Vassar College - Vassarion Yearbook (Poughkeepsie, NY)

Text from Pages 1 - 252 of the 1897 volume:

l I l r IIE- TI-EP IIII?5II,vII Bi,-Iv u ' I' .IIITQY -If I' gf.: ,LII III'I1.I 'III '.4Q'u F' .-' .' If-231 ,..j'5Z5'-I 'ISFIITI .hfII'L,'If .Ig 1 ' I i-FJ I-II.-'Q 1 .I '. If If 4 I . 7. ... IM'-III' . -4 ' F I' ' LI- IIEQIII-, , :' JIf'I..I1 'I II 'IIA .-Aff: ' ' . . ' l'. '. rr-I ' FQ ff- .Q- I I- - I' IIIIII: .- Q 2- ,If I ,E-I'-if'-. I,- - la -I' ,I HI-- ' .Ia,.I'5' I.. I.. I:IIII L3-I-II. :II ,I ?':.If- Q I .I..I'C'-I-I-Hg .- II.. 1 T Ji'-I -E:q'.I.E:-mx 9: 5'5I5 v'- 'I..r.. .. n II., ,. ' II--1.. Ig.-s Q-II--,I I .I -,I II :--I' I..I. .- I I. .FII I I -.' '.I .I I- Ivl I'-.-I -22:1-' I f. I I -1-'I. ' II I AI I I- I' I '4 I' .,. I ...I . I I .. -5'-.Tis . I Iffggf IMI 1 . .--',I. ,.g -: f ,iii lII'I7 I If. 'I..IgII.'.I'--52'-' .L I - - .-'II, IAQ' ' j-..I',. -II I.-. . -I.-I .I -., - I -n' 1 . - L. fp IIII-ITIIIII I, I 'II-I IIII . -'Q FII- 1 7 5 -I I ---11. I '..I, 1. -. :Ina-II - :.If?9'1?'f.' ,III 'II -I-II. I I fs. . fgpI'.fII'Ff' 'I liffl . I I I I lib'-I 1 I r,.'f'Y., .-Ing... I fm- , II ....' 'IIE I- - .I wa ' .I ,I I I-I .IQa'?:',I I I ,T --1. I -I.- IGI-'-I I., .fgI7II 1 . . ,I,I,II J., IIIII I ' I T . 51'-'fi-3, I-II I I . '- . . I1:,- . 35-'A ...'L' H 1: .QI I.: II .. ,- . . I -f-I-I. - . I.1'. 'I ...I 392- . . III. I, IIII--Ig... . -I -- ...I IIIEIII. .- .IIL'7I.--I -,I.L' I ' .IIII,f. ' -' 1 .I .,:..L . I- :IRfjlIF':I II I I -5.- I 'rr'-III' ,- I+'Z'- -' If E l.fI ' - I,-I' 'II ,, ,'III . gIi.Iff'5I-I- .. .f'IIQIIFQ'.' . .II I -V- lf' ,I r IIT' .. II. J. I-gL-. .- - . .- I,I1':j- I5l.'4 I 1 -I.- -..Ig--I .I I ,- , :II , I4 i- - II II - I ' ' ..I..TI-'l'.I-.L Fw. - Q - A V I V - F H -' 'I.fI..gII:- I. 'JL U.-.-I. .' IMI' J .If II-ITIIIIIIEW-In ,I ..I.IIII-In-I: IMTL .I r I.I..,. ., Ir . - - ' II 'I II' 'I .I . .I '5.IEII I 'f 'j.I.I ' I'I-I'e1I:,:f.1-I Q ' . In - , I ..-I I 5-.',.1II5'IQl I. .. r 30.1- :r'.-1- I . ' . . .. -. ...II-I-ISI. I AII.-It 1 , 2 ', I 'v..,-LJ.'Ii.-.au ' ': I- I I II -I--I ...Ir . ' ' ' 1.'1-...fiisi .Iv . IIRERIQILL I - i'r.?!T'.?3,5? I II X ..I..3In-I:-I: .. - :I .- f 'I - .'.J . ...,U H I 'gLIfI- I -II ' 'I - - I' '- 11 - II' II JL- I - TI -I J I- I Q . I Iii. 5 I is L... ' . . - if If ' ,, V 14 I I I I' J I , . ' I ' I .I leaf ' '.I I -- ' ' ' II ' I . ' I I I I u I. I, YZ- 1-65 Ga., -'EH I 1 I ' I I.I I I Y ' .I . - .I I l 1 V I III.: I I -.I ',l. I'.' . I .A ll- I I I1 II ' YV-. I I I,-K.-II UIIIT. I',I'-'fn I I :.., 5 I III I I- II. 'I-. l'I!L:,:I I J I ,4 Id II. ,,. ml I.. If --J I rII . I.II IMI.. ,Ig ,I ... . I -I I II- I ' I .5-III..III,. Board of Editors. QA! Chzzifffvzmz. NANCY VINCENT IVICCLELLAND Lifera ry Ezz'z'!nz's. MARIE REIIVIER. SARAH ELEANOR DUDLEY. MARY ELIZABETH LEVERETT. A rr Ediloffs. ANTOINETTE NEWELL. HARRIET ELIZABETH BEARD. Bzaszhess Zlfzzzzageffs. ALICE WI-IITON. ANNIE LYNDESAY VVILKINSON Secre tmjf. ADELAIDE CLAFLIN. YJ1 1 IN1I:!'1f -I l1 I,, 111, 1 1 .5 1112, Sf F 11 gvg 1119.1-': - . 1, 1 - 15i1:ILf:. .1 If..--11 '-f,- ', ...Q .. Li-I 41, .-,. if L11 111 1 1a S' :T lfl Vx' 11 , 1 . 711-21 1. .11 1 . LV V' '1' I1--1. 11,1 6.- 011: 1 11 Vx' 111 .35 ff Ji. 111'13 +42 -H JZ.. HH '1.'.l-' 1 'rf' Q. -111 F 11. f if L . I , ' 11'-,ii J' . if 14? 1511 1,.. -111 ., 1 '111 .1 su 4- 1 lil' 11,11 4111, l :'TL':' 1.-r 1, . -HH.. -1. mg .J 1315- , L 51115 - 5 11J5:.' 'Q-.1L1Ll.1.y....4ai.l uf 'FNF11 I' '11 v ' I1 1 .-'4.'g. -'l'l'i' - r 1 J X11 11 ,..1'-In 11 1 ' 1' '51 Q1 1 WW1 ,1I1 L - 'z . -U1 L H- 1 1i,,g1,.. -- 5 .1, '51-1' A3 'Q W Q I :. F P' NQ:f..:111 1 . :. - 1- 1 5..-1 11' .11 K , 1 - 1 1 1 1 1 1 , vm.. 1 . .,:. 1 - I 1 1 ' , 1 1 1 1 y I, . 14, , 1 fn. V 1. , Y ., . , ' ' 1' 9: , 1 . N 1 11, 'IWFYP , 1 - FIVE MY 1 ' 1l 1 4.k4,:?1,-1 ,. .711-4:1 LIJI. .,,, ' 4:1 A V 1 'Q if 1 . M 1., 1 3 I 11 'vi 1 1 ff 1 1 -1-'. 1F-,g-,Ifi-I ' .1 .1-1 151-iqq -.' LL ' . ' 1 ' ' - ' .-.1. 1 . 1 4'.r,,1l'-.-sf ': 4--1 11. T 4' -1, 1. 1 , I1' 1 1,5 c1,y 1 .vb I V I, U 'wx '-' ,' S I Z1 ' ,AI 'I 'VJ 71'fl7'15 :' .1 - ' ' '4 Ufy U 'V 1 1:-11111'r ' 1' -' 2 1 Ju In 7- F1 -H :. .1-1.1, . V 11 ,dv J' f I .7 .Ah 11 11 gifn-Q .. ':3 51: ' ' 'Lv 1 :V 5115 1' .' ' H M' .nw - ' N.. 15 1 X V1 xi. J Q ' Q ,. wg I: Q . kv' 'Q K x vb 1 A X f few:-v-. -X ,- .inf I 1' -' -' V-L ' av'--'FEMS' .S-, , X Q .,., . ,Q-,,, - wigzuiw . , ,gg , f4ffNa a4.1:MQ .r 1 3 Jig, ,Q fflgwzlilw , 'Q:.f...,1!Z'PT,',,., ,V :nfl LX -J' g,-91: 77 X' ..f111Q N 'av Q -51viEc'13' iW 5-755323 ,rw X 1-'1--1i:':a5c- :i g22f: Fgi'g:t,S 15 , .,5-4iw1-s1:..::5a1E:Q,:'- if ' - ., vw-V - - f1fsffw112', J w 2 W 1 Wf5:1f-11' p21'sa.1f:2s1vus5.f x : , ' '-w.Tw.ee:x:xqf - 1-' S25eS5m-vvv+u1:w1f:- -4..J z:.1.-,kvgv 1' HS -.T,a-91,-Q-Win: '1 sw. A ' ' ' 'K' Qfrf fix 1: M - 1 ,- ,1.13r'5 ::'flH in 11:2-www. - W-r. fm:awa Nl P--'fi-IME I A +.'f'-X f, ff X v- ,f9:..,x, !Mfw:.e,Jaff,4- fx 1.- 1 vnu 5 .KX f pwvp- -3,-,ff.y.v M-rrrw, H,.xf,,-A mg: A., w:bsp,.,:ff.,X i5ii3f:':f' . Q. Qs:-am? 'fzfitf' ' .' ' ' 'X Qu- X, V ,fix Zi yi Q.. eb .Zn 0 C Calendar ..... Board of Trustees ,... Officers of Government and Instruction Brownies in Meeting, The College Organizations : Classes . . . Students' Association Y. 'W. C. A. . . . Dramatic Organizations . Athletic Organizations . Literary Organizations Debating Societies Musical Organizations Eating Clubs . . Miscellaneous Organizations Campaign ..... Social Events . Grinds . Data ontents. ai 7 I3 16 22 28 58 -14 T5 -21 -24 -56 n59 60-62 63 73 S7 -72 -36 '94 95-98 90 107 III- I23 129 T47 163- 106 110 122 l28 146 162 182 Index. Q25 Answers to Correspondents . - 152 Athletic Association, Members of 76-77 Athletic Association, Ofhcers of - 74 Athletic Records . . . - P30 Basket Ball, Team of Ninety-Eight . . 51 Basket Ball, Team of Nineteen Hundred . . S5 Basket Ball, Team of Ni11ety-Nine . . 33 Basket Ball, Team of Ninety-Seven . . 79 Brownies in Meeting, The . . 22-24 Buildings, Breaking Ground for New . 131 Calendar ...... 13-I4 Campaign Posters . 124 Campaign Songs . 126-127 Chapel Echoes . 148 Choir . . . 104 Choral Club 106 Civitas . , 1 18 Class Day ..... . . . 145 College Glee Club ...,. , . . . . IOI College Settlements Association, Vassar College Chaptefof . . II3-I I4 Colmnencement Day ...,... . 146 Committees of Y. W. C. A. . 02 Committee on Self-Government 21 Contemporary Club . . , S8 Current Topics Club . . , S9 U. A. R., Vassar College Chapter of . - ug Data from 1361 to T597 - - - . 164-182 Dedication . , . l 4 Dickens Club . . A 90 Duchess County Eggs . 159 E. S. G. . . . U9 Fall of Ethics, The . 155 Floral Club . , , I 120 Fou11der's Day . , , . LM Freshman Class, Members of . 23-33 Freshman Editorial . . 27 Gobblers ..,. . HO Graduate Students . , 56 Granddaughters, Society of the t IIS Hall Play, First . , , 137 Hall Play, Fourth . I 143 Hall Play, Second ' 139 8 Hall Play, Third . . . 'H'EAAHNlKH'ETAHUHA Junior Class, Members of . Junior Editorial . . library liules . . . Mandolin and Guitar Club . hlarshah Club . . . hdenu of Suvedtes Banquet . Miscellany, Board of Editors of Nine Nimble Nibblers . . Ninety-Seven Federal Debating Society New Courses in the Curriculum . bmxlipgland Club .... Officers iof Government and Instruction Philalethean Dag f.... Philaletheis : Chapter Alpha, Members of . Chapter Beta, Members of Chapter Omega, Members of Chapter Theta, Members of . Non-Chapter Members . Philaletheis, Ofticers of . Qui Vive . . . Rabbhs . . Iiecipes . . . Senior Class, Members of Senior Editorial . . Senior Parlor Opening . Shakespeare Club . . . Sophomore Class, Members of . Sophomore Editorial . . Sophomore Party . Southern Club . . Special Courses, Students in . Spider and Fly ..,. Students' Association, Officers of Summary .,.. TI and hd. Thekla .... Trustees, Board of . . . Vassarion, Board of Editors of . Wake-Robin Club . . . Washington's Birthday . Y. XV. C. A., Officers of . Y. VV. C. A., Reception of . 141 Q2 44-47 43 162 103 122 I25 93 108 Q8 160 116 1 6-20 133 66 67 68 09 70-72 64 97 rog 161 52-55 49 135 QI 36-.LI 35 136 II7 56 158 53 56 96 105 15 3 121 142 60 130 Index of Illustrations. .25 Advertisements . . Aftermath . . , Athletic Organizations Brownies . , Campaign . Campaign Posters Class Day ...., College Organizations .... Composite Photograph of Vassarion Board Debating Societies .... Dramatic Organizations , . . Duchess County Nurseries Eating Clubs . . . E. C. S. G. Club . , Editors of Vassar Miscellany Editors of Vassarion . . Election Day . . , First Hall Play Pictures Floral Society . Fourth Hall Play Picture Freshman Editorial Freshman Rebus . Glee Club . Gobblers Grinds , Halloween . , . llellenica .... Hockey as Played by the Faculty . Holiday Sign .... Literary Organizations , Mandolin and Guitar Club Miscellaneous . . Mohonk . . . Musical Organizations . New England Club Nibblers . . Night-A Dark . . . Night XVatchman . . . Nineteen-hundred Basket-Ball Team Ninety-Eight Basket-Ball Team Nine-nine Basket-Ball Team . Ninety-Seven Basket-Ball Team N octu rn es-Two ,... President of Alpha , . President of Athletic Organization President of Beta . . President of Christian Association President of Omega . . President of Philaletheis . , IO PAGE 183 I60 73 23 I23 124 145 25 154 95 63 148 107 lIQ 93 94 128 137 1ao 143 20 27 IOO 11o 147 133 qz 153 157 57 1o2 111 132 90 116 IOS xl 157 34 So S2 78 157 66 75 67 61 68 65 President of Senior Class . President of Students' Association President of Theta . , Rabbits . . . Raymond Hall . Recitation Hall . . Recollections of Phil. . Scale of Localities Represented Second Hall Play Pictures . Senior Class , . . Senior Editorial . , Senior Parlor . Social Events . Sophomore Editorial Thekla . Thiqd Hall Play . Title Page . Valentines Day . Wake Robin Club NSouthern Club , PAGE 51 59 09 IOQ ISI ISI 157 S7 139 50 48 134 129 34 117 105 I4I I 140 121 Z?d1 -..1 Calendar. Q25 1896. College opened ......... September I8 Vocal and Violin Recital ,..... September 25 Miss I. W. Hubbell, Mr. Erwin C. Banck. Christian Association Reception ...... October 1 Ground broken for Raymond Hall . October 6 Ground broken for Recitation Hall . October I4 First trip to Mohonk ..... . October I7 Lecture by Professor Andrew Seth . . . October I9 Optimism and Pessimism. Chapter Plays . .. 1 .... October 23 First Meeting of the Contemporary Club October 30 I-lallowe'en Parties .... October 30 Election Day . . . November 2 Senior Parlor Opening November 7 Second Trip to Mohonk November 8 Sophomore Party ..... November I3 Lecture by Professor W'ilhelm Dorpfeld . . November I4 Tiryns and Mycenae. Lecture by Professor Seligniann . . . ' . November ao Democracy and liconomics. Meeting ofthe Vassar Students' Aid Society . . November 21 First Hall Play ....,. November ZI 1' Americans Abroad. Thanksgiving Recess ..... November 25-28 Concert by the Hampton Quartette November 30 Song-lecture Recital by j. C. Griggs . . December 2 Schumann's Songs. Q Philalethean Day ....... December 4 Speaker, john Kendrick Bangs. Glee Club Concert ....... December 5 Song-lecture Recitals . . -... Deciggigigjrcflii Miss Villa' Whitney White, and Miss Mary B. Dillingham. I2 Lecture by W. Lewis Fraser ....., December 18 Pencil and Graver in American Boolzs for Nearly Two Hundred Years. Second Hall Play .... . December I9 A Scrap of Paper. Christmas Music . ..., , Degember 20 Christmas Holidays . December 23-ISU. 6 1397. Organ Recital by W. C. Hammond and Wulf Fries january 8 Xlecture by Professor E. H. Barnard ..... january I5 Some Recent Photographic Revelations in Astronomy. Ice Carnival ...,...., january 16 Address by Mrs. Ballington Booth . . jgmugyy 17 Prison Work. Violin Recital by Herr Banck . . . january zo Lecture by H. W. Clzlpp . . january 22 . Hamlet. Mid-year Examinations .... january 25-29 Second Semester begins . February 1 Lecture by Professor William james . . , February 5 Psychology and Relaxation Piano Recital by Miss Whitney and Miss Chapin . February io Lecture by Mrs, William H. Blatch ..... February II Economic Position ofthe House-wife and Woman Wage-earner. Third Hall Play ..... A February 13 Caste. Valentine-'s Day Celebrated . February 13 Lecture by Talcott Williams ...... February rg 'l'he First Presidential Campaign and the Last. First Annual Meeting of Alumnae l-Iistorical Association . February zo lVashington's Birthday ....... February Z2 Song-lecture Recital by j. C. Griggs .... February 24 Lecture by Mrs. William H. Blatch ..., lfebruary 25 Employment of 'Women in the Early History ofthe Country and the Development ofthe Factory System. Lecture by F. M. Warren . ...,.. February 26 Victor l-Ingo as a Poet ofthe Household. 13 Address by Miss Mary McDowell . . A . . February 27 College Settlement Work. Lecture by J. E. Humphrey .... M-2LrCl1 5 Mushrooms. Lecture by Professor G. B. Adams ...,, March I2 The Place of Dante in General History. Concert by New York Ladies Trio Club . . . March I9 Lecture by Mrs. William H. Blatch . . . March 24 Factory Legislation. Lecture by Dr. Julius Sachs .... April 9 Greek Vases. Concert by the Dannreuther Quartette , April 23 Spring vacation .... March 26-April 7 Chapter Plays . April I7 Founder's Day . . April 30 Senior Auction . . May 29 Baccalaureate Sunday June 6 Class Day . . June 8 Commencement Day I4 june 9 Board of EDWARD LATHROP, D.D., CYRUS SWAN ,,A, AUGUSTUS L. ALLEN, AM , GEORGE TNNIS, . JOHN H DEANE, AM.. HENRY M. KING, D.D., . JOACHTM ELMENDORF, DD AUGUSTUS H. STRONG, D D. WILLAR --Y .DL.DEAN,. . . XX FREDERICK E. THOMPSON, AM ALANSON J. FOX ,.., . DUNCAN D. PARMLY, . . . JAMES M. TAYLOR, D.D.,1.L.D., ELIZABETH P. SHANNON, AE, . HELEN H. EACRUS, A M., . EDWARD JUDSON, DD., JOHN D. ROCKEEELLER, . ALBERT S. BICKMORE, A.M, Ph.D ALLEN W. EYARTS, A.M., . NATHAN E. WOOD, D.D., . SAMUEL D. CGYKENDALL, . JAMES M. BRUCE, A.M., . LEVI P. MORTON, LL.D., EDWARD ELSWORTH, A.M., FREDERICK T. GATES, DD., ELLEN H. RICHARDS, A.M., HENRY M. SANDERS, D.D., CHARLES M. PRATT, AE., HENRY Y. PELTON, AB., T rustees. . N ew York. Poughkeepsie. . Poughkeepsie. Poughkeepsie. . New York. Providence, R. I. . New York. . Rochester. Poughkeepsie. . New York. . Detroit, Mich. . New York. , Vassar College, . Fort Custer, Mont-A . Brooklyn. . New York. . New York. . New York. . New York. Boston, Mass. Rondout. . Yonkers. . Rhinecliff. . Poughkeepsie. . . New York. . jamaica Plain, Mass. . . New York. . Brooklyn. . . . . Poughkeepsie. Officers of the Board. EDWARD LATHROP, , . WILLARD L. DEAN, . BENSON VAN VLIET, . CHAIRMAN. SECRETARY AND TREASURER. . . SUPERINTENDENT. Qfficers of Government and Instruction. My Arranged, with the exception of the Ilresiclent, in eaeh division, in ortler of their appointment. .255 JAMES M. TAYLOR, D.D., LL.D., President. Professor of Ethics. HENRY VAN INGEN, Professor of Art. LE ROY C. COOLEY, Plrlb., Matthew Vassar, Ir., Professor of Physics and Chemistry. Physics. WILLIAM B. DWIGHT, A.lNI., john Guy Vassar Professor of Natural History, and Curator of the Museum. Geology and Mineralogy. ABBY LEACH, A.M., Professor of the Greek Language. LUCY MAYNARD SALMON, A.M., Professor of History. ACHSAI-I M. ELY, AB., Professor of Mathematics. MARY VV. WHITNEY, A.M., Alumnae Maria Mitchell Professor oi Astronomy, and Director of the Observatory 'KMARCELLA I. O'GRADY, S.B., Professor of Biology. - In Germany, on leave of absence. We Matth I1ERBERT ELMER.MILLS,AAL,PhDU Professor of Economies. JEAN CHAEEEMAGNE BRACQ, AB., John Guy Vassar Professor of Modern Languages. French. JOHN LEVERETT MOORE, Ph.D., ew Vassar, Jr., Professor of the Greek and Latin Languages and Literature Latin. FRANCES A. wooo, Librarian. MRS. j. RYLAND KENDRICK, Lady Principal. O'l l'lLIE HERHOLZ, Associate Professor of German. CHARLES W. MOULTON, Ph.D., Professor of Chemistry. ELIZABETH B. THELBERG, M.D., Professor of Physiology and Hygiene, and Resident Physician. FERDINAND COURTNEY FRENCH, Ph.D., Professor of Philosophy. ELMER ELLSWORTH WENTWORTH, A.M., Professor of Rhetoric, and of the English Language and Literature. GEORGE COLEMAN Gow, AE., Professor of Music. LAURA JOHNSON WYLIE, Ph.D., Associate Professor of English. 17 LYDIA ANNIE WHITNEY, Instructor in Music. IESSIE CHAPIN, Instructor in Music. ELLA MCCALEB, A.B., - Secretary of the College. SOPHIA F. RICHARDSON, A.B., Instructor in Mathematics. ELLA M. FREEMAN, A.B., Instructor in Chemistry. SOPHIE C. NEEF, Instructor in German. HARRIET ISABELLE BALLINTINE Director of the Gymnasium. MARGUERITE SWEET, Ph.D., Instructor in English. HELEN FRANCES EPLER, Instructor in French. ADELAIDE UNDERHILL, Reference Librarian, and Catalnguer. ANTOINETTE CORNWELL, A.B., Assistant to the Lady Principal. GRACE HARRIET MACURDY, A.B. Instructor in Greek. SUSAN BRALEY FRANKLIN, Ph.D. Instructor in Latin. 18 LILIAN WYCKOFF JOHNSON, AB., Instructor in History. RUTH GENTRY, Ph.D., Instructor in Mathematics. ,LELIA CHILDE DEANE, A.B., Assistant in Biology. CAROLINE ELLEN FURNESSA, A.B Assistant in the Observatory. FRANCES G. MARKHAM, A.B.. Assistant in Chemistry. LAURA A. BROWNELL, A.B.. Assistant in Biology. EVA G. MAY, Instructor in the Gymnasium. MARY ELIZABETH COOLEY, A.B., Instructor in Physics. WINIFRED BALL, AB., Instructor in Latin. ' 'LIDA SHAW KING, AM., ' Instructor in Latin and Greek. KATHARINE XVARREN, A.I3., Instructor in English. PAULINE G. WIGGIN, AM., Instructor in English. ELIZABETH E. BICKFORD, Ph.D., Instructor in Biology. 19 ALICE W. WILCOX, A.B., Assistant in the Biological Laboratory. SARAH 1. MCNARY, A.M., lnslructor in English. CORNELIA H. B. ROGERS, P Instructor in French and Italian. GRACE N. K1MBALL,M.D Assistant Physician. EDNA CARTER, AB., Assistant in the Laboratory of Physics, IDA W. HUB BELL, Instructor in Singing. ERWIN C. BANCK, Instructor in Violin Playing. CORA A. START, AM., 11.19 'a Assistant in the Department of History. 20 ,XX Committee on Self-Government. E95 CHA IRJIYA N. '97 VASSIE JAMES. '97. '9S. M.G.DUNNHKl I.E.PATTERSON. A.WWHTON. '99. G. JOHNSON. A. P. SAVPPY. I M.B.GRANGER A,KAUFFMAN. S.F.SHEPPARD 1900. A. P. BARROWS M. P. ESS. The Brownies in Meeting.i ran! f ,T-ff! ? 7 gf fQ'.. ,1-,l,..g ' t f...?.- Qiuiqk X 1' ill T -V i- ff f'i ii Z: c ,, 5 I VA ' 7222- : -.'! :- 1 :N 1 K ,a Q flseii. v --f f i :I LI ' ' ' l ' .-' 'i i : ,' 'i flffemliil ' i T sound of bell the Brownie Band M g Was prompt to leave the work on hand. Their scurrying feet the halls passed o'er And entered at an open door. There every Brownie found a seat, Arranged, as all agreed was meet, In Quaker fashion-so they sat, On this side women, men on that. The heavy doors had scarce swung to And shut the'Brownie Band from view, Ere one who plainly was the head With dignity arose and said: You are not often here, my friends, In concourse for such weighty ends, The question, he remarked, In short, To boil it down, is this, the sort Of garments that the Brownies wear Wliile riding round, now here, now there, Are suitable, we all must feel, But only when we ride the wheel. Wfithin the class-room's sacred walls a No province of this garment falls. Can shortened skirts high honor gain, Or knickerbockers fame attain For those who to the world must stand As educationls strong right hand ? Most list'ners had not time to wink, Much less had they the time to think 22 Before a Brownies voice was heard Intense in every rapid word. Her English was so marked with speed It left one out of breath indeed. The Brownie scribe was in despair, She rose in anguish from her chair. I would request, in tones discreet She said, the speaker to repeat, Then vainly tried with all her might, The sentiments expressed to write. The speaker did not like the dress Wliich she advised them to suppress. And then they all began to hear A buzzing which they thought was queei A battery was in full play, Set going by her eager way. And none of them appeared to know How they should stop electric How. Now muttered one beneath his breath, This droning talk will be my death ! So versed in musical disaster, Perhaps- his organs I 'can master. Witli something 'twixt a skipp and hop He then essayed to turn the stop Upon this currenticeaseless, flowing, Wliich all unwitting was set going. This end in right good style he gained, For in all arts he'd been well trained. The Brownies, too polite indeed To give his victory due meed, Yet looked on him with beaming eye, While he, becoming strangely shy, Subsidecl with a bow quite grand, Forgetful of the theme in hand. This filled the concourse with delight, Though it upset decorum quite. At first the leader joined in too, And then said he, This will not do! I now apply for information To one of classic reputation. For answer came an awful snore. 'Twas sad-the leader'd looked for more! The Brownie wakened with a lurch, And in his pockets 'gan to search. 'Tfborrfqind it all l It cannot be I've lost my written speech l quoth he. But when the paper he'd discovered, I-Iis wonted calm was all recovered. From what he said, 'twas plain to view To wheel suits he'd be always true. Next spoke in accents low and sweet, A Brownie very hard to beat. A lady-principal 'tis said In all the Brownie conclaves dread. My friends, in much I deem you right, But see it in another light. This matter of our daily dress Our pupils surely must impress. Then let us try if we can find Effect of it upon the mind. Perhaps our friends who've not been heard Upon this point will add a word P I' Then those who never spoke in meeting Were greatly flattered by such greeting. Their little note-books they consult And promptly call out this resultg bg f - fr ii If-'fill a a X I-f l ' I I I ! ills I ' Il l , The wheel girls best bisect a circle ! Their efforts know no tire! They mount with ease historic cycles! 'And English style acquire l Thcy're falling off in Greek and Latin ! Deficient quite in French ! r'And in their German are not able To tell a Uliaxul from 9J6e1iftb. .Then rose .the leader, always seen VVith dignified and pompous mien. To speakand end this altercation, I feel my ground of obligation. Effect discussed by you must be As well as cause. I hope you see, All moral taste,s perverted quite By this division bi-partite. i Adoption of a garb so scant 23 Is sure to end QI quote from Kantj ,5U2itungeIjeue1' Qieifonniienljeit. I And this, of course, would not be rightf, Then spoke another, known to be A master of psychology: Thy thought has crossed, I must confess, The threshold of my consciousness, That every faculty should be Developed to full symmetry. The Biologicview- of this We all regret that we must missfl The chairman spoke- 'Tis sad, indeed, And all this land must feel the need Of this one absent, pointing there, Where stands this year the empty chair. The Belle of Brownie Band spoke now, A woman Wise, with noble brow And versed in abstruse Grecian lore. Such dress xsthetic is, nay more, lt makes the maidens fair to view, And fascinating, lovely, too, And he'll agree, who once reflects, Attractive to the sterner sex. An artist then of great repute, Tried these strong statements to refute. Sweet, smiling faces, you'll agree, Are always beautiful to see, The maidens need no other grace Except, I will admit, a trace Of Grecian drapery, soft and flowing, Artistic sense and culture showing. A foreign accent next was'heard, I wish to add a single word, To devil up the youthful mind Must be the aim of all mankind. VVhy speak of this obnoxious scheme ? More proht's found in wiser theme. 'Tis well, thus spoke a well-known friend, The bodies, tired and worn, to mend. And exercise is always best For those by mental work oppressed. Let each one glorious health acquire And this will nobler thought inspire. Then up rose one who stroked his head And pondered deep before he said, My friends, your talk is all remote. He paused, gazed upward, seized his throat, t'The theme is not our pupils' dress, Our query is of us, no less l A solemn voice gave its amen, .,?Icf1, atb, febr gui, muh nun mu-us brim? The learned chemist answered soft, Experiments are useful oft. The Brownies and their wheel suits take, From these a combination make, Then observations you may draw, And next deduce a general law. A Brownie rose who digs for stone, Some specimens we all have known, And has their -honor petrified, Because this costume they have tried P Oh pshawl quotlr one most mathematic, You all are growing too erratic. Just wear the suits. You'll mark my lines Wlieii you're attacked among the pines. But now the supper bell did sound As spoke the leader, looking round, Wlieii will you ever understand That newspapers still flood this land P Wliat pictured stories will appear lf we allow this foolish gear ! Think once how public scorn will rise, How much involved within this lies l I-le spoke, and struck his desk with force, Think now. Free will may bring remorse! The vote !4Shall we forbid this dress ? H A chorus answered him, Yes, yes l Great manuscripts in one huge pile Delayed the meeting yet a while. Petitions these from every class! Shall we refuse them all, E71 fzzasse? H The question passed without dissent, And all from force of precedent. So now at last the business through, Each Brownie bade his friends adieu, And where this little folk had been, Soon reigned a quietness serene. 24 1 23. T I Q, ' 1-0' A .W w. lm' f '- !- x A -x XX QM Q vgcimiz caxiiwms Qx Q55 QS gimkmii QSSQQomcQKmQmm Sf' X, f 1 , I-'x1 ',l,N RCK .Q Aw: wg EQ NC, P vf'Mf T ef QV Ulf Ml' A V J Q I, I N xl Q' Ill! ji JIM A 15 LM WS V ffl, Ky 363 ii, ggi? f ,aa f f :M f il fi 2 Q l QW M5235 V' H 3 1 f xvggw 2 iffy? W ' V' cfm W rig? Aww ww X4 5251 U71 W I Awe ' W 'X S1 gg? Y 7 XHWQN I aff im? W M' XG? I 3 N Wj X w E I Xk X X Ir! 2,3-5 M in I fl 'l x 5 Y ! 36? 3 N I x x 1 f Qu I 1? V, la-J,-A If . Y I Fug FHYX xx V --4 219 X5 v id ws ' X -ff 44 S inf Q-ll H.Rffhggari's:. ll WQQAC Dxfmmmxw, Qxfgcmmzccfmms ? QXXXXQKQ Qrgmxi mxmmms Esgixemfmxfbg xfgmmxzdiiwms D XE X Q cmikmxe SQCLSQAMQS MSXM QYBQQWQNZ, Qfwms E QQM25 QMAMS m5 QQNM QMXQQ MS T X - ,.L 4,1 ,,..f.-...-..n.!..,.u,. E .: E 'Ll7 A - . 111.0 -sri '. -T-:gf - A -if is 2 C91-gk ' ,-I l f. , ' 42' VV iiifiifm f 1 v ., ,f - A ' my f ,L 1513 , 33 f L 4. 2, I' ii! -5? , ' 1 f nlql- 551, V 'I , .. - ff , 3 4 is , - ,Q Sl? xgvdfiq Wfn M PFFKIWHMFKM U .. img E+ -Q 'x 37 7 'W I 1 i ll W cu' If DW. 'ar PIQ H H,-r 1 .ga N m, ,i L? 15 ' r :re 'f-sv V ' . J, ' N-px 'feel ' , ,,, ' Q 4 -1 - 5 XS S? P 1 1 ' 9' f 1 1 l 1 X 7 : 1 ff 3 , 1 lx Hx 3 7 NMIWIIIIII fn faq !!l,,ff5,x M . 1: K N . 'R N 'N I ,US 1 K ZR N . f Y ,f K fjflmt mx V. -' 1 NU 'I '1 ,'- xl w y X M 1, 4 'Q L-. WAX 1 fx X A V 1 f N 5- Q ..,. N,, , . q mx Mg fm MMM I I J H I ,IQ 39215524 '. Freshman Class. ROSE AND GRA If. DARK RED CARNATION. -QC Class Qfficers. LINDA ORIJHA PERRIN, B'fsz'dmz', ALICE PRENTICE BARROWS Wm-Bzavidezzf, ADLEM, FLORENCE WI-IITE, ANDREWS, GRACE, . ANGELL, IOSEIII-IINE MEDBU ARMSTRONG, ESTELLI2 R ICE, AX'1'ELI., CLARA ELIZA, BAKER, NIARTHA LAIJI-IAM, BARNARD, ANNA ESTELLE, BARNARII, VIoI.E'I', . BARROWS, ALICE PRENTICE, 7 JESSICA MAIQIE BECKER. Sm-efmjf, FLORA GIZACE DEAN, ZP'msw'er. Class Members. R Y, 28 Red Bank, N. ,I Yonkers Leavenworth, Kan Detroit, Mich Pittsburg, Pa Saginaw, Mich Rochester Saginaw, Mich Lowell, Mass BAR'Fl,IZ'l I', LOUISE STEVENS, B ATES, BERTHA, . . BAXTER, li.-XTHARINE CRISSEV BEADLE, PHEIIE PIARRIET, BECIQER, JESSICA lX'lARIE, . I I BECRWITH, FLORENCE IVIERNVIN, BELKNAP, ALICE SILLIMAN, B ENEDICT, NlARION, . BIRDSALL, AI3NEs, BOILDEN, ADA ERFORD, BORDEN, AsENA'I'H, BOURNE, MIARY JOY, BOYD, LEILA, . BRADLEY, EMMA, BRAUN, BTABEL, . BRENT, MARIE LOUISE, . BROWNELL, FLORENCE NIINERV BUCKLEY, LAURA. . . BIIDINCTON, ANNA, BUDINGTON, MARGARET, BURNHARI, ALICE MIRIANI, BYINGTON, GRACE RICHMOND, CAHN, ANNA LOUISE, CALEN, CARITA NIAUDE, . CAMPBELL, FLORENCE DICKEY, CANDLER, GERTRUDE NlARY, CHAPIN. RUTH WIALLALIEU, . CHRISTOPHER, LELIA, COMSTOCK, NlARIE BELLE, . A! Co RBIN, EI,IzARE1'H BREXVSTER, CORCILUIS, IRENL1, . CRAIER, ANNIE MARIA, DAILEY, EVA BOTTORFF, DAVIS, ALICE ESTEP, DAY, PAULINE BOYDEN, DEAN, FLORA GRACE, DEGRAEE, BESSIE LOUISE, DENTON, JULIA, . Providence, R. I St. 'Louis Mo Plainfield, N. I Rochester Keokuk, Iowa Cazenovia Louisville, Ky Brooklyn Glens Falls. Red Bank, N. . Fall River, Mass. . New York. Nleinphis, Tenn. Hinsdale, Ill. Chicago, Ill. l,iOlLlI'l1bUS, O. . Hamilton. Parkersburg, W. Va. . . Kingston . Kingston. Hamilton. Norwalk, Ct. New York. Boonville. Franklin, Pa. . Detroit, Mich. Southbridge, Mass. Kansas City, Mo. Alpena, Mich. . Oxford. . Jamestown. Freehold, N. . Peoria, Ill. Glenshaw, Pa. Springfield, Mass. 'San Fraincisco, Cal. Detroit, Mich. New H arnpton. DENVEY, RUSHA A. HUNTINGTON, DORRANCE, FRANCES, . DOWLINO, FLORENCE CI-IISHOLM, DUROIS, EOLINE BEATRICE CHURC IJUNNING,lVlARGARli'1', . EISEA-IAN, ALICE LOUISE, . . ELLSXVORTH, CAROLINE PARSONS, ESS, MARION PAULINE, . ETTIENSON, HARRIET ESTHRR, FAIRI-IEAD, LIZBIfZ'l'H DAKI5, . FLEXVNVELLIN, HARIQIET ELIZABET FORD, FLORENCE MAY, . . FOWLER, SADIE LESLIE, FRENCH, FLORENCE HOSAIER, FROTIIINGHANI, MARY, GALLAOHER, HELEN DAVIS, GAUS, DAISY, . . GOODIENOW, XIALIERIA STONE, GRAHAM, EI.IzAIsE'I'I-I, . . II , I-I , GREEN I-IA LGE, H ARRIET N ESMITI-I, GREFI5, RU'I'H XVINFREDA, . HARNION, Rl,-XRTl'I.-X GROSVENOR, HARRAH, FLORENCE, . I-IAVENS, ALICE LENA, HELIIER, lVlAUDE LOUISE, HENSIIJXXXV, HELEN BTANVILLE, l'III.I., AUOIISTA, I-IINCHMAN, BARKER, HIRSCPI, TELZA BABETTA, HORNE, CAROLINE RUTH, . I-IORST, IVIABEL LOUISE, I-IUMPSTONE, l'lELEN, I'IUNTER, EDITH LOUISE, JOHN, EMILY, . . JOHNSON, EMMA LAWRENCE, JOI-INSON, NIAY VIVIAN, JOHNSON, SUSAN FORNEY, . JOHNSTON, HELEN BURROWES, St. Albans, Vt. Dorranceton, Pa . Toledo, O Providence, R. I . New York . St. Louis, MO Iowa Falls, Iowa , Kansas City, Mo Leavenworth, Kan - Covington, Ky . XVatervliet . Oneonta Newark, N. J . Albany . Detroit, Mich . Brooklyn Brooklyn . Boston, Mass Memphis, Tenn . Lowell, Mass Des Moines, Iowa . Hamilton . Philadelphia, Pa Denver, Col. Alder Creek. Des Moines, Iowa. Montgomery. Philadelphia, Pa Duluth, Minn, . Albany. Newark, N. J. . Brooklyn. . Norwalk, Ct Meyersclale, Pa. Asbury Park, N. Asheville, N. C. Asheville, N. C . Chicago, Ill. JONES, FRANCES MAY, JUSTICE, ANNA. . . KAUFEMAN, DIARY CATI-IERINE, K LEBERG, NIAY LOUISE, . LENT, SUSIE BARBARA, LEROY, ALMA MILDRED, LLOYD, h l:XRY ELIZABETH, LoNc:, IiARRIl5T BICRMORE, LORD, ELEANOR ANNA, L,Q-XlIi'lT'l', MA RY, NICMAIION, SUSAN, . BIAROT, PIELEN GWENDOLIN, MARSALIS, LAILA, . . hlERRIT'1', EDITH SOMERVILLE, hdITCHELL, MIRIAII VIDA, . NIORIARTY, LAURA ANGELA, MOSSMAN, BTARIAN XMATROUS, MUCKENHOUPT, LEOCADIA NIATILDA, NEI.SON, ANNIE ELISE, . OBERLY, EUNICE ROCKVVOOD, O'CoNNELL, FANCHON EILEEN, ONDERDONI4, NIAISEL HELEN, PACKER, EDITI-I CROZIER, . PATTERSGN, ROEEIE BELLE, PAUL, CLARA LOUISE, PAYNE, IENNIE MACKAY PERRIN, LINDA ORIIIAIA, PERRY, MARIE TI-IOMPSON, PIERCE, Som-IIA GLEASON, . PIERCE, THERESA VINTON, PLUA-IE, NIYRA VVINIFRED, l,OI'I'1,liTON, ELIZABETH, PRESTON. MARIE MAPLES, . QUIGLEX', CORA CECILIA, RAITT, ELSIE MAY, . , RANDoI.1'H, BLANCHE1 FRANCIA, RAY, MAIIDE LoUISE, . . RAYMOND, GRACE BERTHA, . . Catskill . Philadelphia, Pa Des Moines, Iowa. Brooklyn, . . Highland. Manchester, Iowa . Pittsburg, Pa '1'enant'ls Harbor, Me. . Rosemount, Pa Little Silver, N, I . Bradford, Pa Dayton. O . New York Newark, N. I Denver, Col . . Albany . New Haven, Ct . Poughkeepsie . New York Concord, N. H Fort Dodge, Iowa . Poughkeepsie ' Trenton, N. J' Franklin, Ky . Joplin, Mo Flint, Mich . Rochester . Rochford, Ill San Francisco, Cal lndianopolis, lnd Detroit, Mich Cleveland, O . . Delhi Harrisburgh, Pa . Newburgh . Chicago, Ill Franklin, Mass Charles City, Iowa REYNOLDS, IONE ARMENIA, RICI-IARDSON, RUTI-I RAYMOND, RICHARDSON, WINIFRED MORSE, RITTER, LAURA, . . 1-ROBINSON, BTARY CATIIARINE. ROCIQEFELLER, -LORINDA, ROSE, SALLY, . . RO'l'l'I, LENA GERTRIIDE, RUSSELL, EOITII LILLIAN. RUSSELL, ELLA MAY, . SANISON, ELIEANOR KEN DRICK, SAUVAGE, VILIIA, . . SAVILLE, ALICE BARTON, , SCARRORoI,Ir1H, JULIA MACRAE, SCI-IMIIIT, lX'lAl-SEI. PEARSON, . SEc:E1sAR'I'IfI, HENRIETTA WILHELAIINA, SEYMOUR, IIIA J., . . . SIAIOUSE, VANCE, SIIIENIIERC, ELSIE, SRIITII, ALICE LOUISE, SMITII, EMMA XVALDU, SMITH, NlARY DELIA. SMITH, NI':I.I,A BUEL, SPENCER, GRACE IONE, . SI'RA'l ll, MARY MARGARI-:'I', STEl'5l3INS, ELVIE GRISIVOLII, . STEVENS, CAROLINE HZARRIS, STEIYART, JIQSSIE AITREN, SUFFERN, ELSIE DERIEMER. TALLNIADGE, Al-RRY LOUISE, TARIIOX, JULIA BRAINERD, TAYLOR, ELIZAIIETII BERDAN, TEMPLE, MARY ELIZABETH, T1-IOIIAS, OLIVE WAIT, THOAIRSON, MAUDE LILLIAN, TIIORNE, ANNA DEAN, ToUR'I'ELLO'I', IDA ALICE. TROWRRIIICE, ISABEL. Highland. . Brooklyn Brooklyn Rochester . Unadilla . Germantown Leavenworth, Kan . Allentown, Pa . Rochester W New Haven, Ct Portland, Me . Newark, Denver, Col . Austin, Texas Indianapolis, Incl . . Dunkirk . Granville, Mass Henderson, Ky . New York . New York Newton Centre, Mass . . York, Pa XVaterbury, Ct . Utica . Ogclensburg Little Falls . Rochester Fall River, Mass Plainlield, N. I Evanston, Ili . . Batavia South Orange, N. I. . . Seneca, , Belleville, Ill. Fall River, Mass . Utica. . Fall River, Mass. . Constantinople, Turkey TUTTLE, GERTRUDE, VAILE, GERTRUDE, . VAUGIIAN. REBECCA T., WADswoR'rH, LILLIAR, XVAGAR, EEFIE SERENA, XVALLACI-I, ADELAIIIE NETTIE XWALLER, NIABEL, . . WARE, LOUISE, . . . XIVARNER, ELEANIJR SKINNER, VVARNER, EMMA ALDRICH, f EEKE, JULIA MANLEY, VVEST, FRANCES ELIZA, XNHEELER, SARAH ELIZA, VV!-IITE, GRACE IRENE, W1-IITLOCR, VANNIETA, . VVIGI-l'1'MAN, SUSAN XVILLIAMS VVILKINS, CI-IRISTEL WIIIPPLE, XVILLIAMS, EIIIZARETI-I CARR, XVILLIAMS, 'HARRIET EMILY, , . Hornellsville Denver, Col Atlanta, Ga . Albany Lakewood, O New Yclrk Indiana, Pa . Auburn Boston, Mass Centralia, Ill . New York Des Moines, Iowa . Little Falls Boston, Mass Matawan, N. Hartford, Ct . Boston, Mass Bellows Falls, Vt Providence, R. I i Sophomore Editorial. tai 'Twas sophish, and the windsored girls Removed and campused in the main, All fudgy were the Saturdays, And all the rest was brain. Beware the foodelaws, my girl! The Germans bold, the maplets gay! Beware the cooling chemoulton, And shun the Sophomore play! Alling engaged upon her door, She ground her digrous task with might, And when the elangrous Tenclock passed She cut him into night. She met the cooling ehemoulton In hydro-gravic den, She armed her with senorial arms And labbed to conquest then. A, B! C, D! For now we see A primer for young minds, Who in the vocaled dining room Are fed on sumptuous grinds. And hast thou had a German, too? Then you may dance, my maidens fine ! Oh, rosend gray! Hooray, hooray! Hilca hoorah, ninety nine! 'Twas sophishg, and the windsored girls Removed and campused in the main, All fudgy were the Saturdays, And all the rest was brain. 35 I Vlxssu I 'rin pfhkov-ra bpncrru Sophomore Class. RUSH .-IND GRA V. BRIDESMJXID Rosa. Q23 Class Qlficers. -I um N I-I A M 1 LTON, Presifimf. PHOEBE K. TRUFSDALE, If?fe-Hwsiffmf. GERTRUDE HEYWOOD, Serrefarv. MARGARET MURRAV, 73'm.mrer. ALICE R. TAGGART, Poef. Class Members. A1:1m'1 1', Bxcfxikrcrs VAIL. Brooklyn AIf:w'v1'T, Clxkullfz GARDNILR, Cleveland, O 30 BAKER, NELLIE ROBINSON, BA'1'cI-IELOR, ROSA NIARY, . BIEA'1 I'Y, Luci' TUIIIIER, BELQHER, -TANE, . , BELCIIER, li,-XT1-IARINE FISHER BIDLEMAN, NELLIE RUTH, BI.OMEN'rI-I.AI., l'IELEN, . BOXVMAN, EIIA C., BOYD, BIARY, BREED, PERSIS BIARY, . BRINCRERHOEE, MARY LOUISE, BROXYN, MAROU SOIPHIA, BROXVN, hlABEL WEIss'I'ER, BURNI5'l l'E, JANE ALICE, BURR, Nl.-XIQ-l1JRl1i, BURNVBLL, E'I'I-IEL IRENE, . BURXYRLL, ELIZABE'I'l'I LOUISE, BUSEY, NlARlli'lf'l'A RLI'I'H, CHAMEERLIN, LAURA ALLENE, CHANDLER, UNA El.IZABE'1'H, CHASE, l'IELEN VAN CHOATE, AUGUSTA , CLARKE, ALICE, . COLBURN, HELISN ELIZABETH, COLES, ALICE BELDEN, COOK, lVlYRA GEORGA, CRONVELL, ALICE BRUEN, DAVIS, HELEN LEE, t DAY, ANNE lVlARjORIE, DE FREES, NIARY LUCY, . DEI LAND, MINERVA LEWIS. . Bangor, Me New York Columbus, O New York Newark, N. Columbus, O. Chicago, Ill. Philadelphia, Pa. Memphis, Tenn Louisville, Ky . Mount Vernon . Boston, Mass Knoxville, Tenn . . . Clyde. VVilliarnstown, Blass. New Brunswick, N. Winsted, Ct. Urbana, Ill. Geneva, O. Gloucester, Mass. Chicago, Ill . Atlanta, Ga . Cleveland, O. Newton Center, Mass . . Kingston. Minneapolis, Minn. Springfield, O. Moultonboro, N. H Providence, R. I. Goshen, Ind Fairport DE LANY, EIIEANOR ANN, DILATUSI-I, CARRIE MAUD, DRANsIfIEI,n, JANE, . DUnI,Ev, CARoI,vN AUGUSTA, Elxsrwoon, lVlARY EDNA, EIJSON, LQRAINE, ELTING, EVARENE, ETTENSON, l,,ll.,l.IAN, EVANS, NIARY RULAND, FAXON, HARRIET FLAGG, FISI-I, AI,IcE PARSONS, FI'rzRox', AIEXANDRIA SIQENE, Fos'rIaR, lS.'Xl2El,l.A GRAI-IAM, FowI.IcR, CI,ARIssA LOUISE, FRY, lVlAliP1l. MII.nREn, GARRIc'I'T, EMMA Lou, . . GA'l'HRll2II'll, lVlARGARE'l' MAUD, GII,IIIeRsI,IcIayE, l,II,I,IAN, GRANT, SARAI-I GICORGIANA GREER, FIMRIINQIQ, I'i,Xl,LARAN, M ARV, HANIRIIRGIRR, S-'I'EI,I,A, l'l:XMll,'l'0N, JEAN, . liARDING, I'lANNAIfI VIENNA, HARRIIIAN, lVllNNllE FRANCIS, l'IAR'l', LoUIsE SANDERSON, . HASSl.ER, CLAIRE BRACIC, PIICARD, Cl'ZR'l'RUl'JlE Boo'I'II, . H RN RY, SARAH M AR'I'I-IA, Hilxvwoon, CARoI,vN GI-:R'I'RUnE, l'lll,l,, HIIITI-I, . . , Chicago, Ill Robbinsville, N. I . Rochester Concord, N. H . Albany XVashington, D. C . . Utica Leavenworth, Kan . Rome. Stow, Mass XVaveI'ly . . Brooklyn New Haven, Ct Olean Rochester, Pa Atlanta, Ga Louisville, Ky Denver, Col St. Paul, Minn Chicago, lll Toledo, O Allegheny, Pa. Oswego . Gaines Snnbornville, N. H. . . Albion Newton Center, Mass Pittsburgh, Pa. Fall River, Mass. Holyoke, Mass. . Medina. LIOSMER, NIARY LOUISE, Hov, I-I 11:1,IzN KA'1'HAR1NiQ, Hovr, JEAN Boucsi-ITON, H URLB Ur, M RRY Ev1s1.,1N1Q, JACOHUS, Einxm Lonisls, Jixmics, JANE E1.1s,xNoR, Jnifmicv, LUc1Nnix Bum, fSJ'ENR1Ns, ANN1ic I51.1zAR1s'1',1-r, X JENKINS, Lumix, . JOHNSON, CLAR15 LOUISE, JOHNSON, GRACE, JONES, ANN11s CALVERT, . KALJTSKY, NIINNIIE L11,i,1ixN, LEHLIMCH, ANNA, Loma, SARA, . . MICCAFFREY, CORA AGNES, MCLEOD, LEILA DURANT, MAR'r1N, BLANCI-IE, . iVIATHENVSON, MLNNU5 DEANE, BIEARS, RU'I'H BARTLILTT, MEIQNVIN, ADEL13 HEYWORTH, Mnsicic, IRENE, . BQILLER, Susus GERTRUDIQ, NIORRILL, GRACE, . RIOSER, Rnc,:1NA VIRG1N1A, MURRAY, M,xRGfxR1z'r, , NESSENSON, ELSA, NICOLS, ELSIE, . , PAGE, ARRIA I-IORTENSE, PATTERSON, NIABEL LEVVIS, PERCY, EDNAH, . Oswego . Albany Canandaigua . New York. Springfield, Mass . . Albany Littleton Common, Mass . . Evanston, Ill Norristown, Pa Cleveland, O Chicago, Ill Vicksburg, Miss Indianapolis, Ind Newark, N. J Ticonderoga Oswego Brooklyn Little Rock, Ark . . Avoczi XVilliamstown, Mass New Haven, Ct Little Falls Sutnelcl, Ct Concord, N. H New York Kansas City, BIO St. Paul, Minn St. Paul, Minn Lowell, Mass Brooklyn . Rochester PHILLIPS, JULIA TRACY, RAY, ELEANOR IQNAPP, IQAY, MABIQI., REED, Rowiaxfi, RIcIIA1aDsoN, BEIITIIA, Roms, SARAI-I Fox, . Rolsmxs, GIIACIQ I-IANNAH, Rom-:I1'I's, RosAmoND, . Russian., EDITH SU'I'IIILI1LANII SCoIfIIzI,n, l'IARRIIiT BATES, SMITI-I, N.A'I'I'IAI,IIc, SAIITII, SIIsAN EI,I,If:N, . SI1AUI,nINu, LILILA C1,1f:AIENT, SPRAGUI5, AN'I'oINIf:'I I'E BURTON, SI'RAoI'I2, FI.o1II1:NoI4: EMILY, S'I'ooKHoI,AI, l'lP1l.I'1N WARD, S'I'owI2I.I., RIAKY Es'IA', TAGGART, ALICE Romxsow, THOMPSON, Hrzucx DI'xIsAR, TOAIPKINS, Blassnz AIARIE, I TozI2:I:, ALTA MAY, TI:EMIso1a, BnII1'HA ALICIA, . TI:LrIssnALE, PI-IoIsIaI: KIIIIQPATIUCIQ, TURNER, H4XliliIli'1 I' V ELMA, . TU'l l'I.li, ANNA S11IzI,IzY, UI'IIIzokArI', RAQIIIQL, . VANnIsRsI,Icn:, ISAIIEI. LI'l l'I.E, X7AN INwI1:oI41N, ANNA, VAN SYCIQEL, JEAN, . WARE, Amar HvN'rINo'I'oN, WI-IIQEIJQR, Rl I'l-I, . . Brooklyn Unionville, Mass Franklin, Mass Sacramento, Cal . Brooklyn Independence, Kan St. Paul, Minn e . Brooklyn New Haven, Ct Canandaigua Newburgh York, Pa New York . Toledo, O Toledo, O Poughkeepsie . Ithaca . Newport, R. I Colorado Springs, Col . Poughkeepsie No. Bennington, Vt Freeport, Ill Youngstown, 0 . Camden, N, J Cliarlotlesville, Va McGregor, Iowa Germantown, Pa Port Jervis Flemington, N. Topeka, Kan XVest Pittston, Pa - 'EL-, - my JW. QL- ILP. ' 'N V' , wh V. , Fw ,nj-V' ' ' In .-'.',- 1.1 rf, f gm ' wh ii rl , '. 45 I, I .ig 1 quit' ,' Q- ,.. W ,.n, ia -.P ,ialiiv , 31,5 X 1,- LHR 7 -V, w tl: fl' , -j,,h bi wt .-3-Y, 3-,J 4! L - . U 1 -if r'v.1,l' L+, - . n ww' TJ- ' ji I I fl-Q:-if-.-.4 in .. ..-I 'I f j r l. W 1 Keg ix unior Editorial. tai VVitl1in our halls a genus rare once made its habitation. At First appearance, 'twas unformed, a mere agglomeration But, being soon subjected to a careful cultivation, It showed the usual consequence of all dornestication. Each specie, then, displayed its ownpeculiar variationsg Some showing tendencies for growth, some for deterioration Until at last, as natural, there came a separation- The Survival of the Fittest here had found substantiation. 43 7 l .98 wlA5sA R , ' :rdf-or ffurcyay vang unior Class. H055 ,1 ,VD GAG! V. PINK C,ixRNA'1'IoN. W-5 Class Officers. PHEBE ANNE'1'TI?, HAI'FIELD, B'esi1Zmz'. HELEN IVES I-IAIGHT, Vife-H-e:z'fz'mf. ELLA VIRGINIA JONES, Secrctafju MAV BRACE GRANGER, 27-easufer. AMY WENTWORTH, Pan. Class Members. Ac:K1aRLEv, MAR Y BELLE, Poughkeepsie ADAMS, ISABEL, . . . Chicago, Ill BAGG, NIARION CHAPIN, West Springfield, Mass BALLANCE, I-Lxluzlm' NlCX lNS. . . Peoria, Ill BEAN, NAN11cxc1f1'1'H, , St. joseph, Mich BELKNAP, ELEANQR, Louisville, Ky 44 BENXYAY, M.-xmai. Risen, , BL.xNeH.xRrw, ll'lABEI..LE Amm, BLIINIQ liA'l'l-TARINE, . Boiamzx, FANNY, BRINK, LOUISE, Bnoith, E1.1zAi:m'1-1, . . , C1fI.x1tBERt,,x1N, l.ot'1sI-1 A1u1s'1'RONG, Ctnxiui, ANNA XVI-IITMJXN, . ZlQCLBli, H Enix ,AlJliI,P1, .X CRos1.1ax', BliIi'liI'l.X, . CUR'1'1ss, M.-xizx' lfI,IZ.XlSli'l'lI, DAVIS, l'llCl,lQX Ci1':R'i'i:t'1m1a, DI'1.XCl'l, h'lARY AMA, . IDicl,.-mv, M.-mx' El.IZ.Xllli'l'I'l', Dwirs1fI'1', E1.iz.fx1s14:'1'i-r ID1cxN1soN, Eimy, FI,oR,t E1.l.icx, . E1'1Dx','Ltrc1us'r1A GLoY121a, Fiaixuis, hl.-XISICI. RAY, Fosriaia, ANNA FRA-xxcias, P'REmr,xx, Nic1.r,uc DICE'l llli, GARDNER, jt'1.i,x Gia.-xcic, GARVIN, Gkixeic Mini-xr., Gi1s1soNs, AI,ICl:1 Nicwxmx, Gnanoxs, Rum' Sl'1X'BIOlFR, GRANGJQR, MM' Bnfxeie, . GREENXYOOD, l'Ilil,liN St-iucsces, GUY, ALICE BAKER, . . l'IAlGHT, lolELEN Ives, HART, FANNY, . . HfX'l'f'IEI,D, P1-ram: ANm5'r'1'1z, fl.-XVIIAND, Gimeia Trauma, I-I1cM1f1AiI1,1., LUCY B1a1.I.15, . HIQQUmil-sotfr:t:,' H ismcx h'lAUDE, I'Ic'm'.xiu,m, jmssuc BIil.l,, . Howie, Enxx l,o1m1-:Ai.x, JAQUES, EMILY H U1:1sA1a1z, jlcifl-'1'1iasoN, lDl,JRA EVL:I.x'N, joxizs, lflI.l.A Yiiusixm, Albany. Benson, Vt . Wfest Troy. Fall River, Mass . Kingston. . . Buffalo. Chattanooga, Tenn. . . Binghamton. New Hamburg. Norwich, Ct. . Rochester. Montclair, N. I Peoria, Ill . Chicago, lll Poughkeepsie . Bay City, Mich. Bay City, Mich . Toledo, O. NVinthrop, Mass Canandaigua Poughkeepsie Wlest XN'insted, Ct Rochester Rochester Wlinstecl, Ct . Syracuse Middletown, Ct. . Auburn. New York. . Utica South Norwalk, Ct. Louisville, Ky . Dunkirk Rochester. Trumansburg Ashtabula, O. St. Paul, Minn Mori'-is Church, Va. JUSTICE, LUCRETIA BERNARD, ICAUFFMAN, ALICE, . ICING, CLARA ELIZABETH, . LARRABEE, IQATHARINE PELLIAM, LOVELL, Pl-IEBE DURFEE, , MCCAIIL, ROSEMARY, MCCARIAV, MAIQIA Cox, MACCOLL, MARV, . MCCULLOCIYI, RORERTA, . MACFARLANE, ALICE CLVAIER, NICKINNEY, FANNY LEE, . MAIIAN, NIARV BARRERE, MAL'l'AIAN, GRACE ISAIIEL, MARSI-I, JANE CATI-IARINE, . MAVNARIJ, FLORENCE ALMENIA, lVl'OI,XVl'l'Z, fkLlN'IA FREIJERICA, NIORKDAN, h'lARY .l'lULMES, NIORRIS, SARA HAIvIIL'I'ON, Q MoIJN'r, HELEN EIN, MI,1RIIoL:I-I, JANE Roma, , NCJli'l'KJN, SUSAN XVI-ll'I l'LESlEY, OLIVET, FI,oRENcE WHITE, PARKER, ALIQE BENNETT, PO'I I'ER, LOUISE ELLEN, RICE, LAURA OWEN, RQRBINS, LOUISE, . SERVISS, ETIIEL MAV, SEYMOUR, BINA, . . SHEIJARILI, RAQIIEL ADICLAIDE, SRIERIIARD, SARAII FLETQIIER, SIMPSON, LIZZIE MAV, . SLEIGI-l'll, JOSEl'l'IlNF VVHEELER, SMITI-I, ALICE I-IARLOW, . SMITII, N15LLlIE MAY, SQUIRES, NCDRNIA MAV, STONE, AGNES PIAYICS. '1'ABER, NIARY ALICE, TAYLOR, FLORENCE EUNICE, Philadelphia, Pa Des Moines, Iowa. . New York. Portland, Me. Plainfield, N. J . Utica, Gouverneur. Caledonia. St. Louis, Mo Louisville, Ky Binghamton St. Paul, Minn Chicago, Ill Springfield, Mass Springlielcl, Blass . New York Pittsburg, Pa Pittsburg. Pa Freehold, N. J Pittsburg, Pa Peru, Neb Poughkeepsie Louisville, Ky WVeSt Vilinsted, Ct Cambridge, Hass Nyack Closter, N. J Rockville, Ct Bath Penn Yan . Mexico Poughkeepsie Montgomery New York XVeSt Haven, Ct Rochester Sherwood Hamilton k 1 ' 'F I 1 'Lf5fI'f- , A L-:1.. ' e1:l H ': l'4 '! X 1 NUT ' -1 , -,-.5 1..v.,,4fls '- - Vvfi' ,- . Jil L at Ty ,U I ,.. H A 1 'f '-a',,.-'33-.. K ,, wg 3 ,,.'4i,,,.5. ,' V V ELQQQQQJEQ1 j I ' Q3bQSEQy!g,1 L l -, ff ' ' 7 y I , I .Lf W V mm f -va I .LU . A M1-If P1 I fr? '.1:,Q1.TV' LF' foigsg Q ' LAM, 1 , 'lf' -,wif . J -JH.. 1:15 ', TT . 3: A.,-'He dh A I ' wfuln-' 'lin .ff . - ' .r , :LTU ' . 'lj fir- Y J. . r :gg-jjEl,? -I-fqp ' -' in-. ' -. .A 'ling J Qu: ,Q ,, . 'L . nf nl' F' ' w In . '.i'.Hf f, 'if fu , .. .lj jw. I- .1 Q EIN ' u' fun w ,' 'I I 'rn ' lla .-l.. I' I 4 I..-fi I I..'T:.I ' 4 I r J ,K ww ' l'!l' -Q 4 ' 'I . . 1. 1 1 A fI.4..L-I.'.l...' J . :- X-QQMQM Q , X Q fsfxafbz X' wax xx? 5 6- W A Vassar College Commencement. fr V X, x as June 10, 1897. W4 Organ In-voluntary. IMPRECATIONS. Gofwj- A Rest in Vacation, . . J'0'0lll fha ft .6Qar!.' CHORUS. The Complex Critical Consciousness as zt Cause of Con- stant Complaint ,...... H0190 A. Lifllemarf The Evolution of Everything Eventually Expected, . Fczzfh O. Szkirm Life, Death and the Grave from the Historico-Economico, Psychologico - Evolutiono - Analytico-Scientinco Stanclpoint, ....... Colzsfzzfzrc H'lL!lQl W hat Shadows We Are, What Shadows We Pursue! . Pafzkvzfc Bazgfjafzfz' Liszt-To P1'ixy's Latinfl- Opus, ,Q7 CONFERRING OF NVALKING PAPERS. HOME SWEET HOME. XVEDDING MARCH. N Surgezliet Up. 49 'x Vmssfif enior Class., R055 AND GRA Y. VVLIITE CARNATION. at Class Qfficcrs. MARY E. CHAMBERS, Bfemiezzi. NIZARIE REIRIER, Vln-Prwiffefzf. ADELAIDE CLAELIN, Sefremrjf. GERT'RUDE F. BRITTAIN, Z?'mmrer. NANCY V. NICCLELLAND, Paef. Class Members. ALEXANDER, LAURA V1c'1'0RIA, . ANDERSON, HELEN Ewmlx, IXNUICRSUN, MILDRE1: WlxI,1i11:R, . :XPl'l,I41GA'l'E, Klvrr-MRIN IC 'l'RAEEoRD, ATKINSON, EI,.Islu:ETl1 BUSI-INELL, Blxu,IE, NIARY EVANS, . . BAKER. EMMA LESTER, , 52 5 I4 Bronson St., Oswego, N. Y. . . . .Tecumseh, Mich. 1042 Second St., Louisville, Ky. . . . Red Bank, N. J 62 St. Johns Pl., Brooklyn, N. Y . . . McKeesport, Pa . Barrington, R. I BALDNVIN, ELINOR LYDIA, BEARIJ, HARRIET EI,1ZABF.'l'l'l, BECKNVl'l'I'I, FRANCES AGNES, . BI5ZNI1IIJlC'l', MARY 1iENlJRICK, BIQ:RNRoI-IE, FLQRA BELLE, BIsI-Ioif, ELIZARETI-I LORAlNE, BIsIfIoI', HIQLICN LOUISE, . BOWMAN, AMY C., . BRAISLIN, ANNA PRISQILLA, . BRIiVO0R'I', RIISAMOND RENWICR, BRIGI-IAM, h'lARY HANNAH, . BRILL, EMMA CATI-IARINE, . BR1'I I'AIN, GERIRUDE FULLER, BRONVN, CLARA IQINGSLISY, . BURQI-IARD, ANNA TLZRRESSA, . BURNET, JEAN EIRLAR, . CIsIAAIRERs, hlARY ELIzARE'rII, CIYIANIJLER, AI.IcIf: BELLE, . CIIAPIN, MARIIf:'I rA PIEARSONS, CHASE, ANNIE BIARIIEN, . CHESLEY, BIIABEL LOUISE, CI,AIfLIN,AnELAInE, . CLARK, NIARTI-IA MILLER, CLOUUH, GRATIA, . . COMSTOCK, l'IARRlE'l' BETTS, Cooic, BERIIIA, . . CRAIG, EVA BlAY, CRANE, EDITII, . , CROSBY, FLORENCE NlAY, DUDLEY, SARA-H ELEANOR, . DIINNING, lYlARY GARDINER, EASTON, ALlCE FREEBORN, ELLERY, ELOISE, . . FIERRIELL, NELLIE I. IDYLYNE, GALLAIIER, GRACE MARGARET, GoonRIcIfI, lSAl-BEL FRANCES, GRANNISS, HoNoRIA EI,IzAIsE'rI-I. GREELEY, EIJITI-I, . Milford, Del . . Norwalk, Ct . . I7 Court St., Utica, N. Y . Brookline Ave., Clifton, Cincinnati, O . . . . Wellsborough, Pa 74 Pitcher St., Detroit, Mich . . 74 Pitcher St., Detroit, Mich 1618 Susquehanna Ave., Pliiladelphia, Pa . . . . Bordentown, N. I 390 N. Broadway, Yonkers, N. Y . . . Canisteo, N. Y , . 255 N. Vine St., Hazleton, Pa 127 N. Fullerton Ave., Montclair, N. I 110 Midland Ave , Syracuse, N. Y . . . Hamilton, N. Y 315 Lenox Ave., New York, N. Y . . . Bronxville, X. Y . . . . St. Albans, Vt . 1632 Chicago Ave., Evanston, Ill . 573 Highland Ave., Fall River, Mass . . . . . Malone, N. Y 446 Dunham Ave., Cleveland, O 335 State St., Brooklyn, N. Y II45 Benson Ave., Evanston, Ill . . . . XVilton, Ct Tarrytown, N. Y . . . . Vevay, Ind 2650 Bellevue Ave., Mt. Auburn, Cincinnati, O . New Rochelle, N. Y North Pleasureville, Ky . 4 Grover St., Auburn, N. Y 458 High St., Fall River, Mass , 21 Rutger St., Rochester, N. Y 78 Capitol Square, East, Columbus, O. Essex, . . . . . . Ct Delhi, N. Y. Foxon, Ct. , Scranton, Pa. 53 GRIITITIN, MAUDE VERNETTE, GUVER, ELIZABETH, . HARDIN, CAROLINE HYDE, . HAZEL1'INE, EI.IzABE'rH PIALLOCK, HECICER, MARY MAGDALENE, HEMMINGS, ANITA FLORENCE, Hnvwoon, RosE BARTLETT, PIIGGINS, MEDORA LAIvIIsER'I', HOMMEI., LILLIAN CIIAPMAN, I'lOOKER, EMILY GRISWOLD, HOTCI-IIQISS, FLORENCE, . I-IUTcIIINsoN, KATIE OLIVE, JAMES, VASSIE, . . . . ICIRKLAND, WINIERED lVlARGARET'1'A, LANIJEIELIJ, GRACE HANNAH, . LAPIIAAI, ENIILY MARIAN, LAXVRENCP1, EIJNA IRENE, LEVERETT, MARY ELIzAIzE'I'H, LEXVIS, HORTENSE WI'I I'ER, LURD, ELIZA MARY, . Loricjov, LILLIAN, . . McCI.EI.I.ANII, NJXNCY VINCENT, lYlCh'lAl-ION, lVlARY NlAl3I'1L, h'lCN.XIIl, JEAN FERI:IIsoN, MAI.I.oN. FI.oRENcI-: CORDIELIA, . h'll llRlI.l., MARY, MEYERS, BIELAI-I, . NlllCRSCl'l, ELLA lf.Alll,lli, . B1Ol7Fl'I'l l', EDNA VIRGINIA, N EEI1', l-I A RR I ET CAM I LLA, NllXX'l4ZI.l., AN'l'l7INlE'l l'IC, . 1'AT1'IzIIsoN, IRENE EDXVARIJS, l7liZ'l'liR5, HELEN l5AroN, . l7l'Ill.I.ll'S, SARA JAY, . PI..X'll'I', SARA FAIRIQI-IILII, Posr, ANNA WARNER, . PowEI.I., FI.uRENcE CARLILINE, Rlilhll'1R, MARIE, . . . 24 Orchard St., Danbury, Ct 450 Pennsylvania Ave., Waverly, N. Y . . Beirut, Syria, via Brindisi 226 'Winsor St., Jamestown, N. Y 222 North Sixth St., Allentown,,I'a . 9 Sussex St., Boston, Mass . Northampton St., Holyoke, Mass . . . Ticonderoga. N. Y. . Port Jervis, N. Y Winter Park, Fla. I2 High St., South Norwalk, Ct. . . . Redlands, Cal . 1417 Linwood Ave., Kansas City, Mo . . . New Berlin, N, Y. 34 Stuyvesant St., Binghamton, N. Y. . 5 Gibson St., Canandaigua, N. Y 1036 Willsoii Ave., Cleveland O .Y . 41 Lewis St., Binghamton, N. . 223 South Second Ave., Mt. Vernon, N. Y . . . . Burnt Hills, N. Y II Lafayette Place, Poughkeepsie, N. Y . 263 Mill St., Poughkeepsie, N. Y . 43 lf1Ckson Ave., Bradford, Pa 154 North Church St., Hazleton, Pa . , . Malone, N. Y 28 Rowley St., Rochester, N, Y . 504 Fullerton Ave., Chicago, Ill . . Emsworth, Pa 1125 Grove Ave., Richmond, Va . 452 YVest YYzIter St., Elmira, N. Y . . . . . Bristol, Ct . . . . . Franklin, Ky Luray Ave., XYalnut Hills, Cincinnati, O 199 Fifty-ninth St., Brooklyn, N. Y 'l'enaHy Road, Englewood, N. I . IIS East Third St., Oswego, N. Y 1025 Fifth St., S. E., Minneapolis, Minn . . . . East Aurora, N. Y RIOIIEV, ANNA GERTRUDE, SAXVYIQR, ALICE WVELLINGTON, SCI-IAIIIPELER, RAOIIEL CAPEN, Sul-Inssnv, MARION, . SCOI-'IEI,II, -ILILIA JXUGUS'l'A, SHAVV, BEATRICE, . . SRIITI-I, GER'rRUImE, . STA'1'oN, SALLIE BAKER, S'l'ORK.lQ, ALICE 1'IERMIONE, S'rRAIrsII'I', GRACE CLARK, I'r'I'ON, EIJNA Woons, TAYLOR, I.oLfIsE CLIN'I'oN, T1-IAIN, jEssIE IsAREI,LE, TI-IALLON, IIIA CARLETON, T1-IoRN'I'ON, EMMA CLISORA, TIIfI-'ANv, BELLE LOUISE, T RAVEN, MAI DEE MACWI-IORTER TXVEEDY, GRACE BENEDICT, VERI-IoEIfIf, CAROLYN PARKER, WVARNRR, GRACE MAY, . WI-II'I'NEx', BERTHA BELLE, . WI-IITON, ALICE, . . XVILKINSON, ANNIE LYNDESAY, 257 North Ave., Allegheny City, Pa. 1128 Duval St., jacksonville, Fla . 1532 Broadway, Cleveland, O 2006 SOuth Sixteenth St., Omaha, Neb . . . . Penn Yan, N. Y 196 Ellison St., Paterson, N. . . . Woodfords, Me . . Tarboro, N. C 143 North St., Auburn, N. Y . 184 South Ave., Bradford, Pa . 491g Centre Ave., Pittsburg, Pa . . South Orange, N. J . . . . Chicago, Ill goo St. Mark's Ave., Brooklyn, N. Y . . . . Moravia, N. Y . , Fredonia, N. Y 23 Park Place, Saratoga, N. Y . 4 Farview Ave., Danbury, Ct 825 Second St., Louisville, Ky . . St. Paul, Minn . . , . Bethel, Ct . 202 Madison St., Brooklyn, N. Y 431 Chelten Ave., Xvest, Germantown, Pa Graduate Students. an BIARY EWART AD1Q1Ns, A. B. ASQ6, Physical Training. 'HANNAIA1 W1N11vRED ARNOLD, A. B. 1396, Modern Languages. DIARY E1.12,1xoR Giznmiy, A. B. 1895, Art. ANS HERO, A. B. 1896, Chemistry. 111.1 GR.1C1zKRUs1z, A. B. 1896, English. C.,1RR11c CRAFT L.111'R14:xc12, A, B. ISS2, Mathematics. ANN111 AIQURE, A. B. 1896, Biology. -lU1,1.,x A111sUs'1.-1 SC1-1w.xR'rz, A. B. 1396, English. NIARY Eo1'1'1f1 TARBOX, A. B. 1896, Astronomy and Mathematics. I-l1c1.1cN 'l'111Rz.x Wooo, A. B. 1896, Greek and Latin. Students in Special Courses. Q24 A 1.1sRo, EDM C1..1R1i, . Cfxxxixiz, ANx11'1 1.1 BLANC1-111, Ic1q1,1aR, LYDIA M.11R'1'11.1, lQ1z1,1.15x', Acgfclcs R1.1s1c111.'R1s1'1, LA1'1GN1i'1 1'1c, BIARII-T L01'1s1a, NORRIS, BI.-Xlilil., . . Pli'l l'EE, 1111.11 Exsiux, 5'1uxN'roN, EDITIAI, . . VAN K1.15nc1i, M.1R1E 'l',x1,L1'1.11n1s1a, GR .-1 11 Lf A '1 11: SENIORS, j1'x1oRs, S111'1f1o11oR ummary, Q25 ST 1? 1 11-:x'1's, ics, FR12s1f1R11f:N, , lx 51114161.11 .Cu1'Rs1-is, . . W11o1.13 x1'111s1cR, 56 Pouglikeepsie. Aspen, Col. St. Paul, Minn. . Pittsburg, Pa. Fishkill-om Hudson. . Springville. . Lakeville, Ct. . Oxford. lloughlceepsie. IO 106 . SS 130 ISO 9 523 'I I N. Y. I I ..,-- - I I I MASS. PA. 'IIT I I ' ...LTI-- 1 CT 'TI I .ii 1- A-- I- OHIO I -I-I-E'-'------' - IWCIQ- ' -... KY. 'MIB lovIg5fJV!V ...I NA -- C O L. - .-. . KAN. I and RI I. TENIN. I Nl D. 1 -fal- IVI E NIH. I I CAI.. - N. C. -ii-, VA. I 1 FIA. -- NEB. TURKXEY -E ARK. I .gl- DEI.. -- DIC. 4.1 IIvLl.l.I..I.l II LI LLJJ. IA. I I I I I I I SCALE OF IVIEAEUREIVIIENT ufikr TEX. I I EC THREE'ET'GDE'i:EN?s IOTHEEQUAE I W I . I .E -I '-A-Y 7A7E I I vv. TA. -- COMPARATIVE SCALE OF LOCALITIES REPRESENTED 57 Students' Association J . 97 VASSIE JAMES, Prfsz'11'mf. 797 MARY GARUINER DUNNING, Wu-B'esz'fz'e:z!. '98 FLORENCE EUNICE TAYLOR, Serrefnry and Treasurer 58 VASSIE JAMES, 797, f7l'L'5ZIIZIc'iZf af -Sflllffllff A.vs0r1'm'2'07z Y. W. C. A. Ea' Officers for 1396-7. 97 JESSIE ISABELLE ITHAIN, Bm-ifz'e:zt. . '97 ANNA PRISCILLA BRAISLIN, Was-Hfemieuf. '98 ALICE KAUFFMAN, I6m1m'z'1zg Secrefary. '98 HELEN Louxsu W HITMAN, C'07'7'65f07ZIl7Z'7Zg' Secfefazjf '99 PERSIS MARY BREED, Treaszzrer. 60 X, H , .S JESSIE ISABELLE THAIN, '97, Pf'esz'de11f of Yf WZ C. A 798 .98 ,98 799 99 IQOO 1 F.l Y O - QQ A-O J Officers for 1897--8. '98 HEI.EN LOUISE VVHITMAN, H'e.v1'r!e1z!. '98 ALICE NEWh'IAN GIBBONS, Wee-Prfszliezzf. 799 CAROLIIN GERTRUDE HEYVVOOD, Rem1'f!z'7zgSecrfz'arj'. 199 BERT!-IA RICHARDSON, C01'i'1'5j5077a'1'7zg Secrcizzfhy. IQOO ESTELLE .RICE AIzMsTIeoNG, 2?'!'H57!l'L'1 Committees. Committee on Devotional Meetirrs. '98 A. IQAUFFMAN, Cfzfzirfzzfzn. '98 M. MacCoIl. ,QQ J. Dransneld. '99 K. Belcher. I9oo M. C. Kauttman. T C. E G. J I9oo M. P. ESS. Committee on Missionary Work. 799 E. L. GAIlRET'l', Chrmwzan. 99 C. M. Dilatush. 199 P. M. IQOO E. C. Packer. Committee on General Work. '98 P. D. LOVELL, Chezirmfzfz. '98 A. Wentworth. '98 L. E. 799 M. Murray. 799 R. B. I9oo M. L. Ray. Committee on Music. Breed. Potter. Mears. 799 H. V. TURNER, Cfzczzllvzzzzlf. F. Sheppard. '98 A. H. Stone. '98 lVl' B. Granger. Ward. '98 L. O. Rice. ' '99 M. Gathright. R A. Shepard. '99 E. L. Iacobus. 799 M. Day. E. Sprague. ,QQ C. G. Abbott. I9oo K. Samson. U E. Chandler. IQOO G. B. Raymoncl. IQOO A. Warner. ' Stebbins. I9oo P. B. Day. I9oo B. Taylor. Committee on Philanthropic Work. ,99 M. RAY, ChlZZ'i'lllLZI1. 98 L. Robbins. 799 M. L Brinckerhoff. 99 A. S. Tuttle. IQOO A. l.. Tallmadge. 62 111- DH MRTUCC 2259931221 UH-0:1 M1255 mx 4 1' f u fX fw f'44 f TNW 7 1ff',k E399 A ' Z lx M X XQM 1! f!! W! N I x Fa X !f 'fff f f M f- MH! ' ff? ff , 'H A X X U. I' NX 'N .' ' 'f,.fi 1 1 Mi X BY' ffffif f if W FQE XM I U! N IKFN S X71 x X f f X N . ' M. 512' ' 7' ' Lf'-x X x Y' . - ,111 I XX X V ff M '- ' xv Rf, fra W X .n , W X X-x W , U 'Ii-M 'K Mx -I 1, L X- xx , X X' 9,5-X H 'uf f.rN , 1xl,. t 1 r ll: il UN I W ig fn .' ' . ! ' N u-I 1, if I' 'M W .WW ,qi fl ' ' 1 M1111 w w J g ,Q LQ 1...- ..,'i' AN E ,Iii x M K X? Y N E X J W . 5711, A N, 7 'YR A 2 '22 -E ft m f 1 A , T 1 ' DM' -3,3 A 59 S33 vegmi - A .... 2 245... 143, L A E Philaletheis. .29 RED, XVHIT1-Z AND BLUE. Qfficers. b MMA LESTER B '97 F A K ER, Presizfeizzi LOREINCE HO1'CHKlSS, Vine H1 'Z - 52167122 '98 HELEN ADELE COBB, Smfefzzzy. '98 PHEBE ANNET TE HATFIELD T , reaszzffer. 797 GRACE I-IANNAH LANDFIELD, Prapenjf fllrzmzger. '98 SARA IEIAMILTON MORRI ' S, Alsswfalzf P 64 rajbfrzj' Md7Zdg67 A EMMA LESTER BAKER, ,97. Pfffifffllf of Pkilalethazk Chapter Alpha. 4, N aa? M sash w-G .3 if Toitucbyzeif Soqmfi 511:11 if-' 5 . Q Q WM .M t R14 LJ , ,Ag 7 t IS ,gps V , its 2, 3, .yi :1 , 1. My . .f f l . .v ' lx 1 ' I ff Z. if EK L. V. Alexztncler. H. E. Anderson. E.. L. Bztlclwin. C. K. Brown. I. R. Burnet. F. A. Beckwith. G. Clough. M. M. Clark. N. 1. I. Ferrell. M. V. Griffin. K. O. Hutchinson. ' M. L. Higgins. F. C. Mullon. J. F. McNair. B. Meyers. '97 NELLIFL I. I. FERRELL, Pzexzlfffzf. . .Z I ' X it N '97 BELLE L. TIFFANY, IQEK'-fV'l'A'Z1I76'l1Zl. Members. M. M errill. S. B. Staton. B. L. Tiffany. B. Shaw. E. W. Sutton. M. A. Blzuiclmrcl. M. R. Benway. H. G. Davis. A. F. Foster. 1 '97 LAURA V. A1.1axANn1f:1z, SI'L'l'6ftZlll'. '99 LUCY T. BEATTY, Zlwzxzfffff' ,99 L. T. Beatty. ,QQ M. S. Brown. 199 H. V. Chase. 299 H. F. Faxon. '99 I.. Gildersleeve. ,QQ M. F. I-larrirnzln. '99 H. K. Hoy. 99 R. Reed. 799- E. S. Russell. H. M. Hequembourg. 199 H. B. Scofield. E. H Jaques. B H. . Mount. F. W. Olivet. L. M. Simpson. A. Wentworth. 00 '99 H. W. Stockholm. 199 B. A. Tremlnor. IQOO E. B. C. DuBois. 1900 V, S. Goodenow. H. F. E. H A. A. M B. E M V. W. G H A. A. E Beargl. B. Bernkopf. L. Bishop. L. Bishop. C. Bowman. P. Braislin. E. Chambers. Cook. Crane. G. Dunning. james. M. Kirkland. H. Latnclfrelcl. E. Peters. G. Richey. WV. Sawyer. I I. Thain. I. C. 'I'h2tllon. A. Whiton. A. L. Wfilkinson. N Bean. H E, Cobb. B. Crosley. M. E. DeLany. F. E. Eddy. L. G. Eclcly. Chapter Beta. .25 Tri rflrjwf Uljfl 971: 6 lf. W1n'r15. l97 ANNA GERTRUDE RICHEY, H-e.vz'de7zz'. '97 GRACE PIANNAH LANDr1E1.D, Wre-Prcsfkzkfzf '98 LUcRE'r1A GLOVER EDDY, Smrfazy '98 JANE CATHARINE BLARSH, Ylwzmzm Members. '93 M R. Ferris. '98 G M. Garvin. '98 A. N. Gibbons. '98 R S. Gibbons. '98 C. E. King. '98 K P. Larrabee. '98 G. I. Maltnian. '98 J. C. Marsh. '98 L. E. Potter. '98 L. O. Rice. '98 J. W. Sleight. '98 A. H. Stone. '98 H L. Mfvllltllldll. '99 M. Burr. 799 M Busey. 799 M G. Cook. '99 M. L. DeLand. ,QQ Dransneld. '99 S. G. Grant. '99 F. Greer. 799 L. Hart. 799 Hamilton. ,QQ M. L. Hosmer. '99 R. B. Mears. ,QQ L. D. McLeod. 'QQ Nicols. 67 799 E. '99 M. Percy. Ray. 799 B. Richardson. 799 S. '99 G. 199 '99 799 799 A. 799 ,99 '99 IQOO B. H. IQOO A. 1900 V. IQOO G. 1900 M IQOO A IQOO M 1900 H 1900 M IQOO 1900 L. 1900 IQOO E. S. A. I. L. M. L. F. Robb. H. Robbins. P. Savery. S. E. Smith. V. Turner. S. Tuttle. R. Upclegraff. A. Van Inwegen. Vanclerslice. Bates. E. Barnard. Barnard. M. Cancller. . B. Comstock M. Crater. Frothingham B. johnson. Kztufflnztn Payne. O. Perrin. . C. M. Ray. K. Samson. R. Keiiey. . XV. An derson. E. Bailie. L. Baker. F. Brittain. . P. Chapin. B. Chase. E. Dudley. F. Easton. B. Heywood. M. Lapham. I. Lawrence. . W. Lewis. V. McClelland. ,99 M. McMahon. ,99 Newell. F. Platt. C. Powell. . Reimer. P. Verhoeff. M. Warner. Borden. D. Dwight. . I. Haight. P A. Hatfield. Chapter Qmega. JG Burl-1 ,97 BLARIE Rniixuzk, Hzarificfff. '98 E1.1zA1s1gT1w1 F01:BEs VASSAR, lfifa fP'6'S1.IIlC'lIZ' ,99 ANNIE EL1zA1:Ei1'H JENKINS, Srrremfi Members. L. B. Hemphill. L. B Justice. . D. Lovell. R. Murdoch. A. B. Parker. 1 L. Robbins. . E Taylor. E. F. Vassar. E. C. Ward. C. G. Abbott. P. Breed. U. E. Chandler. A. Clarke. L. Edson. M. L. Del-Trees. M. M. Fry. M. M. Gathright. C I. B. Hoyt. . G. Heywood. A. R. Jenkins. C. L. johnson. C. A. McCaffrey. N. Smith. A. B. Sprague. 68 V99 l.oR.11N15 Ensow, Ylwlfllfff 199 F. Sprague. '99 M. E. Stowell. ,QQ A. R. Taggart. ,QQ P. K. Truesdale. ,99 Van Syckel. ,QQ A. 1-1.Ware. '99 A. H. Wilson. IQOO IQOO 1900 1900 IQOO 1900 IQOO IQOO 1900 IQOO 1900 1900 1900 1900 1900 1900 E R. Armstrong. A. P. Barrows. A. Borden. H. W. Greenhalge H. I-Iumpstone. E. A. Lord. S. McMahon. F. E. O'Connell. M. XV. Plumb. E. Poppleton. J. M. Scarborough I. A. Stewart. E. D. Suffern. A. L. Tallrnadge. E. S. Warner. C. W. Wilkins. fk K. T. Applegate. E. B. Atkinson. M. K. Benedict. R. R. Brevoort. E. M. C1-aigf G. M. Gallalier. I. F. Gooflricli. E. Guyer. L. C. Hommel. M. E. Leverett. H. C. Neef. 1. E. Patterson. A. H. Storke. Chapter Theta. W-5 ,Q7 GRACE B. 'l'w121zDY, Hfesiffefzf. '98 ALICE C. MACFAIQLANE, Wae-Hz'.vz'zz'cfzz'. '98 liA'l'I-IARINE BLUNT, Secrcfmy. '99 E1.1sA1w014 K. RAY, 75'6'Il.l'7!l'I'l Members. 797 Cr. B.Twee1'ly. '98 I. Adams. '98 M. C. Bagg. '98 B. Belknap. '98 K. Blunt. '98 L. A. Chamberlain. '98 F. Hart. '98 M. MacC0ll. '98 A. C. Macfarlane. '98 B. Seymour. '98 S. F. Sheppard. 799 E. K. Ray. IQOO F. W. Acllem. 69 1900 1900 1900 1900 IQOO 1900 1900 1900 1900 IQOO 1900 1900 J. I. 4 R Pf C. E. R M Cv. L. S LX M. Angell. M. Becker. S. Belknap. M. Chapin. B. Day. R. Horne. John. B. Patterson. T. Perry. Tuttle. Wadswortli. W. Wiglitnian. 7 97 97 '97 97 97 97 97 '97 97 97 '97 97 98 .98 .98 .98 .98 98 .98 .98 .98 1 1 1 1 1 1 1 2 1 93 798 Y98 E. C. A. 'l'. A. B. F. M. Non Brill. Burch arcl. Chrtucller. Crosby. M. M. Heelcer. F. Hotchkiss. li. li. Miersch. E. V, Moffett. A. W. Post. G. C. Straight. L. C. Taylor. li. C. Thornton. 1-1. N. Ballzmce. A. W. Clark. M. E. Curtiss. J. G. Garrluer. H. S. Greenwood. A. B. Guy. 1. B. Howarcl. L. Howe. U. E. Jefferson. A. Katrffnmn. R. McCall. R. McCulloch. 98 F. L. McKinney. Chapter Members. .25 '98 F. A. Maynard. '98 A F. Molwitz. '98 S H. Morris. '98 E M. Serviss. '98 R A. Shepard. '98 N M. Squires. '98 G L. Voorhees. '99 B V. Abbott. '99 N R.B:1ker. '99 R M. Batchelor '99 J. Belcher. '99 K F. Belcher. '99 H. Blumenthal. '99 lx. C Bowman. 'QQ M. Boyd. '99 M. L. Briuekerhott '99 M, W. Brown. '99 -I A. Burnette. '99 A Choate. '99 H. E. Colburn. '99 A. B. Crowell. '99 C M. Dilatush. '99 C A. Dudley. '99 E. Eltiug. '99 L. Ettenson. 10 K M. R. Evans. A. P. Fish. I. G. Foster. C. L. Fowler. E. L. Garrett. M. Hallzirnn. S. Hamburger. C. B. Hassler. G. B. Heard. S. M. Henry. Mi. E. Hurlbut R. L. Iacohus. I. E. james. L. E. Jeffrey. A L. Ienkins. G. Iohnson. A. C. Jones. A. Lehlbach. S. Loeb. A. H. Merwin. I. Mesick. S. G. Miller. G. Morrill. R. V. Moser. M. Murray. E. Nessenson. A. H. Page. M. L. Patterson. R. Roberts. R. Wheeler. 799 F. E. 'Wright '99 M. E. wyiie. IQOO IQOO 1900 IQOO IQOO 1900 IQOO IQOO 1900 1900 IQOO IQOO 1900 1900 IQOO IQOO IQOO 1900 1900 1900 1900 1900 1900 IQOO 1900 1900 1900 1900 G. M. An clre ws. L. Baker. P. H. Beaclle. F. M. Beck with. A. E. F. G A. C. F. L. E B. I. F. M A. F. M H F. H D E. R. M. F. Birclsall. Bradley. M. Brownell. R. liyington. L. Cahn. M. Cnlen. D. Campbell. Christopher. B. Corbin. L. DeGraff. Denton. Dorrance. Dunning. L. Eiseinan. C. Dowling. P. F. Ettenson. H. French. D. Gall21ghe1 Gans. Graham. W. Grefe. G. Harmon. Ha.rral1. 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 IQOO IQOO H. M. Henshaw. H. A. Hill. A. B. Hinchman. M. L. Horst. E. L. Hunter. M. V. Johnson. S. F. johnson. A. justice. A. M. LeRoy. M. E. Lloyd. H. B. Long. M. Lovett. L. Marsalis. li. S. Merritt M. V. Mitchell. L. A. Moriarty. M. W. Mossman. E. R. Oberly. lx. C. Packer. M. M. Preston. 1900 1900 IQOO IQOO 1900 1900 1900 IQOO 1900 1900 1900 1900 1900 1900 1900 1900 IQOO IQOO 1900 C. C. Quigley. G. B. Raymond. R. R. Richardson. W. M. Richardson M. C. Robinson. E. M. Russell. M. P. Schmidt. V. Shouse. E. Sidenherg. A. L. Smith. Pl. W. Smith. M. M. Spratt. E. G. Stebbins. j. B. Tarhox. O. W. Thomas. ' I. A. 'I'ourtell0t. A. N. Wallach. E. S. llfagar. J. M. Weeks. S. M. T. Van Klee-cle. ylxkl e1',0 WIIZ aw Athletic Association-. 97. I. C. THALLON, Presidezfi. 52' '98, H. I. HAIGHT, Wu-H-esz'de11i. '98, P. D LCVELL, Secrefary. '99. M. L. HOSBIER, Twaswfee 74 I V V w 4' A. . , , IDA CARLETON THALLON, P7't'.S'Z'd67Zl4 of Aflzlefic Asxorialion. H I+' M E. E. I . A. A. I. M A. A. M G B. M A . I M N. H . M Ii IA. E. A. H B. E. M 1. E. Anderson. B. Atkinson. . ln. Bailie. L. Baker. L. Baldwin. A. lieckwith. P. Braislin. T . Burehard. E. Burnet. E. Chambers. B. Chase. Clallin. M. Clark. Clough. Cook. . G. Dunning. F. Easton. Adams. C. Bagg. Bean. Belknap. R. Benway. Blunt. Borden. Broad. W. Clark. A. Cobb. Crosley. D. Dwight. R. Ferris. Members. Pnorizsson A. M. ELY. DR. E. B. THELBERG. PROFESSOR J. L. Mooun. '97, N. I. Ferrell. G M. Gallaher. I. F. Goodrich. E. Guyer. R. B. Heywood. F. Hotchkiss. K. O. Hutchinson. V. james. G. H. Landheld. E. M. Lapham. E. I. Lawrence. M E. Leverett. H. W. Lewis. E. M. Lord. N V. McClelland. M. M. McMahon. M. Merrill. '98. I. G. Gardner. A. N. Gibbons. H S Greenwood. H. l. Haight. P. A. Hatfield. H M. Hequembourg. I. B Howard. K. P. Larrabee. P. D. Lovell. M. MacColl, R. McCulloch. S. H. Morris. H. E. Mount. 76 B. Meyers. Ii. V. Moffett. S. F. Platt. M. Reimer. A. W. Sawyer. R. C. Schaufller M. Schibsby. B. Shaw. G. Smith. S. B. Staton. G. C. Straight. E. W. Sutton. L C. Thallon. B. L. Tiffany. B. B. Whitney. A. Whiton. A. L. lVilkinson. F. W. Olivet. A. B. Parker. L. E. Potter. L. O. Rice. L. Robbins. B. Seymour. A. H. Smith. N. M. Smith. M. A. 'l'aber. F. R. Taylor. E. F. Vassar. E. C. Ward. A. Wentworth. C K. M G. Abbott. Belcher. . S. Brown. M. W. Brown. M. Burr. E L. Burwell. M. R. Busey. U. E. Chandler. H. V. Chase. A Clarke. A M. Day. E A. DeLany. C. M. Dilatush. I. G. Foster. G. Andrews. E R. Armstrong. V Barnard. A P. Barrows. L Bartlett. A S. Belknap. A. Borden. E Bradley. F. M. Brownell. A M. Burnham. G. R. Byington. R M. Chapin. A. B. Comstock. I. Corcilius. '99. M. M. Fry. M. M. Gathrigh S. G. Grant. G. B. Hearcl. C. G. Heywood. M. L. Hosmer. H. K. Hoy. M. F.. Hurlbut. A. E. jenkins. L. jenkins. L. D. McLeod. R. B. Mears. S. G. Miller. M. Murray. A. H. Wilson. I 900. A. M. Crater. P. B. Day. B. L. DeGraff. F. Dorrance. F. Dowling. M. Dunning. S. L. Fowler. M. G. Harmon. E. L. Hunter. E. B. King. H. B. Long. E. A. Lord. H. G. Marot. MclVIahon. Sprrial. A. R. Kelly. I E. Nicols. E. K. Ray. M. Ray. R. Reeil. G. H. Robbins. R. Roberts. L. Rockefeller. E. Russell. H. Smith. A. B. Sprague. F. E. Sprague. H. V. Turner. A. S. Tuttle. A. H. Ware. R B.'Palterson. M. T. Perry. G. Pierce. M. NV. Plumb. M. L. Ray. E. M. Russell. lf K. Samson. V. Sauvage. V. Shouse. li. Sidenherg. E. W. Smith. M. Spratt. C. H. Stephens. A. L. Tallmadge V , Y x 1 E l 1 x z Ninety-Seven. Basket-Ball Team. .25 E. L. BAKER, Capfaifz. M. E. CHAMBERS, flfafzager. B. Cook. I. C. Thallon. A. F.VEaston. B. L. Tiffany. S. F. Platt. G. B. Tweedy. M. Reimer. A. L. Wilkinson 79 5 V Ninety-Eight Basket Ball Team ab' F. BORDEN, Capmin. P. A. HATFIELD, Mdlldlfff. B. Crosley. . H. I. Haight. H. M. Hequembourg. P. D. Lovell. L. E. Potter. L. O. Rice. A. H. Stone. A. Wentworth. 81 I 'ggi 1 Ninety-Nine Basket Ball Team M. RAY, Czzjamin. I. L. VANDbiRSLICE, .fl1zzfzage1'. A. Clarke. C. M. Dilmush. C. G. Heywood. M. L. Hosmer. H. K. Hoy. L. jenkins. R. B. Mears. R. Reed. W., VT..... . I li Nineteen-Hundred Double Basket-Ball Team Q25 F. G. DEAN, Capmirz. F. DORRANCE, E. R. Armstrong. A. Borden. V. Barnard. E. Bradley. A. P. Barrows. M. B. Comstock. ' L. S. Bartlett. B. L. De-Grafi I. M. Becker. F. C. Dowling. A. S. Belknap. E. B. C. Dubois. 35 Ilfazzager. L. Hunter. B. Patterson. L. Paul. O. Perrin. W. Plumb. L. Ray. ecord in thletics. R A iavuxr. 1oo Yards Dash . 220 Yards Run 12o Yards Hurdle Running High j ump Running Broad jump . Standing Broad Jump Fence Vault . . Throwing the Basket Ball Throwing the Base Ball April 18, '96 115. '99 . .25 Track Athletics. R ECO R D . . II seconds . . 32 seconds . 2I seconds . 4 ft. 5 in. II ft. 8 in. . 6 ft. IIE in. . 4 ft. 5 in. . 62 ft. 105 in. . . 135 ft. . Basket Ball, 1896. . 6-1 May 9, '96 11o1,n1:R. A. L. VVilkinson, A. M. Day, I. C. Thallon, C. G. Heywood, . H E. Booth, H. E. Booth, S. F. Platt, M. M. Champney, . 1. C. Thallon, 115. '98 . '97 vs. '98 . 5-3 '97 115. '99 . April 25, '96 115. '99 . 1-o May 16, '96 w. 'QQ '98 115. '99 . . 1-o '97 vs. 98 . . May 23, '96 125. '97 . . 1-2 May 30, '96 Ur. '98 in favor 0f'949 by defauli. '97 115- '99 - - 5-2 Championship won by '97. Tennis Championships. Singles ...... E. L. Hunter, '99 S. F. Platt, '97 Doubleg I. C. Thallon, '97 86 Z, I I K C ontemporary Club. J 97 GRACE MARGARET GALLAHER, Clzczzkmrw of Exerzzfizfe Cmzzvzifiee. '97 FRANCES AGNES BECKVVITH, Secreiaqf. A. Hero. I. G. Kruse. I. A. Schwartz. L. V. Alexander. E. B. Atkinson. F. A. Beckwith. R. R. Brevoort. E. C. Brill. G. F. Brittain. I. E. Burnet. M. L. Chesley. M. M. Clark. S. E. Dudley. E. Ellery. G: M. Gallaher. I. F. Goodrich. H. E. Granniss. M. V. Griffin. E. H. Hazeltine. M. M. Hecker. A. F. Hemmings. L. C. Hommel. F.. G. Hooker. F. Hotchkiss. K. O. Hutchinson. ' V. James. M. E. Leverett. N. V. McClelland. ' J. F. McNair. M. Merrill. E. V. Moffett. Sweet. '97 L11.L1AN CHAPMAN HONIMEL, Lz'bmrz'mz 1 Members. '97 H. C. Neef. '97 I. E. Patterson. '97 S. j. Phillips. '97 M. Reimer. ,97 A. G. Richey. '97 S B. Staton. '97 E. C. Thornton. '97 B. L. Tiffany. '98 H N. Ballance. '98 N Bean. '98 E. Belknap. '98 M A. Blanchard. '98 K Blunt. '98 F. Borden. '98 L. Brink. ' E. Broad. ' L.-A Chamberlain ' A. W. Clark. ' H A. Cobb. ' H Cf. Davis. ' M. ' E. 98 98 98 98 98 98 98 '98 N 798 98 '98 H '98 H 98 98 98 98 1 7 7 L. DeLany. D. Dwight. . D. Freeman. G. Gardner. J. G. M. Garvin. . S. Greenwood. . I. Haight. P. A. Hatfield. G I . .l-laviland. I. B. Howard. A. Kauffman. S. M. T. Van Kleeck. Honorary Members. C. E. King. P. D. Lovell. M. MacColl. A. C. Macfarlane. R. McCall. R. McCulloch. F. L. McKinney. G. I. Maltman. M. H. Morgan. S. H. Morris. H. E. Mount. J. R. Murdoch. S. W. Norton. A. B. Parker. L. E. Potter. L. O. Rice. B. Seymour. S. F. Sheppard. J. W. Sleight. N. M. Smith. N. M. Squires. A. H. Stone. M. A. Taber. F. F.. Taylor. E. F. Vassar. E. C. Ward. A. Wentworth. H. L. Whitman. K. F. Belcher. I. G. Foster. R. V. Moser. Dr. Thelberg. Professor Wentworth. 88 Current Topics Club. ,f . , , X ITV- x Iggy? 5 Asi ts ff . ff I , fxgtv wk- in E - -X- A fir- A jx x f-f XX ff X 101334. Officers. SARAH F. SHEPPARD, Pfesiflenf. ELIZABETH DWlGHT', Wm-H'r'rz'a'e1z!. '98 I. F. Adams. '98 '98 M. C. Bagg. '98 '98 K. Blunt. '98 '98 F. Borden. '98 '98 L. Chamberlain. '98 '98 B. Crosley. '98 '98 E. Dwight. '98 '98 F. E. Eddy. '98 '98 L. G. Eddy. '98 198 MARION C. BAGG, Secffeiary. EDITH C. WARD, Tf!05Z!7'67' Members. A. N. Gibbons. '98 L. Robbins. R. S. Gibbons. '98 S. F. Sheppard. H. I. Haight. '98 A. H. Stone. L. B. Hemphill. '98 F. E. Taylor. L. B. justice. '98 E. F. Vassar. A. Kauffman. '98 E. C. Ward. K. Larrabee. '98 A. Wentworth. A. C. Maefarlane. '98 l-l. L. Whitman. J. R. Murdoch. A. B. Parker. 59 I 99 A. H. Ware. Dickens Club. GC 67 FLORENCE HOTCHKISS, President. 797 EMILY MARIAN LAPHAM, I0'ce-Hesidefft. '98 SARAH FLETCHER SHEPPARD, Sfcrefary and Treasurer Members. '97 Emma Lester Baker. '98 Lucretia Bernard Justice. '97 Rosamond Renwick Brevoort. '98 Sarah Fletcher Sheppard. '97 Florence Hotchkiss. '98 Edith Gillette Ward. YQ7 Vassie james. '98 Helen Louise Whitman. 797 Emily Marian Lapham. '99 Marie Gertrude Fulton. '97 Nancy Vincent McClelland. '99 Annie Elizabeth jenkins. 797 Anna Gertrude Richey. ,QQ Grace Hannah Robbins. '98 Marion Chapin Bagg. ,QQ Anne Pym Savery. '98 Louise Armstrong Chamberlain. Honorary Members. Miss Cornwell. Mr. Wentworth. Miss Leach. Mrs. Taylor. Miss Marla ham. Dr. Kimball. Mrs. Wentworth. Dr. Thelberg. OO ' 1 .s 'en. I ' V 2,7 ,V .71 uk' , Y . 1 ,, ., - r vmfeft s if S - ll 5 6 ' . t-i f sas if E MM - , F I '-i. 'X ea- - ' 1 'R 'H ' W e 'i i 'ff wil l if . s w f ef- A A NSQQLL' Shakespeare Club. Q25 97 SARA FAIRCHILD l'lLA'l l', Pnfsidmf. '97 IRENE EDWARDS PATTsRsoN, Via:-H'f.vz'zz'e:zz'. '98 Aucis CLYMER AXIACFAR 1 7 Members. 97 Mildred WValker Anderson. '98 97 Katharine Trafford Applegate. '98 '97 Elisabeth Bushnell Atkinson. '98 7 LANE, Secfezizfy and Ylzvzszzreff. Alice Newman Gibbons. Lucy Belle Hemphill. Alice Clyiner Macfarlane. 4 Marie Barrere Mahan. Q7 Nellie Idylyne Ferrell. '98 '97 Irene Edwards Patterson. 799 Loraine Edson. '97 Sara Fairchild Platt. '99 Margaret Maud Gathright. '97 Jessie lsabelle Thain. ,QQ Florence Greer. ,97 Carolyn Parker Verhoell. ,QQ Clare Louise johnson. '98 Isabel Adams. '99 Mabel Ray. '98 Eleanor Belknap. A EX-Members, ' '77 Miss Wylie. '79 Miss Richardson. ,93 Miss Deane. '78 Miss McCaleb. '88 Miss Underhill. V '96 Miss Hero. Honorary Members, Miss Ely. Mrs. Mills. Mrs. Moulton. Mrs. French. Mr. Mills. Mr. Moulton. Mr. French. Mrs. Moore. Miss Salmon. Mrs. Kendrick. Mr. Moore. qi 'faq jPJlgraTifafrbz+4ralgf111gm7l ia iralpfalpfa sv -Q. 'H 'EAAHNIKI-I 'ETAIREIA. -'- 1 i 1 , y 1 '- ,137Z'Z67.'LfTTjS, W ' ' T1rap,yoS, , r ' Fpamzfrraifi, QL- 1 1117. 1 il , .I 97 1-A '97 lin! W 797 el Officers. Boufbf. W. M. Kirkland. M. M. McMahon. B. L. Tiffany. T '97 E. M. Lord. ' 7 1 i 7 l 2 PRDFESSOR LEACH. - -7. 97 A. CLAFLIN. ,. 4 '98 R. MACCALL. LA. 5 ' M. E. DeLan . L-1-7 - 'gg Dransf1eld.y ' ' 'OL Kozvaiwoi. ' L... L Miss Macurdy. '97 A. L. Wilkinson. '99 H. K. Hoy. EY' ' '97 E. L. Baker. '98 M R. Benway. A '99 B. Martin. I I M 4 '97 F.fA. Beckwith. '98 L. Brink. 799 M. L. Patterson. ' 4-A-f '97 M. H. Brigham. '98 E. Broad. '99 T. Phillips. ' ' 797 E. L. Bishop. '98 M B. Granger. '99 B. Richardson. I l '97, H. L. Bishop. '98 H I. Haight. '99 L. C. Spaulding. 44... ' 797 G. Clough. '98 M C. McCarty. '99 H. D. Thompson. '17 I '97 H. E. Granniss. '98 M MacCol1. rgoo A. Buddington. '97 E. Greeley. '98 L. E. Potter. r9oo M. Buddington. l ' i 7 '97 E. Guyer. '98 L. O. Rice. 1900 F. D. Campbell. '--y '97 A. F. Hemmings. '98 L. M. Simpson. 1900 I. Denton. K-W Q' T '97 J. F. McNair. . '98 G. Voorhees. IQOO V. S. Goodenow. 1 '97 M. Merrill. '98 E. B. Wilkerson. IQOO A. M. Le Roy. .,,,, -1- ' 797 A. W. Sawyer. '99 N. R. Baker. 1900 L. A. Moriarty. -T7 , 4 '97 R. C. Schauffler. '99 M S. Brown. 1900 G. B. Raymond. ' .L 97 M. Schibsby. '99 L. A. Chamberlain. 19oo R. R. Richardson. 'A' -'H 7 '97 G. C. Straight. '99 A. B. Coles. IQOO W. M. Richardson. . 3 I '97 I. Thain. '99 A. M. Day. IQOO E. W. Smith. ri., '97 I. C. Thallon. '99 M. L. De Land. IQOO I. Trowbridge. li tl ' '97 M. M. Traver. '99 E. A. De Lany. IQOO L. Wadsworth. H17 '97 B. B. Whitney. 799 M. Eastwood. i9oo S. W. Wightman. '97 A. Whiton. '99 I. G. Foster. i ,, Ll? 92 ---r B X'iillihlaellfaliahralyrej+z2+UaHf2J!1ti'Q15. 5 EDITORS OF VASSAR MISCELLANY. FANNY LEE MCIQLNNENY. V KA'1'HAR1NE BLUNT. LUCR1z'r1A BERNARD JUSTICE. ANNA GERTRUDE RICIIEXV. GRIXCE NIARGARET GALLAHER. MAIDEE MACXVHORAER TRAVER. - FLORENCE HOTCIIKISF EDITORS OF THE VASSARION. MARY ELIZABMI-I LIIVEMTT. I SAIIAI-1 ELEANOR DUDLIIY. ALICE WI-IITON. ADELAIIII2 CI-IAIILIN. AN'1'O1NE'f'fE NEXN'ELL. NANCY VINCENT BlCCLELLAND. NIARIE :REIMER I-IARRIEI' ELIZABETH BEARD. ANNIE LYNDESAY VVILKINSON. ' lDMiiK ATTSfN5G SQQQUECHEQ5 1. l , .' tv g , i . 5 'ti . f ' , a n I and M Q O House of Commons. '55 MARION SCHIBSBV, . . . Syheoker. FLORA BERNKOPF, .... . Clerk Members The Class of '97. Debates Held in T. and M. House of Commons, in Parliament Assem- bled. March, 1896: Resolved, That the scientific tendency of the age is destructive to literary excellence. Question . . Opposition. Debate . . . Opposition. May: Mock Republican National Convention substituted. November: Resolverl, That the Vice-Presidency of the United States be abolished. Question ..... Opposition. Debate ..... Ministry. December: Resolved, That the Sophomore Play misrepresents true college spirit. Question .... Opposition. Debate .,... Ministry. February, 1897 : Resolved, That the clause in the Constitution of New York State in regard to prison labor is a wise provision. Question . . . Opposition. Debate . . . Opposition. 96 XZ? 5. K iii ,S -lim-,.Q:.,??-be' s 0 v X f+iT' .2 AQSQ Qui Vive .pw AKLICE BENNETT PARKER, P7'esz'dezzz'. IOSEPHINE XVHEELER SLEIGHT, Wie-P:wz'dmi. M HELEN RLY MOUNT, .S6'L'l'6flZ7j! ami Z?'easzz1'e1'. Members. The Class of '93. DEBATES. October, 1896: Resolvezi, That it is justifiable for rich women to holcl business positions. Question ...., Affirmative. Debate . . . Negative. November : ' ResaZm'1z', That the Government should own and operate railroads. Question ..... Negati ve. Debate . .... N egative. January, 1397: Resaftffff, That a certain number of legitimate cuts from recitations should be allowed in Vassar College. Question . Affirmative. Debate . . . Affirmative. February: lfasolveri, That college has a tendency to destroy good manners. Question .... , Negative Debate , Negative 97 '97 Federal Debating Society. 'AC F. A. BECKXVITH, Presfden! V. E. Anderson A. Beckwith. B. Bernkopf. E. Beard. L. Bishop. L. Bishop. H. Brigham. C. Brill. F. Brittain. T. Burchard. B. Chandler. L. Chesley. Clatlin. M. Clark. B. Comstock. M. Craig. Crane. Alexander. A. T. BURCHARD, F. M. Crosby. E. Ellery. N I. I. Ferrell. I F. Goodrich. H F.. Granniss. E. Greeley. M. V. Griffin. E. Guyer. C. H. Hardin. E. H. Hazeltine. A. F. Hemmings. K O. Hutchinson. V. james G. H. Landheld. E. M. Lord. 1. F. McNair. F. C. Mallon. M. Merrill. B. Meyers. oS Sfcrffzzrjl. E. V. Moffett. A. Newell. S. J. Phillipps. A. W. Post. F. C. Powell. M. Reimer. A. W. Sawyer. R. C. Sch au ftler G. Smith. S. B. Staton. A. H. Storke. G. C. Straight. L. C. Taylor. E. C. Thornton M. G. B. Tweedy. M. Traver. G. M. Warner. B. B. Whitney. .zff ,f A W' f x - A QV N ff' f J ' ' - pei? f .'A ' f ' 6 , ,V XX ,f X - J . 5 I .ff X Xx x 1. f ! X Y fl r f, 5' jf Xx f' E If Q ij vj . A QIVTR XX xx Q :gy A f . ,, g y ,A Q M . 1 ' 'A ' V 9 , s X 1-292+ 'V V-wimsz- -W Q 'x 'Y' X-. J R T 1 . , 5 w N ' , V 1 , 'x ff, . x Q 'Q jf ', 'f 33 i,,?, ' H --f ' I ' 'yy ' R .. I , A Q7 X il, Yffgfig-V , gd 4--A, xx at magg- m J iff: ZW' I 5 1 NN -W ff Jaffa f- ff 4.11 X , .X 'Q- X 1, N 1 we vi-in X xx ., , fl l:,, X I f f 'X ' -A' . X ' ' X if I X ' Q 33 1, ., 5 , ff 'ifiiig' ff 1 ' W W College G-lee Club. M. M. '1'1aAvb:R, Lmdfr. ,97 A. F. Hemmings. I. C. Thallon. M. M. Traver. H. Peters. B. Shaw. F. Hotchkiss. C. K. Brown. B. L. Tiffany. I 1 J- I. C THALLON, Asszkffzfzf Leadeff. '98 A. H. STONE, Bnxiizfss Manager. Jiffy! Soprfzzm. 98 G. L. Voorhees. 1900 E. B. Taylor. 99 M. M. Gathright. '99 L. O. McLeod. Serum! Soprano. 98 G. I. Haviland. 1900 E K. Samson. '98 E. C. Ward. j'?7'.fZ' Afia. '99 C G. Abbott. ,QQ H. K. Hoy. 1900 I. M. Becker. Sammi A fin. 99 F. E.lSprague. 1900 G. B. Raymond lOl 1900 M. L. Thompson. Mandolin and Guitar Club. 1996 97 N. I. I. FERRELL, Leazlw. '99 A. S. TUT'1'LE, Busifzexs jlkzfzager. firm' Mafzzifflills. ,97 N. 1.1. Ferrell. 199 R. Roberts. IQOO R. B. Patterson. 19oo L. Ritter. . Gm'fzz1's. '97 A. C. Bowman. ,97 1. F. Goodrich 197 l. C. 'l'l1allon. '98 F. XV. Olivet. '98 L. Robbins. ,QQ J. B. Hoyt. ,QQ A. S. Tuttle. IQOO Sidenberg. 1900 E. B. Taylor IO3 y Scmmz' Ma11d0!z'1z5. 98 R. S. Gibbons. 98 A. 1-1. Stone. QQ M. M. lfry. 1900 F. C. Dowling Choir. .ae PROFESSOR GEORGE C Gow, Ofgxlllltjl' aim' Choir Direcfof. Hrs! Soprano. A. F. Hemmings. '98 J. B. Howard. L. C. Hommel. M. E. Leverett. I. C. Thallon. F. Hotchkiss. C. G. Abbott. B. L. Tiffany. '98 A. H. Stone. 98 E. C. Wfard. 98 G. L. Voorhees. Sammi Soprano. ,97 H. Peters. IQOO L. O. Perrin. J+2'1'5z' Alfa. '99 H. V. Turner. Sammi Alfa. ,QQ B. Richardson. 104 ,QQ M. M. Gathright. IQOO E. B. Taylor. r9oo M. L. Thompson IQOO E. K. Samson. 1900 G. R. Raymond. 1900 C. M. Calen. 1 . AJEMILU 9,7 NIABEL MCMAHON, H'csz'1z'em'. ' '97 E. IRENE LAWRENCE, Wm Prfsz'fz'mf. 97 M. E. Bailie. Q7 E. C. Brin 97 A. F. Hemmings. ' Q7 E. I. Lawrence. 97' M. E. Leverett. 97 M. McMahon 97 H. C. Neef. 97 H. E. Peters. 97 B. L. Tiffany. '98 IWABEL R. FERRIS, Sm'ez'mjz. '98 ELIZABETH D. DWIGHT, Dfearurwf E. D. Dwight. '99 C. G. Abbott. I. Adams. '99 H. Blumenthal. M. R. Ferris. '99 W. E. Chandler D. E. Jefferson. 79Q M. L. De Frees. M. H. Morgan. ,QQ L. Ettenson. L. O. Rice. '99 M. M, Gathright. A. H. Stone. '99 A. Lehlbach. G. L. Voorhees. 19oo P. B. Day. E. C. Ward. 1900 E. Poppleton. 105 Choral Club. :At PROF. G. C. GOW, Dz'rezfa1'. 97 L. C. HOMMEL, H'esz'rz'e11f. 97 H. E. Anderson. 97 A. F. Hemmings. 97 L. C. Hommel. 97 G. H. Landlield. 97 M. E. Leverett. 97 H. Peters. 97 B. Shaw. 97 B. L. Tiffany 98 M. E. DeLany. 98 M. B. Granger. 98 1-I. S. Greenwood. gs G. 1. Haviland. '98 R. A. SHEPARD, Serrefnzjf ami Zzfasvfffer. '98 798 '98 N 199 B. R1CHARDsoN, Lfb!'ll7'liU7l Members. B. Howard. R. A. Shepard. M. Smith. 199 C. G. Abbott. 799 N 799 E' '99 A. ,QQ M '99 H '99 E. ,QQ B. ,99 H . R Baker. C. Bowman. B. Coles. . M. Gatllriglil. . K. Hoy. Nessenson. Richardson. . V. Turner. 106 ,QQ R. lVl1eeler. 1900 IQOO IQOO 1900 19oo IQOO 19oo 1900 1900 IQOO G. Andrews. J. M. Becker. M. Budington. E. Bradley. C. M. Calen. L. O. Perrin. G. B. Raymond. E. L. Russell. E. K. Samson. E. Taylor. uul1n rlI1hA Wulf Mmm ....Z . f f . f f , 7 ,W ' 'I Z .,,,. ., V! 'W V KJ.-4--sl-,f , ff! ,f -., 71' I .1 ,AQK 1.1 ,.. .T If f 'aff , , -fc-f ' 4-- MM ' ff, V f ' .4 . -. N f , A, fg , fi, fe pd' 35'-xy' 5., -1 ,ig J gi-M -Ay bi XXV! I L , -,4 - F ' IEL Y4 1,47 in .32 qv 'ie 5 3.73.5 wwf ff - 7 l 7 . , if fwffr. .. ' 4 ' - - V 7 ' ' . ' xggfirl Tg93,11.E1gf1Cp1 g- . - ', 1 - 1 1.-Qxszqggfg-ay. - -.1 N ,, L . 1 .f 3-3.1.2, , Q , V .N erre-S+ '-'A . 4199 ,ff 5 t1:-:-1:: 'jv-- f , N .f f 3 ' +2 . - Y' HIE-fe '-A-sg' , : fax? -K y f s- '-'nr' Y -F ' - is 1 fa.: , -V ' uf The Nine Nimble Nibblers. ea' 197 Roszunond Renwick Breevoort. 7 97 Florence Hotchkiss. '97 Irene Edwards Patterson. '97 Sara Fairchild Platt. '98 Louise Armstrong Chamberlain. '98 Sarah Fletcher Sheppard. '98 Edith Gillette Ward. '99 Elizabeth Annie Jenkins. 1 99 Clare Louise Johnson. 108 kptsr- ,gif K . ,f . ,.- - ,, L W ,5-,lligh lsfif-,:vf,f1 , ,,:.+ fi- . , .4 . v U he abbitsf' Q25 '98 Isabel Adams. '98 Marion Chapin Bagg. '98 lzfllcanor Belknap. '98 Katharine Blunt. '98 Louise Armstrong ChZ1H1lJ61'lZll11. '98 Lucretia liernarcl Justice. '98 Alice Clymer lvlacfarlaime. '98 Sarah Fletcher Sheppard. '98 liclith Gillette Ward. '98 Helen Louise Whitman. 109 Qv' 2 A .,..,, . 4 riff: 4 07,7 i If 'if A MW k. YW, 44 4 4,124 f gg H3 5 9 a A 3 P' 'V ,,. :Km 33 wx O ft lx 'iii' S :Ek , fri? 1 531-'Q 'yggl-Q' . s a -.123 2 'Q' XA Mi' i F sf .. L, --ef f ,A A+' K ll' . SN, , V N . ..5' ,Q 1 U The G-obblersf' J Marie Gertrude Fulton. Sarah Georgiana Grant Florence Greer. Louise Sanderson Hart jean Boughton Hoyt. Leila Durant McLeod. Elsie Nicols. Grace Hannah Robbins Anne Pym Savery. Susan Ellen Smith. Phebe Kirkpatrick Truesdale 1900 Bertha Bates. IIO Miscellaneous. Q5 imc .gas flu 4NRE RM .. gb xxxgs 2,6 Wt1'1ri l stxy - - Vassar College Chapter Ulf 'I'lll2 Society of the Daughters of the American Revolution Miss SALMoN, Rcgezzf. .25 Qfficers. 197 F. M. CROSBY, V726-l?fge1z1'. '97 K. T. APPLEGATE, rS'fcf'ffa:y. ,QQ M. RAY, Z?'msw'w'. Miss Salmon. Miss Start. '97 197 Florence May Crosby, ,Q7 Grace Margaret Gallaher 1 97 Isabel Frances Goodrich. '97 Antoinette Newell. 797 Florence Caroline Powell. MISS START, f3eg1'5z'rzz1'. 797 A. NEWELL, Hi'lSf0l'fd7l Members, li atharine Traiiord Applegate. II2 Y97 .98 .98 ,99 '99 7 99 99 99 Grace Clark Straight. Alice Baker Guy. lane Catharine Marsh. Harriet Nevins Ballance. Mabel Ray. Sara Fox Robb. Rosarnoncl Roberts. Alice Robinson Taggart. Vassar College Chapter O l T H li College Settlements Association. JF 797 VASSIE JAMES, Eleffor. Miss Ball. Miss Cornwell. Miss Ely. Miss Franklin. Miss Furness. '98 JANE C. MARSH, Wk:-Elecior. Honorary Members. Miss Herholz. Mrs. Kendrick. Miss McCaleb. Miss O'Grady. Miss Underhill. Miss Warren. Miss M. W. Whitney Miss Wylie. Q29 Undergraduate Members. 797 L. V. Alexander. 797 A. W. Post. '99 B. V. Abbott. 797 K. T. Applegate. '97 M. Reimer. 799 H. E. Colburn. '97 M. E. Bailie. '97 A. G. Richey. '99 M. l.. DeFrees. 113 James. A. Beckwith. L. Bishop. L. Bishop. R. Brevoort. H. Brigham. B. Chandler. L. Chesley. Clough. M. Craig. G. Dunning. F. Easton. H. Hardin. F. Hemmings. L. Higgins. C. Honimel. Hotchkiss. M. Kirkland. H. Landlield. I. Lawrence. R. Leverett. M. McMahon. ' Merrill. Meyers. E. Peters. J. Phillips. C. Powell. A. A. E. B G C I . K 1? B. E L. M L. P. R J. F. H. J. S. L. B. N A F E W. Sawyer. H. Storke. W. Sutton. L. Tiffany. B. Tweedy. P. Verhoefi Adams. Blunt. Borden. Crosley. F. Eddy. G. Eddy. Ferris. B. justice. D. Lovell. McCulloch. C. Marsh. A. Maynard. E. Mount. R. Murdoch W. Norton. O. Rice. Seymour. M. Smith. H. Stone. E. Taylor. C. Ward. II4 '99 H F99 E 199 G '99 199 '99 C ,QQ C. '99 G . F. Faxon. . L. Garrett. . B. Heard. E. L. jacobus A. E. jenkins. . L. johnson. A. McCaffrey. . Morrill. '99 M. Murray. ,QQ E. Nicols. '99 I- ,99 E 799 E ,99 B. ,99 P. ,99 l. '99 A T. Phillips. . K. Ray. . S. Russell. A. Trernbor. K. Truesdale. L. Vanderslice . Van Inwegen. ,QQ R. Wheeler. 799 I. F. Wicker ,99 A. H. Wilson ,99 A. H. lVare 1900 1900 1900 1900 1900 1900 A. Budington. H. N. Greenhalge F. Harrah. E. A. Lord. L. Marsalis. E. L. Warner. LJ E The Society Ol' PHI Granddaughters of Vassar College Q29 M. E. BAILIE, Pfffrifielzi. B. RICHARDSON , VER'-Presz'df71f. A. S. TUTTLE, Sfwfefafy ami Tfeaszzrer. 97 Mary Evans Bailie. ,QQ Anna Seeley Tuttle. 97 Elizabeth Loraine Bishop. ,QQ Abby Huntington Ware. 97 Helen Louise Bishop. IQOO Marion Benedict. 99 Bertha Richardson. r9oo Ruth Raymond Richardson 99 Mary Esty Stowell. IQOO Winifred Morse Richardson Honorary Members. Miss Ely. Mrs. Van Ingen. Miss Whitney. Mr. Van Ingen. Miss Wood. IIS QQTTT' - --enero M- 3 r - ' xx if fi We l' : 9 'L Q2 7 A M Q H fl X if DFL. ff Af 'X 'x -, , ,g h'-4 ,' , Aflfsrfl' L ,, s- X., X ' f Q T255 3 . ri-4' X 'i A --we f' Slew Q iff .J zfvN so s s ff ' 2S1v' . ,i ? .gg'1 f Y s- ' V-:f I if' 5213 ' A5 - K' ,M Ei ff fm ,- f 1 . Y I-4: 1 5 'Sf 'F ' 'r A - , Lge, ,Qt y HV! 5. + ik is f -1 Ps, ff Q eg -5 4 mf-,JN A fig 51- A wg , ' 1 ---mm--5 fs we .X 344, e J 1 gg.: as F: at l7o-Q A pm? Q . 1'-' ge 'H- 'f?5 'fig A 'igU'f's' 3422 Es.-'W M , qv., 2 gr gf?- V E. fi!! ew England Club. 97 GRACE B. TWEEDY, Prcszdenf. '98 LAURA O. RICE, Members. Maine, . . New H ampshire, . Vermont, . . Massachusetts, Rhode Island, Connecticut, . . II6 Secfefary and Tfeaszzrer. 3 4 -3 22 4 zo X2 34 597 SARAH E. DUDLEY, H'esz'f!wzf. '98 LUCY B. HEMPHILL, Wu'-Hfesiriefzf. 799 ANNIE C. JON ES, Sfcrefmji amz' Y9'e4z.fm'e'1'. Members. Arkansas, . . 1 Florida, . 1 Georgia 1 Kentucky, . 4 Mississipi, . 1 Missouri, . . 3 Norih Carolina, . 3 Tennesee, . . 4 Texas, . . . 1 Associate Members. Miss johnson. Mrs. Kendrick. 1 Mrs. Moore. '88, Miss Poppenheim. '89 Miss L. Poppenheim. ,79 Miss Richardson. Honorary Members. james Lane Allen, john Fox, Ir. Thomas Nelson Page. 117 Civitas. all Elisabeth Bushnell Atkinson Frances Agnes Beckwith. Adelaide Clallin. P -Sarah Eleanor Dudley. Grace Margaret Gallaher. Vassie james. Nancy Vincent McClelland. Edna Virginia Moffett. Marie Reimer. Marion Schibsby. Iessie Isabelle Thain. Maidie MacWhorter Traver. Katharine Belcher. Fannie Borden. Alice Newman Gibbons. Ella Virginia jones. Mary MacColl. jane Robb Murdoch. Louise Robbins. Bina Seymour. 118 .2 H - . X X ' J f I F - l 9 . :MB K EIQQQS QQ? 7. A. W l 5 3 4' M Cglll All , ' fm' A f' A. fllflllllfr Q Q llllis Fei ' ' 5 I M l'x. lilftlM '97 S. F. PLATT, Bfesidefzi. 7 ' MQ 2--'-' 1700- '98 L. ROBBINS, V256-H-wz'fz'efzz'. '98 K. P. LARRABEE, Serrefary and Treasurfr. Members. y97 F. B. Bernkopf. '97 H. Peters. ,97 S. F. Platt. '97 G. Smith. '98 K. P. Larrabee. '98 I.. Robbins. '98 E . M. Serviss. 199 J. Van Syclcel. IQOO IQOO IQOO 1900 IQOO IQOO A. S. Belknap. A. L. Calm. H. D. Gallagher H. A. Hill. M. Lovett. J. M. Scarborough. H9 . is 7'8 i-. ff: 'ft 'f,li2t'.: 'w '41 iif w1. -.MKS 1.1SF h'-?Z' 1 . I rg, ' 'G 3 li J J 'R ff!!! 120 '97 M ISS LEACH, H'etz'1!e1z1f. '97 E. M. LCRD, Wm-H'e.rz'rz'ffzf. '98 R. A. SHEPARD, Serrefaffy aim' 7l'6lI57fl7'67 Q5 Members. Miss Ball. Miss Bickford. Miss F. Bracq. Mrs. Dwight. Miss Ely. Miss Herholz. Miss johnson. Mrs. Kendrick. Miss Macurdy. Mrs.Moore. Miss Neef Miss Salmon. Mrs. Taylor. Dr. Thelberg. Miss Wiggin. Miss Wilcox. '96 A. Moore. '96 A. Schwartz. '97 F. A. Beckwith. '97 F. B. Bernkopf. '97 H. L. Bishop, '97 A. C. Bowman. '97 E. C. Brill. '97 C. K. Brown. M 'Q7 . L. Chesley. '97 G. Clough. '97 M. G. Dunning. '97 N. I. I. Ferrell. E. H. Hazeltine. '97 V. james. '97 E. M. Lord. '97 M. M. McMahon. '97 J. F. McNair. '97 M. Merrill. '97 E. V. Moffett. '97 S. J. Phillips. '97 S. F. Platt. 797 A. W. Sawyer. '97 R. C Schaufiler. '97 G. C. Straight. '97 E. W. Sutton. '97 G. B. Tweedy. '98 E. Belknap. '98 M. R. Benway. '98 L. A. Chamberlain. '98 A. W. Clark. 98 G 7 . I. Haviland. '98 L. Robbins. '98 R. A. Shepard. '98 A. Wentworth. '99 K. F. Belcher. Q9 H. Blumenthal. '99 L. A. Chamberlain. '99 L. Ettenson. '99 I. G. Foster. '99 G. Morrill. '99 M. L. Patterson. '99 E. S. Russell. '99 H. W. Stockholm. '99 M. E. Stowell. IQOO K. C. Baxter. 1900 P. H. Beadle. 1900 A. S. Belknap. x9oo P. B. Day. 1900 A. L. Eiseman. 1900 H. EI Ettenson. 1900 R. T. Vaughan. IQOO E. S. Wagar. 1 ff 1 MISS l!VHI'I NEY, Dz'1'efir27. Rubin f 797 S. J. PHILLIPS, Pfcsirimf. Miss Whitney. Miss Furness. Miss johnson. Miss King. '96 A. Hero. '96 A. Moore. '96 j. A. Schwartz. '97 M. I.. CHESLEY, Wu-Presz'zz'e11z'. '98 F. BORDEN, Szw'f'fm'y zmzz' T 72415111 ef. Honorary Members. Mrs. Harriet M. Miller. Mrs. Henry Van Ingen. Mr. John Burroughs. Members. 797 H. B. Comstock. 797 E. M. Craig. '97 S. E. Dudley. '97 N. 1.1. Ferrell. 797 V. james. ,97 E. M. Lord. ,97 S. Phillips. 797 F. A. Beckwith. 797 F. C. Powell. ,97 A. P. Braislin. '97 B. Shaw. ,97 M. H. Brigham. '98 F. Borden. 797 G. F. Brittain. '98 M. E. Del.,any. '97 M. L. Chesley. '98 bl. G. Gardner. '99 J. T. Phillips. 1 'I M. H F zozmetfwwrn Srwifmfg eggvoifgfi 2 .-mv-rw 2' 357229552 sam ' Fifi? B. Granger. I. Haight. Hart. D. Mathewson. F. C. Mallon. The Marshall Q5 '97 C. P. VERHOEFF, Hfesz'1ienz'. '98 M. R. Members. W. Anderson. E. Anderson. T. Applegate. B. Atkinson. A. Beckwith. I.. Bishop. B. Bernkopi P. Braislin. H. Brigham. F. Brittain. T. Burehard. B. Chandler. P. Chapin. B. Chase. L. Chesley. Clough. B. Comstock. Cook. M. Craig. Crane. M. Crosby. F. Easton. Ellery. I. I. S. Ferrell. Guyer. F. Hemmings. B. Heywood. O. Hutchinson. ' '98 'G. J. I. Thain. E H. E. Mills. V. james. M. E. Leverett. B. Meyers. A. Newell. I Patterson. I-I. Peters. S. F. Platt. A. W. Post. F. C. Powell. A. H. Storke. -w S. B. Staton. . C. Thornton. A. Whiton. Club. F ERRIS, Serrefmjf. '98 H. S. Greenwood '98 A. B. Guy '98 F. Hart '98 P. A. Hatfield. '98 L. B. Hemphill. '98 H. M. Hequembourg '98 J. B. Howard. '98 D. E. Jefferson. '98 L. B. Justice. '98 A. Kauffman. R. C. Schaufller. '98 K. P. Larrabee. '98 P. D. Lovell. '98 R. McCall. H. N. Ballance. . R. Benway. Borden. . A. Cobb. Crosley. E. De Lany. F. Foster. '98 A. C. MacFarlane. '98 G. I. Maltman. '98 C. Marsh. '98 J. R. Murdoch. '98 S. W. Norton. '98 F. W. Olivet. '98 A. B. Parker. '98 L. F. Potter. '98 L. O. Price. '98 L. Robbins. . De E. Freeman. '98 R. Shepard. G. Gardner. M. Garvin. N. Gibbons. S. Gibbons. '98 S. F. Sheppard. '98 I. W. Sleight '98 A. H. Stone. '98 F. E. Taylor. L'A. Voorhees. '98 A. Wentworth. T22 lf!! The Campaign? Other Candidates were ' l ' ' ' - -af? Vi? . Q A 1391 ,,,' wtf' p, .- V 4' A 7, U., I23 Th -YQQFMEMHCCLVV5-Uf7LeT1770n.l ell:-lI17jTo17 Wbvklnjmenp THQ fflhlej .Sound l'l'2o1'zg-5 Club, 'Flu Mew Womans gold .sfandcucl i5TQ9W 'l, 'Flu Cl,5socla.Tul mEKlnlejlfes o'ffl'leH0.T11Tne1- 'Flu-. ' and C1r.,,.'1, g0lgl:Bmj5 of Clqaflwflleullle 4 will call on l'l'lv-,THQ Kmlcsy al' lqls l1ome,l,lo.l Leclun-A-Row, CLQ,1-l'l'ay-ll c:-FrlCl0.-5 Qvehl-TH, Oclf lb, al' fidorlock. 61 ll lojal -Rekwxllllcahs 0.1-e ll'lVlYCCl Yo be b'!'2S8'U'l'f YHQTCMS HG.l7I'1lJ,. lymic sl Hlfenllon golf! .Bwjf qv a. n cl JW 3655 JVkQ2Tl-Nj Nallbnal Democmlir. Tariy vrnvnfsl-pl' ln l'lu 1xLcYi..1-L 'E00 '1 al' el!-iluf' COITIE F7Olb0C.Ta.'l'5 I-Fl'lC1'ElS 321' lflmf. Ya 'I'C'FdTfTl, COTFIQ -Eefnublicans Hf,.,, ll have o. CPIQHLL afil' Foo, Haan- l,YC.Vlfl'1iTng5fL,Cu113'r-essma.n .B7-zf1lfen1-iJje4,,??-Z::J1'F1,-3 can-lyfa 111-:J jenzvffar U37-m5 of Q1-Afansas lnulres S0-ll 'V1'wf- Silva?-ffej Yo ll:m.1' Hxfev- of Q Sumflnfuus Eamqueql' PD LL jlvtn lf'I IYFHA7' 070 rf H071 Wm J.:B7l70U and IHS ClLm.1-mlnj wlfze. 'Tn Aajfven a.1 H-me H',L.Il g House. a.'l F-PM -Roamk Hn Hou uNqRe,l:ul:lll1:cLn? mnjou won-IT To he able V0 ISO-jj U0 l un'l'cL'r-5 Conlrl bbfllons fl' N 3? 0 EP Ov, . Com: To The TC1.T1El IXHCLSS mneflng 'l'Q..1g5p.,r nn Hn Lacfure -Room. 3,3665-I-'25 BB .grbealter-Reed .S n To ev-la'l'orSl1er-mary G Q 7' fllllm,la1gM.'+1mffef 0-YR Hanna wlll jlJ'f2SlUlf- Cam Paijh 3a'r1j5 UJHJ Sf7GCCbC.S a. jvocl a.s. Tha.-gold 'l'l1e5 advoaafe Overflow main s WH'l-I Tl1lenT of 7'He in-.s'l'ordev1 f z Menu for Silverites Banquet. Q25 Soups. McKinley in the Soup. Fish. Stewed green fish, 12 Za Hobart. McKinley on the half-shell. E71 Zrek. Gold Democrats. ' Dz'saj1j11'0baz'iozz Sauce. Mefzfs. r. Roasted Platforms. Sf. Louis Garzzifure. 2. Stewed Tariff. 0 Za Prafecfzbfz. 3. john Bullroxasted whole. Seasoned with non-imitation. 4 Vfgefzzbles. Haslied-browned Gold Bugs. Squashecl Republican Hopes. Desserts. Floating Democracy in sea of prosperity. Angel Food. Rerzfe jG'01Il Mrs. Bryafis mem cook-book fGold and Silverj Cake. Ijrizzks. Flow of Oratory. Extract of Patriotism. Wine of Success. 125 'Irv Tulle' .' A11zt'r1'm. Campaign McKinley 'tis of thee, Scion of Liberty, Of thee We're Loud we shall s told 1 ing thy name, Fur we shall spread thy fame, And through the world proclaim Billy and Gold l Tum' .' YVVKZIIIZ7, 7'7'6l1llfJ, 77'fz111p. Cheer, cheer, cheer for General Palmer l Cheer for Buckner and Free Trade I Cheer for Cleveland and for gold, As we did in days of old ! We will put this Wlilliam Bryan in the shade l I-lere's to oL1r h Time .' ,lfzzrfh1'1zg'Mrzmgh Gz'01'gz'zI. Icliinley. May his platform 'long hold sway l Down with William Bryan, For the gold will win the day. Democrats and Popoerats had better run away. Raise high the banner of Freedom ! Q' i V , , , fs f ,,. - 'P . 1- 1 ..,, C ,J l' , i f W ff-f' X. Q W if x em? if f e r A y K . N 'X , Mgr, . if 5 we ,P 1 4 'Mfx f x Q ' I . l- - 1' ff Q ff f NCB 4' f r ' 5 I r' X if-N1 A , N fffxx YA M6317 rl I ,J fly rj r 3'.i .. I It YJ! ,Y - I I ,. 4 In My XLXL' if . Y - f if !f E V .. iv . 3 . fir . ' l it r - .lfff 2 lghfl ff ,, fa , if -fy -t , .- 7 io n ic if .ff , , ,Q V in I . IRM-f 7 120 f D171-Aflf, Daily, Mcliinley, Mcliinley, we give you our promise true. The third of November, we'll cast in our vote for you. XVe must have an honest dollar, And so for you xve'll holler. 'We'll give you fame, You'll win the game, For all Chappieville's solid for you. Solomon Luffi. Hurrah for brave McKinley, For Garret Hobart true I A ballot that is cast for them Is cast forfreedorn, too. Prosperity, Protection, XVe're going to vote them in. We'll carry the election, McKinley's going to win ! i A7 X Q fix y i 1 4 N 1 ,yi ff!! ,f I ffl x BX JJ it A Sl lxfifx .Ext Vli' - if ff fl ig . ' E 127 .. izgy gl ,I ..f:':2:'.6 :3:-:,. 3-27 I:- 5-7552152:2152f2?'27'f1E?51E'3s1E'EIfI:illlzfiizfff .. V ' ' :f .-: :a44:-144, ,.,.2?-:iafkfibi :U5'?QI: fi w.........,..,gg....,,,.,,.,.g,gy,.,....., . ..-Q..fz.,,...,.g....,.f,aI.-U,.........a.m..1I.tm--m Q2-gfQ'-rwfwzfc-11:1-:aclww-11:-:':f:f::-w:rfu':'u':'u:iw -rf: X 1 ff' -- . , a - - Y H., 9.9 .1 , X ' - -- , Ja... A p - -' 51.9 - , ,.,,..... ,. emit Q .f......,..,. , , ,,. . -- I W... .V... O O O I ,Q O 'O M-f EPUBLIC :Mama Nffrloxm. vlifgrno Sowfu f TECYPLES, ..,....',.u .U...l... .U..-..- ..-....-. .....-fi..- ..., ......, . ,.....,... .. ...- A., ......,,. K... .,.- . ,......... I .g11::1:,: I ..:: I L' Y-1 . 1 ... ... I ,f........ M1 1 .f- .,,.,1,,,u ..,,.mf.., .---...U--I I ' n - .......A I ..,...... a ...,..,,,. I ,.H,.,,.,.. l -.....,,.. I ....... n .....g..J ,.... ... ,-,.,.,... . ..,.....,.-. . ......,.... 1 I ....... ..... - .',. . .. ...., ..... . ,.,.,,-.. I . .... ,..,.. . ,. . ..... ...,. . .:,. . ., ,.,. .V ..., ...... . ., ,.,.,.-., . .. ...., . .... ., . I 1 I 1 ' . 1 I 1 . . u I 'IB5'WE'I1IE' ' ' I ., I I I I m 1 J nn n f I , I . . . - ' ' 'HK'E -'HH' H mmrmnnm n I m,f.,,,,.Q. 1 mmm l n- IBHIWUIEI um-1-v.-... I I I :ufixn-1 I rffmfwn ' 1 wana, I m 'IFHHH '- III!! l .-nn-If.: I - -A.- l IIJIWIZI I l I n.u.u...m I I I x ,mmf I I I muiu us I I I I :Mellini I I . lfu.,,,.x u I I lxuuunl llUEBElINU!mIl llmFlWll1lImmlmllImTHIl- IIWMIKIBMKMSIBMMMEIEMMMIIUMMIHIUMUTBII1 llMml!SUllm!l1l1m!ulxr1m11lmlllrm'!lll7lu ullunlrlnllll llMimlll!llUlil llMlEllmHHlMlEmmEll ll1mmlzmn n nlm!lm-llmmillrllll ll l I IIIIIIR-IITINHIIH-I ll l n W... . . rilzvewulw 'X '.'.f',1m...'.'.'. nnnn' m' 1 '.',',',', .,. ... in !lmn:mnng: : : : : :n f -'-' - M .J:-1-.ha-rw .-mi , - 1: 'iw - 1 . - ,K -- M ww WL' flvzsvky- T- , ' '11- 29 ' ' Sumd' IIA? Exim L. I' ' 1 fd - Iha cferk whosafnegrfnz 5co!n Csld Damn-iI:'3l i I efiri vffne WIEU af' Vassar, I0 I28 ff! f - ,' ,f . -- x f Z Q 'V .,:, I r'yX A32 N. x 'eg' as fx 'UE We xl 's . , 1 rx ' rag-1 r 4, 7. ,... fy, ' , W Xa 1:- f b f JIM' 'li d w g 4 LZ! 414, f .3 wmv' Z vfnv L. L I 7,1 , , if NNW ' X f. , . Q., - M , 4 X-Q, 1' 1e.,f f., V, X- --...,. r ., V x 74 M-'r 'A xv , -- wif- h x' 'f1,x,X- Y f igl ' 5 ' I-5,35 .Y 5 . ..q.,:iaff 4 3' .f, 2, ,.f, . ffj HMA I f ,G 51155 55 L M- , .f 44,wz.,,4., wwf. ,. ,, 1 . , H : 'Lf .' 4'x -. Q M , ,P ' :A jg, f A -4, ff f, rr A r A if .. , W' V7 ,ZH ff ff ' 1- ,f2e2?15f??' 7? if ' 'Miz' ,-' 92 fl Qffrlre-fyiff:-fn 4f'.Qvi',eiW1ffn- A 5 f Y ...wx x gs f -- A .A V -A' ' -fz,,-- iff-'-'rw - 1 N gig g E fa g - , fl ww, -.W ,..a2'f?Qfy,,v-fwf' my? 5 ,V va,-.X ., 5,21 I W .,,, ,.., Q, ,A-H , . 0 QXu?m -if Yo Wo C+ A+ Reception' October I, 1896. Q5 Committee. LILLIAN CHAPMAN HOMMEL, Clhllliflllllll. Grace Hannah Landfield. Louise Ellen Potter. Antoinette Newell. Jane Dransfield. Alice Bennett Parker. Florence Emily Sprague 130 , , 'z .Ng ., . . Ji,-. ' ' 'ff v.,,:a?4A.1.r V 'ip i . ., , T, ' tw 3 .5-EX E sg in e-3341 Raymond House, .A.1 L X 5333. TW-71551571 Ground broken on - - --533, 531,333 23 Ifziqiqr 53351: ' O er ' 1 x-'ilidlg .,, lid 123,513 E33 jjfiiq-Ii, aging 1896. ' ' A loo Q13 llllli i1 E4?lf17gii7Tff'?7'3?!7 uw 1 1 I.. f' ?ifi'fi'ii ' -'v' i-34-1-4,17 M., V u '- V 'ALqWM 2l JK . 791575 ,ML Y 1' ,abt . 4. . ' f Recitation Hall. I Q -4 ':5Q1z.Qw, ,- 4 or A av v V A , E? V ' Wgfbzs ' . ' 371 ' w- f 3f:1qg:,,f5:r'.., if . Haig ' '- -' 'i I-'zz A P' , : ' Built by the gm of Mr, john , i sg gh, Q M y 1,,V V J f I N D. Rockefeller , E- 1 n ' 4 I -z-:V f ,.-:,:,:.. 4 - e --W' 1 -,xfe tz-.1 f::r-:r f 'i-. -:-W , 413912194219-' . , - Ground broken on Octo- bel 8 6 , ' 147 I 9 ' - ,...,4.,..-rua.-wma gm,-v--'-' Mk- 705. y. K-we'-'Wiz y-4, 90625 ,Zfjy f ,y fx M y f f N-we 5-:fzf.1fme:'.e'1-eff. 4 53, xv, 1 ,. M. ,,.,.,J, ,Q-.M ,,l,,a '.r- ' ,SQL . ,. ff-.fave-F11 .-'22-.:':i'.,:,. g ' ' M I I ,,, , , .,,. ,W . , '-...-'-eww ,C 7-an-sf.-.-41.4-1-:A ea- W: ma:-1 xv es , - . wff- -'fs' fwfr 'f ff' fr .4 W- ifftfr' - 5. . V- -avg..-: , ,M ,Wa .,a,v-fi, ,W.e2Zrg,ggmym--aye-21f..-, Q- ,3,1,pg.,1 4 -V 1 -. ,. Q, ,443-',4 ' . :,..5f: Tf fj'5 'v Af'5 .'f'1 L2 5-'Z u, ,g - ff 4.51, -. rf as ,i. f:.'3,Jff::-'a::f,,:- fr- ,- ,, - lgfzfff 1 45 I '. o ' Exercises. Address by Mary E. Chambers, President of the Senior Class. Address by President Taylor. Breaking of the ground with Matthew Vassar's Spade. Alma Mater Song. ISI Annual Trip to Mohonk JW October 17 and November 8, 1896. Il 132 a11oWe'en Party, October 30, 1896. MWKWW T33 QM? T34 7 XY Senior Parlor Opening. November 7, 1896. at Committee. Elisabeth Bushnell Atkinson. Anna Priscilla Brziislin. Roszimond Renwick Brevoort Annie Borden Chase. Nellie I. Idylyne Ferrell, Katharine Trafford Applegate. Mildred Walker Anderson. I 3 .. N in , -Q:-mf A ,F I VAssAn', Q: 4' Tdpskkovvaaplowa -I ,,f':zf11' , A 2. fig, Ago, . -mrvlro 1 ' . '?f,., ' M ira' 'MSA if vf ' 'W-1w:' , 4g f- w 1' v :v,.,L- :,: Sophomore Party November 13, 1896 Q25 Committee. ELSIE NICOLS. Q GRACE HANNAH 1ioBB1Ns. MABEL XVEBSTER BROWN. 136 First Hall Play. it November 21, 1896. at . Americans Abroad. Caste. GILBERT RAYh'IOND, . A. G. Richey RICHARD FAIRBANKS, G. B. Tweedy LANDOLPHE, . . . L. Eddy CASSIMIR LAJOLLY, . . B. Shaw PENDLETON, . . E. Belknap FLORENCE XVINTHROP, Miss Jenkins JESSIE FAIRBANRQ, . Miss Chambers BARONESS DE BEAUMONT, . Miss Beau I Committee. E. L. BAKER. 'I. E. PATTERSON. A. W. POST. A. NEWELL. L. ROBBINS. M. CRAIG. A. P. SAVERY. l 137 Philalethean Anniversary. C55 Philaletbean Reception, December 4, 1896. Address of Welcome. . . . ...,.,....... . ...... MISS EMMA LESTER BAKER Address ...... ,,,,,, ,,,, , I OHN IQENDRICK BANGS Commjflrf. Alice Freeborn Easton. Katharine 'lrafforfl Applegate. Carolyn Gertrude Heywood. Belle Louise Tiffany. Amy Wentworth. Lillian Chapman Hommel. Mabel Ray. Fanny Borden. Ruby Seymour Gibbons. Glee Club Concert, December 5, 1896. 138 J- Second Hall Play. December 19, 1896. Q4 A Scrap of Paper. Cast. PROSPER COURAMONT, . M. S. Brown BARON DE LA GLACIERE, C. K. Brown BRISEMOUCHE QNatui-alistj, M. Lord ANATOLE fhis Wardj, . V. Barnard BAPTISTE QSe1'v:11itj, . C. R. Home LOUISE DE LA GLACIERE, . Miss Ward MLLE. SUZANNE DE RUsEv1Li,E, -, Miss Mahan lVlA'l'I-IILDE QSisteE to Louisej Miss Bragg BlLLE. ZENOBIE, . Miss G. M. Wariier PAULINE QMaidj, . Miss Maltmau Committee. G. F. Bu1'1 1'A1N. M. BAILIE. L. 0. RICE. F. C. lV.lALLON. A U. E, CHANDLER P. A. HATFIELD. L. O. PERRIN. l39 A ,Sf ,Q 52 2-if gig? if fe H Z if .qufw . Uhlxl i . 1 f 5 I wg-f wiiq i'-1': A A Valentinis Day February 13, 1897. 140 A Third Hall Play, February 13, 1897. at . Caste. Cast. HON. GEORGE D'ALROY, CAPTAIN HAXV'lxREE, ECCLES, . . . SAMUEL GERRIDGE, . MARQUISE DE ST. MAUR, A E. E. Miersch . M. Burr M. Reimer . E. L. Baker Miss Bailie POLLY Eccuss, . Miss Atkinson ESTHER ECCLES, . Miss Bates DIXON, . . . F. I-Izu'rah Committee. A. B. CHASE. B. COOK. A. B. PARKER. L. C. HOMMEL. A. S. TUTTLE. F. DORRANCE. 141 l Vvashingtods Birthday. February 22, 1897. es Lady Washangtons, Most respectfully informs the Ladies and Gentlemen of Vassar, she intends having at Concert at the Assembly Room on Monday, February zzndg assures 'them she will use her every exertion to render the entertainment ofthe evening attractiveg the following is the selection for the occasion : Sang: Coming Thro' the Rye . MISTRESS l-IOMMEL. Song. Robin Adair . NIISTRESS '1'1F1fANYi A Q1m7'fe'Zz'f. Blue Bells of Scotland . . . Song. Flow Gently, Sweet Afton . . NIASTER PLBBOTT. Song. Auld Lang Syne .,... M1sTREss PETERS, Music will be provided for those Ladies and Gentlemen who choose to have 2. Ball after the Concert. I42 Aff' is Fourth Hall Play. March 20, 1897. l Mrs. Hardcastle Miss Hardcastle Miss Neville Dolly . . Sir Charles Marlow Young Marlow . Mr. Hardcastle Mr. Hastings . Tony Lumpkin Landlord . A. F. Easton. M. K. Benedict. She Stoops to Conquer. Cast. . Miss Applegate. Miss Ti-uesdale. . Miss Ray. Miss Nicols, E. Belknap, . L. Edson, H. Haight F. Hotchkiss L. Hosmer . . . A. Wentworth Committee. C. P. Verhoelii S. F. Sheppard. F. YV. Adlem. J. Dransiielcl. T43 Foundeifs Day. April 30, 1397. C25 Committee. Fzzrzzlgf. Dr. Thelberg. Mrs. Kendrick. Dr. Moore. Professor Van lngen. Miss M. E. Cooley. Sfzzdmfs. Irene Edwards Patterson. Harriet Elizabeth Beard. Grace Mabel Garvin. Lucretia Glover Eddy. Louise Sanderson Hart Christel Whipple Wilkins. T44 YW Q gf Class Day. 1 June 8, 1897. MARIE REIMER and . . . fwkfoffizzffs. GRACE MARGARET GALI,AHER ELISABETH BUSHNELL ATKxNsoN . .Sjbadf Onzfar. ANTOINETTE NEWELL .... . jllmzvhaf. Committee. G. F. Briltain. G. B. Tweedy. L. C. Hommel. G. M. Chesley. E. Guyer. A. L. Wilkinson. R. R. Brevoort. I45 Commencement. ee VASSAR COLLEGE Thirty-Second Year. Q96 June Eighth, Eighteen Hundred ana Ninefy-Seven. gwygof Q 4.1 ffriallz -E +0 X5 XE S' E gb F ' ..,. MS S ?Q -.x . , gfe42e2,2ffff'f e Poughkeepsie, New York. 146 W W 7 LK ' r if f I , X .5 'J X N ' SN fi N 9 -1F5.6Th--gs-du LX 0 M Q 1-I7 .1-F -'. i X X, e l t X 0? N X, pa LA X x V il + T . A X 4 ' , f IQ 1 0 is X af .--1 u xi i yqlfwxl vig, up ,, 4 . all f i u gk! L. 'B 1 v e 'P l l 145 X num xx +G! lf! ri' '-s Y 4 r l , . '-f. U SP, ll' N l1,4,Tl'1SSARY. Chapel Echoes. Those unexpected symphonies, The organ's gentle pleading, VVhich give the proper emphasis To P1'exy's scripture reading. That earliest voice we hear in prayer, VVhich untold comfort Ends In begging that some glorious light Eliminate our minds. That scientific fact we learned, So startling in its line, That on the unjust and the just The falling rain does shine. That dreadful voice that cries Aha ! And frights us with its roar, The laughing of the mighty horse As he goes forth to war. ,- f1....,,,, G H77 ,Xa VI r G59 , f, 5 ' A E EB E Ulfii?Li7H Q A EE .uf EEE TW was Hull is-25 M 148 We are glad at last to say with our front door The Spring is Broke. Basket ball, according to our physician, is a sight for gods and men, but the gods get it all. Economically considered, it is never well to shut up the Mills. Qzcery.-Wluat is the essential difference between juggling with one's conscience and with the printer's devil? INSTRUCTOR fgoifzg info 11zz'l!z'1ze1fy storey, I wish to buy a small cock-tail. Mr. Bryan had not come on the scene last year, as you may infer by looking at the cover of the '96 Vassarion. PROFESSOR IN PSYCHOLOGY Qooz' Physiologyj Miss 1-, ex- plain how the air is purified in the lungs. t ANNOUNCEMENT BY A SENIOR.- Do you know that three of our Professors went up to Princeton this fall to celebrate their one hundred and fiftieth anniversary I 'Young ladies, you can well afford to take off' your hats to the Puritansf' Historical method of the Sophomore year.- Don't learn dates. Don't, I beg of you, learn dates. Simply know when things happened. VVANTED ! An explanation of the term doodle. Hoot awa, mon, ye dinna ken. Na, na, ye canna ha mair than ane orange. Ilka lassie maun ha the same. NEW PUBLICATION.-A recent manual on Hygiene. Called Back, by Mother Flett. PROFESSOR tio his 7th hour olossj How many of you have an engagement the seventh hour? Let's see, I think most of you are in this class, aren't you ? In the Vassar catalogue one observes that the French is always bracqueted. af' For reference, see Ferdinand's French Revolution or XVestward I-Io. 149 My dear, there is nothing radically wrong in your sitti g up 1 your ioom the night of election to hear the returns, but lf it should get into the papeis, think of the notoriety. The Newgwoman 1 SENSATION AT VASSAR. The Erstwhile Stillness of her Secluded Walls Destroyed by the War Trumpet of Politics. POUGI'IKIClC1'SIE, N. Y., Nov. 4.-Scarcely ever has such wild excitement reigned behind the imposing hedge which shuts out Vassar College from the outside world as held sway last evening. All day the atmosphere had been charged with turmoil, till, as the sun sank in rose and gray splendor, it had reached fever heat. The classes were sparsely at- tended. Democrats met Republicans with clenched hsts. At ten o'clock the gong, which usually brings quiet and repose, sounded, but was answered by wild shrieks. The first returns had come! The athletes were the first on the scene, vaulting bannisters, sliding down elevator ropes. A seething mass of fair hu- manity soon surrounded the bulletin board. As each return came in fil2CWOI'liS were sent off in the corridors, at imminent risk of life and limb. And yet this is the domestic sex I ! 150 beings face in day w J 1 ost-O stand, older wish best A centl tures it I sea sh force i greate difficu a bull few o numb in go that pat oth I elec Pres ers w port c his ma A spoken Word, In voice oft heard. lThe moon serenely melloW,l And what is ihat? A high silk ha+, Ah I quite another fellow. A gloomy night, O, awful sight, A robber fierce and fearfu A maiclen's call, Here take it alll In accents sad and tearful. 151 Answers to Correspondents. Miss V. ERDANT: It is perfectly proper for a girl of sixteen to wear her hair down her back and go to Faculty meeting to inquire for her English professor. QUEEN MAB: The Ave Maria rhyme of which you speak was intro- duced by Chaucer. YOUNG GIRL : The quotation, 'S Ab- salom, Absalom, wherefore art thou Absalom, we have been unable to find in the Bible. LITTLE lQA'L'IEZ I. Yes, dear, you Inay ride in the elevator free of charge. 2. Refreshments are rarely, if ever, served in the chapel. Dining rooms are provided for this purpose, FRIENDLY RE.-XDERI lf your num- ber of pieces in the laundry increase during the process of laundering, you must expect to be charged extra. OUR 'l'HoRoUoH Bass: 't Come, is not generally considered an equivalent for 4' present at roll call. ToM's FRIEND: We are glad, my dear, that you show so Inuch affection for your male relatives. lt is a beauti- ful thing for families to be united in love and admiration. NIODEST SENIOR : Yes, the wearing of a new dress. is a very appropriate means of announcing your engage- ment. SWEET NlARIEZ Yes, adult hen is the term used, when the chick has reached years of discretion. A BELLE: Although forbidden the Sophomore Play, we cannot see how the Faculty can possibly object to your giving private impersonations in your own room. ea' 152 NEW lVIEMBER OF STUDENTS: Do not confuse the Constitution of the Students Association with that of the Contemporary Club. The latter is meant for upper classmen only. V.: Yes, oranges are very good' for the complexion. Never take less than three. MIss J.: Thank you for your kind words. DETACHED : ff Dear Father, is not considered good form for the outside ofa business envelope. l.ovER OF THE BEAUTIFUL: Watch for the Winter Birds l JUNIOR l.VlEMBER2 It is not the cus- tom for the President of the College to pay the students' bills at Smith's. SUNSHINE : It is not to be expected that your professor will go personally to summon you from the Ethic's al-- cove, when the hour has come for the written lesson. INMATES: I should consider a li- brary of 23,ooo volumes amply sufh- cient for the ordinary person. You cer- tainly cannot read more. OUR CORRESPONDENT: No, a cut in the VAssfxRIoN for the Marshall Club does not necessarily imply a cut from an Economics lecture. YOUNG CHILD: Limited space will not allow us to explain the difference between basket-ball and tiddledy- winks. OUR COLLEAGUE: No, the three line couplet did not come from France. SENTIA-IENTAL FRIEND : We are glad to learn that rye bread contains the most nourishing part ofthe wheat. P. S.: All send love. The Faculty at Hockey. xwu X H N ff M K K i rf gf j x I TQ Q .L ,NX 3 N WS?-, qM g fQfXxQ K xx Xml 'M' fgr, M xg: 153 The Vassarion Board.A ' ' Q lgw J W . E :11 , 4 Me A ff ' ,.,- f if ff ,, , '- '-- fj ' V f ff ' A 1 ' ,- 1 1 ' if f X ' f ff , f ' aff ,ff ff' ,.A. 15, I V kno Cxxg T-L.SQQKn 154 l THE FALL OF ETHICS i from September to february. aa THE HOST SUCCESSFUL OF ALL l'lELO:DRAl'lAS. PRESENTED BV THE PEOPLES COMPANY. Grand Scenic Effects.-Way1and's Express with Real Locomotive Head Light. Program. Time.-A cool hour. Place.-Anywhere from the Market Place at Athens to a Pie-Shop N. B.-Pie-Shop connected with '66 0100, to eat. Cast. Count Ug of O . . The Villain Thomas Aquinas A Middle Aged Aristotelian Schibs . . An Unknown Author Pushpin . A Court Fool N. Telechy , An Interpreter joseph . A Butler Noah . . A Porter James . . . . A Tailor Frances Power Cobbe A Lone Spinster Miss De Meanor . . . A Foreigner Stage Director.-Categorical Imperative. Prompter.-Conscience. Questions served at the Gymnasium after the performance. 155 A Scientific Game. 1 I Oz' . Q-Qi 9 Q Fig. I.-Cross Sectxon. . C 9 . . D. . q Q Flg. II.-Longtudmal 4. Q Q Q 0 Section. . Q ' 0 G5 . :1 11.-Nucleus. O Q 3 0 0.-Vacuole. - - - - qu Qu r. -Somites. 5 ' l 1 . rf.-Cilia. -.-J l..- .. - -..---..- 5. -Protoplasm Qresting Q stageb. H.-Motile protoplasm. le' i. r .4Devitalized proto- U . plasma . f.-Nucleated mass of protoplasm. , us. FIG. I. 2' ' 5' C, er A '- 4- .fl ft E . ' Q n 3.1 ,733 Tx ,!fZ3f'21 -gi -. mn. FIG, ll. In taking her lectures throughout the past year, Her heads and her sub-heads We tried to keep clearg But when she was talking so fast, then I fear That even our own heads were not very clear. Cabolistic Correspondence. VVL. ? WY. . Q, S Y G2 M-U-4.6, 4,11 4- at .C Tufpl Tuff THE HOUSE OF LORDS. In session any old time. Subjects for discussion-charms of upper classmen. A. W. I E. G. R. C. S. M. IVI. Szkfers in Mz'5ery. M. I-I. B. A. H. S. C JP 150 Two Nocturnes, X., , PROFESSOR Car jim' 15255. ig fl 1'ecz'!zzfz'o1zl: Before we A? leave this subject, are iiIIl.A!V . 1 fb there any questions you Ml' e , XX I - would like to ask? , ,JN TIMIIJ FRI3sHIIAN: Yes, - . MB'1 N' lmbvf T -W .... . what's your name? A TrIlDNlGl'I'l' XYIXKP1. A MIllNlKilI'l' NAP. SIGNS or THE TIMEs.-When the Choral 95242: f Z Club announce in March that snmer is a-cumin' 4 K in. Y X When the cream pitchers stand on the pantry Xi IFE! shelves. T X4 lfVhen Billy is dead. PRoFEssoR or PHvsIcs: Let us L Hui I now immerse the couple in sulphuric RICCUIJAlf1C'l'l'JNSffl l'l1'll-- -OUR NIGHT acldl YVA'VC 'l lN- NEW DIscovERv! Turkeys with necks which reach through the whole dining room. Do Burrs cling to short skirts? Prospectus of English Lectures for t 1 T he Year. .I if lx x Kipling and Knitting in K. Q6 VJ El? Dobson and Darning in D. Praed and Patchwork in P. X? Hood, Hunt and Hemming in H. In the class, they dissected a cat, ' She fainted away where she sat, 'X She recovered quite soon, From her terrible swoon, ,,,,. lim all Fight, but 0, how is the cat P H I OUR I-IoI,IDAv SIGN. The new students are informed and the old ones reminded that no flash lights, foot-lights, head-lights, delights, alcohol lamps, paper lamp-shades or unnecessary gas are to be used in buildings. There is no restriction, however, on the burning of genius. BY QRDER oIf THE Bolling or TRUS'l'liES. 157 When do you think ofvvorl-1 io do? When your evil deeds rnosi rue? When do you long for sornethina new? When do you wish you wasnt you? When Prexy bubbles over 96 The Spider and the Fly. 96 There has often been a tea P Cher and he, fOr shej has said io you iOr to ine,7 HO, Corne tal-ie rny exam, You will not need to Crain, n'Tis really as easy as can be Don'i you see? He has led you io his den, There and then. He has caught you in his snare, Hh, beware? With sweet words he has beguile D, then has flunlied you with a sinile Hnd has asked you very soon To coine again. gal We had a fine ice carnival With inusic by the band, Hnd all that I can say of it ls that ii was-very estiinable. 158 l W .p 'l i fs , M ,ff 1 v Trees ll! rl .W -2 my 1 'X Q X My if-' -mf If XX , X , mn ,fy f ff! ffl!!! gli!-fy XX l fu: WJ '4 vu, A UW4? 4 rgyiq Q , - XXQQQQNNXQQMQQQ ik f 'sr N ff! Ji V I I' ffvfrffvll bk 2 5 x - N Lsieg-Z Zi g s M 21 I M' X ,frfgiiiih .N Q xg. - X :1 . ' r lf w gl f' , X , I Tlllf S'I'lll'Dl7lN'l' BODY. O, lovely harbingers of Spring, lfVl11ch strength and V1gOl' to us brmg, Your pr ' f rever sing, O suse shall we o D uchess County Eggs. We spurn your rivals from the store, Your soft-boiled joys we clamour for. And e'er shall call for more and more Of t Duchess County Eggs. bl' - Q 'l M Q my mp ff T514 Courses Gffered During the Past Year. PHYSICAL CULTURE. COURSE B.-Sixteen lessons in Delsarte or the art of flying. This is given as an introduction to Transcendental Philosophy. COURSE M.-Fencing. This course was instituted in response to urgent appeals from the Wonianis Rights League. DRAWING. X COURSE G. G.-Curve Tracing. This course is open only to those who have had a certain degree of musical training. Will be offered only while the ice is good. COURSE B.-Biological Reproductions. An extended course in drawing on the imagination. HOUSEKEEPING. A domestic course of great importance in the art of dish-Washing. It is offered to those who have acquired a sufhcient knowledge of beakers and test-tubes. 1 up ., w 'lla' i -i 1.3, 4 . lillif ' te-' tif f Z . ill If , fQfg:4'ff7M A ,ff .W . MWVW ' AFTERMATH. Her eyesight is not very strong, So really she did nothing wrong, X!VllCH she turned in the aisle And said with a smile See, here we go bowling alongf 1 She adjusted her glass to her eye And turned to receive a reply. She was met by a stare, And a dignifled glare, For Prexy was passing her by. 160 ,f 5171! 9 ft Recipes. A juice. Ingredients 3 Paper, one large sheet. Pencil, one lead. Spirits, greatly depressed. Chew pencil violently. Think over past history of the world. If anything laughable has happened since the time of Noah jot it down. If nothing funny has ever happened borrow a few old jokes and change the form. COMPUSITIZ C1z1'rIc:,'x1, Cowsctorfsxicss One must be wily, indeed, to have good results in mak- ing this delicious dish. Take four quarts of critical imagination, hnely sifted. Add slowlya large and square amount of carefully assorted knowledge. Season with a pinch of romanticism, Sub- ject to a thorough Browning. S'l'u1f1fED D,4'I'l'iS. Take several dried facts. Mix with enough interest to make them adhere well, Then fill into dates. Alarlrlcml. THUNDER. Play Basket Ball upstairs. Then go sit down under it. A Poem, Decide on form, Repeat da-di-dum until you are per- fectly familiar with the metre. Decide on first line. Make list in alphabetical order of all words rhyming with last syllable of tirst line, and use those which suit the metre best. Leave choice of title to the editor. Gnmnxw Bam: E1f1f1cc'1-s. Spend one-half hour in Music Hall. L I ,- IGI Library Rules. as I. No student is allowed to use more than six reference books at one time. She may read one, hold two in her hands, and sit on three. 2. None but professors may talk aloud in the library. . Vxfhen using o ular reference books lease ost a notice on our s P P Y back, stating a. How long you expect to use the book yourself. b. To what depth you have promised it. c. Wliethei' you have engaged it for 9.35 P. M. d. Is it any good? e. Additional remarks. ff!! 1 W J y, il I62 ata from 1861 to 1897 June 1864, 1865, 1865. 1866, April 1886, 1889, 1890, 1892, QData From 1861 to 1897.5 '95 Buildings. 98 4, 1861, Ground broken by Matthew Vassar for Main Building. Astronomical Observatory completed. Main Building completed. Lodge erected. Building for Riding School, Gymnasium and Music rooms completed, 1874, altered for Natural History Museum, Gymnasium, Music rooms and Art Gallery, 1890, Gymnasium changed to Hall of Casts, and Laboratories added. 16, 1880, Vassar Brothers' Laboratory opened. Eleanor Conservatory erected. Alumnae Gymnasium erected. One Professors cottage purchased. Four Professors cottages erected. December, 1892, Strong Hall completed. 1893, F. F. Thompson Library Building completed. November, 1896, President's House completed. October 6, I896, Ground broken by President Taylor for Raymond House. October 14, 1896, Ground broken by President Taylor for Recitation Hall. 164 Presidents of the College. at MILO P. JEWETT, LL. D., 1861-64. JOHN H. RAYMOND, LL.D., 1864-78. SAMUEL L. CALDWELL, D.D., 1878-85. J. RYLAND IQENDRICK, D.D., Aciifzg Pffeszklefzz' 1885-1886. JAMES M. TAYLOR, D.D,, 1886 -. :AC Historical Items. .ar April 29, 1792, Matthew Vassar born. january 18, 1861, Vassar Female College incorporated. February 26, 1861, First meeting of the Board of Trustees. September zo, 1865, Opening of the college, professors 8, instructors zo, students 304, number of students increased to 353 by the end of the year. 1866-7, Students first divided into classes, regular students 197, students pursuing special courses, 189. IOS March, 1866, The Founder's birthday established as a holiday. February 1, 1867, The corporate title Vassar Female College changed to Vassar College. june 19, 1867, First Commencement, four graduates. june 17, 1868, Rose and gray adopted as the college colors. june 23, 1868, Matthew Vassar died. June, 1872, Preparatory Department separated from Collegiate. December, 1872, Riding School abolished. I8767 Schools of! Music and Painting established. March 17, 1882, Chapel organ dedicated. june 7, 1887, First Alumna Trustee elected. V June, 1887, Preparatory Department abolished. December 2, 1889, Self-government granted to the students. june I2, 1890, Twenty-fifth anniversary of Vassar College celebrated. December, 1891, Schools of Music and Painting abolished. june, 1894, Seven graduate scholarships established. june, 1895, First fellowship established. 166 Existing Qrganizations wi! Philaletheis, constitution adopted December 5, 1865. Floral Society, organized 1866. Vassariana, published June 27, 1866, superseded by the Transcript, published yearly, june, 1867 to 1870, superseded by the Vassar Miscellany, 1872. - Society of Religious Inquiry, organized March 21, 1867, reorganized into Y. W. C. A., 1885. Students' Association, constitution adopted February 22, 1868. Shakespeare Club, organized 1870. Dickens Club, organized November 5, 1870. Vassar Miscellany, first number issued April, 1872. T. and M. Club, organized April, 1879, reorganized into T. and M. House of Commons, January 23, 1889. Tennis Club, organized April, 1881 3 merged into Athletic Association, 1895. Qui Vive, organized April, 1882, present constitution adopted November 1, 1892. . Vassar College Glee Club, organized bythe Students' Association, june 1, 1882. Thekla, constitution adopted November 7, 1883. Young Womens Christian Association, constitution adopted March 7, 1885. Vassar Chapter ot' the College Settlements Association, constitution adopted May 16, 1891. Hellenic Society, Constitution approved November 30, 1891. Current Topics Club, constitution adopted October 28, 1892. 167 Society ofthe Grancldaughters of Vassar College, constitution adopted Septern ber 27, 1893. New England Club, constitution adopted March 2, 1894. Southern Club, constitution approved October 29, 1894. E. C. S. G. Club, organized February, 1895. Vassar College Athle-tic'Association, constitution adopted March 27, 1895. Choral Club, constitution adopted October 5, 1895. Wake Robin Club, constitution adopted October 26, 1895. Civitas, constitution adopted December 14, 1895. Contemporary Club, constitution approved October 5, 1896. Vassar College Mandolin and Guitar Club, organized by the Students' Associa- tion, October 22, 1896. Vassar College Chapter ofthe Society ofthe Daughters ofthe American Revo- lution, constitution adopted February 16, 1897. Marshall Club, constitution adopted February 26, 1897. , 108 1867. H. 1868. S. 1869. A. 1876, bl. 1871. E. 1872. 5. 1873. H. 1874. F. 1867. M. 1868. M 1866. 8. 187o. C. 1871. E. 1872. A. 1873. E. 1874. L. 1865-'66, 1866-'67, 1867-368. 1868-'6g. ISGQ-'7O. 1876-'71. 1871J72. 1372-Y73. 1373'374- 1874-'75. 1875-'76. 1876-'77, 1877-'78. 1378-'7Q. 1879-'8o. 1880-'81. 1867-'68. 1868-'69. IS6Q-'7O. IS'7O-,7I. Vifarner. Blatcliley. M. Glidden. Denton. Folsom. Catlin, C. Hiscock. A. L. A. M. A. M. Cushing. L. Dickinson. P. Rhodes. E. Daniels. W. Ritch. L. Hawks. W. Foster. D. Swift. A. Hill. john H. Raymond. M. L. Dickinson. S. L. Blatcliley. M. Glidden. E. D. Storer. E. M. Folsom. E. Hollister. B. Wlilder. E. VV. Barrett. M. B. Taylor. Richards. E. M. Logan. H. R. Ransom. S. F. Richardson. G. F. Cole. H. S. Durand. A. E. S. President M. XV. Wfhitney. M. L. Gilbert. M. Churnar. Valedictorians. 1375 1876. T377 1878 1879 ISSO 1881 1882 Salutatorians. F. CQ 1161-kms. I C. Price. L. 1. wyiie. S. E M L I . G. Wlilkinson. M. Perkins. Reynolds. M, Freeman. M, Patterson. 1875 F. G. Swift. 1876 A M. johnson. 1877 C. P. Swift. 1878. H E. Thompson 1879 E M. Arnold. 1880 C. B. Dow. 1881. A. M. Abbott. 1882. M F. Easton. Presidents of Philaletheis. ISSI-,SZ S. Yamakawa. 1882-'83 M. Foos. 1883-'84 E. O. MacMillan 1884-'85 M. E. Ewing. 1885-'86 M. Wlickliain. 1886-'87 A. A. Berry. 1887-,88. E. L. MacCreery 1888-'89, D. F. Norris. 1889-'91J. G. E. Sanders. ISQO-,QI L. A. Lawrence. 1891-'Q2. E. M. Mast. 1892-'93. A. Whitconib. 18q3Jg4. A. Latimer. 1894-YQS. E. M. 'Welclr 1895-'96 L. Van Anden. 1896-'97 E. L. Baker. s of Students' Association. 1871-'72. S. A. Catlin. 1872-'73, M. Monroe. IS73-Y74. F. M. Cushing. 1874-'75, E. A. Rice. D. Hileman. I 69 1875-' 1876-1 1877-' 1878-7 1879-' 1880-' 1881-' 1882-' 1883-l 1884-l 1867 1868 1869 1870 1871 1872 1373 1874 1875 1876 1377 1878 1379 1880 1881 1868 1870 1876 1877 1878 1879. 1880. 1881 1882 1883 1884 G. H. Learned. Senior Class Presidents. B. F. Sheppard. S. G. 'Wilkinson G. Darling. B. Hazard. M. S. Morris. B. G. Shaw. L. B. Stanton. C. A. Valleau. L. K. Smith. E. Deming. J. P. Clinton. L. Dickinson. E. Glover. M. Glidden. A. Denton. L. Sanford. D. Seelye. C Hiscock. F. Fisher. W. Kellogg. C. Price. E. Bliss. E. Stanton. C. Iordan. I. Preston. G. Bryan. 'Whittem0re. L. Hughes. G. Metcalf. F. Sheppard. M. Wing. D. Kennedy. F Cole. S. White. B. Taylor. Sharpe. A. Townsend. Class Orators. 170 1835-iss. 1886-'87. 1887-'S8. 1888-'89. 1839-,QO. 1890-'91. ISQI-'Q2. 1892-'Q3. 1893-394- 1394-'Qs 1895-'96. 1896-197. 1882. M 1883. A. 1884, A. 1885. 1 Sl 1886. N 12837. I. 1888. G. 1889. E. 1890. E. 1891 M. 1892. A. 1893. E. 1894. B. 1395- J. L. F. Sweetser. G. M. Cleveland. F. T. Patterson. L. B. Poppenheim K. Smith. C. A. Bentley. A. M. Robbins. M. V. Clark. M. B. Mumford. K. C. Reiley. E. McCloskey. V. james. . B. Brittan. H. Lathrop. Blanchard. C. Hening. 'Woosteii Skinner. Rideout. Greer. E. Morris. T. Allen. L. Reed. B. Cutting. Ferry. Greer. 1896. M. N. Sanders. 1897. M. 1885. B. 1886. N. 1887. I. 1888. S. 1889. C. 1890. H 1891. I. 1892. S. 1893. A. 1894. E. 1896. L. E. Chambers. C. Woods. P. Morrill. I. Butcher. G. Chester. B. Weeks. Borginan. M. Ober. E. NVooclbridge. Whitcomb. D. Chater. Madeira. 1868. 1869 1870. 1871 IS72 1873 1874 1375 1876 1868 1869 1870. 1871. 1872. 1873 1874. 1875. 1876. 1877. 1878 1579 1880 1881. 1868 1869. 1870. 1871 1872 1873. 1874. 1875. 1876 1877. 1878. 1879 1880 1881 1882 1883. S. L. Blatchley. 5. L. Stilson. E. R. COFFin. M. Clinton. NV. H. Eliot. M G. Townsend. E. L. Hoyt. M. B. Taylor. Z. XV. Brigham. M L. Avery. K A. Sill. C. WV. Ritch. M D. Glover, M bl. Rawson. A. Skeel. rl. 5. Bennett. E. M. Tappan. E. M. Gifford. M Stoyell. M H. Rollins. L. M. Barr. A. P. Bailey. M H. Stockwell. M E. A. M. A. E. A. K C. A. M, E. A. A. L. L. WV. WVhitney. J. Williams. W. Woods. S. Nicoll. B. Folger. Vtleed. G. Howes. Roberts. T. Hale. H. Dana. NV. Clarke. M. Towner. VanKleec:k. Shove. F. Glenn. Page. Class Poets. Class I-Iistorians. Class Prophets. 171 1878 1885 1887 1888 T393 1394 1395 1896. 1897 1882 1883 1884 1885. 1886 1887 1888. 1889 1890 1891 1892 1393 1894. IBQ5 1896 1884. 1885 1886 1887 1888 1889 1890 1891. 1892 1893 1894 1895 1896 E. Fullick. E. Leonard. E. R. Hoy. M. Rich. E. Neil. L. Howe. S. WV. Hoagland. C. D. Kinkead. N. V. McClelland M. R. Sanford. S. F. Swift. M. F. l.. Hussey. M. W. Craig. E. A. Ferris. M. Sweet. F. L. Mactfreery. A. T. Nettleton. K. Smith. I. XY. Tompkins. S. B. Tunniclitf. E. P. Cobb. L. Howe. A. L. Crawford. J. B. Hart. M. A. Cumnock. G. L. Chubb. C. G. Lingle. A. L. jencks. R. 8. Foster. L. A. Ferrell. C. F. Patterson. D. N. Taylor. M. M. Morton. K. E. V. D. Harker. H. Ellsworth. E. A. Giliner. F. A. Chase. A. Graham. L. Booker. S. YV. Chamberlain C. D. Kinkead. 1868 1869 1870 1871 1872 1573 1874 1375 1876 1877. 1878 1379 1880 1881. 1882. 1869 1870 18711 1872 1873 1874. 1875 1876 1878 1879 1830 1881 1882 I. Carter. B. A. Strong. M. A. Parker. K. Cv. lewett. M. A. Loomis. S. S. Dana. L. H. Brownell. K. M. McBain. M. Clark. M. Thaw. M. VV. Case. E. E. Fletcher. E. M. NVithey. C. A. Lloyd. M. E. Shove. M. G. Mead. E. M. Folsom. A. B. Folger. E. Wfeed. M. VV, Marvin. K. Roberts. M. A. jordan. A. H. Dana. M. Colgate. E. M. Withey. M. H. Stockwell. E. B. Varnes. M. Sharpe. M. L. Dickinson. H. A. L. Mason. S. M. Glazier. H. M. Austin. . E. J. Williams. E. H. jones. Senior Spade Qrators. Junior Spade Qrators. Editors Vassa1'iana. 1 8 6 6 Editors Transcript. 1 8 6 7 -' 6 8 . 1868-'69, 172 1883. A. B. Poinier. 1884. K. L. Smith. 1885. E. Ricker. E. R. Foster. N. H. Canfield. 1886. 1887. 1888. M. Ransom. 1889. M. M. Chamberlain 1890. G. R. Kelly. 1891. E. H. Haight. .1 I8Q2. B. Hartridge. 1893. E. R. Evans. 1894. M. Van Kleeck. 1895. I. Poppenheim. 1896. L. F. Collins. 1897. E. B. Atkinson. 1883. M. E. Adams. 1884. M. W. Craig. 1885. C. G. Lingle. 1886. A. L. Jencks. 1887. M. Rich. 1888. E. K. Hunt. 1889. H. F. Mace. 1890. F. Halliday. ISQI. S. B. Tunnicliff. -1892. R. B. Cooley. 1893. E. A. Gilmer. 1894. A. Graham. 1895. XV. Chamberlain. 1896. b. Dudley. H. A. johnson. H. A. Warner. M. L. Avery. M. W. VVhitney. S. G. Vwlright. E. R. Beckwith. L57 E. L. Hubbard. E. M. Colby. M. H. Norris. E. R. CofHn. '73 H. C. Hiscocl-:. '73 E. D. Swift. '73 K. M. Lupton. '74 L. A. Stow. 1 7.1. A. G. llowes. A. L. Meeker. '75 K. M. Mcliain. '75 E. M. Tappan. '75 M. B. Taylor. '76 E. E. Poppleton. '76 H. E. Hersey. '76 M. A. Jordan. 77 5. F. Sheppard. 77 A. H. Dana. 77 L. I. Wylie. 1 1 '77 M. Whipple. '78 H. E. Stanton. '73 M. R. Botsforcl. '73 H. D. Brown. '7S H. R. Ransom. '73 A M, XVll1g,BI 1869-'7o. E. R. Coffin. 1870-'71. M. S. Nicoll. Editors 1VIisceIIa.ny. I372-'73. '74 L. A. Stow. '74 I-I. E. Olilen. T573-'74f '75 K. M. MCBai11. '75 E. M. Tappan. 1374375- '76 E. Metcalf. '76 E. E. Poppleton '76 C. F. Butler. A '76 H. E. Hersey. 1875 '76. '77 5. F. Sheppard. '77 M. Stoyell. 1876-'77. '78 M. R. Botsford. '78 M. H. Rollins. 1S7717S. '79 E. M. Perkins. 79 B. Hazard. ' 77 E. AI acobsen. z.r. Jllzm. T73 M E. Hakes. E. Jacobsen. M Colgate. E. P. Clarke, Bus. Illzzu. M Reynolds. A. P. Bailey. J. F. Smith. H C. Armstrong, -Bur. lkfaw. C. S. VVhite. M L. Freeman. A. K. Fitzhugh. I. Harrison, Bm. Mail. E. M. Howe. M. B. King. M. R. Sanford. A. M. Nickerson, Bur. Man. C. L. Bostwick. M. Sharpe. S. F. Swift. A. H. Lathrop, Bur. zllzm. M. F. L. Hussey. J. H. Merrick. A. Blanchard. L. A. Barker, Bus. Mafz. F.. S. Leonard. L. H. Gould. C. Hiscock. M. E. Ewing, Bur. Illcwz. M King, Cres.j L. L. E. E. P. Sweetser. L. Newell. A. Ferris. W'itkowsky, Bm, fllmz. 1878 1879- 79 80 1880-'81 1881-' 82 1882-'83 1883-'84 1884-'85. 1885-'86, 174 M. Reynolds. C. 'A. Thackray. M. E. Mort. M. C. Palmer. A. K. Fitzhugh. C. C. Barnum. E. M. Howe. M. B. Brittan. M. R. Sanford. C. L. Bostwick. S. F. Swift. M. Sharpe. M. F. L. Hussey. I. M. Merrick. E. S. Leonard. L. H. Gould. M. E. Ewing, A.r.vf. B. M. M. King. L. F. Sweetser. E. WVitkowsky, A mf. 3, Ill L. C. Sheldon. E. C. Greene. g S. XV. Learned, Auf. B. IW L. E. A. S. E. E. C. E. A. L. K. M E. C. F. M. D. R. M. K. E. E. M. A. E M. E. E Nl A . E. A. M C. Sheldon, C. Greene. K. Green, W. Learned, 13u.v. llfalz. C. Kountze. Lewi. L. Barnum. L. MacCreery, Bm. zlfcm. T. Nettleton. A. Ferrell. NVarren . E. Chester, Bm. Jian. E. Morris. Suydam. F. Patterson. Carbutt, 3u.r. flffzfz. N. T aylor. M. Kavana. F. Wfashburn. L. Strong, Buy. Mau. C. Banfielfl. TS. Hartridge. 5. Packard. M. Robbins, Bus. Zllafz. K. Adams. V. Clark. WVilkinson. B. Cutting, Hur. Jllzm. L. Boynton. L. Wells. L. Hussey. M.Macauley, Bur. Jlfafz. 1.286-,257 1857-,SS 1888- i889-' rS9o-' 1891-' 1892-' ISQZ-l 175 Shaw, Qresj C. Kountze. E. Lewi. L. MacCreery, Ami. B. T. Xettleton. A. Ferrell. E. Chester, Ami. 5. M. E. Morris, Suydam. Carbutt, Amt. B. Ill. N. Taylor. M. Kavana. L. Strong, Asst. B. Ill. C. Banlield. M. L. Reed. M. Robbins, Ami. B. Ill. K. Adams. E. Palmer, Crc-:SQ V. Clark. B. Cutting, -4.f.rz'. B. Ill. L. Boynton. L. Wells. M. Macauley, Ami. B. L. Crawford. Boynton. Dorrance, Auf. B. JW. 111, ,QS A. L. Crawford. 'QS G. S. Boynton. ,QS E. E. Boyd. '95 A. Dorrance, Bm. '96 H. I. Scranton. '96 E. McCloskey. '96 B. A. Jones. .Ula n. ISQ4-,Q5. 1895-'96. '96 G. E. Mac.-Xrthur, Bus. Ilfafz. '97 G. M. Gallaher. '97 F. Hotchkiss. '97 Nl. M. Traver. ,Q7 A. G. Richey, Bus. E. L. MacCreery. J. Edwards. S. G. Chester. NI. D. Anderson. K. VV:1rren. M. E. Chester. I-1. F. Mace. M. WL Muerman. M. Carhutt. M. E. Rickert. K. H. Pringle. D. N. Taylor. .flfa 71. 1896-'97. Editors Hors d'Oeuvre. 1888. L. S. Fagan. Editors Vassaxion. 1839. L. LaMonte. 1890. L. S. King. 1891. F. Halliday. 176 I. Scranton. E. McCloskey. E. MacArthur, Ami. B. Af. M. Genllaher. Hotchkiss. G. Richey, .4.v.vz'. 5. III. L. McKinney. Blunt. L. B. Justice, Amt. B, JU. H. C. Buttler. E. C. Kountze. M. Rich. L. A. Ferrell. M. M. Chamberlain K. E. Smith. K. O. Petersen. C. F. Patterson. J. T. Dorman. M. F. VVashburn. H. C. Oakley. E. VVoodbriclge. Owens. L. Perkins. A. Mathes. Neil. Whitcomb. L. Hastings. I-lowe. B. Mumford. L. Boynton. Strang. A. Monsch. G. Thorne. Hillier. A. Schwartz. A. Palmer. XVinnington. H. 'Walworth 1836. A1 C 1887. C L. 1889. L. L. Recipi en P. Sherwood. G. Lingle. A. Pratt. G. Sheldon. LaMonte. L. Iddings. 1892. E. C. Banlield K. B. Davis. S. B. 'I'ur1nicliff. M. Morton. 1893. E. R. Wlilkinson. E. R. Evans. J. C. Palmer. C. E. White. 1894. E. H. Haight. G. XVhite. C. Coman. E. Moore. 1895. I . Cohen, E. Emery, H. N. Ladue. G. Witschief. 1896. I. G. Kruse. B. C. Grant. L. P. Sheppard. L. Greer. A. Hero. ts of the Helen Kate Furness Shakespeare Prize. 1891. E. Rickert. D. N. Taylor. 1893. K. Adams. A. 'XVhitcomlJ. 1894. E. H. Haight. E. D. Chater. 1390. B. A. Jones. 177 J. A. Schwartz 18S3'83 188187 183567. 188686 Recipients of the Barringer Prize. S. H. Treadway. F. L. Terry. F. L. Terry. J. Pomerene. Recipients of the 1VIrs..Ermin 18S7'S7 F. L. Terry. 1888'S9 C. Keen. 1889. Fir!! PTIDZL'-'90 C. L. Scofield. .Skfcozzd Prize-'89 S. C, Gates. S., B. V. Gaines. 1891. First Prize-VN. D. King. .SFKUIIKII Prize-l:l. M. Mast. 1894. f IA7'.ff P7'l.,5E Q5 B. E. Bennett. Serum! f71'l.ZU-'QS K. C. Reiley 1896. '96 K. S. Dunham. '98 E. D. Dwight. Winners of the I S 86. S1'1zg!e.v--'88 A. M. Mcliinlay. Dnubfzzv-' 87 I. Skinner. S511 grlcr-' 'SS A. M. McKinlz1y. 1888. Q0 I.. Wetmore. Dozfhlfxv--'92 M. S. Guerin. .SlZ.l1'g !l'.f1-' D011b!17.v-- Is., R. H. XN'alworth. ISQO. Q2 S. S. Homans. M. Schwill. '93 C. 15. xvmtt. ISSQ. '89 C. Keen. 1890. Hendrick. 1892. G. Sands. 1894. B. Barns. 1895. F. M. Taylor. 1896. R. M. Mann. 1897. S. E. Dudley. .1 ie Smith Prize. 1890. F1'r.v! fJ1'1'5!-'QI C. B. Dinturff. Sfmazn' Prizm-'90 L. Knowlton 1892. Ffrsf Prize-E. Flaherty. Sfmmf Prize.-M. E. Cooley. 1895. Frm-I fJ7'lAZ6'-'QS M. Fl. Gedney. Secnfm' P1'1'zf-'95 V. C. Wood. 1897. '97 M. Reimer. Annual Tennis Tournament. 178 I887. Si1Lgle.v---'88 A. M. McKiulay. Dazzbfair Sifzglvs- D1wZ'!u.v .SiI7g'!f.F1 D0z10!e.r- -'88 G. A. Pocock. '90 VV. M. Sebring. 1889. Q2 S. S. Homans. --'91 C. E. Furness. S., V. I. Merrill. 1891. '92 S. Homans. 'Q3 A. C. Brown. ,Q4 E. B. Bartlett. 1892. Singles-'92 S. S. Homans Double:--'92 S, S. Homans. ,Q2 H. G. Moorehead. 1893. Sizzglex--'96 H. S. Banks. Doublex-'96 H. S. Banks. ,Q7 S. F. Piatt. 1895. Sillglfi--,Q6 H. Banks. Doubles-'96 H. S. Binks. ,97 S. F. Platt. I 1892-FALL TOURNAMENT Singles-'93 I. A. Morgan. Doubles--'93 I. A. Morgan. ,Q5 B. Strang. ISQ4. Sizzgles--'96 H. S. Banks. D07l6!EJ-,Q6 H. S. Banks. ,Q7 S. F. Platt. 1896. Single:--1900 E. L. Hunter. Dazzblgx-'97 S. F. Platt. ,97 I. C. Thallon. ssociate Alumnae of Vassar College. .25 Organized, June 21, 1871. Officers. President, Miss Heloise E. Hersey, '76 ,... 25 Chestnut St., Boston, Mass Vice-Vresiclents, Miss Gertrude Palmer, '79, . 395 Xliashington Ave., Brooklyn, N. Y Miss Delia lf. Norris, '39, . . 35 West 50th St., New York Secretary, Miss Ada Thurston, '30, . . 157 NVillow St., Brooklyn, N. Y Assistant Secretary, Miss Adelaide Underhill, 'SS, . . . Vassar College 'l'reasurer, Miss Mary L. Bernard, '73, . . Kingston, N. Y Branch Associations. Association of Boston and Vicinity. President, . . Miss Alla W. Foster, '72 Vice-Presidents, Miss S. E. XVentworth, '79 . . Mrs. R. NY. Neff, 'SI Secretary and Treasurer, , . Miss Leonora Howe, '94, I4 Concord Ave., Cambridge, Mass Assistant Secretary and Treasurer, . Miss Elizabeth L. Smith, '95 Association of Chicago and the West. President, . . . Vice-President, . Secretary and 'l'reasurer, Assistant Secretary and Treasurer, Association of Cleveland President, , . . Vice-President, . Secretary and Treasurer, 1559 . Miss Frances E. Durand, '73 Mrs. Tliacldeus l'. Stanwood, '80 Miss Adele Whitcomb, '93, 3625 Grand Boulevard, Chicago, Ill Miss Elizabeth L. Rowe, '92 ancl Vicinity. Miss Frances A. Adams, '77 . Miss Mary li. Baker, 'S9 Miss Katharine S. Dunham, '96, 383 Dunham Ave., Cleveland, Ohio Association of New Yor President ,...,.... Vice-President, .... . Secretary, Miss Harriet M. jenckes, Treasurer, , . . , , . k and Vicinity. Association of Central and Western New York. President, ........ Vice-Presidents, Secretary and Treasurer, . Mrs. F. NV. Noyes, '30, Dansville, N. Association of Washington President, , . Vice-President, . Secretary and Treasurer, . . 1524 JF . Mrs. NVilliam T. Cornell, '70 . . Mrs. -lohn 'I . XVilliams, '71 '84. 525 Clinton Ave., Brooklyn, N. Y . . Miss Lida Harkness, 'S7 . Miss Kate L. Strong, '91 . . Mrs. Lucien Howe, '82 Miss Katharine V. C. Stebbins, '94 , . Miss Louise Sheppard, '96 Y and the South. Miss Ida I-Iowgate, '82 Miss Annie H. Rainey, '78 . Mrs. Charles C. Darwin, '78, 'l'wenty-eighth St., XVashington, D. C fficers of the Vassar Students' Aid Society. V9 Qrganized, Qctob President, Mrs. Truman Backus ,... Vice-President, Miss Louise Lawrence, . Secretary, Mrs. William Myers Dean, Treasurer, Mrs. Raymond li. Backus, Auditor, Miss Sarah bl. XVilliains, . . First Director, Miss Katharine V. C. Stebbins, Second Director, Miss Mary R. Braislin, . Third Director, Mrs. Louise Lincleke Weyerhauser, Fourth Director, Miss Achsah M. Ely, . . ISI er, 1889. . . . Brooklyn, N. Y , . . . New York ISS McDonough St., Brooklyn, N, Y . . 26 Broadway, New York . Brooklyn, N. Y Rochester, N, Y Bordentown, N. -I St. Paul, Minn Vassar College 1867 1868. 1869. 1870. 1871 1872 1873 1874 1375 1876 1377 1878 1879 1880 1881 1882 1883 1884 1885 1886 1387 1888 1889 1890 1891 1892 1893 1894 1895 1896 T397 Mrs. T. S. McGraw, Miss A. M. Ely, Mrs. F. A. Mahan, Mrs. E. T. Slocum. . Miss E. W. Hopper, Miss A. B. Folger, . Address Mrs, T. Backus Mrs. E. F. Chapin, . Miss Nannie Allston, Mrs, XY. Sharpe, Mrs. L. S. Davis, Missj. E. Davis, Mrs. O. V. Stewart, Mrs. T. V. Johnston, jr., Miss M. E. Burke, . Mrs. F. E.Barney, . Miss jessie K. Dewell, Miss M. E. Adams, Miss Phoebe Loving, Miss E. A. Ferris, Miss E. R. Hoy, Emily Lewi, M.D., Miss Lillian LaMonte, Miss Catherine Suydam, Miss M. 'E. Rickert, Miss P. Herring, . Miss M. S. Blake, Miss L. A. Fitch, Miss S. H. Evans, . Miss Cornelia D. Kinkead, Miss Adelaide Claflin, Class Secretaries. 81 Alfred Street, Detroit, Mich. . . . . . Vassar College 414 S. Perry Street, Montgomery, Ala . . . . Pittsfield, Mass . Hackensack, N. I Nantucket, Mass , S7 Livingston Street, Brooklyn, N. Y. 182 . . . . . Lake Forest, Ill 133 N. High Street, Chillicothe, Ohio . Philadelphia Ave., Chambersburg, Pa Sumner and Clinton Roads, Brookline, Mass Normal School, Hampton, Va . North 4th Street, Steubenville, Ohio 112 Willoughby Ave., Brooklyn, N. Y . , N. E. Hospital, Roxbury, Mass 915 4th Street, S. E., Minneapolis, Minn J,oo Orange Street, New Haven, Conn 471 Dunham Ave., Cleveland, Ohio 2003 Clay Street, St. Joseph, Mo 1835 Collingwood Ave., Toledo, Ohio. . 46 East ZISI Street, New York . 321 East 1orh Street, New York Wfashington Street, Binghampton, N. Y . . . , Flemington, N. I. . . . 5 La Grange, Cook Co., Ill .10 YYashingtop Street, Vilatertown, N. Y. . . . Q . Englewood, N. I. . . . . Skaneateles, N. Y. 32 Trumbull Street, New Haven, Conn. . . . Poughkeepsie, N. Y. . 446 Dunham Ave., Cleveland, Ohio. f Z 5, , X u if R .X- 14 s V T591 ff 1'-6..xR?'.Z'.X VF 'N , f -1 ,yt W- I Y X 2 x, ' W N W l5i'x 3:? L1x Y. 5 'IV ' 1' , 'I Jw 7, Z? mai N -is . X --- X 5 NNN ' ' .f i xx X ww 11-v g vx wx fg ii .ffa W- 51 X X: 'T X' --f J gi -?:?-?5- J Q izilr Z. 1'v X 21, 3 255 xfl ,Yi -f53fL5'5ii:ff1-'l?lx A-aXiY 'fi' S5-2,3-'jf i'Ki::'5' k Ac4N9T?5f xtlflgz 11- bi Y gi -T' ' 2 K QI Y fi. ' -1- ' ffl 11? ,.:-3 Q:- 'We can furnish your house all through I We can feed you if you desire, Books, and schools, we can offer, too. E can clothe you from head to foot, We'll transport you by land or sea, Or we'l1 give you awheel to ride g We can even provide hoLels,-- And a hundred good things beside. Now, all you who have money, come ! Read our pages with careful eye, When you see what you want in here We entreat of you, go and buy. ii , ESTABLISHED 1836 Q5 ZW Jfmgg ,QERRISU 1bam anb JBaccn X OUR CONSTANT AIM IS T0 MAKE V THEM THE FINEST IN THE WORLD. X we Tllwife U36 Elff6I1fiOI1 of ,m..1bousekeepers A in MW . -. w,4 Y 2? 1 4 J-fs' . ' -- -Q ge .g.xM..., wi., Ax mp V+:-'ew x ' V- ' -'-ff? ----.... , C - 32Q,q4.Vg.,:,.,, . , . ,,. ,, ,,.,...V... , wg .. -V ap-1-' .Q ., ' 4 - '. , -y5,3y ., - V. .. V pq- ,h-:-xx-.4-mfg-ci-5:53111 - -gffQr,-g,zQQ4:v- 2-1-.J---cV:-.,::.-we.:.-::..gq.V1V,.,.V .. M-f.--yy.. . A . V. 41 .-fxsfsw .pi -afzqggwr-fV:1V:v1sVVmVp14.24-.p.Vg.3...V,. , , A f V V-V-1341-fs ' bf --f-V-H .. '- f VfV.':-2,..- , - '-rw , -.ff-..::fV:f' .- -3--ig112-151.-f-xr-14-sw:s-zf.-r:--1:15:.:.1'ff:-:aamp-ea:11::.1:s:'.':::V:f.Ss'-If 12001.51 ' 42' 'Gr 1155-E'Efe'g.f' '55, - , -ffq1 i':V2 ' .V '4f:f.V,: ,. V ff: V. V 'ii .' ,La ' - , .MQ V,, ...X ,-V-.e',.z...V.:. ' I '- '- -. -Van-.t.V.:..sVgf1i:::af:.f.::1.w's.a3.13.'.:2'-urine:-..1zf-2-rvafrfi:--5-1 1'-.f.:1:as:1ez-ac' V'f.-.ai--455 gw,.:-gf ff-V.. .:- M ., V -., 1 V- '- 21:1.5f:2'5f2.3Q1ei:5233k5915v1f'VVggsLh?:-Nitri:x: 1-izixm-e:rsV Hsu- M -QVVVH 1' . . -'- - ' ' -mf,-V-3 ' ' ,.-:1e,.-g.- KV.-,gsvlgf-,': ,V,.,.-rs :':gq135.:IQV11ig:r-q:,:-f5rg.2'31H.V1::v',.g2.x9311- ' -'+3:rS:-:?:i'- .- f- fgff, 'L -'v?ggf33?qmf5-r4.a-.e1-:SzVfavfs?msV.fVg--1:7:-f5:a5:f.a-.fs-lf.-':.-Q:' Rm: -V.?V:f:5?x4Vfi'fL.- - 1 -fV ,Q M . --1 A -f 4.P-wi-'-2532x1zgf:1.1.1.g-5.'.ff13-5:1-3.V2-.1':gp:.1-gs.Q,g:-x4ie3siVe,-2 '- , v, ' ' T ' r 4' -'-'-' V Vex-fwf 3 551- .Q - ' ' . ff. Za fSf'z.f11f-:-,f'i:i1'121,?: B ff 'l-- 'l'il ' ' -F '1-3:3-i1:V1E255:15fii 511' '25 'X 5-I ff-1-,V 1. A. ,, ---r2-rV- ., V f-'f' 'I' -' ' V V V:-ww.. 5'-'f-2f4a.2.1. ' 21. if - -'S-'-.w'-32? Q- 11F.ff ' ' f.. -V . - 11521, - f 1 V ', ,N 'V - f- ' . , f 44, V -. . .+g,.- 23:5 ' '21 '-xf.Q5g.73'S:22T ,'-I+:I:I.G.I-':'-Z6.,'5,1-V-if.-11V-.g.5.5:5 ' I-A155.N:.i'i Q ' -rf .:- V - 3 .122.,Cl-2253525-if-szisigg315314.15-1-:Kia-fggy ff .V3'.j153.f15g.:3i5 L -1 . V' - - 1,3 -g2M.s.1 -1 H? V -:af Vw. X ug.-'w--2' .' 1. F' .. I-1 ' .5-amz: .25552Ji'-:1EfLf-iiiiiv. .35g3gf:Vfas-i'-.- ai-V+ .. -Q gi .1 ' , V- 'Aff' 615: -4.2.-:.va32-fggwea -.V. -4 bv. V - V . . , -V -f . m.1..,,,.., x.. .:.-ba MV fQ:.wi':1.s:.-'zrs - .- N' V VS? ,.'+,.-:-r32:o?T ?4 V 5- ','5'Z-H.: -- V 1- Vi'-1-5 . :fm1:15Sm3?9fs2fsVff9V.:2a2:-1.wfffaai-:a:s:.:2-fV.1V.,.31.. +5'5.f2:,:,.2j'1:1?-3-gg-rbzigig.-'Q-,Q . ' V, ' - 151 if-9 df:4iPA:1f':i:m-aIH:f'f-'fm. VsG.1s-5 ' f S'-x sf -1. fs-i f -L 2Z:1w-f1f:- 3-V:.ff.sV:VIi -I-I- -V -,, .ff.f ' . ' 'Ei V -' 3 .' 1 V? ,is -'fag , ' - ., 5: . ' .f'5.iVi5igVf V A ' ',f.!kf-441274.44-P-.P-, ' x -:Vf--aww . V 452265-:V:2-v, akoff-wvmksqafV.:-affk-2-1we-wah?-1 - -:-:-.r:12- g .. gf--::ff-2:2 ' . '- V -V , V. rw- viii ' E.2112.V.yf Vi Kg: 2 5 t-7-aaa?-5 .-1 5:5'asqiv-4,,.,23:y...pgxg5 5. . .p 91.431,-?,,VMfVf,a?15f...qi-4.9-.iz-.QVV-:-:Vz., f .ww V - -..s-Q, fif-:Vp-. 1.1,-2',:.g',.. j., 'r: '? '. gy, veg.:q'g'VV::xaX2E,5-2-:::,.r,?-V.-:X1 ' ' Xf -192.5-V.-3... ' V'.-f1f5e:?.:Q.sf-QV-9:5-V Vs: Vff. V'f1sV' - X: Mg. ..1V.,.,.1-.-.effing ,. V. V- Nm.. VW- -V 9. 4. . Q i51iS:1f?1xg.2,g:,f3gc-:lain:mx+3-.555 2.1 :V f'5f7i,5i'5I5fi:3.V:j3f7' . . ':'f.i3ii3E?:f'l .1-: fl'332513-if-nf-SW-11' if 'f-f1z+f V.' -- mf.-Lig.-ag.Vf'V.' , ,s 'V -1 , 3.2-1f25.:i:,,-V. -. .vii ' 'fiE'55.?jf5EE--gfiiff' Rf? ' -V55-:Eg 3-V1-'L V' 119 11.1.1.9-.--. - . fr. V- -'bf-'I xr-',Vfs-1:3 X -' ' V 15 : K ' - . Vu-V .- -' - ' V '- PA V' Tiki: ' -. -QV:-Vf' . .1--V . . 1'.V-.gsv-?,.....g: s 42212:-' - 12- -- .' 'e-my 2. - N gf- 5-V 3.91 1-V '1 -'l.1'.?'1-V---fir'-V J 'f ' '355:3E.V::-'1'FE1'- , YT, X123-.,:-. , -V ' H- -3151,-..gV.,f ,. V- , -.H-37.-I ' I ---' t i-lkVp.' - . f': .. - Jfifl.. -uw Y, 1 wg? , . .,, - .- wgqf.-,Q-9. x .W -iY5qg.VQ,,3.3--.-X 2 . 'V:m'V-,- -,V,-331, uh 4.1,1g..,,:,3,3..--U,-IV' .aw-f. i s-1.5-. ,.N,fqg. qi-:s.g5,:4:,gqV,qM 3 . , QQ.. ' 4 -5 -....,-., ' ..,m.V.. ei f-- iv--' 1 .,Q :1:15 ., z 1, , . - - -- ff ':. 'S ' ' 5:25V.-IV?'.f1:z1V'Q-f-a g -Q W. ' . -1 'f n , 1 W-if-5'5's . .: ,.. 'f 'IpQ?fJ?'-'I-S1:,T5i'g Q A -:FQ-V? X ,-'V,...M,:mw-': I itiq, . x 4.,.,.:vQg.j3: V::f.,.:.-, , .V.?L,,,.? i jg.-jg - Tv. -'3:.:'1g-f-iffy? ,w.,.fV- ,N..,-ivm Vp:--:L V' ' ,I3.VV-fx . V.f3,:AV-2-5'-'5' 7 ' ' , V. f ,. - L ' 'Q ui . -.5 HUNDVV -' ' - Q-V . .V . , -2,3 15.1-X gk- w g 1 r 1 F'fltFiV -1 . Kr4sV2::,.Q..V V. V , af -' ' V QM- V A zgkw, 555 49.4.7 -- ,M 1- Qe,f5,-j, 1 - ,i f .V - in V , Vx' X- 1'-.VPC-f 212-W ff-'A' ., .1Q'L15 'T'-, ' ui' 1.- , - - 1 5'-'V' A 4 X-?'ff,1ff1a,.Vi - f'-. QE-:'J+ - ,. VN -' - - 1 -5 '7 I -2 ' - ' 1 5 1 elif A 'Wa ' -'73' 5-55439 V' 'fifliif-I .171' 'Wa-' -V21 . .- - - , 1 N 1 . ' 141, a M --50:2-ff I V-guy' w4m.1,.-44? V-,-j ., .5 -, -, - . ,' ' ' ' .Q , Wy?-,.5fc-.gftS:g,-',,- 'Vg yr ,ggi -5' .J 'cy-V I 5 V' 495' vii S Agszg- .A ., ' Aa, - 4 jg--MI -V -1- ' ..V ' K-2' V, i - ' . ' X-4.1:-'f-I' -Q . fgi'-f J fi ,.,. .. M' V- Q ' 'V f . -as-V - .Qfp X 4 - ,..f- . . .5-em ., , URITY ,, -V,- 1.5 .ff Vp -iw V. -3 2 .STRENGTH nj, ' -1 5- -If if N- V-- Vu V . H2,i5,PERFECTIONgg -.- 1 .V-.T jig? I-- ' . - , 11 , f,g:'5.,,., W:,..1.: ,,.j53,45' , g. i 2 V 1, I ,-ffifiif V? D DE L V V V . n fr- V RK '..V--V-1-1:12 M, ' . f 2 ' a, ' f . ' -' !'1f'7i5:4 - N-EwV,uAB5u' swf-ff iv l!.,!l' !l!lFll,,B 5 g g A l lm , l llfl is r f ff f 'nl 1.1, . . .1 E .l .l an M.. 11 w. X. s l '1wsW:MlunlIW lllllllllnillllll'llllllwllllllllllilm Illlfllllllllllll Hllmpllllri' ml IMIWTITHWTNI MMIIHIIIIHII ynlxrllmlmlm Uiflnllunlrnlmiil' llilIIII1lTITlIfIl'llI Il-Qunru l llil -q , will HH - r llmii? K ll l ilu ld L ill E - .... - H' '1'--- I l ., .. r , ' - 2 fe-M lll'lll'm illmwlll r um l lUU HffffHlTH1ll rrrmmlmil Q PU Irlluuua mum! Urlllnniiiiliiuriill 'HHVIII Hmmm' '! 'i ' nIHllli1mI.y 'rllllwllllliiiiuiiiiiillv A liilllilihiiiiiil ljmllllmiiiil gmrmmnmn S lilllllllfi sgi I l l will Miiiililllllhm li 4:Y' -ifeeifilvi ii l ,, ,ll l H ills, f M uf mln , eu gu , ' WE 1 5 l , 1 ill ,i f Y,,,. wi -' 1 f'A f ' :'A ,. 1 The 999 items which come into the realm of the modern Dry Goods store, can usuallx' be found here. There are larger stores in some of the greet cities, but few are more complete and satisfy- ing for supplying all the ordinary wants of the people. Departments: Dress Goods, Silks, Black Goods, Laces, Ribbons, Hosiery and Gloves, Perfumery and Notions, Cloaks, Houskeepers' Dry Goods, Men'S Furnishings, Ladies' own Goods, Carpets, Wall Papers and Upholstery. Your patronge is invited. LUCKEY, PLATT 15? CO., 332, 334 and 336 Main St., Poughkeepsie, N. Y. V A. BAS1TIANELLI 9 LadiesiC1oakS and Suits, 21 VVEST I-IOUSTON ST 'S NEVV YORK. . R N til . 4 X .L E' ' Rh at .,,, ,l ui ,X 1 . 'T AT The Linen Store ---- where Linens have been dealt in as a specialty since 1855, there are shown all desirable sorts of LINENS HOUSEKEEPING Of Unquestioned Reliability, The Very Latest in Style, In Largest Assortment, At just Prices. It is always at pleasure to us to show our goods to those who are interested. Our Catalogue is mailed free to all who ask for it. JAMES NICCUTCHEON 6: CO., I4 WEST 23d STREET, NEW YUHK. Glue 'qpopular mbps' N. Y. TIMES-I! it n tw11pz'z'ngf!:zm' fa rfikil. 'THE TRIP TO NEW YORK will of course in- clude a Visit to TI-IE POPULAR SHOP lwhere the Styles are setl for a leisurely look through THE LIBERTY FURNISHINGS, N. Y.!SUN- The .tart of shop fhat fzuzmzmz lingui- rz rout. N. Y. HERALD-Dnffllgfhtfzzf jQlb7'1'cs and qzznflzz' bfi: 0ffIt7'llZ'fI!7'F 'zuhfrfi zmvfw' .vzwil fa be njlrru- 11' zrcifa' elxefzvheru. N. Y. VOGUE-A flaw' 'where :me ran .t1'!L'c! :furn- raf.f1'e v1nz'u:'fa! in licszzruly faxhiwa, ftiiih My fzrrozlzprzfziazzwzz' of fialite xw'r'z'cv mm' Mr rw'- mfflty of My High! .wrt afrtozlzfnzlzy. N, V. HOME .lOURNALf,'lj5!1zc.' to .Mali mzffke 1z11yMmg a1zyzLfhi'r'v, and yet re1111'm'srw1t zyf 1'1'e1j 1tfh Ure. N. V. TRIBUNE- Ywlll' zwzz'qm'.vt :J uniglru ayints, Zhi' blue and -whim roam at My Popular Shop. N. Y. COMMERCIALA YWL' grezzf zz11cz'pv'1'11fzfal rhzzrvz ofa!! tha' IlI!Zl'6'7'l-llfll' am! qpQ'dx shown at ZTfl'ffllgh'J' it th :ir a2'ig1'1zn!z'ty andefcZ1fl'1'7fe1zi'Js. The Fabrics, Wall Papers, Floor Coverings, and Furniture of The Popular Shop are not to be had elsewhere, LL'1'x11reZJf l1z.rped1'arz Lv Cawizlzfiy luwityrf. JOSEPH P. MCT-IUGH 8: CO. I Lllild Street. West, NEW YORK. 1 at 5th Avenue, Wall Papers and Liberty Fabrics-- lparcels 35,00 and overl. Carriage Free to all Parts of the States. l'rRAnic Mull-cs nEG'n.1 Eg esesiaaea gaataeaiwaaeag .W N TRADE MARK. Nfl-J For Sale by Fine Retail Trade. GOLDSCHIVIIDT 8a IVIETZGER, 597 BROADWAY, N. Y. YOUR attention is invited to a food product which is used in innumerable i households and which, tho' not a luxury. is very essential tothe comfort ot those who have the care of providing for the family. it is A CRACKER STAMPED Hiurriisir miriam? Throughout the country this CRACKER has become a staple article ol diet, not only on account ofits delightful flavor, but owing to its health-giving properties. Poughkeepsie Cracker Bakery. . FGIICV GYOCQYIQS, SN. H 'VI A N N , S Olives, -lellies, Sauces, Sarclines, Can Puclclings, French Peas, Mushrooms, 'l'ruHles. Canned Cherries, Plums, Peaches, llears, Nc, XC. lYhen we Say lfancy ifrackers, it means a very large Variety. Our intention is to have all the popular goods of the markets in the line of Groceries, as wellas lfruil. QGYUQIIIQI' 85 Pdfkhlll. Worce stef USE IT. IT IS THE BEST. 3 xii IN THE LIBRARY. Have you Seen the 'Descent of Man' P Hardly, I'm only nineteenf' df IN MATH. CLASS. First you differentiate, then you differentiate again, then you keep on differentiating till you have differentiated the last ti1ne,then-why -oh, then you differentiate again! .29 How do polywogs turn into frogs ? By a sort of allegra movement. .25 ON THE VVAY TO ENGLISH CLASS. Wliat did Leigh Hunt write P Autobiography. Oh, yes g Whose P viii UVHY do women wear corsets about the house, 'tix when riding, cycling, playing tennis, or iz' - - - - - 92,1 indulging m any kind of exercise, and how can A ' 7 fa fi, they do this in a corset and be comfortable? in Because they don't know the NAZARETH WAIST-the NAZARETH WAIST is newA in 1 , xr? a twelve month-a million women will know it- a good percentage of the million will wear it. They can't wear a corset all the time and be com- Qf If tortable. V Why is a NAZARETH WAIST better than ' a corset tor two-thirds ofthe time that a woman 5 wears a corset P-A corset is made ofa woven L- i 'L fabric, starched and molded into form. A NAZARETH WAIST is knitted. A knitted fabric can be made into a waist that will preserve the form.-The NAZARETH WAIST is Z1 soft elastic garment-elastic over bust and hips where needed-non-elastic at the waist where strength is wanted. A series of good bones give support-bones that are warranted not to break or rust, and need not he removed, when waist is to he washed. One corset weighs much as six NAZARETH WAISTS. Singers buy it for the deep chest notes it allows-impossible in a corset Cyclists wear it because it is a true bicycle waist-the bicycle corset is a delusion. There are a dozen other reasons. Sr.oo and 31.25 at leading retailers everywhere. Ask for NAZARETH WAIS-T5-the genuine have this stamp. 2581425-628 Nazareth TRADE MARK ffm s 1 f ! -l I ll NAZARETI-I MFG. CC. . hazaretb, Pa. new York. a San francisco. IX X LES IVUSERABI-E51 BY VICTOitiliiiifiaO?R1YOiTT??CiT5i3ZqfStfKifZ.Za,,f.?'mCdPY A' In the whole range of fiction, no work has ever been produced exhibiting such a tender pathos. The whole world has recognized and felt the deep thrilling emotion with which the heart throbs at the. intensely human picture ot a man's struggle with fate. It this edition all passages not bearing directly on the story have been omitted, leaving the whole tale continuous, absolutely untouched, in the words of the master writer. Perhaps the interest is thereby intensihecl, To elucidate all historical or local allusions, and interpret the absolutely idiomatic expressions, a few explanatory notes are added. The volume is well made, and in large. clear type on good paper. iemo, cloth, pp. 533, Ergo, post paid, Complete catalogue of all French and other Foreign Publications on application. WILLIAM R. JENKINS, 351 'Sf 853 SIXTH AVE, YORK. Cor. 48th St. PENN TABLET CO., ' U ' E 300 BROADWA Y, NEW YORK. 52QiQEtatiot1et't3, M'M'M M,,,,,,,,,C,,,,Cd by College News Fully Reported. J. C. BLAI CO., ' . H , R The only Paper giving full ummgaon, : g : Penne- COIVHVLENCEMENT REPORT l7l'1'r'1'f Sf1lflm'1lf.r 1fm1f1'f1'n11l ,Yrfftf I hrk. by 2. gfadliaiie of H16 College. Gambribge Dioitione OF THE COMPLETE PoE'rlcAi. worms OF ROBERT BROWNING HENRY WADSVVORTH LONGFELLOW Each author in one volume, printed JOHN GREENLEAF WHITTIER from large type, on opaque paper, QLIVER WENDELL HOLMES with a Biographical Sketch, Notes, JAMES RUSSELL LOWELL lndexes to Titles and First Lines, a line Portrait, and an engraved N Title-Page. Bound in attractive style, hrm but flexible, and handsomely stamped. Large crown octavo each fwith the ex- ception of the lirowningl, cloth, gilt top, 352.003 half calf, gilt top, 53.501 tree calf or full levant, 55.50. l-lrowning, cloth, gilt top, 53.00, half calf, S5.00g tree calf or full levant, 57.00. Look closely as one may. it is impossible to tind a defect. Paper of substantial quality, a handsome, open page, rn spite of the double columnsg strong, ilexible hack stitching: gilt topg engraved title-page: etched lrontismece portraitg a neat and pleasing coyer, decorated modestly with a ,quilt laurel wreath and marginal line-these are salient characteristics that catch and hold the appreciative eye and evoke sincere Commendation .... Would that all the better class of English and American poets were accessable in a dress so satisfactory in every way.' -lp'a.i-lm: limf-ou. SUM by 6aoK'Jt'Z!f1'.r. .S'c11l,j2a.vywa1'zz', by HOUGHTO , MIFFLI 8: CO., BOSTON. X all apers! 1 fsi 35 Our Stock ot Wall Paper comprises many new and unique effects in all grades, viz: Renaissance, Colonial, Empire, Heraldic, Rococo, Louis XIV, Floral and Geometrical. We beg to call your attention to our Antiseptic Fibres, being a reproduction of lngrains. These are only produced in the softest tintsy and the etlect, when on the wall, is most harmonious and pleasing-the latest shades being Ashes of Roses, Royal Purple, Ox Blood Red, Apple Green and French Olive. 0ur Entire Httention is Given to Pdilllillg, PGIJQI' Bdllgillg ssss Hlld IIIIQNOI' D6C0l'dli0ll, EIC. Sample of our workmanship and decoration may be seen in Senior Parlors at Vassar College, which we have decorated for the last live years. E. VfGRZxNT, 31-7 VIAIN STREET, PO'KEEPSlE. limit E 'hmmm 25 v Happily characterizes the Jdual action of 'Yllbaltine with Goca Illlline' in the f0ll0W: ing graphicRn1anner: The Coca boosts fat the patient and the Maltine furnishes the peg that prevents him from slipping back? Other tonics afford only temporary stimulation, with nothing to prevent the subsequent reaction. xi cl-IE Q Diamond Seal Brand fur ...Crimmingsm Q25 EXCELS ALL OTHERS. -31.1 x 5.5.5. O0-J-ffzadossia Sold bv dll the Beading Drv Goods Bonuses in tho Ll S The Art of Dressing Well Does not necessarily consist in at large expenditure, but in the judicious selection of those articles of dress that contribute most to the perfect Tout Ensemble of a well-dressed Woman-the most important of which is the tailor-made suit.J..a'.phb'J.a'.a' LADIES' TAILOR-MADE SUITS TO ORDER FROM mr seiecnoiv or IMPORTED FABRICS wma JACKET OR wrusr AND SKIRT sinc-LINED Tl'lROUGilOU'l'I VM, JZ: LM ' Z v Z ea . We Guarantee Cloth and fit absolutely If Ifwwx if I satisfactory or refund your money. fi 1 X QNX r ae am ll ll ' 728 WEST 4211 STREET. BROOKS BROTHERS, BROADWAY, COR. 22d STREET, 1 NEW-YORK CITY. lothing and 'furnishing Goods, 'W mtgggpfo mmm ln our department of Clothing to order will he found :I complete assortment of Scotch and English Suitings in all the year rr-und seasonable and tropical weights, and a large variety of other goods, giving the fullest opportunity for selection. in recognition of a general desire for appropriate dress for Outing purposes we have given special cure to the selection of allarticles embraced in this class. They include Knickerbocker Suitsq Red tlolling -Iacketsg Scotch hand-knit Stockings in suitable colors and dvsignsg Golfing Cups and Glovesg Highland Gaiters, etc., etc. Scarfs and Ties in ro er shanes with some exclusixe materials lo same to or er. ores o nrevai Inv s a es an trim or rivinv' :In d G1 P lg ll' h d d ' 1 d ' ' d J 'bl street wear. Knit Waistcohts, Shetlirnd and Fair isle Sweatersf' with long hose to match, for bicycle and golfing purposes. A carefully selected line ol leather :intl wicker goods including Luncheon and Vllffil Baskets, Trrrveling .'l1'1C.l Kit Hugs, llolstcr Cases Sheflield Plate Flasks, etc. Riding Whips, Twigs, Crops. Holi Cluhs, Balls N Caddie Bags. 7710 f'z7'!.f1'11f1l1'fart'rz'rrr'1'I'r'rl'6y11x fu Zhu' fuf nuff' lllzrllllflrllrrr' ry' nf! ,g'ur1'11n'1f.'x Ihr frofwllfl' ry' 1 , , . ffrzffiwll um! Zhi' qllalify :If 11lzIIw'1'fzfs, .erl!g'mInUlfr'v Ihr' Amr! rulfnz' nf 110 hlg'hr'1ofw'. r'c.r ffmu lzm'j1'sgzzu112!,1I' zz.rkr'dj21fa gnzrmwzlr mmfr- in Zargu iifhulrawzlr' Zofs qf1'1f'z'zar zcffzrl-uzrr1z.I'h1p. Catalogue, samples and rules for self measurement sent nn application - xiii D CEO: . 'Q we 143 Euclid Hvenue, auwufma. .... 9 water Solara. Enom Qwiruiatwrers. 519141 CSQMQQ15. Q Ma jig flwarcied P77865 Whe1'evef' Exlzz'bz'fz'11g. Gold Medal at Convention of Photographers, St. Louis, 1886 Braunswich Germany, 1886 Silver Cup, Boston, 1886 Gold Medal, Detroit, 1895 Chautauqua, 1896 Grand Prize, Columbus, 1896 QIZISS Pl70IOQl'dDl?Ql'S f0l' '96 Zllld '97 STEI W Y Gt SONS T 13 T HIGH 131eNos ihew S -L L A UVIANUFACTURERS 'BY APPOINTMENT TO E H15 MAJE5-ry S U Hrs APOSTOLTC MAJESTY X y at an .' ' ' - 'r Emperer Wrllram ll. T Emperer ' Trait? , ' J hl ' Anaahe T2-JciTrX1ii:TJiL1ii2Aixlgi'ZPRussrA, 22 I f BR OFAUSTRIA. U '-Sim ' all 5 AUSTRIA- And KING OFHUNGARY HUNGARY. HER MOST GRACIOUS MAJESTY 5 And the Imperial Courl: ofAustria and Royal Court of' Hungary. ' Rl: E Q92 K0gA.,g?k The Uueerr el England. F er, mar army- .Hem ROYAL Hioi-messes i A - ii i 1, ' ' E The Prmee and Prmeess 5 , el Wales. eThe Duke el Edmhurgh. T' m Hrs MAJEs'rY 5 HER MAJES-fy . . Umherlel Km el llaly The Uueen el S am iialllll 'T g ' E p ' All ,Q , . E 5 ...iw I LY. E ms MAJESTY EMPEROR WILLIAM II. OF GERMANY, SPAIN' On June 13th, 1893, also bestowed on our Mr. WILLIAM STEINVVAV the order of THE RED EAGLE, III, Class, an honor never before granted to a manufacturer. THE ROYAL ACADEMY or ST. CAECILIA at Rome, Iltaly, founded by the celebrated composer Palestrina, in 1584, has elected Mr. VVilliam Steinway an honorary member of thatinstilution. The following is the translation of his clrplomn ' THE ROYAL ACADEMY or ST. CAscrLrA have, on account ofhis eminent merit in the domain ofmusic, and in conformity to their Statutes, Article 12, solemnly decreed to receive W'illiam Steinway into the number of their honorary members, Given at Rome, April 15, 1894, and in the three hundred and tenth year from the founding of the society. ALEX. PANso'rT1, Secretary. E E. DI SAN MARTINO, President. ...Ti- ILLUSTRATED CATALOGUES MAILED FREE ON APPLICATION. STEI N VV AY Sc SONS, Warerooms, Steinway Hall, 107-111 E. 14th St., New York. EUROPEAN DEPOTS: STEINWAY HALL, STEINWAYTS PIANOFABRIK, I5 R I7 Lower Seymour Street, Portman Square, W., Si. Pauli. Neue Rosen-Strasse. 20-24. LONDON, ENGLAND. HAMBURG, GERMANY- r -HQ -- W - , r XV , V HQLMES, Dealer in 'Fancvand Selected Groceries, Cea, Qeffee, Spices, Etc. Agent for WHlTMAN'S Fine Bon-Buns and Chocolates. 366 MAIN STREET, POUGHKEEPSIE, N. V. TELEPHONE CONNECTION. USE -, , HHIIISIEUS ffsHREQDED IJUIIIISII. TRADE THE BOX WITH THE RED BAND. But yet they quarreletl, we are told. Well, now l recollect some more, 'Twas Locke who died in seventeen fOL11 'Twas sixteen-ninety-two, you say, That Bishop Berkeley passed away? And Clarke was horn in seventeen-four. No? Berkeley lived a few years more? Well, then we must be wide the mark Ah, yes, 'twas not till seventeen-eight That Bishop Berkeley met his fate, And Clarke was then just four years olil, A century or so on Clarke. Well, now, I fear we're wrong again. To-1no1'1'ow, please look up these men. A f I 9 V7 A 2 'ilu f if :if - ii il time Cmcopherous gn! if if rl A !,4Z, , -l i W gl 0 f ' f We In WJ wig. Q 'W i t 3 awawawawazawar aewwewawawef v ,f li X,i. f,is'-4-::-- 1 XY? T ' gm t. f I., , y jgiaaflrx qi The finest ha1r:dress: .J -,U Km-a s lvl? ' h e - 92? Wi .fQil.eiS3XSX - . '- ' 11113, and best 101110 tim e -U 1 use hl l eigh 555 N. e l if. X ' ' Seld Everywhere. XXI D . ,- W-,w-.,,-.,,,,.., r ,fri ' Qt LF' .Im E 1, ' :!?y, 'EZ,'E?..:::':. , 'wg- e A , Mf r. 1, 'Fwd-x!E:f. 4 fiifli - -- - W- we .... ,.,p.,f,3,l,g,,l J .r +:.t ,.. -Q fi4ih...',,r--.-- H- - qi -'21, 3' iff? if S lit? ... . -1. ,,, .,.,1,..., gr1,,.Lf,, -lu 9,1 ff f..mD.. ,.. . . 11-vin! ihwvlf-ip... w ry- Q ,. .',,,,,: , , .i-:.g?gg:gg.-1, ,lsr rf- we 1 f Ii13-tfigfif-'-Lf!.iilfifr 4,- - - fxiff -i4.,12.g':- viixf? :,:!.1jf!ifQgigi3,g, ' -M e-c Y qp,lqQ?133? 53: , -fIgtt,'r '.X,f:'fa rpm.-:iff f N-'r2'e::f.n9, . 4. .7:,.:x9 ,. ,mu -sf: X-,:1'.gf:-awgifwg V P . 'aff-7' 5' f' ,- f- 7 - f-'-1e.f::.m1.-c-1:,r1gA V , ' v , - , --1 .4.-wt, ' ' g.1 ' 'li 'A Y i f yu L -' g r .. 1 ' f 2' gf 'ffl' ,4 55 Ina'-1rifle.,:afar-s2'.f'fffffMww- Y 'W Q-M V :U - 'V f3?5?if:?v-' 11' f- .- rw .- 5-.:-s ..,, 1 'M .. 5 .L f-,rings -jL25531e:. ,aww-'z ,..,,p? ' Misses' smuons. HATTER'S K OX THE WORLD RENOWNED THE STANDARD OF I-I FASHION EVERYWHERE 194 Fifth Avenue, under Fifth Avenue Hotel, New York. 212 Broadway, cor. Fulton Street, New York. 340 Fulton Street, Brooklyn. . IQI and 193 State Street, Palmer House, Chicago. Agenziv in all Me prinrzpal ciiies. r 7' M-6' Six Highest Awards at the Colu mbian Exposition. -1 , f 'fix f K lf I 1'-fl 3 5 MU? I fig f 43 fl 5, 1.11 N l fyfy 1 Q Mi ills R ' xr., If ,I f N I ga' -Q 1 F R , L, M I fL.:Xx QA f- 0 'VZ 0 1 1 ,AZ T t ' if f 1 is X, ff! I LIKE THAT PICTURE OF A Vf5???3F,f?ll?L KEATING BICYCLE. 'tr with The unjon of graceful rider and graceful vyheel. would ,f he exceedmglv common among the colleglans lf more I 'B students tried the KEATING. , -Z., NK uma,-f .:-Y THE EASY GLIDE would be a pleasing revelation and f' , f xx iff , prove the claim that Keatings are 365 days ,, lx V3 1 X ahead of them all. Fri' l '.' we A 'W mg i W X KEATING WHEEL co. A --f MIDDLETOWN, CT. --Sh:-el zllzzsiu 11 mf Cafzzfnylns l'7'n'.-- xix HIGGINSHSEITERI viii? rms icnirfif 1 Leda-XJ Ne Goods i po tel di ect from le d'n ' o teries of tl e 'O lil. A ric s 25 V es: nesevllere. ,-f- - ' I. ' L 50 '52 W 22nd, St. NewYorK. G? ' ' 4 9-9 5 X A- 5, 1 s,-5 I , , Q RICH CUT GL-Ass. v i 7 v r ' -- ' bf- :X . Y 9 Floors Devoted to our Business. ' VV In I' C 1' El 1 Q ca P t 1 xx rc t p e If 1 S K tha l 'T jflnx Hlltrz' Cuffzlaqzfz fn: Y J Q w Q24 l7O BellevueAve, Newport, R,, l.- e J., QWKWZKJWZEQZ SOLE AGENTS IN BROOKLYN FOR THE Juuvill Km GLOVES, BEST FITTING. BEST WEARING. GllSS8lS lJBlW66ll 6i1Gl1 Flllgtlf. SHORT FINGERS A SPECIALTY. NONEGENUINEUNLESSSTAMPEDTHUS: www DE XAVIER JQUVIN INVENTEU R. ,,, Reciprocity is a popular word of the present 9498? DXINVENTION I day. The people who advertise here help us: QS' QQ now it is our turn to help 'them and buy the I goods they advertise, J O U V J , 7 QM. JQTKDILLE U O Other Gloves sold under the Name of Jouvin' are imitations. eflgee Egs seerieiaeg eeee2QustUm SBU? IIIDHEPP. REPAIRINC NEATLY DONE. FINE WORK A SPECIALTY. No. 5 SOUTH HAMILTON ST., 4 POUGHKEEPSIE F. E. BRQTWN, Repairing, Upholstering, Etc. Q5 Cabinet maker and Finisber . .. . . . Furniture Packing and Crating a Specialty. Locks Repaired. Keys Fitted. Skates Ground. Prompt Attention to Orders. CHARGES HEASUNABU5- 424 mdlll SIYQQT, P0llQl7kQ2I3Sl2, H. Y XX 1 THE... . BUSH ELL SPRI GS 0. 3 BUSHNELL saiieEDGE VANSAR COLLEGE, Poughkeepsie, N. Y. E. L. BUSHNELL, Dmr Sir:-Yours. inquiring how I am pleased with your Spring Mattress is at hand. I have used them for the past twelve years, and they have given entire satisfaction. Those in use prior to purchasing frotn-you began to fall, and as they became unfit for use we Elled their place with yours. In a word, I am saushed, considering them superior to any other we have tested, as to ease, comfort and durability, M. VASSAR, jre. l I The I opularity of our SPRING EDGE Bed is ever on theincrense, as it is the ONLY Bed made which prevents the occupant from coming in Contact with side-rails of bedstead when getting in or out of bed, or while sitting on edge of same. This feature added to our already popular Bushnell has secured for it an enviable reputation enjoyed by no other Spring' Bed. HE BUSHNELL MANUFACTURING Co., EASTON, PENNA. I Ili 104015465 UA' N07 if A005 llA7f0 01' if 1w,mAw6Afz6AwffAz 0A75Z4W0A'iAZ hff W1 f0,0Mf,019 5417i 0A'f?fff!Pf0f 3 IF! hf!l'1725 Q? f0f? fXP,9f55 GZ4,-?6f5. 'ITJILET PAPER FAMILY CASE lE0005HEETS 3 Irv PEI? CASE 30005IIEET ROLI.5 SATIN FINISH FINEST QUALITY IBO SHEETS Awziaffwifaapfifmy Uwflflmmwffflzwfff, Piwfmflfafwffafpfmzf, UUf!'0l70U0f,47Pf5P0!V 306670 UA24M'.5' FOR I CENT. Q A Y N ' lqlwmln rflawfnrr if-i AW22,eff2J:30A'af7aa,Pf5z I-BAN , ,,0m4.ofzAfm1J7ff7m9a.W5f. Plyffddfb' :MAI ' 5.417 fkfflyf U C' 0. 32 114715 19,4750 IM5. 50,.570l5f z? DfV0!7.5l9'ff?.f.5Z' PURE FRESH DRUGS. V TOILET ARTICLES. t i w The FINEST FACE ,I.I Deli ht IMPORTED Powmans f g Bnusnes. 7 51 AND 0 SPONGESI TOILET SOAPS . HUYLER'5 cANoI:s FRESH EVERY wszn. A P 4 BOL TON'S PHAHMAO Y. MOVSTREOUSG groin-xg bl I, 33.9 Main Sf , Poughkeepsie, IV. Y. pf, d ,, 'Prescriptions Carefully Prepared. HB5 Weill arg i In public bath W::3531'i??55fi-::-1 ,,,. .1--- ' house. Sfobn 3. fllbills, Eentiet 348 flbain Street, llbougbheepsie, IFI. 1.9. the Home Curkozliussian P.fifi2:..I 'folding Bath Qabinet. Enables you to take Dry Steam, Vapor, Oxygen, b ' I l Perfumed mths, prlvnte y, ecollonuh-ally nur w ance nl perfeur cleanliness. Medi ith tl A new and perfect prlnm-iple fbutlxixlg, A I-ure G D K! Ina. out, llheunmtlsm, Ixerxous Iaeases, dney nnrl Live 'l'rouhles, etc. Send for Free Clrcular to MA YUH, LAIVEEQ C0., 747 White St., xii New York Dr, P, L, FQQTE, FRICKER an CLARKE, ...Dentist... 'emfisls' I constantly on hand. 288 Main Street, ' P h k . N Y KAYGREENHOUSESQV oug eepsle, . . , 635 Main Street, MOVED Farm 318 BIAIN ST. P0ugl'1k66pSiC, N. Y. E5TABLISHED1851 EINIER 65: AMEND, Manufacturers R Importers of CHEMICALS and CHEMICAL APPARATUS, 205, 207, 209 a2II THIRD AVENUE, Comer of 15th St., New York. Finest Bohemian German Glassware, Royal Berlin Ei: Meissen Porcelain, Purest Hammered Platinum, Balances and Vlfeights, Zeiss Microscopes, and Bacteriological Apparatus. Chemically Pure Acids, and Assay Goods. fLf'wQgZzs2Z Z STANDARD OF THE WORLD b '- l-i:v .'5, :f lmiall d, In buying lamps for gills or personal use be sure E: they are stzlmpecl THE NEW ROCHESTER. if Then you know y0u're right, whether you buy for show or for light. 'l'hey're just as low in price gmt' as the others, too. 7- QW livery genuine lamp has the name stamped on ,i it. Insist on seeing it before you buy. A beau- , K Ei tiful Art Catalogue, 96 large pages, free on np- liczition to Dept. V. G Glffdlilfv-.-'l ' ' N920 I . .gm b llzwuc- Q the Rochester Lamp Go. - A A 'HA I -1' i f-.ir ' 42 PARK PLACE AND 37 BARCLAY ST., NEW YORK, ND'EDI4v3B. ,- i xxiii -S I I! I, S funny-bone. lui CD ause that's where he keep -Do F --Bo -Bee I I v I' o f, XX X .. 9.x - Iv? I' I NI I I I I I IIIMX ' II I ,Ili If I I II -3 TSKI ff I I I I I II I II 'I ff My I L AL,-nluull 1 ' l 1 ,QL IIIIII I III I IIIIIWIIIIIIII II I IIIL I I III I I I ,III II ,,...,,... xI.w , ,,A. In I I ,Wi ff I 1 .HI jjj ff f I 1 2 Yr ' ' W f 'I '- '- ia in ,eieiffdf ' gZe3,:efe. Iw :- .. ' HUII ' d IiI I W ' - SIIIII III ' X L-gs ' , I -- I dia, M- 1 Nr -S? . II IIIIIII IEW 1 : :J .- : .1 f-' .-4 GJ .-L' 4.x f-4 .-1 O Ah, indeed. That borders E- SH ESTABLISHED Sole Official Judge of Fur Exhibits, ELIQRJAZSBZHIAN 5815532 World's Columbian Exposition, Chicago, 1893 EEE QE ge HEF EE, aeaeFil1Q 'ftlrsaeae 139 FIFTH AVENUE, Bet. 20 liz 21st Sts., NEW YORK Estimates furnisliecl upon application for all kinds of Repair work, and prices given for Fine Fur sets. Mink, Sealskin and Sable Garments. Rhodes' Steani Dyeing and Cleaning Establishment, I No. 217 UNION STREET, POUGHKEEPSIE, N. Y. Ladies' and Gents' Garments Dved and Zleaned, Also, we makea specialty of cleaning Silk ancl XVoolen Dresses, Portieres, Lace-Curtains Kid Gloves, Slippers, All kinds of paces, Xe., bythe celebrated French Cleaning Process. 1836. pvc?--'vi-v---TTY? 0Ohen,.l 7 COMMON SENSE Bazar du Uovagg GOOD AND ECONOMY UNITE IN APPROVAL- I WALL STREET, There's Success! cor. Broadway, NEW YORK. ' he NIONROE STERN, Jfamzgw' 6 travelers' UIIIIIIIQYS. TW' CUSHIONED Reliable Trunks BUTTON and Bags Q' If 5 lliillilil lflilllli p lflifil, lip' I I fill? Supporter. Steamer Chairs, 51.50 THE WEAFKER FINDS I Steamer Trunks, 2.50 N0 CUTSWNO TEARS. AND NOT A SLIP ' IT'S VELVET, YET IT WEARS MARKED AND DELIVERED. AND HAS THE E fig-LS OF ALL l' .,,, DEALERS' GEORGE FROST co. 5lll7llflf?1,L1ZAl', 551 TREMONT ST., by1Iflr11'1,25c. BOSTON, Nmss. Q Ask For The Q Z7 85 29 WES tailor made and 'fancy Evening Zostumes. millimfv, DQCKWQGI' 333333333 SILK, FLANNEL, FIADRAS AND DIMITY SHIRT WAISTS. AAS BROTHERS, T 31ST STREET, NEW YORK CITY xr IE XT xx- f iii SESEQY E?i 5 5233 'f isii ifwugigii . ' i .'? T5i 7 LSI 4-1 iQ?iEwEiwwwEE mfliligsg' fXfQQl1iNw3fn'5 vp,.A! LAX.. iw-w,.u':-fx- T 7 fi- T 3 E 1, TTT,,, E lim:-f 4 If 1. -EE IQ .H,,m1 :fLf-l'? Mmm. U, W W T W1 'MTL T F lfv almgni-1-E wk T 1 1,,?Q'f' mm W . 'mvilill mlm' W3 TMNT 'T Tl MM- L - , Elfag.-:EE - Qmulim-g. f i F 51553551 L www A 'li L 'WF 4 v i ix H. 'lf ffl-2-T 1 gg j lgl uh . T '- ' ny- , ', . NF- I lmmlm ,,7 nf 1' K----'z my T7 fw pn m p W 3 f- ' Tw? T W t? ,.,,. T - 'ik T 5! !f 5 ET 'T - Ei . 5 IIIIW' WW HUULU MEM! L Qui W ,,,,.,n. X'-ff wmv TT .. TIME MT - In ,J L. -3 M T if E mm if f 2 T , T nmm'T'mm!wm!sw!LwJ H1 R Wg' mnlhn rmumuuu V pdl' v W i mulum' Y 1 RTM yy,-gf. 'fl 'I wg ' 1 Ma ximum il! .,,. 'gpg Iuvmsui Hmm w M 11 ---- 4 '-----f-,-------- : .-.......,,,,,,,. ' ' 14 , w g 'T LTR TFL T J? ' TM N T If WM Tgq j 1 Timm me 'J EI Q 'fiiiiiiil :?fQ3Qff g v w - m m m .M ' hi xii XXVI .I 3 C' 1. J -4vuLL Fenix AZ D: .. QC ' QlllliS QWGQ Gdf dlld ollfillg QQSM6. 'Mf- The Largest and Hanclsomest Store in the city, built especially for Bicycle business Repairing, Renting, Instructing, etc. LYNDHURST . . . . . DEALER IN HUMBER, SPALDING, CRESCENTSLRAMBLER John Van Benschoten, Cathafing Stn Near Morgan lflnuse. 671413. JW. T. Hmgsirm, 'wmbdimw 298 MILL ST., PUUGHKEEPSIE. Designs from the latest London ztncl Parisian models, livening and Class-llay Gowns at specialty. GUILFORD DUDLEY, HARDWARE DEALER, 260 1viA1N STREET, POUGHKEEPSIE, N. Y. where he has been located for more than 30 years, offers as well selected a stock of Hardware, Cutlery and Tools as there is in the city. Some of the Articles that will interest COLLEGE STUDENTS are Pen Knives, Scissors, Le Page's Glue, Mineralogists' Hammers, Skates, Boxes for holding papers. CTC., Packages f01' H Crum's Parcel Express, may be sent here. Are so simple that the younw' 't can uno r SIN C E R S E WIN C M H I N stand them. So easy that theiialzlesn can wtfrli them. 105 Years Old, W-, LTaiIirL1irom LiiQi -A-My ilfears olri. i ir Such easy terms that anybody ' ' ,,,,,,,,,,, The Singer Manufacturing Co. OFFICES IN EVERY CITY IN THE WORLD. xxvii The Misses LockWood's' THE DETROIT Zollegiate School, Home and CDW School. A FAMILY SCHOOL FOR GIRLS PREPARING Established 1818. FOR COLLEGE. MOUNT VERNON, N. Y. Special attention given to prepara- Every advantage is offered for rapid and tion for College, efficient preparation for all colleges open to Women- , , ELLA M LIGGETYQ 14.5. The certificate of the school is accepted at Vrinci M Vassar and Wellesley. P ' Circulars and references will be sent on JEANNETTE Aff LIGGETYZ application. Associate Prin. The elevator was well filled, They crowded in one moreg And then a half a dozen girls, Squeezed through the half-closed door. 4' l'm only standing on one foot ! It sounded like a whineg A voice from out the depths rejoined, And that one foot is mine. Emma Willard School, ENGLEWOOD, NEW mm, TROY, NEW YQRK, 'Wlfbifso Qettfioltlo PreflaffilfiifoioilliffllE?iZZS5iZ eSu2Z2Q1fen Zollmidte School for Girls. Departments of Music and Art, jd 84th year opens September 22, 1897. COLLEGIATE AND SPECIAL Miss MARY ALICE KNUX, QQURSES QF STUDY- Principal. NEW YORK, BROOKLYN, 160 JORALEMON STREET. Mars K6lffZ6l'Z'7Z6 L. Mczlfby, FBJ4., Will re-open her Home and School on the Brooklyn Heights, September 3o,r897, for the reception of young ladies who desire to spend the winter in the city in the enjoyment of its Art or Musical advantagesg or for pupils who wish to enter upon a regular course of Academic study. Special instruction given in Literature, Elocution and the Languages. Circulars upon Application. Ninth Year. xxviii MISS WHITON AND MISS BANGS, 43 WEST 47th STREET, NEW YORK. Elcabemic Glasses for Girls. CI'lR'l'll IC.X'l'lZ admits to Vassar, Smith and Wellesley. Special Classes in advanced work. Ten resident students. No extra charges. Rl:FEl?E,VC'E.S':-llnll, Sal!! Lniu, L1..l'7.. C'nInr1161'1z Chllfjgu, 7'1'1z11mr1 f. !i1zM'u.r, LL.U., l'1u'A'vr t'nlhgg1'1zlr' fm-f1'Inl1'.' L. Cfrzrk .Slrr'!y1', DJJ.. .S'w1'fh L'nl!11g,'1' 5 ,llr.r.jfm1u.v A. Gnzjiuld, .lfL'IIf0l',' lfvrf. ll m. R. Hlnllfllgfqll, D. ll., .ll7'. !7nm'a1z D. l'1u'11lf,1', ,ll2.v, llcmj' lf. .Y1n1rz'1'1'.r, .Vein l'm'k. MRS. lVIEAD'S SCHOOL L-..-jfor Girls anb Lpoung ZLEINCS. HILLSIDE, NORWALK, CONN. Thorough preparation for College. Superior Advantages in Music, Art and Languages. Opportunities for Special Students. Circulars on Application. THE ,... Pris cilla Braislin School ...FOR GIRLS... PEfP For Circular address the Principals. BORDENTOWN, MISS BROWN'5 School for sms. 713, 715, 717 Fiftll Avenue. Prirnary, Preparatory, Academic Departments. Preparation for College, Special Courses. NEW JERSEY- RYE SEMINARY. For Further Particulars, ADDRESS, NIRS. S. J- LIFE, RYE, NEW YORK. lllllS' lllllllilllalll Slllllllll, 479 SC 431 Dearborn Ave., cH1cAGo. Twenty Second year begins Sept. 22, 1897. Day and Boarding School for Young Ladies and Child- ren, Prepares for College, and gives special courses of study. WEABREYCE5 sligligsf 2 PRINCIPALS- xxix - A-- - i l 'nlflflno' lclflfb. Soflfrlrommome, Ql1lil7LCJXlflA3f7 Olfbew lleglomlle. l1..-., glue Ql,l,lro,1fmg go,mA,wo,l,, erwwg., Glfbew mezlomlc. ,-Y. l l l - ' nl Qlflfbwzs QL. QL SolyrlfLo1nf1,cr'm,e, all-oooom Qollefde, Qomcahlfzeelkrobe, 'lfln 'lil' . W . f'The enclosurel P. S.-Be sure and send cucumber pickles, raspberry jam, VASSAR COLLEGE, Poursuxmzrsie. DEAR MOTHER: This is simply to say l am well and happy. llon't forget the box you promised. As I am in a grand rush to-clay, must close with love to all. ' Your affectionate daughter, ANN Ll'l l'Ll'1SOl lIOMOlili. November seventh. VASSAR COLLEGE, I'ououm-:l4:1's11a, N. Y., Nov. 7, 1896. Ti-114:A1.nANY,louux,x1.: IJHAR SIRSI-l'illClOSSCl please lincl cheek to your order for Soo, in payment of sub- scription to your paper for one year. Yours truly, A. l,. SoL'1nm1oui+:. OFFICE or ALBANY JOURNAL, Nov. 9, 1896. Miss A. L. Sornomoiziz, TJEAR lllmmm:-Yours of the 7th inst. received, with enclosure. Wle are very sorry that we are unable to meet with your re- quests, but the office cat has eaten all the pickles. Respectfully yours, Arla.-xxx' jol'ur:.x1.. white gloves from my top bureau drawer, my silver napkin-ring-the one Aunt D. gave me, peach preserves, chocolate cake. XXX METER JGNASSON 6' CO. Suits anb :AB Garments 26? SOLE MAKERS OF THE Sunshine J J J Shirt waists ff W-Q MQ BROADWAY 85 12th ST. NEW YQRK ILLER5 s HQI5Ls,,?n 39 WEST 26th STREET, NEW YORK c1Tv. f- imlnluims V 'T - golf' -- '-Q-- ' Y'1 -'N 1-, llll5ATHw5i lt? ' E Eli ff t 5 si ,. , .. .4 ., . .ga , . .I --. ' - sg. ., E5 s 4 ' - - aaiw ,,' F- 't w3 2Vg ff'l-1' piuiijlli : f TQ:-1 . '21 lm. ' ' ' I , .,4g.vgHH.9aw!-s . J , .., 1-K ,Y '-,pa ,uf V. -' Q h : .hs fr ::fh,,,i M.! 5x:.4x95, ,W xi., J f lgsgvif' T5 : -LZ: wllwlrb 1 J! L f... Yv mm, 'v .. : ,SEL , X0 - 1 . fp 1 3 lf'-I ' ' '-:55l 'f51i53r't'i tiL.-.M--'T f 26 : 77 1 5 i . ' E S143 5 M Q jf ilf l '1f 4 ,jgFIS E '5 ' Ein - gllgii 1 ,3 ii .-.JE,. zf' --wr 1' 1 ' nl. 1:15491 f i ll Era!-vel? ,exf t ,q-- lag' ' 'H T 'E ' ,N Q igzu' . f ,. -,'X-- ex ' .,,Ni,-f vi' an . '-' lttlllm lll ll l Q 3 ' ' , gs., f f 5 ' E XE V A' fffseiml. 5f?1t'W'fi'1g'W uf' '1' vl-L-fu ------ -'l Q' - ,.- .F la .,q-?'gH'3.- 71-s, 1 wf.',:,f.+s..lf'. m ein Q.-f mt-lin ,ea - t l ffl . -- , ., '- ' ,-J W isis- t- -4' ' use ,,.-'N ' Zii ' gif.- 34' ' 5-3-F fr 1- -P13353 A Strictly, Temperance House, on the American Plan, especially adapted to Ladies traveling alone or in parties. Quiet, comfortable, cosy. In the vicinity of retail trade, places of amusement, and the principal churches. Patronized by Vassar, Wellesley, and Smith Colleges. For the accommodation of students and tourists, when desired, rooms will be given without meals or mealsmwithout room. Special rates for Families and Permanent Guests. CHARLES H. HA YNES, Proprietor. xxxii JHIIIHS HBUHUIHSEQEQR EEEEIBVHIUI UU., POUGHKEEPSIE, N. Y. Flour, Feed, Grain, Hay, Straw, Salt, Grass Seed and Fertilizers. OGG LARGE s'I'ocIc, GREAT VARIETY, BOTTOM PRICES. MEAE. EQ.. E SIEEWEHE E1 EERE? 318 Main Street, Poughkeepsie. WYQLLI EHPEQS. ew .Q2wwzaw'.QJw1z QQINT? I I E'EE E E A ,,,E.,,,f QWQTQIWS HMB QJQJEBETS 1 1 I PRICES ALWAYS MODERATE. QLD FURNITURE, CHINA AND CANDLE-STICKS. flnlfgzfl' l m'u1'!m'y llnnghl, Sold nm! lhgba-7'ezl'. . . . JOHN F. COXI-IEAD, QGNIIQI mdkQl'. Fllf'!7l'fllf'B Made to Qfder. 22 NOXON SEFREET, Poughkeepsie. New YIIIk. va R. WOLF-F, ' 21' Poughkeepsie, Ny. NQY.E.L,Tl,E,3.,!.N FURNITURE AT ,MODERPeTE.PR1CES- 523 C. H. BARNES, 407 8: 409 Main St., Poughkeepsie. ORDERED womc A SPECIALTY. WILLETT TITUS, Garpenter if anb 556 5Builber 44 CATHARINE ST. THE MA1soN An. BRAUN 2. co. BRAUN, CLEMENT 8s co., ssssssssss. Xs .1 gl 4-Qx N 5 u4,,l ,I V5 1 ,,,.- fir- TJZIA1 QL? xx l XXX X X ill fi X l if X , .ks 'Ni' M 0 xx Hua! JJ ki: .af :fi- ' ' - 1 4 -- -1. -s-'- e ' -sf- . ,. 4f'f:5e::i2-19'- .. x-lt-. ,iz-:Fears-a-F, -il . :R geiwx., ' -21za2:fs:ss:':s- 'ti-Emir .fd -. All' !melg4Zugs:- ,Ms N is ,- -I , s.J..ll.-il i slstaiaaepfmjgazt: . ..... 7. . 'lt . . ..... . ..... 'r 1 MH 3 - ' 'A .,.',? ,!' +E:s?'fii ,- 'fl' l - ci?1'.2ff'i J :J Y - -ll' 112255 f' 'F -s - W WAN . , ,V I .4 X . fists I ,f ff X ,X s h,.,L'-1 fill ilb f .1!lj't -7:53 hi sl -3' , s l 1 ,i m il? -el.1-tsiif. s nv--Goss. w. f- , ml W1 1 2, ,r,s'sf:f5'fil..' .s,. .V ' . . L- I Q- , usb- 1 iilgkflruf-S' fi f,i.,!2gsjqg'fl5,'t,3:,'a.'.'517231.35 5-:is-'-zgiss,i,'s'55'i'B5:t.11 ' ' ,L-. ,s.. m -.- ....,,,...s ,s:.s.Jl.. l.-vs .rl -his finial iff 12-.ggggggifggesfi 5515 1 ,V lfillllr sgisia -'s si s ' .sy . HN Publishers of P9155 257 FIFTH AVE., ls,.y,-w,,3,.,N 23,1-H Am, 291,-H Sf,-KRW new YOYR. .2515 REPRODUCTIONS lllusrrating the most Admirable and Famous masterpieces of Painting Graphic and Plastic flrts of the Ancient as well as Modern Schools as represented in the Qfurnpeuii .lirt .galleries of Amsterdam, Antwerp, Berlin, Dresden, Florence, Harlem, Hague, London, Madrid, Paris, St. Peters- bourg, Rome, Vienna, and many others, In the great field ot' tHl'lJllliBCllll'B uno Sculpture we publish reproductions of the Monuments of Egypt, Greece, Rome, etc., of the statues of all Galleries of Europe, of the Cathedrals of the Middle Ages, and ol' the more Modern Monumental Editices of Paris, Versailles, and other large cities. Our Reproductions of liainlings lil1JlToDet'll .Hrlists s embrace all the principal names of the French School. Special attention is drawn to our Latest Publica- tion, the Prado Gallery of Madrid, rich in examples of Velasquez and Murillu, Titian, etc., etc. FRAMING in Renaissance and Rococo, and other styles carefully attended to. - A large stock of frames imported from Paris. Special Inducemenls to Educational Institutions, Teachers and Students, The Maison Ad. Braun Co Braun, elemens .ss co., stissessol-s, A 257 FIFTH AYENUE, NEW YORK. xxxiv DIREKA Fine Stationery and Engraving Hou e ' I l2I Chestnut Street, Philadelphia. COLLEGE INVITATIONS WEDDING INVITATIONS STATIONERY RECEPTION CARDS PROGRAMMES MONQGRAMS BANQUET MENUS COATS OF ARMS XEBJATERNITY ENGRAVING 3 All work is executed in the estulalislnnent under the personal supervision of Mr. ADDRESS DIES HERALDRY AND GENEALOGY A SPECIALTY. COATS OF ARMS PAINTED FOR FRAIVIING. Q Dreka, and only in the best manner. The reputation of this house is a guarantee of ihe quality. All loyal Vassar girls should use the goods advertised in the Vassarion. - O Send il Postal for Specimen Pages, etc Successor of the Tf 3 ,x.Ti,,s,E,,.s Q E THE BEST FOR TEACHERS AND sCn00Ls RIIAIIUNAL aggfgilb 3 BECAUSE IN THIS DICTIONARY nfff N ' rnhummlc DICIIU '-I lt is easy to fmd the word wanted u I E,29- L It rs easy to ascertain the pronunciation .IIIIII It is easy to learn what a word means G.2ir.MrRm.Ieii lt is easy to trace the growth of a word dard of the U. S. Supreme Court, of all the State Supreme Courts, of the Sian U. S. Government Printing Office, and of nearly all the Schoolbooks. Warmly com- menrled by State Superinteudents of Schools and other Educators almost without number. - -l1 - Hon. Charles R. Skinner, State Supt. of Public Instruction of New York, SEIVS :-The International is easily king among hooks, and royally gives for the :rskingi iust the information needed and just enough of it. 'We should be :L better educatet heople if a copy of this work could be plat-ed in every home and school library in the land.-March 15, 1895. G. 8 C. MERRIABI CO., Publishers, Springfield, Mass. 0fy04y04J04y04yO4j0 as no so an as in on to ll on as on on as so OIC 9 nternational Z i6Ii0nary XXXV HE VASSAR IVIISCELLANY PUBLISHED MONTHLY BY Tl-IE STUDENTS' ASSOCIATION OF VASSAR COLLEGE, 9' :H A LITERARY MAGAZINE CONTAINING ALSO COLLEGE NEWS AND ITEMS OF INTEREST CONCERNING ALUMNJE AND FORMER STUDENTS. Subscription Price, 52.00 a, year. Single Copies, 25 cents. E35 Q35 I ADVERTISEMENTS INSERTED AT FAVORABLE RATES. IEDN to TL IIBHRQIS FR 'M'NG' Va ' 9 PASSE-PARTOUT5. PICTURE AN,D MIRROR DEALER E A R S FRAMES REGJLDED. IN U. 0 REFERENCES ---- 329 MAIN ST., POUGHKEEF-sis, N. Y. Prof. H. van Ingen. Rev. George Clarke Cox. UI'-STAIRS. Mr. Edward T. Mason. Mr. William C. Smiley. Mr. Peter B. Huyt. Mr. Alfred M. Frost. NI.-xm:,fAC.l.UREk Ol.- Mr. Henry Booth. Mr, William T. Bolles. F. A. Faust, M. D. Prof. G. C. Gow. LIBRARIES. .se se .se gOur topically arranged General Library List of the Standard New Books of all illublisliers revised to date has just left the press. It will be found of Great use .by Librarians and all others having' occasion to select titles, and will bac mailed Af . , l' . ' : ' . . . ' - - .ree on app lcation. Lstimates on proposed extensions to public and private Qlibraries promptly furnished by THE BAKER CY TAYLOR CO., Wholesale Books, .5 and 7 East 16th Street, New York. xxxvi sgnoyq pneqogg JV JunH oalgqo 'J U? E 52 in N7 VUISV AN Can MD 23.1029 Jo aouapgsag AUXX U12 QP 'WCP SH 'b OS YP? SFWQM 'D 'U 'sxaplgng 'u xxxvii 'fzf 11 :H 5 il ,K A1- ifif , nay 9 -,H Gcean and Rail TO TI-IE South, Southwest and West 0 E' I :i1.x+'.s i , I 1 1 - X 1 - ' The large modern stezlmsluips of the 0 0 0 ,ld EOHIEHEOIE :me perform a daily service between New York and Old Point Cornfort, No1rfo1k, and Ricldrrlond, Va. connecting with all rail and steamer linee divergirxg. -,,,,,.Ax,.,X,. Through tickets and baggage cllecl-:S to all points. For full information as to rates and schedules address QLD DOMINION STEAMSHIP CO., MER 26, Nolwrl Rrvma, NEW YORK. W. L. GUILLAUDEU, Vice Pres't and Tralllc Mgr. xxxviil DIXON'S i American Graphite PENCILS ARE UNEQUALED for smooth, tough leads, that hold their points better and last longer than any other pencil made. They are made in ten degrees of hardness, suitable for all kinds of college, office or pro- Xfessiocnal Work. . . . . . . . . . . , . They are used in more schools and colleges than any pencil made, and always give satisfaction ....... All stationers keep them, or sam- ples, Worth double the money, will be sent on receipt of I6 cents .... Joseph Dixon Crucible Co. jersey City, NJ. irrt ssl, H is .,.,, , ,,c.,, '.1,:.,-r-2 A sql B Large and Elegant Line of Diamonds, Watches, Clocks, Jewelry, Novelties and Optical Goods. Special Attention Given to Repairing. EYES EXAIWIIVED Bl' A SPECIALIST. We grind :incl lit the most cnrnplicuted glass. liver ten thousand tropool persons are wear- ing Glasses tilted by us. PERKINS 84 COMPANY, 322 Main Street. l f ' I l A. . ,QC Q1 1' 0 SYQ, PHQTQGRAPHERS. Y e iiiili iiliiiiiliiiilliiiilallillil lllllllillllllli XVe have recently remodeled our Studio, and sup- N plied it with new Baclcgronncls, Accessories, Improved E-get 1 Instruments and Appliances, and are now producing ff!! S xx X the most artistic effects in all branches of photo- ! ll!! V I X- ' 'xxx h I l' 1 ' ,fl graphic work. ul? D602 P0l'fl'dif negatives of the YGCIIIW dlld TIISYIICIOYS of Vassar College complete, and a large assortment of interior and exterirr xicws of the College and Grounds, from which prints may be obtained at any time 254 and 256 Main Street, --- ri,-,L.lh.i,, POUGHKEEPSIE, N. Y. Class Photographers for 1880, '84, '85, '36, '87, '88, '89, 'go and '94. xxxix SCJ' 'W W Hmifm + ff v well imdf Q. 1 .ra I , ' ' ' - ,. fl iw , , it ,195 Q - f lil? . . sl J W- 5' 5 fi- . ll f l gg 5 A lf - W. .T A VERY DARK NIGHT. FOUNDED 1524. J STERLING SILVER WA REED 8z: BARTON, ep-4 RE Union Square, Corner Broadway and 17th Street, NEW YORK. . George ill. Shieblor Sf Zo., x Siloorsmiths. A DQCRCI' Blllldlllg, ss Union Square, west, new York. New Sterling Novelties just Received at V99 Q3 QUINTARD BROTHERS, .. . JEWELERS . . . 316 MAIN STREET, PQUGHKEEPSIE, N. Y. Q5 Q9 Watches and Jewelry Repaired by Experienced Workxnen. THE DUTCHESS RESTAURANTQ 309 MAIN STREET Cuisine Urlequalled iq Poughkee s' p le. Y Dutchess Ice Cream cmd Fancy Ccrlies The Clioicesr Oysters, Meats cmdGc1rqe. 'E del' lvered at the College every day. xl ? LINDQ BROS., I Q s,3f?5YSlS'Q?. ?1'lQ?l? FBT? QCRIQIS Ufofqlfe 'llesflgfis tZ1sZfZiN0i'6Zfl'E,Y fn 7311111-zomifmtwlljf. BROADWAY AND 29th STREET, Opposite Gilsey House, NEW YORK CITY. ESTABLISH ED 1872. XQRETNOLDJ 6' CRFll'lEK,j holesalc G oces is - ,,,, YYYYY YYY, , - .- - T. And Shippers of Flour, Grain and Feed. Proprietors of the celebrated PER FECT brand of Canned Ciootls. Mill Agents for Christian's Superlziliven :incl White Sponge lflours, Choice Food Proclticts :1 Specialty. Warehouses and Elevator, opposite N. Y. C. 81 H. R. R. R. Passenger Depot, POUGHKEEPSIE, N. Y. QAJ ETSVEJ 1 Oil Stoves, Alcohol Stoves, Cooking Utensils of every description. Rub ber Tubing, Gas Globes, Shades Burners, Drop Lights, Chaling Dishes Stove Mats, Xe. llblnmbing, Gas Jfitting, Sc. 344 HAIN ST., oee. Monson HOUSE. CI-IAS. COOKE, Poughkeepsie A I1 fl, i. f,v.,,-,W -' -X V ,,.,, e aux R- - V XXX'-lift-3: ' p lk. . K ,- g For sele, io rent. nd ' d. R Mr. V. SCHOONMAKER. 442, 444 81Z44l2elll::ili?1Si. sli xiii Q For College Girls desiring Room and Board by the day O1 V g 4 week for their guests, or for themselves by the year. WAFFLE SUPPERS, LUNCI-IES. SALADS, CAKE FOR BIRTHDAY SUPPERS. Mrs. Milton H. Taber, 24 H ker,,2Z22,KEEp5,E, N, y, fgeafcfuclz of Qcu1f14cl'1fLeI C1111-O ZTII1 lzloifccull Qllulllimuze. gPI'iRQa.teIessOnsat any time, Minuets, Gnvottes, Xe. arranged for enlerminn ents. Speflial attention given to Fancy Dancing. REED Si FORMAN, Iliinfrg, Sal? sub Qrrhngv Siehlvs, 432:440 VIAIN STREET, POUCIHKEEPSIE, N. Y. FIRST CLASS TURNOUTS, BOTH SINGLE 81 DOUBLE. GENTLE HORSES, AND PHAETONS EOR LADIES. TELEPHONE CALL 226-3. STDERISR BREAD aw. RULLS GSRQGERS Y QJZWQWW u I l IJLDIES LUNCH! GATE 63? PESTAUHHNT xliii 6 . . - Q U o o 0 o Q o ca MZ D z 'E !? 5 !Z IE IE E 5 5 5 E0 Eos gui ogogio o O D D ' o V - - G - - w W W X9 X9 vm w W W' D on c cooo 000?PX0?Fx050Q?QJ?00000000?QJC?9X0000000 00 00 00 0 0 00 00 0 00 0 0 fX A n A 0 0 n fx n f- A n 0 ci fx 0 xcy-oooo?a'3'SS'S'8e'Seocecc.-oooooooo Qogo co cuocu 00 00 00000 00 000002'-'X000000000000o0000000 00 00000000000 00 00 0000 iaeeebeeeeeee-eeeeeeeeeeeeeeeee MMM QX.,q,o,ffkn,frk0'aXooooooooooooofz3nK5X nno Xcyo o 0 G f---v -- -- --- 'MMMMW O f Ever once . KKMNML .W ogooc NWMNX 00000 00000 MMMMN 00000 Q, qooo NNNMN weeee MMMMM O Q ca D o o o W O O O O O O O O O O O 0 O 0 O O O O O O O O O O 0 O 'QOQD oQu QQU oQo QQL: QQ: o co o cn oQo o eo o no o co co o so co o co co oo o oo o no o eo o no co oo co o no o o fxfx. i 0 0 D fy 'Ea LZ: 53 L5 'S '32 ?n 'S ' 'S C5 13: LE 'S 3 '6 55 'S 'En C6 2 'S LE: o o o 3 fgqgmfggrgwyilgyggggagmmmmmtggmo o no o co o eo co o co e so co c oo oo oo oo an o 3 O O D D D D O O O O O O O D D O D D O O D D 0 O O Q .. . . ,W , . .. . . . W -, UOC lm www I M V :if .. U Mi li . . , 30 O Q P -4.41 A ff - f 'L 4 3230 Qi . A 1, 2' , ' .U . g I M. . . ,- . ' K X f I. 'M P ,N 32 Q xv, I f' , , ' . , -- - ,- , . 0 ,906 i , . - ,Q goo . . . . I V M! ' , I+ F 2 Q . A . l f A , 9 Q ' Y e i ggi 1: AL FAQ , - . my if - - - t - , is ol .f .f. , -. .IlQ f: , 1.1 - 0 Q 040000000003 0 ',l1'I'11ifH1i - Ksismiflbj' ' 0 A 5 920i A .r-- '. . 5 -.,-.tug ' 2.1-. . Q 'Ez -2' , ' 2' I .i , n' I an Ol dsl - ft 1 ff ' L . . Q 1-:2-M-. v . ,N Y. I I 1 . - -. 3. M1 V he ' .- - .,.,, 0? I , N QA A .. ..,. 0 . , 1 e i Q gcc , W. , . .. .. f .e,fi. ,. , M ,, ,, , . ,, , ,,. 900 fi . - - if .,..i ' ' 0' - A X - ' i ' L'-f-Wfaf' .. sb -. f f S M M gli -W W-........, 451-gag g ::..,: -- D30 l U V ii ir i .. 0 o o U m Q 0 0 0 o u o o o o a -L, ca o 0 o o o 0-AE: S770 S MMM QX n KA 34-X rw 6X o 0 0 o .fax o o o o o rs 0 0 o c o o ng Q7 ga ga DOQUOOMM DQ O Zin mai o o 0 Q SEE THAT CURVE EMKM go 0 O ' 0 O O D O U C7 O K E A 'TI N G Kmiil KXEX ,KE-EDZQM, V W ls the wheel-for wheel fillers limo knoml good wheels. Jlmggiim O O U U O U O UT O O C7' U O U O O O U O U U O O U U O C EXXMEEM MMMMMM Wiql 0000 1000 000 0 000 00 0 'Z 0 gfwfigl Have youlever noticed the nicely of Keating Workman- iii 0 nl . .. N 1 . . - . Q Q ship? The finely fitted paitsg the flush Jointsg the finish ,fjoogo 3 'gi f the cones? Ever noticed the lone' chain for s eedP 3 3 Mmlo - ' e P ' WM Xml KEATING WHEEL co., genie, O Sheet Music and Catalogue free. Middletown, Ct. 'NM . , ., ,,,,,,,, . . ..,, ,. , , ,, A ,AW ,f l 4 yy O 0 0 O O O O O O U o D o cz cr O 0 O O 0 O O O 8 3 ' MMMM .KAX Q o Q Q o 0 0 o Q o o 0 o o 0 0 o 0 o o 0 o 0 o Q o xgf cn Q, o u 0 0 O U 0 O X9 0 O O 0 0 O O O 0 0 o 0 0 O O MMMMN ,o, ca, AOA 'QA or Q, Ao- O or YOA 0 or AOA Yo, Wo. Vo, Yon ,OA pr Yo! ,or Yo or Yo' Yo or or l xliv Spring Styles for H8 7 , -,S-...H If-af, H, L Kip, ei, NOW ESTABLISHED. 'lin ' .V--. W '. ',.e - - 1,-I ,y- HE designers liavecreatecl the most exquisite Y '-Q-Wy-' 'i,, ,f5-.jf garments, perfect dreams of loveliness, depend' I -K 6 ing upon genuine FIBRE CI-IAMOIS inter- 'Gag' Q F' - Q lining' for the artistic execution. Absolutely -- 34 unobtainable by any other interlinings than genuine 'f-- f 5 'W 1' Fibre Chamois? 5, ,' Genuine FIBRE CHAMOIS interlining' gives the clressmalcer unlimited latitude in which to make the most pleasing and fashionable effects, sup- plies tone to the tinish and shape to the form, and not only drapes and shapes the folds into the same perfection as they are pictured in the fashion plates, but keeps them lperiect shape. free from creases or crushing when paelreflfsat on or otherwise crusherl, and thoroughly pro. tects and pi'es'erves the material at all times and untler all conditions. fx? ' The composition and manner of manufac- arnlng' ture ol' genuine Fibre Chamois is such that it is absolutely impossible to manufacture any 2 t-auf,-' f mf-. ,' ' 'L PIE ff ry, f f' kr ,K -Cl l 1 iff? ' t 9 3 M 12 ,fywa , . ,n 421 . - ' ef .EQ Xf 1 XX ' xl l T Q Wd -ik! gf' l ' L .l 6' , 'Vit Qgqf f' Qfiggtit' -rl .,. A, if ' - ' ix , 1 Fibre lnterlining that is not iuinous to the sha we of the V . . , . l fin? . .W ,,. . sfo.- gfarrnenk without, infringing upon the patents of the fA ?a4-Q6--Tglcbdjig Fibre hamoisf I Dressmakers who have had experience, using all the different interlinings. now use only the genuine jig' 1,5 FIBRE CHAMOIS, and avoid having all their labor, skill, and the material ruined by the use of some ug! li lg , 1, poor imitation Fibre Interlining which has been put on the market. gf fgggg, 1 .. Lg Ladies, protect your garments. Dressmalcers, ff protect your customers. Dealers, protect your li? ':gff2jifgf f'5Rfi,j'Z,'.,fah,Qff,QS, trade, by insisting and seeing that every skirt, waist, jacket, or cloak you purchase has only the genuine Fibre Chamois lnterlirxing, and re- ,gf ,',, fuse to accept any other as substitute. ,gf 4 2,152 f ftrfl Squeezed and twisted into the smallest , E-11, minimum space material will allow, all ready to be packed tight and compact. jr N, Q , This is what the genuine FIBRE 7' p,,A'.,Q,gr CHAMOIS will do when if is used HS un fn- terllning for garments, which is an impns- 1333 , Q . , . L T , , , . , sibillty where other interhnine is used. Zi' - - 1 .zs,f,:.--'-e. ' . -af-inf . , 1-1 'if 'rf , - ' ' ' 'H f' ixi f' ,li 'PV- 2 '14 H '? 'ca PM Kham 930- 'tit SELLING AGENTS TO 'ms 'rmoa 14 - JL : :?f.e's-M. 913113 -,g,. ., XS t J' W- GODDAHD 42 SON, fe l' .mite Dressmalcers sending their busi- ness card to selling agent or the 5 ff -7 company can secure the latest '1' '-224 ,wf 'l ' -ev-,-f--f , Qi if ,. Paris Skirt Pattern Free. Wfny is Prixy like a fashion plate. 1 P Because neither of them believe in waste. xlv CATALOGUE VIAILED FREE S I I 0 0 ON APPLICATION N 1 FOR BOTH SEXES. ge FOR EVERY AGE. FOR ALL US ES. ALEXANDER 6th Ave. ci 23d Street, BRANCH, I34 FULTON ST. . . NEW YORK. IN Fine Millinery High Novelties in Fancy Goods, Ladies' Furnishings, Novelties of the Seasons, EVERYTHING YOU WANT. TELEPHONE CALL, E6-3 deiddddetadddeldebddabdaeba JOHN PETERKIN, 330 Main Street, Polkeepsie. Teeth Filled without Pain by the I-Iale Method for Painless Dentistry. Dr. Stephen Palmer, 5Lll'g60l'l 'Devlfiet 310 Main Street, Poughkeepsie. OUR FURNITURE is made especially to till h f V Students, to whom we give a speclal d in rides. Our stock will alwa s be f h P Y largest and most complete in the city. ONE OF OUR SPECIALTIES Packin and Shippinvf to any destinati ll is E1 gil? ' fi B ' B ln so urmture, '1ctures. TIC-Eb I' When You Need our Serxices Drop us a Postal, GEO. HUGHES :Sc SON, 4lIE. lllll 81410 Main Streel. Poughkeepsie. N. Y xlvi N K If DODGE 81 DEVANNY, 180 COLUMBUS AVENUE, Buu.n1NG CONTRACTORS. A mAsoNs' suPPLlEs. PITTSFIEI-D1 MASS xlvii IFFAY 531 Co., Q GOICI dlld Silversmiths +2 Designs and Estimates Furnished for Fraternity Pins, Class -Rings, Class Cups, College Stationery, Etc., Etc. .ai .al .2 Gold Watches for Ladies AN ENTIRELY NEW SERIES OF SUPERIOR GOLD WATCHES FOR LADIES, AT THE FOLLOWING ATTRACT- IVE PRICES. In plain 18-karat gold open- S25 face cases, ...... In enameled gold cases, with SB enameled dials, .... In enameled gold cases, set S70 with diamonds, .... :S 75 and upwards. vie' ESTIMHTES on class rings, pins, etc., are largely governed by the quantity required. No order can be accepted at ci price not consistent with the best worlirncin- ship and ci quality worthy to bear the nanne of the nouse CORRESPONDENCE INVITED, F m7o3. FCb.11, Q7 xlviii UN1oN SQUARE, New YoRK. SPRING oUsE . . Richfield Springs, New York. The New Bathing Establishment furnishes all the accepted European methods of treatment Cby sulphur waterj of Rheumatism, Gout, Catarrh and Skin Diseases .... It contains Sulphur Baths, Turkish and Russian.Baths Cwith sulphur vaporl, Douches, Massage, Inhalation and Pulveri- zation Rooms, Swimming Bath, Gymnasium, Sun Room, Resting Rooms and other conveniences ...... Skilled Masseurs of both sexa. A full corps of competent afttendants. All under the personal charge of Dr. Charles C. Ransom, 152 West 48th Street, New York .... The Spring House fl-lotelj and Bath Houses Open Every Year from June to October. Missiles! r,,i i,rr RR rii. m2.13!ise1E:,9,fx ,i,, f .iii.f T. R. PROCTOR. Vassar College Students should trade with the lirms zmclvertising in these pages. ' f ,fa,:,f7 ' . V U , v V X... , .,V,,, ,,,-, , 12 5.-'11 I ,. 'piggy . . 1, , ., , ,Q,,,w . WZ ,,,. ,- . , V 52,3 'AH thing of beauty cf .1 'ez ,.,:, ,:,,w-ff:,e- .4. , C' 1. ,. ,g,.Z1wv,f, ' ' ff 4:9 which comes ID so appropriate- Y Q1 ll he han S0139 DUB S ODDS SllllS v:ffL:,:af,2 f2 rawzH:wfa1,.s4,4,Ze, fwzrqgf, X 4 ,, - .ar -:rf , . - -.1 -4 ' 393' 3 -y , Wgfaw:g4ifaf1fmf.mf.t . '- qwfff f f..,f - w -25 f'i't-z, ,2,,fs'mZ'1- M , ff 1 v -212 -Slilfl ll! lllSlb , 222 ' f ...fi aft if . - .' 91,5524 1, .7 i HQ': 2 v A -V1-,?ff2' and C111 OUIQF KIHJS Ol '1'T4 Y .fiiiivrf :'.L.5'! f' r e 'ee' 1 it A .1 .iw se w. a - V r..s,-sffwi'-. wf.fw. .4-rf-A ', - A Q21 - ' P A -r-ir - , - 5 '-Puri' .4. 1 A- ' Po lfeepsle. ' sells at 308 MCLID ST-l WLWNV 1 xlix Fine Millinery and Fancy Goods. FRANK H. CARPENTER, The Corner Sfore. 348 MAIN STHEET, PUUGHKEEPSIE. MISS A. R. COUGI-ILAN, Dressmaker, Q4 Market St., Poughkeepsie, N. Y. All of the latest Paris and American fashions on hand. C. D. MILLER, Dentist, 293 Main St.,'Poughkeepsie, N.Y. gjomuril Q. Jilieel, fiilflof Stearns, wrient, Ubomas, ilftiagara, wuting 8 'Ctourist JBic33cIe5. 1Renting ano 1Repairing. 192 main 511661, 5 1 1 lbougblieepsie, 1l4. 113. WOOD 81 TITTAIVIER, E5'I'1XIlLl5I'IIiIT ISIN. Wholesale Dru ggists and Dispensing Pharmacists, RELIABLE DRUGS ZHVD MEDICIIVES. A Fine Line of Toilet Articles, Foreig We carry Laulier's Quiniessence of Violets, an ex- quisite Violet Exiracl. n and Domestic Perfum es. ETHICS PIQOFIZSSOR-Wliy dol Find fewer terms to express complaeential than clisplacentizil feelings? ST UDENT Cpromptlyj- Because you have fewer complzicential feelings. DR T. FELIX GO.URAUD'S ORIENTAL CREAM,0R MAGICALBEAUTIFIER. . x livnmrea 'l'n11. Pimf gk 71 ples. Frevkles Nliilli A -, n- rim R 1 1 Ps! ' ,E 5 W Pnrihes ns well as Benutlhes the Skin. No other cosmetu will do il. J ,X -N bkln Il 1 , ' 2' cry ll h b '-. ffxjfnygilzn af ,Q 'P fK,J non. ltl 1 in J , kia fm r , 1 1 is so lmrml if v tmaleit to benure ll p1'opi-rly made. A ci-pt no counterfeit I' ' similar 1 me. Dr.l 1 1 , f . A. Snyr 'dl I il ' I' , ' 01111211 11-r 1 A .. tiv11L,: As,' I li - ,, X will use tl I I 4 cummenfl 'Go l 1, 'Z Cream' th l L E 'JJ harmful I ll tl E I Skin p 1 ll . I1 - X Fore l l, ll I g., ulszs nml Fancy-lioods Denlelrs in the U. S., Can las anmlE11rope l FERD. T, HOPKINS, Prop'r, 37 Great Jones Sl., N. Y OFFICES: HE 2A Beacon St., 1 y aos'roN. ft S J l69 Wabash Ave., caffff W, ff? iss- e ' . : . Si frgonefaff ' Send for Agency Manual. i h A Tiff ,,....e'NTN AGEWBIE S 3.e.,f' MM W , I One Fee Registers 'T-L AND -if In Both Oflices. At the Theater. l - Down in the pit The Freshmen sit, The Sophomores just behind g And next, within the balcony, The juniors you will End. Above them far The Seniors are, And hold their lofty stationg To rise above the common herd ls quite their aspiration. lllli lilSll TEHGHEIS, ll!lBlllilliS. EVERETT 0. FISK Sc CC., Proprietors. 100-frrzgu Agency .lla1z1nz!.rm1fYb'r'f in any m!f11't'.r.v. 4 Ashburton Place, Boston, Mass. 70 Fifth Avenue, New York City. N. Y. 1242 Twelfth Street. Washington, D. C. 355 Wabash Avenue, Chicago, Ill. 25 King Street, West, Toronto, Canada 4:4 Century Building, Minneapolis, Minn. 107 Keith 82 Perry Building, Kansas City, Mo. 73a Cooper Building, Denver, Colo, 525 Stimson Block, Los Angeles, Cal. AN is valuable in proportion to f its infiuence. If it merely hcarso vacancies and is something, hut tells you about them it is asked 'to rectnnmeml a teacher, and rrcommenrls you, that i3,5n.grgREC01Vl1VlENDS. C.W. BARDEEN, Syracuse, N. Y. 0 Q 1 -b o ' ' Positions Filled in Every 5 llilshlp Part of the Country. There is at constant demand for College gratluzites. 1 ' Agency Send for llegistration blanks and circulars. W. F. JARVIS, MANAGER. 3 SOMERSET ST., BOSTON, IVIASS. A O Q' Q 0 THE CEILEBRATED Z:-Zzgggsgsgzgggsgsgsgs gel- 'J PIATNOS- Are at present g , W5 ,m Preferred by ieiiff 'ill .W ill -Al l . the most ,E the leading . popular and c A Artists. 'KW-TA '-N ' ,:..:::::... - iii x' H 'RW x' EVERY GENUINE SOI-IIWEI? PIANO HAS THE FOLLOWING TRADE-MARK STAMPED UPON THE SOUNDING BOARD. i ff-If 4 f -17 A s It 9 ' Q Q -fi, ,J f l 2 fr la inie? ' CX 9 3339 r O76 Y, Q-by fp Qt A eo Q1 O -L' ' o 4 0 239 - Mags.-f fb AQ OA- Q QXV' qv' 460 IHS soumigpd 7'1'5 FIRM TO A0611 RADE MARV- 50l ll'lER 6' CO. ms. M910 Iss East mth St., Dew York. CAUTION.-The buying public will please not confound the Genuine S:0:l'l:M:E:R Piano with one of a similar sounding name of a cheap grade. lil THE LEADING A. W. Millinery 8a Fancy Goods Cor. Nlain and Liberty Sts., ....STORE.... PQYKEEPSIE, N, Y Peerless Double Dress Stavswe will never break, bend out ol' shape Q. nor cut through the dress. RLLQYD, R 1 lllslllm ll s CARRYALL5 6: CARRIAGES FOR LARGE PARTIES Sc FUNERALS. 1 All kinds of Fashionable Turnouts. Horses for l.zlr.lies' Driving :l Speuialty. Special rates to Vassar College Customers ........... Direct trip with Carriage from Vassar College lo City, or any Dcpol in City, SI.00. Hefore 6 A. M. and after ro P. M., double rates. Extra charge for trunks carried on carriages. Mrs. Mclilyimsn, n MODISTE, Good Rooms, Q Q , Excellent Board, 48 JVOKLOYZ QSZ7 ggi' Near the College. 71' '-an l J ll? I J r7'1fL7hAWfJSM' Q' 3' POUGHKEEPSIE, N. Y. Evening and Day Gowns made up in the Latest Styles. When in Want of HARDWARE, please call at . . J. E. ANDREWS, 340 Main St., Opp. Morgan House. Colies, Toes, Salads, Waffle Srlppers, al' rqoderare prices ...... I-INADQ UA wr is us no lc BllLllMBlA rr Hllnrullnvmw eles, W. E. Spalding ll Hrns.' Spnlling Bonds. Bicycle Repairing and Renting :L Specially, Dis- counts given Lo Clubs on :ill classes of Sporting Goods. CHAS. E. SCHOU. 7270 MAIN S'1'lcu1c'l'. PUlTGI'llil5EPSll'l, N. Y. uuounvn ' 'Tfwf 'fill-I H..-,gudtoono 0221 I . Q Qsiuwfffg 3.- inf , WI,-sl 3 UNE' is It .4 I ?. A :B K? f5z.l j.,f .. w ir - . vw- ,4--1,4 -R .vw ,, ss ' ,lf-1 Q ffm llllll li I' , ' 1. ff 'If' - ,A - ,K 6:1-' I at V -as .f::1' im' f T ,' if I Hum.. I sesgge 1 'y .- . I X 1 lfliifjil ' .m' Q1 a . ., f f I, f If ff I , I I Ik wg, .l4.l. 5 fe 0 QSTLUUISTO -R D53 QXI2KANSASflAEXAS T fmcfovprarrncntw Wonwl liALll9lJI2NlA. E573 ELEGANT Txnousn Senvlce vm THIS THE TRUE mmtren Rumi WINIEIIllES0IlT5fIf50UIIIIIE5I Wrile General Dmsenger Agenljbr Pamphlzla giving Pwlcvlarv. UTINIAIN JW-Jfvlffies - 092125: I'9.IeP:n.:'LfJ flskrzev -STLMJID' PLUMBING. GAS FITTING PETER ADRIANCE 81 SON, . , . H ll','.1lc'tl. f Piwrfrssson rn-' Izcoxoillczs.-XX here in the HW Us might S oc m me ml O Bible do we Iincl mention of the improvement Gas Fixtures, Drop of land? Globes, Shades, Burners, Heating Burners, Gas Sloves, Gas Irons, S'fU1JEN'1',-Oli, er, - you mean about Gqs Signs Rubber Tubing Agate Lot's going up-I really dont know, Wa,-ey Till Ware, Etc. b 393 MAIN ST., near Hamilton St., HEATING. POUGHKEEPSIE. TINNING Miss Carroll, Fnfiiiveeia I 259 Main Street, Poughkeepsie, N. Y. LOVER FRANK VAN KLEECK'S HAT STOREJ iiv NELSON fi? HOUSE. Che largest anb Jbeet Equippeb 1botel in the Glltxg HEAD QUARTERS FOR COLLEGE PEOPLE. .41 1 if 5.1. ' 1 1,-W 1 ,Q 1 63 .iw -4 I. ? w I QSESN7' 3 1,1 1.--2 Af .'.f:::-'Q AVE. ' -AAA' 1 . 9 'v L ' J -C - , , ' ,-.,':'1, f, . ' 1. 1' fl: V N V , If i VDOUOHIQQEEPSXAE,-.5 , 1 a.1.11 f'fv . ' 1 , 1 , HoRAT'O.Nf5AaN..11 ygggl' - f'--ig., f. ' I -. I f ' X . .A .V ' 1 I I . ---f1w..11-li f g ffwz 11 V' ' ' . PR0PR1iT.o'r2. ' ' 1 -' ,jaw-. 311' ,. ' .1 , W - fy , , H , ii'?f?f.f1f.f'2l-' f 1-544-:arf-. M f?Lw?v1, jx-1.121 ? M 1 . j ' -1 .gf1,j.f Q .Y , .Mig HQM.. . .., H, . ...M 1. 4 .,..,4 .1 . , .. 11.1, ' ff - L1 1, digL,1- Q-1 -g y E- f , V i mf' '? Q2 rg . - Q J ' 1- -1 4. ,L ' ' - - 1 P 1 1: :.f 1:1-1 11 - 1 .Q 1- 515 1 f1. Qwya-1.-mi w3es.21..- 1 , .1 :Q Lp' - H' 1 -A MZ. , 1 V. , A,1,,, ,VAA: , A,,, E uf. Q ,I q ,.., .,.. 1 ,,,,1 ,.,,., f- -wwffn:-1. 1, .' fe:1,.1:f5 Q, 1 -. 1161- i:,r- ff '- rfvgwmg-19v - J 4- fr: ig, -Us-14113,yR.':-1:15:51 ALSO H. N. BAIN ab Co., HORATIO N. BAIN, Proprietor. THE PALATINE I NEWBURGH, N Y THE MODEL HOTEL OF THE HUDSON VALLEY Proprietors. lv QDOBITIVCIQ the Ieabmg llbcu , - . ii i E 0 1 - 4 if 2 ffvfrf A . wver E1 Illbillion in USC. Ollll 21111 C11 ASKfZ2AZS'ifi0ZZ,5W BLUUMSBURG, PA J. J. NCKENNA, Suns :- That Harye lion which has served as a gift at so many Senior birth- days. The noii-basket-bzllhplayer who appears in the picture of the team. 36 East Twenty-Third Street, Bet.BroadwayancI4thAve. NEW YORK. , Ivi o 0 i Riverview Htddem5l,.F?921ss!f!iQer1Sfsr!212,9 62d year. GIVES BOYS a thorough preparation for College, for Business Life and for Government Schools. Riverview students are found in all colleges and scientific schools. THE INSTRUCTORS, nine of Whom are resident, are men of experience in their departments. MILITARY DRILL is in charge of an officer of regular army Cdetailed by the Secretary of Warj. THE BUILDINGS of the school are beautifully situated on high ground overlooking the Hudson. Careful attention has been given to drainage, lighting and ventilation. JOSEPH B. BISBEE, A. IVI. lvii 5 ,- A THE... , 'T x E if . . - -KA 7 n gi ' A r3?f?r2PBUI1lB 3 Slllalll lallll ill, i e 9? ' ' . i f 23 85 25 Catharine St., l i ? n e i E ' - . , :7 -.' Poughkeepsie, N. Y. ,V iii1,', :l Fine custom work a Specialty. Ladies E if w if' jf Shirt Waists laundered in the most approved P , fi I : H 7- Orders left with Mrs. A. H. LAW, at the X Gate Lodge will receive prompt attention. lg:.?1q ' i'fj A I Goods called for and delivered free of charge. ' -. ' 'fill W f ZW N i gr' , m f Telqbhozzt' l0li?. fi lm - ' -ff FEHGUSUIV 62 oounrmfy, ii Props. C, W, Qsuocesson TO WELLES s. ZIMMERMANJ get V- DEALER 'N-e watches, Diamonds and jewelry, 6 1 Gold and Nickel and Frameless Specks and Eye Glasses. I - ' 284 MAIN STREET POUGHKEEPSIE. N. Y. if w ith A7 ., X rf 04 , . f Q - .- ' ' . Repairing VVatches, Clocks and Jewelry in First class manner. XVe have First Class Goods at Reasonable Prices and respectfully solicit a share of your patronage. DoBBs ae RUGER, 'STAPLE AND FANCY GROCERS. 354 Main Street, Pou ghkeepsie, N. Y. T E L E P H 0 N E 5 1 3 N , :' f in Kok .15 ' .-N, 'ii Best Place to buy reliable Furs at lowest price. Dyeing and remodeling of seal garments a specialty. K 2' 12599 jfs. -1 X- l ZW sA'rlsFAcTloN GUARANTEED. sf . '235,,,.Quf fl 4' ' -' '.y',,f7'iE. K-fi:-is f ' f. Q, 1.- .W Q4 M Wx-T . ..f 7,,yi fi, ,v . gf -' .QM wg, JllElllllfllCllll'Blf of .fine Jars, f 7 595 FULTON STREET, X I f K f I 0 W WfW M ESTABLISHED 1873. Bf00klYI1, N. Y V If! IWWW f ll 7 lviii Do You wear Pure Silk Bose? HEN remember that Belcling Bros. Sz Co. make the only reliable fast black, full weight, never-wear - out- in - the - foot, silk hose in the world. Ask your merchant for them. They a wf BELDINO BROS. 6: COPS Silk Mill, NORTHAMPTON, Mass. Do YOU EmlJl'0ldQl'? HHN remember that Belcling Bros. BL Co. make the only NEW PROCESS FILO in the world. Warranted not to split, fray or fade. 341 shades. 60 more shades than can be found in any store of any other make. Send 12 cents for color card. BELDING BROS. 8: CO. 45.5 Broadway, NEW YORK. NEVV MUDELS2 IN THE IMPORTED AND OWNED EXCLUSIVELY BY Simpson, Crawford 6: Simpson, Sixth Avenue, 19th to 20th Street, New York. 4- - e x HoRsMAN's HIGH GRADE mg: TENNIS RACKETS. H l!u:IlH:lll:-lilllll he X ul Illllllililel XX TUXEDO nil:-1 a all :g:n.::e::::.':::.-55:3-viHi.H.5g.A X . 1 I ll , : H g,.,:5,J .-,1 nur- --:pil - '-1:-' 'Qi i0'f3i'1'2,,a2.',': S Eiiigig f -lilllllllilllllllllllliliiiilliiif O.aH:::.:::.:EiE.::::::1wiii!F W tlllllllllllllTllllli'lllQIl1,g! The Tuxedo marks the point of absolut 'lllgllllllllllllllllllfl' perfection in Tennis Rackets. 'I lllllllllllll'lll': 'fsl!ll'llIlI-ll!-7' SEND I-on - X 11111111- TENNIS CATALOGUE. X-'J E. I. liorsman, slz Broadway, new York. OO' , I Ei 1 J J!! I I 'I ! ae HABIT MAKER AND I WT LADIES, TAILQR The only maker of Il F. NIULLER'S Patented , Perfect Fitting and Safety I Riding Skirt I Fur which the I I HIGHEST AWARD WAS OBTAINED AT THE WORLD'S COLUMBIAN I EXHIBITION . .... Always on hand, the latest novelties for Riding Habits, Tailor-made Costumes, Golf and Bicycle Suits. Jackets, Capes, etc., etc., made up in origi- nzll and latest styles. 240 Fifth Avenue I I NEW YORK A ' ., 'ittff HV ta I .f f A ' Q L...f:1, f Ag At if ZFM Q , I - , , H , ' ll pw, HE young ladies ot Vassfu C0 ege QW . fr 'Q '52 fy T w- - I 1 5 I 54 A . use and iecommend GlLBERT'S 5' HFVEI I RSI DB S L' inffs ' b inc' S e1'iOl' to f '1 A , 1- , 1 S 111 e 015 6 6 11119 , A5 122 'M if 1 ' f - I I my Othel make' 1 A in A 'w lvi r , Xjig NAME ON sEl.vAoE. tlttt 'I fi g A f ' lf' fi r, 'l s I Qgrh- 'M pig, !- - 'g:':..e. ,- ', ..I. - I -1 1 Q21 M-M. -V . V- ,. ttt. . in .,.A , ,X H, X. 1 li: lx CQRTTNA. METHQQ J X CAwarded First Prize 'nt Chicago Columbian Expositionj A For Use in Schools and Self-Study. 3f'3fI55'51SHH I Z0 LESSONS. ENGLISH CLOTH, EACH 51.50 FRENCH, SPECIMEN COPIES OF BOOKS I AND II, EIGHT LESSONS 50 CENTS. Ufher' Books. Sena' for CORTlNA LIBRARY. CORTINA ACADEMY OF LANGUAGES. R. D. CORTINA. Director and originator 44 WEST 34th STREET, of the adaption of the Phonogrziplx to the teaching of Languziges. - - - - NEW YORK- .SEND F016 c11cccfL,I lf and l',I1c7'1C1'L,IA'.s.'. Ixi .,lllilitllll I , il l ...t at ELEGANT IVIATCTILESS al A Harmless and Healing Appficaton for the Skin. CUTICREAM is not a cosrnetic, but a harmless and delightful ,gg preparation for preserving tne smoothness of the skin, i , if and being free from narrnless or injurious substances or ll anything ot a greasy or sticky nature, it will not soil in 1 5, mlb tne rnost delicate fabric l .iff ' A i H X U 4 I W .ll XX' Illease send me three bottles of Quttcream. I hnd it a very iii ' afrreeahle and useful toilet article, lfliatrzxa MoD liSl'X.H li curtcmtm 5 ,.,. . J, . AH H H , . fl gk. , ,uttcrcani ts one 0 tie most giate u preparations or tie s in .stint...t,.iat.Nt.tm...tt , , , , , , , , ,, H, . I have ever used. -lt-.ssin b.-titt'i.if.'i 1 DAvis. .s I . . a . N ml:,,:3,:H5RgfJ:, ' I take pleasure in recommending Csuttcream as the best t:,7'g':,2',5GT.'T3..'lff5m,,,.ittZ pi-eparatimi of the kind I ever used. Aliwscste hIlTCIIEI,I..H T' FRU ,Jw-Q' ,, , . . , . . ft..l.,a.'55wiiW ' l tr uttcream ts the best article in that line I have ever used. . Y ,,-',.,..'T,.,'7 Mics, Nlclxeiz RANi'iv. kifz.:zzf.5Ax.f...gwgL,.g2' . H 1 A Q . f . I. T A if.i?ifh,',C.'127l.33u l Luticream is the most soothing and efhcient app.tcat1on for ,,I,,j2f,.C.QLl5Nr'g525,y, the face and hands I have ever used. YIOLA ALLEN. ,.,,m.,,,.,u. U V 1 V . V , X our Luticream is a success. It produces the promised effect. ?ff??'?'AZ ffi5Z553.7Qi !1i.'Qv lt is with pleasure l commend it to all. Biat.t.iz Mi5i.vi1.Lt2. ,,...,,.,.,,,l.,-I Wu ' PRICE, 25 CENTS. . 'jj' ' ' X, .i , PRENTICE si EVENSON, I 'mn ' Wm -3 ' u css,-.M 4 3.11. .,.,E,,,, ,-TRADE MtRK13,8Q5. JANESVILLE, wis. Tl'lE D NTIFKICEZS MN selecting a Ilentifrice. avoid all preparations which are advertised for wItl't'I-ZXIXU the e teeth, as to do that they must contain an acid, which will in time destroy the enamel. All that any good dentifrice can do is to keep the teeth clean. Liquid preparations are inef- fectual, heetuse in order to lseep the teeth clean it is necessary to have the friction of a pow- der. The American Dental Association at its meeting in Boston, condemned the use of mouth washes in anv form. The ideal dentifrice should be a powder which is entirely free from acid and sharp gritty stthstztutfes. SUCI1 EIS Cl'lH1'COz1l. cuttle hone, pumice stone and silex, all of which are too harsh and cutting to the enamel to be in daily use. THE PRENTICE TOOTH POWDER is prepared from select material, and the ingredients are harmless. simple and effective. It is endorsed by the highest dental authorities as the ideal dentilrice. PRICE 25 CENTS. From C. F. COLLINS, Ph. G., Analytical Chemist: I have examined The Prentice Tooth Powder and rind that it contains no free acid or other deleterious substance, hut. on the contrary, iscomposerl of evcellent materials. From Dr. GEO. H. MCCAUSEY, Janesville: - I have examined the formula nf the Prentice Tooth Powder, and rind it to be composed of ingre- dients which are well known to the dental and medical profession to he most useful for cleansing the teeth. Containing nothing which could he in anywise deleterious in its action. I give it my unqualilied approval I From Dr. S. H. GISH, Janesville: lAtake. great pleasure in giving thc' 'K Prentice Tooth Poxvrlerff in y' hearty approval. It is a superior dentifrice, simple. sale and a very convenient preparation, giving, so tar as I can learn, universal satisfaction. From M. A. NEVVIVIAN, D. D. S., Den. Dept. N. VV. U. I believe the popular dentifrice lcnown as the Prentice Tooth Powder, begidqg being 3 very pleas- ant arlrlition to the toilet, contains ingredients that if used according to directions will prove of the greatest utility to the health at the mouth and teeth. From Dr. T. -IUDD, Janesville: Knowing the excellent composition ot' the Prentice Tooth Powder, I take pleasure in recommend- ing it as a safe and ehectual preparation. The real merit, style and convenience of this article cannot fail to make it a favorite with all. ,mmm Prentice 8 EvetlSoll,mEsmiw--., laii For Good Health To l-leal all Pain, To Control all Hemorrhages, use To Subdue all lnflammatious, POND'S EXTRACT The genuine is put up in bottles only, eueloserl in buff wrappers, on which is printed out' landscape t1'ZLClL-11112lI'k. A VOID S UBS TI I' U TES- W ealar , Wate ry, W orthless. l .7V'0z'c aw' name an ezfezj' Zabel and wrrgfaper Poud's Extract Co., New York and Loudon. THE PHETTIEST JLAEE IN THE AUIHUNUAEKS. QII-9 lHEllllHHlll LHKE HUUSE, Prize . . A, R. FULLER, P1'op1'1ef01'. S ' ' 1 are rrirely taken with at poor RATES 5-SQAQQ to SQSIQQ Per Day' camera or Iinishell with unsatis- , factory supplies, We have ex'- 510.00 YO 517.50 PSF WEEK. l erythiug photographic, every- thing good, at prices that make the goods prizes. Meacham Lake 3 miles lun one-hall mile wide . ' 2' 1 me mmm it mlm m.. of New mm. rm' ig' W. I. LINoor,NAo,xnts, mms. NO Dogs taken or allowed in the house. NOS' 60 and GQ East Nth Street' Postal Telegraph in the house. semi 559. rur ll Smiiylie willy ..r 'rue 1-ii.,u,g.e..,.il1U Y .1 I mf iifiiiQili,iiiiJ'iiiiil'fiii- MQm m POST-OFFICE, DUAIVE, Ill. Y. A private Park of 8,000 acres, open to the guests of the house only. Fine roads for Carriage or Bicycle. lxiii Index to Poughkeepsie Firms. fa! ANTIQUES. l John F. Coxhead . R. Wolff . . BICYCLES. H. H. Abeel . V. Schoonmalcer . Chas. E. Schou . 1 John Van Benschoten . BOARD. Dudley Cottage Mrs. McGlynn . CABINET MAKER. F. E. Brown . . CARPENTER AND BUILDER. Willet Titus . . CRACKERS. Poughkeepsie Cracker Bakery DANCING. Mrs. Milton H. Taber DENTISTS. P. L. Foote C, D. Miller john ll. Mills Stephen Palmer DRESSIIAKERS. A. R. Coughlan . Mrs. A. bl. Frey M. T. Hingston . DRUGGISTS. Bolton's Pharmacy . XVood Sc Tittamer DRY Goobs. - Luckey, Platt 81 Co. . Geo. D. Olivet . . . . DYEING AND CLEANING. Rhodes' Dyeing and Cleaning Establishment FINE ARTS. E. L. Baker . lxv xxxiii xxxiii l xli liii xxvii xliii liii xx xxxiii vii xliii xxiii l xxii xlvi l liii xxvii xxii l V xlix xxv xxxvi FLORIST. Fricker X Clarke FURNITURE. C. H. Barnes . Geo. Hughes 81 Son GRAIN, FEED, ETC. james Reynolds Elevator Co. . GROCERS. Carpenter 81 Parlchill Dobbs M Ruger XV. V. Holmes . Reynolds 8: Cramer . PIARDXVARE. J. E. Andrews Guilford Dudley HOTEL. Nelson House JENVELERS. Perkins :Xa Co Quintard Bros. . C, XV, Zimmerman . LAUNDRY. People's Steam Laundry LTVERY STABLES. R. G. Lloyd . Reed S: Forman . . MILLINERY AND FANCY Gooos. Frank H. Carpenter . Miss Carroll . A. W. Jacobs john Pcterkin NEws1fA11ERs. Poughkeepsie Daily Eagle PERIODICALS. Vassar Miscellany PHOTOGRAPI-Iliks. Vail Bros .... PLUMBING, GAS FITTING, S'rov15s, Ere. ' Peter Adriance Sa Son . . Chas. Cooke . lxvi xxiii xxxiii xlvi xxxiii vii lviii xvi xli liii xxvii lv xxxix xl lviii lviii liii xliii l liv liii Xlvi X xxxvi xxxix liv xli REs'rAURAN'rs. The Dutchess . SCHOOLS. Riverview Academy Sllomifxlialz. Chas. I'I. Bogler XVALI. PAIWCR. Chas. li. Bowne N Son E. V. Grant . . lxvii xl lvii XX xxxiii xi eneral Index to A J ART FURNISHINGS. Joseph P. McHugh it Co., New York A'rH1.E'r1C SUPPLIES. ' E. I. Horsman, New York. BICYCIJQS. I The Keating Wheel Co., Middleton, Conn. Books. ' The Baker K Taylor Co., New York Houghton, Mifflin S Co., Boston XY. R. Jenkins, New York . . G. X C. Merriam Co., Springfield, Mass. CHEMICALS AND CIIEMICAI. APPARATUS. Eimer it Amend . . . CLo'rH1Ncs. Brooks Bros., New York CoN'rRAc'roRs AND BUILIJERS. Dodge X Devanny, Pittsfield, Mass. , D. C. XVeeks K Son, New York . COATS AND SUITS. Adrian Bastianelli, New York . CoRsE'rs. Judie Corset ' R. it G. Corset CORSET WAISTS. The Nazareth 'Waist . CUT GLASS. Higgins SL Seiter, New York . DRESS LININGS. American Fibre Chamois Co., New York Gilbert Manufacturing Co., New York . DRESS STAYS. Peerless Double Dress Stays DRIJGS, 'l'o11-1i'r AR'1'1CL1-Ls, ETC. Barry's Tricopherous . . Cuticream ..,.. Ferd. T. Hopkins, New York . . Maltine Manufacturing Co., New York Mayor Lane 8: Co., New York . . Pond's Extract Co., New York , Prentice Tooth Powder . . lxviii dvertisements. vi lix xix and xliv xxxvi X . X . xxxv xxiii xiii xlvii . xxxvii vi . lix Xlix .ix XX xlv lx . liii Xvi . lxii l Xi xxii . lxiii lxii FINIQ ARTS. Braun, Clement S: Co., New York . Foon Puonuors. J. XY. Bearclsley's Sons, Shredded Codlish, New York Cleveland Baking Powder Co., New York F. A. Ferris X Co., Hams and Bacons, New York Fleischmann's Yeast, New York . XVorcester Salt Co., New York . FOUNTAIN P1-:Ns. Paul E. Wirt, Bloomsburg, Penn. . Forts. Kohn X Baer, New York . F. O. Linder, Brooklyn . Edmond R. Lyon, New York, . Gmvizs. Fred'k l.oeser S: Co., Brooklyn. H.-vrs. Knox, New York H OSIC SUPPoR'r12Rs. The George Frost Co., Boston, Mass. I'lO'l'ELS. Meacham Lake House, Meacham Lake Miller's Hotel, New York . . The Palatine, Newburg . . . The Spring House, Richfield Springs JEXYELERS. Lindo Bros., New York , Tiffany Sc Co., New York LAMPS. Rochester Lamp Co., New York L1x1sN Goons. james McCutcheon Sa Co., New York P.-wick. . A. P. W. Paper Co., Albany . Prmcrrs. Q The joseph Dixon Crucible Co., jersey City, N. ul. Pi-itnrcvoiz.-ivirnks. ' Decker Studio, Cleveland, O. . P1-IOTOLLIMPHIC SU1'v1.IEs. The Scovill N Adams Co., New York lxix xxxiv xvi iv iii vii vii lvi xii lviii XXV . XX xvii xxv lxiii xxxii lv xlix xli xlviii xxiii vi xxii xxxix xiv . lxiii Pnmos. Sohmer EQ Co., New York Steinway X Sons, New York RA11.xoADs. Missouri Pacihc R. R. R15s'rAU1uN'1's. Fleischmanns' Restaurant, New York ScHoo1.s. The Priscilla Braislin School, Bordentown, N. Miss Brown's School, New York . . Cortina Academy of Languages, New York Dearborn Collegiate Institute, Chicago, Ill. Detroit Home and Day School, Detroit, Mich. Hillside, Norwalk, Conn .... J. The Misses Lockwood's School, Mount Vernon, N. X Miss Ma1tby's School, Brooklyn . . Rye Seminary, Rye . . . , Special Preparatory School for Vassar, Englexv Miss WVhiton and Miss Bangs, New York Emma Xllillard School, Troy . . SEWING M KCI-IINICS. The Singer Manufacturing Co., New York S1-1114'1'wA1s'1's. Monogram-Goldsmidt X Metzger, New York Sunshine-Meyer -Ionasson uk Co., New York S1-mics. A. Alexander, New York . S11,14s msn 311-14 Hos1f1. Belding Bros., New York S11.v1-:1iw.-x1z1z. Reed 81 Barton, New York . Geo. XY. Schiebler S: Co., New York Sow. B. T. Babbit X Co., New York S-vkixc Bains. Bushnell Manufacturing Co., Easton, Pa. S'1'.x'1'1oNL:1w. Dreka, Philadelphia, Pa. Penn Tablet Co., New York ST15,xMs1f111f CoM1'AN11ss. Old Dominion S. CO. . lxx ood, N I' lii xv liv xli ii . xxix xxix lxi xxix xxviii xxix xxvili xxviii xxix xxviii xxix xxviii xxvii . vi xxxi xlvi li X . xl xl xlii xxi XXXV X xxxviii