 5 -'f-- Z .5.55..,, Wg , ,,,..,,, 5 5 4 1 5 3 5555 1,5 ,,,,, A S ,,,.,. 2 ffffffi 5 f I, ,,,,,,, 5 1.5 L ,.,,,,,, 5 55 ..,. 5 I .,,,,.,, 5 5..5.55.4 , 3 55555: iflflf' 1 WE J Q ,,,,, ,mi 3 1 ...,, fffg 56:11:15 5 .5,,,5 . Wg 5 21? Z Ihe Nlodcl Hal f E , ' P 1 5 5 Om' ll'ul11Il'wI x4'1'f'nly'fu1U' 4 5 5 .55..., WW , ,,,,,,, M ,,,,,,, ,W ,,,,,,5,,5 5 -'--5-f- 4 5 5 ,,,,.,, 5 ,,,,,,55 5,,,,,,5555 , W ,,,, N ,,,,,,,,,, M W... ,,,,,.,, 5,,,,5,, W ,,,,,,, . 5, ,,,, .Z ,,,.,5, 9. 5 ,,,, 5 ,,,,5,7,:,,,5 ,. M, ,, , 'X r .. .. Nw 5-f' .5 - .' .' 5, ' 4' 'ff N E 5 .fl i .5 5.5. 557 ,E M , I , I I - 'Q -'42 5 ' WM..5,,,,4 1' A- 5-f , ' 5 - ' I ,,.. V5 , 5 A , 5 ---- ,,,.555fM-WW'-.5-5 ,,w5W5ff55,..,VW,,N,w' -1 -0WQU,..55f5w,,,..5mj, ,,,,, .... 1 5555 ..,.......5 5 Mew... WW ff 5 f wxwxw Q S QM Sm Q X X xLmK.XXK fm,, Xx.xNNXXXkk..Xx,.- .... A X233 X X 5 S XX X SEL L 2 X- .-.X xx, wx-X Q f-I' 'N.f- N. s wx Athletics NX bwikwm.. v 1-1. grae. on o fx faijiiwg - WASH 2 W9 i Z I 1 2 Z l 9 .... W4 1 . 2 4 ,,.,..,M,..,... s,, ,MN.., ,. ,gf We ....,.., ,,,,W,,, ff- it ,f .,,, f .,,,, lj 1 f ff 3 W... .... fg,,,ff,f.,y wx 'V 'Tf.yg- ..,,.n , ,,.., , M f -f i,fff 'f ff. lp V -. ., aff. f- me fi, aMif'W,,,, ' ML, f f' ,.,. 511111212 flififli l .5 1 .4 Z 2 O ' Q Lil' Uilifzlefza Code 0 ' an Athlete I am determined: i play the game to the limit of my capacities, giving to each detail the I greatest care and attention. -4 2 strive to carry more than my own burden, to do a little more than my share, not seeking help from others. lf correct my faults, ever eager to learn and improve, never seeking to cover up or conceal mistakes made. lllrrn L 5 carry the fight to the opponents with the spirit of the Old Guard that dies but never surrenders. 2 be unselfish in endeavor, caring more for the satisfaction which comes from doing a thing Well than for praise. glory in fighting against odds like the Lacedaemonians who never asked of the enemy how many are there but Where are theyf, ,,.,.,, If .Ziff ? hate an alibi, knowing that the man Who makes excuses admits his Weakness and has a dwarfed soul. fffree' 5 rise above obstacles, to fight harder when the game is going the other ' Way than when Winning. 5 fight With an unconquerable spirit, realizing With every act that the deed , 1 is the measure of the manf, 'N IIVI play according to the letter and the spirit of the rules, scorning an un- fair advantage over an opponent. f be undismayed by defeat but with a will hardened by adversity seek to learn the cause of the failure. , , ,,...,., be unspoiled by victories, realizing that brave men are softened by success rather than by defeat. . t gfififif 3 give the best that's in me to the end that I may bc a better student, a better citizen, a better man. 9 g 01111 I nrlrml sel:r4nfy-xiii: ,,,,,, ,,,,,,, ' '--' -ni f am... all ,,., i , ,,,, ,Y h ,. Jfr- ,, ,,,.. f:iiii1f37'L'l3'i X ,ffiiff X f 1 .,..,,, , f ,,., '- W -f-WMM-W4.,m:,wfm,VW: 'fmMff'n::WfwM I yy N, 'N VX 1, ,ff . 1 ch 5 , .,,.,.,,,,.... , , i,.,N,.. M .J . , 5 , 24 WM H. ' 015242. fe, -3, 2,3 22 fm? 'mek ,,,z,,m'v yf -1 -, ,Ma 7,,,-+--Lu fr- ix x -XE ' f 3 ,....,.. 4 2 -Vi 1 ......., 2 f A 'k,., , Vx i 2-. ,.,.,..,, ,Q,,, fQj...! 'vw Na 2 W.,,,., 1 ,zffiiii DCQIIKV Jlffm BASEBALL-1924 Leonard Reilly Donald Dunn Charles Limerick John Dunn James hIcGuire Edward King Norman Aubry George hluellich john Dunn Arthur Geoffrion Clayton lX'Iatt Kenneth Arnold Gerald Steinecker Edward Sloan Dewitt Fought Pete Penkoff George Muellich Eugene Farrell Kenneth Neubrecht George hluellich Pete Penkoff Gilbert Bartko Robert Radbone Lawrence Coon Pete Penkoif 1 Louis Booth V Glen hlartin . ...... 5 Robert Tierrlan jjj TRACK-192-l Wlilliam Lindner A1 Franklin Whitney George Duffy A Albert Stith FOOTBALL-1924 ..,,,,,i, L Al Harry Steele Donald McClure Albert Buechsenschuss Lawrence Coon Ben Pencheff Dale Kalmback hlark Pecord Elmer Annis BASKETBALL-1925 Franklin VVhitney f --f-.... 4 Ben Peneheff Donald Talbot 5177! 2 Kenneth Neubrecht F. ! T Parks Emmert Qffjjfl V .,...r 12 O Il 1' lz llnrlrfrl sr'1'f'rzf!1f.wL'y1i VW? r '-'-- rf a..a4 fm ,,,, 4 ,.,. , ,.W,,,, ..,., .. ...,.... ,,...,,,,,,,... , W I V U lldddll Vfgv M V M 5-...qi ,, ,ff ,ff 7X 7 ,.,f..,, ' , .. . ,V-,. ,,,Wff 1' ..f .Va ,6 7:ffy,,, , .r . ,-f V, f , M ,, 'Cf I ., I , 1 V , V 'fftfi , V r , f Y , iavfma-f-.f ' , 42 Q.,N,,,,,.,Wf,,AVVf 1 if , . A -V V '.- i' 'fgf ,,,, 5 V 13f M . ,H ,,,' 5 ',,,M'f ,FV - , f,,:i .,f,1V,,gA -Vf------- 22V1'1'f:ff' , 1, .f ,,,,..,.J,:. .... V I , , f 1,,,fgggg,W,,,,N ....,, ' .,.. VVVV A A .... ,,,,, - '---' ',,,,.,,V..rf'1'u:' ' - , V , WWMU' V--,V mwwffh 5 wW,...w.M,m,9Vmiqmg.,ggwwlffv-wff1a2f5a.w'3:pAg .... ,,. ..,,. ,.,, W ..,. , mn--f-'f UN ig . ,,..,,,,, ,L mam? fsffffff . 'W-QLgQ '.igy K ' V X ,.,... ,Af-Mx , .,,., .32 , I wr , f 'iq ,f 4 tv., f 2 ,,,A f gf 3 ,J vii f ,, ,, 2, ' M . f I f --,ff , ,f V .J X' ' ia J iv' M ' ,n,,,,,,,ff ,f ,i ff 5, f. fm ..,, ., ,,, , f.- 1 yff ff ,LJ ' . . wwe f. W fn' f. .. f., ,,' , jf f .. ff-.g,,, 'V f 'ffm Wf45'.,,,,,. 5, rw f -me' arf? , f f 'ff il - .5 A ,r -W .J J vm f - ' f ' f' ' . , .N Wm. .,,,,,. W - ,,,, ,.,,. , . -' -' ..a,,..,. ..,, , W., ...,.v....aa..,.. x,:,,,,,....., -.,,. ' :.,V,,,,, ww, ,W,,,,z. , ,.,,, , .. . 14 1mm..:ff:1m1.f:.:f:,.awmNw ...... Ae. .....,,. ,,.,,a.,,z,.....n.,,Jfr14ff --M . .... H , . W MV.. YVVV . . . . ,.fAvrr,,,,,s .Www 'Ili , 5, ..,,, 4 , ..... ,.l 1 1 5 . .E i V Q . , , 7 5 K f 4 ,,,, , ,,,,... , .... , , ,iiiiiig 5 E ,,.,111, g iii? E 5 2 f 5 . , . . . ,..,,.JT I 1 Q 4 ' ---' f r Q 'vvvf rifijiii fffljlff ?ffl535il 1 l if 11:11:13 ilififj MR. KLAG 53:5 ?'i11:11i l 4 Waite High School, national football champion! An imposing title, indeed, and one which many people have aided in bringing ahoutichief among them the Purple Hurricane itself. , I But while praises for our wonder team are on eVeryone's lips, we know very Well that Fred Flag, i by consistently choosing YVaite7s opponents from the best in the country, has built up the standard J of athletics in the school. The title itself would not be so thoroughly deserved were it not for the number of line teams, including the strongest from eight states, which were included in this year's schedule. The Hworlqingcstw man in the school, Fred Flag still finds time to instruct students in the ' wonders of physics. 'I'here is really no need to introduce liimg even the freshmen know him and his infectious humor after the first mass meeting. Om' IIIIYIZIVPIZ 8!'?'!'7lfjf'f fff,lIi EQfff35 , ,,,. N M ,.,, M MW. ,,,,,,,,,, s..,.,.,. ,,,,, N ,W .W ,,,,,,, . ,, , , 'I .ff ,f ,f ' f ,.., , ,.,,., ,,.., ,,,. f ' H , , ,, ff, ' 5. ,ii .,,,. , f , - at , ,, 5 ff . ,A ...,......, , V .,f,Lgy,,fM, ?' .3 ,f M 1 , . , , ,,,, ,vv ...,, , ,,,,., ' ....,.. .-gm? i 1. ' .3 .,,, fy W pw- .f E , af fy V f-'v gyw.-www: ffff- . W ----vv . ,,,,gmnfef ' f--.f , ,.,,. -' ff fi::,S,,1,,.,tiffJ2r,, J.. ..... ,ff -, I I ..L,.: vf,5WW.W..1,zwLL54mL,I,.. 4 ,ILA - 5 ..'f??1.- 2 'y , ,,,,.,,..... ff ,f fa WMWM ., m,,W,m,Z,,,,,,mh,Q, Z2 ,.,,,,,,,.t.,,,,M.,,,,WW,0,,,, . ,,,W,,,,.N W, . rn , Mm tv 'x fm 'NN , a xvw fm ia N 'XG ff' ,K 5 ' I va 1 f .1 .... 1 .7 f-. , 1 ' f , Mau-D as-. f fi!-J Yi s,.,,s.,,,W,,f g., f Az X 7 f...,...,'-Q, f ,, y,IUif'Ef+S J -V ,, -. ,--. , E , ff .fum f ,vw-tj 1 1 dl V, f ,f'o.,.f'zjf ,sf ,-af-,..,,, -45 f, .5 He.. , Z -vw.. ftyfx f w f-'-- ff 'Q ' . -'--- 1 Q '-'- M1 j ,,,,,,, 4 L ,,,.... 4 g 1. ,,,... 4 1 2 ....... al 3 .1 . . - ' 2 5 4'YYlierels my headgear?W Did you get the cleats fastened on my shoes? ' '4Heyl this ball is too softlw f Let me have a good jersey. V These are just a few of the problems a student man- . ' 1 ,,.,,, ager must solve, and Jimmie Carr has pretty successfully solved them. He has been ready to take command of ad- . verse situations, and satisfy a bunch of tired football ' players, which are not the easiest things in the world to do. Helping wherever he can, attending to the thousand- ,,,,, and-one miscellaneous things that are called for in the f ' 2 4 2 course of his work, he has won the respect of the entire squad and of the coaches. The school, as a Whole, may not realize the responsibilities connected with the work J . 5 of the student manager, but those who do, will remember 1.111115 2 the way jim used to tackle difficulties, and his cheery ' ' ' ' 2 smile that was able to radiate sunshine into the gloom- iest situation. . 2 A Ziff f giaazgg jffffffff j PAUL ST. JOHN Any machine, to Work efficiently, requires much care and adjusting. No one can deny that our purple- clad steam roller ran smoothly last season, for which v fact a share of the glory should be given to Paul St. john, ffff-f M3 , ..,,,,.. 5 ...... 1 , assistant student manager. His forte is doing any job ' no one else will do, and picking up loose ends generally. 1, After his two years' apprenticeship, he will be chief 5 student manager in 1925-1926. f Om' Irllnrlrwrl .w'1'm1ly-nifir' K , gliliig 5 ' 3 ,,,, , ,,,,.,,,,,,,, ,W ,,,,, , ,,,,, , ..... iw ef 2, ..., , ,,,, , ,W ..,,,,W..,, ,V ,. f'fff'fiN'! ff ....,. , ....,....,, , , ,,,fff1i1111fTLff ' ,.-ci? , I VY' 1 Z 'hZz,'f 3' :ji f - i.,.-f ,.,f'jL1l- f , ,,,. 1 , , 1 5, .. , ff vvfff , f ,ff4..'g,'l.V,V ,.....f I ' ,rju - 1. ,.,, V - ,,,,, --'- .... 'f' W. , , . , ,. .V .,,.,, ,. K f . . 2 .. ,fgww W1 ,, ,. ,,h,,,fffaf,,-awwww 5 MW? ,,,, W,,M,,mN - M-Mf-Mggwfffffffm ,N .... ..,..,,,., .,., ...... ff-4' I V--X Wfficf f , 2,1 f' '-,My .X 5 Wa ,.,, ,.,, f , ' ,Q ff ,fl ,f y , . .... f 2 z ,, . ,f :rg f g - -uw,::Qz:a,,, 'A-, . ff f , 'Z ,,.,f AIII ,ff H..,,, I J .M iv, If 5 1, ' ,ff j fx - C 14 2227 ' , -, ,,, ' 2 f' 2 zfffiff , ,.. ,.,,.,1,, ..,, Q,fZf3ff6'Mf' , .,,, , W. W . V- 41 fflfwf 'A f -- W- ff-f , ,,,,,1v- Q, MA, www, f f f W mc,,:z..fmi.f,m,,,Wwmz,,fw:::w:m:aug4m..W,.-.4,.,,, ,..,, ,.4uJ,,,,,,..,,.L.if hW,,z,..N,,,w..,m,M..Mw,.. -Aww ,,.. My ...,, ....4Lgm,s,,M ,,,,, We,,N,.w4sWw,6.,y,W,4 7 E ...,, .7 Z ..f..ff 5 Qffiffi , 1 il 4 1 i Liiiiiiii 5 THE CHEER LEADERS As important as signal towers to a railroad are cheerleaders to a rooting section, both in 353 d1rect1ng locomotives and rn contortmg themselves in rmitation of semaphores. V, ',e,', 3 Our cheerleaders this year proved apt in coaxing yells from the students. Art Force Won the 111i cheerleader's letter as a reward for hrs gymnasuc generalsliip. Eddie Wellsby, the smallest boy 4 5 in the Senior class, and '4Red Burson, who will direct the VVaite Vox Humanan next year, aided Art in his Work. , 5 ,WZ NM.. . Q ...,.,.,, QIZZIILQ 5 pf, ,,,. ,5 5 'Hfffffj 5 4 Om' llundrwl viylrtgf 4 4 VM, ,., M' ff! f'! f ' ..,, '--WW, f , ' C37 f ,,,, 1 , f N ' 2f:zp1N U' 'I,qU V2 J ' ' ig, 2, ,V Q, X f X IAAA If - f In 'Yl,,l l Illl V --vv ii:.:..1::..:::::::.:--,-.ey ' '. ,..,, ' f ' V! f J? - I - ,.-3 Maas-4:,f,.u ,f..4,,W0,,.m llllf f f ff 1 -aww, 115. fEf4M!!17'fl . QW 'R 'wid K-, . 1: fjjjj' ' .Z3 M221 S' W 1 gr ef , j We C3a..-,.fa.f3--C-,Q .V .t.,.,,,.ly-- 4, V , -fu ,,,,,f Y...-1 ' .J l' ll -13311, hx.. .' j f --1 'V' ff ,fre x,,,:..,..-1 3 1,1 ff' W If SK If X1 5?Q ',.f,,g2jjw-xc ,fc ,fQ,fw.x ! M f inf fm fX9!,,kJ.1fe5?,l ra,f.s,,f it ,l'k.,, Vg'-V, wqam ,www :-'rr '- Wa. 5 ,...... 4 E 3 4 6 , -4 1 f 1 6 W4 .... , f f f 2:51:12 Q 2 llfll z , ....,.. , lfliliff 5 l tl A 1132 5 John Ehrle, Head Coach 4Af. I A B 6 I! 2 The 1924 baseball team, while not as successful as the aggregation of '23, fought its way into third place in the High School League with a percentage of .600. John Ehrle, assisted by Joe Collins coached the squad, and though only two letter men were available, they whipped the remaining green material into a team which gave the League leaders a battle throughout the season. amz . After practice games with Maumee High School and the Toledo Police, the schedule proper '---' was opened in imposing style with two decisive victories, Scott and Woodward being defeated by scores of 21-12 and 23-3 respectively. Then Central crossed the river and overwhelmed the i Purple and Gold, 16-4. , The next week was an eventful one. On Tuesday, St. Johns, the tail-enders of the league, 2 upset the dope by beating Waite 11-6. On Wednesday and Thursday the team was compelled to play Central and Libbey, who were then tied for first place in the league. Fighting with their backs to the wall, our battered warriors took both games, the first by a 4-2 score and the second by ji a 7-6 margin. . ,, , . 2 After this spurt, came two more defeats, Libbey and VVoodward putting over 12-1 and 14-10 wins, the latter game being broken up by rain when barely live innings had been played. 3 YVith a final rally, VVaite completed the season with 15-3 and 1-0 triumphs over Scott and St. Johns. In the last game Lefty McGuire, thc Purple and Gold's premier hurler, shut the Saints 211111112 5 out without a hit or a run. Besides this achievement, X1cGuire's pitching was outstanding all season. He was credited with only one defeat in six starts. Limerick, toiling in the outheld and , behind the bat, also did effective work on the mound, usually as relief twirler. In his one full f game, he pitched his team to a 4-2 win over the pennant-winning Central team, allowing only 2 fjggjgm, hits. Tiernan worked in several games, but seemed to be unable to hit his stride, being chalked 5 up with two losses during the season. Balyeat, the fourth pitcher, was defeated by Woodward .... ja, , in the one game in which he pitched. Z Of the hitters, John Dunn's work was most noteworthy, He led the team in home runs, lacing out 3, in total bases, with an aggregate of 31, and drove in the most runs, 14. Incidentally he struck out the least of any regular, agitating the air only once. Booth whiffed the oftenest, being credited with a K on 14 occasions. He also led in three-baggers, cracking out 4, and in Vlijjj runs scored with 17. Aubry, who was taken ill after the season was half over, led the team in 'fffffflff One hundred eighty-one 1 15:11 A 1 .,.,, . ,,,,,,, - - .,,,..,,,, M ,,,,, ,, ...,, M W..,,.,..,,,- ,.,.. - .,,.,,, . ...,. ,,..,,, . .,,,,,,.,,,,,,,, ,,,,. ,. .,,,,, , ,,,,, ' Q' gg, K ,,,,ff Q,ff ,.-f' fjf l .. f 2' ' , N H'1'f fl w W iff-f .1-f':ff7 ' -f-, - ' f' l ,. 'V f X I 2 2 Z Z E f E 1 1 , , 1.-.14 3, .....,, g L ........ 2 t ..,,..., 4 1,114 Ni 1 ...4 311113 311111112 1 ,,,.,,,,1. 5 1 ..,, 1.15 3 , .... ,H ,. e, 4' F7 W- ,,.,... rfigigvfl FE :XNggggiv,3,,W f-4 Qi , , , of ...1f1lWx'J.-1 fu! li N 1.1. 4.ff-J'--'J if ' l f AAA ,,., , f 1 batting, having a percentage of .444, and in two-baggers, smashing out S. Pete Penkoff stole the most bases, 13, and also was the best waiter, with 7 free tickets to Hrst to his credit. Don Dunn led in legal times at bat, 44, and was tied with his big cousin john in number of hits, with 15. One thing which helped the team was its remarkable speed on the paths, a total of S1 bases being stolen during the ten games. , Record of 1115 Sfafon Opponents Score Waite Scott ...., .,,, 1 1 ,,,,,,,,,,.,.,,, - 1 12 21 Woodward ,,.. 1 3 1 23 Central ...., - 16 4 , St. Johns .,,, 1 11 6 Libbey ,,,., 1 6 7 , Central ....., - 2 4 YYVV 5 , Libbey .,,.,..1 - '12 1 1 Q Woodward ...,, - 14 10 1 Scott .,.,,. 1- - 3 15 , St. Johns .,,, ,,.,......,.,,,,,,.,,.,. 0 1 in 'llff Bafling Order and Summary Name-Pos. A. B. R. H. Per. tiiijjffi 1 Booth, lf .,,.,,,, ,,,,,,,,..,..,,. 3 9 17 10 273 1 Penkoff, 3b .... 1 1 39 10 10 273 PM - ' D. Dunn, ss ...... 1- 44 10 15 340 I Q J. Dunn, cf .....,. -- 42 13 15 357 Ziilllfll 3 Limerick, c. p. rf-1-.1 11 37 S 9 237 , , King, lb ...,,,,, 1- 33 6 3 090 3 I ' Burwell, 1b ---- 11 4 0 0 000 V Aubry, 2b -1111 1 - 18 7 8 444 I V,,' H N1L16ll1Cll, 2b--1 1 1 2 5 7 Reilly, c ---111 11 25 6 10 400 Martin, rf ---1 1 1 22 S 5 225 'W' L McGuire, p ---- 1- 19 5 6 316 ,lil Tiernan, p --11 1 4 3 0 000 is flrf 2 f Balyeat, p 111- 1 0 0 000 ,,,.,. 1 5 Allen, rf- -1111 - - L -Q 2 000 Total 1-----1--------1--11-111 1 347 92 96 277 7 1 - as uxmqweea Qjjg giijiiiif 5 1 One hundred eighty-two J ' 11.11.111 ,,,1, 1111 ,1.,,.,, 111 .,.,.,11 1 11111 ,,,,,- ,,,111,,,, 1,,,1,, 1 .,,1,jy,!.7. --1-. f' ,,., .... ... 1 ,,.. 1 'W f ,:t::4,,W, 1 Lf 1,-W 5 2 Z X , , f AE -V A ,aim ,,. , M. 5' ' :V V- M y , J V- ...,.,, 112 .,,, ?m7 3 .,,. w,,r,'f-gg,,, ,,,,, f 1 uf ,,fh'-W 1 ' ' ,419 L' H ,f f 3 .1 W ,fe 1,5 ,f ,243 5--X f f Mfg , 1,27 I X It .,,.,.,.f' 'j MM fb, ff-ff'-I ---M, , I f,,,Mf,,x J? fffvfg, rm, . ff- f ' jf. if .... 4 r ..X IS K... C HI I'1PIONSHIP A-GEOFFFNON Ifixccpccuuitlbvzalll fwf Y '-M ' ,fff ,f f J. ,,,'.7ffqffQM 'WWff'Qi' 5 f' 56.51, ,. f uf f ff ' ffffff' ,:g1,,Z1zg , f 1, fn --'ff- ,,,,,, , ' , , - 1 g,gf,,,i,6 , fv 1 ,, W,,,.,,,,.Q,.,,,,,,.,,v,4f,,.,:wM, 2 . ' V .. , 2' iw fi M,'i'ff?27 ai ,,,. f ,ffm-w,,,, ,,,W,.,,,.M - , ,,,,ZQMW WMM, .gm M ,f. f f . , f f WM. ,me,.f..fgf.,.fffM:e,QiWzA::mf4z2 awww N 1 , f i f 2 Q.w:'25faf:f1ff,, 'Wm .. .,gx.pz.'-2' Qi, M , H :Lf '-IW M fmflfll- 1, ,,:Q5...,1m, M f' 'Nw Vx M ff ff 1 J ..,.. fzwwwf-N ..fg,:g..,,MM-, ,fm :Q ,H-X -L 1, 1 A AD K K A I - - x .Nz ww, 2- X ,J 5. ig gm .,,, 5 j'1Q,, ,,.,! vw H ' gg fl f 5- 1 fffyz MH. ,,,, ,ww 7 f 'ff'14 ,- ' . f- f - f f l-.A f W f 1 ,,,. xi, ..,. .... ' fz..,2,.ffM.,:f:mz.::M.1wmimff.Zw,,z:um.,mZ:f1,,, .1 ,,,, mfmcQiw24:,wfz:f f ' ,,,,,,., 1 5 5 5 5 Z 2 , Z 2 9 5 3- 2 7 9 T - O :z-' U ... ru 5 Q' ff 3- 4 rn un 1- ,T V rv :- O L-1-4 5' : : gx: z .. v-A m H O O -1 ,J 5 : - js ,., WO O ru 9-2 sn H N S ,qnguiwwfggi X - H A , :M 'J o 0 5 2' FJ .53 f' rv 3:39-,524 :Vg ' w ,,, .. -1 no . S . .1 Ts S' 3 :Q H 'D G E fg E- H my 90 B EZ' HN. 2 r-f Q 4-F su ffl D nw O 9, '-1 : X Y ,,, Q. ,, 'K w C iq 2 Ex E 51, H 3. E: D H un :J 3 5 U, O :- 0 : -4 fa ' 2' D 'D 0 5 H 3 E S, 3 5'nQ -U Q gl z- 1 71 ,, . :1 Q. E H l ' :D ' 5' sif - f-v Q E 2 2 Q U' 55 X O R' E' 0 b- fn 0 if 452Ef3:r2LT9 S 5' ... H' FV w 5 S 5 2 95 ET F1 5 3 Z ?4 5 -- 5 1 E' fn S O 0 'D O 1 r- ,. ' '-' T' Q' ' ru QP :ax-21 ivsi '-T0 f, ' 9' cn :Lg Q 514- u 5 'U ,- Q 2 ff 8 0 0 :i ' T 2 WS 5 23' f-+ gn K ,U D : 5 ..i. -' . .N.. v G O E 7? Sf 3- O 0 55' Qs, . O' B -1 ..., -' ua 'U rv Sv 0 F. fo 5' 1: -J: gg 3 :. -1 : Q- ., gf N S ' '- X 3 -1 ra k5.,.E?:,..,. H Q H F V, A, O O an X :- H 'O ' Q, C - D- o 5 O 3- 4: f-f 0 570 3 Q0 'f S 12 T H U, 5' v 0 Q-::.flf,.,i:E? 7 ' 'X O -T Ears? 52 GSE 2? 5 sg -' H 1 ff A 2 gr F24 7 N Q- 5 1 Q QM 3 3 5- U' 75 3 Vfffi .E ... SD . S H 14 'Q -f fm 5 '4 3, :- rv :- x A., ,-, -. 0 if :- 5 5 UE. as 3 '1 5' 4 : :, Q. Q' zsx UQ W ro 0 0 L EQ .-.- '1 O 5 X -'T' ' N as sw X ,D 3 5 H 6 U: u UE 9' sn T -'T' ' ZZ O 71' Q X 5 5 E. H W ' 1 E .. D :' 3' S- 3 1 2- E. 3 o : : -ga 5 f-f 5- ' i ' x .T :' -3 ...- no 3 'D : H x 12 R2 'U 9 zz. Q- 2, :f 'E 5 3 Q Q. 1 X13 3 :f Z' H2 X : -Z' 1 0 5- -, - A P, av Q X V K Aww xx X-fx ., ...A, . .,., , ..,N.2 -2121 , MM-WW vxiuixxiax N NN M -Q-- f..,.--A . .1 M M...,,,A . 1 V ff 'ff s f Af f ,,,, r f 1 fr 5' I ' ' I X VVA- f 3 ,,f lrl, X7 ' f ,,,f If 3, 'HX 7 W JE W ,,,,,,,, ,M , C , 5 ilfif f fl' ,ff 'ffr ' ,W ,.,, fr ,,,, ,fe f ' f QW . J VW f ffff y ,,,, w,,f4f,,wW f ,,,,. 11:11 ...., .',' f :M,ffw.fJffm:,m,f, fm,.fW,f,,,W. f f f f,.,, 0 l,Wf:,:,,ffff,, Mydihmzzmazyhgk, Larry Bevzui, .Xtlvisory Condi LARRY BEVAN It will he diflicult for sport followers next year to thinla of footlwall at Wvaite without associat- ing: with it the nainc of Larry Bevan. During! his four years as mentor here, the name ol llaite High has been emblazoned in the annals of football. Since Larry took over the coaching of the Purple and Gold team, it has suffered only four setbacks, two from Scott, both by a one-point margin, and one each from Steele, of Dayton, and Cedar Rapids, la. The apex of Larry's career was reached this year, when he piloted the Purple Hurricanew through the season, undefeated. Last fall Bevan announced that hc was 'Alt-ating football for goodfl and, at the close of the season, he rc-signed. He labored unsparingly in the cause of football at Xllaite. llerels to Larry -the man who made the Purple llurricanen hurry! Ona Iriuirlrwl eiylffy-jim: t t M -' MMM ffff M ff W ,.,....,.,.,, X, 2, ,,,,, ,,,,, !.,,,. ff ,f H7777 1 X W ,,,,,,., ,.ffW,,f,,.54,, X , , 4, f . ,,.,f.4qf. r ' ,. ffl ...,,. I V, ,, 1 r f f ' f A . ..,. f ' Y ,...,,, , 4 f 1 4 A A Z 1: M 'jfcicvwwwwfh f f W,,,-,ffm , -9 100WW,,,M,,,,,ML4,25i?,,,M5ZW,Z,N,.,0-, M,,,,,,,,352W,Ll,,, v.., ,M , , all , f 1 i I , Q , r ,, ....,,, 5 , . 4 2 ,. Wiififkfp, ' 'inf' F 'u'f .sifL....1f. 4 ,,.... W1 f N Vw rw. 4' 'K' my M ff1.-,,,7n-ff-cf 'J NWT- -1-rut. fe U ,Xue ,... 5 2 '1 4 .Ma M,lKM,w,1': M! l hx .,.,.,,. 'vw fx, . A Wwe ,dw .F A Sta ,uf :UQ I In twwf. .raw-WQWI JMX E,4i,,!' fy., ffm.-Vl..,'mw4 ':,. fm fxmfnxl Ju f.. sy? gal... if-.ww V, fav W Z,,a.,t,,,,x ..., 22.111ml,mi.Qlfjffiiaffffnff,mmm...mm:,,.::::::sa.xe:,z:...1p .,,,, .,,. ---- f fiiiiii, 5 V-A'f'ff 2 ....... Q Z --'- -v ..---.- 4 z 5 .,..... 1 5 , L ,...,,,. i f , ...., Z ..,..... V iffjifqiii . ,lii I vfvv 5 , iiiiiiiiii 5773372 l lliiiiiii 3333332 f 2 s f1L1111:l --f-f ? 72 2:1112 3,2222 2 5531111112 2 ff'f---f g 511211211 1 '-f4f ZW ,,,. Z , 'fi 2 l ffl 5211122 i 2 f 5 2 2:31112 v V'V'-- rl 2 52 f , ...,,... 2 we-s l ..., gg .,,,.. sg 2 5 , '.,,,..,. , 2 5377573 , ..,, :xi , f v '-- 5 ' ...,,, Mr. Harold Fletcher, Line Coach Mr. Noble Jones, Ass't Coach l 1 211111112 -- f 5 , -'A 355:53 L s , ,..,.,,,, 2 5 l E , ,.,..,. 5 1 5 ,.... i , ? ......., , , , ...,.,,, , , MR. HAROLD FLETCHER 55:55:22 1 , ,,.. 4 U . n l i ,..,,,,, Z , ln every one of Vfaitels games last fall, the work of the line was outstanding. Lvcnly- , balanced owerful well-coached. it smothered the runnin Y attack of ever team it encountered. r 4 , 5 P 5 1 k 1 f Y 4 .,., 5 5 , ,... 1 The man who was responsible for this epoch-making forward wall is little known to the rank 55553332 5 and file of VVaite High School-Harold Fletcher. He knows football from the ground up. His 51111112 ---'--f' . . . . . . . fiflfffl if 2 work as tackle with the University of Chicago won him a place on the mythical All-American '-'-- ri fr -'f----- f . . . 531:17 gljjjjjjj eleven. Although he was with us part of last year, the past season was the first in which he .... .... 2 f fff'V--' . . . . 57113111 5 221111 worked with the squad from the beginning. No need to comment on his success. Results speak .... 5 ' for themselves. 511111112 ' ........ 4 1 ,...... 9 '----f-- Q l , ,...,,... . f 511.1113 1 f'f---ff A 5 JIVV ..,..,,. 5 f , ,,,..... 1 Y , , E ..f. f' . ---f-' X MR. NOBLE JONES ijgjjjjjjgl i 5 L .-.----- 2 f f f ' . . . ........ g 5 iii? 5 ltverv football game is played many times before the actual combat. A teamls final showing jjj ' ' ' - A .... is preceded by innumerable hours of labor, much of it by persons who are seldom thought of in f . . 4 Z connection with the team. 1 f V - n v . s I Among these Hunseen forcesll of the lVa1te gridiron are the third team and their coach, 5 Noble jones. He trains his squad to give the varsity the best possible opposition, and, incidentally, he is on the lookout for varsity material in his own club. Herels our appreciation for the men 4 behind the scenes, one of whom is Noble Jones. f r 1 U., One la'11n1lr1'1l eiglzlyasfglz .... 15533555 2 -- ' 5 illllllli waWW,WM,,.. ,,,,,.,,,, M ,.Wff,,MW,., ,,,,,, N fffifwfw ,,,,,,, , 0,,,M,,N, ,,,, W ,,,,,,, ,W ,. ,,,,,.,. W ,,.. N M ,,,,,,, W. ,,,,,,, W me ,,..,,..., A .M .,,. M. ,,,. W, .WWW ,,,, ,WW .,,,,,,, W ,,,,,,,,,,. W ,,..,,,,.... WM ,,., ...n..,e,, ,...:.ye,, WM ,,,,.. :,,Z7,7..,m0,f,:7.,,,.a l ' ,Mfr'f'1 3:Wii V 7?7 'a,t-W'-,Mn -f-ff' 1 we f , ' 'r 'fff .wi-f' . , . , fr 2 t 4 1 'W I fff, 1 ,.,,,,, 2 -2 . . . . . ...J .. ,,,,, V '-: .... ..1..1f'- V V 5 ' -v.v.v ,QQl.yf'f .. V- . f ,W 1,,5Q:W,,.,,,Wa,, .,,,.-' -f - ' .... WW. v,,, ,..., ' T ...,, : ,,,, ..,..... ' ' I ff 'ff-'-- uf X t ,7,, l , wf.m:aef1ff,,, , if , ?...,, f v f 4 ,. .,,,.,, 4 . ,,......,.e, N ,.V.AAA,,, ,..A . M ,, ...,A .. .K 5' sf , ? 'W .,....,. gxnsycgy S V,,. 0itC.ig2,, ,f' at an .J , ' ...aj ,,.. 4 ,X 1122! 'V' fi., ,1 MQ X in ,W , 1 ,, ,.2.1..F ,.. ,L gn , 1 A f f ' wtf N ,f ,Wx -M-, an N., -,J 7 -v s- f 1 .2 -st., -- f1. 'r'v ..,. 1 .... ' 31:4 ,.22222, 511111 iii? 3211115 ? 22-2-- 2 KT? ,... eg f iff 5 ifffffffi , ,,,.. as , ,.,.... 4 ,,....,. g l 111111112 1 ,...,.. 3 211531112 Mr. Herbert Colvin, Ass't Coach Mr, Carl Sterling, Ass't Coach ...,.,.,. 3 ' as 4.111112 MR. COLVIN Our coachin staff was rounded out late in the season b the addition of Herbert Colvin, Z ..., g y 9 f--- Ml a famous Waite ridder of former 'ears and alternate-ca tain ofthe s uad in 1920. lX'Tr, Colvin , s 5 , P fi , 3 did his bit for the school by helping hflr. Sterling with the freshman team. VW! MR. CARL STERLING In 1927 when the loyal rads return to W'aite to see the Fur le Hurricane erform an , . 2 P p , , entirely new group of players will Compose the varsity. The Mold boysw will wonder Where these fellows came from, and who was responsible for their elementary training in football. The answer is hir. Sterling, the freshman coach. W'orking quietly, and for the most part unappreciated, in his ofiicial capacity, by the massiof students, he labors with green material in order that YVaite's high standard in athletics may be maintained. Although this is Nlr. Sterlingls initial year as mentor of the Frosh, his diligence and per- severance have been a matter of much comment and have earned for him the Jraise of those ' 4 , 1 ..,,, who know the kind of work he is doing. Ona ll'lLlllIl'l'lZ l lffIIi,!l'SPI'HIl M ' WMMW 'wfflly U 17 - . A ff f ' ,147 , f 1 2 - . . ffgzifff' Q ' 2 ..... ' . , I j .... ,V .,,, I -- . . ,,,, ....,,,,,g .-5531 .gag .A,,,.,554,, .,.,., - ,,,,,g:f V. ,,.. H5551 -,ZNI ..... ..... jf M., . .... ...s... 1 'W ww fm-H--K' x, gf 'K m 'jQ,,, 'lamina ,,,. ,.... ag. 1 f N N --no 4 M3 W V. .4, tc ,Vs M QM q.,., A 1 V .,,, A ,,,, ,N A WNW? A:-5 ,VV I -ME J' , 7 fi. ' 'A ,,,' f ,,Zf,wff.2f m::f:f::,.,m::1 m:f,..,,mff .,,, mf ,fV,' ,,, ,f., 0 ff . ,Qs-.-i t ... ? -- - KQV . , . K 1 H -N 1.-pg x ---, U W A K - V -, :-'V- i 1e:'f:.:s: . :.frm:-..,,Q-- mi .. is--si i V , V .Va .. .V up ..., i r i , ,,,, XT' it i sk: V S ' iq. - -Q, Q, ,A , ,. s, A X - , eps , . 5 it sf ,, A ri - ' w f' g V- V i . , , M is Q I , PM ,S A X .Wu , bg. E -Vilfjb' '- 1 . V fir if 1 ' H: ar in ' 1--1' if l' A -V-Vs f . , 1- . gi- . M Prix. X V , N '- . l' . .yd 1 , wav . . ' 9 . ,., if , A I ,' . , . p ee Q s if .. Nghsip gas if .sr if . t ' . K K. ., Qk r N Q I, s,E:,:::Q5+ A 0 -f . ,,- -5- Q ,I L .. . , . . , . , .. , A, ,, , . , . .. V , A . V si 1 , V, V V A w i 5. .f ' si! , iw? - . i , V - Q 1- , Q 3 i c' M - , f A p ii .. V -is fsgiziiff-.Viis-gt A ci -it -k-,f. f-i . :Z , 2 ,v . --:-,fp s g' ' , V - N ,Q , M ' ' M - A . .. i , 1 V. ii .6 'V-- -J g,-V, K FV: fa V--. ctgi,-fl-JM K .hte ,- V - 1-5 mf'-,? 1 , -e .- ii ' Qiiil, x nf' ' 'YYY W W J, ix, I VVaite vs. Vlfoodward. Penkoil' going through line, ? ,,.,,,,, g he Football Swim V When September rolled around bringing with it fall atmosphere and footb ll f ' a ever, no topic was more discussed than the personnel of the football team There was no doubt in an 'one's . . 5 mind that it would be ofthe same high calibre as in recent years, but who might compose it was 1 uncertain. Captain-elect Jarvie, Butch Domhoif, Cole, and Dunn were ineligible on account of the eight semester rule. Tiernan and Kinker had left to attend school in lX'lontana. Siewert, l,im- erick, Reilly, Wickenden and Trumbull had graduated. The only regular left was dependable Ping,' Arnold, who was elected captain of this year's club. 4 5 2 4 Z Z 2 Z I i 4 Z 5 Z i 5 f x ,p ' Arnold Neubrecht Czlplzxin Quarterback Penkotl' Halfbuclc One hunflrccl aiylify-eight i ,,,,.,,, 5 a'M 'i 2 ......, W,,M..,,,, Ww7,,W M ....,,. , ,W .,., M, ,W ,,,,,,, N. .,... .M ......,.,.,. .M .W .,.... ,W MM.. W,,,,m,.o.,,.,,MW,M,,,W,,, Mmm .,... W ,,,,,, ,,,,,,, ,,., . ,jk ci ,, , , ,,VfjI,ff,ff ,ff mgygffwm., ,.,,,, ..... , , f f , M, ff, 1 5 V' f ,,,, 1 1 1.y,,ff72 . 2 5 ,, TWH' 1 'MW .VVV f 2 , --'-- I, .V ff' , ,,.. ' ' VV-V . V .,.,, i -VVV 2 .1 JW, f--- fn.. --.,,,4:pgpgm:mmfrwww,,ww H Hg WQTL..an-,,,..,mil,,q,,ZmMZh5j5l'fQ3fZ-LZ?1Z2z,gmwfffaffm - ,,,,. ,,,,,. W ' WW ' ,, 1 , - , . . ,.y:vf'w t 2 x N-f -., ., me f- f --' .fy z 1, ff' s VN 4' 'K' 3 'VN ,,,,, , f Qc. fl V If if , i ,,..,2j 2 ii Mf,I.,,f'C,f' -7 V W M ,,,,, A ,.,,,,., , I ,f ,yy Sxx f 1 ,ff , ,, 2 ,. Q V17 f , 5 1 ,M , f ' f 'iVl 'i-JU' 'f5- ' 5 af Vw .,.,' f f1w,ffw..mfffm.. 4 ..,,,, .... L:f!Z2:?MwMa7fn:mm:un:WML:mmw,m.11:u3.::aM.,.mm,J1ffai,.4uwu1:,-wwazfffgvfmm:,,,::,.m.. 1 5 f lf, -, . White vs. Carey. Line plunge by McClure Of last yearas letter men Bueehensehuss, Sloan, Fought, Stienecker, Peneotl, and Xeubreeht remained. With these and Kleclure, Farrell, Pencliell, Coon and .Xnnis of the Reserves, Duffy and Steele, the first string squad was formed. Il 1 d tl NI ,hllg tl tl ppi t ll W1 ll ' 'le season ovene Wi 1 1 orenei l ic 1i an as ie ini ia' o Ol en . 'lie 'lo verines mat established an enviable record last year in their district, and it was thought the game would he of proper calibre for the starter. However, the visitors were hopelessly outelassed. The entire lliaite team showed the eflects of early coaching, repulsing everything the vlsitors had to oH'er. ln the backheld Penchefl, Penltolf and Farrell gained consistently with speedy dashes and long runs. Fullbaeli XlcClure gave promise of being one of the best plungzers in the Clif' by tearing L Ag W,-wr f h1cClure Penelietl' Farrell lfullbaek Halfbaclc Halfback Um' liuntlzwl riffhlgf-nine ,ff V ',,,, X ff I ,f , ' ,.,,,, ..,,,. ,,,, f , ,.,ff'1iiiii?3ffQf' 'X ,. 37X , 1 ' ' , ,f ' f - ' 1- - ,,......, . H 5 511 '::::1:fI.ffj fp ,. , , f- ,,., M H flyyl ff - I ,Wy f . f ,W g4,z,1.,f,Q,L.,W,,,,',,,2'4f'HY-mi'iff 2,1 - -1 , .... , .Wi f'f. f ., , My . ..... , , WWA , ,,.,, my 4f,m4,,,3,,,,,,m 4 0 fm-ww., , . J h , ' QV I, .A..V V f- Ve 5,1 , Z X V- f Hy, IVV, - ,Y K ., 3 ..,,f W1 H my j I Q 'HW ,,,,, f ., .Vvvv jfldf-lj V, Ve,,A,,,,W,f 1 Vw f ll V f .VQ I pr, ,IIA if ..,, E Z If ,,,, ,,,,, X rm f.. iwMf.Zf: , ,,., 4. vlvv X. A ?T,,,,:,,, KVVMM vflw ,,,t ,,.,., 2 l , K --zeVwarwfvfwmafsszrff'wfmsrwwwawsmy.sfxgfafsagaggmgmfxawmagptfywftiwpggifwggggwigrprgg-hgwrfszfwgg:M Va- :tramwqqwfagqggmggyaswezgwfrzgez,V A il ll mtg w . 31 a Elm . 1 'Q f K fl 1 ' ' 'W' it f 'Msg I K' , f , - W ' I V V if 'L . 1 ff' f- V, +'::. - A 'L V 11. V , ag-K2:ga:':f5:.':a .::-4-iva:s-aww2f2:.-hwjg,:D 6 fi Q 5' . ,V fi! M H Q' ,, gg X3 ' ' 'k-' 5.1 , m . ,U VU L - -- A E I- '- - 5 , ., .. gr . Q j, , . rf K, . 3 4 gy ! V -'.' f- -Lf . Q Viv ' 5-.i -- 3,f.iggeg,'5t'f'V H :V W Q15- '2 3 3 ' gf' ' 3' 1 V .5 gl i- . ' W 4,' N' ' , ':' ,: 'Z ta . -. f' A' . 1:1 :iff .'-.:g' ,: : z V W 5 ' 'i f 35 M 2 '-'itligisix rl- ' V ' ' K' A Th. r 3' lf? A'L' V ll i f? -V , - V l 'ix V if Q 47:gi ,. rZ,ts ... L , 'af . L, M , . , 'V t ,. - AE - f L l L 5 7 YY:iitc Vs, Lake Charles, Ln. lfought receives pass. , i , holes in the forward Wall ofthe BIlClllQE1IlltCS. Halhour Y laved cxce tionallv well for thc visitors. .. . . Q- 5 P, 1 - . XY ith the hrst Victory of the season challicd up, 90-0, theWa1tc1-s appeared to he logical contenders for championship honors. The second game was again with a Vvolverinc club, Detroit Northern, which proved to bc 7 our second victim. The Eskimos were touted for thc Detroit Citv Cham ionshi and came here , . . . . - 3 1 5 with an untarnished record. But the Waite team consumed the bacon, and the Northcrners lost, 32 to O. Thev were a bull-:V crew 'ust thc ti' e to furnish a real battle. Lnhlic most teams that . - V . Rl . - . . . , play in the Bowl, the Detroitcrs finished strongly, holding the Collins boys scoreless 1n the last V quarter. 1 ......,, Q ? ,,,,,,,, , 3 Pccord Kalmbuch Buechenschuss Back End Tackle Un w If unzlrwl vrinr-ig! I ....,,,, 3 ,,,,,,,,,,,,W f i , ,,,...., 4, Y ....,,,. 5 2 211111112 5 ,. , Z M7,4,,,1 f Q --.N ,,,,.,,MVgWZ52'f 'H I, f - x -c K f I M,,,lM,, If ,ff -- ff? .,:gip,34Ve 4 V ,,,, , 'gnzaylyf f 5 ' ' of ,f.L.,,i, 1, ,,,,.f' V. ' 13.41175 5-ff, V f ,AW,,,,,,,Z7:,,,,..,:m,,:j'c f f ' ,:f731j25f4 1 - ' ,. 2 ' ' , , 2' V E757 gf ' f V ,,,.,Vf 5 , f V 'aff' wwf' wwf fMff W 'T AW',,'fff V f M529VfV4.M7'32:11::QYLCf:::f.127:-f.,,, - -'f ' f 'V 1- f 3 ,,f -V 4, ,, ,,,.,,,,,,mv, ,L .,., 4 , Mex - .VVAA.A..,.,A,, -. vt rs- f x Ks .W 5 If K1-nf Y ,,,, J-M1231--f ' .JN K., af 3 - . .,.. . uf .. .. - . X 1 1 i s s i Z -i 1 ' e 4 1 9 .M -fr Q ' E K-sm..,.1...f'iy.lJ M W X.Nfw..,Mf t sg f X. ,Im .Q -gs ,' . 3 1 ' If J 'E' 1' V .,, 52.1. I , , ff 3152. 1- f7 3T1'M'vf-,iQfN'Pf's, FW- W' . 54 I ,Muff ,... fmfx fa N-fl ' 2 ffl' M-' J 1' lv-' lf r'1 ..... ::m,.exa:.x.:N.p .... V' 'a - M ' If? 55311 1 J 5 31111114 f Q ,,.,,, 5 l if , glffffflfl l 3 , , ' 21111112 . I 57233 1 ? i 2 ii .... 2111117 ..... 4 Y 1 2 V t ..i..Z . 1 4.211123 f fit: X ' -'-- ' 1 , l 1121.2 ? Q ...,, iii 1 .......,. , 9 mm- .. ,. ,- - . 31.5152 ----- .,,,,, . . . , ? Vault- xs. Bloomlngton. lleuehefl urouml cutl. 'ff-f' 4 ,,,,,, g Q ,.,,,,,. , Ca tain tlrnold, laved a great ante for the Purvle and Gold. llc uartiei ated in almost ' i t Q . t . A 1 L P Q f every play, rnalung hne tackles, and ll1l'OWl1!g the opponents for losses. Penkoll provrded the . thrill of the afternoon, when he intercepted a pass and ran 90 yards for a touchdown. And so the second game ofthe season became a matter of history. with ll arte on the long end of the score. ,,,,, lClated by then' showing agamst Scott, W oodward Tech. crossed the Rlaumce, and attempted Tiff: .... to hold Waite to a low score, but a 59-O drubbing tells the tale. The lnttle brown team could do nothmg W1th the blg VVHIIC boys, and but for the brrlllant work of ll nlls and Zaner, the score + 2 would have mounted still hrgher. Wjj f , . 21:11:13 , 1 t ..... ZIIIIIIIZ , W5 Exe! Q ,,,. .M ',.,.fff1 VW 2 , ........ 5 51:1 . r A'-- '-1 rw- 1 ....,.,, 5,,,,,.,,Z I 2 ,....... tm? Q llffffl 21111112 1 3. .... .g ' f' ELM L.-WI .... l ,,f,f. , iiiiiiiiii -rllffff 4 ' 1 331::fi , ....... 1 , Steele Duffy .-Xnnis Guard Center Center Oni' llllnrlzwl ninfffffnrm 5 ...... I H llllfffl , l ' 3 ,qwfww MW, ,,,,,,. ,C ,,,,,,, W.Q...,....,.,,, ,,,,,,, n., .,,......,...,,.,,,.,.,,,.. , . W,.N,,.,,, MM ,,,, N ,, ,,,, , ,W ,,. ,,,,,, M. ,,,, . ,.,,,,,. M .,..,.,.,,,,, ,,,, ,,,,,, W ,.,,,,,.,. , 7.,,.,,7,,,,.y,W,,,,A.M..7..5,,,.. MW v ,Ulf I ,f ',,ff!,f y f ...., ,.... .,....... ..... 5 . I . . ,.,. .,,f:iii1:l??iiQ2.,,f-' ,,,-'57 ,. , ., A A. .... ' ft f' V I lg ..., , ..., .L ,',,,',2fZf .,.W1g1z1:g::.,' C451 , 2. V-.f ' pe, . . H I .,,, 1 -- , 5 if 'v :34 fi6f ' f--for ff' y Lf '!M Y , ,jQ,,,,,.f,2 n:Qg,:,WW,,,4,,,,,-,.., ..... g md4,, , ..... ,.,,..m..W,,..W ,,,,, W ..,.. 5, i f 4 Z , w, , .... - , ,Q f fag ..,y 5 .,.,. g , 'Q ff i I' 'fer f 'ff' 5 21 f' We K af-. ,amy ,M f ' any y , . A ,I ,'f,f,.J --at 33 .. It 1 f, 7 fl! f--. f ,, ff-ji ,, , 2 ffffff 7 ' , , M , 2 2 V. M4 1 V, ..,' fwfaz f ,V V ,.,, f'- .,f'a f -f ff- ,I fb 7'W'? 'a Eiiiiiiii g..1ii.1Z 5 ,,,,, ,... g 5 , W 1 , ,giiiiiii ' ' ,., , , .,.,..,, 4 , ,,,,,.,, 2 1 1 1 XYaite vs. Scott. Neubrecht starts for a touchdown. 4 Qiizlj The Carpenters could neither pierce Waitels line nor skirt the ends, and their defence against f the terrific plunges of lXlcClure, and the speedy dashes of Penkoff and Pencheff, was insuflicient. Offensively Woodward was unable to make a First down. A 1 4 During the progress ofthe game, Penchefl pulled some basketball stuPf in making a remark- I able catch of a pass. Vvif I ' ' - - ' '- ' - d W A VV... 2 Fl went VVa1te's record of an uncrossed oal line! With two minutes to lay , an ante , 8 ...,, , 3 ooie, leading 49-0, Tong Carey fullback, carried the kicltoff 90 yards for a well-earned touchdown. , ' This ended a very interesting game, not nearly as onesided as the score would indicate. The Carey 5 f , . . . , , l f f f - tar backfleld l'e t the Waite team on its toes throughout, though the visitors me was ar our s t p inferior to W'aite,s. Neubrechtls place-kicking of seven straight goals after touchdowns was one V , of the features of the game. I , f 4 ' 5 W E i f Z i rs 4 i ? f 1 4 l 'i 3 l 4 1 Z 4 1 V .,... 5 , A r , asf: ' - . fiiizii . .fr i .i...,,, Stinecker Sloan hdeullich Tackle End Tackle Ona' lllurflrwl nilzrfy-1u'n 4 fiiiiifl ff ,WW .,.,, ,N ,.,, 'f f f M ,,,,,,,,,,,,,,, M ,,f,,,,,,,,,, M .,,,,,,..,,., W ,V ,,,,, 7 ,,,, 0 ,,,,,,my,7M , , f 41,1 ff ff f ' f f f ' f fff 3,9-g 1 - ,, f , , ' , 'iff' av f fd, X ,,.. f.3,f.,4fg 4 i E , 'Mari' M V7 l X , ff ,,,.,,,,., HaiM,,,, f ,M . . , , J, K4 f f ,. X X -W Ye -' ' -- ,,,-.i wfm v 2.23 42 'f i 1, 'u Y 5, .,- ,.,........,, s frm... lf .Kyra 1 3 ry. '-' , ,,,, 1 HA ,CAN if 1 Q J, ,,,,.,.,..,,,,,. ,,',, Z 2 MM, i K., if 3 V -if .uf . f 2 . w 11.1, V- ' 2 QQ f 3,137 ' 2,,::::z?,115122111,m:1fff::Jff:gf.- .,.,. ,IIIQQQQ l ,,ffffff'l ,fill ' mmm ...lflff hllllllll Waite vs. Scott. Penkoff breaks through line. From the sunny south came the 'Wwldcalsll of Lake Charles, Louisiana, Remembering 1 their defeat last year, they were prepared to give their best to calm the Purple Hurricanef' Although heavily handicapped in weight. the 'ivltlldcatsl' played so fiercely that they held Waite to a 20-6 score' and after a bad first uarter. lavecl on even terms with Bevan's ets. Khourv. , H A Q V D. . P .1 1 a tackle, was the star for the v1s1tors,scor1ng their only touchdown by blocking a punt and falling ,AAAA jjj on the ball behind the goal line, Coon scored a touchdown in the same way, running 40 yards 1,113 VV1tll the ball after blocking E1 kick. Duffy played his usual high class game. Liiijiig In what was expected to be XVaite's hardest contest, the Memphis, Tennessee 'Wvarriorsu were defeated 4-I-7. After lavin a stiff ame for three uarters the southcrners weakened and . g fl y lllllfl ,fllljf fffffffffl ? .,.,,.,. 5 Q ......,, I Qllliil L ,.....,, l 'Mui 5 'ffffff g ,,,,,,, 5 gfffiifg 2 l V ,,,,,. Z f :::g, .Wg ,,11:1, We 5 .,,....,. ,,., g Fou iz h t Coon ZW? Lnd Iind ffl? Om' hl1n:If'4'rI Ilirwl!l'fl1l'rw ' am: M f ff M 'V mamma ,,.,.,,,.,,,,... M ,,,. . e--me ,,,,,,,,,7y,,,,,, ,,,, N ,M ,,s1,.N,,,,77.W f ,1,'m, .1 , ,V fe WW ,..fglff'fff' , n fl, I W,ff 'ii153 'f.f ' wi? 1 1 z f R1 1 ffff f 1, -2 'f ' f- ' ' , 11:1-ff' f f 1, .... 1 ,,,, ..... 1 .,,M ' fr, f fr' ,. ,V ',,f,1.',1f -.., , .S ,.., fQ,1f::: 1 - .... ' ,111 ,Ql'f'W ' .zf '5jj:11i11f11'?f'Zf, , ' V gffguwvwwl My ffvv ,...,,,,,,,..zM:g'WMW,f4 ,r ,WWMIAIMMJW4 ,,..., WW, ...,,.. ,M ,vww ,,,,, W WMm,,y,,A.,7 vrfl N IVIA f ' . ,ff-y4ffv.' my L 1 2 x 5 ,,.,,,,, , ...,.,, . ,.., ..! fm., Z 1 i Z , 5 , i A r f ,M ,... g. 3 1. M! 1 ,,... ' ,.z y 1 r 3 M., W., .....,.,, , ..,, M ,f'r '-f M f--,M 5' K A' 'H' ' ,....,, ..,.... E A , 3 me ..,,f ,..,, f '-',, ,,,, , th , ' ,aa X E X ...., ..,, f 1,1 if--J N? I ff I JM ,VVIV fd... ,v,. ,M ,,,,, 7,11 f VI Wf f jx: rm fav J., f 41? V1 fm, 4: y '7q ffw,..v.::::,w .,., :zzc::1p..,zep4m,p,,,.,.e. ' ,eff-me-w.,,,1z,e7,.w-----1w,umfc,m..f.:umfuQ iii1'11..l . ,iiiif f -Vf'--- Waite rushed over four touchdowns. Steele was the individual star, breaking up passes, blocking 5 punts, and tackling fiercely. KTcClure's plunging featured the offense. Quinn was the brightest 5111111112 hflcmphis luminary, his ball-carrying and passing ranking with the best. The VVarriors' left ' 1 l a fine impression with Toledo, and will probably be on Waite's 1925 schedule. ' s A thriller! Nothing else but! Waite's 38-35 victory over the Bloomington, Illinois, 'flndiansw was the closest game played in the Bowl during the year. The Bloomington running attack was 5333332 not nearly so good as Waite's, but the passing! Taylor to Nlurray, Taylor to Kdurray, time and ' 3 ' again. This combination nearly gained the day for the f'lndians, and a mighty sigh of relief A escaped from the bleachers, when the gun was fired with YVaite three points ahead. The coming ' of Bloomington taught Waite a lesson. UGet that pass! became the watchward in the Bowl. ,lii illfill 1 Closing the regular season, for the Thanksgiving game was played in Scott field, Waite swamped the Peru, Indiana, team 74-0. The game was a walkaway for Waite, with the work of , Arnold outstanding. O'Brien, a roly-poly 200-pound Hoosier, furnished the bleachers with plenty j f 'VVVVVV 5 amusement while he was performing', on the field. The Peruvians were reputed to have a fine Qiifjijl Q --v-' passing attack, but in that department of the game they were not nearly as good as Bloomington. iff., Only one-quarter of their attempted heaves were completed, and their first downs were made by ' this method. With Peru disposed of, the task in hand was to get ready for Scott. ii Q-gg The big game of the year, the classic towards which the team had been pointed all season, Q resulted in a 13-6 victory for Waite, the more glorious because Scott was overwhelmed only , after a breath-taking struggle. No one could safely predict the outcome until the last minutes 9 of play. iffilllll 2 1 Both teams were well backed by enthusiastic rooters, who kept the name of one school.or , 11111111 5 the other in the air continually. Waite's well-drilled lettering section provided an interesting ' 5 feature. Waite and Scott were spelled in solid colors with huge purple-and-gold cards. f The outstanding features of the game were Waite's running attack, and Scott's bewildering array of passes, which kept the Purple and Gold warriors on edge throughout. WZ?.ltC,S first 2 touchdown came near the end of the opening period. The ball had been forced deep into Scott territory, until, after a poor kick by Garrity, it came into Waite's possession on Scott's 35. On V the first play, Neubrecht broke through the left side of Scott's line, and, evading the secondary i 1 5 defense, sprinted 35 yards for a touchdown. 2 'Zi Q1.iZLLLLi After that the game was scoreless until early in the fourth quarter, when a Scott pass, though l i l deflected by several Waite players, was caught by Sack behind VVa1te's goal line. That evcncd ggi 3 7 'i M , things up, and it looked to many as if the game might result in a tie. fffliil t , .W 1 ti ..,.. 5 Waite started a march down the field, but a place-kick, attempted from the 28-yard line, 1 ' fell short, and Scott took the ball on the 10-yard marker. Then the pass, which had proved '- -ffl effective earlier in the game, turned on it's users. Scott attempted one too close to her own goal. It was intercepted by Pencheff, who carried the ball to Scott's l-yard line. The.Scotters, fighting 53173, with their backs to the wall, held for three downs, but on the fourth, Penkoff circled left end for I- five yards and the winning score. He added the extra point by drop-kicking goal. Three minutes later the gun was fired, concluding one of the hardest games of football ever lx 'iiiiiiii seen on a Toledo gridiron. I , .,..... 4 ,, X 4 i Summary f Wlaite Scott Coon ,YAY,,,,, ,r,, L . E., ,, Y.Y-YYYY Wcrtz jwg 11111 ' Sloan ..,, , , ,, ,L. T., ,, - . ,JOSCP!l f Arnold CCL, , ,o,, L. G., ,, ,, ,Wcckel i Steinecker, ,, , ,,,, C. ..,,, -- - ?'lOO1' ' Steele .,,,,, ,,,, ,,,. R . G., , ,,, AOVCWC- ,,,., 'f Buechenschuss, , , ,, ,R. T., , , . , , ,Russell FOUgh'E ..., .,,,, , . Eh -- -- - Ramsey' jj Penkofifu, , ,,,Q. B.,-, --,,.--- S3014 - 3 Neubrechtu, ,,,L. H.,,, .,.,, ,,,,Rllf9T 1 Pencheff ,,,, ,,,R. H., , ,,,, Lmdersmgth mi . NIcClure, , , ,,,, , , , F. B., ,, .,,,, G3l'l'lf!' 0111: hundrml ninwty-four 'f'A- www ,,,,,,,,,, ,., W ,,,,, M.. ,W ,.,,. , ,.,,,.. ,.,,...........,,,, - ........ , , ,,, ,,,,, N ,N ,,,, ., ,W ,, ,,.i,.,w,,f f ' ,,.. .,.,.,, f -f V ,,,,, ,,ff- ' fffifwf' 'YIVIV jjff-3336! ..,1 , f 'tr' V... . 1115, ,,,, ,531 ,,,.,,,. Q i11la4ii1l3g111.fc +1 2 :I ....s....s,. f My I M M 1 A A , , c Ks , 7' ,uf 'fi nii.3 W:a .... ,.,,,. We f 'sfP M 'vm ,f . f , j N-Q 1 J, .,,., 7 , 1 J...s.J K., if ,X-ic J f ,f ,f 1 79 ,if J w 3 vrll WJ I ,i .,,.,,, .. f 1 i, ,, ,.., H . I, , ,Q ..,.,,,, 4,1 ..f,,.,??:.lv,,,..,,g ,fg?f,,L,j,.. ix . r h f,,lv,,mJ7 Y f. 5, Inav 4 If ,M WW,,marmfwmm,mf.'MmW,,m,,amm .... mi..,M,1gfz:f5.c:ffff:fmm,-wfm ,... :few ,,,, arm ..., f ' 5 , ,,..... , z Stuff by Periodr 7 NVaite,- ,,,,,,, ,, ,.,.,,, ,, 6 O 0 7313 Scottn, , I, O 0 O 6- 6 iii? 5 2 ., ,,,,. 4 Touchdowns: Neubrecht, Penkoff, Ritter. Point after touchdown: Penkoff Cdropkicki. VV..,.. Substitutions: Waite: Farrell for Pencheff. Officials: Referee, Dr. F. A. Lambert, Ohio State, umpire Carl 'Weygandt, VVoostcrg field J judge, Irwin Van Tassel, Ohio Wesleyan, head linesrnan, Ray Fisher, U. of M. V 5 ,.,. 1 Everett f'The farther they travel, the harder they fallf' appeared to be true, after the Everett High 4 team, champions of the Boston Suburban League, was defeated 46-0 by Waite, in a post-Season f .,,..4 game, December 6. Everett is considered a wonder club in Boston, but, as the Eastern coach said, he had never seen a high school team of Waite's caliber. Everett did not lose the game, Waite won it. That is, the visitors fought fiercely playing , .,...... with every ounce of energy they had. The boys from down Boston way were unable to slow up ---...-- the Waite machine. Penkoff, Pencheff, Neubrecht, and McClure ripped and tore their way e--- 2 through, frequently for ten yards at a time. On almost every play, Everettfs second line of de- 2 f fense was called on to stop the plunging Waite backs. Considerable ground was gained for Waite ......., i .,..,,., i on asses, three out of four bein com leted. 1 .... .,,, P 8 P Captain Giacobbe, and Taylor worked well on offense. Peterson starred in line play, as did ,.., Redmond and Convery. Taylor brought the crowd to their feet near the end of the game by a y ff---... i , .....,.. 5 48-yard run after grabbing a Waite fumble. The inability of Everett to cope with Waite was shown by the total number of first downs, Waite running up 34, while the Easterners were not able to make a single one. They kept fight- ing gamely, however, and in no one quarter was Waite able to score more than twice. After tl'e game, a dinner was given for the visitors at the Commerce Club, where a spirit of friendly fellow- 93 Z y ..,. M! i 'M ship prevailed, and a good time was had by all , especially by the athletes who were allowed to ff consume food to their hearts' content. At midnight the Easterners departed, after having com- 3 mented enthusiastically on Toledofs sportsmanship and hospitality. QW' This completes the season, except for a trip the boys took to the Pacific coast, for the purpose If of playing Lincoln High of Portland, Oregon. Due to extremely unseasonable weather, and the condition of the field, it was necessary to cancel the game, to thc disappointment of the players, iii- Z i..c.s 2 .Mg coaches, and rooters of both cities. gggggggi 55:35 , ,,,. . M t v c ec ofa' gf Me 6605071 .... Q , I , , 2121131113 WVa1te , ,, 90 Morenci, hliclngann , , 0 Waite W 32 Detroit, Northern, , , 0 Waite , , 59 Woodward Techw, , O Waitev , , , , 49 Carey, Ohio ,,,,,,,, ,,,, , , 7 Waite - - 20 Lake Charles, Louisiana- W . , 6 2-ij Waite , , 44 hlemphis Central, Tenn. ,,,,, 7 VVaite , , 38 Bloomington, Illinois ,,,. , 35 VVaite ,, 74 Peru, Indiana .,.,. . ,,,. ,, 0 2333315 Waite , , 13 Scott ,....,., .,.., , , , 6 YVaite , , 46 Everett, Klassachusctts, , . , O - - 465 61 51112 Our' h1mulrr'4I riilwiy-jiri' 21325 .,,... 5 , ....,,, W .,,, ,,,. ,W ,,,, 0. --.,. ...,, ....... M ,..,.. M N ,,.. W ,,,...,,..,, W ,,.W,,,7.,,,,,W. ,,,,,,,,....,,., ,.,..w7.7,,, wwf 4 mwaffft, , -. .,,,,, ,,,,,,,f ,,,fLfff'ff Z . AAI' 1 fW'f:Wvff:'FT.,, , .... X, ',,W,,,M:::::2ieff3 ,IAII , 4',g::i5'f 1 4 ' C ' , I e ,.,. lnfjjfll, , 7,3 f ,,,,, f ,mg ,,., ..,, , ' ' '-.i ,,,, ,lll 1 'j.,:q,p ,.....,.. 2 F A . .... 4--'fjifczttiffj --1, ....- ff' f f -fgfggzwffwwffmfm-W 7,1,,,.fz-L4g.mff:ffaff,,,,,..,vm '' 1- -me 'jjjw ,,,, N AII, ,i,,,,fHjff,M' 5' j. 5 2 1 i i A l .1gf,,,, f' 'QQ --x x l 1 1 e i 4 M! 1 f Z I 4 ' 4 5 1 ,, . .,,,,,..., A,,. W ,. sw, 'f' if -ax, ff ff 'FV ,...,,,, ,. ,. A, ai , , 3 , . M! 1 ' . ff fu! -Vx ..,f ,WX f,,, ,,,3 vvrl. jr J ..., 1 jf 2 ij? vvvv .,,, f M1 -Mf- 2 ., ' rf , ff' iv' N4 .. W .. f X rv If5-Y,,,N,,,y'4:.,,,:W,,,x .,,, llll A fzjl fwz f,,,N4,,,,w!,, ,,i?.?i.'v, -W y 1,,,Wg f,,?,1 awzlfiyw--,mmf-W1-ww fM01f:.::-- My ----- V -a4L:fef.4.gwA-w-wfaf:Aff----M--fer---ww' 4 ff'- we -1-fa-aw:---.waa--.,..W ingacfw 211111113 f -'--'-- 4 ETIQIII2 he ffSerubJ i rfffi NVhen the call for freshman team candidates went out last fall, a veritable horde of aspirants V responded. Big boys, little boys, fat boys, and thin ones, all imbued with the ambition to make', the squad, were put through the paces. Under the solicitous care of Mr. Sterling and hir. Colvin, 51221112 the mass that at first was nothing much, became a good, fighting team, which closed its season with a nice string of victories. llll M el The eleven journeyed to Genoa for the first game, and were sent home on the short end of a 21-6 score. They avenged themselves on Perrysburg, however, in the next game, by a neat little 7-O count. The Holland gridders were drowned 6-0, and the Frosh then hopped on the Bradner squad 26-0. In the last game on the schedule, Sterling's Hurricane Juniors licked the 1 Rossford eleven 15-0. ....., if .Ma We are proud of what our freshman team did. Like their big brothers of the varsity, the Frosh had a successful season, and apparently are slated for bigger things next year. LQ U ' F If ll Three of the school societies, the Engineers, the Forum, and the Quill and Dagger, were represented by football teams this year. llembers of the teams were composed entirely of players who had never been out for either the varsity or freshmen teams. Despite this, two fine games , were played, the Forum carrying off the honors by defeating both opponents. Johnston captained ' . . the Q. Dfs, 'fBun Glad1eux, the Forum, and Lehr the Engineers. The Q. Dfs were vanquished 14-0 by the Forum in a game featured by the defensive work g of both teams. Bill Wertz and Eckhart scored for the winners. The championship was then decided by a game with the Engineers, which was played in a solidly-frozen Bowl, and which rc- sulted in a 7-O victory for the Forum. Wilson Wertz scored after receiving a long pass. 5 . . . . .g11:i11E if Through the kindness of Xlr. Ehrle in securing the use of the freshmen suits, the ICHIHS were fl more completely outfitted than in former years. Whether this made any difference in the play- ing is uncertain, but one thing is sure, the games were filled with enough '4pep and fun to satisfy ifiilifflf az . . Y ? l 5 even the most rabid bleacherite. W iii :iff Ona lzumlrrzl ninlffy-Sign giifgggg a 1-1'-- -3 ,,,, W ,,,,,,,,,,,,,, , , V .,........ .,,, , .,,. .... , ,,,,, .,..,.,...., ,,,. .,,,,...,, ..,. W., ,,,, ,,,. ,,.- ,,,,, N ,,,,,,,..,,,, . ,i:,9,. ., ,. . ' L V- ,. fi X X f . V ' h ' Ziff. .,., ffm: 1l?'i 1'1'2 at ' if f ,' 1:z1:1:fZff7:W ' Un 271 . If .,., . L,:.V.,,1ff'2f!fffZl,. .,,,, Q if? ?5'7'j,Qff'V'- . ff-iff. if is 'J , RSA! Mx if , ,,..,,., , fc-V. IUAUA M 'Z,fff--.grw ,.,...,,....,., .7 Q ,Az .,. 34 N x 4' 'ff , W' 4?'1.,.gz3'f2'fE'f .f ,,,Ax.?,,,3'j'1' if 13 of of R.,igQWlw,M, -9E.,'l'3- Add, j fd, ,1 v. fi ,ff .N W. 4 ww A V ,,,.,.v ,fy --TQ 2f'..gg,j 'jAf-Us as fo. , A,a x.-, 7 , X ...,,.1,,,f-.473g 7 ': '--M. ,IA V- , , '- ' Y ..,,,,,. 51:11:12 f Mr. Ehrle has served the school in so many positions that , one is in doubt which should be mentioned first. Probably he is most often thought of as coach of the basketball team, in which capacity he has turned out winners both years the squad has been under his direction. The baseball team has likewise received the benefit of his tutelage for two seasons, and has won eighteen out of twenty-two games played in that time. The gym classes of freshmen and sophomores have profited by his instruction, and as director of 35,2 organized cheering for the VVaite-Scott games, his help has been invaluable. Last, but not least, acting as president of the XVaite Alumni I Association, Mr. Ehrle has piloted that organization through zi successful year. . , 4 john Elirlc The basketball season, though gloomy in spots, grew con- 3 ...,, tinually better toward the close of the season, ending in the capture of the Northwestern Ohio cage title. As the team was composed almost entirely of football men, they were handicapped severely by having to take up basket ball training so soon after the football season, although other teams in the city had been .... 4 Y Z'--amd. 5 . , squad, and by his all-round playing showed that the honor was not misplaced. 51121112 ,A .,,,,,,. , , ,,,,. , , . . 5 ...,,, l he usual drubbing of the Alumni opened the season, though the old grads made the squad step to annex a 3128 victory. All of the thirteen men sent into the fray by Coach Ehrle gave a good account of themselves. fm ,,., 5 Fostoria was the first real inyader of the VVaite gym, and after keeping neck and neck with a ...... the Purple and Gold throughout the game, was defeated by one point in the last ten seconds of ' play when kklhitney sank Z1 fielder. Stafford, Z1 Fostoria forward, scored nineteen of his teanfs 2 points. 51111122 , ' 1.., ,.,.. Z E - if 2 Q. ,g ,... . ln the first encounter with our ancient rival from over the river the red and white earned the ..,,,, 1 ' verdict by a 20-16 score, XYaite fought gamely all the way, but could not overcome a 5-point lead which Scott had established in the first quarter. Playing on Friday, the thirteenth, against a team entering its thirteenth contest, XYaite lost to Akron Vllest, 31-ZS. The lead changed sides every few minutes, but Akron ran up six points at the opening of the fourth quarter, and held that lead until the end ofthe game. ' ,,,...., i Um' hunrlred 7lfIlI'fjl-S1 l'l'Il 5 5 2 2 X ...N ,,.,., . f -- ' .,,,,.,,.,,. W W., ,,,,,,, , .,,s7,s,,.3,.,, ,,.m,,Ma,, ,, 1 .. Q ,f , fwsy 1,1 ,LH ,-5,51 -- L :W-g'W ': f i': --... , .. ,',,.5V,, V . -. - ., ,f 'f ' f. 4 , W...,s,, . 4 V I .1 f if ftw - at I , . ,' - ,fi ' lll, V . ,..,., ,, ,.,,. , ' ..,, ,. 5 l if st-W . . f? 1' ' .4 l--gq31'.'.if' , 'V 4' C f - ..,,,,,,,, s In fact, it would be difiicult to name any enterprise connected , with the school to which Nlr. Ehrle has not given his enthusiastic fi I support and cooperation. . at work for several weeks. , But when our quintet got started, results began to appear. George Muellicli captained the i 'ff-f mg ff' .,4 tv, Niffikffff , --. Hia fe--s M 1 l f 2 l 5 i Z Z 5 S M rw-fe, cgQ1f M'1n.z51f.. 1-1 ,M C NF ' 1' 5 Vt ...- ..,., - .?....gM5j fr .-Jef.. 575320 ' Qt I 3 Ni T .sf ..!'L,-1 Cs. .,., ,.f1f,f'Cf-'-J 'iff f . ' ,,,, 1 5 f 44-ffWmWMA-mm4a:wrmwmw:s,ugJ.z:p1,m: ,,.. amwafngfffafffi,,:2.w:::w:::::::..w:: N.:f..:gLz4..,: .... .... Q r?mZwM.m,z:::'..:.1c,::wg1m1wW.:w.Mwwmcam-::444.,,f ,,,,,.,, 4anm.m.Mwz. H... .,..,.. ,.... ,,,,,,,, , . N.,.,,., ,... .J . . iiiiiiij ilflfig The fast and clever Woodward squad, led by Center Stephens, handed Waite a 32-17 beat- ing in a furious struggle. Waite led at the half, but the Carpenters launched a lightning, short- 4 passing attack that clearly earned the decision. 11112 , ,, ...... , , In the second contest with Scott, the East Siders turned the tables, and outclassing their opponents in every department of play, triumphed 32-27. Scott spurted in the last period, but Waite's early lead brought the Purple and Gold entry in first. Bartko led the scoring with eight 5 points' ? The next two games were played in the City Tournament, which took place in the Scott gymnasium. St. John's was Wa'ite's first opponent and was overcome Saturday afternoon, 5111? it 1X1arch 7. Although the Saints had defeated Central in a first-round game the Purple and Gold was favorite, and everyone was surprised when St. John's maintained a lead until the fourth ,jjj f quarter. Waite's 25-20 was well earned. 9555532 i . . . . Wi Z, Woodward was again our opponent in the Championship rou-nd. Tech had played two games in twenty-four hours, but their team kept up its marvelous floor game and carried off a 21-16 victory. Waite played well, but was not a match for the speedy Carpenters. As the Waite team finished second in this tourney, it was eligible to enter the district tourna- . . . . . . r - ' Ha ' ment at Findlay, and there made up for any discrepancies it may have shown earlier in the season. ' Ada was easily beaten by a score of 26-5 in the first round, while Kenton was defeating Wood- ward. In the second round. Waite played Kenton, and using an excellent Hoor game and a short Z shooting attack, succeeded in vanquishing the Kentonites, and earned the right to play in the , final. Fostoria was the other team to enter this game. Waite's opponents proceeded to pile up . a big lead early in the game, but Waite kept cutting it down gradually, till our warriors emerged as I . . 1 - 4 . 4 District Champions, in the last few seconds of the game. As a result of this tourney, Waite and 1 Fostoria entered the State Tournament at Columbus on March 20 and 21. For opponents in the first round Waite drew Akron South, the Purple and Gold team started out with a rush, and ran up a big lead in the first half. But in the second half Akron, which had 4 S heretofore played in dark blue jerseys, nearly the color of Waites, changed to white ones, and im- ' mediately broke loose with an invincible offensive which soon put them ahead. The game ended with the score 24-21 in favor of Akron. Q This concluded the season, which ended much better than was expected judging from its ,,,, jjj f inauspicious beginning. We may look for a still more successful year in 1926, when the whole squad will be back, with the exception of Coon. ,,..,,.. 11:11:72 5 jfiiiiii 1 .a , Z ..,,.,..g Om' hunrlrwl- llincty-rfiylit 1,5 11113 1 Z Y N L . .,... , ,. .,., ,..,,, 3 ,,,,, ,g,,,,ff,f - . W, ,f TT ,,,,,,-qjj1lf Z,. f' GX , 1 .,., I H ' .,., ' .. ,.,..,. . H ' ' ig, ' fp, Q I ' jiifi ' - if 'f'-' 1 f f' f - imifilaafffzzzfflilll-.fl K- f 7 1 i f 5 , f,,,-Am x , ,,,, fm if ,,,. . 1 K Q - W 4- ..,......, nwfgqgg 1 f-ff NY- 't::1.- f ' K I f ff' L' ' ,-Z '- I ' f .lf V- F --1'-t ,,,. II ' ef! 53fWMTi '?ZjfWhx f Mi L' 1. ff ,.,- fN-,l'X .fx 'MPX f' it JMX' , I ,.... fm ..., MewzfgiQ:fge-g:1mfm.ef'.:-::s:g:.-:.:,:.:':L14Lx.,W:.4.'4-fif5ff ' ,,,, 1 1'-MsnMm1npwfe:1M4-'Q-be-awe-L!wu2zaxJ5cW,2 ..,..,,, 2 L ,.,.. illlfliii iiiiiiii 5 f Qlflili f , I i-Ji YYaite- -- - -41 Alumni-, ---20 Waite, - - -2-I Fostoria - - - ---23 ' Waite - -16 Scott - - -- -- - -20 f Wvaite ---28 Akron VVest- - ---31 1 v . , 1 Waite -- 17 Woodward - ---32 I Y ' 1 Waite -----32 Scott.-- --27 1 CITY TOURNANIENT VVaite ' - --- 25 St. johns - --- 20 , . ,.,, --5 f W ante - - - I6 Wbodward - - - .- -21 DISTRICT TOURNANIILNT VVaite - - -26 Ada ,.,, - 5 5 vrrr I Waite ---20 Kenton-- ---15 I .r-. VVaite ---I6 Fostoria- - - ---15 STATE TOURNABIENT White ---21 Akron South-V - -24 2 f ' I 1 I f -- Y, X---, - , Q Basket Brill Irinenp-Coach lfhrle, Bzxrtko, Coon, Ifmmert, Neuhrecht. W'hilncy, Nfnelliclx. Pcfnelwif, I'enk0H'. Glzxdicux, Talbot, Bird, Rzxtllwne. , Om' I1 lunlrml lzimfly-ninf' 5 511111112 ? 5112113 5 Www ,,,.., W ,fffff 4 ,,.fff ,... ,.... . ,,,, , ,,,,,,,, V , ,,,,,,,,,,,,, it Z VW lllll 0 ,llll ,,,Y,, V T ,7W77VmyW,W,,gjE42jWg f, I. -,,- - f , ygpfiffff' -,ff vv., ..'- f ' VVV- 7 1. -' H I ,.,. Llliff 'f fm, f f ,,f,,..f,.... 'ff f ' 'AA' ' M I ffff' fl A ,W . fu-4'-'wiW,f,arN f'e 4 'ff'wEiw-JIM ' ' flzf-V-'ff' f '. 7 ff f M -f-f---- ..,. f , .w2,ZLffff7Jw 'H-gw.157 . V' f S 'W f if , ' J M czrgz., .,., :a...V,M,y- aw,,.1g, ft- tt ww 1, gr ' ig-c . .M I, ,. ' ' . .J AA,, , f I., ..., aff jg ff tif' f 1,1 ,Kflwh ff' 'f,f .fwfr vvff .mu ffm I fm f'.Wf'm, JW ,....f'w., Z 7 Q! T., ., . , 5 iw, 7 I f ff f V5 ff' rfvr ff H f f-wmgifamwmmpifm...mmm.,Mm ..., ,,,, M eifeme Bafketbnzll Team The Reserve basketball team, which was coached by Nlr. Collins, finished the season with four victories and two defeats. The last three games were won, and the final one, with the Scott Lightweights, requiring an overtime period to decide. The Reserves should be appreciated more than they are because ofthe good work they do in scrimmaging with the varsity. lt should also be remembered that nearly all the members are freshmen and sophomores, and will compose the varsity quintets in the future. RECORD OF THE SEASON Vllaite Reserves, , C11 hietamora High .,,,c , , .,,, , - .--26 Waite Reservesu ,2-L Second Congregational Church ,... 17 Wfaite Reserves , , , 18 Scott Lightweights ...A., , . , - , M28 Vllaite Reserves ,,,, 19 St. Johnls Reservesw U11 Wlaite Reserves ,... 20 VVoodward Reserves , , - ,- -11 llvaite Reservesw, M17 Scott Lightweights , , - - - -15 4 fufffflg ......,, 5 4 x f 1 4 ,f i i Y Reserve Squaclf Siewert, Brown, Golding, VVard. Campbell, Gaul, Rayburn, Nlzirgy. Drzives, Frost, Bosserl, Krieger, Shoemaker Graves, Brcnilinizer. Conch Collins. . T14-fi I1 umlrefl ifif , f' I 1111111112 ..., W ,,.... M. .......,,, .,.N.,.. ..., . ,,.,, E .... ..,, ,W ,f ff, I .... ...... f . V. 9 -V Q ...,,, . , ,.,.,. ..1:j' f' f If .f 1 .,..,.. ' ' -- ----V .. if -521 ....,., M3 - 1 ' 5 f f, .. ,.,,., .,,..,,,.,, f f ..,,., ,,.,,, . f 1 i by www fff ,, v.,L..,f,,., f'g '3igf- M' . 'gfz fey 553337 'M fe-XM a-. if 'fe' 5 J V' -------ff7f're4Ql7VK:f7 'Tian 'H' is ,xxx V--M .J JJ ..,,.. .4,..fif'J Y' 'vi M'hfM'. -'Wa Y 1--. 7' ,,,, if fd -JB 'ff' L, f -- 'M' ff ' fd 1 f .,,... 011-GUaz1'fz'5f Zayketball After days of earnest preparation, an interclass basketball tournament was held in the NVaite gyn', during the latter part of December, to decide the best class team. The freshmen were matched with the juniors and the sophomores with the seniors. The juniors and seniors won their games. but the tournament went no further, so that the championship for the season remained undecided. Still another championship was chalked up to Waitels credit when the Junior Hi-Y basket- ball team carried off first honors in the Junior Hi-Y League, composed of clubs from the four high schools. The Waite club came through the season without a defeat. Those playing were the Cladieux twins, Martin, VVinchester, Scott, Davis, Dalton, Volmar and Birch. The Senior Hi-Y team had its otherwise perfect season spoiled when Libbey defeated the Waite crew in a fast 16-18 contest. Libbey won the championship, with Waite finishing second. The team was chosen from Bun Gladieux, G. Cole, johnson, Allen, R. Hilty, Farling, VVilson WVertz, NVellsby, Pugh and Flmch. rack Beginning early last spring, and working determinedly through the season, the Waite track squad, under the tutelage of Dave Brown, fought its way to the city championship. In the inter- scholastic tourneys our runners managed to land good places, acquitting themselves creditably. Track seems destined to rise out of the minor sports class at VVaite, judging from present indica- tions. joc Collins has coached the boys this year. Dave Brown having signed up with Toledo University. At the city interclass track meet last spring, Waite was able to get no better than second place, chiefly because the dash men lost out almost completely. A little later in the season, Toledo University gave us a practice encounter in which we came off victors. Little that was exciting occurred during this match except that several prospects showed promise. In the O. S. U. relays which were held April 19, VVaite finished sixth, not a bad ranking con- sidering the number and ability of the entries. May 3, at Kalamazoo, Michigan, Brownls charges captured eighth place, making 13 points. The winning team made only 23, Dunn was the big point-getter for YVaite, with Stith and VVhitncy also placing. At the annual interscholastic track and field meet at Carnegie Tech, Pittsburg, XVaite tied for fourth place with Newcastle, Pa., with a total of 13 points. WVe made a much better showing than the year before. John Dunn won the shot put, and placed third in the hammer throw Whitney took third in the pole vault, while Gcoffrion and Matt cornered fifths in the javelirf throw and high hurdles respectively. Two hundred one - . .... X, . X I ,ff 1' ,ff , ' . fr. -V ,. f f- - .- fem ,,ff',.f . ,,,,. ff 1 ,V , .... - .. , ,, . ' , I ,,,,- ...jig , ..... ,A fa-:fig gg ' 1 f 54 .,.s.-.:...,,,1::31jM,.,,.: I, .ff f ':::i1ii,,.--f' Cf ,Q ggi, . ,553 3 A... ,mid 6,4 ,.,. . I 1, , Z , ,V I ..... sp .l!M:'..w:mH , 'V TZ .,,.. wwf. il: lim- V, Z ,A dl I y. 1g,mff4,,, , .,,,,,, 4 M fe w T M 7 K7 N' fL,-,..7-Miiwgjj '- -A,. 1 351- f it , 1 N1 ., ,,,f m..,f1 ' 333, 11 WN K-1. ....., f 2 V- k...f.W,,,1 52 -1 P A if-'j1'1ff'i ii , , W. , SY ,A , ff ,Y we A 'f'f',saJ?:wm.wmLmm,::m4wf,umw,Jm,1z:mf ,,... fm ,,.. .... 'f',,x:..:,.,,,:,..eee , .3 ,manga1w1afa,.:,ygfaae:M.,Mm:.1.fw.m...:f--W .,,, mm,.,m.,.,w..s...t - gl Z -------- Z,.f,.f.2 , iffiiilf 11111111 2 Z Xlay 23 and 2-1, VVaite's entries competed with the fast-stcppers of the nation, at Ann Arbor. I 11171111 , l , , I , 53733333 Here ohn Dunn ca tured th11'd 111 the shot ut and fourth 111 the discus throw. XVl1lU16V ulaccd , y , P P , . 1 f ? f 4 i 3 , ......,, , second in the pole vault witl1 a leap of 10 feet 9 inches. Lindner got Z1 third in the javelin event. 2 ,, ,....,.. 5 114 1' 5 1 3 1 5333532 1n this, the big meet ofthe year, 'Waite did well to capture 8 points. ? , , ..,,,,,, , a 5 The team earned its city title in a three-cornered match held in the Bowl late in the spring. 2 Q ,,,,..., 4 . . I 1 1 . . ,,3,,3,, ' Waite, Scott and Libbey were the three high schools represented. Flhey hnished in the order Yjjjjjjjji , I ,.,,,,,. Q D - . ..,.,., Wfflffffi named. Waite,s trackers ot am le reven e for the first IIKCI'-C11 meet swam IH Scott and 112211112 1 5 , 3,3333,3 , s P s V . P 2 , , , 5 Q .,.,.... . . 12211 ' 51 ' Libbe ' under a delu e of firsts, seconds and thirds. ..1111f 5 5 i ,....,,, Y 8 Y llllnll 1 5 , '........ , 5 ,.....,. , , ' 122222 . . . . . 1:15112 1 2337332 The men who won their well-deserved W are: Dunn, Lindner, Geoffrion, Wl11tHC5', Stith f'f'ff - 1 1 ' ....-.-- 1 5111 1 2353 Matt and Duffy. 5 5 , 5-ef-Mg ...Mg 3 WMS The 1925 inter-class track team with Joe Collins as coach, started the season off in fine f.f. W f re 'fff 1 style by stepping out and conquering Libbey, Scott, Central and Woodward in the annual city 1 11111.-. . 1 1 ,,,.,..1 I ...,, 1.2 5 5,..s,,, - ' 1 and by stacking up a comfortable number of firsts, our runners beat out Libbey, 61-53. Scott Z was third with 34 points. Woodward and Central each made one mark. The junior and senior teams gathered the most points, but all the classes did their share The junior medley, Dunn, Watts, Williams and Burson, made the fastest time, 1:38 3-5. The senior team, Langendorfer, Hatcher, Crause and Geoffrion was on their heels, with 1:39 4-5. Q.. Y Hemphill, Brentlinger, Jarchow and Hatcher placed in the jumpsgGolding, Eberlin, Burson, Crause and Geoffrion captured places in the dashes. 1 3 1 1 Y r 1 1 V ,,,v,, Tim I1 umlretl two 1: ....... 1 ,,,,,, inter-high tournament, held at the Y. M. C. A., February 21. By placing in nearly every event ..f 5 1 A 1 i 4. 1 1 1 E 1 1 i Y 2 332 51711715 5 3 1 3 Z 5 .4 2 za ...... 2 2 'mffli 1 , 1 1 33, , ,.,,,,.3 ,1 1 rrrrrr -1 1 1 - ,.,,,,. , 1 fffffff ----Z I i ,.... IQQQ3 t ........ 1 ..,, 4 'mi 2 J 1 . ,..,... .,., , 3.33 ,,.3,, 333 1 1,,,,33,,,,,,,., ,,,,,, 1 3333333 11.,111 111111 3 33 3 31 1 3 3 3 3 33,3 333333 33333333333 , , ff , ' W, ' I 'IW ,,,, ,ffl iii!!! fi!! 4145 ff ii f' 2 V--111151. 'M ff ' 1,1275 ,,,Z5jTi7 ' , , 3 3 3- 11,11-M V , -11, 1 U rw' fff N WWMW-W V... 1 '5 5 y , if ,, H' 2 2 f 1 I 1 if , 1 . I ' -- . , fi +.:,xG- Qi, 3 , 5 V ' 2 ' , 353-12i1 '...H g1'fg'fy1 ' f ..,,. 'ffl 1 ffij Q 'f .Z IWH,,W.,,,,,,WwwMa,,a....,f ..-- '-'g ,ani ,,,,f ,,, ., V 61:'. If lf' ff ,tw .m.4,,J .X X K , , ,,,,,,, ,f', VIAV AXA .... pm. .Q X ! ff f I ., A V , , If r X X K , Ls. 1 5 .,,., ,. .2 f , ,,, A , fx r , , ,.,, 1 fm'-N, 1 -4 x?f v' N .,,., .... Aywqa., llIllllllllllllwllllllilllllllllllllwwww '4 ' IIIIIIIIIIIHIIIIIIIllllllllllllllllllllllm 'lf 'I X 511 Ll .I 42? M ul gnumw W I In ,ww,:..f1 mu 1,.1.,,. .unnm.nrf,1um ln HN X 1.132 fn 1 Y V .Tx nm fi , A V .V RM ygiiw 4 ' , .A .ll Q A M ..Lpiii . pQ ll W ,f 'ffl X!! U , N g :y,W J M411MiIiyWg!IH Mwmmmmmmimmwmmmmw 71' i'.1G'gf Fiiiikxi Gfnrllsg Aithlceiticzs WM., M,W.,,.,M.--..,,.. MW, U., X ,. ,. ,nf ,ggyw f J : , Wfffpq fi 1 J..-. ., .. rf-175. - 292.621 - if J. ' 2 -f . 1, we, fp. H... fjf' ' .,,,,,f,, 55 .,,' 3 .. 1 .1 9.4, ,,,,,,,,, ' u V fjfgg: ff eg f ,, '.1'f'e 1 ' .:1:1,. 2z2'f ff, jT f ,-.. . .jz::ff., ..., i....,.:fwfg ,f h.,.,.w,ffwwmW,, ,a 'E ww,,,,,.,,w.M..m,N fW,,mm,:,w,Hw.W-..,,,,h.w:..1gWmW, ----f- WW-N. , i fe- . -1.1. l -' 3 f1.11.i1-5 NV 1.11111 ,..,,,., WW xwffgr M fr--H -11X mx .wx 4 ,, F v- Qjmwujzlffzguzzfi Nlrxqxxrl 3,1111 3, K A ? 1,2 ': ' Z7 l' WY: H LM, 1 I f 7 ,f 'Vw ...1f ,-0,1 .,,, 1 My A J .111 If 1 If X111 1 'W A 11 g ,, A 1 ,Mn 111.1111 VA.f 1, 1 fff'f111z1w if 1 .1 1 1. 5? 1 ,M ,f 'N-lf ffm, ,f M1111 f f ' ,. ,,, fw11,f'a,fwif ,15 f K7 f Q? 11' WM- ff r4 ,,,, 2 .mm-4:1.z:z:u.1f:11,:ec .,,.. 1 .,,, 1 , 1 , 1 1 1 2111.111 gf. ,1,,. 112 M X ' Miss Wim Miss 'rnack 1 , 1 OL R COACHES 1 ' To our coaches, Xliss Wliles and Kliss Tilock, We give our warmest praise. By their energy , and sportsmansh1p, they have made the gymnasium not only a place for work, but also a place v ' 52 for fun. Encouragmg us, they have forced us to play alittle harder, not wxth the spmt of rwzxlry, 1 but Wxth the sp1r1t of joy and pride III accomplishment. 17 .S Z1 EZLZ6 .S'.S'0CZdfZ07Z 1 Laura Dcan,,1 ,,,, 1, 1 ,,,IJ7'EjidK71f I I vv,, L Q5 Coral DElI1l16IlbCfgCI', 1 1 1 1 1 1 IXZCK-1J7'E.Y1dt'7Zf 7 3 ' ' ' uf I Nlary KI11CI'lm,,,,, 1 11 Remrzhng S.f'cWlnry Loxs B21yIHlllCI' 1 ,,,, ,,,, T feaxurff' ' 1 1,111,113 , I 11111111 Q 1 5 ' 1 12:51:13 IVI, lfffffff 1 ' Z ,111111111 1 ,1111111 5 flilliiil 3 2 1 ,,..... , ' ,iiiiiiii M , 1.1, 5 11.11. ---'ff-- 1 1 4- 1-- - -1 - - --1 ' The Athletic Association ,,,. E f 11111115 Two humlrvrl four 135531111 111111112 5 WM111 ,,,, 1 1 11.1111 ..11 1 11.1111 111ff1 1 11 1111111111 1.1111 11111.. 1 .1111 1111 11 11111 . ...1.. 11 1.....1111 1 11.1 .1..,. 1111111111111 11111 .1 11111111111 1111 1. 1111,1,.11,1,,,,.1,1 1111 , ,1,, M11 ,,,,,,,,, , , ,,,,,,, my ,,,,,,, , W ,,,,, ,,,,,, Z ,WV ,,,, 7, , W, .,,, X 1 1,1 13'ffff X117 X .I 11W,1,,,'i. 11.11,,11.,.,,,,, 3, ,151 ,g.,:1,1',1 H: ,f ' If ,,,1,ff', ,ff ,,.f I 1 1 ,V 1,1. 1,11,,,,,A'm ylfll , , ,1j4,,,,111L A:j,,f,f ,,.,, , - 1.1, - 1, 11111311 1 1l1'f1. :-1, ' ' 5 ' ' 1-1 - ,,111,, 1 1... rf 11..... 1.,,,,, - -- 1.,,, ,, 1 -j,,,,, 114,11 lllv ,1...1., f ew: V 1- ,311 .f,, flip 141 ff ' ' .1 ,fan 4, '1 1' 1, X , .- fff ' f figzgzuwwwawfww f---- 111,111-mfwff-fw11111fm -4-'gt 1.1-ff 11111 11,11, 1 ,.11 1 11111., 1.1 ' 1 ff-14' 1' f 4 fV 1 ,f, ,. X., Z My NN i ! N V 'N f s.,.. V' 'f,iwrf -MX LN 1 5 V .yll f .A,A 4,-. i V V, - ' : 1 ee ,,,. f' '. 3 -.. , rf' ,f -. -.,,f ,f '- ..,,Qf' 12: X 2 31 s.. ..,, V2.1 -V-.-f rj V W' M,,,A.,,,,,,ff X 2 fy! 9 SIX ,, ff , ,ref .- , V Vf , f... ., M. ,A-. ,, 'L 4 I' 'fffi 1271 K V , ,-U , 'm , , f. -t ' f eff V35 fi' 1 ' .f ,Vu 1 -tf't+.VVf't ' 1' f '4' 5 f K! W --' VWM1 1 f m,1m,'..1fff. .f,-:fmm,,,.:z::vp ...., ,,,, ref ? , f The Hockey Squad 'ef 7 eff f I ' ' Z7 J' f Z BZLZCJ' Klost of the athletic activities of Wvaite are under the supervision of the Girls' Athletic ,Xs- sociation, the primary aims of which are health and fun. Lack of suitable time to carry on ath- letic work is the chief handicap of the league, but it is the hope ofthe members each year to haye a higger, better-organized club. Awards are based on the point system. The hlteen girls who have the highest number tml , points are giyen the YV.'7 This year special attention was given to the development of Freshman sports both in classes and in the afternoon practice periods. Skill and speed which will be developed to greater pos- V stbtlities next year. were shown hy the candidates. , ? 1 le r 2, Drill ilieanis Tun l1rlmll'l'rl jflvv i ' I f ,,,,,. ' ' i , ,,,,.,, , ,J A , ,,,., V, 1 L V' i V,V:L..,,M .,... .A ,vll -Q , V 5 .,,,.. ll 1-jjQ,,.., mfg ,,,, . -- ,: , , f,fH,.V,,.f- .V V ff ' MW ,. ,ay V , - 7, i LVN, V,,-Q ,eff W, 2 M, , , ,. . A t ., V ,nw f , , ff ' ,, V .,.,,, '. fp, a Mm, 5 W 1, , , V V ,ff .. , , , gf yt f f ' H VVV.VV.V f ' 5 VwWmQ,g3,,,,g,N.u-,.WMVVV1,L1g 7 f f 6, , , UW,,,,,,, ggge:fM7Wmf ,,.,,,..,, .W,hmWw,,,.WM,,,,,,,, HWJMM ,,,, W ,,,,,..,,, ....,,,,, W ,,,...,, MA, R ' i X ? st E is X X X 221, .5 .,i. ri. Q-' I J ,X X 1 x .'-ex .al c'l J as .NN ,Q NN., NX., Q 1 s 'lu X 1 S f s X ,xkx X SQ 'eps X s EE... , Eixw N E: xx v , gs 3 Tx i 1,-S. si K 1 Ss. 1' RA.-F ex fi xx K li K N,.. X XR Lv..-X fq N ,Q WS' ' During the lirst semester pinball teams were organized, and a tournament was played. 5 lhe fifth hour Black and Xkihite llurricanes emerged Victorious after a hard fought battle. Preparation for the exhibition, April 3, occupied much of the second semester. jumping Jack Jubil. Wand drill, Kentucky reel, spanish dance, tumbling, pyramids and marching were features of the exhibition. Athletic tests, baseball and track concluded the year's ro ram. . P 55 1 4 The freshman basket ball group included Lolita Schuster, Lucy Sques, hflarian Sequen, Klary l,. Boroman, Alma Eryman, Klargaret lfryman, Gladys Kiay, Xiildred Cooper, Doush 1 Shearie and lris Laberdy. lhe response to the hockey call was so large that division of the squad was necessary. How- f ever, Ring XVIHICIJS arrival was so early that regular teams Were not organized. Basketball always has been the favorite sport with the girls, and this year proved no excep- 1 tion. Over one hundred girls came out for practice. The senior squad was made up of Coral Dannenberger, Rlary Breesc, Edith Strayley, Laura Dean, hflary Barnes, Irene Dickenson and Klarjorie Barnswell. Nlargaret Hornyak, lrma Cupp, Bessie DeVVitt, Elizabeth Rudolph, Eleanor hlajeska Emma Deak and Edith Hataling composed the junior team. 4 f f Ruth McGinnis, hflarian Rahmstock, Klary Gonis, Nlary Knierim, Lois Baymiller, Lois Berry, Xluriel YValdyogel, hlartha Ricard, Klargaret KIcClure, and Xlarcella Kipp were given 4 places on the sophomore group. both in the diamond and in the gymnasium this spring. ,X few loyal supporters practiced on the track. 'llhe rest ofthe time Was spent hiking, or on athletic tests for points. f Every season there is the hope that we will have a tennis team. lndoor practice was held , 1 this spring, which should prove very valuable on the courts. 5 -2 2 1 , ' 1 , 1 1 - i 1 ,,,,, , 4,5 EH' 5 I I ,,...,,. 1 f- -f ,,,,,,. 4 , fffffA-A- 5 ,,.,,,.. 3 1 ,..,,,, 4 ,Vf,. I Z, 5222325 E 1 r- Mi ff ffr- ,. ,,,,.., 1 14 Z ..x Z QU 1 i 4 1111? t i f i i AX Pyramid on the Bars. 1 . . i lieu llurifliwl sm' ' in 1 f f ,,,,,. , 11 - 'f 4 Z 1 .,,, , ,,,, , 1, 1.,, , , 1 'e X ,,1,,,ff:fz1?f7' V11 1, 1 1 if X . ..1.11 111, f V I Ku X ff M1321 Q f ? : ., 1 f ' i -e'-' 4, 1 'if .... wfrff: ef' 1 ' 1 .1 f ', ' . 1.1 'i1,,y , .21s11,,w fviff e 1.11 , 1- , 1 fn ' H 2 ,,,, ' ' 4. .. g:.11f,W-W,,,,f1f ff-- a1:::::WWwf W 'ti -IWW11 1: 11111 ....1,,,1 1 f ', ,,,, ' f ,f 57x 4 Baseball is another sport that has gained much popularity among the girls. lt was played V 1 1 , X x 5 N . Q' ,, 7 QQ ' F . M NS I 5 X M ..... f,,-, ,,,,. g:::.g,! 1 ,,.,. s M.vA n:.:., ..,: :.2..:.,::Iq i X .xM.. in-5 , I 'W .... , ' W ,,M..., , , I I 2 , W ' 1 Wig Lv .' . LJ-S . rv .L . L, , 4, K E s S fu? WNW WMMW iikq iqg , .:,::,, M .:l, m,W...W. L '-M ' f f gg ,V S '- -. Q - 5 I f -M1 Y if N f wwssgisi, Sai , ,Q F I is ' 24 'N' ' ' 13110110 . 2' fW V'm7 2112 b.. -In Zfw if nf :V 5 5 -.,,,, ,,,,.,,,,,,, f..,, , Z Viiveljjlf vv-v ..,..,,,b 5 ' V3 'Q . f f. X ,X 22 We st ,,...A. f.i..Jf.f--J 'V- ,fi few. 5540 f f ., , V . gg 'yy' 4 'f-- 1 M, ,- ..,, W3 ,ff .,,V M, ,,,, V . 4 A I HI EVENING M , op 5 ,-1 ' .Q 1 A ' X I i YN' I II tn1 I 1 L L L l . Jjffffl f A I 0 . N W 1, H! L Q I Ev ., .fr - 2-: 'NLT ha, -A .. f I MQ' Q WWW'- 3 Editoff Note:-The '4Pnrple and Gold if glad to offer tlze following rpeeeh by ourfmnour Willie llfaile on the oreafion ofa banquet tendered by the faeully in honor of our Unele Ilfillie While and Homer the Hall Hound. Bly admiring friends: My excuse for appearing before you is the same as that of the New Yorker who was asked by a visitor about the location of the Hyppodrome. The New Yorker paid not the slightest attention to the question. Finally the visitor grasped the impolite dweller of the biggest city in America and said, HI have asked you a question, and I expect an answerf 'WVell, replied the New Yorker, HI - don't - see M wh - why, in - a - a - a - ei - ci - ty - of- seven f million, you - sh - sh - should pick A on me. Having been picked on, I shall choose for my subject: The Faculty. Ladies and er - gentlemen. Let me begin with Mr. John Iihrle. It has recently come to light that, while he was a student at Denison University, he went up to his girlls house late one afternoon. The young lady appeared at the door and said, VVhy, -Iohn, it's only live o'clock. I told you to come after supper. VVell, replied john, hopefully, That's what I did come afterf, Xlr. Price. before he came to YVaite, worked in a bank one vacation. Wllhen he received his first cheek, he found upon it these words: '4Don,t tell other people your salary, it is a personal matterf, Xlr. Price endorsed the check, and wrote underneath: You needn't Worry about my telling how much I get, lim as much ashamed of it as you are.', .Xnd while we are talking of the men of the faculty, you may not be aware that Nlr. Klag: is absent minded. This sad fact is true. The other evening when he reached home, he carefully put his umbrella in bed, and slept in the sink. Miss Kimblerealizes the necessity of careful driving. One day when she was without her machine, she hired a taxi to take her to town. She was greatly annoyed and distressed, on the way, because the driver kept putting out his hand all the time. Finally, in desperation, she spoke: 'iPlease attend to your driving, she said. 'fllll tell you if it begins to rainf, Mrs. Allen and Miss Newbirt were discussing Nlr. Charles Collins. as they leaned up against a locker in the hall. Just look here, said Klrs. Allen, Charley Collins left this book in my room. IIe'd lose his head if it weren't fastened on. 'fl guess you are right, replied Miss Newbirt. 'KI heard him say only the other day that he 'ji was going to Colorado for his lungsf' , This high spot in history was enacted in Findlay some years ago. bln: Coontz was escorting 'l his bride-to-be home from church, one rainy Sunday evening. Ifinally he spoke. HVVould you marry a one-eyed man? he asked. No,,' replied his intended lady, HI Wouldnltf' Then let me carry your umbrella, he suggested. Last fall Joe Collins was asked by an elderly lady, i'Don't the football boys even Wash their suits? f'Surel replied bloc, 'WVhat do you think the scrub team is for? Two lr'ILn1l1'Ml wiyhl WW' N ' '-- ' ' ' H M ff--vvvvv',----- ,..,..,, , ,,,,,,,,,,,,,,,,..,, ,f , ,f lfilfl 1 .,.4 nl s 1 4 i W ...,., 3 2 ee -f'f 4 4 ...We -i I I W. ,,.. 4 y ........ 5 , ,.,., we 1,7 ,..,, ,.,,w,W4,7c,,, f ff ,f H we ,,,. ff ,, .,........ ,W ,,,.. .,f,, ,,,, ,, , fa, f f ,,,,,.,,,, ,, '-X ' - f,,. ,l ff f,.,, 1 , U , 'CMV I 2 , 3, f. , ,M-lf' ,l:1,g,,ff? U' ,.. ew V J. f- . .V , ..,a. . ...... W., .,.. ,W 6 . .. X , , .... , , f V' an 1 4 I ,f xlmfaa., .. ...L . y,,i,,...,,,.w7,,aww-.ff.. , ,Q WML, ,,,.., ,,,,. ,,,,U,vWvW,me f ...waz ? ,,..... 4 z 1 4 L, 1 f ,...s1,,, ,N :fe fe-.cu f f' A'A'.'..-'-f M. Wes ffeafb- M W f .ff 1 A 1 W- 1 -' 'a1'4f': L'1i? Zilfnii ' A .1 I X A 1, f 5 JJ '--- ---f 2 f kx is 3 11 W! '-j BW'iM.f1.A.,,,,,,l 'J kk .,.., .:.l11fLf ! V' X126 , vlqn f'fH1.,,,fA 31,-qnmzg-:V-vs, fin ,f,,,fg,, W1 rxqmjrx Hmmm? is 5,-.Wg IL I ::2.1.4:e1v,,E.LJ.Q '11 ,, . ...... 1 ye --f- -1 2 ---6 Do you know that fXIr. Sterlingls hobby is raising chickens? iVIr. Pollock, recognizing Mr. Sterling's knowledge of things pertaining to the feathered tribe, asked him, Is it correct to say a hen 'sits, or 'sets'?H HI don't care whether she 'sets' or lsits',?' replied NIr. Sterling. What I want to know is I this: when she cackles, does she 'lay' or 'lie'? 35552 Speaking of heroes in history, reminds me of a story about our own hir. Leach, a lieutenant in the world war. He was wearily drillin some raw recruits. Finallv he i ed u : fWVhen I 1112 , 1 , 3 .1 P P ,P , , was a little boy I had set of wooden soldiers. One da I lost those soldiers and I cried for a lon f . ' . - . y , ' . 2' 1 ...,.... 1 while. but my mother said: ikever mind Roscoe, some day you will get your wooden soldiers gjjjjj f back' And believe me, you bunch of wooden headed dumbells, that day has come. Wggggj Qne day last spring llissh Nelson went down to the parking court, to go home. She found a dog tied to her machine and its master standing close by. gm ,,,, Q What do you mean, young man, by tying your dog to my machine? asked Miss Nelson. 'AAWIH replied the youngster, some one tied it on my dogls tail. - . - - . . . f 4 I-Iere is the finis of a lively conversation. h'Ir. Canfield had talked a prospect into signing a life insurance policy. After asking many questions he asked the prospect this one, '1And what was jjj? the cause of your father's death? After a pause the prospect replied, UI cannot remember now, but I know it was nothing seriousf' Klay I close my talk with the words suggested to a minister by a little boy who was not fond of hearing sermons? The minister rose one Sunday morning: I haven't chosen a text this morn- ,,,,..' in Y, he be Yan. I will leave that to 'ou. Any one may suv est what I shall say. Immediatel f 33--3332 5- 2- y Y , . N . eg . 5 , ,,,,,,,, , the boy popped up: Thay Kamen, and thit down! Q Fond Uncle: Well imm , vou are a rett shar lad m bo . , Y 1 P Y P . y y W, james IVIcGuire: I sure ought to be. Dad used to use his razor strap on me two or three 1.11::i times a week. ohnny White was gazing at the things marked at sale rices in a haberdasher's window. P , ......,.. 1 Lynn Johnston, who was passing by, stopped to inquire if he was thinking of purchasing 51112 anything. UNo, replied John. The only thing that Hts me ready-made is a handkerchief. iil- 5,.a....l Miss Kimble: What happened to Pompeii? ,A Joe Szmetko: The saliva came down and covered the townf' ,jjj 5111111112 l 3.312 I ' Tom Beck: 'fPart1n our hair? You'd better shift a cou le to the left side. 377113-' 1 , 813' . . 1 P .....z Bob Turner: Sall right. This is only a trial balancefl Qjjgjjjj Bob Tewksbury: I always get drama and melodrama mixed upf, 2112111112 Bill Bannister: Well, you see, in drama the heroine throws the villian over, and in melo- gif drama she throws him over a cliff. 5111111116 . . . Ll? 1 fl' 2352 Ken Arnold: Speaking of electricity, that makes me think- 511113 W'arren Burwell: Isn't it wonderful what electricity will do? ..' 2 vfllvff -ll hliss Hirth: Make a sentence with the word 'malign? in it. ..... 11 Soph Flapper: I learned last night that malign aint what it used to be.', 1 - .1 . . . . Ss. ' Ben Minderz MPa sent me for a piece of rope like this. :sf fjjjj Storekeeper: How much does he want? l ffffflfff V Ben: Just enough to reach from the calf to the fence. Kllllllf --l-1 ...lj 1111111113 IVIagistrate: Can't this case be settled outside of court? gif Mulligan: l'Sure,sure,that's what we were trying to do when the police interfered with us.',-Ex. 5 - r'-Wei 1211112 f'Yo say dat little twin baby am a gal? 1 ..,.,,.. U 1 , ,11, ,,,. Yessahf, ff- 5 An de otha one am dat of de contrary sex? Yessah, she am a gal, too. -Ex. Two lzunrlrefl nine MW? IM., M .... ..... . .... .M ...... 11 .1.... .111 11 1,.,,,,,11 .,,11...., 1 1... 11 1 1 I 1,,,1 1111 1 1, ...1 11 he ' . . ,' 7a,Z Y ' i gif I A -'farf23 4QWvw.L 4 ' 5 ' 4 4 . ! 2 2,,.,.uf ' .,f ,f ':f 1 .f .1.1 1 1' '- '. 1. 11.1111f1L1f1L211i YV .f I M-fr . . .1 '-.. ..1, - -... '1'1':1:::1.::g1,1 111, 1 ?2'2 ?2S4 I 1. N-if?f1 111111::'2 -vz. if MJ':f'1111'i11.M -'- 111. ' 1,,...M :1:::Lu.W' ff! ,A 2 Eg ,,,,,,,, 1 gg ,,,..,., , ffl? If 1 5 6.1.12 H1355 QW, , V -.,. ,-.. ,.....,....,,, W... 'v A ' M l gg K' Z 1 -Nm .,... -.A ,,,, 592 ,..,,. g Q5 .4531 .,.,., I ' 6 Nw 5 .Z , A Q ,.,., N., ffl, 'hieefz .,,,, , ,, ' at la , If .,.. .,,, , Wx ig ff! 14,3 44: V I W 5-ck f M' I'j M ' V '-'f H 1 ff . ff Qfffwff' ,,.. f r -.fi f 'fl25 wr f' 0 I 5: , X M03 VM 1f a ..... 4 ,.,, iiiiigii , I t ..,.,,,, I ' y-.Wye l .1 6 'E A 4, ,, 5131114 4 '-'-- i 5 , ,,.,.., I, Q ,.V,.,. Z Vfflfl 'AA' Never had I seen one so bony. From where I git I could count every rib. Not a rag of clothes hid his awful frame from my eyes. His head hung down, his drooping jaws resting on the barrel- 213335 shaped chest. The man who stood beside him, grinned malevolently and ran his thumb nail up J and down the staring ribs, counting them with fiendish deliberation. We had about enough. Suddenly the nervous tension relaxed, the bell rang, and we left lX'Ir. Nauts standing beside the 2 dangling skeleton. i S E Mr. Brown to Coralyn Blackford: HYou have tenacity in your makeup. F Coralyn: KIy goodnessl Is it as bad as that?', hit- Zigiligg Oliver Rideout in chemistry: Speaking of high temperatures, I had a fever once, myselff y 'f-f 1 -.-.- ftiiiffii Lynn Johnston: I don't see how a watch can keep accurate time? John White: Why not? 35313553 Lynn: f'Well, time flies, but a watch o11ly runs. i- :Mfr 2 Doc,' Heinen was having his picture taken with his father. i Photographer: Perhaps it would be well, my boy, to stand with your hand on your father's I shoulder. E Doc's dad: HThe picture would be more natural if he stood with his hand in my pockctlh Do you know Joe?', he asks. . ..,,,.. li VVhat Joe?', I hazards. v-vv---- 4 UBanjo, he ha-ha's back. 3.1.3 z That,s why he ain,t here for drill, Sergeant. ',',',j -Frolh. Sammy joyfully chopped off the chicken's head. Thus was the second landing on Plymouth I Rock completed. ..., f'Business is all write with mef' remarked the author. ........ ,., 1 . 1 2 The drill corps was marching. Lieutenant: Pick up the cadence. 1 Rookie: Pick it up yourselfiI didn't drop it. -Ex. UI hear you've been traveling abroad, did you visit the Dardanelles?', fNewly-rich Americanl: f'Yes, we took dinner with them. -Radio. 53:52 f ? tziifg Ill The old gentleman was a trifle bewildered at the 'elaborate wedding. .im Are you the groom F he asked a melancholy-looking man. .- No, sir,', the young man replied. I was eliminated in the preliminary try-outs. qQuebec H Daily Telegraph. 'KAre you the fellow with the falsetto voice? No, with the false set of teeth. -Chaparral. Ts? wi 1 H , ....... , How many leaves has a clover? 555555555 L ........ Four, if it's lucky. -Moonshine. gm 'ff--f f . l , 3 t Ed Loudenslager: HI heard of a man who fell out of a twenty-story building and wasn' ........ even bruisedf, Art Force: How come? Ed: He fell out ofthe First storyf' 1' E . +i4----1 .,.. .,,..., 5 1 f'Has any one commented on the way you drive your car?'l 6 .... 2 2 ...4 i NIr. Klag: Yes, one man made a brief remark: 'Twenty dollars and costs'. e Two hundred' len 1 1 ........ 5, ...--- 3 f ,V , f' ffff '!f'f fy 2 yr ig ..... ' , .. ' ,V-'j1V ! . ., I ,M - . ?'.?fiif'tif '- L . I' ...... . f H , A ,,,., A le. .,.,. ,ig H ......,. it A ' 2 if ....... .- gy, 5 ,..... ,yg::::,.f' 5 F ' if I' . 1 .. W-.W 'r :c:a':MwM-M:f--:VW ffiv f--rj W ..... , .,,. , ,, ,.....,,. ' 1 ff., .. if ,V x , f I , r i?. LM, f ,.,.,.. r ...,.. , ........ L .,..,.. . E 5 ,,... eg , ft t ..,,,,, sm., , 5 S ' 4 i 1, .,..,, g .tg , ...,,., T Z 4 We if 5 .z. f -4 :M x, ,-an ,,.,.,. M .,,,.. -. I px. M -Ns.fes.,, M if 'V' We illwiglfibri fc ti ,QP sf .J K-WV' ' ...Q hx ,f jf' LJ -Y- ,.,, - fn f-X PMXQHJ A ijxffff' Sum M: H fr f .fy ,...., 'swf Af 2-fart ,va .V rv W 'fi' 'q ,, ,f-in l , if-'LIP' '- 1 Eggiiiii ...,,,,, , . W , ...... E l 23:25 ' Mr. Nauts: 4'How many have studied the lesson about cells today? l No one raises his hand. l Xlr. lXauts: Who has any idea what a cell is?y' ----- ' i Bri ht freshman: I have' m f father's been in one.', ZW' l 2 y 2 , 5 ' , Miss S avd: fDiscussin the oem Ll fsseswj. 'WVho was U1 sses?,, 3733.15 y , P , s p 5 Y 1 Selina Neely: 'tHe was the reatest Union General in the Civil W'ar and President of the imffi 3 l f 1 U. sf: ' Q V,,..ll l This is mv car, exclaimed hir. ae er to the ara e man, and what I sa f about it oes. H: N . 3 3 8 5 E5 an H, l ' just then a dirty-faced machinist crawled out from under the dead machine and said plead- Qjjjjjjj l ingly: K'Say, 'engine' mister. ,..... , , -li . 1 l i Helen Brown: I had such a lovely nut sundaef' 2.2221 1 Vivienne: HI have one calling tonight. X t v . :M -- 2 l ' Lowell lNorthrup: uDad, do muskets cry! 1 Nlr. Northrup: Why, of course not. What makes you ask?,' ' v Lowell: Well, it says here something about musketeersf' , UHE LOVES ME NOT . i . . . . 9 ,.,,,. l , The rofessor of mathematics and his fiancee were out roamin in the Helds when she lucked -'- . P . . . g P v l a daisy and, looking roguishly at him, began to pull off the petals, he loves me, he loves me not- 1 You are giving yourself a lot of unnecessary trouble, said the professor. K'You should ' count up the petals, and if the total is an even number the answer will be in the negative: if an uneven number, in the afhrmativef'-Iowa Frivol. L ,,,,,, M, I Co-ed: You know, I didnit accept Claude the first time he proposed. Friend: I guess you didn't. You weren't there. -Whirlwind. An old sailor, bein asked to write his im ressions of a cannibal eo le he had visited Wrote 8 P P P , , ,,,,,,,,, 5 the following: f'BIanners-None. Customs-Nasty. ,Z ii., ,i The following advertisement was seen recently in a magazine: Baily, Banks, and Biddle Company rm Watches for Women of W .u erior esi n , ,,,,. , S P D 8' a n d gm.: 1 ffl? Perfection of Movement. V3 1 ,,....,, 1 1 'QT' ,,,,,,, E Jack o Lantern. Going to bed FH , ' - ' No. I'm just undressing to see how I look in my B. V. D's.,'-Ex. M 1 4'Do you think mother will be unstrung? No, I Wired her last nightf,-Ex. Polly: I had a nightmare last nightf' i Q Wog: Yes, I saw you with herf,-Ex. 5 ........ Customer: I want to buy a diamond ring for my girlf' :' , . . , 4 ' I'loorwalker: Glassware in aisle 13? 55313 4 -.. , ......., 5 , Small boy: Look, ma! There's a circus in town. Look at the clown. Eggm-jj hfa: Hush, dear, that's just a high school boyfl 2 em? rm: 'l A sign before a shoe shine parlor: 4'Your pedal teguments artistically illuminated for the infinitesimal remuneration of Scfl , ,f-' NW! She: Isn't that Moon beautiful? He: If you don't like this Buick you can get out and walk. 51112 Il'u'n h rmrlrml flew ri La: . Q 2--I ,,,,, M, .,,,,,,, , ,, 1 bulivi M H ,,,, A, . ,... ..,, . .,.., ,,.. L ,.- .,w ,f , .... rf C2 . ,,.. ffm 1317.3 .,,, f-... -4 --:'rA -A'- . .zzzzm-,1.,'v 'fam fa-xiii, ---' ' fifffif - ff'f ' ' ' ,ima . aa.: TM .... .. ,.... ., ,. ,, ,,W.,... , ,z,w....,- 'W' W, .. K 'f': 'M W' ' 'W' 'M' 5 ssssff ' ----- ,...,, ..,... ' 1' 'W'V f4?'ff ,N'wgm. 'fa I X , f f ,,,,,,, ,.,, 5 f., 7 f 2 f ' ,,, X Q 1 1' I ,X I 112 f 1,2 f ,,f?zf,3,y,gg f- ,f Hd- wwf H f Qi: ' f 11f4WWMffv,mfW f . f zu, .... ,,. yf. , ,,,, f f FOOIIEI I EDITION PURPLEWQGGLD Q GCPYRI HT 9 0P5 T l I 'QQ GN , Cwhfii, ofitt- Nr I ,,. . 5: I' i wzltmf ' I Q' WW? 1 ! my h 1,9 L 2-- 3 'I-'n' I I 5 :oO I P Q-0 v0'l' ' - Q QI. Q, sea 1 'I II Q It 1' Q J gg, I Ill I -l d S 1 .22 X fy If 1 II , I Eb, . 5 I f1'If-iv f Z! f vi' 1. 1 L I '- all gal el '1 iz 4 MI V M ga I IW Main - Tme. Dv-b - 'WIC' -I? GTI , ron-umm l 'il 9 e -- II I IM I -- I ' f' -1 E I I- I 49- my th ' Heb X ..g. QP. V . Q, MX ' Q im? xx 0 fs 'N ' ' Q 21 1 IGS, , ,, I Wo Nw f I CP Q IAQ ff . xx . I N ru xx dig, 3: 7 x I ' 1 5 g X A-In J7?W 4L M - 1 5 .8 I' -K , . Ax ln' 2 1 . , Q .- Deducahon- Io1v. i?fI'4Qq, 1 h594T'i ' ' I I fl 1 SI 'I I o I 1 6 I 4 . I 1 - - , K If vw f K l,l, ' v Sl I i 5 1 I Bi. IS S! gs I I! , A gg I f S l I ' IS Sl A I - ' 3 It 1 Sl x' A - .S r X x X ' X - MU I 5' xi ,I ' I IS .. gl ll X 1 N ' I. ' J X 1 I-Xlfi IW v iw J I I I pf M , mu' 0 X - 'IIN' S f 5 Elm A. i I EBIM dur '. m 'f 0 Iwi mrlrwrl Iu'f'I'1'f2 ,ffwoff f ,f f f f ,f ,.,. ,,f 51 , 'fe 5' I 1 wr ff-f , , WMM . , ,A , , . -- . ,, E' ' ..,,, 1 4' ' ' , ..,. Jr, ,-Wm ' I Lgiptwfi. 1 wx 5 .,..,,,. WM-, . .V ..,, - 1 Q, , fa. ,WM . Y , , W ,,,,,, Mah WWW s i 6 4 S Z s ,mm 5, ,,.,,,, 5.11m hm 9 ,,,,,,.. 5 ga T NSN fgfiilgziv rx 1 'W' 1 'vff e-, e -'-- -5- N i., MZ M N vs 4 13 M 53 M- R age it 'J --fk 's,1 , I 1- :L , 153' NX--fQ.,!i f..2'-'-'j -Vx ' Q . 7 1 If . JN ,..f t rf ff??'Q, ,,55a.a?,i.A:f.':.:,..,.,. ..,... .5..,..,,.,, fi eff:Qfaaeziiiifa..'f 'z1f'r'r -5 11113 - 1 121:12 rj 211111 rj 1555? Hney, Billf' 111112 What1s it? 11115 f'Your doctor is out here with a Hat tire. 13332 ffDiagnose the case as flatulency of the perimeter, and charge him aecordinglyfl ordered the I garage man, That is the way he does. -Ex. 'fSo that's where my clothes line went,', said the lady, as she spied her husband hanging in 1111115 the barn. fjjjjjj iliiiiil -1-l l rf 11111112 Stop, Look, Listenf' , . . . :..,.g 'I he reflective man sto ed to read the railwa warmn . PP Y g 1 , 1 Those three words illustrate the whole scheme of life, said he. f'You see a rett irl' vou sto ' ou look' and after vou marr her vou listen. 1 ,,5,, 1 P Y 2 , , P, Y , . Y 1 . 'f,'Q1fL? Professor: HWhat is the difference between capital and labor?,, 111117: Buck: 4'Ca ital is what you loan and labor is what it takes to et it baekf, ,1 ,,,,,,. g p g ' When two people like the same thing their married life is bound to be happyf sighed the , engaged girl. 'WVell, you and Tom ought to be happy, thenf' remarked the girl who wanted Tom but didn,t ,,,,,, get him. 'fl know you love him, and I notice he is fond of himselff, ' 'l1if -j C K fiiiiiffi .1 . . . EMM! 1 Old Lady: UI see that tips are forbidden here.', . I 1 liliii Attendant: Lori, mum so was a les in the Garden of Edenf' 5 ..,.., 1 r PP 1 ,,,5,,, 1 e-Pitt Panzhfr. U 11- U 111111111 One Sunday night a preacher sternly roared: When those young men in the rear get through 211111112 flirtin with the girls, I hope they will give me a chance. And he wondered wh the con re ation 512113 g V 3 3 r .,,.,... , laughed softly.-Juroran. img ---- Papa Alligator: '6NIy, what a bright ladl What are you going to be when you grow up? Willie Alligator: A traveling bag. -Ex. A I 'i- l . 5111111112 Miss Burns: VVhat did vou like best about Llo d's com os1t1on?I' fjjjjy ' y P f 2 jjjjjjj R. Bruot: mllhe End? Ho e Greene: M new s rin suit is oin to be trimmed in Coolid e ra .M V p y P g g g g g Y ..., 15 77731 Ethel Shatto: That's nothin ' mine,s oin to be trimmed in Bowlin Green. I 1 g, 3 g g gggggg VVilham and NVIISOH VVertz were out fishing. fff Wilson: f'Got a bite yct, Bill? X l,Villiam: IYaw, I don't believe my worm's half trying. Clara Jump: 'fOur dining-room is being decorated in spatter work. Venita Johnson: f'Spatterwork? ,,,...,, Clara: Yes- we have grapefruit for breakfast ever mornin . 1 Y g yu 5 Xlrs. Coontz: 'flt was just by luek that I was able to get this steak. Mr. Coontz: Hlt was surely tough luck. gfffflg M, 14? ? , Miss Spayd: You may buy your book by Wooleyfl Lcrov Bloomer writing it downjz Lamb,s Tales bv Woole with shee skin bindinff' . g . yv P is Tl- 5.1.11 Ifff. Nirs. Allen to Art Force: 'fArt, vour work has been fallin down, and if vou're oin to ick 55.13 1 1 1 . 3 . s fa P , , it up, you ll have to step on itff 531275 i'-'-'-- 5 ....,.... f Don K4cClure: '4VVhat do you say to a tramp in the woods? dj Phyllis: I never speak to themf, s.,,,.,.! l Two liumlrml fhirlrrfn Y ' 1 ' 1 11' v -grr W -- aa... ,,,........ WW... .. 11 r 1, ,ff pf' ff ' M,,,,.Mfffw? j,,,v mm 'ng 1 ,,,., ,,,,M , jf i ..,,, 2 5'i'1:1gu... .,,,,,,,.,,., 'f 5f'55-5' tl, 55--- I. aaeifil ..11 .,,,., ',f'jjg1,,,...fff- nM,,5g5ff 5.1 ,..,f3.,,,1, ,,.11 -- vpggziffll H-'ight-A' jujffii '1::LT??'f:::t:1:'...gLll...g,wf--V. d,,a.33jg::Q,557f I M' ---5 5' ' M'-'R Vffr Ia.,-.,..1..1.:z, ...,,. ,N ,,,,.,. Im l - 1 , -,f ,.... ,,-fm N f, 'ff . . ..,,,. jr M ,f f , A , J f '..,...., ,,., , ,.,. g ff , M W! .,.,,,, , ,,f I X -M X in-qi-:g,pN ,.,,, 1 ., 1 f I 2 . ,l M ,, f llll ' A f l ,l f f ' AA'A ll f 2 H WMW ,f,7, W wwf f :. ,,,,. .,,,,,,... 1 ,,,,,,., 1 ,ez ,,,.. Q fem ,.,... f, ,fff,,,fff WL,fHm...mc, .,fff f fmff.. .,,,, A f ..., A ,m.,..,, Om' ,Cilflflf-fzfe Fffzfqfnef' Sha' nc-cds soxnc new divcrsion now, .Xnnl plans to chase lllC lvoysg 'I'l1cy ull 11-fllsccxccpl nur slnclqg Yann world! XYl1Cl'C are Illy' joys? In-1, lffznflfvwl ,!'u1rrlw:L f W f ,,,,, ' ' liclnmld il girl, lmollx 5 er hands dcnmurc-ly wcel and f'li1', l'OlLlcClg cr glance is innocent-lvnl s-slxl scllcnl ' C IS br-ing nwlclul. .XnLlLl1un.'lis Saul, sllc look 10 smrvlcc, You soc hcl' in Lllc aclg .Xml '- ' 541 you Llun I-11's alll il lalw- .X hllllf7lIL'llK' III l'1L'Il f . Mfr Wmmwn' N, j ,,,, , ,, ,,,,,, 4 Wyffhuz f ,f ff f M 1 ww- W--Iv,::,MwwWm,Wm.,,Wfw ' '--1 '-,W-3, f ' .. 'V My , M 1 ' f ,,,g,W,, ,,,,,,h , ,,,,,,,,, ,,, , I 1 I , Y 7, ,,,...,, 4 r 4 1 4 .tx yE'fQff,jy, ua to W- 4' W' E3-33-g z:1' H' if ,exe ...f ,J avg ' J ai X ' w--,- ,fix .-1 V- wfm ,Z H' 157 fl gf! , M N ' fffxf 4 :-5 Q, ,..A , ,ffm : ' 'I' ,, . 7 if , ,. V. . , . M '. . etaazrgezu, , .A -.. me Qt.a.tf1f,:3.z.-.,a,.t .aw -. , ,,....,,, 1 f --- ' E . . 2:13:12 5 giilllig The smart Alec asked this question: z ..,.. j 75 23333115 If a man should marry a widow named Elizabeth with three little children, what would he ililllf 2 2355? 8319? H FQQQIZI Receiving no answer, he supplied his own: A second-hand Lizzie and three little runaboutsf , ffffi f + f-'-'f'f . 51111112 I -Ex. .,,,,,.- g 11:11:52 l- :xiii 23335555 Neighbors: 'AI heard of your sonls breakdown. Is the condition serious? N'Irs. Trotter: Yes it's the rear axle. 1 W3 i L'-1 :fini r giiiiiiij FAMOUS KEYS I ijjjjjjjjf Francis Scott ----- 5 ifqiiftfig Jack ---- fe. Mon ---- . Q- ----- 5 ,,,,,,,, l I.. ,..., 1 2 22:15 ---- I1 Ku ttel' 31:13 21111112 Playing h0O - llllffr 4 ---- n ote. 5:55:12 Tur ---- . ga Upright ---- l Z ---- flflg- 21213 Kanka ----- . ,IIH VV,.... See that man over there? He's a sculptor. I 9 But he has only one armll' . ,,,,,N, I ,,,,.,.. 5 t, .,,,... 5 I l'Sure-he holds the chisel in his mouth and hits himself on the back of the head. -Wert Virginia Moonfhivzz. aaalf 2 ,..a i 2 r 2 I 4 I f ...,, 1 '-+'1 yn-' -r' Itis a wonderful thing for women- - The popular permanent wave- Now it's up to some struggling inventor To get out a permanent shave. 53 ' I -Mirromflfr. iii V3 There was a young woman named Myrtle, g Who carried a plate of mock turtleg But sad to relate, gjjjjjjg , S f She slipped with the plate, 511112 5 , And all the mock turtle turned turtle.-Ex. Ben Penchelf was having his picture taken for the Annual. Side face? asked the hoto ra her. 331353 2 . 4 P 3 P gum, No, halfbackf' replied Ben. 2111123 Ziiiii' ?1jgjgm1 Mr. Canfield: Where were you last summer: ? Hazel Blair: In a doll factory. Mr. Canfield: And what were your duties there? 5113113 . Hazel: Making eyes.', 335 Mr. Canfield: K'Well, donyt demonstrate your capabilities in classf' l 5 .,.,.. .sg i ' Mrs. Baymiller: Johnny, did you get that loaf of bread I sent you for? , ,,,. I., 2 John: No, the store was closed. Qjjjjjj Mrs. B.: It couldnit be, this time of day. Did you try the door?', r John: UNO. I saw a sign in the window: 'Home Cooking'.', ...M , ,,..,,,., Barber: You sa ou've been here before? I don't remember vour face.', 4335513 Y If 1 . I .....,,. I Ken Arnold: HOI1, itls all healed up again. Mar'orie: 'lThe waiter is han in around as if he ex ected somethin f' fffffffff J 3 3 P 2 ,,,, W5 DeVVitt: Oh yes, he's a tipical waiter. .,.,... 4 Two hunrlrerl fi,fh'f'n Y .,,, ,. ,W I A W rf' A A , 1 i Q! '? 'f7 ' X X ' J' ., ,- ,ff fr . fa ,, .. ' ff l , r-r: f'f f . 1' -- A 1 :aww . ' fir W' ' -1 , f-I ....,- ,,.ff- ' .,.., ---'a ..,. , 1 -' 'f f- .. if A23 .- fgdffi' ' f' .lla-ri? Cf .. ,.., , W -... ...mf-,1-11,.,,,, 21:-32571 Q 22:5 f'115'29ii12?: U . if'-1 'z..3.:71'11'i'i'i17 Hz' .--ff :::11111?:f ' if -- 1---5 ...,.. ,,,,, W: ,f bug lg 4 ,Q hai-Zwfffflff .fm xg, H f AW! A.,A , in ff X ' ..,, ff X , ff X , i A' f ' f f ,f4fff f N fx ' ' oc ii 40 A . Q., , ,, ML 1, il W I5 4 IS f , 00K IIE' ' 44 U Kp ,X 1 fya 1 H? I A ' 1 ff' .. .. J '-mf:-6tf1fQ-31g 5:9 A f M 77' i A 'iii ZF: W' I A - w c51,o., y 1 ,, L11 l.1.l5 f ,X H? ' 1 I w gal:-:K - H A ,yw wif' ' If ,E 5 1?ifxsfQ,Qif: E'1 11 .. If ff? 2fVQicr' ifi.' '-1 GLOTHES LINE ' UP A ff ' Danfkmon 6 ll ,QQ I A I f ' ' M .j.-' Qs? 3 ' f V ne, f -1 .9 -' - . - l yf u.l if , ' 651 'v 11. W P 10 ww gf - . if ff fr 'f 'XB ' t I WI 2 N .. 'nn f .',' ':,c,.: - I- , X !? f Ud'g' f y? '-Lfzff, Hg l , . K . i g? Y ,V , Ll W . xt. ,.,, A, , , ,,, Q . 1 , ., Q 5 all t aff ' Q . x., ' - ,310 5 L f' A A ,, fn vamwonmuon vu 'IIIIIIYHWI s:.1'fw'11 2:7733 ,, , W ,,,,,,,,, ,V W,,,WW,,W,,,n, ,,,,,, l yy ,,,,,,,, ,.,,, , ., ,,,,,,, ,,,., ,,W,,,, f fv'f V X W f Navi, . 3 iii + min i .K I Wm i N s ' , A' fy M Qmskfeaw J .fu dvceritisemenits + ,, fff!:4,f,f fe N mf. ,.,,. ,.,,,,,,,, , -ex I M -A A ' W Vw ' ' ' f 2 . iv- Y ,,,,, ,i h f Q' Y W DA f 5 , , h s I ' f 4 7' 1 L L I F ' . L 4 Ugffl 57' X UQ! 5 5 t ' ' 1 Y hehb 74 hzte 1 to hhbe one 0 the Cjmeyt zcgh Qfehool Qfhhuezlf t th the United Qfteztef t i 1 V Jbfahe zt Worth their While t ow h W , WA1TL: HIGH ANNIILAI. B61-XRD h -5 W ,ftt A -- i-Mw,M h Twu IIIIIALIIWII rfiylzlwen .W ..,..,.V,,,,, M ,,4,,,,,,,,,,,, , ,,,, 0 W ,..,,,,,,,,, t .Wet ,...., A ...,, ,,,M,M .,,, , ,,,..,, 1 ie? ,,,..,,,, ,,,,,,,,,,, N , W ,,,,,,, ,, ZZZVN H Z ' tt- WW fet.. ,5 ,,,, , ,,,. f fff' j1iiiTi3j5f!,i1j !,fffffiiy , f f V th'tA 1 e. .,,, ...h., .e.. f ' 5 53 I ,, W ,,,.,,.. ,.,,,,. ,,,.,m' ,:::f--f-mewfffm ' W--vfefwfwl, 'rifle f' ' f f Q ., , .,, - 'MI' M , ,.... f 2 I X9 5 Z x If 'VN H .,,.,.. vp-as ,..,,.....,. ,,.. , ,. , C I , A N f' s...,1 5. ,.... i f Q ,,..,... 4 Z 5 4 ,A,,, , i AA,, Q f A '4 A ' 1 3 V. X ?594f,,,,gfZ,fg ,if 'I ,ul Af 'AAA ,,, ll ,.,, 9 ,..,... ii fi 'Q 'R aj' N Q1 Q mu, f Q I QL if 'E f 1' 4 ff ' ' N if fm 1 and mb-the IQ25 Qffnfzual f i 7' 0771 E he qcoulledcm Hlrfrcerzeuiffr Q00 Jbfafter Trzntem' Q 111' I 2 C9ne-7fw0- ine .Nqrtb gfie free! Z W 1'ELEPHoNr: G1':1aT1wnE C. IDUNN JD Clin jjj 1 J? ffzfzagzr Tufn l:umlf'1'4 -....... W 1. . ,,, ,, ,,,,,A , 11 AA. ' ,,1A, i1.:1,A i f fL1 ' A ,:.,,f04Q,z:gmwf:1ww.,,,W4n1 ---'jg V --4.- ww- -f..... WW-vw, WQW557 5 -k,, ., jk ,X Q, M ff f--- mf -. .,.. X ,N -.., V fw-.if-.E , ,... .....,,.,. 3 L2 in Mm V , H 55 . Q xy., .. , my 57, .W WDA ,Mu nl U5 M :gk Aj Hgh? iz in If ..,f ..,f' -,.H,fx V .uf f y 'CQM N--5 ..., f VIIY ,J f,,.,, V, '..m,,,.,,J I 'M 'jg hx fi . ff! ,, ,,5M. ,. 511 'ff'fff7f4' ,W ,, 5 -1.2--IW. fu- ,5. ., sm, ,f we 5 A i' 'wwf T' ww, f A . ,A fwJm.f'f5,5 1,152 f 'fff M 5 W 1 ff 5 fy -----' . a' ' ' 2 few' , 1 1 . ,. f Cf l'fi'f' .,Q ' , ' M V., 5,2 ,,,, .,, W MW ?cf.wW,Lpwm.W4:fmW,wwf,::mwwW,,Jm,.mmf,.,.,5m,,,,m,mZ,,f55,,,,:f21m'5-:::::.ww:m,,,m:me,.,.:::a:..,:m.z ,,,, 1 ,,., M.54..M,,h.z ,,...... ,... .,..,. 5. ...,,f zgiiiig ifiiiiiii g fifiiii 1 1 Q ......., ' Zllllffi , Z , 4 4 , fff- f ' ,,,,,, 1 5 5 -f ' g 2 5 ,,,,,11ig 5 5 5 5 5 ..,. I Z f ' 1 Two lmndrwrl twenty Y I ,,,. , '7 rw ff'- ' ,.... ...l ,.. f,, WWW, , WM ,,,,. .,,,... ,MM 555, .,,, - .,,, , NM5,,,.W,.,.M ,,,,,,,, M, .,.,,, 5, ,,,,,,.,, ,,,,, ,,7,,,,,,,,,,21ggg '2,,z ,ff X ,f f fy' , . 55 5 'Cf ,f ,fjf 1 ' '52 f'-- 5 ,,,. ., 'ff ft f , -f'ffffi W f 1 , E 'I ZW . M '4ff fff 'Z f , ,, 5 5 , ff- ,4 ' --V. 1 ' . Q f a 1 1 ff ,V fwzyfvf' 55 ' s :H ., ,, 5 1 f 3 - , i ......, I f , ,, .... . 5' Q ---' 1- ' in ,, -3 5 M f' fy ff Q' X VV -X a f M, f f VN 2 1 - f f f 3 J 4, f , - fp j Z ' , fy f 'y. Q, , 5 gg ,f -,,..f -' f f ' ,mx 'Zf,,,f1'Z V ,T fl 2 , W I MWZWW' , f' -if f 3 -,, .1 L, N: Zf wm :nn ,..., .m,f,,Whiaf,,2MWf1i.mea:..mN.MnmQ3wy4mmx?mw?Z 2' '--- --4 1 ..,..,. 4 5 ,,,,.., 7726 ORTHLAN TUDIO Official Photog- Z raphers for all Portraits and Scenic Photo- graphs for the 1925 Turple E5 Q0 11122 an-M--2 -- ' Us my 515 MADISON AVENUE CLOSE BUILDING T OLEDO, OH1o 1 1 1 1 f 'J ijigiiif V T 'f ' -- ,.., 21:1 ,,,, , I!! giiifjpif . -vvv ' 'A rj fn ,,L.Q ,,,, 1, Q ,a ' 5 -q,,,, q,,,,W,,,,,,m6' ,,gZ,Q, M--:ff WZ .,,. ,,,,W..W,..,., 1 , ,,,, M3 L,.....,4 4 r f u v fm f, - flacfffy . f--N ,Q111f '1'1, 5 ,,,. 5 .,,. gy yr.. XA f K -w Vw 'f J W ' f 3EE1'w f if 1 2 MW 'M Wx' -,.,,,,,Q I , 1.54 j 2 5- Q2 'qqwm-W1 ,yly My Iffkjfml v. X? If ,.,, ,f,,,,,,,,f WW ,7 A . fa nl HW. My f--WL , ,fe , f 1 , ':- . ., . - f V ' '-f ..., mf! 'wi 7 i5fff w1v X X ,mf ,fi fm f'Nf..,f1.,f1 fwl, 1 'VM If ...M A 11, .,, Efwyffa -mae-,.2,',.-4yfv...,J,wf .... 5' '2 Q ,-- , 1 -- f- 4 L ,,,, ...1 1 ,,,, ,.,, z ' .... 1.4 , . ,.,, ..,,.., 9 -.-- 4 , .,,,,.,, ,, ,,,,, 1 ,,..,,,. 1 ,,,, 1 ..,..,,. 1.111113 ,.,. 211121115 l .,,,..., f I ..,, W4 1 ',f' --2 , ,.,,,. ? 1 ffffffl 1 z ,.,,,,., 5 , yjjjjjjjg gf ------- 3 ,,,. ' ...,..,, 3 ,,,, 5 1 .,..,,,, 5111112111 311,13 ? QM. .,,, , ,....,,. W ,,,, 2 Qfffffg Hjjj ? ...,... iff 'ff Z llllll 2 ,,., ..., 2 4 N2 :W 2 ..,..... .... 4 -' 2 we 1 1 fu- ,. ,,,,, ., W :wwf im , ffm! -f'f W2 f Aff'- U4 sv--.2 , .,...., , 3 .,,...., Q Z ..,. ,E --f-f ' 4 g,.,J '--'f ' 3 ,,,,,,, Q ....., hi g ..,, .4 , ,,,..... g Z.,,,,,i 4 ..... , W .5 H53 ?H 'f QM - - f ,,., 1,2 ,, ,,,,,, 5 -- 'f -- 9 ....,... 3 111211115 , .,,,, 1 .5 1 iw'-N3 2 211112 ..., 1 ? '5 .,,..., 5 ! W'2 ...,,,,, ,Wg L ...,.,.. I 1 1111113 1 ,.,.,,., , 5 ,,... Mi We M :QM gf 'ffffff 5 ,Fig , ' g mmf gf '- ' 2 g..M,.,1 , ,,,,,,., , Q lvlr N J '--' Hi 1. .... ,Z 211113 2,1-N---2 iwmj 'f1-f'f' 2 3 ,... .... 1 7 ,..,,,.. , , ,,,,, M4 ? ....... 4 glam 2 ' mf 2 .- W5 I ....... i ----- ' L --.-- 5111115 5 '-'-- 1 .....,.. 4 f' ' Q ,.., , y ..,,,, 5 Two I1 un drfvl I wrfnfy-t wo - ,, 1111 1 ,,,,., , ff ,ff ff X fx-.. 1 , 2 ,... ,ff ,f ' ' f , H A ' 1 '- 5 W' A I, ' -E ,,... A .,,. , H f ,, L I , , :JU I I, fav' U ,. ..,. ' 1 Q 1WWW,,e,11.,,,,.1,,A '-v ,. 'V 2 1 ...I ,W,..W.,..,1i11j..,141.M .,.,,. , ,,,.. ,s,,,.,f:fi,,..,i, ,A I QR 6071? 6155 5 we S ,lfl'l'fH - if - s , ,B . ff. f V. X A rr-fb'---X X-N . , ,, I ,.., , X ,, Kg 2 1 , 1 f - f H X ,a f eMW...,,, N. . ffl, If W, 1 X 5 , ,waazpzfif W . f f X f WI' V. 4, . ,mom ,. Your school days will soon be just a happy memory. The books and things now used at school will soon be laid away and kept merely as a matter of sentiment, Not so with your Conklin ljndura, for it is built to serve you indefinitely. In fact it is guaranteed to do so. i u, 'z On Q K 7 fl ENDURA 0 f' f X ' Q S The Conkhn Pen Mfg Co Toledo, Ohio ,Nl Uncnndlfwnnllq if' Pcrprluullif Guaranteed hast Toledo's Exclusive Gift and Novelty Shoppe The Ywaife Sioppe 826 Starr Avenue he cover for thls. annual was created by The DAVID J. MOLLOY CO. 2857 N. Western Avenue Chicago, Illinois M any Maxim Mud Cover bull: thi :rude mail: o h back ua. ' l tw--fa 1 lml 11 fill X 7' 1' -ff, X ff ,, y,,,,a,,.,,, W :fre . I ,,V. W:f:f'f'i'4,i, f .,...,., .' ,fi 149: . , ,,, ..,..,, f ff , f ia '2.1'25.f,,,,,,,a..,z:Zaw9mi ...A QM 065W,,4Z,gW,,Z: .,., f0',.Wh,.,,,,i5iaW,bM ,.ff WW. ,--- Z f JERSEY SYVEATERS, APRONS, TUB COVERS, CAMP EQUIPMENT, AND 5 IT Wfzifafff, , Q ,mfsiiwlisi . , gxiffm-'-f B I iff., M fy IIS 5 f I 2, W 09713. ...,,, g:z.,,,,,Aff'-1 ' 5 ..,V .,,,. fr' if , 5 I ,I 72 ,,,,, , f I .xx .,..,.,, O f I. - , , -...,f ' I M! M27 ii? X 5 A L:ff 'W' R'-,W ,- j1f,',,.! 'vw V1 EMJAW, 17, ,g LZ 'i T -V-If 'T if fa ffl f- --Wfwm f'-Wk W , , ,. gf '7 V LZ : , V M W. gui f ff 1 A mf! fqwhui f . f X i -K flmliff-,bl uf? ff 7 z f 413 ffww y'+W,,,2 ,,,, 4154-mgffmwf W., .,,,. , ,, ..,. ,,.,0,,E:.E,..1.Mw,i,,ZQggWx-,,,,4.,,,W,,,,wI5fi,f,,,,gf,ymL 5-,,,,:MmQQm,y,W,,w,,,.,,Z,4 4 '--2 I ...,... 4 f 1 5 1 'b-- -- iiiiiiiix I 1 1 ITH the compliments Of 4 i your electric light and power, artIHc1a1 gas and hot ' Water heatmg company. Z I 2 NAVARRE 1405 D. N. MALONEY 8m CO. RAYESS SL COREY 245-247-249 CHERRY ST. 66-75 SUMMIT CHERRY MARKET REAL ESTATE AND ' ,,,, INSURANCE f 1 ffff 3 We Make g ,,., Z 2 All Our Candies Daily 223 MAIN STREET Q I ' ,Wm Y 'W' 5 V EIIIIII7 f' 'I , , , 31321112 + 'f'-'- ' 9 ....,.., 1 3' .,.,,,,, 1 I ,.....,,, f ,....,,, A ' f.,N,.,1 I a, ....,,, i THE HETTRICK MFG. CO. 1 f,.,,..2 Z , j if MANUFACTURERS OF 3, ..,, I 3 Z I ------.f g , , AXN'NINGS, TENTS, TARPAULINS, FURNITURE PADS, VVORK CLOTHING, 3 CANVAS PIECE GOODS OF ALL KINDS. 1 i r 1 I 4 , ,...,.. S .,,...,. if Two l1,unrlr4'r1 flvwrrly-four , A-.4 1 Z ,,,,, , , ........ VV,, We VV,, , ,,VVV Q ,,,,.,,.,,,,,,., 7 ,,,,,,,,,,,,,,,,,,,,.,,,,,, 7 ,, ,,,,, ,,,,, ,,,,,, M ,WW ,A w 1 fff' ff z':- if ' , V' if :WW :::::zf:m::' 1 ,f 9 ' f.!x 5 5 .... , , ,..,.., , - 5 .,,.., Q i X z ..,..,., i ,,..,,,, Z ,,,.,,,. 1 2 ,...... ? 1 Viiift f l l t ....... 2 f '---- it - z Z 4 M..,. s f,,.,,04 bmi g -'E Z ...,.,... g r W1 P f K f X 'AAAV VA l -.,,,., Hx Vt ,A . ,,, 0l7g7'dfLl!dfZ0l15 We congratulate Waite upon being part of a high school system of which all To- f ledoans are justly proud. lt is gratifying to know that so many of our future citizens are being properly ntted for the responsibilities and privi- leges of real citizenship. THE W. F. BRoER COMPANY, Jewelers 3Rn rm. MINIGER Burrmxc Ask for t't PAGE' CCKQKYZ jlfezzkzh' it BUTTER-CREAM-MILK-COTTAGE CHEESE ,QZQQI ICE CREAM DFIIllIl1Il6Il For Their Qunlityl' Two YlL1llIlIl'l'd f7Uf'11f.ll'jqI'l' 2 IIIIIIV , ee, , I W ,,.. , f-f. f M! ja f f Q 1 L- ,,, 4 -- 1 ,-, , 4-fm. ,,,,'f ,,f,.. ,ff ,f ,f f ' flfggfzzzzifyfj 9 gr f,,,,,, ,,,. V, M. ,N fue., we .,,,,, W ,,,...,. zwmww 4 .g..Mz.:.5..:5.l 312 1 fh- 3 523112122 9 ,,,,... A 1 5 . Q Co 5? - Q' ,g.,. :Q Qyq ' ... x Gi- Q fb 3 '-:..-ps--4 'v-1 1 1 SNES. - f Q 28 'U A gf, ml Q Q cm PU A P- Ai-, -1-rg, ' G 3 ,-4 pg .,.. X ,L iw ' N 95 E Q. 33 X S GQ Q C E O F HN N Yu:-G3 4-f C93 2 Zh' G m C xx 1 ra ,-E , 5 ra ,-E CD F4 A, O C: CD A P-Q , D4 ei 1 Z 5 PU ' C Ei? f. w tri PU rn . ff U1 :D S P1 :- a -- ff ff 1 2 a ef ff ff 2 55 rn E Hf:,24O4:Q-444:41 55 '-37127 m :T w :r AA :r Q ::- :r :r :r 0 m I Q 5 hd Q rn ru rn ro ru ru rn 5' fl U1 ENXQXH-Wqsgfm ,-, . p H rn -1 'J f-4 '-1 P-1 '-1 1, Db Eff 5-xx 52545 '-- 0 '-1 0 ' FD Q CD fb 0 fb 3' ' H O 3 fx I Xwiil 'f UQ -4 na f-r 0 1- gd f-r O -A 'P ? 'Tl KE I ff' 7 45 F- :r o sw :r' 5 D 5 C he U3 C C Q ,D 5 E-I 0 ,-D rn Y,-. C g H v-Q O 0 :C ,T : U E+. fn' ST 1- E1 4 S fb D' O Q A A UQ Y 9, ff' A 21 3 ff fm D Q C: A 5 -5 N 2- f-r N ro Q Q? -U 0 '11 U, - D- ru P+ Sal- :fr En ,., C fb S 2, Z Z 'U J E-SASDHQ mbsf-S E1 51-1 Es fu KT' D.. O 9 gd FQ 5' 2 ,T Zi' Q 7: U-A f-I I ix .... m -2 52. 5 r-- if 'U Q- ' g w 1-A C m QI, fm in if C U' A 5' UQ 1 L11 ,Q 7' z AE' V, 5 E 3 as f-f 53 Rc 5 gf 51, E 0 Q' ff' C 3 af 0 Q, D 2' v-5 m hi Ed O H E' G ,, U' S 94 E F3 UU 9 Q O :C 13 O N E' O .... P,-I C :R fe. - A :A A E -. A 5 - E if - 0 N ,O C 3 :S ' O PU -WIN 3 ,, :1 N cm :S UQ Q. 5, 5 :D :U 35 . '4 Q- 'Q' 5 3' 9, 5 UQ 3' ' - ... -- w' fb 7 1- 1 Ugg fu H- A w E :QA A 3 :, 1 5. D D- I3 ,O Q as W m 15.5 fx :A fb ,E U- -1 fb E P1 is Q' 3 :S fb 0 N F11 'A 5 ,N f-r P-' il- E S w ..1 WX E m ,, D 7-' :z rv gg 1 F226 E2 . 3 F' If 51 ' ' 1 4 C: '-1 Q U7 0 N D IT! 495' Y-A s f-4 Q - Q., Q- Qi 2 , 1 Q -1 fi . D B My 5, X E 5 1 9+ 5 5 '33 :w 5 Q if 9+ 9' na Q- T' E+, -:F sig, sk S., Where Privacy Is of Prmme Importance f 1-'- Ai 4 mo 5 .,,. M, Gdhlltmmuin P-wwf , i i 1 D. COOK-H. MCKIMMEY FANCY AND STAPLE GROCERIES ' FRESH AND SMOKED MEATS 1502-1504 NEVADA ST. 1202 IDAHO ST. 2 STORES Q PHONE NAv. 1930 5 PIIONE NAV. 105 1 3 Y Tzvu l11mrI1'r'1l f11'c7:iy-,vim ,,,..,1Lig A ,,,,,,,, .DDD ,,,,,fw'ffZW'W, ,., , 'fffffff fy L l 'fff 'f ffw'1yM 'f':1 g5,. ,,..4:,,,,,, V l I ,.5,,.f f A - A v f'2uc7 ' .. A 1 f , Z1 PM-M f --'-' f ' ' --'--' -' ,,... 1 33,115 K ,m,,,.,1:11z:::L,,g 5,11 V f.,.,i W nj? 'AAII 1.31 ,,,,, 'lllll 1 j ' ' 'QQ,.,,.,, -f,- 52 if M'1: 'fff g.,f,l?Vj,.,,,k H jfif-fsfi ,W --'-' W .ww WWE UM g W,,,,,,,wMfW,4fw4-wg,g,,,,,,,,W,,-W,Wff,a,g29,Wa4:D N,,.W,,,.,,.,,,.,.,,. ,.., , ,W ,,,,,. .,.. .,,, ,.,,E,, u .11-, jf QNX 1 5 ........ 4 WM r.wm:is.ff:47,, 1 N--. NM r-51-N ,..,..,, ,...... . ,, ip- j I 1 . fy NA --W. f -,W es., r ff . T M Z 'v- 1 gjjtg' ,C ff X-EP 1 2 .J if '55 - ss .2 2 ...f ,Lf 2-...M ' ...J ff , R'-..,,,, 1 jf!---ff V' all Ji k 'jii ! ii ' - J 'J 7 A? Y W N fo , . , 3 .W A f-WW. I A 'MV ff' f . 'V L . v ,A , If ff? f' fl., ,,...,, 'tiff '.fiAe'! '?2f,,T M 'ff MH W ,. fu fswfsx Jw ,I-Ap-...f 015: -V 5' AX, ' fqvu lfxvx wx...:mm::..:::paL.gzsf:gzg:4-..,..1:Q. as.m:v+mxwmamw.::,w,JAm.::E,..,i,4w.:g:'lLxmac:-e..,m:. :g..5t:.fE1.w1:.f' v V' ' 1 iiiiij ..,, 31.1112 4 --'---- 4 ! -i Plan Now tO Build Earl this Spring , .,.,. .i ' Don't put it off any longer. Get into a home of your own this year. 1925 will see a . 5 record amount of homes built. As soon as the Spring rush starts prices will advance. Plan E your home now and be able to live in it early in Summer. 1 ...... ,g Bring your plans to us. VVe will give you an estimate on the very best grades and quality of lumber, lath and shingles. Our millwork is manufactured by skilled workmen, in our own fs : 1 mill. Our Long Leaf Lumber Laris Langer 1 f TOLEDO LUMBER Sz TVTILLWVORK CO. t 202 SO. ST. CLAIR STREET PHONE, MAIN 1145 I ,,,,,,, s ,,,. ...S 5 A-ff-1 2 , .,..,,, . 5 The Toledo Blade gives more attention, space and care to the printing of School News . I-i 3 , than any other newspaper in Toledo or in this territory. The aim of the Blade is to f 5 i present a natural and accurate picture of Toledo school affairs-without misrepre- .5 sentation, without exaggeration and without distortion. VVVV---- 4 ig The Blade has the largest firrulation in Toledo heraase il giver the ggggggggg 211111112 most attention, the most space and the most care to thc lhings in f L -----f this communily whirl: are really important and really worth while. f- i iiiiiii 5 Not only does the Blade, every day, carry the most news and the most ACCURATE , 5 ' 9 . i I i I , y ...,...., , -f---- news, but it carries the most features which are informative and entertaining to young 'cn 0 o 'U ,... 9 .T ....... 1 i ' 1 WMM, .. .lit v-r Q f '1 E N UFIRST IN TOLEDO FH V 51','L'Xfi I .,.,,,. ,Wg T, H 111.1'f 2 . ,.., .L ,,,,.,,. 5 ,,,,,,' 4' .. Q 1 Z 5 i-J Q I W 1 E 1 6 THE KUEBLER RADIO COMPANY QUALITY RADIO SETS AND SUPPLIES 5 Cffha 1 235 ST. CLAIR STREET . ffffffffi 1 i .,,, , YARGER BROTHERS BILLIARDS lfl'lzz're all good fellows meet 1011 STARR AVENUE 2111115 T Tivo llululrlfrl fllvfrily-xr'1'r'f1 M ...,,,,, M ,..., ,,. D ,,,, M... ..,,,,.,,,,,,,a,N,,,,,,,.. ,.,.........,,, , ,,,,, , . .W ,.,.,.,,.,,,,, , ,W,.,,,,WL,,,...... fm---1 2 ,,,, . Z:i7,,.,...,L ,,,,, . , . ,.,., , ,ii. .,.,. ..... ,,..,, - .. ,wfziiilifiiiff ,..-, ...' ,.it A- ..t.. ..,...,.., , . ,. w zc:'7 , f . -, i 6 ,N :S f 4 ,ZH NJ 3, . f K 1 , , g 1. , , ,A , My ., , f ff ,af fm 55 , 4, f, I , , f' ,fr 555,10 1 'pf' W 5 1 X 'W 7'Z r '1 ,zzxzza ,... z,fW.,zM,Jkwa::swZ:w:,Mf!47.z.uw,,,,,Zmeem.bL.w.a1imfnc1.:..f:f:..,ffmml 1 , 1 t X 2 4 3 COMPLIMENTS The OF Bock Bearing Company 7716 Tofeda Qmfffy T aper Roller 5705 ' 66 Bearbzgs 1CE IN SUMMER INTERNATIONAL COAL IN WINTER MOTOR TRUCKS Th International C Harvester Co. of I I , . CIUZCHS CC Ameflgg C an FACTORY BRANCH A-,, ., . , .. -,.,,,f7 1, qfaggwf- If L, Hzziffrf H, , Y ' ' 'i,::v.1w4 M, V. ,V 5 Ji::zzpzr,wmm,mmm,-fm' -V - 'z Wgpg , ,,,, .,.. , zz-111, ,,,.f5t.4 wwf . -E. wwf ,431-'fTXj. 3 ,.....,, 6 7 ------ 4 ,..... .1 1 , ,.,.,,., 4 ,,...E5 i ,,..,.,. 5 2' --' --z 1111111111 'V -f-- -4 ei 1 ..,.,.. 4 1 111, M 111.1 119 '1'11 i '- if g-1ii1 -1'1 - 1 1 MRS. M. KUEHMANN'S ORIGINAL POTATO CHIPS Known as the Best 1513 WAITE AVENUE FOREST 4034 JOSEPH STURTZ 15 GROCERIES 2: MEATS 4 1223-1225 NEVADA STREET 1325 N.-XVARRE AVENUE 1326 KELSEY AVENUE I I-Ionest Goody-ffonest Iifeigllt-Hofzest Dealings H W ff- 1 fi ' -. if 1 jA 1 --in 'jjfjf W . FWYQA +4'7Q'1 f' 1 1 W' 27:1 PFA a2X2i2J2i'E22'27S. q.l:!3:lj!fgl5fjuf:q uggujuiqtfqaqlgz-9mv4,f,l 'I ffflp .lf , Q., .za ,A , A A , l.a1aE 1 fn1 2a1n1mEa1a1..1 fimfigigkqaalzaiatamm liijii i gli ,!B4!B1l4!lll1.- mmllmaat .31111gsEEEEgn3!lil!1l!!1 , '!f!!1!!i!f!!fI!ESMQQEQIQL, nn:w!:lwl1i1i aV,mv:pEfwu,,-tWAq.,1u,gJrZn4nInlaygtnn,a,nLn1efx1p3Igq33 ig:EE11Ebi111!a!7n,n:,:Q?1gglial:EER1u-milll31iZs31!?rR!5!f!5QT!g1 ummmEmumnntlmxstmg,z 1mynmmmnlm ggggmf1R11gtx1nu.1u111unmxxtaggmm, 1 1.lfIill2UIgl,l-1-IlfllqlI1lll1l.ll.l1l1liHfll22!gL, mjgu-mgl.mgqmmj EERQlimlQl'!fI1l1lQfl5l:IgllgIflll.ll1l:llQl'lfl1la. 2 .!!f!!1!f!!i!.!1!!!i!!1!!.!.!!B!!!,l!!!?!?!f,?,iv'1 f 1' '1 'f 1' 1 1 1255? GOOD FENCE IS AN INVESTMENT A good, well-built fence Lirdds n'1uch more than its cost to the value of your home. Every vear it returns a profit to you'vin protection to your lawn and Howers, MARLEAU-H ERCULES FENCE CO. Wfffj MFGRS. 82 ERECTORS OF fulfui 4 WIRE ANDF IRON FENCE 1 ,,,, 1 DETROIT AVENUE NEAR COLLINGWOOD Ni Q ZAHRLY DRY GOODS CO. 819 E. BROADWAY ? 1 IVIENS, AND BOYS' FURNISHINGS WOIIIEIZSJ and Childrens' lVearing Apparel PICTORIAI, P,XTTERNS CROWN SHRUNK OVERALL: PHONE, NAVARRE 568 RAY COOLEY CO. DRUGGISTS - 1166 OAK STREET Two STORES 1026 W. BANCROFT STREET Y Tivo hrfnflred twenly-nznr -f --ff ...,,,,, if ' A 1. ...,...,. - W ,,,,,,,,, .. ,M ,,,,, M,..,.W,..,,.m.E ......,,,,,,,,.,.,. ...,., . 1 ,,,,,,,,,,,, X ,,,, I ' ' 1'1 ma.: , fr Yillril ,MW ,457 ..,.. I 1 I ,,.,1 . f f .www I 4 1 .,,...,, 4 1 ----- ---4 f 1 ,,.. .T ,T 'AA , f f , f ' T S S OS O Em ,, If rVrV,C fj .,,0 ,, 'f,f:.,,,, w,M.T..mz1f ffff,.fff Dij-if-ibuZ07,-5 for 'II G. HOEFLINQLR A. M. HOEFI,INFER A PHONE NAV. 1271 U 7 ewpfdfzoie HUEFLINGER FUNERAL HOME Lil'FIl.V6Il Lady ENLLIIIIIZE7' 201 PL,xT'r ST., COR. SECOND 07775177 55 S. EVANOFF 137 MAIN STREET Chodvidl-6-Y YOUNG R'IEN,S HATS, CAPSQ SHIRTS A , 'I',x11,oR1NG AND GEN'1'S' THE J. MUNCH Sc CO- We .vpefialize on imported fwoolenx, for our flotlfef give dignity and rfffnffrnfnt to IXIAIN AND SECOND STS. ffl? fwfflfff- A. F. FORSTER COAL CO. 1001 OAK STREET COAL AND COKE 'IKELEI-H0xE NAV. 3000 If 1 llllfxrlwffl lfzfriy N. ....... M .,.M.,.W,W..M,M,.MM1,,,,.,M., ,1.,. ..,.,... M X ,,,,,,. f ,'f.f 'V ff,,, W f fl , i 1 Z - ,.. ,,AA ,,.. . ., S., f .-f- . fe-...I A ? ,...... 4 f H, f W' .... f --'- NNY--'hijlfi .... , f ii I I M' ,f .,.. Y- fl WM., ...M ., ,A ,, Qfff ff ' 1 I ,, A wh X, M, ., .,, 1' .w -M -. 1 ' Q. , I A '--'S -. .- A, -' Nc f -- 'U -f N' f -fk ,.f. 1 V -fj - Qff.. ,JMX 'K' f A I J W I fx fmkfwidgif 'WFS if M I I' if M .. E ' f' ,,.. m...Mmfi..f.i.ffgmww.vmm.m1::1D::E4.v.:r1:.....E,Em2af2.aewmff-L ---f- Q. .mm E-M----4.wM...wm...E.,.,..,.mrgf.f.g,:Amf.'..2xazlaa ' W A ,...,. 1 I ' I ,. .,..,,, 5 5 ,,.. I MODERN Z. Zi 2 i 5 1 1 4 1 fi ff'--f- J Compliments .I TRANSFORMERS of I I 1 2 Z z I l 1 are Recognizee as Standard Radio 2 Equipment The Compan i COMPLETE MODERN ELEC. MFG. CO. HOME Gm? FURNISHINGS Buy them at your fafvorzte dealeff. Z Z THE WHITNEY COMPANY DRY GOODS Sz FURNISHINGS For ilze 'whole Family V I ,.., M4 Q ,.,, r -N-1 i 4 2 I STANDARD DESIGNER PATTERNS VVITH THE BELROEE COLLEGE CHRI. CORSOLETTES, GIRDLES AND i BRASQSIERS, HEMSTITCHING 5 1005 STARR .AVE. CORNER E. BROADVVAY i ..:::1:Z i 2111111115 f g Q -------- ag , lf' 5 PERSONAL CONTACT ffff'ff- L ilififlljl S Only by constant personal Contact can a bank be of the greatest possible service to its f clients. For that reason you will find the officers of this bank always ready and . Willing to discuss with you any matter affecting your interests Or the l3Z1I1lCyS. You will ' Gnd every banking service here. THE PEOPLES STATE SAVINGS BANK I BANKS AT: 924 STARR AVE., 240 lVIII.L.-XRD AVE., OAK AT F.-XSSETT ST. .Two ltumlrezl thirty-one 1 z f 5 W.. .... ..,......... W .... M .. .. , ,,,,.. .. H ,,,, ,.,.,,,.... Q! ,E ,. ' f . f l J X ,..,..., ,,,, D O, 11 .,y., 1--'iff 111. f rgufk.. - 51, V v,,, M.,..'g't1'wwwfwh::-fe .W,.,.u-fww,,,,,ffm 'E ,,,,,,., ......... .,,N..,,. My ff ' 1 V--X 'I 5' I MQ. f ,W 2 I ..fm:m.-. .. A-. W ,. .....,,, fm-E.,, N... . fm -V, C ..., Wffaifi-21 2. 14 .M 4, 6 X 1-M, 1 Ffa , Q.,N.,,. ,... Af,.,39-Hajj' 1 M3373 if 5.3. ,I I X fjg 1. 'f J! X E 3' 3. rj-9,-EQ N., f ,HJ W W., V-W4 V , .. ,Q , I -, wwf... A -f 52 : fr . f' f' ff , A , .. S ff7'.,,.,,2' M .f ,. ' f f f f' .-.. . ff. 1 mg! 5' If -V. WM' ' ' .ff ..,, f 1 Compliments of HOH LY Sc HOSKINSON PHARMACISTS 501 OAK ST. coR. CSREENVVOOD AVE. TOLEDO, OHIO Does your Roof Leak? CALL THE U. S. ROOFING CO. And your Zroubles are ofver NAVARRE 2597 452 OAK STREEET BOSSERT Sc HALL PRINTING COMPANY ffl! Kinzlx of Trzhtzhg NAVARRE 102 219 MAIN STREET COMPLIMENTS OF J. L. Bueschen COAL COKE CINDERS M11n1If11rt1.'rers of CEMENT BLOCKS NAVARRE 598 1812 STARR AVE. W. 8: L. E. RY. FRED HAAS GENERAL HARDWARE flame Quality Paints, Oils, Glass and A. E. ROBERTS BILLIARDS O Gas Pipe PHONE N.-XVARRE 509 914 STARR AVENUE 630 MAIN STREET Two I1 unrlrwzl H1 iffy-fu. 0 U ,,... , 1 ' 'fw -I - - I 4 f aww., , f g,,.,,... ,, ,,,. iffy.. ,..., Vllyy yfzjnilg W, 1 W:vWA.,,,:ZW,,,M,,,.,.,,,,,,,,,.,,..,I,. ,,,,M,,.,.,,.,faz- -5 ...QT ,,,, ,W Aw-mi?25Q:..,,,,.,,.,,,,,,,,.LmV:m,x ....,. ,,.,,.......,..,...,,. I f f , . f f f f ga! Q, f, ,f I , dmfw,-:if 1' f Q X 'ff 1 I ff Those who bring Jznufzine into the lifvex of otherx mnnot keep it from llll?Ill561'Ur .f.' GET READY FOR THE EAST SIDE PUBLIC HOSPITAL New Building Fmzal Campaign OFFICE: PAR1.oRs L AND M, 'ISHE Boom' HOUSE, 'lP0I.EDO, O. TELEPHONE : ADAMS 2595 IS IT AN HOIPENU OR HCLOSEIT' HOSPITAL? The new East Side Public Hospital is incorporated under the laws of Ohio as a corporatioll l'Not for Profit. It is managed and controlled in the interests of the public by a Board f Trustees, the members of which receive no remuneration, MON ETTA FIIUHRER KENNEDY ATHLETIC EQUIPMENT F or Pligh Sehool Smdefzfy OU'I'FIT'I'ERS Ol WVAITE HIGH SCHOOL ATIIIIETIC TEAMS THE ATHLETIC SUPPLY CO. 'll0l.IiDO, Ouro Col.uMHUS, Omo THOR BERRY, 311 SUPERIOR STREET ffome of the Fines! Tailored Clothes for College iWe11 21535 TO S50 Two PANT f ,,,0 f , , , ,,,, ,454 .f,. 4 4' Zfifizff ff -I f -f Wynn? 2 f 4 T ff W f 4 f X ,, , 'rfj fll ,. SY Wim f My .LI ' fm'-f. t3 L f ' '1:f.. iR'l3.s ,... EI. We f f 'es XD Wx my is-,Wff ' ...J '1 ,ia ew. 'S-f.h,..,4',,,l if---'7 V' A . Al., .A ff A. few! I.. 14 ,V H -W! g,fi.,5iWJ Vf -f A7 ,Q , ,I rm,,ffxmy f if 15: I ws! W . I - 'www...:mnaan..:,::::1I.1s,ze:,,z:..1:W4 . .,,. I I,,feewmenwZ.mmswmeemm:WM,Iewaffgmfmwiwi1W14e:w.Wfm,,mvm.1.fWW .... f I ,.,,,.,, 2 ' ' I I I ' 5 l gjjjjjjj 1 2 I 5. 5 ,,,, I ---- f--44-- 3 I 2 THE MAUMBE MALLEAELE CASTING OO. Service and Quality Guaranteed WOODVILLE STREET AND W. sl L. E. R. R. Q 5 5111112 9 ,,,, Q ji f 222222255 3:11:12 g I - ' I I 5 11111112 Z Qjijiiiiii Q j f 33332 f 2 iijiif - ?55537e H dry? PRED CHRISTEN at SONS A ' 25. I ,I ...,.,,, , . Leading Licensed Contractors f ,,,,,,.. . 5 ,.,. ,.,, 2 '- - ' f :xiii Q f DRY CLEANER CDF EAST TOLEDO i SHEET METAL AND ROOFING -- BERLOY METAL CEILINGS 5 1221713 820-822 EAST BROADWAY ff ' ' 5 , SI. ...... 2 I, . I : PHO-NE: NAV. 2234 PHONE ADAMS 891 f R. E. GRUBB, Prop. 714-26 GEORGE STREET 1 3 f .,.,.... ziiiiif T PREPARE FOR A POSITION At this old reliable school and secure the advantages of the finest equipment, most thorough, and 5 I up-to-date courses and the most experienced faculty of any school of its kind in Northwestern , , Ohio. Seniors who have taken commercial work may continue their course in our summer term. Ziilillilii We assist our graduates to positions. L 'f'-ff- 2 I 2 I . 5 Purchased Jan. 1882. Oldest in City. 2 .,.... . 5 1 Business College V Adams .na 15th sn. TOLEDO, OI-IIo ,iiliilii THURBER P. IJAVIS, PRINCIPAL 2 2 . . . . . ,,,. 3 2 igjjijifjl Member National Association of Accredited Commercial Schools I ....., H 1 'lffli , f Two llfzmrlred flnirty-four I ...M .,.,,,......, , ,, .M , sst ..,,.W.., . c.c, I-..-...Q1 ---. ---- v, 1 ..... T ' ' . . - ' , , ..,, ,E ....., X 'HC 'gf - awww M jg wW,,..,w.Mm,,mefawmwmwk Www.. W ,N , A f f 1 If X 1 . cy wx I' ...K ,N f a......, . , , I. ,.,.,, A 1 y L ....... .3 . I ......,. I A ,I Wy. W 5 f . . f .,., y 7' 1' V' ,fi rI.A NW I Q7 ,,.. f L'n ,,,,,, N 2 I M vllllll M71 f if 2 .q+,M:LQ,,,,f !,'iMf ,J Elk Y ji W . M, .,,vL, f'-..'-.. , , ff' ? 'X X lf? 1 in-N., ' -1 ,,L '35 A ,,,, f ' X .,.fh , , VVf M N ,,,, . . Say it with F 1 ofwers I Q CLOTHES Llams 1168 HIRZEL BROS., Florists Q I THE A Store and Greenhouxei I ' i i 425'-L27 Eaxt Broadway at ' Starr fl-ve. I. 'BEl2I2YCP: E NAVARRE 616 O O V W 7 PHONE: MAIN 4500 MUSIC FOR ALI 0ccxsIoxIs ---f..' RIVERVIEW NIGHT-HAWKS I OF TOLEDO, OHIO H.XROI.D O. YVENING 211 SUPERIOR ST- I 2 i P T 116 Main Street Phone, Navarre 1678 I ' FLORY Sc FLORY . . g Expert Bnrbzfrizzg , ' g SULCESSORS TO Q L. E. FLORY 6 f Hlensj and young mens! Furnishings, Ham, Capsf Etc. I 1797 MJMMIT ST' Suilf and Ofuerfoals Blade to your order f ? C. W. QUETSCHKE PHONE, MAIN 2061 C. J. SEEMAN Y STANDARD PRINTING COMPANY MODERN PRINTING Serwife and Quality 41+ SUPERIOR STREET 611111113 S C'fIll1f7Ii1I1FIlf.9 of 1 Confectionfzry , 3 ' ROMA KER S I FRUIT SoIf'I' IJRINKS 1221 SUNINIIT ST. 1229 NEVADA ST. 5 Two lfzznrlrrfrl flfiwly-fra , i .1112 :lu M I 1 11 ..,. .Q , e'I' eeee I e'ee .,QQ.llTli?f'f 'Iee ' ' 'e 1 g 'fl' ati 4111 ...,, ,, ,,,. .,,,.,,,,,.,. , 1 ,,,,,,, ,ff1ii1iff'ii.ff ' ,fp 5 ' ,..' 2 Liiiiiiillff ,,fgg1:11f ' fu, . X 1. ,,,, ,,,,,.,:V' ...,, 5 ,,,V 'AA' 1 .,,,, . V. H fn f-m.WE.wm,,,fw -f-1 ,M I 1 4 H ff ' ,f 2, 2 T V c, 1 .1 'Z S 5 rim, i 4 ' ,1f'T f 3 LI il -M fwff mix If 1 J W '-vv' 3 ---- '11, .,.,,, 3 f ' .I N '- ' 1 fu ' Z -I . ' 2 f-M ,W,,f -ff, ax Q jnlf' 21: f t 5, 2: A ..,.,,,, ,CMJ K-Jw! 'gf A .fi , . W. f f'f'ff 1 A .Em A , ' A.,,,Q,fgy:f ffl,.,ige:f?,mx ,A , fm ,,Ev,f,,AJ.z ,.,., 4, gl, ,W K fun: ,.:'::1Ep4:4j,n.J.6 ' Y ,.,.,,, 1 ,,,,.,, , zhiiiizf Ziiiiiiii 2 ' - I i I S HAIR AND BEAUTY CULTURE T f XVE TEACH ALT. BRANCHES ' i LARGEST AND BEST EQUII-'PED I 4 SCI-IOOL IN OHIO O A -I- fi 2,5 f ,.,,,,., ii I 'f ' 14 2 I 6 I , ..,,,,, 4 5 ,,,, -4 319 ST. CLAIR STREET R VVVIV EI I EGGLESTON FUNERAL HOME H. A. EGGLESTON Thoughtful care and dignity clzamclerize our verwzfe 732,734 MAIN STREET PHONE: NAVARRE 286 Qfllflg g QI PURPLE AND GOLD to us suggeyts ' I ,,E,...4 I I I ,, 2 LOYALTY, INTEGRITY AND SPORTSMANSHIP M76 .volifit an 0fJf707'fIlI1i1'j' to frrofre tht!! 'wr' IYIII .ff?I'7'F you ,wltisfrlftorily , P111 Eff, W. G. GREINER HARDWARE 844 E. BROADVVAY MZ I PHONE: NIXVARRE ONE ONE Two Two QUICK AUTO SERVICE E ..,,,,,, g ...,,,,,, KASOO MILLS INC. Dairy and Poultry Feeds .4 Toledo Industry 50 MAIN STREET CONIPLHVIENTS OF THE AMERICAN BRIDGE COMPANY Two 7f1l1I1lf'wr1 Illirly-l'f,fllf flQIQQlQ 3 ' , -, '-, 4 - f' rlll lvrif ,.f W'Ql!J'1!1,ji',l, ,ly f ' 4 ' Qif'Lp:z,..7I,,g:11g ,,,, EV , , I,fffffff,iii- i1ZC.,f'f A,,g1,:1. ','- - ,..,.', -VV'V ' ..V-- f-1, J W , f AfE-E' I E'A ff 1 'EEE'I ' f fkfv If - ..,.. ff , K., ix 'VIE , ff -7 -V 5 ,,,, Jw-,U 5 ,M ,,.. , f , , .. ..,., mmz.:..::::,,gfwea,:w14f2W,zZ - - VNSEND STREET KTH ONARY INCH N . 5CI11OI'S C'C'E.Y.S' ess trzliuing. the graduate actual hrst-class ill cvcrv Hee. Please call I'O fpupils. RSON S MICIIIGAN , DER CO. CO. 90 Detroit JXx'eIII1e - I '.f 2 X X ,,.,, M f f f ,,,,,, 5' ,E , 'W , M. W I, af , , M ....,. ...., ,,,,,,,,.., f ff ,fx J Z I F I E ..,,,.. I I . I ,.. .2 If . ...A .A-.Ew.f5zI'fffec'7, f- x ff .I 5 M fe, ...V C ,R L M f -, I I C........ ,.., fwqgvzjjf - ,,,.L.. f K v I 2 J A ' .X Z 1 Ji!--J Ya fb . fwfff: 'X ' -,J . ., 1.5- . , 1 I Rf? f' A-f!h:1r'wf'i ii1N:fW'1 .f f X 1254, ru ra.,1'R-f? Rfk fy ff 1' ni K! MW m,L....1....J..Lx vZE:smwwfAmm..1,uJ,.4zn.Mmxm..LMa.nmm...vmmf...s....Anm..E-.:.4me:.: f ,. ,,,,,, t PM . ..,,,,.. 4 5 i I 4 I 1 '-'--- A I ,.::1:1I I I ..,,. .4 5 I 2 9 5 PIIONE NAV. 1792 PLATT STREET GARAGE Storage and General R8pflil'iIIy T e Star Columbus and Erie XVELDIXG A SI2EcIAI.'rY FRANKLIN B. JONES, Pres., Ser. and Gen. Mgr. UILDERS SUPPLY CO. THE ACME COAL 8: B COAL AND BUILDING SUPPLIES l'lOLl.OVV BUILDING TILE-COMMON AND PRESS BRICK DREDOERS OF LAKE SAND AND GRAVEL Sala Representati-vu for THE VVHITACRE-CIREER FIREPROOFING COMPANY NAVARRE 240-241 OFFICE AND YARD 59 MAIN THE UNITED STATES MALLEABLE IRON COMPANY WOODVILLE STREET H EN RY FAUST Thealrical Costumer and Cfzamcterizer Specializing in Theatrical Costumes, Wigs, etc., for High Class Operettas, Operas, Plays and lndoor Pageants-for High Schools, Dramatic Societies, and Little Theatre Productions. Equipped for large choruses. Our service is complete. Always Reliable. Look for our name on VVaite High Programs. MKIl1b6I'AlIlfiflIIHZ COSfll1lIEf.V, A.v.mfif1lirn1 of U. S. and Cfmadrz 2473 FRANKLIN AVE. PHONE COLLINGVVOOD 3468 Two ll1mrlrwl flrirfy-wifm , lil 1 511:15 5 4 . 5 I . J.. I, ...... I IL... I 1 .z..,.+.s. 1 ---- 5 I .....,. ,, , ,..,.. I . 1 . . A , .,..... I 4.211112 I 3 E ........ 2 ...Wg I , ...., M, :W I gmeg 5 ,,..,,. ,flffflf 3 .... I .43 3 . I Al I I ..... ' 5 I 5 51:61:12 f , .,.,... ---'-- l 1111112 5 .... . , . , ffll 4 3 ......... I 5 Zf.Iff7 f ...... sa--A IW ..... I iiiiiii 2 M5 3 1:11112 2 ...Wg I.,....fi ...A Q .... I ,1 ....., , . , ,...., - I , ....1,.., , , ..... 1 ,z ........ l l ,,,... -Ai 7 5 .... WI 2 . ......,. , 33111131 S g ........ I ..,,,, , ..... 4? 2 I '1 1 , ,....... I 1 -'--'-f' I 2 ..,..... , Z .,..,..... I ff, , A .K f ff5w,,:1f::,, --M ,.... ,..,,f,,1.gr4,f ,V Q V ,,,,ff ff f Z' ,ffkf f f , ' f I 1 ' I ffqi , . T '+Mf'faw'ffff,7,-NWff-f- ,,,,,, ' f 3 ' , A 1 ' 'i--- -1-'fliffi f' ?Q ii .1 .,,, I ,...w-gaiM i- O , ,....,f ' L, ,,,. ,, ., f l ...... Li ' ' ' 7 W 1 ' A,,,,.,q,:--Wf.-w-:5,7,.,w-.Mf..-ff..-.,-:--w..1x:.,-Q-ffgfw-am.,.f-W - 'Q .. glue, .mf 'v- 'N 1 -,.. ........,...:f:L....iWmE ..... ,E .,... 112.11 ' N: 3, , rm, P 4 E 5 fi 2 5 W 5 5 S Q he E .., i f 1 M-S 2 i 4 M .N -VU ' Jw -Nfx... 5 , 'fQ 'f12,.5S.,ffga - PS F UG M if 5 I3 M 5' -A A31 K U- , 3 'W .J v,,1'-x., ' J if f .5 N-. f ji!-V! V' 5 A3 , VM' ,ww 35 f-5 345-' -fi ,,,., 'wf'h 751Wm,5 Z?f 1?f5x faglfm ' 'A1f 'W'x j ,N rwffx .fd f 5fR x f' fi J K' 1-f ,J W-'M5 f 'f f W .,., 1 A-:,zg:5.,.Mc4frwf ,, wgfff-N-.vw ,,,,,, ,,,. 2555555 , ' i 511155555 5 Z 5 ..-- 5111553 Q f y ..,,,, f 755512 2 5 1 Vlilillf 5 5 NSQAQALLTY 2 ,ffilffffi 5 5 --f--ff 5 5 35:51:55 M 5 ' I 5 35555553 2 ,., 2 1 5 .....,,, , - 4 . ' A 5: ' 5 f ,,...,.. E , . 3 2 52555552 5 5 f - , 5 5 5 fx, Q , CJ, , ,Q V 1, ,. ZYTIIIQS gf 5 I 3 fl - ' 'ff f Q J K7 iff-X '- 53113 5 5 'M ' 1 ' 1 2 f----- -4 i 235555551 1' -r ' E1 ' ' - 4 2 ' b---' E f if 5 111111: 554 Q 4 3 fm W4 1 M4 ' if 4 is 5 1 1 a -,Z ' ' Z VME ?' '- 2 YZ I Fifjffjf ' 5 f ' 1 1 X , iii E Z 2:52 - 5 X. -f ' 7 ' if 2 f ....,, 1 ix,-M-,--ff X - f A J K. 4 - viii Hi 'I 521572 1 . ' Q 'I V 5255555555 Y 5 5 ' Q 2 '2 2 S 4 i 5 51115555 J X 5 ' , fi A- , A 'fv'ff 5 3 T '--f--' X 1 .1 ', 5 ,f fl L' ' ---- - ,L ' 9 1 , 1, V f 1 f ' M ' 5 L L' L J f f 5 5,4 I 3:52 5 fbs-S 1 v gr I I ' I3 F ' fi , 5 , 3132 5 lil? '- ,I Q' 1 I - M 2 LJ 4 NNN vxvxfk LJ Y ' l ' If ' f y , f 1 f . 5 1 . , 4 , , L 95575555 1 553 Z 2 55:55:52 ? ' J 5 2511555515 A 4 f Xa I ' M 515555552 ..., A E 2 ' M kv 1,1-Y, x, K I K Q g Q 5 L - . I ..,.... 4 ,, 5 Q 5 ff---- b' 1 Wfffffi i W 2 5 5111111 jleawxgv f fi' 1 A 1,- -'-v 1 f 'f'- , 5 ' , ' 'J A , I ,VA 5 g Qgiiiiiizi mf , X1 Q ,Ok L 4 A if , Ak fc V, f 3 , uv 5 rj A 4 ' ' .' . A .-7 A , 5115552 ' V ' , 5 . ' 15555576 , ' I-f flilf 'L A-' X 'ff fr A if '- 4 N .' I J 5 'Q 2555555555 , ' 4 , ' ' Z' ' ' 7 5 f 4, 5 5 5 ' .4 A 5 a , ,, J . .,.. 1 ' I 1 . ' - ,f - If 2 1 1' ' 1 5?3i2sfif ' ' 5 152 iiilfiiifii ' f 5 f 1 L fri f J 'fs x 551353 5 13, 5 1 ,,.....4 'N ,. ' , - ' ff--- N-5 M iii: K J ' if V 2 Zffgjggii A gf W Q, A 3 5 ,,,,,5, , ,W ,,,,, i ,LgQwf?gl,Qu3m.1WSJL,L4s,f, AY' ,. JIL4 M llddllll A E, ' ,,,,,f37 W' ' ffif' V f f N 5 4 5 ,WM ,,... 'ifP an ,,,,,fff:115fff?ii5f ' 'Z Z . j L V I ,i.,.,v: V L I, , L 5 V 5 ,,-- Z f 2 lM ,i::l r,, ,, . 1 , . .,... , ,- w. . 1' , f , .,f' , 5 V, :W ,wwf - 1 ,z -ffff , r- ,f 1 5 ,,,,,ff ,ff V W. ,f . f .,.., '- - - ' by -- f ' f ', gg, xf .,,,,,...... 5 If ' 5,-,V-, , .5,, , 3 ,,,, ,,,.,. , .'.l'jIIZj '- 'r...:.1.51.1:111-15.5.5vx11f4ff f ' 'f ' wwf ' ' 5 1 1-5 v'-'ff---v- 5' ' TT , ..,, wird., , 1 -f f .5 Vx 5. -55 555 5 555 M65 5 i i 12 2 L.,, r 4 W.: 4 .2 1. px N 4 -1 S. 5, . M ' ' N , .,.. ,,,,...... f M --P- ..,, 4 ,?f'g N, .A Ui W, J ' wwf ,f 2 'N-XJ jan! M fy ff, h ,'h f fic.,,,w' - Af' ff 4 7'9f'g, C I vu 4 25 If .VZ ,V If ,ulv ,Ilya:Elf-f1:,,,,4ZEZ.W?,WE fig ,nw .,,. 1 N fxwlhg fx r,,MmW,,,,i,5 Fai, jf.-Aw 'jaw PM ,.,, 11W1...Zim.,...m,M,,...24' - N 1 ' ' ,N fi, gjfiiig I V r ,f X K . g-.,4 V , i - QQ b 3 W yfs, - J 1 Q - . 1 1,0 T -f' 5 v 5 - F . . 5' KVQ3'-0 . - 'K , 2 f if' Yfffff A Z! O H 5 21111112 212:12 1 ff fp f ' ,1 2 2 , J if ,, 1, J Y 4 1 1 5 QLQYQX gig I ,- ' ?ff22fF f ' ,X L74 'QIQIZZE 2 - ' ,Q ' , J 6 f .J 3133233 5,1125 ' ,.., Ag - jfffui g .2 ' we ' 1 . I , ' ' ,.....,, 4 5' ,.. f V 5, ,. .,.. L V I f d of ,fn - ' . ! , E - V P U W fu' , 5' 'f 1 5 fp K4 ' , r , Q g X 5 1, X f ......,,, V DVDUC, fx xi J I Ni pmlf? . f ali ' .0 Q - 'X ' f , - ' ' X . 21112 if - v , L f A ,::::, ' 5 'x V X X ' hxzzxf f x ' 'N 3 N x D W4 ' 3 ,,., Zi ,, W4 if, A ' ,.' 1 ' . . 5 C ..,,,, 5 N3 V K K A . f 211122212 . A fx Q' ' V , f - , y W A . 5 fd 4 A' ' 7 5 ? - M , , X A V A 1 LW4 ' 1, N, ij , f vp 5111113 it f' 'N ,fl rf 1 -I 7 3' X Q U4 l y V 'E fl i l 1 ,,,..,, M X LL T! X ,,... - .. 1 s ' VQVVVVV -----11-. f if, MW ,,,,,,,., W .,,, N M ,,,,,,, N ,,,,,.,........ N ,,,, M ,.,.,,,.,,,,,,,,,,,,,,,, , ..,..11111 , .....,,,,, ., , ..,,,,.,. ,, ,,,,.,,, , .,,.,,,,... ......, , ,,,,,,, N ,,.. -, , . friv '55,f,,,,,,,,ff 'lMl5,j4j,,f fix f , ,,,, fff-f- , ,... ffl' 3 ,ffffff 4 P . ,, ..,,, f -' L Q ff ' fff' . 1 'f - ,,ff iZ5 ,I V -Q... w:.W,,,,,i VV 1 M:a5'L: 5wg,,5Z , V I 5, bm: .A ,,,. 'y,,5:L,,,,f . J f - '- 'V -- V- -'.. ,.,., , --.... 1-5557 ' fig: ffm- gg -v1-'- www--.H...,,.,w,, ...,,,, WM. .W ,.,,,. ,,:m...T1...M, .... ' X f f ' - -- --, 0' ':czwfw,,,f,,,,w-1-W Wfmmgfmw,,.wa- V WL T an ,4 K ,A ?T'55W 1 A I AL I 25 1, Z i E 2 2 Q 3 , Z Z -s 4 9, ....,. 4 I3 g ....,,,. g f'f'f-- fi Q .... M4 Q WMA v ,.,,.,,., 1: WWW. If Rf A- , ., 5 . A w CMAQ X by ffm X7 frm.- S-L' 'Ky N him Qifwfn M .M ,-X R M 4' JYKZ M .... fc Q ,QD -.J A' , M ' .. ,..N.,., Q, 'rf M s , ,,A,W,,M, MA M V M 2,,,,,w , .. , fit '.! ,L.f x , 55 ...A, W fi' 5' jg T' 'j1'i' 4,4 , N ,QM ' . ' FSM Af 2 ' 4 UU ,mf.Cfg 2, gwmm L 1 ,J D b . f f 1 A , ,,,,,,., 1-r'V g'2 LV - - , f ,f f - , I , I L M., 45 If Qfffff' 3 AW A L! . Lf f . .W 'VTX If x , 5 L 7 V, , - ' jp 'N ' 241131, ? T ' ' -X Q ' W4 l gy lwawf 'V-N' i .W a Www my M , Y f ' ' 5:5512 Z W X7 ff f JA? X f , f 9 N E inf, Lfgflfigfff . GW W H363 W X5 Q Q S QW - MW i QQ' ' f 52 '5 , f A, , 32113 , ,fy , X -1 U ' 5:2 ' W' My JAM J-5 'f 5 ,f ll! f f J, 4 F Q , I l I X L fr?a,Q1, vvif 'f J Q f A -! f Q9 J' ' ' 5 ,LA 1- A 1 Il .f A f 1 J J D2 5- ' X , V 1 Ti D.S'- .- af' . , 1 4. ,f ll L f ,f f ,- xi 4-L, 111,11 ' fi ' j MQ,-1 KVJY 1 I -5 , ff ' --N if vi 1 ,,. x 5 ' X , f .M E g MEXLL fifpff' f ' Jim kg .Q WWqaw f L 7 J E . C ,W :W I ,- E JXLNMI mb , , ,N if MM Q .5 E lk.,-. ,. . .. ,Vw 5 ' ' , X ' 1 V I , Q WML! M' 1 I wwf 1 U L nz C Z in x if 'I 4 N s ' , ,I 43- Q! 1 :,,,,:,, SQL DCMAA. li . I A ,J Z QL b f 2: 3 M. Y ' f' ' X , - j , f 7 , , X 7 ' in , ZH a f71f1wf .Me -X .ff fffff fV-ff , ' V X ' , V' fx HQ 1'4Q'7.fE'f69J -, flfflfybf 'ZJ , Q VV' Lf ff f 1 1 ' '53-4 A ll ' df If I - 95 U4f7?w-rnfk' A 7 x , , A , X . A E 1 ,.,,, .. Q 'fu ff!! aff A J4111-Q E '2L111111g , -f A, ' ' - , ,Ana-pg' , 1 ,W iiiiiiiiii I Lak ff 1 U FWWA I-f' EL sl WV I 1 ' ' Mmm l49rfv:wwc-1 J- ff ,, 4AA A - ALC 564902 4 ,S Z. M 5:51 -, , fig., V .lvlf ,L I 'W '2 ff 2 ' ' ' ---- u ---, V,,. , ,,,,,2,VVV , ,,,,, V VZ,, VVVv'vV,v, ,,,, , , , ,,,1 V,,,, V V , ,,,, ,, ,,,,, ,,,,,,,,,,.., v,,v ...W ,L :M ,, .IAE f ' 'f': ---f 5251 f ? ' , ' '1 ri 1 Q5 4.0-1-mr' ibm 1, 2 4 4 5 ! 1 1 5 3 Z ff. 5: ,M M M4g lv-J V215 ,' E2 x ?.4',1f J , r-'5L,4.- y -A 4 5 fi Q li Y L 2 B X XI X Q vw if ii, W f xg 3 J Q XFX g , :X 5 ' f 1 Ng I Yi X fl 3,9 5 V X 5 ... X 5 ' CK N4 Ii-A xXx ' N, - 7 it Q - -Ni X x Z- I. D XX YXEN' xx: f x f- J P . , X XX X V Q Q -- , Ax f- Q , WX N, Q x ' A 2 X LH R, , ,S H I X X GQ 'Q 415' K xx M ' A X ' Q 1 W N . J YN X Q x I ,S N X Q 0 . ,N lx N Q V s A ' Q A iq s' X F' w 5 W5 L N A - Cf, MS vb 3 . 3 :fi HQ f Q na : X3 ,-.E x M X f fi? X! X AN N, pix! ix , Q V, xg if ' X-Q5 , f L w A'Q 'Q V32 X X X 4 ' YJX at x xx Q xx h is , m, if ..,A. Mt,. Y.. , M h , 5 1 ' 'L 1 Q , 255555 -f A ' ' ffiliif ' Z 7 ,. ,V 4, I -' ' ff' 5 ? --f , f - -' A 1 7 2 wt. 1 f , f if , Q Z 3 ,...,. ' ' VY ' M.. K W' L ' I H , . , AMN j ' ,X gm: Q! mjNgi5ii.:72J ' f-:ff ' ,, 1 4' 51 11219 JV 11112 N. ff rf DQ! f ' ' , , H F fz I' I fijllfi 5 E Xl V A f 21:3 f 'JD , ,Q M 4 d 1 k - ,DQ - 51,3 , , . I I 2 7 I y ,J I kv ' ,A f ' ' f - f f 1 Q , ffrrfi X ' XL X X V- fi '1-c,4,g.f,ff:v-. fi V1 f ff 1 ' . ' X 'w:,u'44f7 S ..,..... -- MMM ,f,,,. ,--f- f H , ,.-ff - - . 1 ,,,,,,, . ..... ,,,,,, ,,,,, .. M N ., . 'I fffif' ff ,f T ' jgqjj A 'w' 2 Yifasziliiur V: ,mg-I , 1 I -f1j3f f 1, f'frf x ,iff 5. X, ,gil ,fa'I:.:.ggp--., ,A 2 -1.11121 if fm ,,,,-'gffzfif' 5 , ,, 1.7.2. .ul ..Rf:::iK-A--N-mi- ..... ,:::5u-53:55:3:':::::7ii' I,.f,,71,L ? 9 1F5? i'!:Q1Li:?g1k WW,.Lw hlll ,1,fP,..', Q, gf'T,,,,ff f ,,,,,'-jfjffjlffff' fx, Q , Arii -h--, , - ---V 3 1' ,-,3 ,-.. ....,. QI ' : -- i f-'fff21:.:::1:1--- N... ,V - 113313 V 'W' '1i:gg M:-1111: V... ff --'- Lll,.1,w-A ,--f11:1f11fQy:f 4' .V ,. f VV.,,. , m.'f 75',,:.w--.Vi ,.,. ,,,W,W,,:L'1Lf..J1,,,.,,.,n. ...., Z:1x..f'f1....ffVA' -f wifi- X 5, f , - X 7' NU 9 ' 1,1 C MLN,,f:f3' Q, . . , Jf4 - ' 1, I V ,ff , 'X -f ,gg-N, -,Amx NX . , Rf .1 M 5RANsAN