University of Wisconsin Madison - Badger Yearbook (Madison, WI)
- Class of 1920
Page 1 of 718
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 718 of the 1920 volume:
“
,. . ,. ,..,..- ',l ,,.-f' . 31 . . ,gy-. '. . ' .-5,1 .V . 'W JM LP' .XL S., Ulf, ji - 'dd-i,,f ,f ' lf X rf' ki XM' X- if .til fx- 7'F S..11 l' - ,TJ fffff .-A f 5.5 .ZZ Z ff! ,,,:rf I VNIIVRSEIY W9 -'fi 4 f ' A W i f 1 fi V.':' V lzizzi 1'11i:i 'ZA.q:W' g pyrwghfed 1919 LINCOLN A QUARBERG 1 X X . V , , sh .W A Ecffor-in-Cfuq' M. VINCENT GSHEA BEN M WISHNEFSKY Bzuzhej flffangyerf 1 K-F141 'V T:'Lf '-Xu ,- Y V.. ,, Wt.-g X, ,- - 11 -H - f ' Y' f ' if f Q , Z.- g ,, K 'M ' ' Ei ' -WW W J V ,A E5 ' - A - in l' TS ' ' ' I . -. ,A M-, -X ff Em L 1:ETQ'rY B DCJER Ass emb led and Published bythe S QF 1920 of the University Of W1s,cohS.1n Q T --,k , IA + fav Y CONTENTS I ADMINISTRATIQN II CLASS ES III THE S ATC IV ATHLETICS V ACTIVITIES VI C0 EDS VII WISCONSIN IN THE WAR VIII QRGANIZATIQNS IX N0 IVIANIS LAND , 'N--. ,. - M-ix-. A' ' -Vy,.,. 6 'xxx If .1 ' .t K V V ,- rm 4 J: f V 2 .sw fi' g Q - -,Lf fi - , - I , , V x. .,,l..,,i, DLJLIUJZ ,: r -., :ng , V- -W. A nli' A :X f: 5 . ,,ff I f, 1 51 . ,AJ 3 .jf .1 5 17e.?sou,I.o.f.an .ll1StltUtlOl7L.W,b0SCS01l5. have gone forth as Wrsconsm men bave gorge as unberslcfobpnlg 11 those who know was l1me'w1scons1n, cf? Q 234 Ycgyf 'IW . T ...LF 1 . i A W!! 1'1.lHNrwf '-H-A A W ' W- X ' H' N1 l 9 lx ' x 1, 1 x , 1 bf 1 l J 1 ,. f llf f' Ui, 1 TQ '.,',,, E2 '-,' V4., 1 :i1?'ij,i' - - 'Af.L . . I ? Q A -,,r 1-3l'Q,Qli.1Eg,.:i1c,l :Z -.,.: g,:':Eg:,.g .-.-1',4 41, gli -cgsj. x tx X 4: 51:4 '-'f P-2 .ia -'rf'l1 ' ff,-,- 1 -- ',.-:,: ' 1. :'- f. T. 2' sf .,,.: 31 4---,: 1.10 ..'.. ' 1 ,-f-', f. .f '::f'f lf .Q .4r.'. -11.1-.1-.q..::.-.2111-.1'F.'f'faf LHS. ',.' . 1f f' X :', . ,1 2 ', .,-',,'N --.,' IQLQQ Y .-4 .A-.. -.-, - - .....4.k ..-. . . .,. ..-,.-,., - ...,..-. -- .- ,- .,.f -.'. - .. - .... 1 ..'. . 1.--.. -,,,,,-.' ,.1, .. V ..-.. H 12 .'1-: K1':' J J '.'4 '1 f A '1 ' A5 ,W' A3?52TiEf-Q5 I .N W1 ,.., . l., . ........ , .. 1 . ..' .. . 4 EV 55' A .. . SLQQ ' -.... -1.1-.:..gE31 .'..' Q .-,.. ..., ,'..,'. 'T, ...,Q. ,ffl ..,'-. 5 ,...5 Q W'x F 2.' 1 iff W ' if L A Olyxs Book is lnlercbeb as a monument bw cv as E5 'XWQ L F Q?-A W l to the part out lCmvm-stty bas taken m the ments, arab, a grapbmo xnterpretatwrp ofb r 'iii66ihif4BIEQQsljairiEQA f5?:a6get...111Ietpmls that wx! accurately cmb .preserves fiiihngly 'wlSC6WSm,S prowb war fume record, it ul ills The purpose for Wlymcly nl! was beflaken., 0116 The dass of 192 Takes prtbe in 'feehnfgf Thai? its ggi: Ib wmxmsm is cy hrstovxcaf arab przimanexrli wistful: t7 il E 'l P VW X 5 'I' QPU Q L, J QQ Q QQ O I 3 .J C 'X .f Q W, f In .1 .. . ,..! ,V . 1. ,. .AA. , . X... , :.,w:3: -, . 1 1. .ck-Q 1- fi ff-:af -M .,,, . 4 fgirizf 52: S,r.Ii -1-'.s:3jf.1'.1'e.E5.z5gf.-5. f-.gj.:5Q:.,Z1.15r'751. -oy. -1,4--::':Q', . gg :ifg.:I1'ff.L1-.1g.fi'.f.'55,,1g.1-K 1 was ' 1:35-1.11-E-' EEL' JE.. ' 2 -Z.,:24f : 3' 'T I ,' 2. ' 1' ,- 1 -' fy '-5.151-,rg :V -,1 fi X .ay--,z.?3:. X'9j Vf' ' 53aj:,-5'jiu:.1Q',e1fg :5i1 'giffp,Q:.g'.,2pf..3,i1zk2gE12 wg FN , ' 2Ez:1ij:jg1. 5 112',lj:5.' ejz .J 1. 1 , ' 1- 6 -' ' N ' I 1 4 'fffq1f.5yef:f.a3.1..gL5::.e:-g:a3:::-iw: ::-.:v.S:3'i1::f1':111i2nn'E -'1.'::,.-'.',isf1-141-,1'..5.-3E,-ww.-ajgq, agff,-Qs..it:5q?gga'1:,: wr fm 2 IQ? XP cl 15. .f'T . 1 1 ffa-'iz' I 1 '1 ' 'Fifa s .1 1 2 1523 '1 4. . F 5 1-3:2'-51,-33:-,-:.1z:1.:f::Qi22api'J 33,.f:u,pqf'-1':rj.-.ffwif-:J ,...y1'.:-3515,.4.-mf:-'V-1e,f.r11':::f .zif-, f1'5Tjf?'5i.i 1 Li' X S -:Gaby-ff .::-rg.. :g.:qf:a-aff' 5Sffq-:f.1.'.,f:.-:p:.2: -r' fa-.gf q:,-gg.f,.- Qfylfig.-fr., .3-3 ,,.5:.g,:N' 'gg-133:13 ,v .gawi-.:1:fi. 15.:g:-at,1v,-'.- ' ' Q' 52 .3 pw.-14,-.-c1111 1.1.1-.-ggfx -9:-e. .L .rf-:,-u.g:f.-f15u'f..w- -,g.j'.Q:'.ncgLTffuj g,.'.fg2'pa':':52j-111155.-.-:-.ff:i..,:,.ny:4:.e.xiii iQ.rJ5anbq-:1'.'.2'-fg.3::rf1:..- I -.1 A K -22::.9fg?.'- 1 , .-.' ' ,' Q.: X . 3 Rug,-.15-51:.g:3u.,a.'.-V.g,'1.'-,-,gpL-.,.fggq,,5:f:nC'-if.-5.A3:,',-,,1::,gf:.g:,-,ga-,1I-1-5355.11-gig-. rg - I fff.:-.'.'-:IZ1-'-wil..fa Vw PJ ff' ff faiiiii 2151152131252fs:ef53.s1-e113:2-'.,-2'Ep1-23.13.-vzfi .gncf:1525:-gg.'agya5f:. ffm 'f 15.7 , . ,xxl'g1-Q,z3tf1gg-.3451 rg ff..-!:f.1gI1 ,f:1,ff5,,--.2 gi.,-Qff1'f.7:31:1:E,f1-35-.-.1,Hg 'F:.9 '::32f'.5 X 55f:55.-?5:g,g5-,.:,- . -' ,135 .1-.f.-:121 . .15 1. '15-'.'.'5-'J-::-,.5:o'-.-.:C '-'-gn'3E1r'1:1:'.-, -: :.E' ' 5,55.:jg51. , H i :e1:-:x-.:-'.g.-,-:fg,'.- : 4+ -X Jak- -1-:g ., . lag.-I+ I .- ,V 5-11, . - .- ,. , ., - . 11:57 .- .p,4,:..:,g W 11.11,-iv.L1Z'1n-jg'--J-17:31,12-f: ff,:,-mf,-, ,-':g1,,,1 1. ff., Tj ,,:,X..,.,:..gf- 53,--.3 .Q ...gm 5: ,3.,,,..:5,'.,.'fE5y5:1gg1 535 -214575: '55 3-fg.1 ,'.43:Ef!-2518.5.5:Sag.fi:Q,E4'3g.Ew3.f925'413513 I j.2:.i Z-2:1 1:11-'-33:1-I-.1 C- Q25Z15935,Qjjv.-,I.E-.'Q3.Qg113:3i1 -fgffgqsgg1.3351532155 U .:?2:11E':2:QT1:1'.E2v'5:.11 T511-if!,1:?1E.E:'g5::'--1.41 fi:f-1,-J:1:j:r-,nz '15'-'.:,:fE'.g11':7:.fe:1.5-5:'.i1::':71::5'ri'.:a-,-1 K - 931:41 -i.11.:fqa5,::522q A -'Jr12'fcsP . .-:r1i?: 1: . - 1.-Sala' Y iilf: , - ': - .. 1 253: ff - : - :' 51 .-jiae:-i-ra . 1 . 7:235+,::. ,, ,-.-.3 ,, . , f, . , ,, 2- -157, Q- ,fggi 1z,3 KN., 5 F1 ,P-, ATLJEY 1 , , . ':,.7-1143-'jwr Rf- -'7 f.5an2:1mE,-e-1212-122413.-2..,.e1.f--241-fr-145.5-,gf.'.:in-9:13-1...ease..1:-1.-:21:1'azA:.f.1...2:.s:'-:arf'c.w.g.'::f4p:.1e'.-Lv....-:-. :1f'.:.'s:.::- .z.1L--fffyaqrs ,W .- zcnq-.vzv-.vrg-,vgzg,qg,,5:y1-,-,55:2-,'.:,.,1.--.1f:.'1,1:,-g5.f..31g..,,-3,gg:4::.-,J-:Sg..-z'.y:,.11mf.-35,,. .f,f,g.1q15,.13:-,.,.,,,.g-Q,-:,-.-3553153 ':,1.'.g:.1f.g,1g.5151.:g f' 4 K -L 'lg A 3.-Jxggygf, '-gt:-,13:.::..-,'g-1y.yuba:.v.:..!1:g,:'511-2:1,::,-x.-1 -n,:,1g,-.15-1315, -'Jia sjr,-5:gg:.r-pgpfzfpl., .l 4.,.55.:q:-g 53-,,g1.g1q:. 1 ,- fkl - , . -1' .:. fI.r:5'a1.2gi1:f::-isa-if-err!11.1:f'a:f':61.::fa14ef-14:92..En.-H-LQ.-fj45g.':2-Fai.15.-:.:f:. T.2:-1-f.szfznaz:awrrivia-5:--2-211+.'-af.-:I1-ilifrawlfi-fffiflie1. ' f 1' 'FP Qvfl F 2 5 1 ' f 'ff!' 1 7 'Ef'33i5 ff' 7 pia?i2.2 4532522 ' P - 4, ' 3. zJ,.,.1,,f:Qe4.,.. . ., :,.,.,,. Q' 7 fx, fda:fqigzrm55.aifi113sQj.qsgkn-s'f.-g.g1,.1'1af,if5533412151:55.-.-3553295525-31-.4Q42-m',?x.vs:3:1ee:1Q'Jake12.555321155242521:,4q5.5.5?2::-,Q15:-255245.Qirgfe X- - . .V ll .- .-..,.. .- 4-f... .,., f., Nw.. , -...--.4--. . ., ..,....f..- ,v---- ..x, -. ..w..... ... - A. ...,,, ,. Fw rf' 1' I . A 1-515214-'-.1 -0 - , f - wi? 5 - if 2 4134 1 'fi . 1-' '- ,241-P ' ' '- f- I2E'EC2-?EZ:fl1 f ' 'Yr R3 EY.--rr2:':2.:'-' -:-'Q-14.154-1:?m.i'1:'11mrGrilizbr' iw43::::.vr.v1. gffifrni 2:11-f:,fF:f:5,1:?-.:-151.1-.,22::3s',i ixifzvrpt ' S-Qllrg fy ff 'N . . '-::- -113.2-IA LQ ., 1.'J,-'.- Pj ,-'-: 5212.15 : 13:5-5:I'5, '- :I-,-sy L, . 'gl-l::Q31'2.'oI - W1'5g2.g., . ,ql ',n'i.Am.--11l::'-S ,-?6:',-'ff-R 5:33 , KA' 4 . .- -f 2, i 5 f C' 'fff ii eff'-Ai ..-iw . A 1 491 -Juvx .:f1:c.'1.--,-vez.-af:gr- .' .9-fr.-fm.:11-g-g-':.cg 221 2:51.19'.':1'11y-fy:--1fg1:..1 yi., 1.11.12 :11.5111-,.::qf1fx5risgnrw-fy-,qr'gg , 5 a. fE?frn'.gJ'aiviwa-':-avivfi-':-E!1'fl'.111gi:1:-Emp.:1:1- '.f-:3?u':1.i-,:!w- ' 'f.-.-9.21-gbiiegfgz-.zggznwffgiq-.yyrqguhuifgzxgiejaia-rg3'z:5u:m:'?: 31 . I 1' 'fialff 4'-ZfzEa1sw41:G:f:+?:1v14ve.-.':'.v.-,'.f -r.1f,111.,f-J-::::.f::-,-2-51:-114i:'::bI.:'--bf-'-.-:mv'fcm::!'.4if51!11- f- ' I wi 1 13 11 Y 4 ,-NR ., V ....,,. MDN N ,N 1 ', , Y -,,....:.. , ' ' ' ., , , . ,-.lkki ,--W . H 1 -pix-, ' 3:1 .1-:fig .Ff.T X- 11- -TQ MIL l MQW.- g.. , . .. , .. 'i . .- - ---- f vt , '- 1 A ! +L- 3 ff-QT, .f A Y -Tfi ,733 -A X X. I., :ri .f- Af :rs-ff ,l A - N..-,LAX . :L-fr:-.-is , .ka-1-ifgff ,.., : 'P' - ' . -Jr L.J flvrgif.-:A ' ki'-v ---' 2 ,W .vi A .4 U-K' : 1...E,X fa- -,.,.-W. - . L 1 x f .L .V ' ' 7- 'f-,,. N - 1 . ' ' -,G r Tj Y -' ,,.f . 1 5 .,-,,.k,jf , l , 0 X-f'ffQ 1 X x I, X Ein Menxnriam Charles Xicharb Van Iffise We rejoice lhal he has bwell among us, anb ihal his spirit will conlinue lo moulb the life of the university. 'Ebay may resi from Iheir labours 3 anb their works bo follow them' ' ' ,. ,Qi aiu Y ..,., ., V 251 eff Qfrzocrac E , ive will keep nA'. n Grue faith with you who lie asleep. with each a cross to mark bis beb, ' Hub poppies blowing overbeabf' -2Nmerica's Answer. fffmy, X xx ., we ,.., ,, , ,, 1 Q . ., i ..: 1551 ' . ' - V, , W Y , 41251 g,A, - 4+g f 111. 1: -1 11 E N- . V ' 17 r ,4 L--qi! j .,1,A,.-A,,, . ---vi-in 1 A M21 5 1 ee - ff 'Y 1 i f.fW - ' 1+ 'X E1 ' 9 D f-'il , V' 1' --Q'-51:1-as Q' f l 4 Q 2'-Z1 , 1W11m..- ax X - 1 3 1 7 ' . 1 l 5 1 morgan 5UacZDonalb Rnberson, '18 . milwaukee 1 , , 1 7 I Iieulenanl, Infantry - - ' hile articipating in ' Q Z K ll d in action October 5. l9l5. W P , 1 f the fhgsierican oEensive southeast of Chateau Thierry. lg: 1 1 2 Z , was s senior law student at the .time ofhhrs eggincg lf'2t0ShF 2 Z Z service, and was a member of Sigma C 1 an 1 e B I j- Y 1 Z Z lelenentered the university wit A.B. degree from e olt 1 E Z X 0 ege. 1 1 1 Z ' 1 3 1 1 5 5 1 7 1 5 1 , 1 7 1 7 Z ' l Z Z ' 1 5 Z ' 2 5 1 H 5 ' ' ' ' S reve rl' Ia. f f 2 , llferberl ilaflm Avery, 18 . . b P0 v Z Tieulenanl. IC. S. 51. Y.. 7. mls bo d E 7 ' ' ' N mber I2 a al' 4 D d E S anish influenza on ove 1 1 1 , Y 1 5 , . the 5, 5 S,pHubbard, then enroute to France with Prmen- Z 7' 1 ' 5. Buried at Arlington National Cemetery in ac- N 5 4 1 can troop . G f h d th 1 7 2 cordance with a wish he expressed shortly ore is ea 1 . 5 i Z While at the university he was enrolled in the course in Z 5 1 electrical engineering. At the close of the second semester 2 Z 1 1 of l9I7, he enlisted in the Navy, and took his training at Z 5 I 1 Pelham Bay. In three months he was .advanced .to the Z 2 L rank of ensign. and was lagerdinade asgiistalxt ILBZIEBUEP 2 4 h l s i u erry. ort y e ore u 4 4 officer on t e suppy I P l 1 4 death he was commissioned lieutenant and transferred to 1 E the transport service. l-le was a member of Chl Phi. 1 2 5 5 4 l 5 5 1 4 5 . 1 5 'l 5 2 ' Z 1 1 1 3 ' 4 3 l 2 5 5 Z 1 5 Charles Walker vsawwan, '19 . . was: Allis 1 2 Seconb Class Seaman. 16. S. UI. H. T. , 5 Died of heart trouble after swimming hourAon August l. 1 . 1 5 l9l8, while in training at the.U. S. Naval Auxiliary Reserve , 5 2 . School, Municipal Pier, Chicago. The firsidgold star on 2 Z the monster service flag at the Pier was plac there in lm 1 g memory. He enlisted in February..l9l3. 5151 WHSPOY Called 5 Z into active service until july. While at Wisconsin he tool: 5 2 an active part in athletics. He was a member of Sigma Chi. Q 4 1 ' 5 1 1 6 2 1 5 5 1 1 6 1 1 f 1 1 1 5 l s u I 2 1 1 William Gu Bartlett, '16 . . . New Glarus 4 2 1 1 1 1 ' ' Dm-ivule, mebical Corps : 4 1 f 2 N Died of spinal meningitis on ,lanuary 25. l9l5. when Z 2 1 stationed at jefferson Barracks, Missoun. He was a gradu- 1 2 ' l ate of the Pharmacy Course, and had been in the drug 4 if business for a year before his enlistment. I Buried at Mon- 5 2 1 l roe, Wisconsin, with Masonic rites. While a student, he 5 g 1 appeared on siveng Hiusical programs and was a member 5 1 ' ' 1 f O the Var5lty ase B team. 1 1 , 5 . 4 4 , 1 Z , 5 Z 1 7 l 7 3 1 5 g 1. 4 1 5 1 3 . 7 1 ' Guv Black. '17 ...... Tori Blkmson xg 4 - 11 5 1 , I ' Lieutenant Klnfanlry ,Z 4 , , .1 2 5 Killed in action while advancing toward enemy line: Q 2 east of Chateau Thierry, on Septernlbbl' I4. l.9l5- He WU' Z Z a member of Artus, Delta Sigma Rho, and Phi Alpha Delta. 5 2 He was a leader in forensic work at WISCDHSIH. WHS on the 12 Z 1 staffs of various student publications, and was one of the 2 2 most prominent men in his class. ? N 1 2 I rf 3 , Iln Fflanbers Tmelbs the poppies blow between the crosses, row on row 1? 4 Z 2 1 2 2 H -.. . -. W U- - if 2' 'i',,g, ip, , H 1 W M1-W - 1 25717 1 11 1 11 111 11 1 11111111,1,,,11 111111111111111 11 1 1 1111 ,ahh !,,11111111 1 1 1111111111111111111v1r111111111 11 1 1 111 1 111 11,,,,,,,-11,111,1y,,,g,pf,,1y1qgQg1!iff ' nj 'a 444' 1 , - ,a 4 4 ff -' w ' - gwxwm'-wr W f '44 0f44....4,4 4 4 44 44, v ! rf--f. ' X f- 4 ' ,ff ,444,,4 44 44 4.44. 'V H, ,,,, , F7 Q X X Q X W if K xxxxxaxxxxxxxxxxx X xxx , .mxxxxxxxxxxxxxxxxxxxx xx xtxxxxxxxxxxxxxxxx xx xxx xx xxxxxx xxxx xxxxxxxxxxx xx xxxxxxxxxxxxxxxxxxxxxxx xxx xxxxxxxxxxxxxxx xxx xx.xx-.xxx 4 4 4 4 7 4 4 4 4 4 4 4 4 4 Z 4 4 4 5 5 6 4 Z 7 4 4 9 4 4 2 E 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 I I 4 4 4 E 5 5 4 7 4 4 4 7 4 4 4 4 4 4 4 4 4 4 4 4 4 4 1 Z E Z 4 4 4 4 4 I 4 4 7 4 4 4 I 4 4 4 7 4 f Xi, .SX .. --- ' ' 4, F L AV., -H1145 3, xx A' ' -4 ff --- + T .ix 1 ws L ' an HNNQ-R Ulaymonb :francis Bloeclyer, '16 . Wittenberg lieutenant, lnfantry Killed by a bursting shell on July IB, l9I8. the first day of the American drive at Soissons. He was a member of a machine gun company and, a few hours before his death, had taken command of the compan followin the death of the regular commanding officer earlier in the day. While in the university he was a member of the varsity football team. l Q Tern Bristol, '18 ..... . Oakfielb D rivate. 'Jnfantrg Died of pneumonia at the Naval Base Hospital, Brest. France, on March 9, l9l8. At the end of hivunior year rn the university, Bristol had enlisted in the isconsin Na- tional Guard, leaving for Camp Douglas in August. ln late autumn, he was transferred to Waco, Texas, where he was in training until February. On February l2. l9l8. he sal-led from New York as a member of the now famous 32nd Dwi- sion. He was the second Wisconsin man to die in the service. 4 John Wiliam Buckley, '20 . . Granb Diapibs lieutenant, Aviation Corps Killed on November 8, l9lB, while on a photographic ob- servin mission in an aviation school in central France, wherein was acting as an instructor. He was one of the first Wisconsin men to enter the service, having enlisted on May l3, l9l7. Previous to his death he had done several months of service f-lying on the Flanders front. Air condi- tions on the fatal day were unfavorable, and it was noted that he encountered rou h fl 'ng while ascending. The lane made a tailspin. and as 13-ii attempted to right it, the horizontal stabilizer crumpled. The machine made a two thousand foot nose dive. crushing Lieutenant Buckley and an oberver to death. Rlexanber Brabley Burns, '20 fDowner's Grove, Illl. Corporal, Tielb Zrlillery Died in the Chaufontaine Hospital, near Luneville, France, on March l0, l9l8, as the result of twenty-four shra nel wounds received two days earlier while repairing the battery telephone line under bombardment. He had been cited for bravery in American and French dispatches dated March 7. As the results of his efforts on that day, communication between neighboring French and American Held artillery was restored after having been broken by enemy action for more than six hours. He was recom- mended for the Croix de Guerre, and was awarded it after his death. being the first man of his regiment to win a deco- ration. He was not yet twenty at the time of his death. Bvilliam Batman Cairns, '19 . . Xllabison Sergeant, 3nfantr2 Killed in action uly 30, l9l8. during the drive of the now historic 32nd ivision towards F ismes. As a. member of Company G of the l27th lnfantry. he had been in the :ireryhmidnt of desperate fighting for two weeks before hrs eat . -Gbat mark our place: anb in the sky the larlis, still bravely singing, fly 4 -.,.., ,Ye wwvvmg-g gm- iw W yg V Y WW we 4- es- A A . 444 441714 '4 - .2404 1144 4 4444444444 4 44444444444444444444 4 4 444444444444444444444 4 , In 1, 444 4 4444444444444 44 4-44-4 444 444 444444 4 ,,4 4444444 444444 44444444444444444 44444 9 . 7 ' ' ' I ..,,, .fpfffffffff ff 11,11fmfmffffvmn,-ff,,,,,, , 'v ffl!! 1 ff 1 1 1 111111 fr nf 1, fffffffhf, fff,-,mf x xx N Q-w X A x N X-vmnx NNN xx NNN mmm xmxxm. NNWW-.N www-X QX A k A, ,, , MA- A, Lf 4 'A AA ' A A A A 4'i4wA',fi iufk A ' X X, 4, M 4, , ,A , A N S' SX Q :X S I s x 1 M' 44 44 A A -f I Q Q 1 - X Q E z : I S X 4 'Q Q ' S X - V. s + X ' ? Y 1 , X f I 'EM Q m wxwll 5' 15, Wm! WX? S 'A a Auf 5' Smksif S 5 ENN? 'I 'f qs , i Z' I, 5 .js 5 M Aw-:vzruz W -v Ml.:-61. 5. -Q -nn :rm n 0 5, W if G1 gl :SHN 5 6555355355 i q,EaEZE5',, 2 521.22556 5 2 85.25-199229922 3- Q.-. -f:'- so--4 o2.g...O ',,, fg -vu... gg-1 Zag- n Ejuegg' n..U -1 Fan--,45..5:w,HnU 5 10011453-. nn 5Z',.p,4:,g mmm ,gy n. wen- u-u,,n.,..w-.1,,,,D5- g -:-,,w-za.:--M Lo 5,-0 5m,,..,,w,.... ,1- 5 f ia 23 s-53 2 L? 5 3,53 La 5 5 gg Z,E.gl5 3 'ig-iam 'A Egg-52923 Q, Ifg F' ggg g 512 if' 21 Q - .. - - . - --can-1 ' fm In g25W',.,Og- 5, ' ' 5' 5-'cNf'rv.... un: Q5 -wwf' 9. '40 3 9 O no 5 QD- I qw '1 W n.,-O ,F L1 'U I 2' 057 ..:E :1 9. r-5- D..,D2,5l F-H' my Q.--UK: '- g-15I:r0- ,..v .ln-an p, W ,wr 0' 'U Q 2012-v Sf -ww--Q-vb 0- --s :-:.'-- 9. Q11 if v-fm 0-.0 0' pc. a'fvCf:::-'-,.--c, - ff eu :.,-1 no:-1,-,son 9 Q an-15 Gam ,, 900.-,..,,..p9' 5-5 -wg, H5-.:Z 9 mob' 'Ui 4-,C-,W-' O' . - Ou- .0 -s: -. ww -1 n D...-:-ever-5-KD-.,, 5 ...-R40 :14 '-1 ...m0f'pD'H'N:sQU '5 1 -1' 0 E-ogpna' 50-0,5 ,,, o mon U 2, D D-E.-m,,,...,,-,aims 9, 5- E.,-, 9 -.- S55-Qrmmn mums Q , 5. 3 USE.: :Z --- Q :S P50 2-c,..5- 3. Ur DQ- - 9 D rv ,q7!,:v-rp: , Og' 5...-:gg--,,,,,3v N J , no.-MNC-, ffl O : ,1 3-v-.5-,,,-r-ng g...:,g,gN -Img B In 01. rv...f-v--rv g Q -- an 57,2 5 Q . fl. or r :Y W o . - 5 T' :sol - F: :VU 5' . EL -' I 52-Ma.s1ff-+95-ga we-QD., H Q 2-sswiwfsb-2 .Q wwumia 2. gmsmwsf can S V-,-A 5,:5.wia.- ang., D ,g ,, ga-5'p0g-H 5 g Qg:oa'g,.1sgzr5Za' E' 3 :Eg-nggzg 5. fy ,,w5Qa55g:'s-:3.5s- Q 9: w N 'B' gi 55h: Zc 3-' 535: gem' :F 'gsrrgo 2 0 Q5 5 '0 S . n'S 'eT'U Of -w '0n.g 3 5 ? W7 V -'- :r'g,M5'1 Wu -- - 5:45.-,ww 7' 'f J 'i.q-...fffv D re E0-D'-E W ' ... '-v-mf-+ogE:S0..w fx 9 11l'2 :Q--H 54UD : .- ru..-gf ,BS Q :rig-.:1,,,,,m-+-.-. 0. ,, 5 0g,N3OS 25:05,--. ,,g,::,.U-0 ,-4 ,wnpwg , .ru .. 00 -v-- ...gm Q - nsown. .Ln-woo., :r L,---,nm 0. 5- un w.,,.-,.,,-400-5 I.: .., ., , 1, H on-' v..:: vf :1 n : D, rv- :fn . :,. nr rv --0 mg ,,,,,,'fmZ Q Q-mg,-Qbww mm? g,,m.Lb,- QQ 5, . gggmrgmggmmm 3 ,,, gp 315511139 glng-3,1,.4g'o,,vn0 5. N , f-35.?L?535'5?S5 K- laifgg-3,53 5'wig32g:9,1?fvL'IH 255559562-' 552225535-gE5E5'3'sO , wmrp-B 5 ,pg-' -.mlm r:..., mg , 1 um og F, H950 ' -1 -.5' as ff and---Nw., 'J ' 'r:P'5- :,'.-wg,-M w:10 'UE,m e 3 rn 5149:-'o.'i.-fr-K. 5nf'o.,,C 0 5. .., Og Q00-Q 'mn-'o n V Q 3- TUTSF '4 I Hnwnm : .1 - ...Os mgfgiaozj, n g w mnDJP-H: 5-r-rmof' -10-10,,5 ,,,':,': ' f Q 1 m -..mov oo!--:qw : QE! :pp ,fn wo, : 1: mme.: .-,:f5,,.2of,Lf-:,-n-.,, -- L,- - g,nD 5-1 '-' U 3 4 M U-gm 5-100 on m05E ng Q fl Q 'Dpi 9:71.- ' Smnfvz'---rv0QZ'-i Hog' ro, . ...Q --gpwg'.!ow,, ,Q - onflm glomo' ff 'U :go-1 H D' 4BQ:'D-OH' ' ' 25:8 05- -1-'f'2'c:'5'n. 'J 'S' 'C my 35D 9 Qa o 1 urn U-m,., '1e -1-Tim-P.-fu W F -foo: ':r'2-vs 'uQ 'E : 5'5 V U73 ': '.':.'.0 FW' f 'PIPES'--' oE5'D 3 v-,Zinc-wg '19..ng::-can-3-----1 :,- f,, 'g- ' 'H gw4n2 m?o U-5':.'43, - ,D-U-UU -nv - mg.-1Ng:-. W' n pu,Q.0,'000 ...c ,.,!v,.. 2 nw5'o-higgongm VA 'yas-15'45.? 3 .TE 'Qs 5559.5-as' s?HQgf'sos'5'2El 5' v:33gSSg,?5 51152 I5f29,5.s.S'j,gwS 3 H ...5 ' .... - Q' gr- . UH,-, W ' m,.:Q-. 5- :,'5-rn mg, ., , :raw UJ,,45,,, 5 55- B ...p. 5:0216 mah--P' -U ,ur co -oc ,,n.wgm-- :v-...rn X rv:s2go,,g,,q...'E, sq, :',.,2c w :cIm mow? .Ural mlllmg, 5 -4: -qw-1 -'5m5-rv Q l I . .D...:m 'Un-vm x ... 550-4 '11-1 'l1uJ,.,n- Sum N- 3 C-105-aimfvgg L mgxw?-.Qi v my-30-0 14 'U 'WUT 'U Q 0 2533.5-'VNU ' SZU' N 1 5.3.,,:,,g-...snr 3 n QEAL: iv 5-..3,3.,aQP,,g'g g- U,a-cpu-310, : 5,-g-, 2-pq ,g3. 5 eoln' 3-uf' D H2 W' ' C tm. 3055515 S' o'i'05E gm 9' Wham-2 2'g-:wo-. 5 S nga-155'-,,,,D,.U : 55.571-r ln -Un U-,h.,g'U..-f 3 gm.-,Qi 5' 'gp pQ'.... ...oiayg 0 Q T-'F'-'T-N 5' UPS?-955 5 2TS?52?L2zs'a'? 3 v5'59.z5f3w if 5i??f92?+.?5E9hf.5 3 2 5' O' ? 3 Q . , 4 x X xX S x X x X Nm X NwwNmx--- Mxvxw-MWX..-.mx-W..-N-W. .N N vm, MXN x X , -N WA .Nu , Wm, ,mug mx-W. -.X Xxxx-A -xmwq xvuvN-xxxx..-wxw-NX-wxxwv.-w xx -. -.N xx xxx xxxNm...Nxxm xv. xxx -xxxxxxxxxxfsuy Ss' f 1 1 K f M 1111157 - - F , c - , . f X f , . . . f- Q a , W, f 11 ,, , ,uwm 11 .,m,,.,fLe ' -- fm F ' r' W' 'W Z 4 -'lea K N' ' 4 '11 J y, 1 - 4 .R Y S, -.rS' -J Z 4 X' XX '- Y T? f 1 9 X - - v , . H f f- ,c 4- f!1ewq,, .-ts, me X- . Q, . -f-' ll 'Ilvnvrn-nrn11nnnvufv1f1111011110111 4 ff A . ' f A Y f gina, '- 5 ESQ - ' - V 3 ' , ' ' - V-'4w,, --4' 11, -,S . -as . , . , 11, , xx W , 1 Q-. H ' if 4 . , .-r-ig'gf-1Q:-- - -:elf .- lf,....tQx A' H N., Harry Worlbinglonfiraig, '19 . Gllevclanb, Ohio lieutenant. Kviulion Corps Killed near Soissons on October 20, l9l8, while making an observation flight over German trenches. He had been in France for several months before his death, and had iloted gunning. bombin , and observation planes. For his bravery at Fismes, wiiere he secured important pho- tographs of enemy-held territory, he was awarded a Croix de Guerre. Ten days before his death, he successfully conducted a bombing expedition, destroying large quan- tities of German stores. For this he was decorated with the Croix de Guerre with the Palm just before his death. He was a member of Chi Psi. mation Charles Cranefielb, '18 . . mabison 'lliontcnonh Elnfantry Killed on the Field of battle on jul 30. I9I8, at Chateau Thierry, where the famous 32nd lgivision of Wisconsin and Michigan troops stop ed the westward flow of Hun troops and, almost unaideg, routed them after more than a week of desperate lighting, turning the tide of victory in favor of the allies. A member of Company C, to which Lieutenant Cranefield was attached, states that although badly wounded in a charge, Lieutenant Crunefield crept along, urgin his men forward, until he was struck in the head by a ixullet. He fell with his face towards the enemy. auliflonserz-Currie, '18 . . . minneapolis Iiculcnanl. Rvialion Corps Died in an aerial collison with a second plane at Kelly Field No. 2, South Antonio, Texas, on May 27, l9l8, just before completing his flying course. He had not yet been commissioned but, having been recommended to be made a pilot, his commission was sent to his parents upon its arrival. He was buried in Lakewood Cemetery with full military honors. He was a member of Chi Psi. frank liloysins Daley, '12 . . . maoison Sergeant. fficlo Fffospilal Corps Died of pneumonia on November 20, l9l8, at the now famous Field Hospital IZ7, which is attached to the 32nd Division. As a non-commissioned officer of the l27th Field Hospital Corps. serving under Major Lorenz of Madison, he was in the thick of the fight at Chateau Thierry and at Fismes, going out upon the battle field to give first aid to the wounded and directing their transportation to the Field and base hospitals. During the decisive struggle of the first week of August, he was obliged to remain in No Man's Land for three days and nights, under two Fires, unable to return to American lines. He had enlisted in the summer of l9l7, and after being trained at Waco, Texas, left for overseas in january, l9I8. He graduated from the law school in l9l4, and was engaged in the practice of that pro- fession at the time of his enlistment. Marry Eillon, '14 .... . monbovi Lliculcnanl, Ilnfanlry i Killed in the battle of Argonne Forest on October 2, l9lB, by a shrapnel shell. For three months before his death, he had gone through heavy fighting in the vicinity of Chateau Thierry, among other things, leading his men over the top on four consecutive days and taking all ob- jectives assigned to him. He was cited for conspicuous bravery in the vicinity of Soissons in the operations from july I8-23, l9l8, and won the Croix de Guerre and was rec- ommended for promotion as the result of his gallantry in action at Chateau Thierry proper on August 5. He was a graduate from the College of Agriculture. -We areltbe beab. Short bays ago 1 1 an 111 111111 11111111 111 ,f 1u11n111u,11 fffpfffn 1 1 1 1, 111111 ,,,,,,,w no ff ml X we liveb, felt bawn, saw sunseliglowr- Qxxxxxxxxx na st ww Qxxxxxxmmxxxaxxxxtxx NX,QQQQQQXXXXNxx,XNNXXXXXQNXXxxxxxxxxxxxxxxyv.atQxxxxxxxxnmxxxsxxvaxwaxxxxxxxxxxxwaxoxwsuQxxxtaxxxxsaxxxsxxxuQxxxxxxxxxxxQQ-vsaxxtu QQQQQQQQQ an Q QQatQQQQmeQ-.QQQQQQQ-QQQQQQQQQQxxxv.QQQQQQQQQQQxQxQQQxQQsQxxxxxnxxxxxxxxxxaam-QQ'-xxxxxx-aQQQQQm.QQQ Qauxxts Q-an Qt t Xanax awww H Xi 3. Q N t t s N w , S : N S S Q X S : E. Q m e S Q Q m t m t S t Q t S N Q Q Q X t Q Q X Q X X Q t m z X N i Q N S . Q E R 4 xx xx xx x 0111 funnrnlfnfuffnuu,1ufuurununnn nnffuu 1 u 1 14, nu up I ww, Ns . xx X xxx xxxxxxxxxx xxxxxxxxxxx wwnunxxxxxxxxxxxxxxxxxxxux xx xxxsxxxxxxxxxxxxxxxxxxxxunuxxxxxxvxxxmxxxxxxxxxxxx-Av.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuv.nuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuxxxxxxxxxxmxxsxxx xx .xxxxxuxuxxxxxxxvmv.xxNxxxnxxxmxuxvxxxxxnxxxxmuXxxxmsmuxxxxxxxsxw.xxyxxxxxxxxxwxxxxmxxxxwxumxxsxxuxxxxxmxumxxxxxx-muxsxsxx NX , . A, , A A AAN, ,QA4-,, A A .4- 4 4- A' X U A 44 ' AA! 444444' ,SNR NX s 5 N s x 5 Q s . ' z 3 I S . 1 , : mai, 1 :?f , NAT 1 , Q. I 1 y : , H x r' f V O w ' 3 Q , S Mr, ,, , . 5 ,CNA ' x-Xf , Q 4NJ .- -WRU 2 x 'SW D 1:-6 1: 'Sli 3 A, lr O, If I . ,., , ,M ., 5 .Z .,. Q 0 J,-'.'?n.1', 2 Gi ' za M Q 4 i'f' X' P 4l.4:'. - - f Q. ro oo 0 cgv:- M nv '- a':w !n'- , 3 23? mz Q 24 5-50 0 Kggdggqgggm 5' ggzgoga mga- 5 Us pro Q' ro55::1Z5E- D g'45f,j7'v'2. Woaiv Wnwf' If .- Q0-1 5 mv: rom rv.-f-0 n ..-1 O- rn ...mn -1 f l.' 9 W-5-:4U 2 E :13U 5, gm!-'I-. DQBBGTW 5 mpsgf' 43.-u .045 -wg n :'m::-'ga'-.,Q'g.g9'U 0 WJIWIVV i- w' ww-H U. -' rn.-faq-0 'ogwz . 1 -+0-Q4 ww-f-5' - -15'-qw -f-1 '-' :s -- 0 -1.-v-...rv ,UD 14170 xv 0,5 5-. rv... Q, TWD-wp-p m.,o 5 v -'QU' Q1mpQO--U ,,f' n fyh 0 -1Q 'D- 0 -v-. 5rn00- mg- mmm'-g rh W fp as gy FQINQ- ,,. y gr-:aWrD,.,fL 9 -' ,fr . 511:21 ' ' 0- s-40:E1 :.550- 5 FM55'---,fvs.'5- R F1 : 'Noding N' 0 rv W 5 gggwggh 5- 253.532 Q in-,.5.,,:-S.gug 2 2Snm2-Eggmggif g mfgfffggunsighxj-h O Wnjf. QQ! g0Q:':'E.n 3 '-:,,0mO5'2mrb5 f-v 3 25250-mgmiupw 2 ENE:-5Q :5ZS f31'G S N' Wf .. uP,-gag' O www:-wy, 3, ii,g-E?gf'?swSm2?F -Q:.2,1-f 'f'6H-239.15 Q agfws H1,nO5asq,, g WL' 3 5'w ' 1 hhlfa' '? . ZTWQ' 'SSW 'S FVWEWSSKMSMH QM fh5'3'5'?5z3'3b'8'i: -1 0, 245-1Z0,g'f:4: W-.3n:'f,.-.b5 pmgnugpomil o ..fQ-Jung Omggo ,S gvgmwwn. 2:,.S':-gm Q ' X 9 Emgvgw 5 . gogmzz-E 0 5,36 ra57-5 'g'fn-1-.1Hi- g'g'wn':Jwo0rg5'g-0: G 0 nmmrargggnlmo 'S F VA 04 :JM D3 - ... - -fWW 1 'f-fn ' -:Hn-'fwn'u :1 'O wg -'TI E. :1 Nf- n , w , .- . Q vu cu -. H 4 9' rf 5 fr 04 ,I : n lx '- 8551932 e MSS-52,2 s35'Ei5'E142Q.2 4952355555950 5 0 ?'i4'+'ii?s.fSlE?5Ua f 2: , .W -1 . 4 w ' ' - u. fu -4. -H ---4 ' ww -N-fo 'H - rn. ,-. ,, rnlfc, 1 40:1 How f' A 9. wg-mp-,... -- , -fn... ..,n. ,..wH.Q5 , x 2? zggfgfgg ff gigyig E N 5-35,5955-QKQQ 4 wmiiiggaaaizgg H ghgsgemiilsafg-E155 in f 1 4- f-r.,5- wiht: 15 mm.-'Dm-'L ' np- 250-1 :Oni Nl Vmspn D QQUEW-1--00 ,., 'l-45-0p,B2g:I'...-1 ,I A of :fm -1-cc wi: D 'www :gin-Ear' R4 f'-H' 0 :wwf 3-.-,.n,,4 -. -own W S0 g.,q5:S':NE Sgwziwg 5Fm,'2.5mBHE,g.Qm g12:Sg549.g2E59'gSg 0059-gggggggvgdfs 'X' Yi Op -TN --nm s ' 5-:r ' -1 5 f 4' rn fr ypgwl' -1. 710-1 rv ---nv,-rl ,-4:-x -- Rupp lf' n rn. O ,ru nv-'-1-K D- - 0 '- ... -13--cu ff mn N, 05500 5 .-- nam v- .1 on-.o,.,:rn G n ,.,:1 ,-,rv R--F :I ,,o'Um 5 ...mm -4 in 5 :Sufi-' Q-1'-ff' pn wp- o E-H mp-Q,-' ',., xn ,,,u0 .+rnqqoBo 'a-'3, ' ,5 E '.'2'v --. O'-f.-,rv 0 ' R I-1 :',,--.-vw--5 i :I Q :K-:r..E noon:-5 -.-.052-1 Z - 4' 2--,ES-ng W0 5' - Urn o:r 4:r'f'71 57 Z' 'Vw '0Fl- :1 '1ff'f-f o ':3-1 . 5-.nn - '-11 Tr - -4 -5:-Jn.,-,corn Q.-e-5091: --.N 5-ntl 5 A 5'g.gmgg,:,' -6-0 mghgugv Q 3,,5.M.3f,,Z9,,Q. 'Q g0,,g':2QgiE.g?g.5 fig-gag:-mgg-2-m5g.S1. .1-r O0 5 nog - w:w,,,g-nO:sZ'.f -vo --:rl 211.5 Gp ww ...:v -WS: WHO 0-1 u rr WWW VI, DF' -.O 75 C700-0.5 5 bn 5 rpg-'B vga Iva 15 5' :Riga 525 V' SWE-5 g 95-in egg awe.-S 2 2 5.5 Q 'Z' 535062-rr ifaapg W - '4 34 00 5 :re : nw rv SC ' nn D 0 C ,... V40 - .. :, n ... ,,., 0. Ng mm ,.. n!..-vm....,..mn2- . rv-:1 xv 5-Q-.,,gw ,M ,. 253:55 Q 3.9,-:Z if gm 5-g 3 Q5-151 42:25. swf' 4 2 442:14 Q-,M S fs N L3 r-nag- --52-.. :E.Ww o nu N 'nD.Uf-' 9- reg- ,.. Ugg.-r mo ..0U501w 1. :l, - ,T vf 5 n4f ' 0'o:1-,1 ':r9 5 Wo. -.OW 30:1 - 9,-.Taxa 53,5 E2. 1 5 12 -...Q-ln mg?-,.Q Q- w,,fv0vwf-f,,5'm- Wg ouugv W 5 5-'mf 50-.o.0:, K4 Q ,: 5-mfs If na D Q-2.2 35242 sf 2 2 42 rv: gf aff-:as - 3 we ag Q s :Ein F' 0035:-0 5 fvnvlf' --:fo-vm ' n-17950 '1--5 '.L: 4- 0:.0Ivnm17rtv: F it nELw9 Q 5' as-H.: y Fawn?-::Q0mm9D lg own..-.-.wn.::.-.za Ed -'r.:1:v-a.n.wn.m'f 2 ig 4 td -. Q f-1 .1 . IS V5 is Q K , X . W 5 X X x 4 4 4444-44 4 4-4- -4' '-AAA' M 44 , Q xxxxxs-mmsxwxxxxx xx xxxxxxxxxyxxXxmmNX,,xN,,Nxmxwqxxxxxxxxxmnwxxxxxx xxxxxsswxxxsssmxxxxxnxxsxxxxxxsxxxxssxxxxxxxxxxxxsxvxuummwxxxxxsxxxxxxxxn-nun nxmu ss wmvxxsxxxxxxyxxssxxsxxxxxsxxxxmxxxxmv.xxxxxsxxxxxxsxxxxxxxxxxxxxxxyyxusnnsxxmxvxxmyxw.-xusxxuxwmW.-xxxxuxxmwxxu,vxxxxxxxx-..-annumsxxvnxxxxxv-xxx? A? N S x ,,,,,.,,,,l!,,,,,,,,,,,,, ,U,,,,,N,,,,,,,Wm,,,,,,,,,,,,,,,,,,,,,,,, , , ,, ,,.,,,,,,,,,,,f ,, 1 , fnunarfrzn any fr lun r 011 f f Ill? 0,0 ff X , S Y K , all 5 f,,,,,,,,mm,m..,.,,,,,3a V' ,ml ,JL Y j , :XX 5 M f X N W Esgsq? ,,Xw wmv mm , , ,,, .,Wf,Wffff,? fb, - WW' if so ' , :,-v A 111' AV 'V'..,' Y K i was s- 'felaub Hagmonb fDuxburg.'15 . . . liffixlon ilanbsmun. Hobie Division. IC. 5. DY. H. ff. Died at Camp Perry, Great Lakes. lllinois, on Septem- ber 28, 1918, of double pneumonia, following an attack of Spanish influenza. He was landsman for the Chief Elec- 'trician of Camp Perry at the time of his death. He gradu- ated from the College of Agriculture in 1915. Slat Scbgcwicla Talon, '17 . . Jllabison Cupluiu. yufunlrg Killed at Thiacourt, France. between Verdun and Metz, on September l4. 1918, while the Germans were makin their last stand in that sector. While a junior he enlisted in the Wisconsin National Guard, and served on the Mexican border during the summer of l9I6. ln March, 1917, he was commissioned second lieutenant, and served as instructor at various mid-western camps until May, 1918, when he was commissioned captain and ordered over- seas with a casualty company. He was married just be- fore sailing. Hia First action was at Vaux, where he won the Distinguished Service Cross for extraordinary heroism in action. He had captured a large number of prisoners and much enemy ammunition, and had personally lcd an attack against a machine gun nest, routing and cap- turing the unners. He remained at the front and was in the thick 0? the decisive battles of the war. Tmery Talough. '15 .... Slurgcon :Bev 1s1GIluss Sergeant. flnfuulry Died of pneumonia at U. S. Base Hospital No. 7, France. on September l6, l9l8, as the result of gas wounds at Cha- teau Thierry some weeks before. Enlisting in july, 1917, he was trained at Camp Douglas and Camp McArthur, Waco. Texas. As a member of the historic 32nd Division. he sailed from Camp Merritt late in February, 1918, ar- rivi.ng in France the first of March. Held in a military hospital at Brest for two months, following an attack of pneumonia. Rejoined his company on the Alsace-Lorraine front in May. Later he transferred to the Somme region where he took part in the battle of Cantigny, escaping unhurt. During the severe eight-day battle of Chateau Thierry, in early August, he was severely gassed and re- moved to the Base Hospital, where he died. Wilmer iff. ificke, '17 Narragansett Diet, Y.. fd Drivale. ffielo Artillery , Shot by a German sniper as he was helping shell an enemy ammunition train near the Belgian border. He died at his post as he was about to man his gun. Enlisting in the summer of 1917, he was trained at Boxford, Mass., and was sent overseas in October of the same year. He had completed just a year of service when he met his death. At the university he was a prominent member of the Cercle Francais and the Germanistische Gesellschaft, appearing in every dramatic production of the two clubs during the academic year 1916-l9l7. He was a brilliant student, and was candidate for the Cecil Rhodes scholar- ship at the time of his enlistment. :frank joseph Tfnlrop, '18 . Glevelanb, Ohio Tfnsign, Hobie Corps, LC. S. ffl. UW.. ff. Died of Spanish Influenza at the Naval Hospital, Chel- 593, Mass., on September 30, 1918. Enlisting in spring, he was sent to Harvard University for training as a radio operator. He had been commissioned a week before his death, and was under orders to report at New York for as- signment to the transport service, He was a graduate from the Commerce School, and while in the university served on the staff of the Commerce Magazine. -Galie up our quarrel with the feel- , m fu anfunnfunuuufunnnnnvu,1u1ruur1nQrrnfLuvfunn11 funn,innruff,f1n1llf I11n1f,,, f Illlfflllul lull1111111711l11l1nvxvI77huu1111111111121121111nip,frurrrnnfffffzffnlflf111111171I lflll affffvmy ' ' Mama 1 Q, if .rg W ,.,..- , .. ,.,,-gg ' -,V . - - f r , wg ,,', H , ,, ,, , ,,,,,,,,,.,- , H 4:73, si I Q' E 7: 1, YI' ' 1 Wm..W...,.,.,....,...w,f,,,,,,ffff4,00? ,Q , - ,e .. ,. ,fe-fm ,ibn w L r-'ew-r- 3,1 I .yi -Im - A: sg , .K . ,, . Y ,mfjfr rf, . .. . v W .YM f, 1 W4 f A of f i 1. .4404 -54 ,l5'55 ' ' - ..- L f fe- f .,., ew- J , , N e- gg f - s , .l77f,......Vss ' - a Z 5 A ' Z 4 l Z N Ilobn. ily-'man Galvin, 20 . . . Collage Grove ' I 2 ' N liorperal, Tielb Artillery 5 , 2 Killed near Fismes, in the battle of Chateau Thierry, on Q 2 August I I, l9l8, as result of shrapnel wound received while 5 Z rescuing horses picketed in a. patch of woods which was 3 2 ' being shelled by the Germans. Their rescue was necessary 2 5 , to kee an entire battery in action. As a member of the 5 1 P . 1 Z W ' liasson detail, he had been called uion to repair broken 2 2 2 telephone lines under fire for nearly t ree weeks before his ' 2 I death and had been cited for valor.in several dispatches. Z 2 , He was a member of the 32nd. Division, and received his g Z I ' training at Waco, Texas. He lies buried on a hilltop com- 1 g L, manding a view of Chateau Thierry, his grave marked 2 Z with a special cross for bravery. 2 , , 5 ' 12 , , g r g 1 - , f , r Q g 5 ' fbwarb Grant Garnsey, '19 Qranb Haven, mmcb. 5 9, Y 7 1 2 1 iieulenanl, Rvialion Corpsl 2 A r l , 5 5 , Killed in action on October 29, l9l8, while in pursuit of 2 5 Q enemy aerial raiders who had been bombing an American 2 Q g supply depot. The.94th Aero Pursuit Squad of the Third Q 2 ' Army, to which Lieutenant Garnsey belonged, had fol- g Z f . lowed the enemy destroyers and was some miles back of 2 Z ' the front line enemy trenches when anti-aircraft guns 5 1 9 g 1 opened fire on them. Garnsey fell to the ground and was 5 2 E crushed to death. Eddie Rickenbacker, Amenca's greatest g 2 ' of all aces, with whom Lieutenant Garnsey was associated. Q f paid a visit to Gamsey's home on his return to this country. g 2 and offered his sympathy to the grief-stricken parents. 2 Z Garnsey was a member of Kappa Si ma and won a football Z f u n - - g V Q W ln his sophomore year. Z f 3 ? 4 5 , , - - , , 4 Z Albert .frank Gilmore, '19 . Tllzabelh, TLQ3. Q 7 - 5 2 lficulcnanl. Rvialion. Corps i , 2 Died of pneumonia in the American Aviation Hospital E 3 near lssodun, France, on October 3, l9I8, while on his g Z , way from a French aviation training field to the American 2 3 aviation Held at lssodun, where he was to serve as an in- 2 g structor. Before entering the American service shortly Q 7 after the outbreak of the war, he served for nine months 5 1 . . . 5 2, with the American Red- Cross Ambulance Unit of the 7 9 French arm . He was cited in Paris dispatches for good f 7 . 3' . . . f Z Q , services ren ered at Verdun. Buried in the Amencan ceme- 2 3 V 3 tery at lssodun. g 2 V i 1 2 r l . ' 5 r l 5 i 4 5 , 5 , W - - - 5 1 william Huge Glogcr, '11 . . . Watertown I ' 1 Z Slnlislician. Geological Survey 2 I l l ' A - . . , QQ N f Died at the George Washington University Hospital, Z Z, Washington, D. C., on October 2, 1918, of pneumonia, Q 5:1 W which followed an attack of Spanish Influenza. He was 3 N employed in the field and office work of the Geological Z E Survey from October, 19.17, and was stationed in Colorado, f gf New Mexico, and Washington representing the Bureau of 2 25 Nlmes in the western manganese fields. Z Zi Q I at s 2 f Z' f Zi Z 4 , s I . 5 I , William Henry Graham, 'lb . Wbnlcwalcr Z i 5 Corporal. Elnfunlrg 2 f, . , , D N Killed during the American advance at Chateau Thierry Z Z, on the morning of August 2, l9l8. just before his death, g Z Corporal Graham and his squad of men had been sent back Q 5, for ammunition. As they were returning, a high explosive 3 Z. shell burst in front of them, killing Eve and wounding the Z ? other three. Of the wounded, only one recovered. Pre- Q Z ' yrous to his European service, Corporal Graham had served 2 Z in the National Guard for five years, and had been on the Z Z vw G Mexican border for two years. 2 9 f 2 5 Z 2 0 YOU. from falling banbs, W2 lbfow lbe-Torch. Be yours-lo bolb il biglyl- 9 , ' - rr f-- - 1 W e 7 6,515-N '-1 ---- V - , W K , i - V ' .. . Q Mmm., U, ,f 1 ,M mm , , ,, 1 wif muffmnwf ,wwf 1' K mf W V V il rj , I ,Mum , W, , H .. h,,, ff' 'f f fm fffwfw N ff ww 1 wwffmwwzzmazrfwzewm!rL2ff Q ,. , , , 7 2 , 1 , 5 , Z 1 1 1 1 1 1 5 1 1 Z 1 5 1 7 5 1 Q . 1 1 9 5 1 1 1 1 1 5 1 2 5. E. 3 wasmamwtxsxxxxxxxatswaxxxxxxtxtustxtxxxxxxxxxxxxmtw -at-rasatxxxxxxxxxxxxxxsssxsvaxttatx Nastxxmmxxxttttxxxttux ttmwtnttxtexsxsstt-atttattt-.stttatttt-A-stttswstttt.. txxxxxxxxsmmxx Z 1 1 4 6 5 s E s 1. 1. f. 5 I ,. 7 1 1 ,. fl 7: fl 1 Qi 4 2: 9. 7! fl gl Z. fi 45 5. 51 fl 5. 1. 1 1 fl 1 Z Z Z 11 who, ff! i . ln il 1. 'x,n.kg M 11111714 'D-nov. B., ,XX ,vwm 1111 1111 1 111 1111 1 f If ffff 'A 4,5 .xx . Q-.ti .T g 5 , Ghomas 'fbwaro maleg Hcgeran, '18 Chicago, Fill lieutenant. Enfanlry Killed by machine gun fire at Chateau Thierry on Au- ' gust I, l9l8, while leading his platoon in an attack on an enem machine gun nest. Enlisting in the French service as a lied Cross ambulance driver in February, l9l7, Lieu- tenant Hefferan was one of seven who formed Wisconsin's first contingent. He served in the Verdun sector until October, l9I7, when he was discharged from the French service to enter an oH-icers' training camp at Fort Sheri- dan, lll. He was commissioned in December, and returned to Europe in january. Before his death, he saw active service in Alsace-Lorraine and Bel ium. Tom Helferan was one of t.he foremost students Eflisconsin has ever ro- duced. He was one of the founders of the Wisconsin ijt- erary Magazine, was University Editor of The Daily Car- dinal, and was the author of many popular poems. At the time of his death, he was wearing a Wisconsin arm band. Buried at Chaumery, close to the rave of Quentin Roose- velt. He was a member of Delta Kappa Epsilon. lfarmon Ilorlcr Hook. '20 . . Oak Dark, fill. Gabel, Aviation Corps Died at his home while on furlough from March Field. California, on December IS, I9lB, of Spanish lnfluenza. Enlisting in the University of Chica o Ambulance Unit. he was in training at Allentown. Pa., wiiere he became a Ist class ser eant. He remained there until March, I9I8, when, at his own request, he was transferred to the aviation service and sent to the Princeton Ground School. ln june he was ordered to March Field. Riverside, California, for actual flying training. He was a member of Delta Kappa Epsilon. Icon Beck Hook, '16 .... wauwalosa flying Cabal. Ulaval Aviation Detachment Died of Spanish Influenza at Seattle, Washington, on October I4, l9l8, while in training as a flying cadet in Com- pan 5, Naval Aviation Detachment. Cadet Hook at- tenriled the University in l9l3 and l9l4, later graduatin from Harvard in l9l6. He was a brilliant student and established an enviable college record while at Wisconsin. He was the author of several articles on historical subjects, the result of research work along original lines. Harolb Herman Fffolling, '18 . . . :plymouth Observer, Dbaloon Aviation Service Died of pneumonia at Columbus Flying School on April 4, l9l8, following the contraction of a severe cold while doing practice observation work in a rainstorm. He had completed his ground school training at Omaha, Nebraska, three months before. Ghcoborc Xobert Moyer, '12 . Syracuse, 51. 31. lieutenant, Ilnfantrg Killed by enemy machine gun fire on july l8, l9l8, at Chateau Thierry. Was a member of a party of volunteers to carry in the wounded. Hoyer entered the First Officers' Training Camp at Fort Sheridan in l9l7. He was commis- sioned and assigned to the 32nd Division as an infantry instructor and sent to Waco, Texas. He embarked from Camp Merritt, N. J., when the Division left this country in February, l9l8, and saw several months of active serv- ice on the Alsatian and Belgian fronts before meeting his death. He was the most prominent member in his class, being editor in chief of the Daily Cardinal and The Wis- consin Magazine, a member of White Spades, Iron Cross, Sigma Delta Chi, the Student Conference, the Y. M. C. A. Cabinet, and the Wisconsin Dramatic Society. He was a member of Sigma Chi fraternity. ..11 X : 1 Q11 i X ' -f . c g r , 1 X ,,,...,,..- .. . . 1... 2 ,, -fc-reset.. .,.-2 , f 9 A . , Y - V f ,594-.-. .ML . 5.1 gs-u .t,. - 11 - 1...,.,111., .,.. 11 1 f, ' 1.5-fi- ' ' -Z -Eh -. 'z' ' ' i ,,e ,- . w'??5Eff'9 ' - - ' Z , -- ' -t-11.4 , - 1 4 . - 3 -3f 'ge break faith with us who bie we shall not sleep, though poppies grow in fflanbers' Tielbs. v 1 f 1 1 l if 'Z 1 , 4 l 9 ' Z 41 -5 l 2 1 7 1 1 . 1 5 1 Z 1 1 1 1 4 .. . -.., , - - --v-----------V 1 - - -1 e . . -J 111111111 11 11 1 1111111 11111 1 I1f'fn111111v11 1 ,1 1 , , ,, 1 1 ,,, ,,,, ,111111111111 11111r1111111111111r1111111111111111111111111 11..11111v1111111111 11111111111111111111111111111f 111,, X 11 1 4 5 5 fl fffmqbai 5 5 ff I I 1 411111 f . - .-1 we-L gg, , f lr,1'Kxj'I.g 'f1,! 72 'afwfffl 141' ' ,ge 4 ffisgf ,,qi11:71fit'1fg:fC iTZiQffQ,,,j,,Q gf.. 'H' -sff-ff- - v ,, f- -- -W., -M' s -su a pas, 1 A sf 4 ,.-..--.. M-. ,Q my 4 if so if H-a'jg'1 ro' .-.ffwfffm is :RQ f --A-offer 'L 1:1 '4 , X, in ,ef V , ,-V. ,,., gms - r., -X - -gg e ,Kwai w 5 V 5 5 1 7 5 ' 2 9 ' 1 1 1 5 , , y x - 1 'N 2 2 W 'Eugene Blancbarb Ilomzs, 17 . . Wmlmellc, Jll. 2 - , , f 2 . fT,iculenanl,lAvmhon Corps 2 Q 9 . - b , 3 7 ' 'll d ' combat behind the German lines on 5ePtem er I 2 l I3Iil9li8,ll:1he second day of the St. Mxhlel offensive. As 'a N Q 5 l mgmber of Major William Thaw's .l03rd Aero Pursuit 5 2 , Z1 Squadron, Lafayette Escadrille, he, with three others, had 2 Z ' Cygsged over the Hun lines to bomb a road over which 1 2 1 . , , Z 1 , enemy troops were moving to the frornt. They were at 2 5 ' ' ' asse lanes, and in the struggle. four 5 g w tacked by elg t P . H 9 3 , Huns and Lieutenant jones were brought clown in ames. 3 2 7 l While at the university, Jones was a student in the College X 5 I ' I 5 of Agriculture. 4 5 1 9 4 5 5 5 1 r I Z Z Z l ? I , 1 , - . ' 1 Z. W l Ilulnus Eco Iforban. I8 . . . . ANUSO g 1 , 1 Z u Drivalc, Chemical warfare Service , 2 1 Y , 1 Died of spanish Influenza at Cleveland. Ohm. QD Ogre- 2 ber 15, l9l8. At the time of his death, he was statione at 2 2 l a government gas mask factory and was acting as inspector. 5 4 Z 5 5 5 ' 7 1 1 5 5 1 , ' 5 1 . - 1 Z I Asher fsaias Helly, '17 . . . Rice fake 1 1 1 2 ' ' ficulcnanl, Kvialion ferns 2 9 , 1 I ' - ' ' ' trenches 7 5 , Killed by a direct shot while flying over enemy A , f 2 near Bar Le Duc, France on September 26, l9l8. As Hxght 2 3 l commander he had led many observation tours and bomb- E 2 1 ing raids in the six months preceding his death. He had 2 21 been recommended for- promotion to captain. 58 WHS 9 2 ' awarded the Distmguns ed U Cross. Entering t el. mi 5 5 l chanical engineering course .in the fall of I9l3, he en lste 5 Z l l some months before graduation and was granted a diploma 5 Z 1 , in absentia. His training was received at Rantoul. illinois. g Z . and he went overseas ailarl-f5i:'st lliutenant. He was a mem- , 2 l ber of Pi Tau Sigma an eta 1. 5 7 7 I W I 4 1 Z 7 , I t 1 5 Y Y 2 1 1 4 l s Z w - . . I V -r 1 V ' Marolb fvcrcll iifmnc, 18 . . ,0rofln0- Jbdbo 5 5 Q ' 4 Z ' ficulcnanl. ynfanlrg 5 ' 4 2 l Killed in action near Soissons on July I9-, 1918. the SCC' Z 5 l . ond day of the big American offensive, which marked the Q Z w turning point of the war. It waslrvhika heading ofia Hman g 6 1 ' truc in t e 1 ounter attack towards evening t at e was s . ' I , 2 1 ' C ' ullet. A member of Wisconsin s Z , head by a mac me gun A , 9 2 N ' n ' ent which was sent to Fort Sheridan in the 1 , rst co ting . , , , fl spring of l9l7, Lieutenant Kinne was commissioned there Z Zi' and was one of five men from the camp sent overseas for 2 1 2 immediate service. He was an ofhcer lh the first regiment 2 gl of Americans to occupy front line trenches. He had been X 2 2: in active sectors for six months at the time of his death. , g 21 As a student, he was' one of.the leading men of his class. Z Z! ' being prominent both aZarL1nterclt:llf8l5l:F debifff Tlevfm 4 an athlete. He receive t ree sc oars ips w 1 ea is- ? l consin He was a member of Kappa Sigma. I Z' ' 5 fl 5 I I '1 W I Z g , 4 5' Y Z I , ' , 1 Z' Alfreb Karl Moss, '20 . . . . mabnson Z I' 1 I Q llrivolc, ilfnfnnlrg , 3 1 . A 1 Zi Died of Spanish Influenza at Camp Grant. Illll'l0lf, Oh ' Z 2 1 October I3, I9I8. He was working in the Depot Brigade Z Z l 1 Personell Office as personell clerk and filer at the time he 5 1 . 7 3 was taken ill. 5 7 1 I 3 Z 3' ' 5 1 .f 2 w -Dies! ye nn peace, ye fflanbers beabl- 1 2 1 , 1 Q - -1- --1 -A Y... sQY..fiYfff,1l,, Q1 WM' .. - .f,, ., ' ' . Y Y . . . Y Y is-S 1-. .- s . . .- . - -Y --V - as ' 4 - . . ' 11111111111111,111111111111111111111111111111111v,,,111111111111r1u,,,111111111,,111 1,1 u7111u1111111111111111 I f11,,1,,,,,,, y,1f11llf111111 111,,,,,111v111111111vru111111111n11011111111011,,,,,,,,,,,,.,,,,,1,111111111111,111111fu1111111111,.1,,a'! 1,q !l +.,, -xx X X K XNXXxNx'x'WxNxV Nx 'NV M 'Xx xxX VVN 'N N'H'xxxQw-nxxxxxxxxxxxxxxxxxxxxxxxxnxxxxxxxxnxnQv-xxxxxxxxxxxxsxxswaxxxxxxxxuxsxxxxxxxxxxxxxxxxumx-xxxxxxxxxxxxxxxxxxxwmssxxxxmxxsxxsssssxssxxxxxuxgxxmvulnynvswlvyitfvisit?-ss-anwwwmfs-:er2Erlwww-WNNwfxfxwmmitsxwxqifvmfflffgfrxrgfttfxxsmxnxTYxwX .4--4 44 4 - 4-4444 4, A 4 A A 5 A -A AA 'A Af - AA A A - - W- fum Af-AAA' 4AA'A'fAAfm'-W-' ?7 A 'Q , .z',g,4,4Lg.Qf,44g,.ae,,L-4. ,14.f:.-44-1 144-44---4444 44:-.44 5 A, , 4, ,W .,...,A ,ML ,4.,,,,, 44- Mi 4, , , , A A , , A 4 4 4 -4 4 4 . f.,4x,,.,.. .. -4444 . 4 44.4 4 ' . A A A' ' 1 N f I , AX V QX 1 1 ,P X , : Q ,. I :fa , 1 Q4 Q G1 , no w 52 1 as 3- 5 :wa s aim args 5 52 S'-gg S U 5- ages 5 ga xg 55.215 5 gpgggwz 3 , www -' :VU-'o:vfv...' yq :x 45':n 5...-All -- --W ..,,- :VU + ': ' -va.. U 0 W ..,c0-ff orv40 '... aux' Gsiffnvs... ln -'-3-1 Q- 9 M 5-5 N... .-, -.04 -momgv -B l ws.. -1:-'.,, , ,N -Ogqmg-1. 5-on 9 --.U:'u- 215- .1 ,Q , fo ' 500-' FQ- EI. Q. ww 'fa GW ...-1 'c nn. - ' of LA: s 5545? 54 Q95 555453 73 Sig-5538 S lg 55E.:9.Q.fjffg, D eq 545 QEAEZ' 5 qi N 5'-h UJ,,5 Nwvfv 5- O, -'W ,on 5 o 'UO -4- :r'g n D Z':-nu - ' 145 f 5 'ln4v 2 E225 z'+f rn., g 552-50 55 1' 9f5zE2f??','1.:E9 'E Qz: ?:?'gE 2 +54-f ', -wo: 9 , mon 5-:Iv-5,5 'f' H, go- -- Wg-.. 5'xmfI f, - .nga 0 -Aw' n n.o:o eq .. :.-1:-ggoww-, 3 H' 'L 310, .1 f' 5: ...- gg'-,gum -1 0 H,--g C H' I 5304: 5 4-r Nrx'4o on 5-,,, :E Cr-0 .,. ma- ,A 5 0, of no 3 U - -1. x - fu rv -- -,,.... Q. 1 H U I If 0 , L 2 45.2 2 3 5? -12-4357 5.5: H 5 50 5 S af'-Z 55 'fi 55.asf? 5-3 GUS-:P g 2 23 52225 2- 4 1 5552: 0 :4Q22s:':i.10'gS' -- HSSPZQO:-22 HQQFQQDF--img? PM f?'fQsQ9E-242 vw, r p' 9. 0 -fm... -UU, nl... : g woo one vw ,, -- 5-.0 53490 ,, 5' f, gyms. rv n L- '1 mam 0 .., .., .O W, 5 5-O.. :rg nn,-5 ,,, cg fn-:E n.,go....: 5 .gm Ag- yy I spin: Q 0 -.,f'.,:,', :fp D W-gofffvb -- Ruff,-4-o 9,,Cru -1 -.0 n.-+79--e,g 14 Q 4-v--mf' ' 253, : :.-'Qin - Q. 52 5 1' 20 0 u- 000 -.. A en Q . - so :v-NY.-v 5 '- -.::. wah 2 :' o- fa 0-aan' .D T5 I 11? - ' n 1 vo., 0 mu .-1 0 - ul I5-4-1-H , :I . -5-- ,U n ?' S or .- , I, 0,129 Q U' m5 Si:93,'-'L' - 'rg5-Q'544'5'-9 '- 1i'iwf,2H5 '55:1 ,imE, 05- 'g '0' V U I 5.175 F '5'uw?oijIlfg VZ 33:1-EW' 2' 'X' SE'5Awng15,Ufrf5'55'Z Q -5 '5?:72,Eg',?Y' 1: .-P40 O Zigm-f.-1 EW' 0 warg-.-. Gown' 'Q C...n GN H ,0 f g -1 - . ,, -v woes U1 vm :...... ' :r '9- 'pl Un- 5 nU1 'gf0 ,V l 2-' Sw? 51 sBeTP'?Af95's'?' ' - imglwi' g as 5355 221955821 E '52 5135 2 ' - ' w ff 0 cr 00:15. . ' ng c n. Oo 0--v-'o... 9 ... D -- V eo o wr. cz-an 0 -IU! 'HU' 615- -1 on -nr-:,,., . ,,-n nge- -,, X -1559 ' -1' UJ029-DUPO ' 79:97 5-0 g 4 .'.1.inf my .4 n--Cx gi' - 1 .V - -- O as - ,umm Ot., UIHN: :I ,H 5900 -U Q U4 3 la -is-Q in Qoiessmogfm M445-3 2. sfnfae-+a+2xs.E1'.1 Kw2,sy:'2 we o- fn-wig g 's5'9gn'5-15'-H' Ogcggi' ':-239a?3E. 3.H'52': ,usa-g'Q.'L': . pw, ' ' 55:10 f1C'JmQ 'ovol-1 ' 50:-o n- P ' : 5 -4 UU : n 'w' 'N-f A 5- USN '. gfwg-S5554 B'S.:.a'g li' l2sAng,Hs22:500 ,Ar z':.f'-2.20 n My A '-' -' -' .-. .,, ww mm' W ,, 555- 7. w -'lug 14 2. Q32 fmiggg-3.248 5 aging E: Gio-a3O'L5'E5:ag 2 55-Maas 2 sag . vw F' 0 fo- o 'orffvu 'cw - -1: 5 --5 -V' 'U 1. .I M D-Wo 5: 40 --W oo -- 0 ng -mn 75 -5 p . 'gr ' -- 1 0 -5 B Q1 cob:-5 .- gP:',,-,1 5 5- Qnrnnnvcgc V, -ewan,-:SO o G 5 5 5' QEHB'-2 OV' 2 5'f'0-YQT' ' 0-2,5- 2Sw4:o- 05' :Iwi 2 f' ... , . IW m ,RQ 2, -3,-04 mg-9-WZ D on-Sr,-S 5 .,,5'g3gQ'3.-5,.nv2 U EIU-?,'2 D , is V 0 '33 G' H553--'W5' S- OAS!-was ' Oz-2:2505-as 'J as '3'-2 5 I -' ,-, u- '1 1 1 Q - nd' , . 5 V 0, rv-1. 0 rv-m..o:l..-fff: 0 1 lt, 5 woo 5 tv, f f -1 0 - 0 .1 x . 2 sfjfi 'X Wx 2- 3f u . , 5' '. I H J f,'L-Wu A l l F 4 ' Midi R 0 1 lb. M , Q 2 A24 . f a 2 ZA ' ' A W 9 ' , 1 5 . E' . I ' 5 2' W fx . Z 1 ' my X ' 1' Y! 1 I N A 1 . 4, k.. ' r, Q . -x- -A' -4 2 1 A 3 , , 1 , l 1 Q I , 1 1 1 ' Q 1 ' ' 3 X . - .x L SSE W 44-444-44-444444 -v4-- K x '-4444-4 44 44 4 4 4444 4 4 4.444 4-444 4 4444. 4 4 A A A A A ' ' . J.- ,. 4 4 - A 5 XQ- NNXXNXNXNVKNXXXXNNXXXN NXNXXXXNXXXNXXXXNNNXXNXXKNNNXNKNNXNNNKXXXXXXXXMKRNXNXXX NKXKXXKKSXXXYSXYKXXXKNXXNQNKNNXXXXXXNXXXXXXXNXXXQXNXNXXXKXXSXKSXNNXKVKXXXXNXYXXXXNNxXNxxNXNHXNXNxNN K KNNNNNNNXNtXNNNXXXxxSNNWXKYXXKXNVNNGXKXVNXXXNKXXNNNKXNKNKXKXXXNWNKNXXNXKKVNNNNHSNWXXXSLQNQKNNNXXiNsxxxxKsNxxxxNNKXNNkNlliVxKXX xxXNXXX S xxx xx KNN Xxxxxxxxxxxx S AF , , Q, A ' ,, nf I N 1' 1 Il 'ff' up 1:un1011111110111rnunuv,,,1unnn1uunu,1nn1,1 fn 1 fu fu fn 1 uunf4,,, ,,fnf111n1f anfufufuffulzzflu afuunnnzufnf fnffnulnfnlzfffffvffffffunrzfnl url f V I Z 1 f f f 1 f fffffffg X f - v f 4 we-H ' A- - -cg-r. ff - Y ,.-4 f X if N, 1 ,, ,W M 'e' ,. ,. H c i ' , I -. g.,i.F. 1' '-S - ' France. av death. P Rub we will keep lrue faith with you who lie asleep Benjamin 'Harrison mueller, 11 Alma Q lieutenant, Ifnfanlry Died at an American Field Hospital at Beauvard France on july 27, l9I8, of wounds received the day before while leading an attack against an enemy machine gun nest He enlisted on May 4, 1917, and was commissioned at the First W Officers' Training Camp at Fort Benjamin Harrison After being stationed in several American infantry training camps, he was transferred overseas in October l9I7 He had seen five months of front line service and was slated for promotion to a captalncy at the time of his death Buried in the American cemetery Bezu le Cuery Axsne A Ilfenry Xicbarb murphy 15 Beaver 33am 1Cnber call unassrgneb Died of typhoid pneumonia at Trinity Hospital Mil waukee, on April 3, l9l8 He was to have entrained for Camp Stevens, Oregon, on the day of his deafl' Eobn Bastian Nelson, 14 'Eau Clan-e 'lllieulenanl 'finfanlrv Killed in the battle of Argonne Forest on October 8 l9l8, while leading his men against the Kremhllde line He was commissioned First lieutenant at Fort Shendan l9l7, and assigned to the 32nd Division which was being formed at Waco, Texas. After several months spent in training men there, he embarked from Camp Merntt N J Although stationed in the quiet Alsace Lorraine sector at first. he was later sent north He had seen four months of constant fighting at Chateau Thierry and along the Bel gian front at the time of his death George Bernarb noble, ll orllanb, Oregon l Tlliculcnanl Jn. anlrv Died of infection following wounds received near the Ourcq River in the American advance northeast of Chateau Thierry on july 28, 1918. Although he had been wounded at the beginning of the action he refused to be evacuated and remained in command of hrs platoon until ordered off the field b his superior oflicer rn the late aftemoon He was awar ed a Distinguished Service Medal before his s Y vpellborn Saxon fflribby 17 CC :cage 'lieutenant 3nfan!rv Died of gas poisining near Badonvillier France May 29, l9l8. He was one of Wisconsin s first contm ent of l5O men which entrained for Fort Sheridan a few a s after the outbreak of hostilities Commissioned there was sentgto France in September l9l7 for instruction and observation with the first unit of the new army officers to be sent overseas. He had seen six months of front line service before he was gassed He was awarded the Distrn guxshed Service Cross for ' heroically defendln an im ort ant post near Badonvillier against a large orce o the enemy and continuing to perform his duty after having m been fatally gassedf' He was a member of Chl Psi ,,, ' ,HHH If ff ufffffwfffifnffffnfffnff 0,11 f 11 lun af fn , 1 ,ff nn, f fan: ff ,nn 1 an uf l fl A Xff? ' 1 1111117 Qwaxxsxxxxxsswxxxxxxwass.ttttxxttvassxssxsxxsxxxxxxxxsxtttttttaststssxxxxxxxxxxxxxxxxtxtxttssxxsxtxxxst w.xsxxxxxxxxmsssssxxxxxxxxx-Asuxsxxxxxxxxxus-measasxxxtxxxxxxxxsxxsxsxuxsstsxttxtxstnsssttsxxtxxxst x atm- tsxssyt-ttsxxxxssstta..want-.tts-tus -xstsusut.t,...astsswsxsxxsssx-.stteassstx.Newstwa-stutxss-ssxxxxxttusts-sxwx-ss-sw-sssw o S A . K s if . we ' I , 11 ' .r 1 J' . 1 V il? fi A . rl I . I l I I 1 .1 '1 r I Qi 1 ll 93 ld all F l I l. il ,ew f yllfv SQN 1 ,,. vil- S N3 l'-'55s ,,, .Y . - 1 , '6 . . . ,, ,N 1 . ' - ' Y. ' X : 'W Z of-ftxiolix. ff' ,,...- f f!7Ml-L1 1 maui mf u 1 1 , -Vawvzv VZ' fm . xg :?f?z V M-L -F-.4 5 -x.-,,..,- , , If WAX, I 1 . rs A- -H .e , 1' - xt - 'fil Y 7 -L? 'i 5.5ig':'5.t--.1 R W ' r -L f-1 J ff ' - 1- .q..,, ' , 4 I 'T 5 s ffloyb Allen Ramsay, '20 . . Beloit Sergeant, 3nfanlry Died of Spanish Influenza near Nevers, France, on Au- gust Zl, l9l8. Enlisted in the Wisconsin National Guard .in February, l9l4, and served on the Mexican border in l9l6. Before the outbreak of the war, he reenlisted and was stationed at Camp Douglas. ln the fall of I9I 7, he was transferred to Waco, Texas, where the 32nd Division was being formed, and after six months of training there, sailed from Camp Merritt, N. J., at the end of anuary, I9l8. He served in the Alsace-Lorraine sector an along the Belgian lines. and had gone through the battle of Chateau Thierry before the time of his death. :Eugene Washburn Heath, Grabualc mabison Cabal, ihvialion Corps Died of S anish lnfluenza on October IB. l9l8. while in training in tie naval aviation ground school at Minneapo- lis, where he had enlisted five weeks before. Before his en- listment, he was acting as an instructor in the department of patheology doing research work leading to a doctor's degree. 30511 Basil Xolacrts, 'IS . . mabisen Tieulenanl, Hnfanlry Died in an American Held hospital near Drevegny. France, following wounds received from a high explosive shell which had burst near him the day before. The same shell killed his commanding officer, Capt. Myron C. West, of Madison, with whom he was in conversation. He had served as a private, corporal, and sergeant on the Mexican border in l9l6, and reenlisted at the outbreak of hostilities in the spring of l9l 7. He was in training at Camp Doug- las, and was later transferred to Waco, Texas, where he was assigned to the 32nd Division. then being formed. He em- barked from Camp Merritt in February, l9l8. and had served in the Alsace-Lorraine sector, along the Belgian border, and had gone through the early part of the battle of Chateau Thierry at the time of his death. Zionalb Sage mciormack, 'l9 . . f'Delavan lieutenant. Rviakion Corps Killed at lssoudon, France, on August ll, l9l8, while Hying alone over the field where he was being trained. His plane was at an altitude of 3,000 feet when it fell to earth. crushing him to death. He was to have been transferred to the front for observation work in another ten days. Carl Searle, '15 .... Gopeka, lifansas Tnrivale, mebical Reserve Corps s Died in the Johns Hopkins Hospital, Baltimore, Mary- land, on October 9, l9l3, of Spanish Influenza. At the time of his death, he was a student in the johns Hopkins Medical School and, as an enlisted member of the Medical Reserve Corps, expected to be called for immediate service at any time. During the summer of l9l8, he was engaged in ex- perimental work on war gases at the American University, Washington. .ff ,ith X - -with eacb a cross lo math his bob, anb poppies blowing overbeab, W W wffffunff fffmm 11 uf uufffmffmf 1 1 1, 1 ff uf m11u,,,,, -k,p11.r11ff1ff1 f ffuunffmmmnm:11fff110,fff1,f1ffm,f fn 1,11 fffwf 111011011111 ffffff ' ' .,b 'a XX 1 ff 4 . I uw' !,,1nfffff1 f ff, nw, 1101111111 11 J, 'a 4 1 ff 1 mfnnffpffnfffzff ff zffnufufnnMunn X X X XX QW. XS - XN' .N ,XXX XXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXX X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXX X Y uf 44444 - 4 4 4 4444 -4 44 4 4 f A4 -A 4' 44 - 4 4 4-444 4444- 4'4 4 44 444444 4 444 444 4444-W 4v444-4f4A -f '--'A i '- '- AA ' 4 ' 5 5 A44 AM N M M A A M4 A4 A A A All U NAAAAMAAM-R44 AA , 1: X S l 535 ! 1 X i if X , 1 X ' 1 X t X X Y A Q N , F 3 E '1 fl: 5 51 l' ' X X 1 , , E ,. -': X w i E 3 g X .Nu W, 4 , r E J ' I ' S Q + K E W! , Y 5 ' ' , X . i, X L1 I Y -J' , , 1 I , i W: ' X , 1 . 2 ' Qfwgh 1 0 1 WX 'T U 2 Nxt. ' ' 0 .X ' XX X I , 1 0 x .Xy X X 5 S ' 3-X e 1 D -. '41 Xa' J' X 0 ,M 8 bldg -Y' 3 A , 1 q . 1..'Q515 . hx F1 rn Q Ph sw! V, 'T vi '--sv Q w0cr - OU' Go' D f+ . ' : f' D yrs' :vs gif? '4 gfngimhi -1 svn' 3 g wsT,f!.w :Gaim 1 5-2 jgwsl' 4 z1'ff'2'hv ' :F o :r' rn nv n ffm 1 Q-.Bo ig' Egg22.5-rc - D-5 sex - Qgg 2,3-g:,o:9,7X 5 fgaegwfc-3,557 - 7if.y7f,guI U.. F2--5. -09:1-1: U-Sana'-r: bg 0 fv...o-fm5'.'4,,E g.,,u: pon' FN ig -,, - I U--1 n 'P '1 ' -' 5 ' 3' . o 43.0 ff ' rv D.. f Y 0 gpm. gc- -,Xia .-- :X cr rv - .XNg':r a.,, Q .- w B: g X ,, O ...nn .7 Q ,o Q. Q nv 0 sv E f, E 8 :gig G' vang?-no ci 5' 555 go 5 S-Qggv-Ig 71-IQBEE-gs. D 5023-Q12 Qi lg X Mil 1 O. 02 wig ' U' 5 O 09' ni 0 0 27 5 n5 rf,-HU ' 'fl ,. .Q at gp W 5-cm D'n.nn' 5 5 ra 0 T50-1 5 ,.,. cvmn,,,., O: :S A -, N, n wow 5- :Agn--. 5 CQ rvnD.,.,,., 1:2 ww -was 9 XX 35-fpL:0,,-,, N 2, , :1 '-7:3 87 0-054' P' -r 32.50 'm n . ' rum: wma - ' in fn :sw Xu' 5'-'U-:QHGQ o O,.JPO 0 O FX pw- .-I , 051-v l Wm 0 0 D -nnwm-1Cn m 9' NDBHE U! W' , V '4Q,mV'X WZ Wg- 9' 140 15' 'XC W o4,,,,5U 'Ul -lm - - 1 1 ' ' rr 4 -- .- -. -X- ... ... 3' V5 F2 - Uggfghii' .X 3 997125552 3 555558553555 3 H Q'5'0mTZf'3 5- r fe 'i 5555 5 gggsgwg 3' gg 25,5235-F 3 5Hg+:azgEfg'EQ.afg5 Efgigxsiylif- ' u gg. 0 -g 5 , --sv :S ' ' 11.0 o . ' ....'o U -Q A ' ' W Ie? M. gigg' D 3 F 3253: D i Q-TG9f-9 E a?5'H ' . ' gE',9'51:s ,.I I ' ' ELG- 2-aes-EM - 12.0.1195 - 22- as ,Haw .4 IUSZMXEX X. X X. - 'iw 3' 535056 a Z. 23.592,-L 1 'Xl SX-2 5,525-:Fai P 01 2.2 SLE,-5125 2. X ' 5- p , 0 pq, ...' o,,'4,,,,rv 2 Q-5'fv ,,:,-'X U 5 ... W5-X 'Tm ' o ET? 5' ....5':.v-I: 5 Q P fn rv 24 3 H, - E 3 g gg 0: o' Q-9192.13 Q NJ, , M Bn' ' 'S-'fsai X-:'G fQ' '5-1?5B'fv2s'v wv- .4w:S2?4'52X' Eg: fs - 924:12 EQ Q ' EIMS af 2 12:-grfL21f--N 'E -fm Q aww' Sw 2 ,-wg-if -1 1: n:':1-v'ru-X-.- 'fv5c,'- g of, D--H 90 01- gow 755H--- jeff 'X w'U:,w mmm an 5,-,mem-1 , :....,g 5g,.,4N.,.... O 4-,mn-.-X-.., -,QF GEM 5' ' Sim' fv ' 'Q ' FMS rw 6: 5' fQf 9h F '1'-323 3 ':P 5-E F5 'X' W IJ. ' W ' '1 ' ,. D D' ua rv 14 ff ' , -3 25232152 :ww 4 25o2:mf0?.if-Hb ' saozif? ' rn 0 M - Su, 4'5'ru H0 -X -' W :IW 'ww-1 m9'.,.,F :1 - 4 'sv 0 To w rife: ' D ogfllarn U-5' '40 c'-3 '4 -Q1-' fm ug f,U..g N, Q,-,rnpon 'f-f, mc-.goin ff 5 n.oUl '- :ug': f'c3o., ' cog-nm 3 Oigrmgmggujg- Q HIV? 342 32 gag Q 2112352 S2522 ff 5wS H9ff'-2:12 3- 92-M2-522. J' fig: :: S-9-105.0 SKUFE 5 5B 53g5f-XF -91 ,S 359555-3' O :r' - -I -X ' D X 2-1 3 eg Hi: 1 Q S: gf? 'P gs E 'Lge H S sim Q iw iff 2- '43' Q 00511 gC....En H nn- :fn ' B1 mE.:h - --Q C s -X W 1 , 5- I : -'-1 0 -' 5 :1 F' . , av 4 mapa: 2 :Xena 4 fisnazfrxffasw 25 :wave g .5 0 'J' D Xa- 4 Q D I l Y , S N ' QW SS X -4 X ,, 4 , 4 4-1 SXXX 4 ,444 4 4 4 X X g 4 K' X WNN KN'- -SNNNNNNK XX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN-:XXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXX X XX XX X XX X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX .XXXXXXXXXXXXXXXXX XXXXX XX XXXX XXXX XXXXXXXXXXXXXXX XXXX-XXXX X XX XXXXXXXXXXXXN? XX? X X r fmv, A 40' V . ,. t , Warn? U, . ' --l - - f 1, 74. . , ,w,,,,,wNm,.m,m.a-i Q Q,,, r' --x ' X uf ' - ' J-:i'ix .-,,-,..-'15 V W, f fe 'ef ,W ZTJZLT' W L. . , T ,fp gn 4 , f' fI','A1 Q:qgqk, 5, -5 A-tx - f- 110 yvvmfm.-m,.,,,,,,,.,. , mfwlff, 4 ', gfffy. , . , - .. .- - . 1 Y 1 - .5 f-jffff' . SSR' .-,f.-4.:-'-'5'-f A - - - M ' . -'?'?0w 25 gf'-f ,. . , a'1r.q-- 'f 4-L+ 'I l 4 :L A ' ' - ' 'Q Qzifi N ' 4 i. ' ,f,1Zgsx l Ex Q 5 'H f Z ll 4 if L. , , 2 Q r. Karl Wagner, 21 . . . . . fmabison I Z Ilrivale. 'Engineers Z li Died of- pneumonia at Brest, France, on April IS, 1918. g Z l-. KEnlist1ng1n February, he was assigned. to the 20th Forestry ' g 3 Engineers and received six weeks of intensive training at Q gf- Washington. after which he left for overseas from Cami: 2 gl, Merritt. While on board shipxhe contracted a bad col , 2 which developed into pneumonia shortly after arriving at 2 Brest. He died in the American Base Hospital at Brest 2 3 five days after reaching France. 5 T l ' Z 2 1 ' Z ? R Z 25 l 2 ' 2 9 H ' . . . - ' fy willnain wallrich, I7 . . . Shawano 2 5 i ' 5 5 ' Iiculcnuul, flnfunlrv 3 z' - 4 Z ix Killed in action july 23. l9l8, near ,Iaulgonne while par- 2 2 ticipating in the allie offensive at Chateau Thierry w ich 2 Q I started on July IB. He was a member of Wisconsin's fa- 2 it mous first contingent to Fort Sheridan, and was eommis- 2 Q 4 sioned there. He received his university diploma while in Z gl carrap. Arriving in France indtliixe jpking no L9l8. he was Z gy' ma e regimental gas o eer an a en in c arge o sev- Z 5' eral gas attacks before his death. Z Z Z 5 , 3 2 I 7 5 3 1 5 7 ' 1 5 ' 3 Z ' I x - - - 5 I vman Case vvarb I6 . . Sl. fours mo. I 5 , ' v - 5 4 , Q f Z r major, .infantry ? 5 5 Z l Killed while routing an enemy machine gun nest in the 5 2 4 Verdun sector on the morning of November 9, l9l7. He E g enlisted immediately after the declaration of war and was 7 2, sent to the First Officers' Training Camp at Fort Ogle- Z Z l thorpe, Georgia, where he was commissioned captain. He Z Z ' sailed for France the latter part of July, and was a member Z 2 w of the First unit of American men to be placed in front line 5 Z , trenches. On October 30 he was made a major. One week , 2 later he was fa-tally wounded. His grave at Haudroment 5 2 lgearslnthelxnscription: Killed while gallantly leading his 2 5 ata ron in action. 9 5 5 5 3 5 1 I 5 5 Z 5 2 5 5 Z 2 , l 5 Z Donalb William while, '18 . . manilowoc ' 2 5 1. -4 3 4 ieulananl, Jnfanlry u 2 7 I 2 Killed in action on November l, l9lB, while repelling an ' Q 2' enemy attack northeast of Chateau Thierry. Killed by g Q 1 machine gun fire while leading his platoon in a charge on an Z 21' enemy machine gun nest. Was awarded the Distinguished g fl Service Cross for extraordinary heroism under Fire. He Z Z was a member of Alpha Sigma Phi. 5 1 l l 5 5 1 ' f Z1 l l 2 7 'x l L 2 5. W l 7 2-x ' 9 4' l . f fr l 5 7 7 -v . . . . ' ' gg l .franklin Charles williams, '17 . milwaukee , Z 1 N . 5 if l - - - - 4 H 1 Sergeanl, flelb Artillery 5 7 l . . . . i I ' Died of pneumonia in the Mossley Hill Red Cross Hoa- 3 Z 2 1 pital, Liverpool,.E.ngland, on April 3,. l9lB. As a member Y 2 Z ' of the 32nd Division, he had been trained at Waco, Texas, Z Q 3 until early in the new year, when he was transferred. to 2 2 1 Camp Merritt, New jersey, for embarlcation. Leaving Z 3 near the end of March, he was taken ill on the transport Q 3 Z 1 M just before England was reached. He was a first sergeant: Z 21 'Q and had been recommended for admission to the officers - Z Z 1 training camp at Gaumure, France. He was a member of Z 5 g Chi Psi. Z 2 , 4 Z . 13 ' ' 5 Z 5 I ,N ' I ' , .. , , 1 2 I ' -So le! your rest be sweet anb beep m Jflanbers' 3Fxelbs.- 5 2 5 6 9 , , W 1 lg---H --..-.- ..-.- M-, -seas ..... - ...F - -- - 2 wx, f , Mus., .mn ,..,.. Y. ,. s. -- -. --- f , 4 i' 1 ,rj f s V. 1 ff f, wnnfuuf 1111111111110f,,,,,,,,v,,,,I14ffnfzznufuffzfnufffnf1 1 1 11 fn, In uv 1,un,,,, ,nfnlffzfuf n11f1fzvfffnfu,u11nmffnfuffflffffffn f ,,,,,,, nun, ,,,,,,,,,,,,,,1ffuf1if1 auf af 'M xx us xx xx I x x xxx Sw , . : X S X : . X X V Q Z I - N 4 N 5 . x Q ' 2 ' 2 1 N 1 . , .,. 4, V1 ' 5 Q w y 5' ' 1: av' N we -X 2' ' 'V 6. My ! n -N . Q QM 2' ' N' 5- Qxxkx-Gr mg. I 0' X A -buff Q xv. '17 1' . ' 'gli '1 1 ' sf: z 4 3 'xl 3 2 .-TS 5 xo 6' In xg: Q . 5z:L0e,1',X- ' --ggi V , , lv -4 M w 5 mg: 3 5 :rv 'Z o rn .-qw w my 2 H -no G' 84 ?.!:?f,u'1.x ' X ' k ' ax 'L-yiff-' 'h' 1 i Ss 2 21: S m 57: 2 if S U If :22?5g251U 2 ii'-2555, 5 22 w a Q Q-.MM--. ,,. ow-. 1 -...ww H nv-. D Q., :H fs can ,cz Q ww uf. S 5, gnggasiagz rr-:sg-K wogovninnbj 5 ziwqmpngg 4 no--.D. .... .., ,MW - ofvE2. of oo--005'-' ggof' 0 , ,fl g -as og W, wma gg gn 5 mc, Eg , Q 5, H- o eo -fain. I - .Url s: ':uwZ f' W5 '.-v I o :r'5f'::1f1- rv ',,H:r- Q f 1,- Q- ng um rt---,... C ucv C ' sv: nwg-Rom '1 0 O 0 y 50 D'-.0 -M, .1 mg.-vnWD-5:1 In gr... wwf' P rp 5 .U E-Spa' 75 .1 'K' -- XM S A ve O-ff.--'4nf -f :1 M: 0 fffo O 'U S44 -...U- :v--4 Q f'S:- -u : 'f' N. 0 N C... np .-. og.-v . 0 5 on or-M l V .. ?2.59.3s5f' 3. 5 'U-gs '-f'- 5:55-2 55 P2 54 S SE gilug gg, IFEQS5 5 z 5 2' 2.-v3d9,3-'flag Ug EEC- Q a.E.O5'fv2Hg5 D :I n-5'E'g'3g 0 :F- o,,:.S 3 ', .X Q .o-1 515- v -5-1-1... 3 24- 5-g 0231- 51 Qin 0 4 ,.,i-.wc ' a IQQNSSPMEQ F: 5 50352 gr 5555511522-Q au 9052?-'21-'i H g Qegiii 2? W g Q rr. :10.. -- .-.- in pu --. n. W gg, - a- no -. W' ,-- U 2g,?:5Qa1g9S2 ' :.f' gs?E.1xaa- Qggsmwg-2 Q ?22s'S:5H'5-'g 1, H- , U 1: n nn g -v-.Q , H :rv-915. 5 Q -.W0 0 0 0 : ' ' + 5 wiS2lfE':a,H ff. ass: 2- 2 zfsfie--iw irgfvr-asm 5 gg- 12255212 af- ' Q, w 9- ,,,, .on 5 . ,.: 0 . Q-....,, 0 mg - 4 or 5-mov : 5'...-1-1-, 9 :s 5 59 5:20-155 f mfsw :'s--aispcaa iw gafrf wsS',gwQ 4 5 wig- E-lg - ed- ,,g-4n,r-1 - 9, n a D -s ,,E,,.,Qp .-.,,gO 5 Pg A S 2 52.59255-E-1, U' :ag-w F o3.S?5S.2m5f' :.'. gipgos :1 ' g'm,,'.'l.Q 5 N wg , 3: ow' ----,.. 2 D 5' , - 5 -...Q .-. - : - ua. 'g' ' 'of' : . ' ln 5355-Sf?-S'fDi1. F352 .:' Q-FQQEHQNEQ Sfezia-5.51 N Wifff. 5 9: 9,12-Pgoguqgv-5 'G WSPQ- win. ig aj:-gil. Q' . agua gg .2 giogag 51 - ' V .. 9 .1 53 u .5 . 5 1 afgfnifasil O gil samlsgggi. Emgmg ' SL?-fps: 1A 'ug :VUU am 09,191-v-' S' ' ..,.:1O'o W -f-. 3. 3. :v-gzfv' Q-uv Q 5 v ' 'S-H Homo- ' -12-.D-5 :avr 43' N 1 9 ang, rv, ,,- S -. rv- 3,2 :r' xo Q ooo..-,Ui ' Ugggiiiief H gig 533,55-EEEE. E 535 552 3' 3,1292 1 Q 0 v g Q -wgm g o ' :S :ro W ... -. ...ogggm-1,.1,,q 5 ngrrg 5 .... ,.. -.0 -.-.go O, nv C ,D , X H H HD. O ohh 0 I-fm C0 ru' oog -5-.. :,- y mf : P2JS'o3f m5.g S, gag, E 0-53. og.,-U Q' -maxim 0, Q-van'--u 5' E ggg g2:Hq ,, - sin. 3 15 5-s.5 Ef 55 Q Q'2'5.L2f'5 C D-gf? B 11 5:5 A r-T51 3.0 ?'i4:' w ?-LE g 2'E5SFf'3E5'? 5- :2lE'f?i A 555 9,52 E ' 5 X ' : K. ' - 0 ' z Q, , ill 0 2 3 W E ci ' , z Q .N z Q SX '12 ' as R M X E is Q . x X EX- ' A A ,Am W ,g,A ,Q- X'4xixxWn.Snxxxx xxxxxmswqxxxxxxxgQlsxxwxssmg-xxxxxxxxxxxxxxylx.Q-LQxQxxv.wlxxmxxxxxxfxlfxwfmxxxxxxxxmxwxxxnxxx uwxxxxxwnxnn uwxmvmnwxxxxs x-.xsxwu N x unmuwasxw.xXxxxQxxxxxxxxnumuxx-.xxxxxxwxwxxmxxmxxxxxxxyxgwmyynu-xv.-.ww-vmwww..wxuu.,.w.mNvN.N'...xwxxxxun-s sumxx-xxxxwxxxxxxvxxx? ey, fb Sw 1' 0 AF' ff' YW' swxumm-.NNxw-wwmmY.-ixx-393-5.x53x-,,w,,,1.5y9w55g355yN5vv-rx-Ngwwxx.v.NxN-mmNKmx-Nxv.W-.Nxxwx-.wmxw AX-NNu-.xwxxxwNWNWXXN- www-.XNN-.w... Nwwwwmmx.....wwN.,w......-N..mx.Nm----W-ww-.xX-.v.xwmNNNNWWWWN-xwxx,w.x.-Nm.Mx-.NX-Nga , ,wfdi -- L, , A 4 - -1 4, A M , , , , -4 4 , . , ,, W, , up M , ,,,,,,m, -K! 44 A , Qi 1 H, -2: Q - ALI, -4- -- -4- U44 4, , A ' A ' i 4 , A f , A , Q, fy., ,Q . ' 4' X' '-In 'Xe Q 1'5 :SX v 5 . -QNX I 3 -- , fji 5 1 3 .55 ll! H Pu 15 I-, SFS: Ea g L'-sg: 0 3ggogg:.'gss'g'g- g ggfszgneg D sagem- D M :Egg-HW 3 Ea-fo 3 sf'af5f'25-sign:-vw 3. :JE-Bao 3 Egan'-327: 1 2 X , ... .. ,J , -- -. , W mo',,a,:B: 2. 0-4305 6 'g,m,,olPS'...:v a...,-woe 9 0553: -15. U, n'pa-sf: bg A X gg U W-'-S4 5' 'rv 'Q' 5 -'g3n'arv-is 9953- 5 ' 0o'2Bg0- :YI :DH p, 1 3. ,.,,4w:-,T , 5-o59 ,, gt :v-QSQQ3 mango u. g-gn-,aggo bi nm-13943. ., 5 W HWWESWE A 5 '9-on Q a0w'gW2o Tomo- g 0 go . :'-N 5- For U? 'D E f- Q53-2!.: 'p ' 0-2-g:'5'q5: 'vm0f'-q5 4 g5 4 gag'-g '5Z'on'S 5' Sings D 91 fi wogoggq- 5 309,125 R' Igglg-9'E'U5'i'.'f752 :, Pl .-,wg'53,'gg Ho Sggnigg- ' 2. X rv-D.. -and g 0 -rg-Us 6' 0 ., m',-y W Q we 0 oo 3: --- W 5' :ivan - -L ', V I 55 a'fS4's'5E Gr S M225 E' 5 22325-55553325 3- 5-'E5 2?95 2 S' SC2S5 5'o :- + Q if-'Sz-me Ls 'mf' gs- me-we-:E--e-2 v -2:---2-as 5 g,'2-'-'-me - . vu W ' I- gr ., - .4 -1 - rv 5 -f - -1 3 S5 5.--0Q., o- 55' ' Woppg 'H g..'D ' ' ' 5'-in :v wh' 230 D' 2 ' 1, . :1P'-gf-E - .... 'I ' 9 55- U35-gmwa -ml ' H 0-fv3'.-V5 0 U'm9wU7: - ' ir' . 3 MQ5-2 Q - pf' F97 5.--00: -. g c0F :f' N1 E4'g.w'O 5 'LL '--No.3-v.. 3 1: 1' ... rv'-50:' :J v5 '5-33 ' .,'5:.1.3 -3, 2.1 :'p0-I.S-fv m- ff-Zmnw 3-1 W- P' Wm 5 ' . 0 - ' 5 I Vw W -- ' On?- 10 0 , CTD' 9 . - fr' l gf Z,Sgh'so?ff?O gsadam IEE-ima:E529g-+ ggwizig- 9.5222-52 H ' - H- . ... . - 5 F3 SS'O59+Z0' mag?-Q-3 E..,'PDi'9?.3,E-S,: .1. 0222.0-:mg O 255-3-' ,,. , 5 12' Sa rs'?f2 D' ' 2 90-s' 3 9-I' 039:-TE i52 SQ' 0 ' 5' 3 f Fa A gl' as? ? - f . . ' -ff - D :r ---1 ra p -1 -Q V 1 U W 25 1' o5 '0Q 0 PpU3:0 0 an g :H W Una n 'Wg g 1' 1 ' 5 ,Ang ,., 2 .-fb .,, ... 2? 5-, W 3-5 -1 536.93-an : . og-Hn . -X , N - 0 ,. 4 -1 U3 N -U , IN p 5 5-3 73 . n u G. 9 Q 9 n E' I w s -'Z' . i'f.2 -2-233.-':1,5 ' 5?-Law 2 - ez'2TQ55:sf'i.??,. 2.a 5 51aL,-9E-- 5' 5.252-5 .1 X , 1 5 -1 - --1 re -. . , . A 1 2 rr? -I--f' SIZE' U 2-' 3.11121 Ps:-5' U .Ci . f-:gm :1 ,, 5a'B':S.' 'f 1 J 5: n.-151-o-og, f-'Sas D' nEZgS'g:'fNE!3ow'fl9. Q If-mg?-, G gc:-. 5- 5'1 N '- 5-225591 :QE-ig ,g ,igmgpgginhis-9 g giznsig gmfigzg, 'wwf 5' ' ' p, ' ,,, EI.. 0-1 4 - - 0 . F' 13 , YQ - W 2 2 Os H 5-12' 2512 S 2125 2 mg-.fs 0 22-229 ---SL - - - -. H ... -- :: . ' , wmmog -1 N132 - fa 1 o .--lg 3 na' 5'-3-cn O 230- fe lf 'ww - :.- Wx., 5 -H 2 w., 0 . 9.--Zfr-E35 FO- SL 9' '-,L--mg' 5 U-few sd ,-as 2' E,Eg'g-SEQ Q 353 S' 25225825855 O 9223?-55 '-gf: EWE555 .2 ' :. :r' ' av' w . -1 -- - an - :1-'-1 ' - V lg, .vn.,,9L:' gg' .-.3902 3 f:lf'S53.'-.vn?r'v 37 1-?i'?9.?:O 3 EL'rS.f:S5 0' , ' 0 fd 0 c' n N 31. ,' l 5, s 5-ll' ' ,q ygflu,-'-.:'--.R , Q-3 4 f f,'fM. 1 -1 ' V' .fyyfk 1 n ' If ,ffvff . V JIM ! fo VI ,. M7 3 5, g rf, 1 I' ' uf I- - ,LTI I ', A ln ' . pi' f ' A ' In AD' rx 2. , ,- I 'n 5 I g A -f fs gg 4. , ,Q . 3 3 - Q I E , X 5 N S , Q x --A MXN ,Z 5 Q xxxxsvRTAixii.RRRcmiiiixxmxxxxxxmmxmmxxxxxxxmxxxxumwmxxxxxxx xwxxmwnwmxxxxx-.x-Nmxwxxxxxxxx-.-Nxxmwmxx-xxuuwxxxxxxxxxu-xmxxuxxwww.-.w.-.mn-Awww:-mx-uw-s1v.w.v xxx xx-M-A-Mxxswnw-xxx-.w.-.-mxxyx-.wwwwwx-xvxuxnNum-xx-.xy-.sq-.W-M W. X A xx .A xxx-.x -.. X wxwxxxx-.xxxxx-5 My N- - 1 , V f . , N ,mf ffmlqfyqlffufufl 1111110 nuffuuf, ,uf 1 1 111111114111 1 ff , 1 N 11 ,, - ,,n1uu1 11 ,yfnnnfurfnnfrfun-ff11fn,11ff,,,,,,, , ,, , -- ,,,,,,f,,ifn12f1l1l' 1 f 1 ,M X, fmfnrrfufz 11111 111,11 x xx 1 1 1 fu 1 mf ' f ' 1 , ' I 'f f ffunfnfunfvny 1 .M ' 19' mf' ' I H wffful mluffafnwfmfafnfrfumffn ff 1f111fuu,ruW,,1 1 x YW. xg X Nxxxxxxxxxxxxxxxxxxx xxx -A uw. xxxxxxxxxxxxxxxxxxxxuum xmxxxxxxxxxxxxxxxxxxxxxmumxxsxxxxx-.xsnxxxxxxxxxxxvxxuxxxxxxxxxxxuuxxxxxxxxxxxxxxxnsxxx-.X-.xxxxxxxxxxxxxxxxxxxxxxnxxxmnwxmxxwxxxxxxuwnxuxsx wxxxxm-.xxxxxxxxxxxxmxnxxN-xxxw-xnxx NxmxxxxxmxmQxxxummuxxxxxxxxxxummmmxxxmxmxxu-xxnumxxxxxxxxxxmxxxxxxxxxx-xxmxuxxxxvx f NS N , Q SX E FX 5 : Q m E - z S K X . Q . X X 2 x S, 5 E , S 5. 5 A S . I ' I N x Q X Y , . 0 6 . 0 Y 9 X 1 E ,lk 'Aw 0 fw f E.. AN N W 9 X-.X:N.X'hj 1- I uh Nfl ,- no ,gg 3 A S xl :Hi .., - f er .X sa ,whim H' l'7f19'.. 'g 0-va -Us p-align: F -1-.-'gpm'-v rm ak. rv U-fm up Q .- it ggi kv ... ' ,., F, ,,,- an rn ' ... n- -Q. '.mA B' Sigfslszgiwq F 52225350 2 22225220 P. ?'f?5?SZ?rvU 'E S5?'i2sU 3' gnigvkf-A E 5'o m,,,., 'a,., 'Q o4 f:r 5'-U-,.. ..on:vraS2fvL'g .-. 3 'Ag :r- : 'H'-19-'--g flw'!: X9 a.7r'wU'gD-p:-'rT:1: 1 -,,5rvv5'inf' Q mpooE 5' 0 ima'-'?-,,Lnmxa5' 0 Fv'5jo:'m5' 61 6 -mf! 0' ... 32-,, :W D-'-If' W-. mm HD- 'U--w-f. --9LD- V1 N:-rj gO -0- 5,,,.,,:x ' G- - 'KM -r gr: :hn.... D- - 'gimp 2- 'W 'gn Tn- w -hcioo 1 9, UQ 0 'WIVJ 5- of FW Saw 5 ga- Q .gigs 2392- , 2, 5-2 95 fa N 9.2 2 I's'f2g.2- E' as E.g::.-an a , g--h o-- Q pn F- -N o 'Um r F, ' 5 '-'- 0 .f 3.4 EQ 25 225-E 1 afg,s5Qff Q5 2 aim 5:35 22 329 WEE I 159231 2 f 5 . :foo own ... ra :I xv m 5 I cu : S2 : g -c A .- 4. -1:-f-..,,,, wma on .- 'cw vsp.. fa mari c : ,,n.mE': , ' A ,-gl Go.-ro D,-5 Hin ar -uve:-n 0 Q HP-Hung! o-S.:-Q-no 5-3 Gm mm-HPQ 1 , 5 Pr..-'p.n..g-.Hao -I I gcgimgo. 31: ga D Q-QQQHK rvnqmru.-fggwo 5.0 5:-5:5 N ... 1 0' - -:1 m ':r-L 5 5 Q rf. 2'0ml'fW 2 D 'U Jvwmmm -- 9 2:1 0 :s uf IS mf'-.... sv .r'T' 1A 0 E Song! 4.32: I wcS,..::w::1 -.-5 of' ::'1o ' O3-5--vrph'-'m mE'0UI Pro' '4 '1 ff gn---. w D :a,:2,r':.::1: ' -': f'n. '02 C 3 '05j0::,'5'uqUW -5 wsvqcmm' -- Q Vw N755 :-N4 : ' '1 Q mu 5 RWE OU'-'-m n 5 V' gg-pkg g,H-f. ' - l - Efvompovqh-119 vU'G rg.,-f:'Fl fvf-+ .0-1 ... .., 71, --.D m,.,,,,, rw 3 0:1-1:.'-:UC - K -- -4 0....: 9' 5 'f,50 rvf's--- D-D-Cp-Snug: . nv aio, fr 0 rw 9,-v-.mow X' N Q 2U'DS '-1-2,:1w..'0 Q' W -.rJ.Cra-2: sv,,ff4fv,,D 'ugmo-.ng-w gr- ' f4un.f' .- 1 N in g--, rr wg. -1 D- U'-so B 5 5 Sm- --nw 5 . ..-.-1 Gig B -,n 91:5 -- '05 0F 'o ' ,' wuonw-15' -. -1 o --25:'-.S.D'r N HTWWST--r D ' 40 U' D N ' ' lg naw-ifnfavszkn . awww gf- - :fn wgww- Q f:g,.o8v,,E: - 5525 zfmao 4 0' Iongglbx-nz' Z' O -:r 'WWE'--2 l :15-Sf'--- 5 H 3'fPg,pg:--v-hE'f' ' -152.-E503 ' 7 1 V. n.9ngw-cn.-:r,,-nag, T5-so-g-w ,R a.,,.-U5 vc-, ga, M, gwpgw on ff' :ww L, ,1 . w gina-1 U wE9':'g,Q-1 m 0939047-1 5.1-v 5U ,,::nq. -v-N sworn: fx - g, '1' ,, ...w . pf-vm :s . - n.o-1 ':r rw --, D' on c :nn Q cu --- N ... . ' 0055 rgophf n-- wwf' 'Q' -fm 0 :s ww 5 nro up-h so-.UIQ Q5 Q0-v-rv-' 3 O WW rr.. -nv-'C . OU' 2.i5gfgzSg23 fEgw25.2glEf4 sggzrggiai -agga.-Snag? V' 59,525-fa 5 . ...gg-1...-I,-'gf' -'I 9,,' 3 mc -1 4,4 OU-... r 2 7.-+ 3'-. NUS cr 00412, .4 ' :,,.4f'w!':r-,C-,O f. oIn,'Nn G...w-n,,-- 23-0,Lig'f1w, . ,.lm9'5'P'.-. 'Ac 5'If':ag55f. 'Im 92? '5'.0-' v 0. 3' ' :s-'F- WSL g,,5j.f D-Zo-gg' zmggsgg 1 U, a245E.'-20212. tg ' ..E55g3g,,n H H95-52.2 'V O 2 na rv cu P, 1 '1 C pa ru V' nu n 5 H' ' ' W 0 cn 9 127035. 1?--1D'W an 'rr' nm E. .1 rv -155. U1 , '-gy-2107 O1-Q 2 --n'J0 -.gags 25-n.-.c OWBQQBO, f. ng--'coin A w ,,,,fv,,n,.- -g,,.CowH.' 3 .,, nga 5-Q 0 fo g .-. ,.,. NO -HSD' .... 5:5 W 1 -. 41.51755-1 -f 5 Hnofvooo f' bf -'ff 319'-' U, D520 nz Q - '-'ru 5- 1 .4 , -,- U-,U Q gp 4. nnmm ... m n. 6 fren-UQ If29.Z3g,?2w 9 22305 F50 S U2'?4e.': Ii 33259022 3 ff75p?l'ZZF rv cu ,. rv :,.. 1255-agcws S QE-S5-?Ug6':' 9' SEG .155 Q 29hl3'JIgS'I5 5? 'QTJSE' S I.-,5'2'a'5s,1z,g -'I 5oi.?.5.sQ9 Q1 gggi-'g-.g . g.9,PPagm2g' LQ S,-9,S'2rQ 1: x uma:-1.n.n.. 51' -...n.- . : .-,mm.::. 'ta .n.n..:r--. -- n.m.-.r:.T:1 av' Q 6 O' 9 3 S 3 2 S N Fx Ss x S R X NNN ssNXXNxxsxxxxxxxxxxxxxxxxxxswN-Mxxxxxxxvmvaxxxxx wmw.xw.sw.w.sxmumxmvwxxuuwwxxxxwxxwsw xsxxxxxsmxu-wmxxuu -.N wwxw x xx xxxxvxxxxxnxwmxxxxxmxxxmxxxxx-xv.xwxxxuxxxxxmxxxxxuxxxxxxxxxxwxxxwwxusxmmxv-sxmwxNxmvm.,-xxx-.xx-My-xmxN.NxxxxxX xxx ww xxwmxxxxxxxx -s QF Q ,s W I fly f Y M r V W Q. , V ,alll if N 1- .P Q . 14 ' , g ' :Q-figs.. If ff, 4 r f-gf ,9f4i'f1r:qgm,.A.j,, jeakgv -- - . 4, - --- ! i M 1 1,11-11,,.m,,1,,,,,. V H --f-if gflff wg -ESQX g ,F-t f3'i Q, ,, 2- ' 1, f ,-, 41-1.-. K E -'rf' -----S,g,, so 2 .. 2 Si' ,,,, - l if .ir Dieo for Democracy Augustus Toss Bell '16 merrill manning Benson '19 George Wfarl Brainarb '15 ffreberick John Curtin '10 Charles fllaul Giessing '16 Holm Barton mciarthy '20 walter Effenry murphy '15 members George ffitzpatrick' 22 Halph william Gorham '22 michael mathew Qruber '22 llfoseph Ifohn Mans-on '22 ffranla Emil Ftfeller '22 Clarence :Donato Mill '22 fflowarb George nelson '19 Ralph Etfaney Derry '16 ftlarolb Sargent '17 waltcn Ufimball Smith '18 Stanley Story Stevens '14 fucien Dorter Wetherby '12 Otto louis winter '11 ofS. 21.6. cc. y Clarence milton flfughes '22 Bohn william martini '19 'francis qfowarb mcwermott '19 morris william nelson '22 fflomer :Eli Derkins '21 flflurcell william flliper '19 :Burr Tavio Koberts '22 illn memoriam fDuoley Flfubbaro Ghase '22 Kenneth Soverhill ifarle '22 .ljfenneth Sterling Tay '20 fDonalo 7!V.e33.oy Iffoisington '22 1 1 111 1 1111v,,1111111 111111111111-11111111111 1 1 If ,Ha !,,111111111 111 1f1111111f11v1m11111111111 1 11 1 111111111nw11,1,,,,,, ,, ,,,, 111r1 I 1' ,,,,, v Spirit of Sacriice :By Kucilc Sclk '20 Greater love bulb no man than Ibis: that a man lay boxvn his life for his fricnbs Tlfome 1'ZXgain! m back, boys, back from the mubby, sbell-torn Iielos of Trance to the smootb green slope of the Big Mill, the best place in the worlb to be, our Alma mater, twice as beautiful anb glorious after we have been away, lighting for ber, breaming of ber, anb ob, olb pals,-longing for ber - 's great to stanb again in the familiar boorway mlb look with ORS Abe bown the tree-borbereb vista of green- , it's over the lop every lime for a Wisconsin man wbelbet be is charging into an enem'g's trench or up the winbing roab of the bill of learning- fl ly! A stroll past Ialbrop, mlb EI bear as of olb lbe shrill sbouls of the girls at play-Q ' u . .IA u' -.fi Q u i' 'E-.ff ve learneb what real fighting is since fl last left the olb :Armory tbat bas been waiting on the shore like a grim but kinbly castle, for ber boys to come home- .J 5 , .x. -1 ' ' A A ' 'i-.g'1a.Qg.J'- - ' 1 -' 2 4-1' Q. 3: fsgf v 1 'S 7' Fw. .V .. F2.'- 'xii-,L Vw W4 .f . 4 ff' A . x , 397 ' -. 4-1-Qqw:'f:f:-iff: .,r 1-V:-1-w2'4f.-,, 4' 1:5 ,vm V -' ,,w','fxf.',:g -. vq,ff ..7m1?wffZ' f,',z .- MJ? t 11 ,H A 1,--..I Q S' ,- , ' ' ' , Wig, --5, ' QIMLL '-,ag ' 1 l -4, a : 'f1.w-1: f 1 nf 1 x lr:-'. SQ., -., '31 ' ' if 1' - wwf? 1' . :fa-f.,..,,,..,,.. 2513514 ,Z , . , .. ow Ffve longeo to slroll lbe sbaoy coolness of the fDrive as Ffve lrampeo the roabs of Trance with the teb muo heavy on my boots- 'be clock Iowan' of a shell-Rom 'M cl-purely in fflanbers brought a swift sweet memory of the happy bouts this olb clock bab rung out for me- - -2 : , x l9al's Ibis? Gbe splash of a - pabble, anb a browsy ripple? Cilyese spring nigbls are worlly living for-anb believe me, pals, worlb figlyling for, looses- ? nb the rustic agrics-what a joy it bas always been to stare along the while ribbon of walk that leabs over Ag campus- 'W' ook al that vista of calm water W Ibtu the trees! EWS the soul- inspiring quid lbal TW bremneb of when the earth lrembleb with kbe Ebunber of big guns- '9' nb' there is Ilicnic Iloint, stretch- Q ing its long emeralb finger out into the shining blue of our lake- -3 nb this breaming sunset water where one can brifl, anb with Mer, fotgel that submarines anb batllesbips ever wrecheb human life? 9' nb the observatory, bigb on the E Mill, trying to plumb tbe twink- ling infinity of the skies, un- minbful eitber of the bitterness of strife or the glory ofpeace- 'N' 2.621157 'N 'T' be frienbly willows ever sbabow- ingl the gray olb rocks willy slenber leaves ofsilver green- fflolbing bere lo reminb one of war- oys, lbe1'e's not a bit of sunsbiny blue in all Trance like our own lake on a summer afternoon 'W' his glorious goloen after-glow which fills ones heart with flleace-the inspireo emo pur- poseful flleace that comes with a return from strife emo horror to the sweet, mah youth olof t Wisconsin- . .Q- L: 51 5.5 'v':'?'7'WH ' -L r v y,e-g' E39 EMR? -.r ., -.mm-..-,L.i,..... ,..,,,W...,.o.,,1.f' 'QQM ' , yu ml A , 4- we is b 5 M, A B' -+' +,..'f?Q .n-we K .wk - , , , 'fN k. 1L' if W 7- :mf,1f1i.,1i1i-!7l. .,,.,.sQl..e f2 fwf .Q,r. if H M ,, . -wx .e ilsikw, - ' ' - k : W f...,!.,,,f - ' ' 'X BL-:Sis-X fi?-15'3f52 4-tsiuj? X f X xxx . ,,, - N - A -. . - 'x 's: -fc -' we io - .V - r x x -xg , , ig Wear - Qgmf wa- -.. me R 4. 1' ,f . V , e....-e , . A ,Y , Q, 1 - KS - ' A ' F Q- ' -'-- 5 A IA. r s Miers.. , ,ol-B V 4 ,- T' -si.--5.1 , N-U' . .. - f ...M , , , 1 MN.. ,. . . - ,fi-.'i53 ' 2 -. A. ,,,. X me J, A, in 'A - Q .f -QQ s-,XX N.. A . , -7,- .wx N: - ffm-ef-se,, Q . V, 5 ' xr--'Jw-5 . 'N . f. Sa g, so . -V - wg-A.: we -. Aww--sg Q5 ,., oe, 4 - X N--1 f +L - . - ,. -. -wrffqxo . ' k H cfmi1xiS1?aTTo1x Photo Copyright by Schneide Zin iiiiemnrinm Charles Xicharb Van f'l'l'ise lift was the supreme merit of Er. Van Iffise as presibent of the Kniversity of Wisconsin that from the Frst he conceiveb the problems ofa state university in a new way anb with broab comprehension, both of the buties arab possibilities of such' an in- stitution. Me saw clearly its- outy of carrying knowlebge beyono the campus ano making it birectly effective in the life of the stateg anb he conceiveb anb executeb this outy to an extent arab on a scale never before attempted -Dresioent TE. ZX. fifvirge. m,m.m..wmvm. m.....mm..m... ' resibent Charles Uiicharb Van Tlfise 352 fDean Scott ffl. Goobnight Hs a scientist, as a conservationist, as a thinker on economic anb inoustrial problems, ano as an ebucator, his name will live in the minbs of men in the worlo at large for generations. Ellis co- workers in anb outsibe the lliniversity will be inspireb through life hy their memories of his unflagging zeal anb persistence in the attainment of high purposes, of his gallant bearing when assaileb-unafraib, un- resentful, anb unfaltering-of the well-reasoneo justice of his jubgments, which might err but were never petty, anb of his vigorous self-biscipline anb ever-broabening scope of interests. Hlgfe was in truth a man. A fbhe stubents, however, the true beneficiaries of his life work, coulb not all meet him freely from bay to bay. Ehey knew him at Rrst only by his cheery good morning on the hill, but from that time on their love ano reverence grew apace. Ehey soon aomiringly learneo that he was an abvocate of manly sportsg that he himself excelleo in walking, ribing, anb canoeing: that he hao a keen interest in competitive athletics. Ellis innate squareness was proverbial. Fife consistently sponsored stubent self government as the one principle of stuoent control wholly compatible with the proper training of citizens for oemocracy. One of his great unfinisheo tasks was to provioe an aoequate Knion anb Com- mons for wisconsin men. none of his preoecessors for many years back hab maintaineb such close contact with stuoent leaoers or possesseb their confibence to such a begree. r fDuring the war, fAmerica's iust cause hab no more earnest champion, the league offflations no abler aovocate, our boys in the service no more loyal frieno anb arbent supporter. IH is last public aooress, belivereb from the library steps three bays before his beath, was an inspirational ap- peal to the stubents of the S. Zi. TJ. C. unit. f55ut the full import of the great lesson of his life comes to the stubent after college bays are over, after experience anb responsibility have begun their long schooling anb oistance has lent a bit of perspective to the view of college life. fnhen the first vision that rises before the retrospective glance is that of a sturby, virile incarnation of the Wisconsin spirit, of the genuine Wisconsin spirit-whole-hearteb, altruistic service towaro fellow man ano commonwealth. ' Elle was in truth a wisconsin man. gas sea EEE sts ..,W,l.....,.H,.W,..,..N.m.,mmm.,.m.,..,,,.m....m.n. ,. ,..., .,.,.w.m...1.,..m.,K..n.,.....n. ni. .m.m..,..m.m.m.m,mm.mm..,m..m.w..m..m.,m..,.mm.U U mm uw1-11in1In1.1iut1.IwwI.11H11111.11u1in11.11-wwimmmwm ummummmmlmmm mmm-umnm1.ummmmuummmmnummmlmm nn nmumn mmnmumi I nmmminmymummmmiummmummmmmmmmmm: Page 48 A Oribute by the .faculty e, the :faculty ofthe lCniversity, woulb pay our tribute of respect anb love to our beparteo leaber, Dresioent Charles fi. Van Wise. Ftfis beath has afflicteb us with the beepest sense of public anb personal loss. we rejoice, however, in the service that he renbereb to his fellow men. He preacheb the gospel of service anb he practiceb it with insight anb energy. Ztfis service was not the conoescension of the great to the humble but the solicituoe of the elber brother for his brethren. Tao him the great obiect in life was to release the capacities of men, to help them learn how to help themselves. Ellis broab conception of the part that the Mniversity shoulb have in this work of spiritual libera- tion was Hrmly grounoeb in respect for pure scholarship ano his success in securing its fuller reali- zation is one of his titles to grateful remembrance. File hab a bemocrat's faith in the ability of the people of wisconsin to recognize the worth of university training. no opposition, no boubts or fears, coulb shake his confibence in their unfaltering anb full support of the Kniversity which sought to open to all a boor to richer anb nobler living. He was truly a bemocratic leaoer. Ztfe was simple in his tastes, belighting in the curling smoke of the campfire anb the small. still voices of the wilo woobs. Ftfe was accessible to everyone anb sought abvice from all who woulb offer it: he respecteb honest opponents anb workeb with them as harmoniously after a conflict as before: he enoureb even malicious personal criticism with serenity, Ftfis tolerance was inbeeb amazing anb it sprang, not from inbifference or oisbain, but from single- hearteb bevotion to the larger, benign purposes that he cherisheb for men, and from the concentration of his strength upon the effort to realize them. f'lJt was characteristic of the steaby ano consistent broaoening of his interests that he passeb from the stuoy of the forces which have knit the outer fabric of the earth to the investigation of some of the potent influences which make or mar the welfare of men. Ghe well-being of the people of wisconsin, of the people of the nation, engageb the probuctive energies of his mature manhoob. when the great war came ano threateneb the bestruction of western civilization he bent all the powers of his minb anb heart to the great problem of gaining the victory for liberty anb iustice ano then, in these later, stu- penbous weeks, to the greater problem of making that victory secure through the organization of a brotherhoob of free nations. 'fihe leaber who began his presibency with the noble ibeal of freeing human capacity throughout the commonwealth of wisconsin Httingly crowneb his brief bays in the fulness of his powers with well-wrought plans for ensuring to national ano to inbivibual capacity a free opportunity throughout a liberateb worlb. live reioice that he has bwelt among us anb that his spirit has moulbeb anb will continue to moulb the life of the Kniversity. 'Ghey may rest from their laboursg anb their works oo follow them.' Funeral Ceremonies, November 21, 1918 -m.,wm.u...wi.mm..m4..m.w mwmmmmunnumumumummn n u Page 49 sig D m....,..z,,..,...z,'.L'u41'wz:1':4r iz Eli E 2 Z its EE E52 E-5 its 5 5 5:5 EE EEE Eli sis sis E55 Y: E E.. s, QE .RE Our new 'filrexy Wisconsin After the War By President E. A. Binge isconsin after the war will have more students than ever. War has shown to the world the value of college training with unexampled force and clear- nessf The youth of Wisconsin will be no slower to catch on than are those elsewhere. Technical and professional courses of study will be crowded and new lines of technical instruction for both men and women will develop as a necessity of preparedness for peace. The moral training of war on the individual will have its effect on the university. There will be a new earnestness in college life and a new appreciation of responsi- bility to the state. The big tent Cto use President Wilsons termb will be the center of things. The side-shows will be numerous as they always have been in university life but they will be side-shows. University men in the west have dreaded the invasion of our universities by the eastern conception of college as a chance for four years of club life instead of an opportunity for vigorous intellectual work. We no longer dread this situation. Carry on will be the word in university life for faculty and students alike. A We may be sure of these results. Others no more important are more interesting because more doubtful. War concentrates attention not only on preparedness but also on preparedness for immediate and specific duties. There is a real danger that this limitation of purposes which is necessary in war may be carried over un- changed into peace where it is harmful. A university which limits its teaching to vocational instruction ceases to be a university and students who look only to preparation for the immediate duties of the future are not university students. The Morrill Act of 1862 in establishing the college of agriculture and mechanics made it the duty of the land grant colleges to teach the branches of learning related to agriculture and mechanic arts 5 thus keeping the institution as a seat of learning rather than making it into a vocational school. Here then lies one of the most important problems of a university like ours-to serve the immediate needs of the state and not to lose touch or let its students lose touch of those wider aspects of learning on which the intellectual life of the state depends and on which in the end rest its prosperity and happiness. n The Hill ii . .mix iiiimimmiimniiiiiiii ..i...i.ii.i.m.i i . 1i.iiin.iiii.i..niiiiimi.iiiiiniiiiinniinii.imim.ii..ii.i..ii mi mi mi.. i im ii i .. ii .ii i.-i...iimi.i..ii. .i..n....... mm ,,,,4,,,,,.,,,,,,,,, ,,,, ,mu miEmEiiianmmmHmm?mmmmmr -,....,-.-.- ......--...,.--....ii-...la Page 51 FBoard of 5Regen ts CHARLES H. VILAS , A. J. HORLICK .... Ojtcers HENRY JOHNSON, State Treasurer . H. J. THORKELSON . M. E. TVICCZAFFREY G. L. GILBERT . . A. H. LABISKY . EDWARD A. BIRGE . CHARLES P. CARY ..... GILBERT E. SHAMAN, State at Largs MRS. FLORENCE G. BUCKSTAFF A. j. HORLICK, First District . . WALTER -I. KOHLER, Second District . CHARLES H. VILAS, Third District . THEODORE M. HAMMOND, Fourth District JAMES F. TROTTMAN, Fifth District , MISS FRANCES G. PERKINS, Sixth District D. O, MAHONEY, Seventh District . . GRANVILLE D. JONES, Eighth District . ORLANDO E. CLARK, Ninth District . BEN F. FAAST, Tenth District . A. P. NELSON, Eleventh District Personnel . President . Vice-President Ex-Ojllcio Treasurer Business Manager . . . Secretary . . . . Bursar Purchasing Agent President of the University, Ex-Officio State Superintendent of Public Instruction, Ex-Officio . . . . . . . .Milwaukee . Oshkosh . Racine . Kohler . lvladison . XVauwatosa . Milwaukee . Fond du Lac . Viroqua Wausau Appleton Eau Claire . Grantsburg ' I I The Drive IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIiIiiIiilliiGiIFIIIIIII Page 52 I I I I I I I III II IIIIIIIIIIIIIIIrIIIIIIIIIIIIIIIIIIIII IIIIII II II IIIIIIIIIIIIIIIII II 2 IIIIII I I r I I I 4 E35 Eli IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII1ImIIIIIIIIIIIIImr S I I II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIE 5Board of Visitors Appoinled by the Regents GEORGE P, I'IAMBRECl-IT, Madison XVILLET M. SPOONER, Milwaukee .1 Ol-IN E, IX'lCClONNELL, La Crosse MRS. CIH,xR1.ES R. CARPENTER, Madison Appointed by the Al ISRAEL SHRIMSRI, Chicago RICHARD LLOYD JONES. Madison Appoinled by the G MRS. CHARLES M. MORRIS, Milwaukee E. B. BELDEN, Racine umni XVALTER A. ROCEIIS, Chicago MRS. HOXVAIID GREENE, Madison 0'U6I'l'10l' I.. J. STAIR, Brodhead W. A. TITUS, Fond du Lac D... 5- ,. ..... -....., wi is 1 i The Lake Shore 1ERiiE1iiiiiEKQKFEMI1niimuiiiuiimiiiiimiim Page 53 gmmnumm-mmmmmnmmmmmymwunuuw 25gmmuwmmmmmmmy11mmm.m.mm.m. EEE EEE E Q 2-1mmm..5!H.Em.E!En..1mm-lm. i-ummm-mmmmnmmnmmmlmlymiium I mmmnumwnvWn1Invu1wunnwminwin1InwnwuwwInInwmanwuwunInmvuwrummvuwmwuwuwInunwnwruinwmwuwuvwuwruwnnvwun1wWnmmnvwuwnuwuvmwuwanvuummnwuwmanwuwwnwuwnvvuunum1uwuwrnulunnvmwuwInwumymuuwuwInuvwnwuvunwunnnvuvwuwmunmvnuuuwuvnnwuvuvwmmminwuvmuuuInwuuuwwu1nwmrnwnwannuInnvwIninwuvunumummmwum mmmlmWmmm'm'm'mm'HH'mmmumm'm'H ' ,. um. 1.1 N. .m..,,- - .MH . N. , f.. 4 W V ,. .. .4 , H UW... . . W.-1 .N N . ... WL . .u,,..,....,K..,,..M...,.,.nn.,..,,,..,,......,.. . ..,,.. . ,n,,,,,,. n,,MINlI,.lI.4VIAv .,......,..., . ...,K..,..,K.. , ..,...,,...,.,....,,,,,..,u.,l.,,,,,,.. A .,,H.,..,...,...,,.,..,...,...,.,,,...,.n.. , ,,,,,,,m,MmuummnmummmllmmlkmMEmnmmm..,...,...,.,,,,,,,,,,,,,,,,,,4M,H,IMMMW.MWMW-'mmm H. 35 mlumumnIn1Inmmlwynumlmwnm.U1InN.1.mmm.HummHM.WumllnlymW1Wmmmunmm..mmwm.m.wmmm... nu mm u ' ,,,,,,,,,,,,,,,,A,,,,,,,mmmuWmlummmmlmm I I H ..... ,,....,H.,H.,,.............,..,.....,,...,..,..,,..,...,..,km...,.,...,,..H.,..,..,U.,H.,..,u........,..,..,...,..v..W,..,..,...K..m...,...m........k.,....,.,K.,.m,..w..........W...,.........u...........u.,..,,.u........mmr..ma:s::nnm1mn5m..1.T..1.1mammmmmr Page 54 QWMDIIIIIIIIHIHKXUFIWI!H1WIIHIIWWIHWHVI!WV1WWKWHNWIWUUHWIllWIWWllWllWWKWWHWHYWINNINHUHNHNWENU!NI4NHNH1NI1NI4NHNNA11PWNHWWIxMNilNTlNNINNVINInNllNNIUIIHHIIHINIWUEN E 5 ,,,.. 2 1 . ,v .- 5 ' .Sq-f - E , Mlm A NWIWHW11WWWlWblWVUVHWPlNwIUHWHWHWWiWWHWilU!NHNWHNIHHWN1WHWNIWWHWHWVHWilWUW1IWWYHIIWNINNI1H1HINNINNIHNH1llNNINNINNKUPHllNNllNUNNIINilNNINIllNllNNI1NI1NllHIWIHIHIUIHIIUIL E E inIllIIINIINIIHINIHVIHIINII4VHVII!I!HIGHNI!NIIN!I1VHVHNIi!I1HINIINIINIIHIWIliUUIIHIWllNVHH1NI1NIlNll!HHHNHNIllVIHI!HIWIIIPIIVIIHINIHIllPlNNIlNIINll!HHHHINIllNIIPIHIINIliPII!IIHINll!llHI1H1NII1IllIllNIINHNIllNII!IIHINIllHHIlHHIllHHllHIiHIWIINIl!HINIllIIIIllNIHIIHIUIINll!IIHI!HIWIHWIHIIHHIINNIlNIINillH1NKINIHUHIIHHNI!UHIlilllHIHIMIHIhIl4IHilllIF O 3 ii.,iw..,l.i..w..,......,...,.,,, 1,.. .,,.ll..ll.1l..lll.ll.llm,.l,.l.il.i,.,W,iiil..i...l..ii....ii........,..,..,.,,l,.i.. ,.,, ..Wi..im..ii..l,iimi.,..ml...wimili..i.i,.,..,......Wim.,...H.lii....i.m.i.i....,il,....., ..,.. ...l..l.....l.i...liWil..imi.wi...,.....,,..i....,.., l.Hi..ii.,i..lK..iiil..,l..ill.ll..ii.il...ii.lii.Hi.z.isiniam1an1as1isnaii.Uiii..i..i..i..l..,,..i.l,.i..li..l...li.il...iii...l...i.il.,,.....ii.,li.l..li..i....HK..H.,iii..,..i...i..........i..i...li..,.i..i...l,..,i.,.,,,, ii..li.ii.i,.iii...i..iiil.......,l..i.Hiilil...i....l.....,,...m...,.i,.,,.l Letters and Science After the War By Acting Dean G. C. Sellery T is not easy to forecast the evolution of a complex college like Letters and Science, and when the forecaster is a novice, and knows that he is, the results are not likely to be startling. The College will undoubtedly try to do its work better than before the war. The instructors are good teachersg they will bo better teaching, talking less and having more discussion with and from the students, and stressing careful work in the laboratories. The quasi- professional courses will be strengthened to meet the demand, created by sharper international com- petition and the need of repair- ing the war's destruction, for increased production of goods and of trained leaders in pro- duction and distribuiton. Equally vigorous, I am sure, will be the elim-t of the College more effectively to train young men and women to appreciate literature, philosophy, history and the other subjects which brighten life and make rest and leisure a joy and not a bore. There will soon l:e established, I hope, courses in painting and architecture, and these, to- gether with music and the his- tory and appreciation of archi- tectur:, painture, and sculp- ture, will make the hne arts a force in the higher life of the College. The instructors will teach better and the students will work better. The war has taught us what youth can do when they are in earnest: and the peace will not take away from the coming college generation of students that high, cheerful, carnestness, which makes work go. Finally, the faculty and the students will more than ever be com- rades-in-arms, working together to establish, as an essential element of our far-famed Wisconsin spirit, the tradition that Wisconsin loves workers and does not tolerate drones. DEAN G. C. SELLERY iniiiiiiiinniiniiiiinnniimviiiiiiniiiimiii i iiiiiinmmiinmimniiiiiiiiliiiiiiiiiiii .lli.lV.,l..,iilli.ll..ll..ll.ll.ii..,l..,li.ilitl.il.Hll..liiiK.,i..,niii.ii.il.lli..l..l,iiiiil..i...lifK..i..,llil..il.li..i..,ilil.ilill.l..ii...i.lll,iniil,W.Uilll,Hl,l.li..l.ii.Ww ll..l.l,.w,, W..W.m li W. ,. ii . ll. iiiiii..Vli.ii.li.ii.UlDlii.,miiiiiiiiiiif ..li..iiil..,liiiiiilini..iii.Wi,Hi..i,liinil.il...iliill..lK.,i..mil.iK......,..li.W..,,.,l.ii.iii..il.iii.il.i..ii.,.,,,l,.i.V.l,, m.i..,l...,..,..l ,..,,.l.l,.,,i,,....l..i.,,..i.....,...i...,.. l. .1 ii ll .,...i.. . . ,iw U .i Page 56 sn: qwwww3555355553my55555555My3555553535wg3155my35:M555,Hyyry.fm55mn.555Q553,5M1535553,U,T:mmW,E,535551WW51333W5.my.W,ff33.1'533:55K!!WXty5513mm553335,Em,M15,IIH5,mf!33NW,.w.W.., ,.,,,, 1,.,,m,.H..,..u.m.H.HL.X,.1U.W,.m..H.,,. ..,. yX.1,,H,.,,,.1,V,X,.,V..W,..L..XHWW.1,,.1X..1,.4Xy.,,.,,..,,.W.H.,,.., ,..,, ,,,.,,.f,V.,,..,....1.,X..XH,,.11V..,y.1,.,XK..XH,W,.HK..V..W,.1,..XW,HXH.X.H,y.1V..L..m,1.ww.m.m.3 QE E s 2 3 2 12 12 E li EE li E22 EE EE EE g g FMW...H.H.,U,,......,..W.W.....,......,W.,..4,,....,..M.,.H,..,.....,m.,..,.,..H.H..,,,.H,..,......,,.,.,,.,,..,......,..,..,..,.......,..,.,..,..,..,.,,.,,..,,..,.,..,,.,...,,.,..,..,,W..,......,.1...H.mt.,.W..1,,1:5um.,,...,.mw:,M,,Mmmm.:M!1,w,,t,Mm15,15my1,MmmmMT,,..U.,,.,...,..,..,,..,,.,,..,..,,.,,.....,,N..,.,.,..,..,H.,H,,.,,,H,,,w,,,w.3,3M.,:mums:wMw,..W,..,.,u..s I I H M' H 'WM' Mm'mmmwnmwm' mlmmmmwlW'-'U H I-W V W N HllllAIllHIIllNIINIIAIll1HNllNllnlNrnIllWHWllWIIAillLIINIHIllullllNllNIMIllNIINVINvuInLI!lllHMHuU1IIIulul1llul1KIAulnyNVIAluNllIllNIn1Ilul!IlnllwllulvllnlullrlH N N indiaEFI51REEQiiiiiiiifmilhii-iiillilini1I1Rnhi1ERduuiumihmmmuwmmummnmmmfmmmunmuNuumwmmmvumnmmnmmnwmnmmmnmnmnunmmnm lm I age 57 I nTRIGGERiii1iiRIEMFRIEQEREQEILIIIiiIiiiiiiBEIGEEiliiiMMUmmmdmimm.wnmm.mm.mm:,mmummm.mmmmmwmmmmunmm3 . . , .V V, V..VV..VVVV..VV.VV.VVV.V.VVV.VV.VV.VVV.V.VVV.,VV.VV.VV.VV..VV.VV.VVV.,V.VV..VVV.VV.,V..V..VV.VV.VV..VV.VV..V.VVV.,V..VV..V.VVV.VV..V..VV.VVV.VV.VV.,V..VVVV,V..V..VV.VV..VV.VV..V..V...VV.VV.VV.,V.VV.VV..VVVV..V.VV.VV..V.VVVVV..VV.VV..VVVV.,V..VVV..VV.VVVV.VVV,V..VV.VVV,V..V.VVVVVVV..VV.V.VV..V.VVV.VVV.V..VVVV.V..VVV.VVVVVVVVV..V..VVVV..VVVV.,VVVV.V..VV.VV..VVV.V...V.VVV ,. ,. ..,.. VVVVVVV ,VV V., V VVVVVVV.VVV.VV.VVVVVVVV.VV-VVVVVVVVV-VVV-VV-VV.,VV.VVV.VV.VVV,VVVV.VVVV.VV.VVVVVVVVVV.VV.VVVVVV.VVVV.VVVVVVVVV.VVVVVV.VVV.VVVVVVVVVVVV.VVVVVVVVVVVVVV.V..VV.V.VVVVVVVVVVVVVV.V.VVVVVVVVVV.V.VVVVVV.VVVVVVVVVV.VVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVV.VV.VVVVVVVVV.VV.VVVVVVVVVVVVVVV..V.VVV.VVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVVVVVV.V.VV.VVVV.VVVVVVVVVVVVVVVVVVVVVVVVV-VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV- as ...VmVV...V.VVVV,VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV.VVVVVVVVVVV.VVV..VVVVVVVVV.VVVV.VV.VVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVV.VV..VVVVVV.VV..V V VVVV..V. .VVV..VV..VV..VV..VVVVV.VVV VVV.V :RVMVVVVV-VVVVVVVVVVVVVVVV...VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV.VVVVVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVV V V V VVVV VVV V V .VVVVVVV VVV V 22 F,-...Q-MV!M-Wwwmm V VVVVVVVV .VVV .V VVVVVVVVV V V.. VVVVVV V V VVVVVVVVV .V V.VVVVVV..VVVVVV.VVVVV.VVVVVV.VVVVV.V.VVVV.VVV.VVVVVVVVVV.VVVVVVVVVVVVVVVVVVV.VVVV.VVVVVVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVV VVV V VVVVV VVV VV VVVVV V H I H I I ' 'H H 'H WWIH'-1H'1-wfvuu-1'-Hvwlw1-v-H'-1I mu V1 V- ' WVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV.VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVuVVV,VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVV - ' ' ' ' ' , .,,,, ,, ,, ,, ,4,,,,,,, I ,,-. .VVVVVVVVVVV VVVVVVVVVVVVVVVVVVV.VVVVVV,VV.VV.VVV.VVVVVVVVVVVVAVVVVVVVVVVVVVmmVVVVVVVV.,VVVVVVVVVVVVVVVVV.VVVV.wVmVmVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVL5 Vu V V V .V V. , . ..,. . .V ..V..,..,.,.,...,..,..,,.., ,,,........, . ,., ,..,. . ,..,,.,,,.. . .,,.. ,,.,.. . ..,.H.... .,..,..,,......, . ,,,,,. ....., .. .... ....... -,...... ..,.. ..-,-..,...........-..-.....-.......,......- VVVVVVVVVVVVV .VVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVV VV VVVVVVVVVV VV VVVVVVVVVVVVVV.VV.VVVVVVV.VVuVVuVuVVVVHVVV,VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVuVV.VVVVVVVVVVVVVVVV.VVVVVVVVmmVVVVVVVV:VVVVVuVVuVV.VV.VVuVuVuVVVVVVVVVVVVVVVVVVVVVVVVVVVVV Page 58 VV-VVVVVVVuVVVVVVHVVVVVmVuuVVVVnu.VVVVVVVVVVVVVVVVVVVVVVmlmmmmnuummummmVVVVVVVVVVVVVVVVVVVVVVVVV-VVVVVVVVVVVWVVVV :K :Sa 1 111 11 1 11111111 1 111 1 11 1 11111111 1111 1 111 1111111111.1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111my 1 111 1 1 11 U: ii: i 'n ' ' ' U 'W'ff'fffffwfYfffffff fifYfffflfffffffffffwfffiff'f'fTTT''U''TffffffwfDfffT'fTf1 'lfff'ffUf ffff.'f'1 ,fff' Il'I.f,..I' 'ff' 'ff'lf.'f.ff.lff1fflff.ff f. 1,'.fI.,'f..fff'1fff'1 .ff '.,. ..,.... ....,.....-..... ,.... .... . 1. . 1 1 . . . 1 . 1 EFi:auux1uulmn11mmn11n1unm111111111111111111111u1n11111nm11mmrwnum111111111-n111um:1111 1n11- 111111-11-111111111 -11n 11nnnrv11111uv1ru11A11rv11111I111111ex1111-111111I11111n1u1v11111:1u1111n1111111111111111111111w1111n1m111111111111111111111111111111111111u111111111v111111111111111111111111111111111111111111111111111m111111111111111111111111111111111111111111111111111111uw1111rn111111-111111111u1n1n11n111411111111u11111ru1111u11N1u11u1rl1111111111111111u11111n11nm11n1u1m1nm11:1111I1mn11numuu11vvu mug EEE EE E55 FE Ez E 212 :ii ' ' - 111 Sis Ei? Zell? 533 2.5 335 ' 57.0 552 LETTER no 5, x 'icuam-me 1 .-1.- - '.111 if iff- P1-Sf. C.D.L,oo ' Rorneuice L-aa-xguun. es EE? K 515 iv W1 iii ,' ,f Shaw 1 1.11.1.111...1..1.1..11.1 ..11. 1.111.111.1111 ..1.. 1 ..1..1..11.11..11,11.11,1,.1..,... 1 11111 11.1 ...11.1..1... 1 .11.11111.111111.11.1 111.11111111111111 ....11.......1.11...1.. 1 .111 ....1.. 1... .11 ...1..11......11..... .11.11...11.111 11...1.1 1.11.11 ..1. 1 1.11. ....11.............1. 31111111111111111111115111E111111E11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 Page 59 1111.1111111111111111.111111111111111111111111111111111111.1111111:5.2111111112211111111125113111111my11M1g1w11.11111111111111111111a g 11 1 11111115 1111111111111111111.1111111111111111111111111111111111111111111111111.111.11111111111111w511111 -.WM lKv.'v-..- W 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111 ..... .............................................u....1g .. ... ........................................................................................... ........................4................................................................................................................................................. ................................................................................................................................................................................................................EIE.E..........:s5 ............................................................................ ' ,. '..i'.i1.Pi1.ii'ii'I'. .... ................ ...... .. .. .. ............................................................................................... .,...................mn:mnmmmnq:za:zzz::z:.:::anmx1zzxzzs:::::::::nzzan:::ua:za::snxaxnmamzzzznzzaxmasm::::::a::zz:zz...,......................,.... . 'V LQTTGR N :leave ,1,, Rau I ' The Upper CamP..s 'VK .SH Q2 'Of ,D Ed QCA? 53: . :QA EE E35 232 235 --------.----H----------.-lL..!.l..!!..L,...!..,,,..u,ff,Q1LM313225315221ggggjgggggggggyggggyggwgglgmggg55.533333.5525553535.gm...........................................................................................................................................um........................................................................................................................................ 2 is . . ... .......................................................................................................................................................I.............................E.I......................................E..........................................n............................................... 3 i...1.......................................... .. . ........1.............................................................................................................................................................................. ......... ......... ... Page 60 -...nmnwnunmInmumInumnmmmmmmmmlu.-un ,W , .,. ...,.. . ,.,. , , .... ,, .,..,,.. .. . . . , EM ,-.A'- MN --lh -x-.--..--!--!.-, gwggjfgmt hbab X5--5M',55,331,5f55M-I53-3-5L3333,HW35555555w,5M5-353, v4--v- ,mlmjl Vlrv 5,5,3H-twgm5,5ww,y.5X1.1N53355355554-gn,-5133,I-,!.,55H.H..W.,,H,.w.1..H.wm.1u.m..m...,mfW.,,wW.,,,.,,.,,..XH.,..W,.,..W..vfm.,W,,H,..w.,m..wmm.m.w.mww.WW.ww.mm..,..1,.W.Wm.-w..,,,mmm,.m.w.,,mf.H.m.w..Wfm..wm.m.mm.m..w..W 5 .. ,,,,. ,. ,.,.,. ,.,,..,,.,,..,,,, , ,,,,,,,,.,,.,.,,,.,,,L.,,,,,.,,,,,,,4,..,,,,,,.,,.,,,.,,..,,,,,.,,.,,,,,,,..,..,,..,. 1 , ,... , ,,..,,., , ,.,,..,.,,,.,.. 1 .,..,...,.,,,,.,,,,..,,,.,,.,,,.,,,,..,,.. , ..,.., H.. ,l,, ,..,,..,...,,..W.,,..,..,.H,.1,W..i..w.m.U.m.4,..W..mg25 E iss E EF si ESE Ei 525 Ei? - , EEE Egg ,. .f Ei? . EP? 355 4 2 . Room E15 E 5 amwm1yuWm1InIn'mmInm1IninInm1-mmmmwmvm mmminunHfminmmmmmun.Imf.mmInfnInmInulmrnmmummmmInmmmVHwHfuwuwnvmmmumm..W1.Ifum1Inuvinin-.I11.1.I1.HH-H.NInmmmInmmmmummmmminrnmymuvmmnmmmlmw H 1. Wm H. Wm. H I. I .H mf I1nmWmmV..wIn.HV..N.rm.Hm1H.InWK..WK.1InmnuH.V..vmInmm1I.1mmin1H1WInNI.,mInyHNHUH1flmf.I1InIn1I.1.HW.HN...HH.wmmvuInXyummulwmmmlfEE 5.1ummWmwInummmInummmmmmmnlnnmmmwuwnwnlnuunurumlmInInvmimhmulhirilwiwhiiilnhIiiQiiiiihiuiwminfimiiiiIvi1iuEiiiEii1viiihhiiii?EhFluEihiiiiiiiiiiiniiunlnviiminuxhm1wivmlmulululummmmmmmmnmmummmmwmmwnwvumvuumInrmwInvummvu1mmmmummmnw I 1 vu Page 61 ,,....-.. ..... . ..... ,.,......,:: .mwmmm n uv nmmmumumnu11.11uwmmmwnwvuinwmInInInnlvuwmmyvuu1inulwmuwru1uwmmnlummmmrmmnmnnruwn1Inmmmmmmnmnmms Commerce After the War By W. A. Stoll, Director Course in Commerce URING the war, on account of a shortage both of students and of faculty, some of the courses in the Commerce program as well as plans for the future were suspended. At the earliest possible moment we expect to revive these courses and to proceed with the development of our pla1'1S. We l'1aVC already made progress in this di- rection. just before Christmas a new group was organized in the interests particular- ly of young women who wish to prepare themselves for secretarial positions. lt is available for juniors and seniors in the Com- merce Course and includes courses in Factory and Office Administration, Buying and Credits, Mar- keting Methods, Retail Advertising, Advanced Commercial Correspond- ence, Corporation Finance, Investments, S t a t i stics and Publicity and Print- ing. Still more recently spe- N cial attention has been called to our Real. Estate PROP- W- A- SCOTT group in the hope that this important business may attract well trained young men and women who will ap- preciate its public responsibilities. ln the new epoch we are just entering, American business men and women will play an important role and the Course in Commerce expects to aid them in every possible manner in preparation for their new responsibilities. lts organization is sufficiently elastic to permit such modifica- tions and adjustments as the new conditions may require. :gm ---1- U Hi -1 I 1 -iiimmmimiuuvnii :nu u u v -I : i 'Hi v v 1 i nu innImmuiinmimiumium ri , U .ii Page 62 . is 55 .2 .. 5: 3 . NM....,....H..WH.mum,,.,m,m,..m.n.,,,.4 ...,, Hm..m.u..,.,.,.,.,.,. .,1,.,,.,. M ...,..,, . ,,.,,,.....,.,,,.,, . ,,,, , ..,,.. , .,., , ,K.,,. H .,,..,,.,,.,,K.,,.,,.......,,,..,u,,.,,,, , ..,,,,,., M, ,,,, ,.H..,, .,.., ,,m.W.,..,,..,,.4, .,,. ,,..4,..W.,,,.,,W,.W 5 .-.................M.H,..,.,..,...,,.,,,.N..,,,,,,...,,..,.. .. ., . ' 'HH'WH'HWY'14'H'WYH11'I I11I'1'I11I1vIW1vIH+IHIwv1 inW...,k.m......,.m,.W.,...,..,...,.,,..m.,,..,...W,.,.,,..,,..,..,,.,,.....,..,..,...,,.,,,,,..,..,,..,..,,.,,.,,..,..,..,,.,,..,..,..,...,..,.,,,.1,,.,,.,,..,..,..,,.,,..,,.,,,.,..,..,,,.n.4:::L.::::11:::::z:::1Q:1zz,1:1:zz1:a15:11:azz1zz:1c::::1::::z1zx::::::q::,pn:zzzzz:zz:nasz:::::'z::x::1:zzran::sr : ' 'MWIH5WllmwwW'ffmfWifif'fmffmffffffWfffffffffiffffifffffffffffflffffwffffffffT!!!!1ff!11!'1f'i f '' ' '' ' ' U 1S 1 E ig: vii nn mu mm I . 4,1 gg .- 515 '. , :JH f W 3 Y 2 QE EE si 15 E ,Z EE EE Q 5 , , 5 i, 2 5- . I , 5 N ldm 3 w . V, ' - ggQ53355555ggggQ5gltgggglgggggwgfw331555135251.WL...HWHW.H.NK...HK..mw-.1.M-1U...H...mmnu.M.H.HL.,W..U.XV..mmH.Xm.U,NInH.V..mmmlmum.,.HXI.wInI.nn.HmH.K..Nf1H4mmMX.HH.myV.Wfnin,HlmInininmurm.HL..X1.Hn.HH.W..X..WinX..X..1H,X.,X....HminXK..num.mm.HInH,rm.HmWW.HH,wIn.HnuInW,WW..imX..mlmy1.1fm.mu1A1XL..mm.,..lmw..m...mnm.,.HWXWWmmy.IXmXmm,mmmymnu,mmmW.mm.mWmm..e55 x ,..., ..n,.. . ..,,.....,.... .. .,.,............... ..., ..,,.,....,...,,.,... , ..,. . . ,,. ,..,..........,...,.,,..,. . ,,,. ., .,,.,... .. ..,.,,,..,,,...,..N..,..,..,,......... .,..,...,. . .,.-.H,., ..,..,,, .....,.,,..n..,.. , ...,. . .. .... . ,... H... . .,. ,,,.,....... ,....,u..N..,,,, .,......,..,...,.,.,. A ...,..,....... . ..... . ..., .,,..,,,, n......... M .,,...,.,..... . ..,.,..... , , ..... ..,..,....,.,,..,.,,. M.,,,..,..,...,.-.....,...,.,-. 3 ilKIIIIKIIIAIIIIllllll!IIIWIIIKIIllllIllIIIKIIIllKIIUIINIllIA!IIIKIIIIIAIIIIII!IIIHIVIIillIIIHIVIIIII4IIILIMIIYI!IllillkllHIUIHI1rllllllInVllIllH1illUIKllllllllmlllllIllIllIllIllIllIIIIIIHIVUIIIUII1II!IIIIIIIlllllrllUI!lllKIIVIIWIIAH1IIIIIIWIIAKIHHWVIIIlllllillHILIIIIllKIIVIIYKIYKIIVIIKKI4H!IIINIllIHLlllllvllluiIIINllNH1IllNllllmvlNIllIllVIIIII!lllVIHIlullHIIIIIHIVIINlllllllllvlllxlnlllmVIINIllIll:InIlliluHIVIIAvllNIMIllInNII!VHKIVAIHH1MHlllllllIII!IHIllHHVIINVI!vllHHI!!HI!IIAH1VIIIIllVIIANIIVllllllllllxlllllluuvluulmmlmummwln: Page 63 E , -.m,,m.,.m.m,mnmWmmmmumIn:wwwr-wwvwvww1rurw1vHwv'1H'1'IH'H1'I11'I1'H H H'H' ''WW' ' H' ' '' ' '' '' H' ' '' ' '' '' '' ''E''III'!I !IfllfffflllF!!Tflflflflf5531FII''I''ffT!!''WllffllY!!IlflfflFEI!!!Y!!'E!!'53E!!'FifiI!UH'IllE!ff!!'fflF!!IEE!!ElfIE!EffflfliffE!!I!!f5!ffElIllElfIEHEff!!!F!!IF!!flfllffflf1251EffElfIlfllffXIII!!!ll!E!ll!!ElfIlil'51I!!Ifl!iffIllTfflYflflllPIIflfIEffE!!1551I!!llllllfE!!fillElffl!U!!Effffl!f!!If!ll!!U!!fl!!Eff!!!!!!f5!1!fflIUflflfflI!!ll!!UHI!!UlfEY!U!!l!!fF!!l!!U!! 2 g5,..m,....... ..... ,.....,.,..,.. ,.... ,M ...K.,,.., ,W .,L. , ,.., ,. .,,..,,.,,,..,..,,,..,,., ,..W ....,...,..,,,.,...,...,..,,. , EES E22 EEE 2 EEE Ei? maize:zesuzrfgzzgn2513112535gmgggqggggglgggg115115551M3555gggiggggggfggmf53:5wg3gmmg31,5555,1551,5155355My1,5w,,,5,,1,55M,3,mfan,Em2.55233:Egn..,.mm1.1W..,,.,,.,,..,..,YW.H.......,,.N,..,..,...U,.H.,..,...,..,,..,..,.H,..,...,..,..,,.....,.....,,..4nw.,,..,..,,..,..,..,,W..,,..,.,,..,,.....,,.,...1..,,.,...,...,.....,mmM.,,..........u.,..,,.....,....,.H.,,m..,..,..,..,u.,.....n...........,,.....K...,...,.,......,......m....,..,...K...,...,m.....5gg llluVIII1InumHHnnullNiluWIllNLII!KIHNIllVII!WIllullNIIIWWWIllWHINIllNPII1VIHHINHMHI4IIINH11ulVIIHIHIIIHIHIIHII11IllrlVN:IMulul1VHNHANIAHI1HAVIINNII1H1LIN1ll1IIIHINrl!Nll1VIHIINillNInHI1HI4HArll1VII1VIAVH1IIANIINIIMIIHIIHIMIIHIN I 4-wma W-mm MW WWI! nmiwin -mNWN-'HMM'-gmuwlm I I mum1wIninwn1ulwuwnmuwnninwfumfmnlummwmmlmmfl1fnnumrmmmwInnuInmXHXInmlmIninwInmuuInvmInumm-mmnmmm Page 64 mmmmmm1mmvmInuvmmunnmlwmmw-mmmmlnmmnmwlnzmummflmmlwnmwmmf QUIIIWIIIIJIIIIHHHHlllNIINPIHIUIllWIlWIITIHUIHUPIIHINIHllUlllllNKIM!!ll!Il4NllHIHHIll!llUINH1HIMHI1HINll!VIHIMINll!NII!VIHI1NINNIlllllU1NllHHVIINIHIIHIDIINIllNIWl1lIiH1NIllNIHIlHINlilVIWLIIUINWNIHllWNVIWIlWNI1WIHIIIVIHHHHNIHH1HHHHHH11NIHVIIVIHIIHIIIllNNHWIHHWNllWNI1VIINllNNI1NNINIHVIWIWMINillNIllill!llUI!WillHHVIIIIIHIINIIWIHIIE .2 A - E E E E 1 . ' ,.. - E E 55.3 '.'1, ' - Hi' f -X ' E E E E E E E E 3NIllVHUINIINIllIHIlllllNIllIIHIHIINIllIIIUIIHHIUHKHIIHIllII!lllVIIWIHVIHIIHHIIIIIIHIHINIHVIIWIllIHillIIINIINIIIVIINIIUHIIIlllNIllIHIIUIINIlNIHVIIVIINIHVIUIIHHIllIIIUIWIHFlllllNIINIIIIIINIINll!HHIINIHNIlNllNIllIllNIINIINll!IIINllNIIIWIINIllHIUHIllWIINIllillNllNIlNIHillHINll!HINIHUIWIllIIIUINllNIIINIllIllIllNIlNllNNIllII1IIUIINVIINH4ll!VIINIIHIIVIIHIHIUIIHIUE griculiure iiiiniiiiiiiiminiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiniiiiiiiininiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiniiiiiiiiniiiiiiiiniiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiniuiiniiiiiiiiiimiiiiiiiiiiiiiimiiiiiiiit iiiniiniiiiiniiiiiiiiiiiiiiiiniiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiimiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiininiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiniiiiiniiiniiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiy 5 5 ess ssh 7- 1 r Agriculture and the War By Dean H. L, Russell cc ERVICEH was the watchword of the NVisconsin College of Agriculture in tl e war. The entire facilities of the college were placed at the disposal ofthe State and federal authorities. From the'Colleg: Halls 553 students and 18 memlters of the faculty joined the colors. Three of our boys won the Croix de Cuerre. Twenty-two men made the supreme sa- crifice. The memory of their heroic deeds will be a flaming torch. bequeathed to us to cherish so that the sacred fires of patriotism kindled by them shall never die down, but burn with undimished brightness as the years increase. The Agricultural Extension Service of the College in cooperation with the Federal Covernment, and the State Council of Defense, carried on vigorous campaigns for the production and conser- vation of food. Members of the Department of Home i Economics cooperated with the Federal Food Director and the . State Council of Defense in j arousing the women of the state Q ' to the needs of the hour. Faculty members released from i teaching voluntarily took the Field as county agents, demon- stration and emergency food agents. Farmers were assisted in securing labor. The director of the United States Boys' Working Reserve was aided by the county agents and members of the faculty in a campaign for lnoy labor on the farms. Stua dents of the college, too young tojoin the army, were found in the furrows and fields doing their part to help win the war. Special campaigns were car- ried on under the direction of the college for increasing the acreage of fall and winter wheat, the production of milk, and the saving of dairy calves. Farmers were urged to increase A 4 their acreage ofsugar beets. and thus aid in overcoming the sugar shortage. Boys' and girls' clubs were organized, war garden associations were aided, and county campaigns waged for the formation of sheep and pig clubs. The record made by the Wisconsin farmer in livestock and crop pro- duction during the war is an enviable one. The college is proud to have aided him in his work, and glories in his success. XVhen the his- tory of Wisconsin's part in the war is written, it will be found that the college and the farmers of the state met whole-heartedly and loyally every demand made upon them by the exigencies of the war. i i DEAN I-I. L. RUSSELL :yngiwiiiimiiiywiiyiiMiiniiiiinqwimgminminiiminimuiiiiinumiiviiiiiiiiiiminiiiiiiiimininnuminimiiiniiniiiiminiiniiinuninminiiniminniiiiiiiiiiimiiiiiimniminiiiiiimiiniiiimiimiiniimmnwniimmiiiuimiiiiniiiiiiiiiiiiiiwiuiiiiu imiiiiiiiniiiiiiiiiiiiiiuiiiiuim, 7 - ---- - ----4 -4--------------M ----......---...................-.--.,...,..--,.-,...,-......... iiiiiiiiiiiiiiiiiiminiiiiiiiiiiiiiniuiiiiiiniiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiniiiimiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiimiiiimmiiiiiiinniiiiiiiuuiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiminiiiiiiiiiiiiiiiiiiiiiiiiiiimiiiii iiiiiiiiiiiiiimiiiiiiiiiiiiiimiiiiiiiiiwiiiiiiiiiiiiiniiiiiiuiiiiminiminiuiiiiiiiuiiiiimiuiiiiiiiuiii iwimiumniimiin. Page 66 mmunwumumm1vmnwwmwnlml1fl1wmmwuuuwm1-ml1-1+wnf1InIn1H1m1U1wInuwnv1--1n11Hu-1nlmluf1Inm1mm1H1Huul1-Iu,I1w-1u.1uufulnlmmmwlwwmHmmm 1nmmmm.Hnwmnmnu I 3 MAIIAIAn,..,,,-..M.l,4..,,.,u 1 .--A-. M ,UIHMIAA ulullullullu ullxnul H H A .y , Mw...W .,,. Wm... 4,.,, H ,,,.,,..,.,..., ,,.,Y,.1,.,,i. , ,.., X .,,.,,..,,.,,. .,,.,,.n..,,., W ,.,,. U.. ,,.. W ,.Y.., ,. ,Y.., ,,,,.,,...w..U.,,,., ,,,.,. W ,,,,,..,..,,. , ..,,.. ,,.,,..,,..,,.,,., ,,., ,mm ,.., ,..,..,,.,,, .Y..,,.. mm ..,.,,...,.., H.,,HU.W,,HY..WW..,...,.MWWH,,M.m..4,..w.,,..,,.,,..,,.,...,,. ' is ali U si? w 2- . ,,.,, , 1 : ,,'f1 5 535 2 2 Z , df sg E , is I ,lr -- .n, ii . , ,- -' , Nu. ...Lf:,M..u:Lsw .5 -f , .W ik V 'AGRICULTURE 1 AW, : Q A pl 0 -JR -. As-sis+a.Nr Dmaxx ,,, 9' 1 l ,: eva? AETXC EE -,, 23 5,5 S35 Sai S23 325 '32 as gg: 55 E ' Z2 E 5 5 ' 2 2 2 52smn-m.m1W....u.,.4awww..,..w..w.14.WM.ww.mw-.wumwmmn..m.mm.qmwwmwMy.H...WWyn.W.nm.m..m1m.m.w..,..m.n1N.HV..Wnumm-....MH1.NmXmmmWnuI.,MH..mmmnu.W--mmm-.wmv.-4.Umm..u..WH.H.unww..I..W4..-.mWU....Mmm.,,.m.mm.w...w..m.,.m,u.....u..mmmmlmmxmvmlmmmwmwmummwmmm55 Sum-umnmmmmrmuummmmnnuuummmnummllmnlwvmnnmlmwnilmm,mmmmm.mummmmmmmuumm-nmmmnlan-.mmummlufunu,mm.HH.nmW-Inmlfmfm.mm....1.n...m..m.m..M.1...mmm..mummmmmnmummn-m.m.mmmmyuWummmummmmln-ww-.wmm...mmmmmmmmmnmummmmU.:ummm-mmmmmmlmlmmlmfmmln-lmmlwlmmnwmi Page 67 'A' :untill nmuuw E WU' 2 vunuff 5 Prof AS AXexe.ndcr Vaierinmy Scwrxce nnumm..mnW.un.ml.,,..m.,.,.,...w., l,., W.....,,H.,K.,WW.,H.,N.f..,...,,.m.,,..H.m..,..m ,,K. ,,H.,H,...1H.W,,.,K..,WK..,K.,U.,,.,.,.,,......H..,.., l..,..,,. .W..WInW..,W,..Wm..m..,..,,...,.,,.. w.., H.YH,ww.nmW..H.,,..H.,,..,..,,.m.,...,.., ..,,., 1..,..,,L.,.HY..,,.,WW,.,,.HH,,H,..,H,,H,.Hmy..WH,H,W..,,mm...WY..YH,.Hm,mV..Km1.WW.Hmy..Y.HH.fuY.U1.1.N..NvmHW..N..NN.1,....HmN.H..,..,,..1..,WH.,H.mm.unm...mlWm..Nnm.,.m.mm.mm..1..,'..u.u..,,.m iz 1 ii 5 si gf ge 51 5a...,...,....,...........,,..,.,..,...,....u....,..,...W.m,..,K...,..,,..,,...,m,...,,..,...,,..,K.., 5 ..... ...... . ..,,,,.,,,,,,,,,,.,,,,,,, M ,,,.,,,,,,N4,A-.. llrhll u -llllnxl A rhrll ....,,...,.....,.,,,...,....,.,,...,,... , .....,..,,,.,,.,,..,....,..,,.,.,.....,.. , ,,,,......,,..,..,... , ..,,.n..,,..,...,..,...,...,..,...,..,,..,..,...,,.,,.,...... . ..., .......... E ,,,,n,,,,,,,,, , .. ..,.......,..,.,, , ,.4,,, , ,,,,,,,,,.,4,,44,,,,,,,,,,,,4,, W ,,,,,,,,.,u,,4,, I ,,A,, H ,,.,..n.-,n,.- 1 llnllhv WW -lln I ..--s M , ..,..,,..,..,. . ,..,.. ,,..,..,...,...,.,,.,..., ....,.,,. . ,..,,.,.., . . u..,,.. ,..,...,..,..,.. . ,,., ,. ,,.....,. H . ., ,,.,..l...,..,..,,. .,..,.,..,, U ,..,,....,.., ... .,.,..,..,,.,..,,.,..,,.,,,... ....,.. .. . ..,,. n.n. ,. ,.,.. .. ., . .K.,....,.,..m..N.NK..,,...,...,...u...mm.,N,.mm...W.MH.WH.,,W.,.W..W.H.,un...HW......,,.m.,....,.....4H.,,...,.....,,..,..m.u..,... U -- ---- .... --,..-:L.-.,...' WL... .M.L....' W ,.P. . ..- ... H,,.,,..,...,.UIn,...Km..,H.,K.,H.,K..nn,...l.m..m.HV.,..,,.H..,...4..,..HH.,..,um.,Km.H...1..W..,1V,H.H.....11.1YH....,..,.H,HW.,WmM.....,L.,.m..,....HU.H.Uu.......1,H...H..K.,um.,....m...i.....,..NH.,..,1.,H.....m......,.HK.....W...lN.,,.m....m.,..,..,I.,..,...,....,.,..,..m.,.,..,.,...,..,..1...m.......,.,....,m.m.....,V P a g e 6 8 51 me 2 E E E 3 Z 2IHIllH1VIIPIIWIIWII4IHIHVIIWIlWIIWIHIIWIllHIHIHIWIHKIHIHIITIHIllIINI1UIWIIWIIHI!IllVIIWIHII4IllVIIWIHIllIllIHHIHIIIINIIIVIHIHIllIllillWIIWIHUHIHIliillll!VIIWKIWIllIliHllilllllllllIllillIllHIVIHIHIINIHVIINIINIllIllPIUIllIIIUINIllVIIUIHIMII!IllIllVIINIINIIIIIINIllNIINIHII1PIINIIHIHIINIllVIINIINIllNIINKHillNIlllllNIHIIHIINIHIllNIINIllVIHIllIllNIINIHIIVIIVIHIIII? Igngineerinc !IIIFlII.lI!llIlllHI'llIllIIIlIUIHI4WIllHHHIIHIIHU1HNHUI!ll!III!HNH1lk!NIHlilillHIHIWHHIHIINVHHHHbilHIUHll!NHNHNVHNllNEHNINIHWllNllNllNH1ll!NKHNHN'llIUNl!NHUIWNIlWVNllWIINUIIHNVIIVIINIllH1HIHHHiNIIHMIIINllHINLIIHHH4VII!LINHI!lilNIUI1NIHIlNH1NIUII1NI1NIHWHHVI!VIINLllU1NVIIHI4H1UHVHHUIINUI!IIWWll!FINVIIIVIIWVIINI1HHNIHIIIIIHIIUIIHIIW' E A , .rzmxi 2 5 E 5 E 5 E 2 2 ui .ii ii niiiiinumiimiiminiwi mn im ii ii imimimiiiiiiiiimmimimiim1limimwmiim-iimniiuiimi iniinimmininmimimiinniiniiiiimmimiiimummiiimmiiuiinlumlmininmimlm,iiiiummiuiiiiumummuiminimumumnmu-uiimuinwwiniimimuinuimuiwnimuiuuug , mnzamaazai,..,,..,..,,..,,.,,.., .. .il mama. i..i.Hini..i.H,.,i..H.,..,imamiaamzazasiammi-..,i ii..K..H.,ml,mmi..i..i.l..,...,.,,animrf.,..aaa5amamnemmm:.na.n....,..n..m.i....,l.a.,m..........,..i.rg2g sz- 31: 512 zi: si: .E if EE . .. ' :E Engzneerzng After the War if By Dean F. E. Turneaure :lg HE great warjust ended has obliged all fighting nations to utilize to the utmost their material resources, their transpor- tation facilities, and inni merable products of invention and 55 researchg and for the successful utilization of these resources the physicist, the chemist. and the engineer have been in great demand. ji Young engineers who have been trained in the schools of this country EE have most emphatically made good, and the training of such men both I' preceding and during the war i constitutes the chief contribu- tion of the engineering colleges of this country to the winning ofthewar. Theyounggraduates ' of these schools have shown 1 great capacity for special and l intensive military training, and E the broad, fundamental courses - which have been taught have been found to be satisfactory. , These same general courses, ' I condensed about one-third. were continued. on request of the war department, during the X operation of the S. A, T. C. Besides carrying on the regu- lar college work, the Engineer- ing college has had a large part H in the vocational training of 555 about two thousand mechanics m during the past year in fifteen different short courses. lX4any members of the faculty have as DEAN F' E' TURNEAURE contributed directly to war work by research and special investigation, and the College has furnished a strong quota of engi- 7,5 neers from its faculty for technical branches of the army. Problems of peace and reconstruction will call for an increasing number of engineers, and this university will doubtless do its full share in the 3 training of these men along very much the same lines as have proven successful in the past. ,- -'E LM,W..,W,H,i!..,..,i.,,.....,l..,,ii.i,.l.,,..,..,l.. ,.i..i.l...i., W., ill, i..i.,i.l i,.,,.,,...,i.... ..,il......,,iH.,..,,..,.ii.i,Hii..,.,...,..,...,.i...il,i..,l.i,.i.W.i.,,,.....,,,..i...i..i.H.,.,,.,..u.l..,..m.l..l.l.W,l.w,..,.iiQ 1iniim......m.n-.iiiii-ii.iiwn..mmii.im in iiw.m.ii.miimmiwiimmiiimii.iiw.iinuii.1ilii,.ii.w.wii.mm.in inVmm,wwii.1iiiiiimmw.mli.ii.,minimm1liinlmiii.....i...,m..i,.i.4iim.m,m,mi...mmm.-..i.iimni...mmmi.iim.i.nm.m.i.Wmm...m m'i.nmm ii Page 70 awww.,.n..wm..fW.mnmlmHvm1.mm..m..1my15.mlH....gf95mmm555MM15559mmmymlmmfM5MW!3wwufwwwMM,,mmgH.95.u..u.H.U..n....,m.i...u.v.,,...m...w.mmw..Nw..VW.W.,mm.,,.w.m.w,mmfmw..m.1fm.Ummmmmv.mm.m.vmumm.mmwmm..mnymmmmmumnmmmmmmnmmmmmmmmmnmm 'i,..A..,.,,...,,mimimnmm..,,..M..,,u.,...n. '.....,.,.K.f..,,,....m..m.....,..,..,....,.,.......,.,.W.,,...,.,,.,,.,...,,.,,.....,,,,,,,,.,,..,..m....,,,.U.,.....,.u.,..,..m.,,,...,,.,..,U.,..,,,.,,.,,..,,.,,.m......,,,.,,.,,......,..,..,.,.,.,,,..,..,,.,,,,,.n,.,,..,.,,,..,ms:sis:mx:zzmmm1:max:msLamaLzsmnzazaaszsszn51:5n:mmspzznnwxssnaazaznaxnaxs::r..7.4:..T4.T.. ',u.....u.,..,a.,...,, ..,.,,........m. ' ....,..,., .mg e sig , I E15 EE ESE E :ge E Egg EEE E E :E 5 IE 555 E . E-E :E EEE S Eli 5 E EXE EEE Eli ESE :ga 525 E55 EE :va :XE 5:5 if E , :QE 25: E55 gg? E55 E E15 :SE - . Ei? I 525 : s I fri 45 Eng SEE E - Ei? EEE EEE EEE E25 as - 2 2 E32 !'-V - v -V EE E' I . . N- 1 - J- ' El: Egg ' ' - , 4 ' , , :fi 1 J - -- , ' E55 -f NGXNESRING ' ' 1- Egg 17,5 ' r .:, ' . - X -' J:,.., E 2 sis Y' J ' ' I ,. ' ' ' . V4 - N - 6 - EE Ei. ,, . . . , -- gn - I7 mn I, 5, SI N zv Q - g.-Q1 P iz: gg 1 , , ., Eze 515 'I 2 ' 5 Ei? as EEE . Ei? iii E22 sig 1, 53? N V xi- Q fb -iv? 5 Ei? EE EEE E52 2-D E25 555 -- ... M-- E25121252Ef!Tl1Il11 1lIi 'll ' N ' ' ' ' ' ' '' ' ' ' ' ' I f ilIf1l!il!2TlIl21lf1fIfllffI1lfflffflllflffffll!iffIIfKill!!1lI'Clf1U1fffEfIl5fff!1If155llffflffff!!!Ylfllflfllfll!UEllflflfllf551151112KSU!!flffffUillffllfllfTIEEUTTHZEYIIIIUIIQUElfTTEH,'Z.'2TffMI. L'TT.'lf. ffL'L '4! SmvunmmnmmuunmummmnmuuummnmmmmvumwundnmmunmmEimuwiiEIFuun?i1nmdluwniiviwummmvmmnummmuunummwmmuwuwuwul:mmnvummmmumnmmmmwu1numwuwnumummuuwmnmummmmumwnummnmmunnmuunumummmummuunummmummuummummnmm:mnmmmuummununu-mmumuulmummmmmlunumuwuumuml Page 71 WmW.1Wm,Hmu.,..mm.mlfm.Hlm.MX..Wmmu.,..,...Yy.W..U..W.muH.,K.,N.HK.,K..N.HN.,.Hmm,nu.HH..mm,,m..,...1.mm.m.m..w.,..w muwumI-1InwwwwImwwwI-HwwH1fuH-I1H1I-H'H1'HH'Y'HHHH1 1H'1H'H'1'H' YH' HH'f ' 1H'W HH'' 'H' flE!!:lf2:2521r:!l!!:1:!l:!f5!!:!!l!!:5lu!!!!15!!!!!1:m!z:!u!l:!!!!!!H!!1fr!!!1!:l!!w!lE:1!!f!!!!1!!!.......,..,.....,...,,.,......,...,....u..W...,,..,....,,m...,...,..,..M...,..,..u....,..,,.....,...............W...,u...,......,.,..,......-:5 mm m ' '--'' ' '''9595955WWEf5wwfMMT5Em555335532595wM rr 1'r r : 7 M ':z z:7a:x::::asnzzzazzzzzanzzzzznaz::::n::::n:::azz::::::1:11:mm:as::::::::::::....,...,M.,,.,..,.....,,..,,..,.H,.........L.,...,,.....,,..,.,,..,K.......,.,.,,..,...,.,..,...,..,..........,,.,,W,,,..,..,...,,.,,.,,.........,....,.,.,....,.,,....,,,.,,..,..,,....M,.,.,..,...u....H........,..,...m,..,....m,.....,,m...,......,...,,....,...,,.m.,...,...,..gEE gg w.m..........,..,........,,.,.,,.,.........,,...H.,,.,.......,...um.,,..,M...,..,...,..........,,..,...,.....,... . .,,... . ...H ..,.,, ....,... ...K.....,...,. ....,,. . -.- :E EE ESE EE E25 El: : Ea? EES sig EE 115 ESE : : Ea E32 . - . E :,- - 5 5 .., ,.... ,W....,...,....,.,m.,.u...,... ..,. ..,,........., ,.,... ,vm,.,.W......yH..uv,m..,,...m,w1.,.,. ., .,,,,..1.,..,..,. ,L.,,.,,.m....., . 5,Hmm--.MW-mum..'mmmmmMMWWU mmW.w.w,.H . ,HH .11.mu.lmnu-mmmvmwInfumy1.HWm1numfmw.Hynnnm1ynnum1H1InlmIn1.1vmfukmrmIn1InH4numnlwIn.H1In.HH..H.Kmmrumm.1m,H1myHyunuI.1myrmHwmmnumfmm1--um.mw.,ml.H..m.wn..1mmm,V.....fm...mmmMmm..uw.um..mmm.m.m.mmm-mm 235 smmmmmmnmmmummmmmummumnmmmunnwInummnmnuInumm1mwmwInunwInummmummmm:HvuwunIninumummInununInnuummmmmmmmummmInumI ' ' H H1ulNIllNInlllullill1InnuInullluull1H1rlmunum1InlunumnnInluulwnlumnnlwlmInvunumsuNllvllxrllrlmuullIllwH4lununlunulul1ll1llmlvu1umumNllmymul!mmullInluulunlmlmlxvIuunmxllnlmmllmluumlnummllHlxmlllulxluwllnnunmlnululmmnmlllmli P a g e 7 Z gmmllmunluunmsmmmmlmllmllummumm:mlrmvmmrnnunwmnumlluurzlmnnrmllummmnummunummmwlwxslxnwHvnmmmmmununmmunrrmmuummwmluummmuvmlmvnmulvlummmmlmnmwuuzwmuunumwllummmunnmmmmmums:mlmmnmluwnulmnuluumz 5 E gg 2 E gllillUHIIIllllllIIIVIIIllHINIlllllllllllllllUIllllllHIUllIII!IHIIIIHIllIIIUINIHIllNIHIlllllIIINIUHHHVIINIHHHHHINIlNIHIllIllUHIIIUHIIHHHINIIIIIHIIVIINIHIIHIIHHlllll!NIINIllIllVIINIUIliIIINllNIllIIHHHIIHINIINIIIIIIHHIllNIHllillllllWIllllNHHIllillWIINIllHllllllllNllNll!HHHVIHIllNIIIIIUllllllHHIliIIUIllUUIUIllHHIllIIHIIHIIHINIllVII!IIHIHlI4IIHIIHIlf La E E: 5 5 E 5 E ,n,,,. i ..... , ...M l....m.i ......,...,,,,. ,Lu,. im... ,..,. ,W ,...,. W .K,..,..,,.,. l n,.. W ,,..,,..,, N ..,,.,...,,......,.,.,..,L...l.,.,.,.,,,,.,,..,.. H .,.,..,,.u, .i .,.,, W .,,.., . ,.n..., 5 .,n,.. .H ..,. n.........,,...,..,.,,..,n,nnu,,. 1, HM. ,..,.,., ,..,.u..,......,.. i.m.,...,i..i,i,.,...A 555 Law After the War By Dean H. S. Richards NLESS the forces of disorder loosened by the war destroy our civilization, we may reasonably look forward, as a result of it, to an accelerated emphasis on state control and state super- vision over the activities of its citizens, a tendency already well marked. This will in turn mean extensive and complex legisla- tion, and the multiplication of governmental agencies. If this govern- mental control is to even approximate the hope of its sponsors we will require intelligent and trained leadership. In short, the need of trained men on the bench, at the bar, on the administrative board, and in the legislative hall will be greater than ever. 1 The just and wise administra- tion ofa modern state requires something more than good in- tentions and a ivillingness to hold ofhce. Knowledge comes through study and training wisdom through knowledge and experience. The law schools can best serve the coming era by in- sisting upon a thorough train- ing in the principles of law, superimposed upon a broad College training, The greater importance of international law, as the result of the peace conference, the need of some knowledge of other systems of law, as the importance of our foreign trade increases, will require attention to these subjects in the law school curriculum. DEAN H. S. Ricumzos The great war was a battle for our Anglo-Saxon ideals ofliberty and law,-won for us slowly and painfully by the blood of our forbears, and now preserved for us by the bloody sacrifice of our sons and brothers. The path of duty is plain.-to raise up a body of enlightened and trained men to defend our heritage, and lead the way to better things. miiniuiiiniiiiiiiiininiinmiiniiiiiuiiiiiiIiiiiiininiiiiiuiiiiiiiiiiiiniininiiiiiiiiininiiiiiniiiiininiinniiiiiininiiiiminimininmiininiiiiiiiininiiiiniinuiiniinininiiiiinmiiiiniwiiiiniiiiiiiiiimminiummiiiiiiiniiimiimimimmiiinummmiiiiiwmuimmi-limiininininmymiiwunmiummmaF E iiiniininiiminiiniininiiniiiiwiininiiiiiiniminiiniiiiininiininiiiiiiiiiniiimimiiimimiiiimmimiiiiininimininiiiiiiiiiimiiiiimliiiiiii?iiiiiiilimimminiiiiumiiiiiiimmi iiwiiiimii mil in iiiuimmiiiimm imiuinimmimmmi iiiiiiimim fum mm miiiiiiiiiimmniuniwmuinimnunmnini. Page 74 M H .1 mn munmmnuml u ummm.mmmmmMIWInmm1rm.-ummvmmmmm1nfInwnmywwwmInWmmyV.1-.1in1.Iwwu1.11ynm1InW.1wulmwmw1Hfnwlnlmmmn-WmH+mmwmmwmmw1.1wnnm1Inunyu1InXuX.IXW1Inul1yurmWm1muunuunmuuunummlmmfl1Innf1m1IHrfuvuH1uInwInvuumwHwufuuuwX1rvnuIn1ImInnumwnumunuwunnvmuvunuulmum- HnmnnmunmummmrmmfummmmumInmmy1ynvmmummmnm-mfumwmll -K ui In 1 4 I r I EM . ,.,.....,..,....,..........,,..,.,.,.,......,.....,..........-.,.,...... ,..,.-......,....,,....,......,.....,...... Timm.1rmmm-..m.4,..muL.,XW1inV.......W..,W..,m,..-1H..m.m.1.HV.,XH1V..W,-.WH-nw....H.U1.111.1vw.-n.mm..v.HH,.1H..NWW1.1H.WW1H.HH.,..,H..WH1X..N1.mm.W.U.H.H..y..WW11.1X1.NV.NH.Hw...m,mm..1..H.m.Uw..m.W..1..w. 'N w F ' W 'T ' i ' W ''Q '' ' ' ' 'T EE EE EE sue EE g , E 2 EE E E. E El? EE as if Eff EQ! 1.1 r f w ,, f EE X ' EEE WHPa. e Q, ? Q. , M. ' X dex iii QW of O ' SEE E22 :f5.1.1m11.1V..H.1k..m...1V.,km.....MH.I.....Q.Hkm..1.HL..H.1...W,....HK..W--IH.1..1..1...,m....m..1fnV.,V..H.mf1.H...WK..V..H.L1X..,H.,y.,.UW,.....,..,..,,..W..1.....1.H...K..1-.1...WV.1V.,L.,...WH1.N..11.H1.1..1.-..-.1.11my1-1.H.H1..1H1.11N.1NU.,InL..H.1K..H.N.H...H.,..,,.,.....NWW..N,HU.,..NynV..XHX.HN.y,K.,L..N....N.H...1...V..,..,..,,yHy.,y..N..,...V..,,..,..N..,y..,..,...HNN.....AN.....,V..H.,W,.NV..V.,W..,N..,V,N.UV..,V.W.,V.,...NV.,H...-...,,H,..,...WWN.U...W..H,..,.mm..,.m.,...,m 5 5HmmuiHIREEiBMW?iiEhmmEiiEii?iiRii1iCGii1EiGEMINI?iiilii5135556IIIEHFIGIGIMIMIEEIGHG?iiiliiQi!iiGiiEiGiRiIGGiEiiREEiGQRILZIGIQEUIQRIQRIQQEFGSEIEIGRiilRiiRERQISEIIHIREIGIGIGH?EIGIIEEZGIKEGQRIDIIGiRIREIGRIREEIIGEEWRIQIIIQFIGEiEIUIGEIEEEZQEISEFKIQIESIQSIHill?RIRIIRXIEEZZEIQIESEIQEIIFEZHIRGIIIERZGEEEIIEEIEIGREQEIQIISTIMEERIIQEIEEZRIGEQEIIQIGEEIIYIEliliiiGilE?G21ii3QilGi?RIRIIQGRZZREEEREYQIRIRIIREIIRIIRZRZGEIIGIHumwmlmmmf Page 75 in III I I Ii I I I I I iniiii iii iiiuiiiriumiiiiinni in I I in in ii I I ii I I I ii iuiiuunumuum ian: II I University of Wisconsin School of Music Faculty MILLS, CHARLES I-I., Mus.D., F. R. C. O., Director and Professor of Music PARKER, FLETCHER A., Emeritus Professor of Music TDYKEMA, PETER W., M.L.. Professor of Music, Chairman, Department of Public School Music JONES, IRVINC W., Asst. Prof., Chairman of Public School Music Department TOWNSEND, LOWELL L., M.A., Assistant Pro- fessor of Music GELTCH, VON, WVALIIEMAR, Mus.l3., Assistant Professor of Music JONES, JOSEPHINE, B.M., Instructor in Voice Culture On leave of absence l9l8-IQ. In XV. B. C. S. CAMPBELL, LLICILLE, Mus.B., Instructor in Pianoforte CRANE, ALICE, BA., Instructor in Public School Music EASTMAN, IRENE B., MusB.. Instructor in Organ and Theory GUNDERSON, HELEN, BM., Instructor in Pianoforte SVVINNEY, EARLE E., AB., Mus.B., Instructor in Voice Culture YATES WMT E., Instructor in Band Playing and Orchestral Instruments CWood-windl, Director of Regimental Band BEANIE, ALICE, Secretary to the Director The University School of Music has made very rapid growth in all its departments, at the same time maintaining very high standards. The faculty includes men and women whose training and experience is of the broadest kind from a literary as well as a musical standpoint. During the past year many changes have taken place in the personnel of the faculty. In the piano department Miss I-Ielen Gunderson of the University of South Dakota succeeds Mrs. Doris Carter Peterson. In the voice department Mr. E. Earle Swinney of the University of Illinois succeeds Mr. Ernest Chamberlain, and Miss josephine jones of Emporia State Normal School, Kansas, succeeds Mrs. Minnie Eergman Lupfer. Miss Lucille Campbell, a graduate of the Uni- versity School of Music under Mr. L. L. Townsend, is succeeding Leon L. Iltis in the piano de- partment. Mr. Wm. E. Yates of Western Military Academy, Alton, Illinois, is Director of the Regimental Band and instructor of orchestral instruments, Succeedingj. E. Saugstad. Mwrgwm IIIIIII IIIIUIIIIIIIII I I I II I II IIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I ii I II III I ' IIIIIIIIIIIII ww II Page 76 EUII4VIIHIllllIHIIIIIUIHllWWIlIllWVIHIUllUHllWIHUILUUHIIIHIWVHNlWIHHHIllIllVHKIWllWKHHHIIHIHIIIHHHWHWVHWHHHVINU1NYIUI1IllUIHIWHUllNlllNIIHI4VI!HUNIHH7IllVIIIIINIllVIIVIINVUVIINIHIHNIIUHVIINIHVIHIINH1NIlNllNIllUIHINVIIIII!VIHIIVIHIINIIHIIUIN IHII H IHIHIH N II II WIlNIINVIIVIHVHHIWVHVIIIVIINIHVIIWIllH1NHHIlHHVIINVIHIIIVIHIIHIMIIHIIHIHQ E 5 E 1 :P 3 gliIIIIllNIIUINVHVIIIllNIHIIIHIVIIUHVIIVHNlilIUIllVIIVHWIHIHIllWIHllNIllVIIUINVINVIIWIINllNH4IIIH1NVINVUNIINIHIHHHHNVINNIlNIHllNVIIHIUIWIIUIlNllNIIUIIHUIHNIlNIUIllHIUHVIWVIINIllIllVIIWVHVHNIHVIIVIHIIUHIIINIHIIIVIIHINIIUIINVHFIIVIHVIHllHHIIIUIVIIWFUHUIUlllHHVIIHUIllVIINIHIUIHIllVIIHllIIHIIHVIHIIIIIVIIIIIINIHVIINIlNIliVIIUI!UIHIILIINKIHIHIII-E Medicine Jiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiwmniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiuiiiiiiniiiiiiiniiiiiiiiiniiiiiiiniiiiiiiiiiiiiiiiiiniiiiiinniiiiiniiiiniiiiiiniiiiiiiiniiiiiiiiiiniiiiiinininiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiininiiiiiiiiiiniiiiiiiiinniiiiiiiiiniiiiiiiiiiiiiiiiiiiiininiiiiiniiiiniiiiiinuiiniiiiiiiiiiiiiiiiniiiiniiiiiiiiiiiiiiiiiiuiinun JiiiiniininininiiiiiiiiiininiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiiiiiiiiiiiiiinininiiniiiiiiiiiiiiiiniiiiiniiiiininiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiuii miiiiiiiiiiiiiiiiii will mini iiiiiiiiiiiiiiiiii uiimiiiiiiiiiv iiuiuiiiilimiiiiiiniininiiiiniinliiininiminiiniiiiiiiniiiiiiiiiiiniiiiiiiiiniiiiniiiiiiiifiiiiiiiiiiiiiiiiiiii Cflfedicine After the War By Dean C. R. Burdeen HE importance of medicine for successful Warfare induced the government during the war to take special steps to keep medical students in school and medical teachers at instruc- tion and research. Medicine is no less important in time of peace than in time of war, The war indeed has served to emphasize the need of more efficient application of medical science to the preventive cure of disease. ln the movement to bring this about the medical school should play an active part. As soon as facilities can be provided the work of the medical school should be extended so as to in- clude instruction in the clinical branches, It will take a con- siderable number of years to develop adequate facilities for giving the complete medical course under the auspices of the University. It is hoped, how- ever, that when instruction in the last half of the medical course is undertaken it may lte undertaken in such a way as to 3 be a distinctly helpful factor in the movement now under way la -A- toward the higher standards of health and bodily vigor in E13 Wisconsin. Meanwhile the new infirmary at the University will enable us to care more adequately for the health of the students and the Bradley Memorial Hospital will enable us to study problems DEAN C- RA BARDEEN of importance in the control of disease. We have been fortu- nate enough to receive 315,000 -is from private gifts for the erection and equipment of these buildings. 1 The constantly increasing number of medical students is taxing our Ji resources to maintain our standards. The capacity of our students wg for work is shown by the fact that they even did good work during the recent S, A, T. C. regime at the University, 355 Qll E Q 5 1inmlmiWi.wwwwgwiwEWMMwww..iiniwiii55,fiiiiwiWilinifimiimlmiin.iimi..iiimimiiiim1.i...mmi.winimiiii.iiinimiii.iiiiimiiiininiiniii.mm.miinmiinimiii.iiim..miimmimimiiiiiiiiiimmiimimm.,mi...uimiiiimmimiiimiiie45 .imlminimininimm.ininimii.iui...iiiiuiii.mi.-iii.i.iiiiimimmmii.HFii..iii.ii.HTiiimi..miiniinim...Tiniiiiuiini.....imi..i..ii.iii.,. mmiw-iii .iimiiiiiii.inm.i.iimi..in...ww,w..i...i.m.i..W..i.iimy1...iim.,im.ii...mW.n,mmi.i.miimwimwi iiwimiiil ii.i,..i..m..i..,.m.s Page 78 2-Qm1nuvmmmInnwnumwIwumm-mmnwmmmwmmumwnfnmm.IHwnwInulWInuv1.11mmwunuwu1Inmwuv1nnummWI.1mm1nfnu1unn1H1Inmwmm1n1luwuwnwuwnwwInuwrnnnw.4vmulwI.wrnw11wInInin111wwulmuH-Iwmwnwruwufru1uwm1-1wmmumm'-mmmuuuvuuu-141I-1N11Hvu1I-11uuInwnunyuI-1m1uwyn1u1nl1InNuNIninVuwInmmwuumm-mmummmnmwmH1VH.fnuul1unwyunlwIn1nwInm1uluwmmmmmmfuulwm1mmXnwvu1InwulwInnlmnummmvmm'mg 3 5 :la 35 Ei - Menntmi sig Z EE EE A , Dv. Lararzkl and 1515-slshxuxiis Y ' Dag-,xW l'n1Qn'i' 01' Hx:E::r:-57 1 QW f . I bhruc gui . s ,MEM Qfwfmj Ska ' W 5 a iii si? 3 5 gs Sl? 313 gg? E, ai? 3 ! 1 25 1 s E 2 sea is 2 5 Sh 333 15 555 3 5 235, LM...mnuwwummm--mmm-ummn-mmInumm-umuummmumm.nm.w..Hwww-.1-4-..uIn1.4-.1um..mmm-1.mmvm1.Mwma1vumWim-nwH.mM.wwI..ul'mm.mmwww-Anmww.Mmmmmmmm...1.11.Hnumwwwummmulummm.mm-.ulmwmmullnumuww-ummI..-...mlmmWmmmvmIn,.Nul..wmu.mmmmm,.Hmmnummu.,un..mm.4nu..nuXInmm,m..vmmmmfu5 gg S.n ',...m.,.......W.n. ........u....mF 'M........W,mmmG..'- M,..J ......mm:fv:n '....M...H.,.nium1i1n:nm.amm.m. '..,.Wmm......4..'..v..mmmmmm57m,mm4...,.H...m..WH,.......WH,.,......,....,......W.H.HH..WH....WM.IWm..W..Ww............,..,...1..,H,,..,......,,.,..........l..W..............n...,......W.....W...un,.....1..W...........U..K..........u..1......,..W..,....m.,,,..,..,,....m..,.......u Page 79 9- nu r V W..W,HY..H...WV.,,..WV.W.UH.W..YY.1,.1WV..,.1Y..N.,YV.,V..H...HY..,K..H.H.....,.MK.,.HH..H.H.,H,X..,H.N.HN..,.HN.HV.,L..,K.,N.N1.1N.mnH,.......Af..,...f.m..,.....,.. .L I wmmYWYHYH-W-H-HwmmnwH1H-1H1Y'HH1HHH1H-1H+H-1I'Y1HW HHH'W1 HH'HH H'H H1' ' 1 H'H H '''H'H H '''f''flH' ''x''iff' im5221551529:ffEffuffrzfblflfsf1:51:lleffMilf!!lui5:11221ff!E1lffrlfflw5:4S!!!ff......,..,..,.,.....,..,..,,..N,,..4...,..,.........,.........,..,......,...W.M...,..,..4N.........,..,..,..........,....,,...,..,...,..,,.,...,..,.,...,.......,...,...m.., WTw5T!WfT95EWWMWwwwmifW' T ' '::a':1:::1:::::zzz:azzzzzxzzaznzz:::::::zz:zzzxazzaqzzzzzzm1::z:::::::n::::s::n:::z::::::z:n::z:::515111111as5:1:::::.n:,..::zzz,nmm,za:,..,,.,,..,..,.,,,,H,.,,..,..,,..,,.,,.,,..,..,...,..,.,,,..,..,,,,,..,...,.....,,..,..,..,,.,,..,......,..,,..,..,,.....,..,...,...,N...,..,..,,..,,..,.........,..,K..H........,..,...,.....,,.,,.,.,,.,n.,l.....,..,...,,.,,..,W,.........,l.....,H.,U.....m....,........,..L - 55, ..,,... U, .nu,,,..,..,,. ..... M nn,n.........u,..,.,..,.,,,. ,,..,, H ,..,,....,.,,. u,..... ,,.,,...,,.,,...,.....,...,,,.,.,,..,,,...,., . , KJ Ei .. .3 ijyggggggggqgggggfggggglgfgflggygwgm3:31551532353551,..1...w..1,..1...mm.,H.W..wy.m.wm..m.1..mHmm.,1.1H-1..mm.H.w.,mv-HWmu1wm.mmumm.,.Huw.m.m.mm.mminu.u..lw..1...,..,...umm..mmm.n.1N..W,H,wm..m.u.mm-1W.mm-w--uminumm.u..mmm.,V-u.mm.mmmumXV..1.Hm,.Hm.W..w.w.,X..mm.,m.m-m..w,.lfNTun..,M9mLq5w1.111-Q::y5 g E -umm-umummmummmnmmmumnmmvmmumInml1.IwwIHWmmmmmnmlmuummWWHmmmmmmm-IumminnlwnnmmmmuummummmmmmmmmmmwmmmwwmilmumrnwwummmmuWumInmuwmnmwwuyummwummmifnlumInuuwmmmmmiumwlm.m4mmm-wummm'mmmmmummulummmmnmmlmmmlmlmmnulWmnInlm.41In1Hmlummm.mmfummuummumuumn:m1nmnnuun1nuwm- Page 80 :E 'E S :E El 1 X. -is El: -s -ig are 5: a i 55: is ,ig tai ??? 1111111 ,.......,..,.,...,...... ..,. ..,......-..s....,.. ...,. :111 Ee! is 55. ig. .S 215 ,Z -a 1i1 1111111111111 11 1 1111 1 1 1' 11'111111111111 1 1 1 111111 1 11 1111-11 11 1 1 11 1 1 11 111111 11 111im1i 1i1i111 1 1i1111111i1i1i1111i111111 ii 1411111 I Cphysical Education if PHYSICRLA ' uutcmero - ' E55 ii ara :ss gi? 1 .., egg 1 I Al 1 I5 l E .Ii . Q TQE. JONES, Chairman of Department . . Track Coach and Baseball QQ GUY S. LOXVMAN, Director of Gymnasium . . Basketball Coach EE Joi-ns: R. RICHARDS . . . Football Coach HARRY E. Vail. . . Rowing Coach GEORGE BRESNAI-IAN . Cross-Country Coach H. H. HINDMAN . ' . Swimming Coach F. E. SCHLATTER . Gymnastics Coach J. C. STEINAUER . Wrestling Coach R. I.. DOUGHERTY Boxing Coach M. A. KENT . . Assistant Coach in Basketball and Baseball GEORGE I-l. HAGEN . . Assistant to Chairman , The work of the Department of Physical Education this year suffered, of course, from obstacles developing out of the war, but the aim ofthe department, to enable the greatest number of students to participate in athletics, has never been lost sight of for a moment and, on the whole, the efforts in that direction have been productive of much benefit. Considerable energy was spent unavailingly when the school was virtually an S. A. T. C. camp, as elaborate plans for inter-company and interlbarracks athletic contests had to be abandoned with the breaking-up of the camp just before Christmas, before the schedules could be commenced. In that it spurred the S. A. T. C. men on to greater par- ticipation in healthy sports, in anticipation of the organized competition soon to commence, the departments labors however, were well rewarded. The transition from planning S. A. T. C. athletics to the work attending athletics uninfluenced by the war was not an easy one, but the department feels that it has made the change as quickly as was possible and that the athletics for all idea at Wisconsin will again be in full swing before the school year ends. The physical educational staff gave of its best men to the country's war cause. Coaches Richards, football, Stein- auer, gymnastics, Hindman, swimming, Benish, cross-country, and Dr. j. C. Elsom, medical examiner and director of corrective gymnastics, all went into service during the year. 251-1 1 11 -1-- 111 -i1--1i11 1 . ...........,...................,..... l .Lu .... ..... LJ 'f.J1....- ' 'l' ' ' L2 .I...1,.,.....,..,,,,, ,,,,,,jl '1ms1'i11. .,., 1111111.11 .,.. 111111.11 ....l.. 1.nm:ua1sm1m ,i.i...ll.il.,l..i..l, 1. ..i..l,..lil,.,,.,..l,,.l llii ..ii.l.li. 1 -1-li1iii 1 1 1 11111111 1 111111 1111 111f1-11 1 1 1 1111 1 '111'1'I11'111'11'11'111 1 11'11'11 11'111'1'11' 1 11111 11 11'1 '11'1 ' '1 11 11' 1 1 1 111 1 11 1' 1' 1111 11 1 11111 1111 1 11 11111111 111 1 11 11111111111111111111111 Page 81 11 1 11111 11111111111111 1 111 11 11111111111111 1 11111 11111 111 111 1 1 111111111111111111111111111111 11 111 11111 11111111111111111 1111111111111 11111111111 111111 1111 11111111111111111111 11111111111111111111111111111111111111 111111111 1111111111111 111111111 1 11111111111111111111111111111111 111 1 1 1111111 111 111111111111111 11111111111111111111111111111111111111111111 University Extension CDivision Stal? Personnel Louis E. REBER . ...... . W. H. LIGHTY . ......... . Dean tOn leavej Acting Dean W. H. LIGHTY, Secretary ..... . Department of Correspondence Study PAUL F. VOELKER, Secretary Cresignedj . . . Department of Instruction by Lectures R. B. DUNCAN, Assistant Secretary Cin chargei . Department of Instruction by Lectures ALMERE L. SCOTT, Secretary ...... . Department of Debating and Public Discussion J. L. GILLIN, -Secretary Cresignedb . . Department of General Information and Welfare E. B. CORDAN, Acting Secretary . . Department of General Information and XVelfare W. H. DUDLEY, Chief .... . Bureau of Visual Instruction H. F. RINKER, Chief of Instruction . . Bureau of Post-Graduate Medical Instruction Rock SLEYSTER, Chief of Organization . . Bureau of Post-Graduate Medical Instruction State District Organization W. H. HENDERSON, District Representative Conileavel ...... W. Hf BENNETT, Organizer tin charge? .... A. S. LANGMAS, District Representative . . A. R. MAcK1NNoN, District Representative . J. P. O'CONNOR, District Representative . - . L, E, BLACKMER, District Representative . . GEO. E. HOBBS, District Representative tonleaveb . First District-Milxvaukee First District-lviilxvaukee Second Distric t-Oshkosh Third District-La Crosse Fourth Distric t-Superior Fifth District-Wausau Sixth District-Eau Claire J. B. Gmswoto, Organizer Cin chargej ............... Sixth District-Eau Claire The University Extension Division in Wisconsin is one of the co-ordinate colleges of the University-the extra' mural college. It constitutes the instrument of teaching and of authentic information for the adult democracy through- out the state. It serves not only those who are disadvantaged by taking educational opportunities to them, but it affords all people a means of keeping abreast. Thus the practicing engineer, architect or doctor, on the one hand, or the artisan, clerk or laborer, on the other, quite as well as the student who contemplates a university degree course, may study and learn at home and without interference with their daily vocations, This is done through consecutive teaching courses by mail or local class, by forulinc-instruction and package library service, by lyceum courses, and by bureau, information and visual instruction met o s. e In this way the University committed to the unbiased search for the truth, may serve continuously an entire State 5 ' 11 111111111111111111111111111 11 1 11111111111111111111 111 111111111 1111111111111111 111 1.111111111111111 11111114 ......!fE.!.'.!L..,Ei!!E....... l 'l it l ' 1 1 '41 H H ,Il , ...,........... . ....,..,... i.,.... ......-.,... ...,.. ...--,,.... ....... .,.. -,....T...mr............... I X 1111111111 1 1111111111111 1 111 1 1 11111111 111111111 1 1 11111111111111111111111111111111111111111111111111111 1 111.1 11 11 1 1 1111.1111111111111111111111111111 1111111111111111111111111111111111111 11111 1 1111111111 Page 82 wide democracy. 2... .,,.. ....................... ............. ... ............ ... . ...............W.....M,....W... ..... ... ..... . . . . .. ..... ..... . .. . ................... ............. ..... ..... ..... ........ ..... ........ .......... ....... ..... .......... swliiliililiii . . ...P 5 i E23 E2 as 352 Els 522 ali Ei? E12 Eli Eli sig s si is 52 s......... . n.. ...... ...... ...... The Library School 1 is - vi 71.225 -:i..zLfE!:,L- 222550: LIKRHR 'ice-we-L .lv wi ' . si.ii 1i1 Library Staj MATHEW SIMPSON DUDGEON, IvI.A., L,L.B., Director. On leave ofabsence, second semester, for American Library Association War Service in France MARY EMOGENE HAZELTINE, BS., Preceplar. Bibliography and Book Selection HELEN TURVILL, B.A., Instructor in Cataloguing and Classification CLARENCE BROWN LESTER, MA., Instructor in Reference Work, 'Public Docu- ments, Legislative Reference JESSIE WELLES, Instructor in Library Administration and Equipment JULIA WRIGHT MERRXLL, B.L.S., Instructor in Trade Bibliography and Library Economy ' ANNA GRANT BIRGE, B.A., Acting-instructor in Book Selection ' 67142 Library School After the War The war proved that librarians had a special preparation which fitted them for reliable positions in federal depart- ments, business houses, and emergency work war of an advanced order. This demand, which could in itself be only partially supplied, left public libraries with diminished staffs. The recognition of library training and the demand for it has brought a consequent increase in salaries. It is evident that more trained librarians are needed. During the last fourteen months the Library School re- ceived 339 requests for workers to fill vacancies in the following positions: librarians of public libraries, of branch, county, college, normal school, and high school libraries, librarians for childrerfs departments, for reference, cataloguing, and lending departments, librarians for business, municipal, newspaper, hospital, agricultural, and other special libra- riesg for assistants in these same libraries, and for workers in various lines of war service. The Wisconsin Library School must do its share in training more librarians to meet these demands. iiiiiiim iiiiiiiiiiiiiiliniiiiii iiniiiifiii 1ini.iiiiiiiiiiiiimimiiiiiiiiiiiiiiiwiiimmiiiiiiiiiiiimilim I. i mum imiimiiiiiiiinmiiiimmiiiinmiumim i. .vmi1iiiiiiiiwmmiiiiiiu ui.niiiiiiiiiimiiiiiiiiiiiiiiiiiniiiiimiiimiiiiiimiin iniuiiimmimiiiiiiiiii .ii .ui i uni I i mii i i i 1 i ii lim I ii ni i my ii wiiiiiiiiii in ii Page 83 ummm.,.HnmH.my.mmm.mmmH.mm.,.HmmnInWWvmInwIn1mmrmWInInnninwInul1fnnuulumInInmy1mfm1ufm1-IW1.11MW11H1yuWI-wmWynfm1.1W-.1inWHw1I-1U.1.IWwV.1mW-I1WW.HVH1InW1Hmw.Umwyu1-IXX-11-IwH.1-IwU1WmH.WmXHX,HW1.WW..W..XI1.XL.XW1.WI..1..X1.XXInH4H.X,HXHW1.4,HXmWHwmynN-XmW55.....Wy353135555355M!in11515555555553tuum!1554553153155IEWmvlylgInW5WinH.Wml..X.NXHXmXHXInWHWm1in1.Iwm1.IX.HwInWWmvmmnuWwnu.umm-1...w.u...f 5igm...nu...1..,....my.WV..1K.,mH.HK..M,X.H...NWWm...1..nnWH+W.fWKm.HnnH.WW...1my.HV..1V..1.H1..H..1..HH1.H1.H...AWnm.Hm1.mmV..1H.1..,,H1.H1..X1.11...N.1,H,.HV..W.A,m.HW..,H.1N.1..,W,...H.W.H,..,...N..H,W.HV..,K.WW..,H.V..1.H1..wm1.1XN,X1.,I..NUXI..,..,...,K..,1.,.HK.,,..,W,-H.HNWL.WW..vmV..,1.1.H1Hw...X.11mHW.X.HmX..XH1WX..11.1WWH-H.,1-1K..V...H,,..W--4H-N..K..W..X.HXHH.XV..X.H...mlL..,y.1.HX..11..X.HH.W1.1,.H1.1WX.HX.IXmm,1mm1.min...mm.m.i.51Eii:fg5 5 5 3 ,,,, .,,, A I I .... .V.... ..,.. ...... ,,---.-,,.,,,..,..-.,....-.--...M.....-....---.-.....,.-..E ,. ,.,,.., . ,,.,,.. n,... ,. .,K..,A. ...,.. ,.,,., .. .., ,.,,.., .. ... ,. A ,. .. u.,K., ..,... ,.,,.. ... .., ., ,.. .. .,,..,,., ,.,,.1 .,,,..k.. ,,, .,, ..,K. ,. ,,, .,... ,., .. .., ,.,...,.. .,. .., ,. .. ,.,.., ...,,.,.. ,., ,.,..,... ..,...,k., ...,.,... ., ,. ,.......,,,,. ,.,,., ..,,.. ...... .. ..,,..... ,.,,.. .., ..,...,., .,,..,,,.,n ,.....,...,.. .. ,.,,..,,.........,.,.,., ,. .., ... ,,,,., .. ..,K.. .., ..,......,,.,.,.,,..,....u...., H ,,...... M U, . I Page 84 053565 Address of Welcome . Class History . . Class Day Oration . . . Farewell to Underelassmen junior Response . . . 1918 and the NVar , . . Presentation of lvlemorial . Acceptance by Faculty Ivy Oration .... Ivy Ode .... Planter ofthe Ivy . . Class Day Exercises Tuesday, june 18th-3:00 P. M. Upper Campus Pipe of Peace Ceremony Nfonday, june 17th-11 P. XVI. Lower Cam pus LEROY J. BURLINCAME C. LEONARD GROSSER SARAH SPENSLEY RAY S. ERLANDSON . EBER E. SIMPSON CHARLES CARPENTER . . RUTH L. STOLTE . Ovio V. Bux . PRoE. A. B. I-IAL1. . ROBERT lvl. BREWER . MARJORIE KINNAN . DEMMER GOLDEN Pipe of Peace Oration . ..... VERNE V. VARNEY junior Acceptance . ............ HAROLD lvl. GROVES Senior Mass Tvleeting and Bonfire Commencement Exercises Wednesday, jane 19th-9:30 A. M. Agriculture Pavilion Prexy's Last Commencement Address .I.1I1.4I.1I...H.inI1.Ii..i..i..ii..,..,,.,,..i IiuiiinGiGiiiiliiiiiiiiiiiiiiliiiiiiiiiiiiiiiilimimi Page 85 QBaccalaureate Exercises Sunday, J une I 6th Address-ROBERT MARK WENLEY, Presbyterian Church Class Day Monday, Tuesday, june 17th, 18th 3 :OO P. M. -lvy and Class Day Exercises . . . 8:15 P. M.- A Thousand Years Ago -Senior Class Play . , . 11 :O0 P. M.-Pipe of Peace Ceremony. ll :30 P. M.-Senior Mass Meeting and Bonfire . . 5 :OO P. M.-Patriotic Band Concert and Song Fest . O4lumni way V Tuesday, june 18th 8:30-l0:30 A. M.-Alumni Registration .... 10:30-11:30 A. M.-Annual Business Meeting . . l1:30-1 130 P. M.-Luncheon . . 1:40 P. M.-Dedication of john Muir Kno ll . 6:00 P. M.-Annual Alumni Dinner 8:30 P. M.-Alumni Reception and Ba ll. Commencement CDay - Wednesday, j' une 19th 8:45 A. M.-University Procession . 9:30 A. M.-Commencement Exercises 4:00-6:00 P. M.-Presidents Reception . Open Air Theatre Open Air Theatre . Lower Campus . Lower Campus Open Air Theatre . Music I-Iall . Music I-lall . Upper Campus . Upper Campus . Lathrop . Lathrop . Upper Campus Agricultural Pavilion Presidents House Alumni Zig-Zag Procession Hrmr..,,.w,Wr.r..m ,w.rr..m.r..w. r1.141.11ininwr.Hmim...1..1m1Wui1urinr-mmrrrmliwlui Page 86 E2 :sz E., SEE 52 muun.. mrnmnmuxnumummmmm.mm I m .mn uv 1. .uv mnv ummumunu nm .mmmmmuummum 1. mnuunum w mmumuwunumunwwmm .Immun um num..11suwu.ummnwuummummm..nun.vu.umnuuuunnunmmnmu mu rvvun.uvunnmuumnmnmwuu numuruwnl1vuvuwnnrnruwrnnuvuwmmvmuxumlumnmmmmllummvllwl PE E'?2H3Eg5gwjgmemm:s2ww::gwLT .... N T -.-1- R -,-.-A'-- ---. , W -.F--. ------11. EE Ei.. :ii E S QSwxxxxwxxxxxxxxxxxxmxwxxxmwNXMmxwwwwmxwXXmmwwxwwwxwwxxXwwwmxxxxwxXXxwxNxxwwxxxmxmXwwXNMRwwmxwwxxxxxxwxx NXSQ N 512 -5 Nm . Nm E E X y 5:2 EE M 9 SS ESE 19 87110 VS 19 525 ..., Il N s ER ......,. -- Sw N - Ns 2225211-ESS ::..:-:..w,...,.,jr'- ----- -r .. .... - XxxR-NwxN-X-XXxxNNxxMww-Rim-NGi11iR1Q...-R-silx-ixg1,RmRN Sw:qQ: Q.Awww....maxRXWQRxXNWRWwxNMNXRXRRRRXRRSXQ lmm . .,...... AN EXE . EE? QE QQ 322 if Senior Class Ojicers E A I'lAROLD M. GROVES . . Pr6Sid6rli E LUCY WALLRICH . . Vice-President . VELMA A. REID . Secretary I HERBERT M. BAKER . Treasurer . Groves I Waflrich Reid ' B21-fer E Q . 5........IfQ...........f..l....C...............I.....................................................................................................................L.................................................................................................iff5Hif.iiif....................Ififi5ffii2EilifH................... ..... .................................. ...... ............... ............................. .T'.'a. :a a'...... .............mx.:.'n1.m'm.. ns:.':.. ' Page 87 QQ V..-mmn.Hmummmummmmmmmmnn1mummmun,mmm..1mInXm1mmXWmymy-.1H.mw.ww.m.w.wXHXmXmHXunm1.IwmX1.11Hwmw1.1m11.Wm1.1XInW.11.IXXHWu1mfInWx-.1WWH1inXHmymyHXX.1XH1rm....UXU,..W..H.w.,..1,.U V.W1W1HWX.HK.my,.HmmW.Ummwm1mm1.UmmWwH1nu-mmwllnmfmHXIn1mmWmxmmW.mmmmnum1fmfum-mm.m.fm.v ....mmmn.,...NmW.mmmmm..XIn1HW..,N.1,1.,X..,H,..,H,XH4X1.Xwmm.m.H..u.u 1mm.W.u..1...um.,W...,..,f..m.m..u1m1m.NWm.,...mm.mm--1.22 I iii 225 55 Ei? E Ei? 5 Ei? ,,,.,,,,,,,,,,,mg555E5mgmmmimmmgmmm-RW ---,- 'HN .,---- .... ...... ,,.4,,,,,,A,,,,,,,,,,,,,1ilfjgggjfgg13515511315331ggggggjggg3ggg5gg1ggg3gggggggggggj33333gmif355553555:335M353mmm,Inuf.553:,3.,...,..5,5.,,..,..,......,..,....,.,...WW1V.,H.,.H,,.,.,1..,m.....,..!,MV-,.H...,L.,v..,,.,..,..,...,,.,,..,......,..,K.,,.1W.m.H.,,..n.,...W...,,.,H.V...nm.,..,,....H,......,W,H.K......,.,..m.,,...1.,.mn.L..m.v..n.,..,4m.,,.mf.sgg Hmmm ummummm11XW1w.11mW-.11H41HwXHwruW1.1ulwinw.IwwHwin1m1.11+I-wWwInin1InWWWw.I1W1.XInm1uf1InX.11mX.H11-1W1HNny1.111.11H1H-XHWmmfnmfmwmuv1H1Hmmmmwumm ' ' Page 88 HXnw.I111.wmruwn1vum1.Iwm1I-1m1uwInmwuvw-111.1W1Infuw-4wUw1Hm11HwHvu1m1Wm1.11muwwn1inwH1WH1w.UIn1mm1H1vu1JE-1Muiim1Inmb..1UWHEHMEElimnumHifi,mminumEMEFKZEEEFCilmE mmwunuma:winwumnwmwnumwnnnununninwwnwuwwuwinwu1wnwnwwuwmwuwuw1nwuwwninwnwmwuwnwwuwuwwnruw1IwwnwNwm1n1fninmwin1nw1n1flwinwmwImf1inrnm1W1muvwmmwn1n1wuww.1wuwnwwIwwuw,IwwHww1wwuwwnumwmmumwuwruuuuwnuuwnuvuwuwwuwrwwruwuwnmmmmmuurvwmwHwwunwI1wuww1wuuwmwanuuwluwuwwu1u11ruin1fuul1un1u1inumummmmvluvwuIw1uwwnwrHwuwXnuuwrn1vuwnwmwuwwuwmwvuwuwruwinunwvumwruwvunvwuwwInvmvuwvumwmnmmmm m ww 1 mmm v rgaaazzmmanmnmaznzuznmazansnzni::nm:m::m:u:::::1:::aaaaamagszzzazmzzzzanzxamzzzzzzqnn::::::::::::,:::q:n::::::q:::qz::::q::::::1:::asm:Quran:man:nm::::::::sam:z:n::::::q:q::::a::::::z:qqzzzazmza:::::z:::q:::q::q::1wasa::a::qz::1:zsunsmana:masszz::z:a::q::::::a:::::::::span::::z:anzqzzsazzsnqsnaqznanxaazzzaa:::::::man:sam:ana:scam:rw:su ' H ': ' ''W' : q H ' w ' ' rr ' z :z':-'n s'z:::':s:.,. E - .,,.. .,,..,,.,... ,..,..,,..,,..,,......,...,., ,.,,.,.,. ,..,..,,.,,..,..,,,.,,.,,..,,..,,.,.,,,.,..,,,,..,,.,,,... . . , . . ,. E E E 5 E E E s Q E E . - M ,E . Ei 1 2' ,, ., ,, H, -a 5 fn 4 .- -ff ,,. ,,,, E 4.1, - E ,aff 412 555 M: E S f' frfffwdf-r -- f'--Y ' :,- W ,x ,..f...W-,,.,,.!w. ,MW W,.,....,, ,,, ,, Eli L: .'5!2'Y: X4-.+'1,:.'1-vwv'-: 'c- 141.1 1542 21 . 4 , 4 if WW? ' : E F',fri.1 2:5 V ,.1m.u, yi ' ' 5 as V ,1 ' 1','4z f .aim Eii EEE 3 Emnyy,nuvm11-11Infmnnmnu1Winnunv1u1H-W1H11.I1InH11.-1.H1H1V.1Inin1..W1.wmN.1.H.Hm11.,.H.W1.,.HK..1..1..1H1.H11.1..1L.,L..1..1.11W1..XmL..11.1.HV...HK.X..1K..1.-1-mm..1..nw.vH1in1.11H1.I1wH11.1InwI-1.I1inXHXU,ulXK-X1.11I.1..,N.11.,-.1m,..1.H1..,,Hy.,,,.,H.1..1L.1m11.11.,U.1m.H1..XL.1N..N.H,..1..1L.,...1MyH.1.1,..,WX1.1X..N..X1..,V.1V.,,..11...H,ynmy.UNHN..minl1.H1uvV.,imWWWHMUNWW1nv11.1n111.1u,1u1-I1X-IXHXin11.1H1nlmmm.mm.nm1 1 w m nf 'EWRHTHii?ii?iiiiii?GifiiEi?iiiiiHiiIFilUiUiiinwfuRhvmuvmlmEuwvufn1HwI-wwnwHW1u1Hwmm1.InuwnwInw-11H1mnnmwnX1uuHXH1myH1H.XH1m1U1Inmym1Inmin1mmm1NH1H1NH1fumuHXm1H1XHwHwin1HM1.I11H1ininummmmlmm fn ummm in K..... mn..K..nm...WI..Um..,..,.,..,......,,.M,., .,l. u..u.1..,...,,.,.,, w..., mm, ..... H., ..,K.,..,,.. 1...X.,,.....,,.,......,..1...,l.u.,.: ..., ,..,..u.,,..,..1 K..,.. ,..,..u.,,..,,.,,.,, ..Y.., ......,,.v., K.., ,.,,..K..W.u.., ..... ,..,,..,.,..,.m.. ,. .. , P a g e 8 9 immm:mnum:mmwmummumm1Innuvu1mm1m1ulvu1wn1u1nu1u1m1rn1u11Inmym1.I1vu1mrn1nummym1H1m1mmvm1.I11n1vu1u1nlm1In1u1vu1vmumwmumml1n1u1nl1H11n1InIn1u1rnXnXIn1nwin1H1Inm1uwwuwInmmu1nul1nl1u1w1u1InmyuuuuuInmmwnmwu1vunluInfnwInnlwufummnmmmwmmmunmlmnnnmmwnm H. 4 I v u vw In nn uumm1uvInwuwfuwuwInwuwmwnwinvu1mwmnlmwuwwnwInwuwnvyuufuuInvuuuw1uuunInanwuwnu1unn1mmmvmmmwlmmu. ggQuInHnunm-mmrwmumI-I1umHnf1nuinwH11In1mmf1-11.H1H1nu1H1In1.I1.H1HX1..1,H1M1..1Imu1V..1m,1.,m1.HW1InV..w1.4W1W1I.11.1N11in11.1nl1I.11I1w-.1-111K..m1U4W1H11Hdl1H.W1m11.1..11H1.HV..1I.,,H11.1m1..1,HV..1V..1HX.11H.1..1m1il?551NIRH1115HQIliiIiiiiil1hill?iiiIli?iii?EEFilIIIIPIRIEGi1.iiiiiHiGiliii'IEiiiFillIiiIEIIFQIFEEli?H25521PEIIZIRil?iiiiii!Iilii?1EliIii?FEW1IEEEIDEICIIIEIGI?JilLIEHEIRIllQllliiliiiiiii52111155iii1IIIGIIFIGIGIEIIIIEIIFEZREEIIEIYFJIIQIIIIIZIIIIIRIIIEIEIKIISE5 .. 2 gs 55 EEZ EE W E EEE ' ' EEE : 1 EE 3 2 EEE HWWM-Wmm--IWWWWWW ,H11.f1.H1..,m..m.,...,..H..,UWV.,,..,X1.1,..1V..XV.,W..1,.1,1.,W1,N1..,,..,,H,V.,11.,H.X..Nm,K.,,UXV.1XH1...1,.,X1.,.N1..11..XL.,V.,W..W.w..,..,.H N- um wmmmln if I .,.. ,. .. ,. .,,. ,, ,, ,, V- H H My K. wm.H.w.M. ,..mw..um I L.HmmW1.111-11.I11H1I.1V..H.mmm..H.1Win,-11.H.H1H1,H1..1InH.X1.Nmmum-.1mWXL.1H.u.m...m.mww.Q..1. Km 1 .H nw. . . .U.,v..H..1.m.. my mn., H in K .V al: ..w.m..v..,,..m..1num,.,..w..,..m.. ,K.,,Y.H...,W,H,.WX..,,UW,H,,.y,,..,,.H,HY,,HH.,,..Y,..W,,.,H.Y,.1,H,,.,,Y.,,,..,,.,,..,,.1,,..,,H,..W..m.,,..,,,,,H,,..,K..,U,,..,,.,,,.,y..,I..,..,,..,..,,.,,,.,,H,,.4,..,,.1,,H,..,,.,,..,,..,X.,5.5,li..iz,,JRanniliiiliixliiiiiziziwiiiii 53-5955- ' '5-I 2 Page 90 vm1u1wnwfuwHwnwwHwIn1If1m1H1.IwIn1mInwHwInwHwH1rwmW1H11.11n1n1m1mwnwUwmw.I1WwuwK-1mm1LHwu1ruwuumnlum1uin1VHm1m1mmImmmuH.mwm1.Inl1ulumWmmmmmulummmm.mmunmnmlmmmmf 1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 1111 15515111IEE1511i1111111111111111111111.111111.IRM111i1111111111111111.11111111111111.11111111111111111111111.11.1111111.1111111111.11111.111111111111il115.1.111i1.I11IZ11EI11I11.11121li,Ill11I11il1Ill11I11I11I.11I11I21LZ11IJL1III1Zi11I11111Ii?1,I11L11.511.II1I11.115211521Ill1.11FilII!1E111Il1L111liJill1iiHi1ill1Ci1Ii11.21LII1Ili1111ii11Z11EIR11111E1L5111211111ll1L511H13111ii1Pi11L211El1Ll1L521il11L111ii1U11111Lil1LI1L311Jil1.111111A11.11L21111111111l11LELl11Li11.i11ll1I2l 1 1 1 111 15 1 -1 . 9 B' ' 1 .f.5'fN.1 R7 1 1 ' '+-' 1 - ,V 11 .. ,.., -LJ,Wk 'gil'-1- .-..5,i9'i..,,,'-. V . 1 ' ' L' if ' 1 . , I x 1 fy 9 N1515111M13111111111111111111111111111111111111.111111-11.11.111.111111111.111.1111111111111.11111.111.11111.111111.11.111.11.111111111.111111111.11.111.1.11.111111.111.1111111111111.11.11111111111111111111111111111111111.11.111.111111111111111-1111111111111.11.11111111111111111111111111111111111111111111111.11.111111111111111111111111111111.1.1111111111.11.111111111.11111111111111.111111111.11.111.11.1151111.1111111.11.1111111111.11111.111.111111111.11111111111111111111111111111111111111111111111111 11111 111 1 1 1 1 1 1 1 111 1111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111El11i1111IE111i11il1il1FIR1I1111111111111111111111111111L11E111i111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111 111111111111 11111111111111111111111111111111111 1111 1 Page 91 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 11ru1mlmHlmlwIIfHlv1'H 1l l '' H ''W W V ' '' '' ' ' W '' ' ' ' lWff5Yflf!f55fll55951555ffL--l--1--1---1--1------1--1---1---1--'1-n--1------ - ' ' ' ' ' ' '1il1Zi'Zl3i311111111ISV?11211111111Ill1'l'1i1i1i1iii1121121112151111Iii?ill3111112111121iii11121111111Ii?1221111P121ill'Zi'ii i1 i1iil1 Z11111111111121H1iii?1153115511515111316111Eli?ii!ii11iliiii1lliIii?5111122117111iii5i1E1i1ii1Iil11i1552 ' J---11 ----- ---- 11111111111111111111111111111 111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111 mmL 'u ' ' 111 1 111 11 111111111 11111111111111111111111111111111111111111111111111111111111111111111111111 1 1 111111 11 1111 111111 1 1 11 1 1 111 11 1 1 11 H11 1' H :zz -11111111111111111111111111111111111111111111111111 1111111111 1.111111111111111111111111111111 11111111 I ESE 1111111111111111111111 1111111 1111111111-'J11111M 51353111111111.11119111111111111121111111111111111111111.111.11.1111111.111.1111111.11.1111.111.11..11.11111111.11.111.11.111.111.111.11.111.11111111.1.111.111.11.11.1111.11.111.111.11.111.11.111.11.1111.111111.11.11.11.111.111111.1111.111111111.111.11111.1.1.111111111.111.11.111.111111.111111.11.111.111111.11.111.11.11.1111.111111111111.111.11111111111111111111111.111111.1111111111111111.11.11.111.11.1111111111111.11.111.11.111111.11.111111111.111.11.11.111111.11111111111111111111111111111111115LJ-1u1m1U11111 111. 111111 111121 ,11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111L111E11iii11i1Lil11111111ii1lil11111111111L111H1L11111111111i11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111u1u11u111111x111111u1m1111111111111 Page 92 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111s 3 E -I I I Ir I I ui II I l ll A I Illrlll R I I II mu Irnimiilgimvg IE is ii I a GORDON DALE ADAMS . . . Evansville ' L 1 V 'M ' A Gardy K 4-VW A ' I ti COMMERCE ,f U , ' J V , Sigma Alpha Epsilon: Beta Gamma Sigma: Commerce I ' It 77 I - - ' - A All f ' Club, Monastery, Tennis Team, Manager l, Football I 4,2 ,,lIgzuLfTN,N Q Team, Manager 25 Union Board. T' X . Thesis-The Application of Budget Plan of Accounting to 3 lr . ' I Modern Business, 1 I ' I I V . I , 'li ' , ., 5 . BERNICE ALBRICHT . . ..., Normal, Ill. 5 . u v , LETTERS AND SCIENCE X 3 ' , , V. IAL, , if I Achothg lllinO's State Notmal University l, 23 Y. W. C. A. 1 A gg , ' - ' : I Cabinet Counrlilg Vice-President junior Mathematics Club. Z 1 ' f y gl T TRENT ALEXANDER . . ,... Madison 9 f X, , LETTERS AND SCIENCE 7! ' E A y f I Delta Zeta: Y. W. C. A. 1, 2, 35 Hoosier Club l, 23 French Q G' L , W- 179' Club 4, Choral Union l, Z1 Women Students' War Work l 4, ' ' 4 1 , Council 33 Basketball Squad 23 junior Play: Geneva Club, X 'T , Suffrage League 2, 4, Classes Section Badger 3. 2 , -' ' 4 Hg., ,. , . . I , ELIZABETH ALLING . . . . Tallmadge, O. ' H V I . -. - Belly J h ,i - ,. V LETTERS AND SCIENCE ' ' V 5 Oberlin University l, 21 Pythia 4. . it . 1 fl f , Thesis-University Extension from State Universities. :Q 33 i' l SARAH E. ASHBY .... Indianapolis, Ind. A Sally - I LETTERS AND SCIENCE - A Kappa Alpha Thetag W. A. A.p Y. W. C. A. Cabinet Coun- cil 35 Congregational Students' Association Cabinet 3, 4, Hockey Team 4, Assistant Editor Satire Section Badger 3. Thesis--The New Psychic Element in the Short Story. IRMA ATKINS ....... Elkhart, Ind. Tammy LETTERS AND SCIENCE Alph? Chi Omegag Ferry Hall lg Northwestern Univer- sity . Thesis-A Study in the Sources of Shakespeares Plays. FREDERICA ATWOOD ...... Madison Freddy ' LETTERS AND SCIENCE Delta Gammag Vassar College 1, 2. Thesis-The Extreme Romanticism of Maeterlinck, LUCILE KATHERINE AUCUTT . . . Aurora, Ill. Ceil LETTERS AND SCIENCE I Northwestern University 1, 2. DOROTHY HELEN AYERS . . . Dickinson, N. D. A. Z. HOME ECONOMICS Achothg North Dakota Agricultural College l, 2, 3, Eu- thenics 45 Outing Club 45 W. A, A. 4. Thesis-The Teaching of Cooking in Foreign Countries. FLORENCE ELIZABETH BABCOCK . . . M adison NORMAL COURSE! PI-I.B. 2 Superior State Normal 1, 2. 5 . Thesis-Social Evils and Follies in the Time of Addison and Steele. 5 l ...... .. gJ,,,,wmgg II.T..m..I..IIm... ...II I.I..I.I...I.II......I..I.mm min II I. I.IIIIIIIIII..I.I.I.I.I.II..II In I . iiiFiiiiiiiiiiiiiiiliiiiimiiiiiiiiiaiiiiiRiiiinni . ,I I. I I.I.I...,.,..,a Page 93 7 I ,.V,k ily' If ' . , ,... 51657, . , -rV' L, VL i, , ' I H l saN'fL 1:7 , Hf1':i5,1, ,, A Q :lift 'Z -.iZ'EI. , 44. , vfi1,g,ilf'- A ,.,i.' i Q f T' L D f:grr:.,,.. .. . - ' ' X, - , N Q., :ff , 5 I r I XJ 5 S R: , ,ff - 33 -- M. use 1 A A A C , .,,k IA. ..kV K 1 I - r if- ' -214 4,1 ff! ggi? ' I Y ,C if-ii .fy ea Q X F xv, S? ' jf J ,gi X Q K I f ik k 0' '55 4 f I. ,A , .. El . A . 5 ,',' if , .xii ' L 1 , .. . I fif iizii, '1 ': l K 5: ' f Y Ti- ' I il 4 T AA A R 2 I ' A 5 'I ':: k A ll 5 4,1 X b li ,d M Y C NV 5 Y T fy 2' at . f L ii ' -' , T M , I, fe, T I I ? I - :,f 'l A . , N a ' , 2 , f -, V I rvl, I, , .,, ., g .L . . A.. A ,,.. D fit I Qoslj - v I if r I L T - 1 Q A Rli.Ti . '.,, 115' if I7 V '- , Ak 2 f f if ' S Z ,.,'r A I fv,:,1-- ,ga ,qi 1,-., ,,.,f,., .,.- Navi-1 if ,,. r XVALTER MICHAEL BAGEMII-lL . , . Milwaukee Mike MECHANICAL ENGINEERING THOMAS MASON BAINBRIDGE . . Platteville COMMERCE Sigma Alpha Epsilon, Platteville Normal l, 2. HERBERT M. BAKER . . . . janesville Bake COMMERCE Chi Phi, White Spadesg Commerce Club, Secretary, Union Board 3, 45 Production Manager junior Play 3, Production Manager Union Vodvil 4g Student Financial Advisory Committee, Business Staff Daily Cardinal l, 2, 35 Business Manager 4, Class Secretary 4. Thesis-Constructive Accounting. C. l'lAMMETT BALDWIN . . Tulsa, Okla. .Hamm ACRICULTURE gFnga Alpha Epsilon, University of Missourig Monastery U . RUTH LUCILE BALL . . . . Muncie, Ind. Billie LETTERS AND SCIENCE I Chi Omegag Maryland College I, Hoosier Club l, 'lg Suf- rage League 3, 43 University Press Club 33 Y. W, C. A.g Woman's Page of Cardinal l, Z, Advertising Staff Daily Cardinal l, 21 Sorority Section of Badger 3. , .- Thesis-Health Insurance as Recognized by the Medical Profession in the United States, Great Britain and Ger- many. . ANNA-ROY BARDON ...... Superior LETTERS AND SCIENCE Superior Normal l, 23 French Club. Thesis-Papers on Corneille, Racine and Moliere. GRACE M. BARRY ..... Richland Center Tuclie I-IOME ECONOMICS Thesis-Relative Proportion of Rent, Food, Clothing, and Other ltems in a Budget. MARCERY j. BARRY ..... Oconomowoc LETTERS AND SCIENCE Milwaukee Normal l, 2. Thesis-English Novelists and America: A Study in lm- pressions, W'lNIFRED BARTHOLE ..... Glencoe, Ill. UWM.. LETTERS AND SCIENCE Alpha Phi, W. A. A. l, 2, 3, Board 43 Student Council of Defense 43 Basketball l, 3, 4, Class Vice-President 33 Union Vodvil Z, 3. Thesis-The Utilization of Rivalry. ZITA BATZ . . . . Sun Prairie AZN.. LETTERS AND SCIENCE St. Mary's College l, 2. IIIIII..II.,.III.IiK..I..mr......II..I.w.m. HI. H. .-iw., Inv... U.-Ii. Iirnm ..i.iI.m...I,..II..I U. Iirrmmiimmm IiInInIIIIInIIImIIIIImrrrumrrirrmrur I ' ' ' ' Iirrimiimummu Page 94 FRANCIS L. BAYLE .... Glens Falls, N. Y. Pele MECHANICAL ENGINEERING Cornell University l, 2, 3. Thesis-The Gas Turbine. OLIVE BEARDSLEY ...... Chicago, Ill, HOME ECONOMICS- Pi Beta Phi, Lewis Institute I, 2. MARGUERITE BEATTY . . . Des Moines, Ia. HOME ECONOMICS Omicron Nug Euthenics 4. D Thesis-The Vitamine Content of Some Poodstufis as De- termined by Fermentation with Yeast. FLORENCE ESTHER BEATTY . . . A Davenporl, la. HOME ECONOMICS Kappa Kappa Gammag Omicron Nu, French Club l, 2g Euthenics, Treasurer 3, President 45 Keystone -lg Bowl- ing 2. Thesis-The Effect of Mineral Salts on the Physical Char- acteristics of Gluten. 'T ' LOUISE I-IARRIET BEAUCAGE . . . Fonclrdu Lac LETTERS AND SCIENCE Oshkosh Normal I, 2g Pythia 3, 4g Orchestra 3 3 Outing Club 3, 43 Suffrage League 45 W. A. A. 43 1920 Badger Staff. Thesis-The Background of Some of I-Iardy's Wessex Nov- els. ' FRED LOUIS BEHLING . . . . johnson Creek AGRICULTURE 'Agric Literary. Thesis-A Study of Certain Plants Selected for Economic Value in a Cross Between Marquis Spring Wheat and Black-Bearded Spelt. RAY E. BEHRENS . ..... West Allis CIVIL ENGINEERING Triangleg Tau Beta Pig Civil Engineering Society, Vice- President 3, President 43 Wisconsin Engineer, Advertising Manager 3 3 Captain Cadet Corps 3. MARGARET BELKNAP . . . . . Waukesha PUBLIC SPEAKING Oberlin College l, 2, 3g Y. W. C. A. Cabinet: Clef Club. Thesis-Theater Architecture in America and Its Influ- ence on Dramatic Production. WILLARD BERNHARD BELLACK . . . Columbus Bill MECHANICAL ENGINEERING Theta Xig Armour Institute of Technology lg A. S. M. -E. 3, 45 Wisconsin Engineer, Business Staff 35 Assistant Editor 4. Thesis-Mathematical Analysis of a Tesla Turbine and Centrifugal Pump. HELEN A. BENISEK . . . . Anligo Benny LETTERS AND SCIENCE Thesis-The History and Development of the Modern Cem- etery and its Relation to Civic Art. ' 9 ' I I .I I Iiiiimimmii--I.. I Ii 'l G ' 'T 'i l mmIIImiIuiiiiiiiiiimiiiiii Page 95 1l I ' 1A , Q, I if , Q Lf? ' af 5 R Ie 5 .R 1 ' ,fA' A .A4A, . g I - 11. J lf , f ' l 'V I' f 1 '+--Q : .r . - Q V ... . I I T WM -.++A f ' i . I .,... l 'FM if ': N '11- I li AA'-w2 'fi .A' f 'f Y S lg? Z E .. A ':'A ' J 1. I Z , .lI i I in If - if ? q I I I A . .,A-: I ' I ni ' ' A Q, V V: .,:, In z L ! ll v Al l b ' ,. U All - ' A , g , '-, n g-A'l'Efgf42Q' If b. A L I A .V, ,E ., I ,q A gf. ' IIIIIIIII II II H I il 1 I ELIZABETH RHEA BENNETT . . Aberdeen, -S. D. Betty LETTERS AND SCIENCE Kappa Alpha Theta, Oberlin College I 3 Press Club 45 Bas- ketball 2, W. A. A.: Outing Club 4. Thesis-Analysis of Most Popular Women'S Magazine. LEONARD BERCSTEIN .... Duluth, Minn. PHARMACY American Chemical Society, Menorahg Hesperia. Thesis-The Effect ofthe War on Drugs and Pharmaceu- tical Chemicals as Revealed in the Chemist and Druggist of London. OLIVE MACDALENEBERRY . . . Dakota, Minn. LETTERS AND SCIENCE, PI-LB. Winona State Normal, Winona, Minn.: Pythia 3, 41 S. G. A., Representative 3, 4, Council 4. Thesis-A Test in Arithmetic. CILADYS BEVERIDCE . . . . Lake Mills Glad LETTERS AND SCIENCE Alpha Omicron Pi, Milwaukee-Downer l, Z. LUCILE W. BIEBERMAN . . . . Duluth, Minn. LETTERS AND SCIENCE Kappa Kappa Cammag Mystic Circle. Thesis-The Treatment ofOur Soldiers alter the Civil XVar. VERA LOUISE BIERBAUER . . . Mankato, Minn. LETTERS AND SCIENCE Milwaukee-Downer College lg French Club. VIEVA MARIANE BIGELOXV . . Madison . Ve HOME ECONOMICS Euthenics 3. Thesis-Clothing Budget for College NVomen. MARVEL MILNE BJORNSON . . La Moure, S. D. ..Vee.. LETTERS AND SCIENCE Tgamestown College l, 25 Dakota Club 35 Taychopera Camp TlIZSiS-Victor I-lugo. MARJORIE HELEN BLACK . . . Flint, Mich. Marge HOME ECONOMICS Michigan Agricultural College l, 2. LoIS V. BLACKBURN ...... Palmyra LETTERS AND SCIENCE Achothg Carroll College l, Z. Thesis-Aptomism of Browning'S Dramas. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III I I I IIIIII III IIIIII III IIIIIIIII IIIIIIIII IIIIIIIIIIIIIIIIIIIIII II IIIIIII IIIIIIIII III IIIIIIII IIIII I u i III II II I II III II IIII I I I Page 96 I DAVID JONES BLATTNER . . . -Sulpl1ur,Okla. Dave ELECTRICAL ENGINEERING Kappa Epsilon3 Tau Beta Pi3 Eta Kappa Nug Varsity Track Squad 2, 3. Thesis-The Economy of Hydroelectric Power Develop- l'TlCI'lt, MARY ZILPHA BOI-IAN . . . Avoca Za LETTERS AND SCIENCE Alpha Xi Deltag VV. A. A.3 Bowling 3. Thesis-A Proposed Plan of Welfare for Working Girls in a Department Store. KATHRYN M. BOLL . . . . . . Rice Lake ..KiHie.. LETTERS AND SCIENCE Chi Omega, Castalia 2, 33 S, G. A. Council 33 Y. W. C. A., Cabinet-Council 3, Cabinet 43 W. A. A.3 W 3 Basket- ball 1, 2, 33 Baseball l, Z, 3, 4. Captain 2, Varisty Baseball 2, 33 Vocational Conference Committee 3. Thesis-I-Iistory ofthe Wisconsin Industrial Commission. IDA KATHRYN BOLLENBECK . . Madison Hide.. ' I-IOME ECONOMICS Euthenics 2, 3, 43 Ski Club I, 23 Germanistische Gesell- schaft I, 2. Rgieiis-Detail Study of Liquifying Micro-organisms in I . HELEN AUGUSTA BORCHERS . . . Whiieuialer LETTERS AND SCIENCE Pythia, Vice-President 43 Y. W. C. A. Thesis-Geographical Influence in Cities of Wisconsin. GRACE XVEYMOUTH BORDELON . . Bunkie, La. Grace Deahu LETTERS AND SCIENCE Louisiana State University 1, 23 Suffrage League: Y. W. C. A.3 Archery, Thesis-The Influence of the Works of james Fennimore Cooper upon Certain French Writers. AAGOT M. K. BORGE . ' . . . . Madison ' C MUSIC SUPERVISOR Clef Club I, 23 Glee Club 23 Choral Union I, 2. LUCILE DOROTHY BORNE .... Toledo, O. Cid LETTERS AND SCIENCE Germanistische Gesellschaft 3. Thesis-The Personal Element in the Works of Theodore Storm. MARION FERN BOYCE .... . Milwaukee HOME ECONOMICS Gamma Phi Beta3 Milwaukee Normal I 3 Mystic Circle. Thesis-Study of Food Rations. GAIL VANDEN BRAAK . . . Green Bay ..Van., COMMERCE - Delta UpSiIon3 Leland Stanford junior University 1. 2 lam' Q.,- III.IIInmi-will--IIIIIIIIIIIIIWIIIII-Iim. ...III 1.1. I I n I ininIinillIlilluinimiiIIIIIinliminiiiiliiiimiiimm II Page 97 Imiiiwt Eli E25 Elf E55 55? SIE EIS iii ESE EEE ,ii il? EE EE E els EIS gig EEE i E s e 1 i 1 mum ii ni mmmim mum in in EE ,, , ,III I lim: I Inu I u Inu Iii I-IELEN MAE BRADLEY ...... Hudson LETTERS AND SCIENCE ' Hamline University l, 2. Thesis-The Evolution of Opinion as to the Cause of De- pendence. GRACE CATHERINE BRAY . . Elkhorn Torcl-ty , LETTERS AND SCIENCE Alpha Gamma Delta. Thesis-Theory of Representative Government in Ameri- can Politics. ERWIN C. BRENNER . ..... Milwaukee 'AEIIIH CHEMICAL ENGINEERING' ' Alpha Chi Sigma, Phi Lambda Psi: Tau Beta Pig Chemical Engineers' Societyg Engineering Society, Track l, Z, 3. Thesis Course. ANN BRIGGS . . . East Grand Forks, Minn. MUSIC Delta Gamma: Glee Club, President 43 Keystoneg Mystic Circleg Clef Club. Thesis--The Standardization ofthe Measurement of Pub- lic School Music. , CHARLES JAMES BRINKERHOFF . . Neenah I-Bffflkn PHARMACY Thesis-The History and Revision of the Pharmacopeias ofthe United.States of America. ERNEST JAMES BROWN . . . Madison ..E.-1... Ajim.. MEDICINE Student Senate 23 Secretary-Treasurer 1919 Class 2: Man- ager Outdoor Players Z1 Student Financial Adviser 2, 3, 45 Publications Committee 2. Elections Committee Z. Thesis-Topographical Anatomy. HELEN CONVERSE BROXVNE . Waupaca Brownie LETTERS AND SCIENCE Kappa Alpha Thetag XV. A. A.g Varisty Bowling 2, Vice- President Green Button. Thesis-The Wisconsin Primary Election Law: Its Rise and Development. KATHRYN K. BROWN ..... Rhinelander LETTERS AND SCIENCE Thesis-Class Barriers in Galsxvorthy. PORTER I-I. BROXVN ..... St. Louis, Mo. COMMERCE Kappa Sigma, Mandolin Club l, 2, 33 1919 Badger Staff. RUBEN S. T. BROXVN ...... Madison Rube - LETTERS AND SCIENCE Plfilomathia lg Haresfoot 25 Glee Club 3, 43 Union Vod- VI . Thesis-The Hague Peace Conference and its Relation with the Present Problem of Internationalism. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I I II I IIIIII II IIIIIII IIIIIIIIIIIIIIII IIII III III IIIIII II III I IIIII III III IIII ,I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I P a g e 9 8 QIIIIIIIIIIIIIIIIIIIIIIII E l'Q?liIJiiKIIIIII.II ag: se Sis ,E- :QE sis I A I Im mu IIII Im ' ' ' l..,-..,....,..,...,,.,.. .....a,...,............- -. l ,...L, . ' ll ANTON WILLIAM BRUNNER . . Durand ..TUny,. PHARMACY II Delta Phi Epsilon. ghisis-Pharmaceutical History of the Chippewa River a ey. RUDOLPH H. BUCHHOLZ . . . Sl. Maries, Idaho Buck CIVIL ENGINEERING Civil Engineering Society 3. Thesis-The Design Of a Rc-enforced Concrete Arch. CARLYLE WILLIAM BURGESS . . Duluth, Minn. JimnIy MECHANICAL ENGINEERING Phi Kappa Psi: Case School oi' Applied Science l, 25 A. S. M. Eg Engineers' Crew. Thesis-Investigation ofthe Increase in Horse-Power Ca- pacity ol' a Gas Engine by Supplying the Air Under Pres- sure. EDITH ELEANOR BURKE . . . . Madison HOME ECONOMICS KATHERINE E. BURTNESS . . . Sioux Ciiy, Ia. Kay Bee LETTERS AND SCIENCE Lake Forest College lg Morningside College 2g W. A. A.g Hockey 45 Dancing 4. Thesis-Strength Tests of Group Muscles of Children. ETHEL BYRNE ....... Milwaukee LETTERS AND SCIENCE Milwaukee Normal 1, 2. Thesis-Dorothy Wordsworth. HELEN CAMPBELL ...... Milwaukee LETTERS AND SCIENCE Milwaukee Normal School 1, 2. A LEOTA MAE CAMPBELL . . . , Toledo, O. 'ALoLsie LETTERS AND SCIENCE National Park Seminary I 3 Western Reserve University 2. Thesis-Professional Aspects of Nursing in Wisconsin. JOHN WEBB CANCE . . . . Galesville V Ajawn.. COMMERCE Phi Kappa Psig Beloit College 1, 2. Thesis-Marketing the Securities of the Chicago and Northwestern Railroad. THOMAS WILSON CAPE ..... Doclgeville LETTERS AND SCIENCE - Thesis-System of Promotions in the Public Service. I I IIIIIII IIIIIIIIIIIIII I I IIII III I II I I I I I I IIIIIIIIIIIIIIIIIIIIIIImIIIIInIIIIIIIIIIIIIIIIIIIIIIII I Page 99 X 51 3 , R 'gi Z- , , in In In ir II ii Iiiii min III un RACHEL j. CARPENTER . . . Iron River, Mich. HOME ECONOMICS Thesis-The Clothing Industry in japan. RACHEL BEAL CHADWICK . . Detroit, Mich. ..Ray.. LETTERS AND SCIENCE Delta Delta Deltag Michigan University l, 2, W. A. A. Board, Wearerg Varsity Basketball 2, 4, Hockey 33 Varsitiq Baseball 3, 4g Archery 45 Y, W. C. A.,Cabinet unci 4. Co Thesis-The Statical Work Done by Human Muscles in Continued Contraction. HAROLD COWAN CHEETI-IAM . . Milwaukee . Cohen CHEMISTRY Kappa Sigmag Phi Lambda Upsilon, Phi Beta Kappa, Alpha Chi Sigma, Union Board 3, 4. Thesis-Preparation of Phloroglucinol from Diethymal- OYIZLC. WVILLARD A. CHIPMAN . . . Stoughton E H Hemp.. MEDICINE Phi Beta Pig Sigma Sigma. Thesis-The Nerve Endings ol' the Suprarenal Gland of Mammals. . MINC-HINC CHOU ..... Shanghai, China CHEMISTRY Phi Lambda Upsilonp Tsing I-Iua College lg International Club, Vice-President, Wisconsin Chinese Students' Club, President, Editor Chinese Students' Monthly. IQEATS S. CHU ...... Uingpo, China LETTERS AND SCIENCE Tsing Hua College lp Artus, Hesperia, President 4, Vice- President 3, Treasurer 41 Chinese Students' Clubg Interna- tional Club, Secretary 45 Accountant 1920 Badger. Qaesis-The Operation ofthe Bank of England During the ar. MAvIs CHUBB ...... St. Louis, Mo. LETTERS AND SCIENCE W. A. A. 3, 43 Red Domino I, 2, 3, 4, President 41 Key- stone 3, 43 Basketball 1, 23 Dancing Honors Bgjunior Play 35 Cardinal Board 35 S. G. A. Cabinet 3, 4. MILDRED CLARK . . . . jcmesville ANI COMMERCE Beloit College l, 2: Y. W. C. A.g Cardinal 4, Badger Staff 4. Thesis-Analysis of Control as Affected by the Organiza- tion ofa Mail Order House. LILLIAN CLARK . . . . Oshkosh MLM LETTERS AND SCIENCE Delta Gamma, Smith College 25 My stic Circle, Hockey I. Thesis-The G. A. R. and the G. A. D. ERNEST CLARKE .... . Madison PI-I,B. Superior Normal l, 2. Thesis-Methodism's Early Interest in American Educa- tion, iiI.mminii..iiIimuiI.iImi.iII.I...iiiIiiI limimmmiInIIiIInIiiIIiiIiiiiiiuiuimiiuiiii Page 100 ELMER RUSSELL CLARK ....... Lodi ' AGRICULTURE Alpha Zetai Ag Literary Society, President 35 Country Magazine, Editor 3. 'gnesits-Frost Resisting Qualities ol' Various Strains ol' a a, VIDA A. COAPMAN . ...... Kilbourn LETTERS AND SCIENCE Alpha Xi Delta. Thesis-A Message from William Morris structionists of Today. RUTH EUCENEZCOFFMAN . . . Rufus HOME ECONOMICS University ol' Illinois l, 2, 3. to thc Recon- . Pana, Ill. V. IRIS COLDWELL .,.... Mazomonie HOME ECONOMICS Alpha Camma Delta. ARTHUR VINCENT COLE . . . . Mauslon MEDICINE Gamma Tau Betag Ripon College l, 2. Thesis-Topographical Anatomy. FLORENCE E. COLLINS . . . JOURNALISM . Tipton, Ia. Chi Omegag Theta Sigma Phi5 Coe College 1 5 1919 Badger Staff 35 Daily Cardinal Staff 3, 45 Consumers' League Board 45 Press Club 45 1918 Home Coming Committee 4. Thesis-XVhat One Hundred Farm Women Wish to Have Printed in Their Section Of a Farm journal. MARY BELLE CONINE .... Nowala, Okla. HM. B... LETTERS AND SCIENCE Randolph-Macon Woman's College 1, 25 W. A. A,5 Outing Club5 Y. W. C. A. Cabinet Council 3. 45 Varsity Tennis 35 Womens War Work Council 3. Thesis-Operation Characteristics of Audions. LAURETTA B. CONKLIN .... Chicago, Ill. Laurie LETTERS AND SCIENCE Kappa Kappa Gamma5 Mystic Circle5 Spanish Club 1, Z, 3, President45 W. A. A.5 Y. W. C. A.5 Tennis Team, Captain 1, 2, 35 Basketball Team 25 Spanish Play 3. Thesis-Translation of a Spanish Classical Drama, El Desden Con el Desdenf' RUTI-I MARGARET CONLIN .... Madison Connie LETTERS AND SCIENCE Mathematics Club 3, Secretary-Treasurer 45 Outing Cl b 3. Thllasis-Algebra and Calculus in the Finite Complex Plane. BEULAI-I M. CONNELL . . . Menomonee Falls Bee LETTERS AND SCIENCE Achothg Milwaukee Normal 1, Z5 Spanish Cl'ub5 Y. W. C, A. Thesis-The Back to the Land Movement. is .wII..IIIIi.II..IwI.w.II.m..i..i..v.l IIiiIuiinIinuiIIiIniinimiiimmmimiiii Page 10 ..,, I A K X 2 ADI 4 J 4565 3 Z5 ,,.. W-.. I I n III III mu I II Imru II mimi I IIIIIIIIIIIIIII I III I I I I I mini I RAY COOLEY ....... Chicago, Ill. HOME ECONOMICS Achothg Omicron Nu, W, A. A., Euthenics, Wahzeda Camp Fire, Baseball 1, 3, 4, Wearer, Indoor Baseball l, 3, - 4, Varsity. Thesis-A New Stain for the Bacterial Colonies in the Lit- tle Plates. i GLORIA O. COOPER ....... Baraboo LETTERS AND SCIENCE Alpha Gamma Delta, Red Gauntlet, Secretary 2. Thesis-The Isolation of Cholesterol and Phytosterol by the Digetonin Method. MARIONJULIA COREY . .... De Kalb, Ill. LETTERS AND SCIENCE Northern Illinois State Normal School 1, 2, W. A. A., Outing Club, Board 4, Wearer-, Varsity Basketball 4, Varsity Track 4. Thesis-Strength of Normal School Children as Tested by the Method O E. G. Martin. ARTMAN I-IOVEY DAI-ILE . . . Madison . AAN.. MEDICINE Gamma Tau Beta, Lawrence College 1. Thesis-Topographical Anatomy. ELEANORFAIRCHILDDANA . . . . Eau Claire LETTERS AND SCIENCE Gamma Phi Beta, Milwaukee-Downer lg W. A. A. 3, 43 Tennis Z. Thesis-Seneca and Marlowe. MARY FLORENCE DANFORTH . . Washington, Ill. HOME ECONOMICS Illinois Wesleyan University lg Euthenics Club 3, 4. Thesis-Co-operative Kitchens: Past, Present, and Future. FLORENCE DEAKIN . . . Waukesha Teddy LETTERS AND SCIENCE Gamma Phi Beta, Milwaukee-Downer College l, 2, French Club 3, 4, Cardinal 3, Coed Cardinal 3, Badger 3. Thesis-A Study of I-Iardy's Women. WILLARD O. DEI-INE . . Waupun Ajoe.. MEDICINE Alpha Kappa Kappa, Marquette University l, Z, Biologi- cal Seminar l, Z. Thesis-Etiology of Epidemic lnfiuenza. EDWARD Louis DEUSS ..... Sheboygan ..Ed.. LETTERS AND SCIENCE Chi Phi, Iron Cross, Sigma Delta Chi, White Spades, Stu- dent Council 3, President 4, Hesperia l, 2, 3, 4, Forensic Board 4, Press Club 4, Daily Cardinal Z, University Editor 3, Managing Editor -ipjoint Debate 3, Semi-Public Debate 3, Publicity junior Play Committee 3, Forensic Editor 1919 Badger. ROY MARTIN DEWITT . , . Montfort LA NV Phi Alpha Delta, Platteville Normal School l, 2, Black- SLOYIIGTI. IIIWIIInIIIIInII-IIIIIIIIIIIIIIIIIIIIIIII .I IIIIIIIIII InIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIII Page102 . I I I I i 'I I i I I a I STEPHEN T. DEXTER . , , Elroy Sieve AGRICULTURE Northland College I. 2, 3: Y. IX4. C. A. Thesis-Feeding Dairy Calves. DOROTHY DIMOND .... . Albany, Ill. MEDICINE Thesis-Topographical Anatomy. ANNETTA DONKLE . . . . For! Ailzirison Neal LETTERS AND SCIENCE Kappa Alpha Thetag Northwestern University I 5 W. A. A.1 Dancing 13 Baseball 3. Thesis-'I he Development of the XVht:at and lvlilling In- dustry in Xvisconsin. DOROTHY R. DOPP ..... Davenport, I a. ECONOMICS lgpha Gamma Deltag Iowa State University I, 2, 35 Py- t 'a 4. Tlliesis-The Replacement Of Men by Women in lndustry. GRETCHEN DUNAWAY . . . . Sikesion, Mo. LETTERS AND SCIENCE Kappa Kappa Gammag University of Missouri: Glee Cluh. Thesis-Development of Soldiers' Homes in the United States Since the Civil War. GEORGE E. DUNN . . . . Milwaukee Bunk CHEMISTRY Ivlilwaukee Normal School I, Z. Thesis-The Development of New Coal Tar Bases for Dyc- stuff Manufacture. MJENNETTE DUNWIDDIE . . . Delavan ujimmien ' HOME ECONOMICS Thesis-Study of Dietaries in Army Camps and Base Hos- pitals. I-IENRYJ. DUWE .... . Middleton Do we COMMERCE Commerce Club. Thesis-An Outline for a Course in Cash Accounting. HOWARD O. EATON . ..,.. Madison LETTERS AND SCIENCE Hesperia I. RICHARD HOIT EDE . . . Madison Dick CHEMISTRY Sigma Nu. l Page103 iiiimiiiiii iiimiiiiiiiiiiiiim I I I HiiiIIiIIiiIIIIIiiIiiIIIIInIIIIIiiInIiiIiiimiiiiiiiiiiiiiiiiiii I 4 W 1 A IW ? ' T 4 ' f.., K I I Q: iiii! 3 f CHARLES ARTHUR EDWARDS . . Lewistown, Mont. COMMERCE Dakota Wesleyan University I, 2, 33 Football, Assistant Coach 4. BERNADO W. ELSOM ., . . Madison Doc LETTERS AND SCIENCE Star and Arrow 3, 45 Artus 4g Cross Country 43 Track 33 Athletic Board 4. Thesis-Public and Private Schools in Wisconsin. LOUISE L. EMERSON ,... Ekalalza, Mont. Louie LETTERS AND SCIENCE Pythia 2, 3, 4, Rocky Mountain Club I, 23 Y, W. C. A. Cabinet Council 3, 4, Blue Dragon, Secretary 4. Thesis-The Woman Suffrage Movement in Montana. MARTHA ENGEL . . ..... Sun Prairie LETTERS AND SCIENCE Milwaukee-Downer College 1, 23 Y. W. C. A. 3, 45 Suffrage League 43 S. G. A. Board 3. Thesis-Shrubs ol' Madison and Vicinity. SAMUEL NOAH EPSTEIN . . . Madison ..Eppie.. CHEMISTRY Thesis-The Manufacture of Resorcinol. QIOSE ESCABI ..... Mayagiiez, Porto Rico MEDICAL SCIENCE Thesis-The Relative Size and Position ofCertain Abdomi- nal and Pelvic Viscera in the Foetus Child and Adult. IVIARIE M. ESCH ....... La Crosse lWari LETTERS AND SCIENCE Pi Beta Phi: La Crosse Normal School I, Z1 Suffrage Lea- gueg Consumers' League. Thesis-The Development Ol' Harpers Magazine from l85O to 1900. I-IARRISONEVANS . . . . . Shuquaiak,Miss. LETTERS AND SCIENCE Phi Delta Phig University of Mississippi I, 2. IVIILDRED CAMPBELL EVANS . Grand Rapids, Mich. LETTERS AND SCIENCE Editor-in-Chief NVisconsin Literary Magazine 4. Thesis-Alfred De Vigny: The Philosophy Of His Poetry. LUCILE EVERETT . . . . Denver, Colo. Evie LETTERS AND SCIENCE Delta Delta Deltag W. A. A., UW Wearerg Hockey Team 2, 4, Varsity 4, Bowling Team 33 Dancing Team 43 Honors 4, Assistant Business Manager 1918 Badger. Thesis-The Statical Work Done by Human Muscles in Continued Contraction. .www-I liiilwiimiiiiiiiimliii .I .I I II mi iliiiliiililiiiiiiiiiliiiGliiiiiiiiiiiiiiiliiiiiiliiiml 'mmm' mn I Page 104 JOEINA M. EWE .... . Lo Crosse jean LETTERS AND SCIENCE Germanistische Gesellschaft 2, 35 Cercle Francais 4. Thesis-l'Iorace's Philosophy ol' Life, ISAREN FREDRIKKA FALK . . Sloughlon Colonel LETTERS AND SCIENCE Alpha Omicron Pig University ol Chicago I5 Pyihia 2, 3: Consumcrs' League 3, 45 S. G, A., Executive Council 4: Y. NV. C. A.: Cardinal Advertising Stall' 4. Thesis-Rise of Industrial NVorkcrs ol the XVorlcl. JOHN MERRILL FARGO . . . . Ml. Horeb Eddie AGRICULTURE Philomathia Literary Society: Agric Crew l, 25 Agric Bas- ketball 3. Thesis-Cotton Seed Meal and Silage vs. Corn, Cotton Seed Meal and Silage at a Ration for Fattening Steers, CLARA VIERLING FAUERBACI-I . . . Madison LETTERS AND SCIENCE Kappa Kappa Gammag University Orchestra 25 Union Vodvil 2. LAURA ELIZABETH FAVILLE .... Lake Mills HOME ECONOMICS Alpha Phi5 Omicron Nug Bowling l, Z, 35 Varsity Z5 Hockey l, 2, 35 W. A. Board 3, -L MARION E. PAY ....... Madison LETTERS AND SCIENCE Kappa Kappa Gammag Class Bowling Team l 5 Class Bowl- ing Squad 2. KATHERINE FEDDE ..... Peilone, Ill. In ..K.. LETTERS AND SCIENCE Delta Delta Delta5 Clef Club 3, 4, Treasurer 45 Castalia 35 Musical Director 3 5 Scoops Club 25 Suffrage League 35 Class Bowling Squad 35 Sophomore Dance Committee5 Co-ed Cardinal 25 Advertising Manager Badger 45 Assistant Advertising Manager 3. Thesis-The Conflicting Natures in Grillparzer as Shown in I-Iis Life and Dramas. GLADYS FELLOWS . ...... Racine LETTERS AND SCIENCE Chi Omegag W, A. A.5 Y. W. C. A.5 Indoor Basehall l, Var- sity I, 35 Track I, 35 Hockey 2, Varsity 3, 45 Wearerg Blue Dragon, President 45 Union Vodvil 2. AUCUSTAR.FELSHER . . . . Madison Srniles LETTERS AND SCIENCE Menorah Society, Secretary 1, 2, 35 Executive Board 45 Banquet Committee 2, 35 Consumers' League 3, 45 Minne- toska Camp Fire Girls 45 Cercle Francais 45 University Zionist Society 3, 45 Germanistische Gesellschaft 2. 35 Women's Equal Suffrage League 2, 3. Thesis-Determination of the Solution of Boric Acid in Solution of Ammonium Dorate. WIRTI-I FITCHFERGER . . . Chattanooga, Tenn. ECONOMICS University of Chattanooga 15 Artusg Ski Club 45 R. O. T. C., Captain 35 Y. M. C, A. Cabinet 3. A Thesis-Peace Time Extension of War-Risk Insurance. 'Q v 2. A - X, 5 f 5 I f I i-i I - A f I W - 'f,. , , I af f' 'ivr ' ' ' I I fr W 3 rj , 2 X .V I V , , Alf 4 as in A 'fi .ee . ,,.... .55 1.. Z! V yll. .Q ,. Q. V: . .. ' ?' 1 2 lA ' 1 li . fv-. - J li lilsizif f .ff ill 'I 5'5 i ,Z-, ,V ,.. .,,, , A .,,.. ,.'. fi X v..' -iii Q . m .,.- -.'. .IIIIII-IIIiIii.I.IIIiI.iiiiiiiw.iI.ii.IIIIII..iI., IiiIiiIElililliiiiiiiiiiiiiiliiiiiiII.IIIiIIiiiiiiiiiiiiiiiiiiiiiii Page105 MABLE GRACE FERNALD . . . . Madison HOME ECONOMICS Swimming lg Tennis I, 2. BLANCHE FERREY ..... St. Paul, Minn- LETTERS AND SCIENCE Delta Gammag Winona Normal l, 2. ghesis-A Study of Some of the Children in Dickens' ove s. MARGARET FRASER FERRIS . . Osage, Ia. ..Peg.. HOME ECONOMICS Alpha Xi Deltag Milwaukee-Downer College lg Consum- ers' League 2, 3, 45 Euthenics Club 3, 4g Suffrage League 45 Congregational Students' Association Cabinet 4. Thesis-Some Conditions Affecting the Health and Morals of Women Employed in Mercantile Establishments, Hotels, Laundries, and Garment Factories. HAROLDM. FIELD . . . . Oelwein,Ia. ..Hal.. LETTERS AND SCIENCE Lambda Chi Alphag Edwin Booth I, 2, 3, Treasurer 4, Union Vodvil 23 French Play 35 Iowa Club, Red Domino- Edwin Booth 2, 3, junior Play 3, Senior Play 35 Junior Open 33 Assistant Chairman Camp Entertainment Com- mittee. Thesis-The Origin of Speech: Some Studies in Emotional Reactions. LUCY LOUISE-GARBE FINNER . . Dodge Loose CHEMISTRY Thesis-Monarda. GRACER.FINUCANE . , . . Amiga Figgie HOME ECONOINHCS Euthenics. FINLEY LELAND F 1sEEck . . Terre Haute, I nd. Fizz civit ENGINEERING Triangle, Hoosier Club lg Gym Team lg Wisconsin Engi- neer, Business Manager 4. IVIARY T. FITZMAURICE . . . Beaver Dam Fitz HOME ECONOMICS Thesis-The Study of Milk Agae as a IX-4edian for Various Bacteria. CATHERINE LORETTA FLEMING . West Allis john LETTERS AND SCIENCE Alpha Omicron Pig Milwaukee Normal l, 25 Red Domino 3, 4, junior Class Play 3. Thf3ifgThe Word of William Jennings Bryan from 1913 EO . Wl1.1,1AMj.FocRE . , . . . Chicagalll. MEDICINE University of Chicago I, HThesis-Congenital Anomalies and Malformation of the CSIT. . .-iHiiniI.iiim.ii.ii..i..iii.i,.ii. iniiiiiniiiiuiiniinuimiiiiiiiinwiii-iii i Page 106 awww IW -'I ' L.,,............ -.t....-..,. ,.L...,-.:...: '-.:....:t.....L. .,. sig EI I IRENE FOLCKEMER ..,.. Camp Point, Ill. LETTERS AND SCIENCE Alpha Omicron Pig Rockford College I, 23 Glee Club 3, 43 1920 Badger Staff 4. Thesis-The Education ol' an Enlisted Man in Peacc Time. MILDRED LUCILE FRAZIER . . . Madison FrazlIe LETTERS AND SCIENCE Phi Beta Kappag Y. W. C. A., Cabinet Council: W. A. A. 2, 3, 43 Castalia Z, 35 Bowling Z, 3. Thesis--Motional Impedance of Marine Receivers. ERNEST FREYMILLER . . . Wooclman DFW.. MEDICINE H Hesperia 2. 3. 4. Thesis-The Action of Dyes on Experimental Animals. EVELYN A. FRISH ..,.... Madison NEW.. LETTERS AND SCIENCE Thesis-Soil Fungi, MIRIAM FRYE ........ Madison LETTERS AND SCIENCE Phi Beta Kappa. Thesis-The Paper Money Literation During the War. IRENE E. GALVIN . . . . Benton, Ill. Rene LETTERS AND SCIENCE Northern Normal and Industrial Schools l, 2. Thesis-The Effect of Solvents on the Decomposition of Methyliodide. RACI-IAEL MARIE GAUSMAN , . Madison MUSIC Choral Union 3, 4. I-IULDAH GERDS' . , A . . . . Milwaukee LETTERS AND SCIENCE Thesis-Co-operation Between the Federal Employment Service and Corporation Employment Departments in the Reduction of Labor Turnover. MARTHA GIBBON ....... Madison LETTERS AND SCIENCE Thesis-The Relation of the Proposed System of Com- pulsory Health Insurance to the Insurance Companies Now Operating Within the State. J. CURRIE GIBSON ..,. . Oshkosh Gibbie COMMERCE Glee Club. Tlhiesis-Business Budgets and Capital Stock at no Par a ue. 'Q ,f 91 .Qu jf .iii..I..I..IiiIii.I..I.iiiiiiiiiiiiimiiiiiiii-iii .. I i I I i iiimiiiiiiininIimiiIiiiiiiiiii-iiiiiiiiiiiiii Page 107 iii.iiiiiiiiwiiiiiiiiiiii iimiiiii iii in ii iiiiiiiiiiiiiiiiiiiiiiii i . I ig- f . ,Lk, H i ,,., 1 X I . . 'i1 ' f I I .L,L I .gi I 'ff'jE, 22 1 .I S1 i- A QI-.g.1qIQf2:29Tir1 1:54 61-12 f'.-,. i fl-3 f2' :'. A A .y . . .. ' '-L. T .r. f A . ccls ,,V. . I Q ,V.. FV Q . .Ak.:,, . . ,4,,. ,AA X . , , 51. fr , 152' 'i fgf.. I f A I .,.. ' I: I .. . a..f.-W X' - If. -i .. -fy -.-M ' f - we - . I 5 i l Q. I.. z r L. E1 W W. . I M . Ea? Z A 7 ' .X al I I tl . Ia i' I ' I A 'I V, 2 It '- I 'El' - ,Q .4 - f-- , .. - .,g. 5 , 'f f '-' I , .,,.. f f i ii II v in II I I I I an I I viii nl nu I HERBERT GLAETTLI ...... Milwaukee Hub CIVIL ENGINEERING Triangle: Tau Beta Pig Civil Engineering Society, Gym- nasium Team 35 Band I, 2, 3, Orchestra Z, Engineers' Min- strels 1, Union Vodvil 3. GRACE C. GODDARD ...... Madison LETTERS AND SCIENCE Pi Beta Phi, Glee Club 3, 43 Choral Union 3, 4. Thesis-Some Studies in Bret I-Iarte's Development of Character. -BENJAMIN GOLDEERG . . . Antigo Goldie MEDICINE IVIADELINE HENRIETTE GOLDMANA . . Milwaukee Ullfladdyu LETTERS AND SCIENCE W. A, A., French Club, Dancing Honors, Dancing Team 3. Thesis-Papers on Corneille, Racine, and Moliere. HENRY LAWRENCE GOTFREDSON . . Green Bay DAHGRILII COMMERCE Sigma Alpha Epsilon, Tennis Club: Commerce Club: Var- Sity Team Z, 3, -lg Intramural and Interclass Baseball 3. GENEVIEVE GOUCH . .... Booneville, Incl. HOME ECONOMICS Alpha Gamma Delta: Euthenics 2, 3, 4, Consumers' League 2, 3, Treasurer 2: Tennis 25 Secretary Yellow Tassel 3. JAMES A. GOUGH . . . . . Sugar Bush MEDICINE Phi Beta Kappag Sigma Sigma: Gamma Tau Beta. Thesis-The Arterial System oflvlan as Seen by the X-Ray. VIOLET E. COULD .,..... Norwalk LETTERS AND SCIENCE La Crosse Normal I, 2. Thesis--Indian Relations in Virginia Between 1740-1760. ELSIE DOROTHY GRABER . . . Mineral Point MEM.. I-IOME ECONOMICS Thesis-Relative Proportion of Food, Clothing, Rent, and Other Items in the Budget. DOROTHY PATTERSON GRACE . . Oak Park, Ill. LETTERS AND SCIENCE Pi Beta Phig lviystic Circle. Thesis-The Women ofj. M. Barrie. .IInIinIIIIIIIinI.IIniIniI..I..Ii.Ii.II.-Milli.. , IIIiiIinImIm.mmIIIinnummu-Immiiliiiil I y I Page 108 LOTTIE C. GRAF .... ' .... Sparta LETTERS AND SCIENCE La Crosse Normal School I, 2g Pythia 45 Y. XV. C. A. 3, -lg SuHrage League 4. 'Ihesis-l'he Effect of Housing on the Assimilation of the Immigrant. FLORENCE MARIE GRAPER . . For! Atkinson Bud'A HOME ECONOMICS Omicron Nug Euthenics 2, 3, -lg Vice-President -lg Outing Club 43 W. A. A. Thesis-The Effects Oflvlineral Salts on the Physical Char- acteristics of Gluten. IXflARION C. GRATZ .... Pemberton. .N. j. .-Gflllilldu LETTERS AND SCIENCE Swarthmore College l, 2. JAMES E. GREENBERC . . . New York, N. Y. LETTERS AND SCIENCE Iowa State College I: Athenae Z, 3. 43 Censor 43 Sociedad Hispanica 2, 3, 4, Vice-President 41 Menorah Society 2, 3, 4, Treasurer 43 Ski Club 25 Swimming Squad 23 Spanish Play 3: Circulation lvlanager Daily Cardinal 2: Circulation Manager Badger 4. Thesis-Export and Import Railroad Rates and Factors in Foreign Trade, DOROTHY N. GREENE ..... Milwaukee LETTERS AND SCIENCE Milwaukee Normal I, 23 Pythia 3, 4. Thesis-The Spirit Of Personal Liberty in Wordsworth and His Immediate Predecessors. MILTON E. GRIEM . .... New Holstein Bill AGRICULTURE Alpha Chi Sigmag First Regimental Band l, Z, 3, Freshmen Baseball. MAE GRONDYKE .... Crawfordville, Ind. HOME ECONOMICS Kappa Alpha Thetag Western College lg Indiana Univer- sity 25 Omicron Nug Euthenics Club 4. Thesis-Home Work in the Clothing Industries. ALMA ELEANOR GROSS . . . . Duluth, Minn. LIBRARY COURSE Thesis-Arthurian Romances as Classics for Children. HAROLD MARTIN GROVES . . . . Lodi Harry AHeclc LETTERS AND SCIENCE Phi Beta Kappag Delta Sigma Rhog White Spadesp Iron Crossg Hesperia, President 4g Sophomore Semi-Public Debate 23 Student Council Of Defense 3, 43 Forensic Board 43 Intercollegiate Debate 2, 3g joint Debate Closer 35 Winner junior Openg Winner Senior Open Oratorical Con- test, Class President 43 President Student Senate 4. Thesis-Intercollegiate Debating. ' MADELEINECUILLEMIN , . . Norzhllflilwaulzee LETTERS AND SCIENCE ' Thesis-The Sulphur Content ofthe Keratins. '-s I.mi..i..w.i..i..iii.I... ...Ii iI.Ii.I.. I. ii EiiiiiiiRiRiiiiiiiiiiiiiIiiiiiiiiiiiiiiiiiiw Page 109 A 'lil T7 X X. ' V .2 an l W . ' f yf i : 'Cf I' af 7 l A is ' K I .. 5 .fl if 735' . ' . g f A ,. f g, f j ' X ,.. 5,:at,,., I f r I f a I I Q , -'-sf ' . .7 -, , .E.. . - .- fr 1'- 1 f f -' i l ' 12- ' ' , ik ? I l ' s'f' I ' , Z 4 Z ii I I I iiniii iii iii I I ii E. JOSEPHINE HADLEY . . . Stoughton ..Jo.. LETTERS AND SCIENCE Castalia 3, 43 Y, W. C. A. 3, 4, Ehesis-Wagon Trails and Trades of Wisconsin in Pioneer ays. MILTON A. HAKER ....... Portage LETTERS AND SCIENCE Ripon College lg German Club Z, 35 Luther Student Cabi- net 4. Thesis-An Historical and Comparative Study Of the Pro- posals for the Establishment of a League of Nations, from the Time of Dante to the Present. LAVONNE HANNA . .... Clay Center, Kan. Vonnie LETTERS AND SCIENCE Lindenxvood College l, 23 Suffrage League 3, S. G. A. Board 31Y. W. C. A. Cabinet Council 4. Thesis-The Neutrality of Belgium. MAURICE MILLER HANSON . Madison Moose CIVIL ENGINEERING ' Theta Xi: Philomathiag Track I, 2, 3, 43 Athletic Board 4, Student Senate 4, Fraternity and S. A. T. C. Editor, Liberty Badger: Class Executive Advisory Com- mittee 4g Chairman NV Dance 4. RAYMOND OSCAR HARDINC . . Madison .Raye COMMERCE Phi Kappa Psi, Beloit College 1, 2. Thesis-Intelligent Labor Legislation a Benefit to Produc- tion. MYRA SUSAN I'IARKER .... NH LETTERS AND SCIENCE Alpha Chi Omega, Clee Club 21 Choral Union I, 23 Inter- Sorority Bowling 25 Twelfth Night 2, 3, 4, Vice-President 33 Union Vodvil 33 Twelfth Night Play 3. Thesis-The Free Theater in France and its Effect on the Little Theater Movement. DOROTI-IY B. HARRISON . . Madison E MDM.. LETTERS AND SCIENCE Chi Omegag Whitewater Normal l, 23 Castalia. Thesis-Dickens as an Historical Novelist. , ALFRED F. HAUBRICI-I . . . Kenosha NAU.. MECHANICAL ENGINEERING Baldwin Wallace College 1, 25 Wisconsin Engineers Clubg A. S. lvl. E. ThesiSRAnnealing of Steel. RUBY LOUISE HAWN ..... . Ruby MIDDLE AGRICULTURE Alpha Gamma Delta. FRANCES HAY ......... Beloit LETTERS AND SCIENCE Beloit College l,l 23 Spanish Club 3, 41 Orchestra 3, 43 Wah- zeda Campfire Group 4. Thesis-Color and Sound in the De Rerum Natura of Lu- cretius. iiwiiiim-.ii.ii..i..imi..ii. mm.. ii. ... .iiiiimi gi. .iiwiiiu Lmmfgi ll I lil l ill I illl l A li I IliIniiliiniilliiiiilliiliillivlivlliil ll I l N P a g e I I 0 JAMES M. I-IAYDEN . . . . Madison COMMERCE Commerce Clubg Philomathia Literary Societyp joint De- nate 4. Thesis-The Problem ol' Government Ownership of Rail- roads. ' IRMA CHARLOTTE I-IAYSSEN . .... Anligo LETTERS AND SCIENCE XV. A, A. 2, 3, 4, Board 43 Outing Club 3, -I, President 4, Suffrage League Cabinet 4. Thesis-The Reorganization of juvenile Court NNork in XVisconSin. ELIZABETH R. HEAD ...... Madison LETTERS AND SCIENCE Delta Gamma: W. A. A, 2, 3, -Ig Y. W. C. Ag Black Bat: Hockey l, 2, 3, 4, Varsity -lg Basketball I, 2, 3, -I, Varsity 3. Thesis-Tibullus: Character and Personality as Shown in His Works. RENA HEDDLE5 . . ...... Madison I, LETTERS AND SCIENCE Gamma PhitBeta: Blaclg Bat 2. Thesis-Bibliography ol' Design Principles. FLORA WILI-IELMINA HEISE . . Green Bay i'FIo MUSIC SUPERVISOR Theta Sigma Phig Pythia Z, 3, Censor 3, Program Commit- tee 35 Choral Union 2, 3 3 junior Orchestra I, 25 Basketball Tournament I, 23 Cardinal Stan 2, Associate Woman's Editor 1920 Badger 3. ALFRED N. I-IEUSTON .... Tacoma, Wash. AAI.. LETTERS AND SCIENCE Chi Phi, University of Washington l, 2. MORRIS LEROY HICHCOCK . . Edgerton Hitch, Pele CHEMISTRY Lambda Chi Alpha. Thesis-Determination of Boron in Commercial Potash. FRANCES LEANORA HIGLEY . . Waukegan, III. Fran MUSIC Sigma Alpha Iota: Northwestern University lg Clef Club 4, Suffrage League 23 Castalia 4. PEARL CORINNE I-IILL ..... Spring Green Tum , PIO PUBLIC SCHOOL MUSIC Choral Union I, 2. MARIE EMILY I-IJERMSTAD . . Red Wing, Minn. German LETTERS AND SCIENCE Alpha Phi, Mortar Board, Treasurerg Y. W. C. A., Treas- urer 45 W. A. A., Treasurer 3, Board 43 Union Vodvil 2, 33 Badger Staff 3. Thesis-The Relation of the Shoe to the Strength and In.II.IIinIui.IIIIIIInInI.III-III-III.Im..wiI IIIIIIIIIInIIIIIIIIIninInmuIiiimiiiiiiiiiii-I Page Ill I Flexibility of the Foot and to Posture. I , I I I I I n I in III II Ii I I TEH KUEI Ho . . Kinghwa, Chekiang, China Doctor Ho COMMERCE Peking Government University I, 23 Chinese Students' Al- liance in the United States, Wisconsin Chinese Students' Club, Secretary 3, Treasurer, President 45 International Club, Treasurer 4. Thesis-The Operation of the New York Money Market in War Time. ALICE E. HOFFMAN .... . Madison CHEMISTRY Wahzeda Camp Fire 1. Thesis-The Analysis of Certain Plants Found in Lake Mendota. BEATRICE MURIEL HOGAN .... Madison LETTERS AND SCIENCE FRANCES E. HOLFORD . . Cassville Fran MEDICINE La Crosse State Normal l, 25 Y. W. C. A. 3, 43 Suffrage League 3, 45 S. C. A. Board 43 Pythia 4. VIOLA HOLLENSTEINER . .... . Milwaukee LETTERS AND SCIENCE ' Milwaukee Normal l, 23 Pythia 3, 45 Barnard Counselor. Thesis-Shelley'S Democracy. l:RANCESE.l'lOLMBURC . . Grand junction, Colo. Fran JOURNALISM University of Colorado I Q Colorado State Teachers' College Z5 Press Club 3, 4, Thesis-A Comparison of the War Policy of the New York World and the Chicago Tribune. PRESLEY DIXON HOLMES . Southwest Harbor, Me. Pres CHEMICAL ENGINEERING Phi Kappa Sigmag Alpha Chi Sigma, Phi Lambda Upsilong Chemical Engineers' Club, Secretary-Treasurer 3, Presi- dwtillg Engineers' Club: Football l, 23 Swimming l, Z, 35 ETHEL M. HOLT ....... Cambridge LETTERS AND SCIENCE Y. W. C. Ag Suffrage League. ELIZABETH-l.l'lOOPER . . . Elkhorn Betty . CHEMISTRY Cardinal Staff 3, Advertising Ivlanager 45 Organization Editor Badger 4. Thesis-Nitrogen and Fat Determination in Caseins. PERLE MARY HOPSON . ..... Madison I , , H-.. ....V......,,,....,,,,,..,,.., .. .....,,. ......,,, ...... . ............,.--.----M my W W 5 nwee.. ? LETTERS AND SCIENCE Pythiag W. A. A.3 Y. W. C. A.g German Christmas Playg 5 Daily Cardinal 23 Badger Board 3. 'E Thesis-The Development of the English Drama in the Early Nineties, Page 112 I I I II I II I II II IIIIIIIIII II II IIII II III I I I II II II I MAE I-IORTON ..,.... Pardeeville HOME ECONOMICS Euthenics. Thesis-A Portion and Cost Study of Fresh, Dried, and Canned Fruits. LAzARus I-IERMAN I-loRwITz . , Sheboygan Luz MEDICINE Thesis-Topographical Anatomy. I-ISUEI-I HAI I-ISIEH ..... IVusil1, China msec.. LETTERS AND SCIENCE Theta Delta Gamma, Chinese Students' Associationg Inter- national Club, French Play 2, Athletic Board. RUTH ANNE HUGHES . . . Downers Grove, Ill. LETTERS AND SCIENCE Delta Delta Deltag Consumers' League: Y. W. C. A. Thesis-Study of the Indians in Coopers Stories. MARIETTA LUCILE I-IULEERT . . . Burlington LETTERS AND SCIENCE Ripon College I 2. Thesis-History of Racine, Wisconsin. from 183-I to 1800. PAUL I-IUNTZICKER ...... Greenwood CIVIL ENGINEERING RUTH BING1-IAM HURLBUT ,... . Omro LETTERS AND SCIENCE Oshkosh Normal l, 2. Thesis-Virgil in the Magazines. GRACE I-IUTCHINSON . . . . Grand Rapids, Ia. LETTERS AND SCIENCE Coe College I, 2, French Club. Thesis--Papers on Cornielle, Racine, and Moliere. MARGARET I. I-IUTTON . . . . Madison HOME ECONOMICS Omicron Nu, Bowling 1, Z, 3, 4, Captain 2, Varsity l, 2, 3. Thesis-Feeding Experiments with Isolated Fractions of Brain Lepoids and Brain Protein. FREDERICK WALKER IRISI-I , Washington, D. C. LETTERS AND SCIENCE-PHARMACY II Y I. fl I H N T l I I I ? ' ,A .i2:i. I' f - I j l 3 , 5 ' . ' - S .7 Qi ' Ie X , . 3 I . jf . ,fi 1.:'f' ' fif- ' It V. 2112 A' M ., I I I. I MBU , I :I 'Neg X 0 5 , ,W ,D ,. , I I se' E1 If - S I, 1 f e . I' ., . V I ' E X' 1 if ., c I In zl A f .e 2 , X I E SS vi If- mx OX NN , fa ,ZW csv? ff swf., ggi? f Q! X rw? mi I Q' -4 I 1 W I , .I I . R , . 4 N A E ll 'dll Q 7 'Nz f ' jf I ! ,Y I f f f . Q, 3,,..,' fx ... 'gm 3? V 3 , Q if :rp . I, . -'1:ia.if I p .I,. f . . ,., fi. -If 4' , 1:-we--1 I. Q Q ' I , .ZQi,mW .-9.4. ! ., . '-,, , ' .- X 4 y Q A --. fa... f 4 e In -I -'z +I, . I . own., my-I -UWM Q 524-A' .Z 1' fe' -I-' TC ma.: L 71' .' Lv f -L 'V.- - ' IIIIIIIIIIIIIIIIII.II.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII s I II II I I IIIIIII I IIIIIII II IIII II I I II I I IIIIII I III I I Im IIIIIIIIIIIIIIIII I II I I I IIIIIIIIIIIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII II Page 113 gmnmmmimmummrmnmmmnmmmnmmmm I ' 1 : 1-ummm..mmm..mmmmiIu.Ii..Iim.Il E , myinII.-II..m..f,m..i..If. L ,.............-.-...-... CLIFFORD E. IVES ..... . . . Sharon MECHANICAL ENGINEERING Ohio State University 15 American Society of Mechanical Engineers. HELEN KATHARINE JACKSON . Sistersville, W. Va. ..Kay.. LETTERS AND SCIENCE Alpha Omicron Pip Wells College I, 23 1920 Badger Staff. I'hesis-The Development ofService in the Public Library. GERTRUDE MARGARETTA JACOBS . Detroit, M ich. Trudie , jakie LETTERS AND SCIENCE , Phi Beta Kappag Castalia, Vice-President 3, President 45 Chairman Senior Cirls Swingout 35 Y. W. C. A., Cabinet Council 2, 3, S. G. A. Board 4, Keystone 4. Thesis-Philanthropic Initiative. ANNA JAMESON ....... Fulton, Mo. ..Jimml.g.. LETTERS AND SCIENCE Alpha Chi Omzgag William Woods College I, 2, Suffrage League, Y. W. . A., Consumers' League. Thesis-French War Finance. DACMAR JENSEN . . . . Racine ..Dag.. LETTERS AND SCIENCE Y. W. C. A. 2. Thesis-Comparison of King Lear and Oedipus the King. GLADYS JOHNSON .... . Waterloo, Ia. 'ijohnnieu LETTERS AND SCIENCE Gamma Phi Beta, University of Idaho l, 2. Thesis-The Women of George Moore. luLIA JOHNSON . ....... Portage ' LETTERS AND SCIENCE Alpha Omicron Pig Glee Club Ig W. A. A. l, 2, 3, -lg W 5 Swimming, Track: Baseball. Thesis-'I he Skirt as a Factor in Fatigue. IVIARCARETJOHNSON . . . . . Portage ..MllgS LETTERS AND SCIENCE Alpha Omicron Pig Pythia I, 2, 3, 43 Glee Club 45 W, A, A. 2, 3, 43 Y. W. C. A,g Indoor Baseball 3:OutdoOr Baseball 3. Thesis-The Entrance of Women in lndustry in America. NICHOLAS S. JOHNSON . . . Ohio, Ill. ujalinnieu MEDICINE Gamma Tau Beta, Notre Dame I, 2. Thesis-The Colorometric Determination of the Haema- Eliobiln gontent of Blood, and a New Standard for SohIe's et O . KATHERINE JONES .... . Milwaukee HOME ECONOMICS Delta Gammag Milxvaukee Normal I 3 Y. W. C. A., Cabinet Council, Consumers' League. Y -........-..-.... ..... W... II1.IinI.III..H.IinI.II.Hm..l..I.m.ll...l I .Imi..ll..m..m.w-lu., ml. - Sawmi- ' .II.IITEliiililiiilLEIBElillilliiiiliiiliEiimiiliilliill 'A 3 N ' Page 114 IVIARGUERITEEDXVARDSJONES . . ForLAlkinson LETTERS AND SCIENCE Chi Omegag Oberlin College lg Glee Club 3, 43 Cardinal, Business Stan' 2, Assistant Business Manager 33 Advertis- ing Manager Badger 33 Social Settlement 3. Thesis-Development of the Dramatic lnst inet Through the Medium of Rythmical Bodily Movement. THELMA PAY JONES ...,. LETTERS AND SCIENCE Delta Zeta. Thesis-Behavior ol Bunodera Lucipercae. FREDERIC T. j UNO ..... 3 CHEMISTRY Thesis-Electrolytic Deposition ol' Alloys aqueous Solutions. RALPH KARCER ......, LETTERS AND SCIENCE Artus3 Varsity Track. 1Rv1NW.KEEBLER . . . . Keelvs CHEMISTRY Alpha Chi Slgmaj Marquette University 1. Thesis-The Effect of the Addition of Sucro in Condensed Milk. DOROTHY ELIZABETH KENNEDY . . LETTERS AND SCIENCE . Madiso11 . Sheboygan from Non- Milwaukee Milwaukee se on Lactose . Ashland Castalia 3, 4, Treasurer 33 French Club 43 W. A, A. 3. 43 Vocational Conference Committee 33 Badge Thesis-The Attitude of the State Toward America. MARY KEYES ....... LETTERS AND SCIENCE r Staff 4. the Child in . Madison Thesis-Book Reviewing in American Magazines, 1810- 1800. HILDA LKIECKHEFER f . . Milwaukee im.. LETTERS AND SCIENCE Alpha Chi Omega3 Red Dominog Union Vodvil 33 Edwin Booth-Red Domino 23 Chairman Alumni Committee 3g Mathematics Clubg Suffrage League. Thesis-First Part: 1-Iyper-Complex Number, FLORENCEI-1. KING . . . . Milwaukee ..Kink.. LETTERS AND SCIENCE Delta Gammag W. A. A. l., 2, 3, 43 Y. W. C. A. 1, 2, Cabinet 3, 43 WCSFCFQ Badger Board 23 Women's Editor 1919 Badger3 Student Council 43 Cardinal Staff Z, 33 Co-Ed Cardinal 33 Sophomore Dance Chairman 2. Thesis-Ergographic Experiments on Right and Left Hand- edness. GERTRUDE P1-IYLLIS KING . . . . LETTERS AND SCIENCE Peoria, Ill. Alpha Phi3 Bradley Polytechnic Institute 1, 23 Y. W. C. A. 3, Cabinet 4. Thesis-The Placing Out System for the Care of Depend- ent Children. in ii ii .1 ii ii. . . . . . ii i min... 1 . mimi.1iinin1ii1iiiiininniiiiiiiiiiiiiiwwiim Page Ili' e iff! .edeff D li i ,E 1 i 1 Ev: E., 512 1 1 1 2 5 I al, LE EE ai B., EE 512 EE SEE 215 EE 522 I 3 .2 as s ii :ii iiiiiiiiiiimwii-iii T I I i I 1 n I in I i i i ii i in I in xiii i r iuuuiiniunmniivnuiuuvni ini mu ui inuin4nuuiiuinumminnuun im i im n uri mu TOWER W. KING .... . Madison Kink ELECTRICAL ENGINEERING Beta Theta Pig Eta Kappa Nug Colgate University l. Thesis-Calibration of Pitot Tubes for Air Measurements. WALTER A. KOEHLER ...... M ishicot CHEMICAL ENGINEERING Tau Beta Pi. DOROTHY KYLE ...... . ,Tomah LETTERS AND SCIENCE Milwaukee-Downer College 1, 2g Congregational Students' Cabinet 4. Thesis-Vector Analysis. ELEANOR C. KRAEMER . . . Milwaukee AEI.. MUSIC IV ' W. A, A.: Clef Clubg Y. W. C. A., Cabinet 33 Swimming l, Z5 Union Vodvil 3. Thesis-Piano Programme. PAUL STEVENS KRAMER . . Faribault, Minn. Pablo LETTERS AND SCIENCE Psi Upsilong Trinity College lg French Play. Thesis-A Translation of Three Essays by Georges Pelissier on the Modern French Novel. MARGUERITE KRAUTH . . Phillips Mpeg.. LETTERS AND SCIENCE Chi Omegag Nlilxvaukee-Downer College I, Z. Thesis-A Study of the Mueorales. GRETCHEN KUEPPER ...... , Milwaukee LETTERS AND SCIENCE Delta Gamma. Thesis-Casein Analysis, HARRIET E. KUPFER ...,.. Kenosha LETTERS AND SCIENCE Alpha Phi. Thesis-Wisconsin State Council of Defense. I-IENRY W. KURTZ ...... Sheboygan CIVIL ENGINEERING Triangle: Wisconsin Engineer, Business Staff 3. MARTHA KURZ ........ Madison LETTERS AND SCIENCE Delta Gammag University of Missouri lg University ol' Colorado 2. Thesis-Literary Editors of the Atlantic Monthly. i-iiinii.iiniiiiiiiiiii.ii.iiimi.iii.ii.i..ii ,,,,,,,,,,, ,,,,,.,, ,,.,,,,,,,, Iiiiiiiimiiiiiiiiiniiiiiiiminiiiiiiiiiuimmiiii 'A ' Page 116 55 T .,K. E32 E! 5 335 EI 52 Q EXE E 5 2 E EE EE is I EE EE I I ' ImimiIIIIIIinInIInImimiiiiimiimimiiiiiiimm .mil-miiuimiim Ii I I I I ,I , 'lW 'll lil,,,,.,,.,..,.,.....,..-......................WM-............,..........,................,.,......-..................,............,,.,..........,,,.,,.,. .,.,.,..,.... 'l I GLADYS KYTE . . . . Grass Range, Mont. , Glad . HOME ECONOMICS I I elplga Gamma Deltag Ward-Belmont College l 5 Euthenics I U . i I . l JEANETTE JONES LAMB ...,. Erie, Pa. . .Ju .. 3' LETTERS AND SCIENCE Alpha Phig W. A. A.: Y. W. C. A., Cabinet Council 43 Swimming 2, 35 Track 2. Thesis-Effect of the World War on Woman's Field of I Activity. MARION E. LAMONT . . Madison AIary LETTERS AND SCIENCE Alpha Gamma Delta. MARGARET E. LANDWEI-IR .... Milwaukee LETTERS AND SCIENCE National Teachers' Seminary, Milwaukee 1, 21 German- istische. Thesis-Droste I-Iulshoff's Treatment of Nature. I-IAROLD MYRGN LANGER . . Waterloo Illia LAWV Phi Delta Phig B. A. Wisconsin 2. ARTHUR LANZ ..... . Monroe PHARMACY Alpha Chi Sigma. Thesis-Cultivation of Medicinal Plants. WVILLIAM JAMES LARKIN . . . Whitewater ADOC.. ..Dad,. MEDICINE Whitewater Normal l, 25 Sigma Sigma. Thesis-Topographical Anatomy. ESTHER A. LARSEN ...... Madison LETTERS AND SCIENCE Thesis-The Work of Herman Amberg Preus Among the Pioneer Norwegian Lutherans in America. MARGARET LATHROP . . . Madison Upeggy.. LETTERS AND SCIENCE Pi Beta Phig Twelfth Night 3, 45 Keystone 45 Class Secre- tary and Treasurer 33 Secretary, Green Buttong Union Vodvil 3g Red Cross Benelit 3. Thesis-Cheruloin. MARGARET D. LAUT ..... Wausau LETTERS AND SCIENCE Alpha Delta Pig Lawrence College l, 2. Thesis-Fencing in the Public Domain for the Cattle In- dustry. T t ...I I. .. .V I ii ,mi in iiiimiiii f.m.m.I..i. IIIn..II...IiimII-I.II..iIII...I.iiinII..ii.I.IIIIIIIIIIIIIWIIIIINI.I...I...,..,I..I. ...mm IIiimmmiiiii..I..Im,...I..... .H II. ii-.'..I. I. iimmml Page117 FRANCES ELEANOR LERRY . . La Crosse Fran LETTERS AND SCIENCE Carleton College l, Z, Thesis-I-Iospital Social Service. LILLIAN LEWIS ..... . McFarland Lil , Red LETTERS AND SCIENCE Chi Omegag W. A. A. g Outing Club Board 3, 43 Y. W. C. A.g Indoor Baseball 2, 35 Manager 45 Yellow Tassel, Treasurer, Union Vodvil 2. Thesis-A Comparison of the Backgrounds in the Novels of Meredith and Hardy. MARION LUCILE LEWIS , . . . Milwaukee HOME ECONOMICS Milwaukee Normal l, 2. - Thesis-A Minute Study of Certain Bacteria Contaminat- ing Foods. LAWRENCE VICTOR LITTIG . . Davenport, Ill. Larry LETTERS AND SCIENCE-MEDICINE Delta Upsilong Inter-College Football 2. Thesis-Topographical Anatomy. K. T. LIU ....... Charigsha, China CIVIL ENGINEERING - Purdue University I, Z, 3, Chinese Students' Club 4. Thesis-Design of a Concrete Bridge, IVIARY ANN LOXVELL ...... Madison LETTERS AND SCIENCE University of Michigan l, 2. LILLIAN LUCILE LOVVRY . . North Fond du Lac ..1-il.. LETTERS AND SCIENCE Phi Mug Lawrence College I, 2. Thesis-Town and Country Life in the Aeneid Books l-6 and the Ceorgics. LOUISE LUDLUM ..... Sioux City, Ia. JOURNALISM Alpha Chi Omega: Theta Sigma Phi, Morningside College I 1 Publicity Manager Suffrage League 45 Keystone 43 Car- dinal 3g Advertising Staff Co-Ed Cardinal 33 News Editor Cardinal 43 Press Club 3, Vice-President 43 S. G. A. Board. Thesis-Newspapers Service to Advertisers. BRETAM. LUTHER . . . . . Madison 'ABu.sler HOME ECONOMICS Achothg Euthenics Club 3, 45 Shakespearean Masque I, Congregational Students' Cabinet 2, 3. WANDA LUZENSKA ...... . Berlin LETTERS AND SCIENCE Oshkosh Normal l, 2: Le Cercle Francais, President 4. .ii.w.I..i,..Ii.IIm.m.,i.i II..MAI.,...r..I...m,i.iI.ir.. mi II-.w.Immi.. im..u.iI..1...II. I...m..II..I. iiiuiiuiiimiuiuiimimu I 7'h ' 4 M T Tni I P a g e I I 8 ,I r I I 5 XVILLIAM .JOHN MCCOY . . . Lancaster ' 1 Mac f A WW '- A I ' COMMERCE ' ' f Beta Theta Pig Skull and Crescentg I-laresfoot Clubg First f I .f, . f ?' A ' , l A Regimental Band I, Z, 3, 45 I-Iaresfoot Production 2, 3, 4. ' f ,ggxkz alW'Ibp11Z7,EQ? fgawiil. 45 W' M1414 f r I A BLANCHE Lois MCDONALD . . . Beaver Darn , lg f u 1. Lois Cricket l 5E LETTERS AND SCIENCE ii ' Theta Sigma Phig Le Cercle Francais: Suffrage League, . W N Treasurer 45 W. A. A.g Archery Z, 3, Bowling Z1 Cardinal 3. ' , Thesis-The Question of Motion-Picture Censorship. J ' ' il HELEN ELIZABETH MCDOUCALL Pocatello, Idaho LETTERS AND SCIENCE Alpha Chi Omega, Rockford College Ig French Clulo 2, 3, 4, Sulafrage League 2, 3, 4. Thesis-A Comparison of La Debacle by Zola and Le Fen by Barbusse, MARY SEARS MCI-IENRY .... Denison, Ia. LETTERS AND SCIENCE Kappa Kappa Gamma: Y, W, C. A , Cabinet Council 4. Thesis-The Retirement ofthe Farmer to Town, ROSCOE LYLE MCINTDSH . . . Edgerzon Niue MEDICINE Sigma Alpha Epsilong Gamma Tau Beta, Beloit College l, 2. Thesis-Topographical Anatomy. GEORGE B. MCKINLEY . . . Milwaukee Mac . LETTERS AND SCIENCE Beta Theta Pig Freshman Basketball 2, Varsity Squad 4. Thesis-The Valuation of Railways-Purposes, Theories and Methods. EVANCELINE MAI-IER . . , Devils Lake, N. D. Vange LETTERS AND SCIENCE Gamma Phi Betag Black Bat, President Inter-Sorority Bowling 4, Sophomore Dance Committeeg Badger 3. Thesis-Influence of Tools and Processes Upon Ornament. WALTER E. MALZAHN . . .I West Bend Wall COMMERCE Theta Chig Beta Gamma Sigmag Commerce Club 3, 43 Ad- vertising Club 3, 45 Commerce Advertising Manager 3, Business Manager 45 Cardinal Assistant Manager. Thesis-The Installation of Adequate Accounting Systems for the A-Company. NINA MANN . . . . . Lake Denton, Minn. Fussie x LETTERS AND SCIENCE Delta Zetag Pomona College 1, 2. Thesis-Delinquency. WVILLIAM GEORGEMANTONYA . . . Chicago,Ill. MECHANICAL ENGINEERING Theta Xig Mandolin Club 35 A. S. M. E., Secretary 3. nm... I . I I liIIilIniinInI-Iimiiiiuiiiimiiwii IinIiiIuiinIiiiniiiimiuiiiiliiiiii Page 119 ff-S -5 i . ...W . Imimm. . I In innmiim.-mummm unmv n I I I HAROLD E. MARKS . . ..... Madison LETTERS AND SCIENCE Alpha Sigma Phi. Thesis-Federal and State Regulation of Railroads. IRMA E. MAROHN ....... Milwaukee LETTERS AND SCIENCE Milwaukee State Normal 1, Z3 French Clubg W. A, A.g Out- ing Clubg Wearerg Varsity Basketball 33 Thesis-The Enter of Gravity of the Human Body in the Horizontal Plane. A GLADYS E. MARQUARDT ..,,. Wausau LETTERS AND SCIENCE Delta Zeta, Consumers' League. JANE R. G. MARSHALL . . . Lake Forest, Ill. LETTERS AND SCIENCE Girls' Glee Club 3, 41 Castalia 3, 43 Lake Forest College 3, 4. Thesis-A Study of Family Relationships in Shakespeare's Plays. OREN H. MARSHALL . . . . East Troy Shorty MECHANICAL ENGINEERING Theta Xi: A. S. M. E. HERBERT JAMES MATZEN . . Milwaukee 'iPinky COMMERCE Chi Phig Commerce Club, President and Vice-President. Thesis-A 'Study of Credit and Collection Methods of Madison Retailers. CORA AMALIE MAUTZ ...... Madison LETTERS AND SCIENCE Kappa Alpha Theta, XV. A. A.: Hockey 13 Class Bowling 2, 35 Varsity 2, 33 Badger Staff 1, Z, 3, 41 Pan-Hellenic, President 4. Thesis-The Development of Perspective from 1250 to 1600. DORA E. MAW . .,... . Madison . COMMERCE MARGARET ISABELLE MELAAS . . Stoughton ..Peg.. CHEMISTRY Alpha Omicron Pig Pythiag W. A. A. 2, 3, 43 S. G. A. Board 43 Bowling 1, 33 Indoor Baseball 2, Outdoor Baseball 23 Barnard Secretary Z, Classes Editor 1919 Badger, Editor War Section 1920 Badger. Thesis-Analysis of Egg Substitute. INEZ CHAPMAN MERRILL .... Pardeeville NORMAL COURSE Whitewater Normal 1, 2. A Thesis-Early Explorations, Indian Relations, and Trans- portation Systems of Portage, Wisconsin. ii......i,..II.I,..I.. .ii-i.ii.wii..i..-H., ..I..i...,, Im. .I .imI..II..i..i,.,I.i.i.w. .W.im.,I..i..ii..,..i..i...ii..i.i.,.iI..i..ii.5.I I-mmm., ii I IIimmiiimminiiiimiummmwiinmiiiiimi I ' ' n Page I20 -Im 5 WWII.. ,Li lnlllll M I II --W ,l,,l...l..AlNl4ul WMM Si3:::m..I.I. 5 EIS EE Ia E52 E55 E15 JOHN P. Memes ....,. Fond du Lac jack CHEMICAL ENGINEERING Chemical Engineers' Society 2, 33 Vice-President 3. EI, MARY ELEANOR METCALF . . . . Berlin LETTERS AND SCIENCE Spanish Clubg Suffrage League. Thesis-Caesar in Magayuies. Si BARBARA JESSIE MILLER . . . . . Ripon if LETTERS AND SCIENCE :ig Ripon College I, Z. ' h Ti Thesis-Mathew Arnold s Treatment of English Literature, GEORGE E. MILLER . . . Charlestown, W. Va. Sleepy LETTERS AND SCIENCE I Sigma Nu. MARIE MITCHELL ....,. M ilwaukee LETTERS AND SCIENCE Alpha Omicron Pig Red Domino 3, 4, Treasurer 3g W. A. A. 45 Y. W. C. A. 43 Track Team 43 Basketball 4, Manager 43 junior Class Play, WOmen's War Work Council -L, Chair- man, Student Council. ' Thesis-American Ideals in Recent Verse. LILLY E. MOE , ..... Duluth, Minn. LETTERS AND SCIENCE Basketball 1, 2, 3. Thesis-Nigelungenlied. SIGRID WINIFRED MOE . . . Chetek ..Sig.. LETTERS AND SCIENCE OutingClub3, 4gSki Club3gW. A. A. l, 2, 3, 43 Y. W. C. A, l, 21 Castalia I, 2, 3, 4g O. C. Board 43 Indoor Baseball Team 2. Thesis-joel Chandler I-Iarris and the Uncle Remus Stories, ERWIN T. MOIIME ...,.. Kewaskum LETTERS AND SCIENCE Germanistische Gesellschaft 2, 33 Hesperia Literary Society 2, 3, 43 Semi-Public Debate 21 Badger Business Staff. Thesis-Ethical Problems in Modern German Novels. ROBERT B. MONTGOMERY . . . Madison H ..M0my.. , MEDICINE Gamma Tau Betag Scabbard and Blade. Thesis-The Hip-joint as Seen by the X-Ray. ALICE LOUISE MOORE ..... Milwaukee 1 LETTERS AND SCIENCE Milwaukee State Normal I, Z. i I Thesis-The Foundation of Browning s Optimism. III I II III I I I I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 121 1 1 1 1 11 MORRIS F 1Ns1cY ....... Lake Geneva LETTERS AND SCIENCEQMEDICINE Thesis-Chemistry. JULIA ANN MOYER ..... . Monroe hjudy.. LETTERS AND SCIENCE Lawrence College 1, Z3 Castalia 4. Thesis-Word-pairs in English. ARDIS MOZINOO .... Wyoming, Ill. Monte LETTERS AND SCIENCE Alpha Chi Omegag Northwestern 1, Z3 Twelfth Night. Thesis Course. CLARA E. MUELLER ...... M ilwauhee LETTERS AND SCIENCE Clef Clubg W. A, A,g Swimming I, 2, 33 Swimming Honors: Union Vodvil 3. Thesis-Replacement of Men by Women in the Industries of England. EMMETJOHN MUELLER . .... Milwaukee MECHANICAL ENGINEERING Alpha Tau Omegag Pi Tau Sigmag A. S. lvl, Eg Freshman Footballg Varsity Football and Trackg W . CATHERINE OLIVER MUNSON .... Viroqua ..Kaly.. LETTERS AND SCIENCE Kappa Kappa Gammag Milwaukee-Downer Ig Mystic Circle. Thesis-Ruskirfs Social Ideals in St. Georges Guild. BRYNHILDEJOSEPHINE MURPHY . . Madison Bunny LETTERS AND SCIENCE Kappa Kappa Gamma. E Thesis-Thomas Heywood's Treatment of His Women Characters. JAMES H. MURPHY . . . Chilton Murph LETTERS AND SCIENCE MEDICINE Gamma Tau Beta. Thesis-Etiology of Epidemic lnfiuenza. ALICE C. NAFFZ . . . . Madison LAI.. PHYSICAL EDUCATION La Crosse Normal 1, 23 W. A. A.g Blue Dragong Outing Clubg Hockey Squad 33 Dancing Team 3. HAROLD NEBEL . . . . Milwaukee Nebs MEDICINE Gamma Tau Beta. Fl hesis-Topographical Anatomy. 11111111111111111111111111111111111111111111111..111111 1111111111111 15 1 ME1115u1u111111125221111.1111111111111111 11111111111111111111111111111111111111111111111111111111111111 1 11111 1 111111111111111111111 Page 122 CLARA A. NEHRLICH ,.,. . Sheboygan CHEMISTRY Alpha Omicron Pi, Thesis-Studies on the Determination ofthe Ash of Com- mercial Caseins. NELS THEODORE NELSON . . . Cambridge T, N. T. Nellie AGRICULTURE Alpha Gamma Rhog Agriculture Literary Society. Thesis-Germination of Corn at Low Temperatures. ESTHER NEPRUD . . . . . Weslby 'ANe,bpie.' LETTERS AND SCIENCE Chi gmegag Milwaukee-Downer 1, 2, Glee Club 1, Libra- ran . Thesis-Music in Shakespeare. ROSE IRATHERINE INEXVMAN , . . . Madison LETTERS AND SCIENCE Pythia-, Secretary 4. Thesis-Experiments on Rabbits to Show the Action ol' Certain Aniline Dyes in the Disinfection of War Wounds. KATHERONE MABLE NIENABER . . Madison Kath HOME ECONOMICS Euthenics Club. Thesis-The American Dye Situation. 1-IAROLD ROLE NOER . . . Wabeno Harry COMMERCE Chi Phi, Phi Alpha Deltag Commerce Club 3, 45 Spanish Club 3, 4, Glee Club 3, Y. 1Vl. C. A. Cabinet 3, 41 Athenae 1, 2, 3, 45 Forensic Board 3, 4, Joint Debate 43 Band I, 2, 3gChoral Union 1, Z, 3, Commerce Magazine Staff 3, 43 Stu- dent Senate 4. Thesis-Requirements Satisfied by joint Debate. EDITH DOROTHY NOLL ..... Marshfield LETTERS AND SCIENCE Oshkosh Normal 1, 2. Thesis-The American Federation of Labor in the Presi- dential Campaigns of 1908, 1912, and 1916. WILLIAM ALVA NUZUM . Bill . Madison COMMERCE Phi Sigma Kappa. Thesis-Manufacturers' Cut-Service and Retail Advertis- Ing, ELIZABETH RUTH NYSTROM . Belly LETTERS AND SCIENCE Y. W. C. A. Cabinet Council 35 Pythia 1, 2, 3, Treasurer 33 Geneva Club, Track 2, Thesis-The Geographic, Economic and Historical Aspects ofthe Development of Trade on the Great Lakes, . Chicago, Ill. BERTHA OCHSNER ..... , Chicago, Ill. jerry LETTERS AND SCIENCE XV. A. A. Board 3, 4, Red Domino 1, Z, 3, 4, Vice-President 45 Theta Sigma Phig Literary Staff 3, 4, Swimming Team Ig Tennis Team 2, Dancing Honors 3: Junior Class Play, French Play 1, 2, Union Vodvil 2, 3, Edwin Booth-Red Domino, Play 2. WIIHIIVIIII IIIIIIIIIIIIIIIIIIIIII -I I I I I iiiiiiiiiiiiiiiiiiiiiiiFiiiiiiiiiuiiiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIm Page 123 I if w iv pix f4nmeZ', Ne, . I. 4 ' 5 I ' Y a . i , I I , , f g Irl, if - ' ,. v. 1 M. 4, .MQ L X 3 V, X T in W' 7 , I 1 '1 .'- 521' A' 1 1 I 7 'ii ' 41 ,, ff , ..:l I , Sik h j , 4 Q V y e Wai K, f . ,4 , . ? Q J auf .4 f f 1 'P x 4 'ak W ,I tx I t f ' .355 5 ,f f A I . . 4 M f V I fa 1 I 4 S ,g - U ',4k .ki 4 ,. fr , , V 1,V' I My . 11' ' 12 'f 'P J ' f L Ei - pllf- Y f I fx, f : '- 1 . 'ix' i f ' .7 f ' 'I -I'I :vi 'I' I if i .7 5 ' Alif -..If A, T ,... ., 2 'Z - . ' .Q ., .,:.V Q if .0 , 9,1 'X .. ,, 0. f . I -.A A , I 4 'M VM ,X , , ,.,, . f Z 3 wi I 1 5 QW 1 I .I1,. :few -V , inf We .,, ,.,..,. . 2 f 4 2 ,.., , Z7 ?4 X If ig , 1 ,W ,wow a,..fA1..., I 1 f ETI-IEL J. GDEGARD ....,.. Merrill LETTERS AND SCIENCE Castalia. I ' Thesis-Studies on a Vaccine for Tuberculosis. ELEANOR O'LAUCI-ILIN . . . Madison AEI.. LETTERS AND SCIENCE W. A. A. 4, Pythia 3, 4, Outing Club 3, 4, Suffrage League 4. Thesis-Synge's Interpretation of the Celtic Spirit. MARION G. OLBRICH . .... Harvard, Ill. Bricky , Belly HOME ECONOMICS Achothg Castalia, Wahzeda Camp Fire 1, 2, 3, 4, Secretary Z, Social Chairman 3, W. A. A. 4, Baseball 2, 3, Outing Club 4, Euthenics Club 3, 4. Thesis-Influence of the European Social Movements on Costume During the Middle Ages. MARTHA HELENA OLESEN . . . Humboldt, Ia. LETTERS AND SCIENCE Alpha Gamma Delta, W, A. A., Outing Club, Ivlinnetoska gfargp Fire, Secretary 1 , Cardinal Business Staff 4, Badger ta 4. Thesis-Strength of Normal School Children as Tested by the Method of E. G. Martin. DORIS LOUISE OLIN ...... Florence LETTERS AND SCIENCE Minnetoska Camp Fire. Thesis-Peace Conference to 1914. MAMIE OLSON ....,. . , La Crosse LETTERS AND SCIENCE Thesis-Shakespeares Women Studied in the Light of Their Originals. MIRIAM CATHERINE O'NEILL . Chippewa Falls HOME ECONOMICS Euthenics Club 1, 2, 3, 4, Treasurer 4, Consumers' League Z, 3, 4, Vice-President 3, President 4, Suffrage League 2, 4, W. A. A. 1, 2, 3, 4, Bowling 1, Barnard Treasurer 3, Agri- cultural Association, Vice-President 3. Thesis-A Minute Study of Certain Bacteria Contaminat- ing Foods. IRENE l4ATHRYN GPCENORTH . . Kewaskum Hobby LETTERS AND SCIENCE W. A. A., Hockey 3, Track 3, Thesis-The Development ofthe Paper and Pulp Indus- - try in Wisconsin. - JULIA OUTHOUSE ..... . Madison ujudy.. ' HOME ECONOMICS W. A. A. 2, 3, 4, Indoor Baseball 1, 2, Outdoor Baseball 1. ThIeZiSFMicroScopical Study of Bacterial Colonies Found IU I . GRACE PADLEY . . . . . Lodi Gracious LETTERS AND SCIENCE Thesis-Development of Children's Literature Since 1850. ImInmiIIIImInInIinIIIIIIIIIIIIIIIIIIIIIII in nm, ri. I I.. I. II I. 1 I.. I ...I .Ii I ...II H.. .m...m....I.. I, I... , i , WXInmWInmmlmWImmwlmmumn ...... ...1 ..u,......,... ...W ...... I.. .a.....,..........,,-,..--.... ,...,..,. . Page 124 EI if :I EIS gg..-.....t..-..,.,....L-..L... -.......--.-.,-..,.-.. ........ ......-.-.,,.. ..,. -.,...T.:.,.I.,.5m E I Ee ADELAIDE PAINE . . . . . Milwaukee gli Achey HOME ECONOMICS Kappa Alpha Theta, Track Z, Baseball 35 Tennis 35 Treas- Elg urer Green Button, President Red Gauntlet, Mortar Board, W. A. A. LOUISA PARKER ...... Clinton LETTERS AND SCIENCE sg Castalia 2, 3, 4. Ei- Thesis-The Stage History of Macbeth. GLADYS PASENVALK . . . . Norfolk, Neb. Pony , COMMERCE Women's Commerce Club. f VIRGINIA CLEVELAND PASLEY . . . Fulton, Mo. I LETTERS AND SCIENCE Chi Omega, Glee Club. Thesis-Industrial Home Work in Milwaukee. GEORGE HILL PATTERSON . . . Chicago, Ill. Pal MEDICINE l Beta Theta Pig Nu Sigma Nu, University of Illinois I, 2, 3. Thesis-Topographical Anatomy. JEAN PATTERSON .....,. Appleton LETTERS AND SCIENCE Kappa Kappa Gammag Mortar Boardg Keystoneg Yellow Tassel, President, W, A, A., President 43 IVY WOmen'S Athletic Editor 1919 Badger, Student Council. Thesis-The Effect of Exercise on Blood Pressure and Pulse Rate. BARBARA E. PEARSALL ..... Evansville LETTERS AND SCIENCE Beloit College l. Thesis-The Geometry of the Triangle in I-lomogeneous Co-ordinates. 2 MILDRED PEDERSON I . - . . . Sirum Mil Bill LETTERS AND SCIENCE Keystone 4, Secretary, Pythia, President 45 Y. W. C. A. Cabinet Councilg Suffrage League, W. A. A. S. G. A.g Chairman Vocational Conference 4. Cl-IAUNCEY J. PELLOW . . . Dodgeville Chuunce . LETTERS AND SCIENCE Tau Kappa Epsilong Athenae, Vice-President 33 Sopho- more Semi-Public Debate 2, Daily Cardinal, Editorial Staff 43 Class Traditions Committee. Thesis-American War Finance 1917-1918. 1 HELEN I-IOPE PERKINS .... Princeton, Ill. HOME ECONOMICS james Milliken University l, 2. I ,..,.., ::1:::1:uII:: .............. l I II IIIIII III III I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII I I IIIII III II II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII I I I P a g e I 2 5 JACOB PERLMAN ....... Madison LETTERS AND SCIENCE Artus, Thesis-The Labor Situation in Railroads During War ime. LEOJ. PETERS . ...., Edgemonl, S. D. ELECTRICAL ENGINEERING Tau Beta Pig Eta Kappa Nu. I Thesis--Theory of Operation of Tri-Electrode Oscillators and Amplifiers. MARGARET I. PETERSON . . Delavan Pete LETTERS AND SCIENCE Kappa Kappa Cammag W. A. A.g Hockey l, 2, 3, 43 Bas- ketball 2, 35 Varsity Baseball 2, 35 Wearer. 'lxgfhesis-WOman's Place in lndustry During the Great ar. l-IARRIET NIXON PETTIEONE . . Burlington, Ia. Spd.. JOURNALISM Chi Omega, University of Colorado 23 Theta Sigma Phig Press Club 3, 45 Cardinal 3, 4. Thesis-A Study of Personality Sketches in American Popular Magazines. EVELYNA. PHILLIPS . . .... Milwaukee LETTERS AND SCIENCE Milwaukee Normal l, 2: Pythiag Y. W. C. A. Thesis-Sources of Parleyings with Certain People of Im- portance in Their Day. ADDIE E. PIEI-I . . . . Madison ..Ad.. LETTERS AND SCIENCE Cabinet of Coxrigregational Students' Association Z, 3, 4: ClefClubp Y. , C. A. Thesis-Cultural Studies on Penicillium and Aspergillus. MARGARET ELIZABETH PIEH . . Madison Marge HOME ECONOMICS Thesis-Some Problems which I-lave Confronted the Cloth- ing Industry in America During the Great War. EMILY MARION PILPEL ..... New York LETTERS AND SCIENCE ClefClub 2, 3, 43 Choral Union l, 2, 3, 4, French Club 1, 2: junior Play Committee 33 S. G. A. 2. Thesis-The Psychology of Stupidity. 'JANE PINE . . . . ForeszRiver,Ill. JOURNALISM Lake Forest College lg Theta Sigma Phi: Scoops Club 23 Press Club 3, 43 Suffrage League Z, 33 Badger 3, 4. Thesis-Criticism of American Newspapers by English Travelers. AMELIA PIRIE . . Q . Milwaukee Ameal LETTERS AND SCIENCE Principia School 1, 23 French Club 3, 43 Spanish Club 3. Thesis-Translation of Sa Soi De L'I-Iommen by Paul Herview. I .III-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .I I I I I I I. I. I I .I .I .II IIIIIIIIIIIIII I .I .II I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ' I I mi III I Page 126 I I I I III I II I II II I I IIII I I IIII IIII IIII II NELL PLACE . ....... Marinelle HOME ECONOMICS Alpha Phi, Milwaukee-Downer l, 23 S. G. A. 3, Thesis-The Growth and Development of the Dye Indus- try in the United States as a Result of the War. VIOLA E. PLELISS ..... . Madison Ole LETTERS AND SCIENCE Kappa Alpha Thetag Mortar Board: Y. W. C. A. Cabinet 3, 4, Vice-President 45 W. A. A.g NVearer1 ViCe-Presi- dent 23 Treasurer Red Gauntlet. ghhesis-I-lealth Survey of the Children in the Madison c Oo s. JEAN L. POLACHECK .... Milwaukee Polly COMMERCE University of Pennsylvania 2, ALICE VIOLA PORTERFIELD . . Omaha, Neb. Paz LETTERS AND SCIENCE Alpha Phig Pythia l, 23 Student Council 45 Theta Sigma Phi 3, Secretary 45 S. G. A. Executive Council 4, W. A, A. 43 Outdoor Baseball l, 23 Mortar Board 33 Cardinal Board ofControl, President 43 Assistant Editor XVoman's Page 3. Thesis-The Men in George EIiot's Novels. MILDRED HELEN PORTZ . . . . Hartford Mil HOME ECONOMICS Chi Omega. Thesis-The Wool Used by the United States Army Dur- ing the War. JULIA I-l. POST ...... . Madison II I I IIIII I L I I 42 I l - ' 'fl- I O.. X V rlyy , VX I I ,hI f,, , gf, 3 V A I' Z .' V '12 .. V ll , ,l,. QV I ' I VV QI V 5 K. . xvfv V KV!! I V V . A X VVVVV f I II: ' - .1 7, .,.,' , 551 I . I l , ' I IH ' . , g'i I 1 V, I 4 V V Wg ,. f I ' ' I R., ..., ' I of '--'-A2- I - , 2 Q V , V11 ,. ,VVV .I In V VV X aw. -QM .A . V X x .f Ai X ' I. .. 'ff 2112? sf I ' A -Q S' A I 'S af, VV N. ff Q S ef X ' K. V XX to aff PM Af . I XX R at X A X E -'Judy' l A I I LETTERS AND SCIENCE j j' I I- Mortar Boardg W. A. A. l, 2, 3, 45 Y. W. C. A. 2, 3, Cabinet I V, 5 ' 1 157 'Q -,f- fff 45 Geneva Club 3, 4, Hockey I, 2, 43 Outdoor Base- I - V .I ' , 5 ' ball lg Indoor Baseball 35 Dancing 3g Union Vodvil 2, 3. V ' 2 1 - ' ':'P 4 ' - Thesis-A Comparison of the Various Tests of Cardiac Function. . LEONA LENORE PRASSER .... . Milwaukee I S Q, :Q A Lonie F fx V LETTERS AND SCIENCE 5. -I .V Y. W. C. Ag Social Science Clubp Spanish Club. I 5, IV Thesis-Results of Probation of Adult First Offenders. ,V jf ,,,, 5 ' fl . . --s' DELIA PROUDFIT .... Constantine, Mich. V -IA' Dee LETTERS AND SCIENCE I Milxvaukee-Downer l, 25 Business Assistant Daily Gardi- I , 525. 2 nal 3, Associate Advertising Manager 43 Badger Staff 43 ff Q, Vi' ' X Y. W. C. A 2. Thesis-Folk Lore of America. RUSSELL EDWARD PUERNER .... JEHBFSOH .jf .-Squeaky 1 - -I - , gf- I - :R H MECHANICAL ENGINEERING 39,0 V Theta Xig A. S. M. E.g Cadet Lieutenant 2, Captain 3. ?f'T :'ijHY-. ,EEZ 25.6 - ' ' 'I' 'Q A I , e f I-IW A KARVER L. PUESTOW . . . . Oshkosh f ',5g,eVZ Z MEDICINE ,g Ai, WV Q i Gamma Tau Betag Athenae I. -' Q .F . Thesis-Topogfaphical Anatomy- IIIIIIIIII I IIII I I I IIIIIIII IIIIIIIIIIIIIIIIIIIIIIII III I I I II II I I I I IIIIIIIIIIIIzaazaaaasxaazIIIIIIIIIIIIIIIII I 'lLl ': rfl3lll5 Page 127 I I I mi I ii mini ini i KATHLEEN M. ROBINSON .... Green Bay R0bbie,l' Kale LETTERS AND SCIENCE Kappa Kappa Gamma. Thesis-Humorous Characters in the Comedies of Terence. RUTHM.RADFoRD . . .,... Madison - LETTERS AND SCIENCE Delta Gammag Oshkosh Normal 1, 25 Twelfth Night. Thesis-George Meredith and His Circle. DUNCAN I-I. REID .... . Montello - Dune AGRICULTURE Stevens Point Normal School l, 25 Agricultural Literary Society, President 31 Agricultural Association, Treasurer 33 Assistant Business Manager Country Magazine 3. Thesis-Methods of Selecting Profitable Poultry. VELMA AGNES REID . . . . Hurley VeIlie LETTERS AND SCIENCE Mortar Boardg Red Gauntlet, Vice-President 25 Outing Club, President 33 Baseball 2, 35 W. A. A,g Barnard, Presi- dent 4g Keystone 43 S. G. A., Vice-President 4. Thesis-Reconstruction in the United States for the Crip- pled and Vilounded Soldiers and Sailors. XMILLIAM I-I. E. REID . . . La Crosse Bill AGRICULTURE Delta Phi Epsilong Alpha Zeta: State Normal School: Fra- ternity Track Team 3g Fraternity Baseball Team 3g Y. M. C. A. Secretary l, Z, Cabinet 4. Thesis-Determination of Specific Gravity Ol' Cream at Various Temperatures and Percentages of Fat Content. OSCAR ZACHARIAH RENISBERG . . erlerick, Md. Fr ..0:.. AGRICULTURE Agricultural Literary Societyg Football Z. CATI-IARINE J. RITCPIIE . . jefferson Bill LETTERS AND SCIENCE XV. A. A.: Archery l, 2, 3. Thesis-Ruskin as a Critic of lndustrialism. EDWARD H. ROBERTS ...... M adison Glaz LETTERS AND SCIENCE Ripon College I, 25 Satire Staff Badger 45 Glee Club -lg Cardinal Day Committee 4. Thesis-Explorations and Excavations in Palestine. I'IESTER DOUGLAS ROBINSON . . Santa Ana, Cal. Sunny Cal JOURNALISM Delta Delta Deltag Leland Stanford University l, 25 Cas- talia 31 Press Club, Executive Committee 41 Theta Sigma Phi, Vice-President 4: S. G. A. Board 33 Basketball 33 Serv- ice Flag Committee 3. Cardinal Day Publicity Committee 4g Daily Cardinal Staff 3, Desk Editor 45 Badger Stah' 4. Thesis-The Effect of the Telegraph and Cable on the Newspaper from 1843 to 1900. l RUTH MADELYN ROEI-IM . . . . Ashland I HOME ECONOMICS I Northland College l. iiiiiilliiliiiiiliiiiiiiiiiiiliIililiiiiilliilliiliii-wi Page 128 s i n ini EZRA I-I. ROGERS .... . Hartford MEDICINE Phi Beta Pi. Thesis-A Study of the Blood-Vascular Supply Ol the Lower Extremity by Means Ol the X-Ray. MARY TAYLOR ROGERS . . . jonesboro, Ark. HOME ECONOMICS State Agricultural College, Jonesboro, Ark., l, 2, 3. I-IAZEL ALICE ROSE . .... . Prenzice NORMAL COURSE Oshkosh Normal School l, 2. Thesis-Cantor's and Dedekinds Theories ol the Irrational Number. FRANK ALSWORTH Ross .... . Madison LETTERS AND SCIENCE Phi Gamma Delta: Philomathia 3, 43 Lieutenant R. O. T. C. 3g Student Senate 4. Thesis-Abortive Reforms. RADA R. ROTI-I .,..... Fowler, Ind. LETTERS AND SCIENCE St. Mary's College I. Thesis-Pioneer History ol' Northern Indiana. CLARA LOUISE RUDER ..... Wausau LETTERS AND SCIENCE Milxvaukee-Downer College I. Thesis-The Aspects of Education for American Women in the Early Decade. MILDRED PRISCILLA RUFSVOLD . . Marinetle LETTERS AND SCIENCE Y. W. C. A.g Geneva Club: Pythia Z, 31 S. G. A. Board 43 Executive Committee Consumers' League 4. Thesis-Re-eduction and Rehabilitation of Wounded SOI- Cliers and Sailors in Canada. LOUISE ANNETTE RUSCH . . South Fargo, N. D. Louie HOME ECONOMICS ' North Dakota Agricultural College 1, 2, 3. - Thesis-Decorative Stitches. ' 4 7 Z., I . A . 31 . X U 3 mx'Q,Nf,-. ,H ' -jf. y V5 U fl swf?- I ,V X . fe - ,Q gf . ' A . Ti- in 4 t1'1f I Z ...r I ' , 1 5 1-It . V .V Jll .-tie. , f. i'l.i A 4 ..... E i I . f A f t'Ie -A I'f't ' K. 4 I, ., ,W .. 2 f,.. -1 ,,., I f I 'H ' .,.g f' I... -C 4 QQ I 4 y if Z ' f f N af jf X C? i I' 6' 'P I X' 1 'ff 4 fl lc gf '51 ' iq., , Q ,sf , f V , f f N e, , f-'sas-E- --NX. v if .5151 fw ...L , , Cs f h a ws-:.2-ra .1 .. . Wi. . l.'I' .I GEORGIA E. SALTER . . . . . Waupaca 'j S ...I I Il i' ,.. LETTERS AND SCIENCE 9 :5 Xu ,755 I 1 X Oshkosh Normal School If 2. Z X A WWC' A Thesis-The Council of IXat1onal Defense. , Q , I :,22g5f!:3q,- 945 V- Qi-ft .. .,... .- .. ' ' ' I NIARGUERITE SAMMIS ...... M adisan ' ' 4 'Af g . Z- f Marge Margie I 3 ' PUBLIC SCHOOL MUSIC . . M V.,, C Alpha Gamma Delta 3 Glee Club 23 Choral Union I, 21 Out- 'ij E- .V ' I. c ing Club 1, 2, Head 0fBi0vCHf1g 2- 2 I iili ffl -.-. if-1 Thesis-A Graded Course in Public School Music. IimiII.Iininmimmiiwiiiiiiiiiiiiiimiii I I iiIiiiiiiliiiliiliiiiiliiIIIRIESMiiiiiiililiiiiiiiiiii Page 129 II Ii I If I. LAURA MAE SANDROCK ..... Madison Dolly I LETTERS AND SCIENCE V Thesis-Frontier Aspects of Early Madison. LULU SAUL ....... Douglas, Wyo. -Sokien LETTERS AND SCIENCE Kappa Kappa Cvammag Mortar Boardg Keystone 45 Y, W. C. A., Cabinet 2, 3, 4, President 4-g W. A. A.g UW. Thesis-Statistical Report of the Course of Employment Ln tlgi Sfgtg Of Wisconsin for Three Years Ending Decem- er , . . EVA SOPHIA SCHAIRER .... Saline, Mich. HOME ECONOMICS Michigan State Normal College l, 2, Thesis-The Quantitative Estimation of the Anti-Neuritic and Anti-Scorbutic Properties ofthe Raw Potato. MARGARET A. SCHATZ , . . Randolph Schalzie LETTERS AND SCIENCE Lawrence College I, 23 German Clubg Biology Clubg Inter- Class Oratorical Contests. Thesis-The Development of the Archegom of Sphaero- carpas. MARIE CATHERINE SCHILL . . Milwaukee - Reef MUSIC SUPERVISOR glee Club lg Choral Union l, Z5 S. G. A. Board l, 25 W. A. . l. ETHAN W. SCHMIDT ..... Chicago, Ill. MECHANICAL ENGINEERING Theat Xi: Tau Beta Pig Pi Tau Sigmag Carnegie Institute of Technology Zg Wisconsin Engineer Staffg American So- ciety Of Mechanical En ineers. Thesis-The EFfect of Suction Lift on Capacity and Effi- ciency ofa Centrifugal Pump. I HERBERT GLUECK SCHMIDT . . Milwaukee Herb MEDICINE Kappa Sigma. Q l Thesis-Topographical Anatomy. EDWIN F. SCHNEIDERS ..... Marathon MEDICAL COURSE Phi Beta Pig Sigma Sigmag Baseball: Varsity Base- ball 2, 33 Freshman Baseball. Thesis-The Pathological Effect Upon the Lungs Of Re- spiring Phosgene and Chlorpicrin Cases. ' VERONICA SCHNEIDER . . . . Madison Vera HOME ECONOMICS Thesis-The Study of the Resistance of Antitrypsin in Egg-White. l EI.INORM.SCHROEDER. . . . . Cle11eland,0. Ellie - LETTERS AND SCIENCE ' Y. W. C. A,g W, A. A.g W gOuting Clubg S. C. A. Board 4. ' Thesis-The Relation of Shoes to the Strength and Flex- ibility of the Foot, and to the Posture. IIIIIIIII IIIIIII I I I IIII II II IIIIIIII I IIII II III Page 130 t I will I IIIIIII Royj. SCHUKNECHT .... Port Washington WI1itey COMMERCE Thesis-Card Record System for Control ol an Omce. CATHARINE SCHULER . . . Milwaukee Katie CHEMISTRY S. C-. A. Board 3, 4. Thesis-Solubility of Boric Acid in Solutions of Borax, MARGARET SCHULTE ..... Freeport, III. Peg , Schulte LETTERS AND SCIENCE Alpha Phi: Mortar Boardg Wearer: W. A. A., Secre- tary 4, Board 25 Blue Dragon, Treasurer 4. MARGARET CHARLOTTE ScHuLTz . . Milwaukee Greta LETTERS AND SCIENCE Mortar Board, Vice-Presidentp Ke-ystone, President: W. A. A.g Indoor Baseball lg rack 23 Dancing 35 Hockey 3, 43 Union Vodvil 2. 3: Vice-President Chadbourne 3, President 43 Service Flag Committee, Junior Play Com- mittee. Thesis-Skirts as a Factor in Fatigue. CATHERINE ELIZABETH SCHUSTER . . Lancaster LETTERS AND SCIENCE St. Clara College I, 2. Thesis-The Relation ofthe Iroquois Indians to the Early New York Settlers. LORENA ELIZABETH SCHWEBS . . . . Madison LETTERS AND SCIENCE Sophomore Basketball Team 2. Thesis-Morphology of Mollisia Dehnii. IVIARIANA T. SELL ..... . Madison HOME ECONOMICS Wahzedah Camp Fire, Vice-President 3, Treasurer 4, W. A. A.g Euthenicsg Basketball 2. ' Thesis-The Value of Various Sugar Solutions for Fer- mentation by Yeast. GLADYS MARIE SEVERIN . . Cedar Falls, Ia. Glad HOME ECONOMICS Chi Ome ag Iowa State Teachers' College lg Euthenics. Thesis-Slomens Welfare Work in Department Stores and Factories in the United States. Lois K.SEvRINoHAUs . . . New Albany, Ind. LETTERS AND SCIENCE 4 Choral Union I, 2, Y. W. C. A. 2, 4. Thesis-The Short Story. MARJORIE JEAN SEXTON . . . Marshfield Marj LETTERS AND SCIENCE Milwaukee-Downer College lg C-lee Club 3, 4, Daily Car- dinal 3. II I I iliiiiiIIiiiiiiliiliiiiiliiiiliiiiiiliiiiiiliir Page 131 K '-.eg .,.. .ft I I I., V' -I fri 5 I In I .X A of H A I 1 - ' ,. .MLIMJ 1 ' - gg: 5 . I 1 C Ml' y 'I I ,f . ' V. ., , 1 . .f .Q W gf h fi ri 1 ffjf jlrgfg 3 T., 5 ' F' I I.-N I Q 1 f 14'-li f ' 'I ': . 'I ..l' 1 Q ,- 455, ,ta ,Z R.: f ' f if ' 4 :-A , . , A f 'ff fl I ' Y -. ..-. 'Q t ' , y . ' ' gm . ii. 2 -fee 15 ' 5 I I I I .,., f I., f 1-qs... .,.. J-. .. Q mws.-1. , . f .. ....... , Ns. ,. ,. . , .,a .f ' -Q-is-'4f41lfY':15w2 S48 M1621-2' ff r -:tz2'g',fff1 '55 W- . ,.,.. WW, 8. ow., I-X a W.,,.i,.,,-,,A,..t,., , V-ff , , xi .5221 Q I. . .1 .ga 551.5 5 ?f'7f3Z1f,6?'ff. ,.,. ., Z Qt - ., e-e- ff' ,f , X 4. . . . ff f' ,f vs svfxf P ' Ag 'atv' 'rw '. QU 151.-.1 E42 if 1- x I mfr, :qi 1541. aff 1 f.'fxf -f-. - uf' 4' .T i slf' -I A -ff' 1 51.1 I f if M f eww-Mama-msTe'f . g a 5 I 2 ' 'Tift-W asf-sf' -if 3 466. f f! 11,44 Z e g: - . 1 eff- I as ...... 0..-5 1, . ' 1 4 rf A .. . X . - - Mr' 1 . . avril: 'I 2' r ' 11146 fi I ' ' . V , W- .,,,.,f.,.e f . A-:,.1,en . I I I I I I I iiiii II Iunii I I In wi: I l MARLYS DAVE SHAW .... Parksion, S. D. Q LETTERS AND SCIENCE ' Dakota Wesleyan University 1. , Thesis-A Scale for Measuring Handwriting. GORDON H. SHEPHARD . . . Mineral Point nsheb.. AGRICULTURE Alpha Gamma Rhog Glee Club 3, 4, Secretary 4. Thesis-The Cost of Making Butter. ' RUTH A. SHEPHERD . . . g . . Platleville LETTERS AND SCIENCE Alpha Gamma Deltag Glee Club 4g Choral Union 3 g Basket- ball 3g Bowling 3, Badger Staff 3, Y. W. C. A. 4, Consum- ers' League 3, 4. Thesis-Wordsworth and Anti-Militarism. -JOSEPH FRANK SHIMPA . . . . . Boscobel Use.. LETTERS AND SCIENCE Gamma Tau Beta. Thesis-Colorometric Methods of Hemoglobin Determina- tion and a New Standard in Sohli's Method. V SOHNIA SINAIKO . . . . Madison Sunny LETTERS AND SCIENCE W. A, A. I, 2, 3, 45 Menorah I, 2, 3, 4, Red Domino 45 In- door Baseball l, 2, 33 Outdoor Baseball 1, 2, Dancing 3. Thesis-Life History of Bruchus Obtectus. HELENHARRIETSKINNER . . . . . Madison CHEMISTRY Kappa Alpha Theta: Vassar College I3 W. A. A.: Hockey 2. 3, 45 Basketball 23 Bowling 3, 4, Varsity 3, Baseball, Varsity 2, 3, Y. W. C, A., Cabinet Council. BESSIE JENKINS SMITH ..... Milwaukee ' Berry LETTERS AND SCIENCE Milwaukee Normal School I, 2. Y Thesis-William Morris and His Influence Upon the Arts and Crafts of Modern Times. CAROL ,IOSEPHINE SMITH . . Grennell, Ia. UO.. LETTERS AND SCIENCE Grinnell College l. Thesis-William Dean Howells: His Change from Realism to Romanticism as Illustrated by His Novels. DOROTHY PAUL. SMITH . . .... Madison . NDN.. LETTERS AND SCIENCE Delta Delta Delta, Red Dominog Union Vodvil 2, Sopho- more Mixer Comrnitteeg junior Dance Committee. Thesis-A Study of the Physical Disqualifications of Men Rejected Under the Selective Service Law. HARRIETT MCCUNE SMITH . . Superior ..Hat.. LETTERS AND SCIENCE Superior State Normal l, 2, Thesis-History of the American Socialist Party After the Entrance ofthe United States in the World War. mmmIIIIInIIII..I...I..m..II.I..II..i , . I II. .Ir-f.II...II..III inIIIIIIIIIIIIIIHIIIIIIIIIIIII..I.IIIIIIIWIIIIIIWIIIIII I I w M l N 'N'iiiTiiEEIi-in un iz Page 132 w II II I I I I-IELEN BELLE SMITH . . . . Madison Helen B. Alpha Xi Delta, Phi Beta Kappag S. G. A, President 4, Sec- retary 35 Y. W. C. A., Cabinet, Mortar Board: W. A. A., Keystone, Castalia, Treasurer Z, Twelfth Night, Treas- urer Z, 31 Bowling 2: Winner junior Ex g NVOmen Stu- dents' War Work Council: Student Council of Defense. ghesis-The Moral Philosophy of Montaigne and Its ource. MARY RUTH SMITH . . ..... Madison LETTERS AND SCIENCE Alpha Xi Delta, XV. A. A. 2, 3, French Club 3, Castalia l, 2, 3, 4, Treasurer 4. Thesis-A Comparative Study of the Eclogues ol' Virgil and the ldyls of Theocritus. GLADYS SNYDER ...... . Clinton LETTERS AND SCIENCE I Beloit College l, 2. Thesis-lnfluence of Brook Farm Community on the Writers Who Were There. WILLIAD M. SONNENBERG . Sheboygan 'NSIORRIEN MEDICINE Phi Beta Pig Sigma Sigma, Thesis-Study ol' the Blood-Vascular Supply ofthe Lower Extremity by Means ofthe X-Ray. SPIROS SOTIRAKOS ,... . Chicago, Ill. MEDICINE University of Chicago l, 2, 3. S. LLEWELLYN SPENGLER . Menasha uchum.. LETTERS AND SCIENCE Alpha Sigma Phi, Basketball, Varsity 3, 43 Athletic Board 3, 43 Chairman Mixer Committee 1, 2. Thesis-A Moral Mutual Benefit System of Factory In- surance. MARGARET SPERRY .... New York, N. Y. LETTERS AND SCIENCE Kappa Alpha Theta, Phi Beta Kappa, French Club l, 2, 3, 43 S. G. A. Board 43 Cardinal Reporter l. Thesis-The Influence of the French Parnasse on English Poetry. NILS EIVIND STABO . . . . Decorah, Ia. l'Henry LETTERS AND SCIENCE Alpha Tau Omega, Luther College l. ELEANOR JEAN STANCHFIELD . . Fond du Lac A'Naane , HOME ECONOMICS Euthenics 4, Cardinal Board of Control 4, Cardinal Staff 2,5 Wisconsin Agricultural Association, Vice-President 4. Thesis-Relation of Diet to the Resistance of Infectious Diseases. RACHEL STEARNS . . . . Madison URW.. LETTERS AND SCIENCE French Clulo 3, 45 Taychopera Camp Fire Z, 3, 4, Secretary 3, 45 Gym Team lg Crew lg Badger Staff 4. Thesis-The Factors of Form Perception. ' , Z ? 5 . 9 f f if f 1 1 E A, IIIIInIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIII In I III I II I II I I II InIInIIimiIiiIiiIInIIIIIIInninInIInIIiIIIIIIIIIIIIIIIIIIIIIIIII 5 Page 133 I III I I mi II I I II II II I IIIIII I 1 I - '- n f I A . . 5 f , 5 Q W 12 fy ,X 41 2 P A a I I 4 SQ? . I Jaw f cp , , I X? Saw Jig up ,. 31... :,aaK sf.:ai::,:ig,.- , rf' 9,335 4 Q 4 1 Q 'Aw Q, 6 19f X J N I K ff- 5 K i gas A X , A .fr . ...N,,, .if . m f. . .ras-af.z:2' -'LQ iIi:. i.:i .1:.1::f-A if we A A 4' xx w ab J 2 X' X we Q' i Q X f 4.1 Q' Sri, HR .I i X 'A fx Nh 3 M . h .,g Q .1 -.-1 ,.,...., ., ,.1,., , . ,,.. .-Q..-.Y ,,., ,M 1 sijllf' 1 ..lQ4 ' ii . I .. , - K' I ,,,,.....,.M,., ' .ff Aff A . -.,. fi ff- 1' 1,.,...:.S,, ai., ,. f A.. I A f :ff-.iw-'fg.-,.w 1.1-f ,, A I .y .,:g-gm i 1 .' S-fri -:2 Y.:??f AY' , fi 1 A',S.?i-:--'fiil--3.-215.:Qi--'Vi'-I:-5'-l:1:'EffT'E'fHig -..7. l fig: 3745 . .f'if?.fi 1 X i A ' egg, Y Q, . I V S . i Q. S3 1 S 1 l , ' i. ' 1 f A ' X . f 'K :W if X effvlfl ' cu I xt ' e I A f R x I . X ix ,- f M X, 'i V I xx 4 1 ,yy E Nfl f a jf ,ai f fif' N X f is I N I ff 7' I iis A eelsl iira . i I e Q l f ff , I 'wgiaaix ZQ- G Q-M.-!:.,..,.A W W 'WWI-grail? Y ff- - , , - ,2 , .., EMIL FRED STERN ...... West Allis MECHANICAL ENGINEERING Tau Beta Pig Menorah Society 1, 2, 3, 43 Engineers' Club 2, 3, 43 Pi Tau Sigmag A. S. M. E. 4. ESTHERIVLSTEUDEL . . . . . . Chilton LETTERS AND SCIENCE Thesis-History and Future of Railway Administration. SARA FAY STEVENS . . . . Chicago, Ill' 'osazzy' LETTERS AND SCIENCE Alpha Xi Deltag W. A. A.g Bowling 3, Thesis-Methods of Hiring and Firing in American lndus- trial Establishments. - N. HURLBUT STEVENSON . . . Burlington, Pa. Steve LETTERS AND SCIENCE Chi Omegag University of Colorado l, 2. WILLIAM H. STEVENSON . . . Onalaska LA XV Phi Alpha Delta: La Crosse State Normal School l, 23 Clee Clubg Holder of Exchequer, Blackstonian Court. MARY KATHERINE STOFFLET . . . Bishop, Cal. LETTERS AND SCIENCE Alpha Xi Delta: University of Southern California l, Z3 Choral Union 35 Suffrage League 43 Y. W. C. A. Thesis-Chinese Immigration to California. HUGO A. STOLTENBERG . . . . Manitowoc AGRICULTURE Alpha Zeta: Agricultural Literary Society. Thesis-Raising Dairy Calves. J. ARIEL STOLZE .... Wausau MEDICINE Phi Beta Pi, Thesis-Topographical Anatomy. LEILA E. STORMZAND ...... Madison LETTERS AND SCIENCE Platteville State Normal School l, 2. I-jfhesis-Private Employment Ofhces as a Factor in ln- ustry. AGNES L. STURCES ..... St. Louis, Mo. HOME ECONOMICS Pratt Institute l, 2g French Club 35 Euthenics Club 3, 4: Y. W. C. A. 3. iiiiiIiiiiiiEiiiiiiiiiFliiiiiliiiiiiliiliiiliiiiiiliiiii P a g e I 3 4 55 I5 EE Eli as E12 if i. 5.25EEEmm5m,.nwljiinzaiz VIV V I I V V I V IV VV I I .V I V. V I V . I ., , , , , , , Els if I RAYMOND J. SUCHY ..... M ilwaukee LETTERS AND SCIENCE Milwaukee Normal School I, 23 Hesperia Literary Society, El Vice-President. :ig Thesis-Construction and Operation of an Ionization Manometer, CATHERINE C. SUMNER . . Madison 2 Kazy LETTERS AND SCIENCE gg: Delta Gamma. EE' Thesis-Experiments on Rabbits to ,Show the Action of Certain Aquiline Dyes in the Disinfection of War Wounds, RUTI-I D. SLJNDELL ..,.. Mason City, Ia. Sunny LETTERS AND SCIENCE i Pi Beta Phig Rockford College lg Business Staff Wisconsin ' Literary Magazine 3. 'l hesis-Stevenson, the Man, as Seen Through His Letters. ELISABETI-I SUT!-IERLAND . . . Hudson Beth I-IOME ECONOMICS Omicrori Nug River Falls Normal lg Euthenics Club 2, 3, Q. 4: Castalia 2, 3, 4. Thesis-Relative Proportion of Rent, Food, Clothing, and Other Items in Budget. ROBERT M. SUTTON . . . . Peoria, Ill. ..Sut,. ' MEDICINE Beta Theta Pig White Spades, Star and Arrow: Basketball 33 Baseball Z, 3, 4, Athletic Boardg Sigma Sigma. Thesis-The Adult Arterial System Shown by the X-Ray. CLEARY NEIL SWANSON . . . Marinette Swan MEDICINE Phi Beta Pig University Band 2, 3. Thesis-Topographical Anatomy. BESSIE LILLIS TAYLOR ..... Glen Haven LETTERS AND SCIENCE Pythiag Wahzedah Camp Fire 1, 2, 3, 4, Secretary 4. Thesis-The Emotional Impedance of Marine Receivers. SARAH M. TAYLOR ...... Ottawa, Ill. Sally LETTERS AND SCIENCE Kappa Alpha Theta, Lady ,lane Grey School I. Tlrbesis-Impression of Early Western Travelers from 1750- 18 0. VIRGINIA SIMPSON TENER . Wheeling., W. Va. Gin LETTERS AND SCIENCE Qlphg Xi Delta, Theta Sigma Phig French Club 2, Bad er oar . Thesis-Keats as the Poetic Expression ofthe Celtic Tem- perament. , M. l-IELENE STRATMAN THOMAS . . Dodgeville COMMERCE Platteville Normal 1, 25 Glee Club 2, 33 Womarfs Com- merce Club, President 4. Page 135 n ini I is ui I ii Ii in uruu I u I iuniuiimn nu n mini iii min imimn I im iiiiimiii 1 EVA M. THORNTON . . ..... La Valle LETTERS AND SCIENCE , Mathematics Club 3, 4, President 45 Suffrage League 4. Thesis-The Group Concept Algebra Of Combination Of Operations in a Group. KATHARINE TIERNEY . . . 'Niagara Falls, N. Y. H UK. TA.. LETTERS AND SCIENCE Alpha Xi Deltag Buffalo Normal l, 2. Thesis-Ability to Distinguish Sex Differences in Hand- writing. -JOHN FRANCIS TILLEMAN . , Green Bay 'iTillie LETTERS AND SCIENCE Phi Kappa Psig Gamma Tau Betag Beloit College 1, 2. Thesis-Physiological Effect of Poisonous Gases. HAROLD W. TILSON . . . Terre Haute, Ind. Tilly COMMERCE Phi Delta Theta: Franklin College l, Z. THOMAS E. TORPHY . . . . Milwaukee LAW Milxx-'aukee Normal l. DOROTHY MAY TRICKEY . . . Berlin ADM.. ' HOME ECONOMICS Choral Union 3. Thesis-A Study of the Bacterial Flora in the Normal Throat. ALICETURNER . . .... PortW'asl1ing1on LETTERS AND SCIENCE Kappa Alpha Thetag lvlilwaukee-Downer l. Thesis-English Seamen During the Sixteenth Century. HELEN LOUISE TURNER . . . Toledo Pele LETTERS AND SCIENCE Alpha Omicron Pig Wells College 1, 2, Y, W. C. A., Con- sumers' Leagueg Assistant Classes Editor Badger 33 Adver- tising Staff Cardinal 4. Thesis-The Recent Emigration of the Negro to the North. THOMAS XVESLEY TUTTLE . . Madison AGRICULTURE Psi Upsilong Alpha Zeta: Associate Editor, Country Maga- zine l: Haresfoot Play 2, Haresfoot Follies 3, I-Iaresfoot Club 3, Glee Club 3, Swimming Captain 35 Scabbard and Blade 23 Junior Dance Committee 33 lX4ilitary Ball Com- mittee . PAUL FARRELL TYE .... West Chicago, Ill. COMMERCE Alpha Sigma Phig Commerce Club. Thesis-Railroad Problems. iiIiiiiiii-iiiiiiiiiiiiiiiiii im ii. I i mi.. ii Ii I iumi L EE I I I IliIillullllirlinliVIIIHIiliiluiIiiilillllllivllulvlliv I Hlmmwm D-mmm-N 'WMMNM-Mn - Page 136 uniii vuiiii ii I im I I ii Iiniii xiii iiiii I ii ii I iiiImlmmiiiiiiiiiiiimii MAURINE VAUCI-IN ..... Des Moines, la. LETTERS AND SCIENCE Delta Gamma, Drake University 1. MARION E. TYLER ..,.. . Glidden HOME ECONOMICS Alpha Chi Omegay Notre Dame l, 2. Thesis-Psychology of l extile Advertising. EUNICE R. UEBELE ....... Tornah LETTERS AND SCIENCE Northwestern College 1, 23 Choral Union 3, 4. Thesis-History of l'On'Iah, Wisconsin. I iiiiii I ,, '-ii' 3 f ,I UIJ. Vii. , .jf , Q HELEN LlZZEL ....... Denver, Colo. HOME ECONOMICS ' 4 Thesis-A Brief History ol' Batik: Primitivefand lvlodern I Adaptations. i . ,ml fl, 4 i '. V . 2.31. RUTH VAN DEURSEN ..... Dalton, Ill. . ' 'IM LETTERS AND SCIENCE fT'V': a., .3 University of Chicago I. I f ' ' ' Thesis-The Function of Aphra Behn. . -..5 S , K f .A i f tix.-1' --iv , -. ALICE VAN I-lIsE ....,.. Madison ' I - I 2 LETTERS AND SCIENCE I gif--4-A-. French Club 3, 45 Student Council 3, 43 Vv'Omen'S Vwlar , uf, V I ' , Work Council 3, 4, Editor Wisconsin Litcrary Magazine 45 S f' if :L I Erenchglay 3. , yi' '- , .-7? ' I , hesis ourse. f -1- I rzraiaw 7' 7 ' ' 1 If ' ADA VAN STEENBERG ..... Lansing, Ill. I f I HOME ECONOMICS . XX , T I ' Z -Omicronglua LewisllnsgitutglA2LFELghIerI1ics 3, 4. ' A if A ' ' hesis- tu ies on ee ing . . . . en. .- gf-y . ,If ETHEL L. VASEY . . ..... Menomonie . . f, - is . 1. Qld, Z, 4 . : ,iff LETTERS AND SCIENCE , .,,. 11 Central Holiness College l 1 Mathematics Club. fil l I ' V ' ' jj ' ' ,f awe., Z, ,. ,,f Thesis-The Discussion of Certain Loci in Plane Analytic ii , . f d X ' g,,:,l,f we , K , gf, -21. 151' I -4 Q, HAROLD F. VAUCHN LP. . . . M ilwauhee V V L, me V ' Q452v., Tf's 4'NQ' E3. ' LETTERS AND SCIENCE . Esta klssiggiaselliall 1 3 Football l, 2, 3, W Mang Assistant .:,.6 , K il oo: all oae 4. or L ,f ee gm. -IW ' 5 I MARION ELIZABETH VESEY .... La Crosse oi, -e.,,, g 4 Q 4 7,3 ir,-3? -'-ffI Ras '9 f-,SKI fa Z Q, LETTERS AND SCIENCE . j , , ' La Crosse Normal l. 2. -'tif Thesis-The Discussion of Fictions in the Atlantic Month- ', W,,IQ.j',.Qj,Q., 1'l 'fi' , . .,',' Q ,V ': , ,.,,,, , A ' rig ly, Harpers Monthly and Scribners for 1917. 4 f 'cf-W ' -to ' 4 Q1 Page 137 I.III..Ii.IuiI-IIuiii.IiImwiiimiiiiiiiiwi iiiiiiiiiiiiiiiiiiiiiimii mlm II I I iiiui I I I I ROBERT STANSMORE VIVIAN . . Madison MEDICINE Gamma Tau Beta. Thesis-Topographical Anatomy. MARCARETMOOREWADE . . . . . Muscoda LETTERS AND SCIENCE Theta Sigma Phig Cardinal Reporter Z, 3. Thesis-The Development of Women in the Works of Hawthorne. FRANCES N. WALKER .... I. Algeria, Ia. ' LETTERS AND SCIENCE Grinnell College l, 2. Thesis-The Influence of Samuel Butler Upon George Bernard Shaw. FRANKLIN XVI-IITTELSEY WVALLIN, Grand Rapids, M ich Guernsey AGRICULTURE Phi Gamma Deltag Alpha Zetag Congregational Students' Association l, 2, Social Chairman 3, Agric Crew 2. Thesis-Arrangement, Construction and Equipment of Buildings on a Farm Producing Certined Milk. LUCY WALLRICH . ...... Shawano LETTERS AND SCIENCE Gamma Phi Betag Mortar Boardg Keystone 43 Council of Defense 35 Vice-President 43 W. A. A., S. G. A. Council 33 Elections Committee, Chairman 33 Y. W. C. A.g Basket- ball l. 2. 3, Varsity 2, 35 Hockey 2, 33 Track 2, Varsit 35 i'W g Union Vodvil 2, Assistant Chairman Vocational Clon- Ierence 3: Chairman junior Advisory 35 Organizations Editor Badger 3. Thesis-The Effect of Exercise on Blood Pressure and Pulse Rate. RUBY WALTON ..... Scales Mound, Ill. LETTERS AND SCIENCE Gamma Phi Beta: Northwestern University l, 2. Thesis-The History of Galena, Illinois. EDNA MARGARET XVARD . . . Sioux City, Ia. Eddie LETTERS AND SCIENCE Alpha Xi Deltag Y. W. C. A. 2, 3, 45 Suffrage League 2, 35 Consumers' League Z, 3. -lg Social Service, Y. W. C. A. 4. Thesis-The Treatment of the Family Deserter. GLENN B. WARREN . . . . Girard,Kans. Bart MECHANICAL ENGINEERING Theta Xig Tau Beta Pig Pi Tau Sigma, Philomathiag A. S. M. E., Varsity G m Team 33 Forensic Board Z3 Student Senate 3, 41 Semi-Igublic Debate Zgjoint Debate 4, Vlfiscon- sin Engineer StaH 3, Editor 4. Thesis-The Gas Turbine. ALLEN SMITH XVATSON . . . Madison Walls MEDICINE Gamma Tau Betag Lawrence College 1, 2. Thesis-Atypical Epitheliomata of Skin. CARL bl. XVEBER .... . Hartland MEDICINE Phi Beta Pi. Thesis-'I opographic al Anatomy. miIiiinimiiiiiiimiiiiiiiimimmiiiwiii In im, .ru -nm.. i...Ii.....n I II.,I.,i....Ii.i..i.....i..II.W,..i.i..,.,i....i , -R-- W-H+--'mr Page 138 IRMA WVEISER .... , . . . Waunakee LETTERS AND SCIENCE Thesis-The Non-Partisan League. - 1 NORMAJ. WVEISKOPF . . . . Sheboygan I ' MUSIC Glee Club 23 Choral Union l, 2. DAVID XVEISS ...., . flfaclison I JOURNALISM Intercollegiate Socialist Society l, 2, 3, -lg Cardinal 1, 2, 3, l Press Club 3, -l. Thesis-Essential and Non-Essential Elements in Repre- sentative American Daily Newspapers. CHARLES W. T. WVELDON .... Milwaukee LETTERS AND SCIENCE Paul Morphy Club 33 Lasker Club. Thesis Course. EDWARD O. WVERBA . . , . Milwaukee Eddie MINING ENGINEERING Tau Beta Pig Mining Club, President 4g American Insti- tute of Mining Engineers, 'ghesis-A Report of the Carltota Mine in Santa Clara, al. VIRGIL ROE WERTZ .... . Madison AGRICULTURE Thesis-A Study ol' the World Wheat Market from I909- I9l8 Inclusive. ANNA WHELAN . . . . . Mondovi Ann MEDICINE ,JULIA P. WHELAN ..... . Mondovi elude.. ' PHILOSOPHY COURSE IVahzedal'I Camp Fire I, Z, 3, 4, Treasurer I, 2, Vice-Presi- dent 4, Y, W. C. A., Poster Committee l 5 Hockey Team lg Baseball 3. , Thesis-Glycero-Phosphates. FLORENCE WHITBECK ...... Madison LETTERS AND SCIENCE Pythia I, 2, 3, 4, Secretary 33 Y. W. C. A., Cabinet Council 3, Geneva Club, Thesis-The Evolution ofthe Tanning Industry in Wis- consin. DORA N. WI-IITE ...... Mineral Point LETTERS AND SCIENCE Thesis-Poetic justice in Shakespeare. I WA it EN... we fxeww IIIIII.II.III..I..II.II.,II.II.IIIIII I.IIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIMIII II I I I II II I I I I I II I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I Page 139 .I I I I I I I nun min I IIIII IIIIII In I I :nun KATHARINE PAGE WHITESIDE . , Louisville, Ky. UK' Pi.. LETTERS AND SCIENCE Pi Beta Phig Smith College I3 Theta Sigma Phig Twelfth Night 3, 4g W. A. A. 43 Castalia 23 Keystone 43 Union Vod- vil 35 War Orphan Dance Pageant 33 Swimming Team 23 Dancing Team 33 Wisconsin Delegate to National Con- vention 33 Re rter Woman's Page Cardinal 23 junior- Senior Swing get Committee 3. Thesis-Contemporary Poetical Drama in America. I-IILDA F. WIESE .... . Madison CHEMISTRY Thesis-Preparation of Phlocoglucinol. ARTHUR N. WILCOX . . . . Madison An AGRICULTURE Alpha Zetag Edwin Booth 2, 3, 4, President 35 Agric Lit- erary Society 3, 43 Agric Association, President 43 junior Play 35 S. A. T. C,, Vodvil Manager 4. Thesis- Running-out in Vegetatively Reproduced Hor- ticultural Varieties. CLARA BASSETT WILLIAMS .... Whitewater LETTERS AND SCIENCE Gamma Phi Bcta3 Whitewater Normal School3 Mortar Board, W. A. A. Board 3, Vice-President 43 Ski Club, Treasurer 33 Y. W. C. A.3 Hockey 2, 3, 4, Varsity 3, 41BaS- ketball 2, 3, Varsity 33 Baseball 23 Track 35 S. G. A., Ex- ecutive Council 33 Wisconsin Delegate to National W. A. A. EDWARD BARNES WVILLIAMS . . . Milwaukee ..Ed.. MECHANICAL ENGINEERING Psi Upsilong Pi Tau Sigmag Star and Arrowg A, S. M. E,3 Track I, Varsity Track 2, 3, 43 JUDSON SPARKS WILLIAMS . . . Bristol ..Jud,. AGRICULTURE Delta Phi Epsilon: Varsity Wrestling Team 43 Class Foot- ball 23 Chairman Sophomore Smoker 23 Inter-college Basketball 33 Interclass and Intercollege NVrestling 35 Intra Mural Sports Committee 43 Class Basketball 4. MADELGN C. XVILLMAN . . Madison Willa Music Clel Club 3, 4, President 43 Choral Union I, 2, 33 Twelfth Night 3, 45 Keystone 4. Lhesis-An Introductory Study of Some Correlations in usic. I-IARRIETTE XVILSON ...... Milwaukee HOME ECONOMICS Milxvaukee Normal School l. Thesis-The Microscopic Structure of the Colonies of Cer- tain Ivlilk Bacteria. JOSEPH ORIN XVILSON . . . Oshkosh aloe.. AGRICULTURE Acaciag Philomathla. Thesis-Corn Against Barley in a Gram Nlixture for Milk Production. EDMUND MERRIMAN WISE . . Fond du Lac Ned ENGINEERING Tau Beta PI: Eta Kappa Nug St. Patrick 35 Wisconsin En- gineer 2: Associate Editor 3. Thesis-A Study of the Application of Frequency Filters to Phonographic Recording Instruments. W Iiuiimiii .IIInmmiiiiiiiiimwii I I ImiInInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmiiiuiiiiiui I I I I I I I I ' Page 140 GLADYS M. XVISE ' ..... . Madison Clad LETTERS AND SCIENCE Y. W. C. A., Cabinet Council 45 S. G. A., Council 45 W. A. A., Board 3, 45 W Wearer. Thesis-Ergographic Experiments in Right and Left Handed Men. BEN XVISHNEFSKY ...... Milwaukee LETTERS AND SCIENCE Athenae l, 2. 3, 4, Censor 3 5 Semi-Public Debate Z5 Sopho- more Financial Committee 23 Joint Dehate -I5 Council ol' Defense 45 Badger, Assistant Advertising Manager 35 Business Manager 45 Menorah Society, President 45 Chair- man Class Finance Committee. Thesis-Satisfied by joint Debate. I-IAZEI. GERTRUDE WOLCOTT . . . Milwaukee HOME ECONOMICS Normal and Industrial School l, 25 Euthenics 3, -l. Thesis-Methods of Institutional Accounting. RUTH M. XVOLFE . . ..... Suri Prairie LETTERS AND SCIENCE Pythia 2, 3, 45 Taychopera Camp Fire, Recorder 25 Outing Club5 Suhfrage Leagueg Y. W. C. A.5 W. A. A.5 Methodist Student Choir. Thesis-The Novels of Anne RadclilTe. KING GRIES WOODWARD . . . Peoria, Ill. Woodie MEDICINE Beta Theta Pig Bradley Pol technic Institute 15 Star and Arrowg Skull and Crescent5 gym Team 2, Captain 45 Union Vodvil 35 Student Senate 35 Y. M. C. A., Cabinet 35 Ath- letic Board, President 45 Athletic Council 45 Dance Chairman 35 Student Council of Defense, President 45 Junior Dance Committee 3. Thesis-Topographical Anatomy. LAWRENCE PERRY WORKS . . Madison Larry ELECTRICAL ENGINEERING Theta XI5 Eta Kappa Nug Engineers' Club 45 Tau Beta Pi 4. Thesis-Advantages of Central-Station Electric Service. LUCILE RUTH WORKS .... . Augusta Louie LETTERS AND SCIENCE Gamma Phi Betag Geneva Club 2, 35 Y. W. C. A., Secre- tary Z5 Cabinet 35 S. G. A., Judiciary Board 3, 4. Thesis-Some Factors Producing the Evagination Cysteri- cus. CORNELIA WRIGHT ..... Winona, M inn. Carney LETTERS AND SCIENCE Delta Gamma. ANNA YABROFF . . ..... Fond du Lac LETTERS AND SCIENCE Thesis-Religious Ideas of Shakespeare. BERTHA D. YABROFF ...... I-Ioricon Burt LETTERS AND SCIENCE Blue Dragon Inn5 W. A. A. 35 Pythia 3, 45 Menorah 1, 2, 3, 45 Secretary 4. Q Thesis-Shelley's Friends in Shelley s Poetry. .L X -iei 51 ii A A 7. Ie.. . Y QQ, . rf K 'f K 4151 l p 2- - I 2 1 I 3- 5215.4 '5'5' If I - imqlf ffifggg A an . fi Q .5 e fffhg, itaeaggg Q 4 - J- .3 ' ' Q' A '4t,, ITEEET' 3 ' 5 if . . I ada ',..f 5 ' , I fcfgfzif f . .... . ff' yr- IV Eej algae.. 5 .t . ff' aj,!ff -' N A! fg 1 , .. - .Wm : I. .- .Zu . . I f eeea?f5t4aa .I? 3 . aaa I. 'E ..W W s 29 ' I ' i P If Z 5 , I . 3? Z I , e X' il 3 'i as ke 7 f X :..v5.,,QE.g, .' 1 'l y ,I , . - Is' 1, f .I-I , 5 . lVgQn.A n4E g .. V ...V, J 3 V V. 3 I fl I- fi- fem: f , .. .. fe I -ag -f.e ff , I X, . I ,.f- ,Q ,,,.. 6225. -.. .,, - ., .gil 5:31 51- .VJ I9 . 22.1. ff'2r eeffee.. f 'n-Qf:.fpeee febeea ve? i ,-fmfZefw ii ' . U 'V . 5 I ,kv Z wi ' ' 1.1 , ' 'L ,ZIV Q ff f , tw' , een X g X xi V .5 gf ab' 'wig i ,.,, sr .i I f' 'A 33 .5 V. .... .12 V . . Q ' ij., I. 1 . Iv,I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I II II II I II I I I II I I I I I II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I Page 141 an i 1 T M ltllxv WL! .vl. F lllrhl mimiiuili u A. HERBERT KOSCHMANN . , Wausau Chula LETTERS AND SCIENCE University of Chicago l, 2. Thesis-The Origin of Certain Metamorphic Rocks. IRENE OLIN . . . . Florence ..Pax,. LETTERS AND SCIENCE Minnetoska Camp Fire. Thesis-Fur Trading in Southern Colonies. XVALTER Ti-TAUER . . . . Watertown LAW E Phi Delta Phig Philomathia. LILLIE TREDVVELL ....... Chicago LETTERS AND SCIENCE Pi Beta Phig Black Bat. Thesis-The Women in Galswothy's Plays and Novels. MARTHA YOUNG ..... M emph is, Tenn. LETTERS AND SCIENCE Agnes Scott College l, 23 Basketball 3. Thesis-Americanization ofthe Immigrant. ARUTH ZILLMANN ...... . Thorpe LETTERS AND SCIENCE Alpha Chi Omegag lvlilwaukee-Downer lg W. A. A. l, 2, 3, 43 Y. W. C. A. l, 43 Suffrage League 43 Basketball lg Hockey I, Thesis-A Study of Tests of English Vocabularies. W l 1iniuiiiiiiiinii-1T.IiTviTlwiiiimimiilw-ii mmmmnmmi ii mimi El ' ' 1iniuiiniuiuiiiiiuiiniiiTTiiTmnimmmiiimm 'M Page 142 mnmumuwm umm umm num vw nmumum v ml In mu um mn u N my vu vm I I N mum mum T u mvummw u mm ru nw mm mum mn T1 1 H T I I nm mmmu uw 1 T u fummml u ww T v 14 wmuwmnw: : ..5X...m....Xm,.X...XXX. X X X X 23-.numum ,T . -XL nmmum uw u wnmmnumnwn 1 Tn X: arg Si: x E .X. . jg QE .fi il? .L Z! 21' E.: m X : 1 2 aww xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgm 2:5 xxx . QS ' s XQ ,Q 5. XX NX -1. 1 N N 15 19 UTI 10148 20 E 'Ni A f M :N N5 EN 1' V NN S 3 5 S SN QW, ,.,, ,nzqw-wmg 'ffffffffff : sgggggggigvgxvg' SN bb.. -'Z-,,,,..-+ is -,.. QS Efffliffli .::::1':E' Pt..-:N NT- ---- N-N 0 ----, gg. X XY , SQSYWN,NNMTW,wwmwXRQQWQQQQQQ .... . M::x.i.g,SNgmQmQQw,Namw...mzaaawwlxNAKWWWWNWNWNNNNNQQS , ,,,,,,, ,X,, xxx . 2 Eg ' s -S 1 :E 1 2:3 i , jumor Class Officers 1 . . ALLEN SPAFFORD . . Pre-Yideflf E DORCAS J. HALL . . Vice-President HELEN M. SNYDER Secretary X HERBERT B. WRIGHT . . 7'rff1SUfGf ANTHONY G. ZULFER . Sergeant-at-Arms -- -X- - T Q T - . 1 f V 1 3 .. A 1- T - T ' X Q. V ' 4 VTLT . . ' T .,,,, - , X. Q ' . : fP-' -' 5 ' -' ..V' ' .. - Spaffgrd Hall Snyder Wright Zulfer X. Ee :LQ E jg- :L T1...TN.,mmm,,..,....H.....,... 4 ., . fu -H-I-L, XXXX ,,M, -0 gm ,.,. H :zusafe!ur:221222:lufwlufweuuwzitllrf ' J!--I-1-5 4,., 2 -2.2.22-Jllhlfh .--4-. --.f N- H.,Ty.mi:mi5niazna:nn:u:nammaana'a ..,, H . ...W T....,. f.T..,T......,. ....,..T.....,.,,.....T.n..,,..,., u...T...,...m.,..T..T.n.,,..,...Tu.mn.,.........,.,.,..,,.....,..,..........,,...,.,.....,.,.H.,.......T.,......,T...T...um .,..,. ml .T.mT.,., nm ..T.u.,..H. .m,.,..1T.,..,.... W U W.,H.,,,.,T...m..,.,m.. . .. ... ..u..... Page 143 55 E wvmnnn1nwwnwwuvmymm1uv1n1unmmumuwmin1uwrmInm1ynwmmmwwInanwuw1nwInInwuwwnwanuv1In1munwanwuwnuwuw1uwun1uwunwmnnwnwwmInwuvwnwunwuwn1wuwuw1nwuvwn1snwuwwuwanwu1nu1uwwn1nwwnwrnnuwnuwnwnuinwmwmunwnuanwn11nXuwnnwmmuuwulunwunwnwwnun1nnwnwnwrnwnwnwinwn1munnnwnwruwuwnuanfuwuxxuuninugW53E1Wwfuuvxanannyxp155infH5mfE!!mf3:5mgQ!35555551ifiwH33M53551E!!3535555153mfIEuf1innwgfwfqm1555lmmf1inW3wffflwllniwg 1-nmzzznnzmmzmazzmnmznz:za:zzman:Q,:::::::zzz,zzzzzzzza,1:1ans:51:1nz,an:zzzan,az51:15:1azz.zz:azz:sn:sam:zz,LQ:2:11z::.::,zzz1:11Lsrzzzzanzz:,zz5:1.zz:xx:zz1..zzz,La:zzz:LanazzanLs:1zz:9:1151zz:,m.zzusaann:,:A,Nsz...H,..,..,...,,..,..,..,,.,...,,..,..,,..,,.,,H,,.,.,,,,.,.,....,,.,N.,,.,.,,.,.,..,,.,,..,,,.,..,..,.,.,..,,,.,..,,.,..,,.,,..,,..,..,,..,..,,..,..,,.,,..,..,...,...,..,....,.,..,,..,,..,..,..,,..,..,,..,..,,.1,...,..,,.,,...,,.,,.,,...,,.,,..M.,..,,..,,..,..,,..,,.,,..,,..,,..,..,,...,...,..,,..,,,..,.EEE 2 E E 2 EE .11 E55 Ez: as age J: Ei: :KE ii: 553 E25 5 .w,. HWWW.HY,.....,W.mml...myW...,.HH.,,..m.,..1....i.m.,, ,..,. m..1,..V.., ...,......, k.,...H ..,. ...H,Hn.,,..H...,..,..m.,L..H.,,,.H ,.,.. H ,,,.. N., ..,,..,..,,, . ,K..,... mu., ,.,,,., k..,..1, ,,,,. ,H,W..W,..WK.YX..Y...N.YX.WW.,W..WH.Y..Y.HX..,,.,...,..,H.,...H,.,.,,,,.,.,,.M.,.m..,, ,w.. .k.mm..,H.N.WW.HW.1W.N..,K.W.W...,,.H..N..M.M...H,..,H,M.,..,,..w,.m..,. .4,. .1Y.H..,,..,..,..,,,.,,.H..,, ...K , ,..,, k..m...M..,, .,,.. ,..,.K..WW.1.. .w.. u..,..m..,.,.. ...K .,.r ..,..,..m.....r .,,K..,........,.,u....1......m....m. Page 144 as ... :Ez 222 mmmmnumuvuvmnnwmunmnrnw1111H11nwwwinM11H1w-IWmumIn1H1.I11-11rl11nwH4mHInH4wH11111.11wVwwn1HwUwwgHEuggw51W5.4in1V51w51w551WHfy53155133451.1mw551W155M3Wym153,E3155153wV5in3ynWumH3wn11IfwH3uww11wnw311in1wHuuuulUInm1I11uwwU1wI+uHumMHmmwH11-4wH1wmmmNIn1-11V-uuluH1wI--rluN-HInuw1In1Hum1I.uwmumuf1HuunwHuunu+NHwuw1Hwm.u..ww.mmHwH11.111.1X.1X1-1MHWW1fn1uww-INuNWHNInmw1H1XIfXmmHmummmumw isU.....-M..mmW...WW.....U.,.nm..,...W,..,,,.,X.1,,.,,,.,,...,..,,..,..,,,.,,..,..,,..,,..,,.,...,..,,.....,,,.,,..,W,..,..,,H,.1,..,,..,..,v.,,,H,..,,.,...,,.,,..,..,,H,,.,,.,,..,,.,,.y,,.,,.,,..,..,,,.1,..M..,..,,..,,..,,,,..,,.,,..,,.,,,.,,,.,,.,,..,,Um.U.....,,...,.,,.,,,.,,..,...,,H,,..,.,,,..,..,,.,H.,..,,,.,,.,.,..,,,,.,,,.H...,,H..,,...,..,N,,..,,,.,..,...,,..,H....,W.,,.,.,.,H,,..,,.,,..,,..,,.,,,.,,..,.,,,.,4,...,,.,,...,.,,..,.........4,,........,,....,,.,.,,...,.....,,..,,W,.,,,..N.,......4,..,.,.,H,,,.,...u..,...,..w.,..- E Ei- ,., -- 552 EEE ii: EE E,-.smmm.,H.,H....l,H.H.11..-mnA..num1.HH.V..11.Umm,in11.1.H1..,V.,,.H...H.,,.1,.,,1.1V.....,,.4myK.,H.U.,H,,H,..,,H1..X,.N,.,1.4X.-X...WXV.XX.NN..,..4V..W.H.m..m,,.,, .,..,, , ,,.,,, .1Mmm..H.m.Wm.m.W..H.1H.H..H.1,.1X..1,UW.W.mm.n..1..N.N..N..,H.XK.NW,in.H,.H,.H.4,..,..wm.W..H..U.W,.W.mm.m.m- ,.., X.,1.11H..,.W..wWm.Hf11K.1V.,11.,1.,,..,H,,..X,1X,-1,VH,..1V.11.11..,1H1.11H,,.1,V.,,H,1.1N.1,K.,N..,L..,.1,,HV..,I..1.NL..,,....m.m,...w.Wmegg unmmmnunmmwInnnmywummummumnumnmmm..wunvulilwmm1Innnvuummm-mxmmmmmunm1iiRii1IE1uwimumummlmwumwWwuwyuw'mmmnmmnuu.mmm'winw-1wm1Mmmmnmmmmlmnnlu1mvHwwnwuwmunfmmmmmm-uvnnummuninwuwwnwunuwnumummmlmmmmuwwmlI.1munwNH1mmmmmmlmw'mm-mlmvumXmXHwmXInmXmXwlm.mmmwmumWmulXmlmwmulXmXHulmlmmmmw-mm..mmmnlmmmlmi Page 145 wmmnmmmmru1fnnmmm:uwuvmnmvmnnuwmmm:fnmumWIfWWnWn1nv1mmmummwH1mmwwI1wuwnuvmvmn1wnwuwmwu1mmommmwrmfnnnwummInanWHwInwrninwmmvmuwlmnnwuwLHwvuinummummuumnuwuulHInH1wn11:wwE1waywyffmmnggf3gmggmg!35355255555555gfml55135511513551531355gg!!15315555gg!gm555ggmfgg!535lgggggggjgggggmg33515551551ggffgguggmglfg5555521553M5355335351EmMfglmmufgwgmgmwilll5553555335915 52,.mmmm1nulmH11Hrm1mlmInmyinumm-m.um..,.nfnWHw1..1in1HWInw.H1.ml,K..H.1mlK..vmruW.HW1kmU.mfmWWummmWWmmWufW-1W1-1x.Ninw11-1-11AuH-WW1.HmnuI-mm.w.mm.wHH.1mH.1.Hwmmmy1....U11.,,H1.HK.,H.Nlm.IlmH.Nin1.11.HmNvm.Hun..X.H1.....,VHV..NWm,..1my.....1N.HV.,1.HmXI.1.H11.H.NnvmH.N1.1N.Hm,.H...1HNmmN1.NK..U.,W...H..H..V..N.MnlN1.11..1..1V..mlInU..H..H.ml1.mnV..1H..1...mN.HH.myH.lmummmu.m.nu.,m..m-,wwe 3 55: E E EEE E E 2 E E E E 5 :E E ijgygggggglgggggfgg55511555555155353153553355553555mf1553553555535uw3555:MEMM.,tl.,H5Wmum...ynWV.3wg.1K..ny...nm..,K..,..XW1-.1H.X.HW,mX..,L..WHWU.,K.,,.,,......1L.,V..1...,H1,HX.1X.HX..XH,H.W.H,..,K.,...H.,K.,,..m.,..mm..1HX..X.H,V.,..,,....H.H,.,H..I...W...1..w..,...w.H..1H..lu...,..XV.,X.....,N..1...1.11.U.H,.HH.H.,...,.,.....,.,..,.,.......m.,K..,.....m...,.....ml...um.,um..W..nm..,....m...m.....um..mmm.XH.1m1.mm,....,...m.u.m.,....5- 3 5 numvwwummwvuwnnnmwnu1Iuzuummwunnuwnuunm1mrm1Innuwmwuwulnur1-Iwwvufu11uwmnu1mmnnwmnnanmywnuruxnumwu1mwmnuunnmunmmuwzu1Inmnurnwnununzwrnmununlxru1nwmnurnnumwmnumwuwnnnn-umunumuuwwuwuhlniillmilIIIIIIXIIIHTFIIHIYIHFIIHHiiiMKIIIiililFIIYIHTIEiilliiHHEWIHFIGHIHIIESIEHIIIRFUHRKIIEHEIDIHIEHElRh'iilfIIH1u:nuuummCifIiKinnl:ulIZHIIIIQEIIIEHIHIEHIHQYEIRWuinuxu1xuuummnnmnumumnummui P cz g e I 4 6 K 1H+mwmmuwvuvmmlwmHumu1In1mvmmuW1AmH41mumin1In1InwV-wUM.U1m1N11HmfU.Wmwnww.Iw1HwuvMHmXHXHX1H1rnW1-1mmwwin1I-1m1V..w.1WnfA..HynInWWIN-wwmwmInin1W1u1in1H1inmHnwIn1.I1114U111-11V-1Wuv1w.IXuXulHmIn1n1nymmm-wmwwmwmwnfnWHinwK4wW1H11HXmmHInmXu1u11H11U1WHIH1H1.I11.11H11I1XWWHm1-11uf11.41.1uH,Hwynu.mmmum-mmH1nwwn1NuXmmufu1I.1inuInuuummHInuv1m1u1nninumunffnuulwwwyg S fiiiiiiiilliil3155131515EQIIJIE55535225Qi?Gi?HJZIQIHinIl..1.H,Q.,ww1HU..,11111.1H.H.H.H,W,1.1.HWH.W.U.f.11H1m1H1mW.Hin1H11.11..XL..w..vm.m.mmmH.1.111.WW..vm.U...1.H1.1,.H,..,,.1mmm.,,m..,..1,..W,H,U.W.,,.4,V.,,.1,.L,,..,PII1L.I..l,I.QE11,il17111511,I.,1Qi1Fil,,QiQ52521Gillill22.1lil1iiiQ51,ElidillH311151413,Fil,iiiIl.JIMillGil,illQ11XQi?lilGil,il.1.11.J1HXZi?,L..xi.6121JilI..Rhi1QLA1.16111In1ll1L,X,1.,'.41,HUm.H1..,,..XInNK.NH.uwInm1W1H1NV.1K..vw.H1H1mmm-fwmmg 5 E !E E 5 EQ: 555 Egg 225 Ei M' '' ' '' '' ' ' ' '' ' ' U' ' ' '' ' 1 ' ''''' 1 ' '' ' U ' ' ' ' '' 'H' '' ' ' ' ' '' ' ' ' ' '' ' ' '' ''H' ' '' l2!H!!'l!!H!'!!!lI!!ll!!!E!!!!!lE!!!!f!!I'fEEETEEUEEYIK!HZ!E52E!!ll!EEIIZEIEEZIEEIEEEIEflfll'525221525E!!EE!!!iI!!2!flEffl2211555232251IEEIEEIEEEEIUlfZ!fH!i2!lE!1l!!!E!!!UEfI152551IlfilllIII''flEEZ!!!E!f'f!IfEI2!!lEf''!f1I!'IHHH!!!''!I3!!!Z3ZII!UEflZ2I!1221EZIZEEYEZYIHEHEEHEIH''.... 'EEIE2fETH 'ff 5 imulwinwuhhwmEIMEEEIHMMFFIZIIIRIEEEIISIIEIUISRiiliiiliiwliliilili?GEii?Gill?HEiliilIilliiwillmiiiwuwwnduwmunw:ivuvulmummwInwInmmumn1mnwuwmInnful1.mu1InmvmunmummunmmmmmnwinIn1InXInnlulummm1.11in1InmmymummmnuInwnmnInmmmummmym1Hw1-1XmmmmmvmmmnunuInummmmmmvmnmm w.HH.wummnumlinHH1mHwinummmm1.I1wI-lmw-1un1ulinNinuwmummunInm1wmlmummmmmnmma Page 147 mylmummmrmwInm1mummm1n1nvummmnmm1HwHwwI11Hw1H1muwmvuwmvuwpnwInmmumwuw1Iw1u1fuw1Hmumm1-IwInwn11HwI-4mmNIn1n1uw1HwH41H1mWu1.11n11u1N1w-Iwmmvmmpu1H11.11m1H1mulHmfn1.41Wm11I11mm1XI1Xmnluw-+1mm1+I11.11vuXHM1mmHIn1I41H1inu+I11Hwuufuunu.ummm1n11uuHunmnufumumuHuH1wu1uwN-11uXWHmuwnl1nu1Iuun1uHuHwufunmvmnwww1u.uInm1141mwHwXuuuwWmu1.4wvu1n1uwwmulHmInrmuwuumummun :mmumum....1Inmy1.1.H.11.11.11..1HWH1V..11IHInV..11I-1Inm1,Hm1m,K.11U1In1m,..1WN11Mm1H1m1HXin1,iw1.il1.-1H1vmm11I,1m1.I1U11.w11H1L.11H1U11.11H11K.1.W.I1,1.1In1i.1dl1in5.11Il1G11IIE1riJill1hi1.111.11H1M1K.1,.4,1.,,K.1L.,,V.1V..1.IXX.11V.11H11U11.1V..11-1U11H11-111-11.11.I11I-1H111-H.11.4w1H1.mw.m.wm.mufl11.1,WW1K.,,.1N1.Nmm1mX.11.1XX..1U11.4,1.1N.11.111-1yn1.I1L.11I.1H4V..1X..w..N1HW11.M1N1X-IXI.1NHX1..1.HW11IQ1il1Qi!1Il1QIllEid1lil1Ii11ii1lil1512PQI1151IIIUIIRKIZRKIRGQUISLH ,WIMIIIIIIIIIII IIII If r w n1wwvuuvwmnwwnuwnwwuwn1mruwnuwLuwuwnvvwnwwu1nuwuwwuwnnwnuwnwLumuwwnwnwwvu11u1u1wuwmwuwvuwunnuwuwmwruunmummm-numn 1 5' IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII'III.Im:.II.II.IIIIIIIIII,.. ,,,, ,I ,,,,,, I I WILEIIM WI1.41.H1V.,..X,.111-1L-X,..,L.,...,V.,11.1K.1L..1L.,M,..,X1,,1.,1.11..XV.1W.1,..W,1.V..X..,,..1V.,X.1,L..,..1V.,,..m.mww.m..,..,..,V..1,U.H,..1,.4,U,.4,,.,NV...N1.1W1V.,1..1...,H.1.1,H,K.,MX..X,U,H11.,1..1X..,.-.,..N,..,..,,1.,V.,.m..vwwm...., mm 1 . H :E ., , ,, ,I I I IIIIIIIIIIIIIIIIIIIIII I I I I I .. ..... .... ,,,,....,., , . . 'W' H' ' ' '4 '- . .N.,,...w.,..,,.H..m ,,., ,..,.H,,.,,.H..,,..I...I.,I1..,..,V.,,,.,H.,K.,.H,y.,H.,..,H.,1.1Y..,K.,..H,.,N...W,..,,...y..,..,,..,,WM.,,..,U.,.H,...,..,,..,,,m,.,,.,1 . P a g e I 4 8 w w v r 4 XY Y ' x xx x M mx X X 19 op OHZOPQS 21 S2 SR S S gg W ,.-fflswfi: fffff?.':Pf-:1ffsi5s?f-'SKSXY vs ---- -A '- RN w .. 45 z2E222.fffsE 2:11 ----'- r ..... X SXXsRRx.N.W.XMm.XwxwQww.:::xRS......R:Ni.Q.5NgSNQmiQqiSxRmw....xssaaxxwslswEMMRmRNWRRxsRRsRg SwXx wxsxmm1NxN , N,,,,x , ,,,. 3 Sophomore Class Oflcers ADOLPH O. TECKEMEYER I-I11.DA B. MAE-LEY , DOROTHY FRITSCH . FREDERICK R. I-IANSQN . HENRY B. ROYCE . . President . Vice-President Secretary . . Treasurer . Sergeant-at-Arms Teckemeyer Mabley F ritsch Hanson Royce .1 In M II I A HI .. .,..,.. ..,..., mmmmmmmmmmiii .,..... .M ...,... .... ..... ,.,, -..,-.....-.. .. Page 149 55 EE ga 5 5qm..,,.,,.... ,,.... . .,K,,,..,,...,.n.., nm., ...,,...,... .mm l.,,.,, m, ..,, ,.,...,,.m,,...,.... .,,,. m.,.L.,...... .,w,,,. mm ,.,,. M. .,.. ,,..,..m.., .,...,,.,,l... W.. ,.,,K .,,..m n,.,l..,.. ,..,......... .,,.,. , .,... WW. ,,.. w..H.,H.,,..v .,,.. 1Km...W.U,HH.,..WI..W,.WH,W.HK.,...,,.....,,...,.,,.,,.,,.w ..w,., , .,,K.,..,, .M ,... H.H.m..,, ,,,. mm .,..,,., 1.HH,,,.W..,,..,.,.,.,,.. ,,., U.K..YH.,..,.HH,H.Yum.,,..,.m.m.,,..u..,. ,,.., . ..,. HHH.HK.,WH,H.,,,.,,..,,.u...,.,,.. ,..,.,.,. .....,W..HH...H,H.u..um.,,H..,...,l 2 is s is Q i E- , 1. , E. . 5. . 5, : is 5 W :E 'Y 1 5..,,..,,,H,..,....W,Y.,.,,..Y...,rmX..,...y,..,W,.W,...,.W,..W,,..,..,. , .WI . H W., H I vu mu 1 xuvul1In1Inrnul11u1llHlAm4muvml1uINruxnlNlurl!HINrlvNmmllmmmllxHmm vl HAH u l vu vu n un nu w ur L E1 ,,,,,,,,,,,,,,,,,,,,,,H,,,,,,,M,W,H,H,M,,KmmYImW,mymXmyinXiHXInYInYInInmlXinMMMiminM.T....,...,..,...,,,.,..,...,...,,,,,.,....,..,,..,.. .... ..,..........,..,..1..f....Lin..l.1.,f.511.I..ruffle,Ji....5....:.:...!ff.11ttf11:5I!!5:2221211121E1525112:52:5::1:::J:!l51:12:25:25122152211f1t!:5!:1:::r::1Elin!!:Biff'121tl:112115:1:21!:!k!:2::52112::ef:::Jtill!!!:ri:relief52:ui:!!l1:!if:1l:f1:z2irfxerfrzirrfuffmwi2!1:u!1l!!M!utw:1!'.''. '. !::w!!k:22ME2tfwm.. . :f:'...H 'ms,,. ' uIwmlnvmumInfnwvuwInmwIuummmInnmmmmmumHXInmmnInufmwm1H1muuumunmnfumumnumummml n I w 11IwmmmmmnmumnfmInwInIn1uwInmumnwmmw1.1mwu1m1uummlmmfuummInnluuuwmmmmfmmmvmwInInmm11mmXunnmumlmmmmmyInulXmummmnuInLIInmmnmmmlmmmmnuwmmmmmunnmmm Page 150 EEE Z f 2 1 5 1 E ss if -2 mmmwmnmmmnmInmnnumymfwmmmmwfmInnnwulmmmuwlwmmmuwynfmWu1mmymummwInfuwInwIninuguw1m'ff1mlminwmfg1E5Q5wE1w55MW555Eff1555535555W53554wg!W3ul3143.H35.3ml5113.5yuun55inxyumm1n1mXmN.I1wHmuw1H1In1H1XInmU.Huwmwm1H1w-1wulWuvuwuwmrmXuXnuumuwwnw1Hwuwwuwmuummmmfnwmummwnuwu1InuuuruwwuwwuuIn1nmwummmmmuwmummumun:mmwnwwvuummmumlmmmmmg 535 EEE 15 E E Ei? gli EEE EE EEE QE V H: EEE 552 Ei? Ei? is as sez E55 :LE ::: if EEZ EEE :s nmmnummm npr nw Ei ' -s EQjmlynmfwmyH..1nf11m1mm1mm.w..u-mmfnfn1.-1VfnH-11-1W11.,H.1.umm1V.,L.....4inX.11N,1..1.HX..1V.X1.11.H.H,..1..1.H1..wV...11,1.X,H1.11.H1.11H,m1.1H.X..1W1H1V.1,..1.H.H,1.,1..1H1W1.11.H1.1XH1H.X..1.H1.11..,inH.1L.,H:,H.13.193,TIn15mmm351555my3511355ffm-I,E33:mm!InEminum5:53:,InlmmmmmfT155215315135HI!552wwmm,HmyIf,H:E1ifWZ:,inmflm123:mumwww.X...Ty,.XX.w.,,1.,v...E9u.-Ti anwvmwuvvmunwnnmu1vmnnwulwimnGli11i.i?5iwl-IIEWHi?lilEHRiii1iiiHIGHiiiiiLliiiiiiiiliiiiliiiliiliiifillliiiiliiiiiiiQEIRIEIHIRii?FiwiimMIwFiUl1umunmwm-.nnmmuuwumnuninummmumummInmnmlmmmmulummfmmwmmmummumwuuwmm1-Iummummm.,WNInmmmmmm.wnwmmm-mmmummmmmmmwmmmuwmmu-www-m-1yumum.wm-mm.-nmMwmmmm.Wmmumm-.mmmnulmmllummmmmm Page151 iii EEE mm gmmmmummummvuHInmuvfmm1mmMXmummW1fuummm-mmm 5 51mmulmlm..m.mnnmmmm umlwmmml H p .1 I w w M wmwmu wwHwmwHWW.4WN1ul1H1wH1n11H111.1H1W1ulyu1Win11Iw1.41L.111-11.41WN.X1I1wM1LHwH1XI1XHXm1H1H11.1wVHm11WmNV-11I11-wmm1w.mwn .1w.111.11.11H11.11U1U.1H1ru1111inmm1N11u111-1H1V.wwu1mru1in1w-1wHwin11-1uXmwmvu1m1u1vu1u1w.11N1mmmlu.-ummmmuummwwv lmmH.1mimmm11H1W1111W11.1in.H1H41K.1m,..,1HN1,1.,.N1..w,..,1.,m1,.1,.11I-1H.Xm,L..1.11,.111.,,H1H41H1H.1..1V.11L.1in11.1X..1L.11mW1K.11.11.H1..11.4,1.1X.11H1.Hw--Iin,H11.11In1m1..in1m1L.X1-11.I1mX1.X1H1L.,V..1..,X1,1W1N1in1K.NIn1..1..11.U1.,1..,H111.,inV..11.1H.1..11.14..1,HH.,H41.11H1nv1H1V..1L.11.11.111HH.1H,1..1..1WN.11.H1.111H11.,,1.X.H,1.1.HN..,I..V..11.11..1.H1..iniHi1,ii'iQHQllil U mnfu1.11V..1.H,..mmw......mm.mm H4 H .mm My .1V..11.1wummV..wwmfww-ww ... ww. N lxlllthhl NHU5L531:54,.111.11.HMww1H1K.111.,11.1H1myL..N1..W..H..,..u..m.,.v.mm.W..,.. M . lmm1rmm1nuwuwfmwunm1mummmmmvmmm ' ' sag XHN-IWmXXHXinXLf5,14HXWNMXNtu3531lf.inIml1W,..1In1UWW..w..Xw..XV..,.1www-m.u.mw1.rm1..,W1..1WV..NH.1..1,Hin1mXNumm-mlwww 11uWulwfu1su1vuwmwu11uwvu1InXvu1mru1Inmm.mmmnmn ' :1 W ,Vlrvllvvlxrllrllbhrlrlhlv rhhl 0 n..,..' A .-1.11W1inIn1H1mmmm.mwmumXWin1m1.Hinumm-,..m-v...u .mlm um . u11uwWummm1Innv1W1InWInXuXmmmmmlmmuvuw H 1 My H1L.111.XH1.Hmf1.Imlm1H,,H1mu.myX.HK.11I.1.1111.1H.nuH.1muwWww,yymm,mm.H,2.n.f,.A-2...u..mm1mum.n-m-QQ .11.I1Inm1In1HWfuwuwminwInw-IwInwI1wnl1mfuwuffmm.mmnl1uwwumy1u1mmWvuwuwlmniii'm1mri,mi.1InIunl1EEhmhvmm1H1ulin1inm1IninwinuinumXInuumXin1HXummnlwInnuInnuIn1mm1mmnuXInInin1.muuin1K.1Nm.Hwnumnummlummmuuummmmmmmul Page 152 u.mu-lwlmmnmm-mmm .3 EE 252 55 :E xs E 4 S 1 i -1 1 555 .an 252 E55 Wmuflm1gmnvygffjmmggfgffM55335535:55H5Um,..u..,55mMmf1W.-,...mmm...n1WU.1InrnAIn1fu1.I1In1mH.,.HMWV..,mA..AV..,533553ufM551I..133W5553551355!5:1535MinAV..H.1A.41WH-AH.mymH.Aum.:155A55lm55553555.5151A.M1.1wHWV..WH.MH.AHAnnnn,HAmmyH.1WV..1V..1I.,111Auf1.HW1H,1Wny1H..1.1nunyA.HupH.AU.AynAyn,mAI.1W1H1WHAmmm1rmInAH.IH1A.HV..11I.AInlmWin1H41yu1H1H.1mWV.-1H-AH.1mWAny1H.mfmlmmmm..mmmmff ggiyi.11PERUiiliih.Im,1Imummum..m..mm..w.w mmlw-.mlm fl .1 mmmmmmmn U 4 .. m u-vm..mmu mmm. mmwwmlml1.wmmm.m.m.1fmmulmlumlummm In mum In wm.mm.mmmmm w Wllvmmunlml .Au vmwuwmmu mm'WIlii?7i??ii?ii'5'.ihummmm 1mvi'1E1i1lllI?ilililii'l Kmum U fl. H umm I HHH4mm.H un?'ITEMEii?5i??ii1iiiRiIIZiiI3i'253 'f 25? . - 35: is: A: E1- Prfeshmen ' 35, Eg! il' if :ii - EEE 2 ,, .,. Mi ' ' ' Webster Sumner jorgescn Thompson Ryan fi? iii jj Class Oficers CHARLES L. NVEESTER . President EY DOROTHY SUMNER . Vice-President 222 -JCSEPHINE L. JORCESEN . Secretary JOHN W, THOMPSON . . Treasurer iii ??? RAYMOND J. RYAN Sergeant-at-Arms 223 55 Z.: , V. O f A 1'-f WV- vfn,J'4'fhwvffvM..f' AW- v ww-Hv4z:4','mcQ, 'hw ,..,:,' -U,wrz,f4AMm:aw w.wfA.',-.,,,m,,vH.,,,-A-1Am,LJAW- .f ,Nw-nf M1 7fm.,,wfff,v,,W-,f.f,,f.ffM wffp .,,1fQ,44+f4m-4, ,v,.,,.,m..,.,Www AM 4,A4,,,. .MA-1.,w..,,y.,.,,,,.W1W.M.A,+,,4M,Q.+ W, M. ,,,y,,,A,yA,, ,,,,L,,,, , f ,4,f,.,g,,?,,.,,LW., M ,zw w,-1ffaf,+' ,, WW .f -, ,Q--yy: fe . pw ' 1 f . A'- A M 3-f --- iz: f -A A mf f W isa ' , -V L: EEE 5, 2515 4 L-.'w..w , A , Q , ':'r.: .v1 oW1w v wwf, W 'z 4f??.-ofH,-Q f ' . ' -V1 -'-' wfrza-',-yz,-gvzf f- wffqw zz: 4'fff13w:fZ'f.fzi.4,4a:,a,f?y:f',-116-,,f.':p1,w,VME..apf 1e:..:+,.,, ., N: 1,15'q.rfY?J,w A'4g4g:,Ad ',-f,s.,, , L-W ' M 4' .. vf., fm-,..,:,.,v,,-z --- ,. X wiv -f:,.2f' viz- - -'L 's g ' Wymgw, rfz' WI 2 15- Q -'f A iff W- iff-egfg--11---Q mf,-4' rw rv4wm:1gf1.,v. ps-151, ww, +:zPQ,n,.w-4.f EE ff! ,mf :ww A Y f-.. fw ff ' f '-A . ' 555, 1 - as f , L A. V- . fx ,.. 1 Ng , 'm '- 2.- gfz yy ,agffghd-515 5, 4 bQ'1f.ip',-Q.y' ff -A ,, 1,,,,w3p-w,?y? J , 1, f-'nf-, Fm:-5 :ff '. . ' ' ' 1' :w f:-- ' :V fwffw 1 A f ' f T.'2H'i' ..4 - 'I . .,- Af A + 5 1 9 f ' A A 5 - -. 'ff' ' fb ' fn 2-- . Q ,,,,.,4m- .,, .A , -:ng 1--1' f' ' A '-'f 5i,g,., - .,., -'45',gy,1.f , ff M 1 a ' , ' A, ,A 1 , YH. , . 14 l y- is . 5, NN. Q .J A V , 3.4, A , fm? Nm EEE gk ?.,,.vi4 J E V If 'Z .. , .gpg ,,f,.I, im: H .,., - . J , ., ' j,J ff'l27i?5 A 'F .ge,.,,, ff3Zil h ' ' gif? ' ' 1.. ,Ju-L1 ' :I 3 . 'W ' ' 5' - . 'A . '-7' ' -Wf..W,,2'swf'f 'w- Af ' ,. 1 , 11 522 -, A , 2 ' ., A. .. f , Ei' 51.1 , -'ff7 l1. : !w.11wff-2fi21ff l,'f'f if 'V ,C29i?? ZQ 7 IG? V ' Z ,V '11' .. Q:'.,., ,- ,,-wwf 'T . ESE gig A N ,,V,5k U54 V- RIAA ,, 'gf ,v.kj,VZh,!:,, 31,,lVi,,lf, IV I J X' I I V,,!l,,:j Z, , , ..,, , , KVM: , A f., R ..,...,, ,. , ,, . A ,.-. 555 ESE Cap Night, April 25, 1918 533 .. E12 2:2 535 ggi -3. E52 :5Evmummxumummmmnuwummpunmuvmumnuwvuwnvannuannuzunnwuwuuuumnuunnnwnumnummumnumm:nunnnmnnmmm wn mum:uwanrnwanmummmmunurnrnuwuwunzunlunwlusurum:numvuuvuummnuunmuurmmnunwuummyununmmnxmmnuumm4 xnmunu nmwmmmmwunnnmnmnnuurumunmm:unnmnnuununuummuuunuumumumnmnumnunnnnumumnnmnunummmunum fm:nmmmuumnmuvvwInnmmiiiiiiiifllmiihiillliiiFiliiilimiiliiflillllnunummmannuwnuunanummmvu:mmInWilFi?EIHEIIIIFFHInnummrnummmwH5115HiHIIIIKHGIIIHIliiiiiliifiiifliiiiiliiliiHIIFIHIHIIIEIEFIHIIUIIIIIlililimiiiFIIFHUIFIIQEIIIHUIFHIIEEIIZIIHIIIEEIIEEHGIGIIIHYHQIIIHIIHITHIGIummmunufmMIIFEIEIiiEIEHIIHIiliiiliiiinxMKIIGiEHilIHGli2iiKiififFuiQMHiKIIIIIIFIREEYIIEEYEIIEEIHFEIRIIIHRIIFGHii55ii5iHiiunuxHIIM' P a g e I 5 3 1 f I If -111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111151111111111111115151111111111112111E11111111111191111151111111111111211111111111111111111112111111111111111515121T1111111111111111111111112111511111111111111111111111111111111111111215111111111111113111111111111111111111111111111111111111111111111 11111111111111111111111111111111 1111 1 1111111111111111 111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111.11111111111111111111111111 1 111 11 1111 POINT BROSH GLASS IMMITTEES U. lu Webster, New Piml- lut. ou!l1nbSvnw7 Pmgnl. cum.. 1. w.11.1.r. 11.1.11 11111111.11 . , .111 .1 111. 11... 11 lm. 1... 11.1 .pp.11111..1 .111.1111111... 1.. 1.1.1. 1..n1.1... .1....., Th... 1.1.11.11. . . 'au 11.1111 11.1-11 .1 11111. 111. . -1. ...vm 11111.11 1... 11... 111. -111.11 by mu... 'nu .1111.11.m.1. ...1 mm c..1..111... Am.. u.yr1.w. ...am-n. 011.1 an 111111, ...x .r1.111.1.11. 131.11 owfnf 'r1.11.1.. c1.....n1.1i.1. 11.11.11-J 1115, nu...z..u1 sm... rm... c.--111... rm... mm. .n.x1-11.111.11.111 L+ vnll, ...'1. c11.11..1.11. A1-111111 nu., 11.1. mx.. c11.,.n1.111, c11.111. mu.- 1..y,m11.1. x.n1111..1.1. Annu. c111.1.1n11., w..1.y 111.11111 111.11-1.1.1., mmm Bm... mx. 61.111111-11.11. ul-dv: s.r11.11a1, n...1.u swan. ony sun. n1..1... c..111111m... - 11.1.1 w1i hc. e1..111.-1.11. Hurri- , 11,.,,.,.:, 11.1m.1. .1.. .1-1.1. 1u.y.1,'n..1.1.. s1..m11.., cu- 1111. sa.-.111... 1111.1 c.1.1-sn... rna G, s1.111.11, 1r1.11111.11. B111-11 0.111.111 1.1.1 111.11111-11., oem. s1..n1y, 1:11111 x.y..1, w.n1.111 P111- sux... cu-lun 1.1.1.1 c..u1..1x. .1..111...1., x-11.1 moody, ...x 111.11-1111111, mu up nm.. B111-1.1. whim A101111 An. 11.111, rumen co..-mn. - J..1.111. sim., .11.sm.111 Mm... 1 b 1. .11.111.1.1.: neu. 1... 111111. ... 01.1111 1-. eww. LH. n.111..11.1. 1.1.1 1-11...-.1 11.11 11.11111 c., mm c...-1114... w1ua.1..,-r. u1111.,.11.1..11.11: R111- ..1 u1n111..u, mm 11.1111111114 11.1. no.-u.11 :mph 11.1111-11111, 51.1121- .1. mari if 11? wf1 Y QQ .A 1. ,DS Q19 Q 1-it'-' .199-095, -1- -rsh' ' x XV. . ,Ny fy 011119 .1 , ip, ,vwpvx w xg? 1 1 ,1- ,111e-N0 , 01.1 .31 ,9p,51. W ov. ,ov 1- 4,1 xv .sq V, ,,-1 , .v a ' 0' '..- 12' K-,As ' 11- Sv' ts-N19 N111 .1 WN' ,, . , 63,1 11,11 :S,J'.v,.',99V Ns 1,441 vga.. 9 Re. ,xv va . 11, 1 1. 11+.1.v'1r' ' V .-9 X 1 fav 1-.1 111.4 B 4 S, 91,-FxyX.1:X1 1' 4xv 1 vw, , 4 6 9 fx 1 3 .1 ' . - Q 2- 102: 9 ' 1 1-1 4 .16 'x '11 0 v Y' 1-1 1 1. ,eff dl 1 X X f' ' . 1 wg'v1 ,Dv -X 1 an ,if 1. x J v211f,1-11- V11 vfiglvffi ajbi. U 1 1 . ,O 1,1-2'-x--1 . 1 11 1-5,:jf.Q.go.+ ,vi 1311- .wwf 093,11 t, - u v 9 Q.. .J 1 W 1 1 1 . 1 6 v 6 . -gy TRY msn WHO LBRBAK U mms Smdmmcomwm sw.. B. r 0rlln1udloGovnrn Underdamnu. mga.-nLmi..1:y .Lmww?l L. 111r..1. Haig. ...11111111z 10 11.1.1111 sw., 11111111.11 11.1. 1.11. 111 111. md... lllllh. 1111.1 zz.. 1.1-111.11111 11 as My gK111...b.1-. .iwmn 111. ,.v...1.1, ma.-11.1. 1. 1. 1. 11.11.111 1... as 1.1. .u..1...1. 111. 1.11.11 n.. 1111.11.11 .111 .u 11.111111 .a.1.... V 1 1 If I I x11u.... .1 1.1.111.1.ny 11-1.5312 1:15. Wbes GHCTWOFFIQS o Thefrosh OPHS' T0 111113011011 Faosu TRADITIOHSA ig 1111.11 is scpumea bi Senate Committee for I Middld al April I . 1 rassmun 1-mmmoru . 1. Nu 111.11-1... .ma -... . agrgi .Hmm 11.1 .mm 1.1. Pm, 1111 . ,mu-.bee 111.11 1. 1.11.11 11. u.. fun:-.22 Rflllrilioh Ag: NOVlmbCl' I. LM Ku '34 lDfihl lltm Lhl HN! If 1.11. 1111.1 ww. .114 1.11. .1111-as lxlhllliiunl. 2. I-'f..n111.1. .114 .13ph..11m ...n 11.1 .11 11.11.11 .11 111. U- Q... - an N. num... .um 1.1-11 . 1111.11.11 1. .11 11n....1...11..1. 4. mv... ...mba ma 51.13 .vm t1-1111... .ml -1... 111. 111.1 1. . .un nu bun-1. 1-sm .111 msn sm. 11.4111-... xhuN11l11?::...1 um: mn. 011 111111. r .xwl zA1111wx...1.11r.. 5111... 5.1.1.1 1 z. N11 n1..r.111.1.1.1 mpxmm 111.11 -Q.. ...amy 1111.11.1- a, No 1m11..11 mn nm . en. 1114... m'.1..lb 11L..1.1-L 5 N. r...1...1.11 .un .11 .11 ..1.u .11 1z...1.p. .11 .111 11.11.1- .ny b1.1u11...- s.1111 .14 11... p1..1.nm.111 11.1. . m.d'2.1.1g1 .1 .111 .1 nu .1 1 1111. f...11..,. 1.11.1151 fr.. ...11T3'.1 ua wah.: 1.1.1. u.4111111.. ..1..1..m... Th .111.1111x1111. 1.1.1 1.11. 11011. ...a ai.- f E1 aglhwmdmzs lm. 21.1.11 . ' nl! Ylfl I-I so '31 011132. .nm u.. u . nn 11.11. an mu.: 11131. 11.1..1. . M 1 e- 11 Swv- Q.-11. 11. 1...1.s.1.11111 -Lu 5. .nm .1 me -mn many of nh uma, -1.1111 1. 1111111.11111 1.1 w.11.1...1.q fail. .na 111. 1.11.1 1.111 1..1111.1m. Prwln In dilrnu iupum n. ...my 11.1.1.1 1-1...1...1. vb. 11... 11... 1. m1m1..n.. 11. mm: m:4...11....ny men-11111. - .1.. .1 111. .1...1... vx1.l.1s111.. 11.1.1114 11. pu.-!db'Y1.:f mx. 11.11111 .1 41.1. 1.1 n. .ma 1. uh. 11.41.1..y 11.11, .M ..,'Z:. no .xuaenu .lun .rumpz rn pun. hh 11111111111-1 -11.11.111 p..1.11..1..1 1.1 111. mm I11. 11.1-1.1.1 n. 1.11111 Q. ...fm 1. ..11..1.11.n.. nl u.. ma... ..1.. 11. 111.-1 u, . 11.1 .1 11.-111.11 -.11 mn 111. 1.1.1.1 .na ...uf .11-.pu .1.u1.11. 1.11. 11.1 11. u.. E HT.. u11.ux..1 un -.13 .1... ..1..p.... 1 14.11.111 111111. - nm 11. 1111.1m1.1s.... -11.1. 11. 1.11111-Ke.. 11.1.11 ..1..1, 11.1 ... ma. .1:L1.a.. g-.v.11111111 11. un... um-1 1111-111111.11111 1. 1:11 11..- .. 11. um 111. 11. 111111. 11... 11.11. 11. I.. .amz ...Q .111 11. 11-1. 11.1111 s. 1.1-1.11.1 .u... ...mm .. 111.1 ld141:1..1.u..1..1...y....,,, SH 4LL 32054 B r'741, S a 4-11 WMS111 0 1wUnr e S 1720 T Drlvoqmu RADITION ak rfamnf hw! s z.. - . . . 1.1.1 1:1 bl 1 mu 555 ' Wie' af? 'Qi 3' Q, .DX 5:.1u11n1.P::.x':1:fn.1. vm.: gig -fr-0, D, 41,14 1 2,4 ,v 9- rn. e11.11.111. .1 m. 11.1v11.ny. A I of 1.9, 9,4 Aviv r1..!. v1.1.1. -n..uu.-1... A A 55 4,vvf,1. A.1.11111111.h.111.u-b1..1111111a..m. . 1 355 .sob may ...uhm .yn .1 zz.. r..4m1.1.. 11.111, E55 1 1. ,qw 1 511114. 111. E4 muy .11 P. n..11.u, I :ss 0.- fm- umm -. L:-311. A111111-..-1., L' .yn c.....y. E. 11.1, na hh L 51. . 1 QA 511111. 1.,, X . P - ' Dafflber SENATE URDERS mg? 1v11..1...,.',Q s,,'f'f' we X. 111 2' 'ff z 1, WW' m.u11n11., 1,,,,uT gig X515 gxrfx REACH URS To :zz pa -we HEMOU1-A NEXT QUAR ,1 S1 1111111 B' :S I . . - rr. .mn ' I EE - qu ea X 'n.1 1. 1 2 6.95 QS : l': f:f.f:: 'mfg 'A-'U'-. VX 1X ..1.. 1 .,, 111. .. 65,11 212381, uw A . 11.1. 11111. lo co.. gg:-,11.:-:,'11,X,gLL.5.1::f,5 -wir: E25 A 1-1. , YNW W 11.9 mfg: . nrm Du.npsn's i15 3,5:5:'D:'i,,'T ?3m' 1. ',' 'QE . Jag, ,411v,,w EMU ...., ,,'j- 1111.111.. -1131. ,P-111.1 EE ,1. ,Q 11 Mp- nn. rm... .1 ,,, . -11.1, W, 1:2913 325. 'yy 1-ff. F71 T.'L'Q,'fu1v'i.1k:',','Q'1A3r':-':7f .,, f:j ,2.1?g5Q .5g, 1w9',n1',. WA- W 125513. .,111l. ' 1......1 717,. f-1. '21 1'-3,11 ,1 ,JW 1f:,f 'ffn3 'J1'- 5.11 1...u111.1-11 wiu 11.1. 1. -.H fn.. 'i -wu11..1?7X.' 'M 1.1 I: 1,1- 222 K 135, 111133, ,'1-SQ, 111. gm... un 111. m. nm an d u.. o'2,P:-L1.1,,, lb. B Lu-:I-11... 11. .J .11 ov .1 , , .sv - . uu111,.1..11.1. -rm. 1. 111. ax... -fm.. u. N 1 ff 'ws'-1.:5:e::'1:.'-.r.1:m 1: Ni.-51'-1312-'fi15'w3.,..,,.,1-'f'12f lll 'ffm' ga 1,-1 L 'WS' 'iv' 1.1.1.1 .. 111. 111.1 11.11.11-1111111111 111 , S, ,,17- -1-.1131 :W-m1.I'.2 3' f-11.2 ,. 0,1 px... 40111. Q Q , D . ..,, ,L -11. ,M 11. 1.. :E .1 ,,,. X, 3,4 1.5, up -.,.1..- -. 1 -- -- ....-1. f11..11. .1..' . ...Wh 1111, ,g ,N 111 .1 . .S . '11-1 1. nw... ww- , EEE m ,11Ww -41.49 'U hx. ,. M 1... 0 'W -1- .1-A 11 ., wo' 0. M 'UNA- :1- agile v ,3111g,. v- 111., ,'gg-fg1..'I. L , 53.1-1-1 ' V' 'Q' Q' 1-W'-me ,sg H I 1 1 1 41 14 wlhvlwtmluvm 1 1 nluuwxlmlulvx 1 I1 111 4111 Hlmlwmm uwllwmwll IA A H 1 .F111111111.1111111.11.11.1111.11.1111.1111111.1111111111.11111111 111.1111 11. 11 1 111 1 11.11 11.1 1 1 11 1111 1111111111 1111 11 1 1.1 111111111111111.11.1..1111111111111..11111111:11m:i11i11111L:11.111.111.11.11.1115511:11:11111:il11111.11.11..1...1.111.111.11 1 11 1 111111111 11.1111115111111511I:11.111:12za1:11i11.111.11.11.11.111111..1 111 .11 1' '1111.1111111.111111111.11.111111.111111.11111111111111.11.111111.111.1111111.11.111111.11111.11.11111111 11111.1111111..111.1111111111 Page 154 iimmiiniininiiniinimiiiimimiiiiiiiiniimniiiiiiiiiiiniiiiimniiiiiiiiiinminiiiniiiimiimniiiiniiniininiininiiiiiiiiiiiiiiiimiiiiwiiiinmimiiiiimiiiiiiiniwiiiinininiinmiinininiimuiiniiiiiiimiinininiiiiimniniiiiimmiiiiiniininiliminuminiininimiiiiinininiuimiumimiimminiiiiiiiimmiiiimmii miuiiininiiniiniiniiiiininimiiniiiiiiiiiniiniininniiiininiinimniimiiiiiniiiiiiiiniininiuiiiiimmiinimmiuiimiiiinininiimiiiniiuiiiiimniiiiiiiiiiiiiiiuiiniiiiiniiiiiiiiiiiuiiiiiniiniuiniinimuiiniiiiiniiiiiiimiminiiiiininiiniiiiiiiinmiiiiimininiinimmiiiiininiiiiiniininiiiiiiiiimiiiimiiiiiii A .minimmiiiiiuiiniiiiiiiiiiiiimuiiniiii .iiuiiiiiiiiiniiiiiiiimminmiiiiiiiiiiiiiiiiif A Word for the Students Army Training Corps By Major joseph D. Holloway, Commandant HEN the Students Army Training Corps was planned and the matter put before the various educational institutions throughout the country, the War Department, through the Committee on Education and Special Training of the General Staff, was attempting something in the nature of an entirely new departure from the usual army method of obtaining suitable officer material. Such a step had of necessity to be taken to keep pace with the rapid expansion of the army to meet the then existing emergency. The S. A, T. C. was instituted to form practically a depot from which material could be drawn that would after training fur- nish the bulk of the commis- sioned personnel of the various branches of the army, chiefiy Infantry and Artillery, Heavy and Field. Unfortunately, with the signin of the armistice, the need for ogflcer material became of no importance for the fur- therance of the War Depart- ments plans, and orders were received not to send any more candidates to Officers' Training Camps. Nothing could have proved more detrimental to the morale and good discipline of the unit than to have the hopes of hundreds of young men shat- tered and quite naturally inter- est in academic and military work lagged. Those men who earnestly desired a university education at government ex- pense continued their work diligently, although their chances becoming commissioned officers were goneg they deserve great credit. Others, whose interests were not along educa- tional lines, deserve credit for the time they have given to both the educational and military work with the one purpose of securing a commission in the military forces. Undoubtedly, had the war continued, the future ofthe S. A. T. C. was assured and it would have been only a matter of time until condi- tions would have so adjusted themselves that all confiicts would have been removed and better men would have been graduated from the University and frcm Cfhcers' Training Camps than ever before. MAJOR Josepi-i D. I-lottowmr iwigiiimiiiiiniiiiuiiininiuiimiggywmuiiiummmiuiiniiiimmimmnumininiimiimiuilimiiimmininmininummiiiiiiiiwniiiiiiiiiiiuimiinimuiimmmm:mmumuiiniigigwiwiimiiigiiiiiiimniw :mmiiiininiinmiimlimiiiiiiiiiiumiwmininiiiiiiimiinmiinmiininimumiiuiimmmmiiuiniminiiniiiiiiiiimiiuiniiimnmiiiiiniiimmiininiiiiiniiiiimniiiiniiminilimiimininmiini.mniitmmiininiiiiiiiiiiuiiiiiiimi Page 156 wminiinimiiinimiiiiiimiiiu!L iiiiiimmiimmmmmniummini Elie Officers TOP ROW-Heep, XVaItOn, Einbecker, Warr, Walker, J. P., Ivliddlebrook. Naramore, Wells, Irion, Ferguson, Webster, Kenney, Epstein, Sommer, Brown, Wallace, IVlCCaSkey, Hanaford, Webb, Weiskopf, Wellltxorn, Watkins, Bentley. SECOND ROW-Benscoter, Washburn, W. O., Ticknor. Lilaera, Multer, Kara, Mowry, Parmenter, Dunne, Sheppard, Joslin, Babcock, Holloway, Weiss, Sloan, McCurdy, Waller, Niederer, Kennedy, Rewey, Kurtz, Jones, I-lerwig, Field and Stay? Weitman, Walker, W, G. MAJOR JOSEPH D. I'IOLLOXVAY, Inf., U. S. A. Com- mandant IST LIEUT. GEORGE A. SLOAN, Inf., U. S, A. Adjutant ZND LIEUT. RUSSELL G. KUR'FZ, Inf., U. S. A. Person- nel Adjutant ZND LIEUT. QRMOND E. REWEY, Q. M. C., U. S. A. IST LIEUT. JOSEPH D. WALLER, M.C., U. S. A. Surgeon IST LIEUT. RAY W. NEIDERER, D. .C., U. S. A. Dental Surgeon IST LIEUT. MORTIMER M. BARTLEY, D. C., U. S. A. Dental Surgeon First Battalion CAPTAIN LOUIS LAEOER, Inf., U. S. A, Commanding Quartermaster Company A ZND LIELIT. MILTON F. XVEISKOPF, Inf., U. S. A. Com- manding ZND LIEUT. WILLARD O. WVASHBURN, Inf., U. S. A. ZND LIEUT. HOWARD KARC, Inf., U, S. A., S. D. Radio Instructor Company B ZND LIEUT. WALLACE W. BROWN, U. S. A. Commanding ZND LIEUT. WILLIAM G. WALKER, Inf., U. S. A. ZND LIEUT. THOMAS E. JONES, Inf., U. S. A., S. D. Athletic Director O. T. C. Candidate Examiner. Company C ZND I.IEUT. I-IERMAN F. HEEP, Inf., U, S. A. Com- mending ZND LIEUT. BETI-IUEL M. WEBSTER, Inf., U. S. A. ZND LIEUT, WILLIAM T. WAl.TON, Inf., U, S. A. Company D ZND LIEUT. WILLIAM F. EINBECKER, Inf., U. S. A. Commanding ZND LIEUT. MERLIN C. WARR, Inf., U, S. A. Second Battalion CAPTAIN CHARLES G. BABCOCK, Company E CAPTAIN CHARLES G. BABCOCK, Inf., U. S. A. Com- manding ZND LIELIT. GRVAN W. WVEBB, Inf., U. S. A. ZND LIEUT. DANIEL B. BENSCOTER, Inf., U. S. A. Company F IST LIEUT. RALPH B. MCCURDY, Inf., U. S. A. Com- manding ZND LIEUT, JESSE P. WALKER, Inf., U. S. A. ZND LIEUT. FRANK MCI-I, FERGUSON, Inf., U. S. A. Inf., U. S. A. Commanding Company G ZND LIEUT. LUTHER M. WELLS, Inf., U. S. A, Com- manding ZND LIELIT. OKLIE D. WASHBURN, Inf., U. S. A. ZND LIEUT. ALFRED K, IRION, A. S. S. C., U, S. A., S. D. Post Exchange Officer A Company H ZND LIEUT. WILLIAM C. KENNEY, Inf., U. S. A. Com- mandirig ZND LIEUT. MILTON O. NARAMORE. Inf., U. S. A. ZND I..IEUT. WVREN MIDDLEBROOK, Inf., U, S. A. Third Battalion CAPTAIN WALTER C. WEISS. Inf., U. S. A. Commanding Company I IST I.IEUT. HOWARD R. JOSLIN, Inf., U. S. A. Com- manding ZND LIEUT. EDWARD D. LIBERA, Inf., U. S. A. Company K ZND LIEUT. CI-IARLES W. SI-IEPPARD, A. S. S. C., U. S. A. Commanding ZND LIEUT. HOWARD H. BENTLEY, Inf., U. S. A. ZND LIEUT. JAMES E. KENNEDY, Inf., U. S. A., S. D. Ass't. Personnel Adjutant Company L ZND LIEUT. VINCENT L. DUNNE, A. S. S. C., U, S. A. Commanding ZND LIEUT. WALDEMAR F. WEITMAN, Inf., U. S. A. ZND LIEUT, GEORGE SOMMER, Inf., U. S. A. ' Company M ZND LIEUT. LEWIS E, PARMENTER, A. S. S. C., U. S. A. Commanding ' ZND LIELIT. RAYMOND WALLACE, Inf., U. S. A, ZND LIEUT. JOI-IN D. WATICINS, Inf., U. S. A., S. D. Mess Oficer Radio Company ZND LIEUT. LEWIS DE R, MOWRY, Inf., U. S. A. Com- manding Headquarters Company ZND LIEUT. LEE C. I-IERWIO, Inf., U. S. A. Commanding ZND LIEUT. EARLJ. I-IANAFORD, Inf., U, S. A. ZND LIEUT. DONALD D. MCCASKEY, Inf., U. S. A., S. D. Ass't. Personnel Adjutant Military Police Company .IND LIEUT. EZEKIEL S. EPSTEIN, Inf., U. S. A. Com- manding K ZND LIEUT. ROBERT E. WELLBORN, Inf., U. S. A., S. D. ASs't. to Q. M. ZND LIEUT. FREDERICK L. TICKNOR, Inf., U. S. A., S. D. Ass't. to Adj. Marine Company IST LIEUT. WALTER W. MULTER, M. C., U. S. A. Com- manding Navy Detachment ENSIGN IvAN C. Mix, U. S, N. R, F. Commanding milII...IIninmy,III.-III.I-..I.III.i...II-IW .WIII.IIInii.I.IIIIIIIIII-III-v.iI..III I-II .mu I .I-I-II ...WIN-In ...nm-,IIII.III.mII..II.IIII. ImiIniiilEIGIGIIEEIIQIIIIIEIIEEiilii Page mmmmnnm L....... .... L. ....... .. .... .... . ....... .-....- ...... ,..,..... 157 ,mmmmmm.mimnmmmmimmiimmmummmummmuw.ummv--nnimmmmmmmmimmmmmmm.immmmmimlmimi.mmiinmlmimummmin:mmmiummiii.mminimminimminimimm1uimlmininim1niHmy1inmm1inimminimuminimminimm1inmlmin1mmmiminimmmmimmlminmlminimmmmmninimmimummminimlminnumimnmmmium.in1Iniummmmimmiwimnmmummmnmmnmmmmug Taking the Oath ofAl1egiar1ce, Got. 1, 1918 Ex-President: Taft Reviews the S. A. T. C. Troops at Vilas Park, Nov. 10, 1918 : - : E IE 3 MMMMm35.,mi..2..,:.,H.5...,H.,i.,,...,..m.,..H,..,,..m,,.......,..,H.,H....,...,...,..........,...,...i..,,..i..,,..i.,,K.....1,.,,,.,,..,.,..,.u..,.,.,.,..,,,..,..,...im.,,.....,....,,.,..,......,,..,..,,...i.,,.,,..,i.....,..,iH.i.,,...,..,..,..,,.,H.,...WH.,..4,..,......,...,.i.....m..,..,,..,...,.,...,..,...,..,...,..,...,,.,..,,................,i.,..,i..,..,im..,,......,..,..,.,....,i..,...,,.......,..,...m..,UH...1.....,,......,.....HH1.....f...H.U..,..,H,..,1.,.,......m......u...,......,...,..ii...,..,.1..1E mimmvnnumaniiniiiniimummlimwmmunminummminnmmmmimnmmininumluummnumimiminiumummfnumiinmiiminmiiminmyinimmyinmyinin1invmhimiiminiidviiiii:EiliiiiiiiiiiiiiiiiiiiiiiiEiiiiUiiiiiiiiimiiiiiliiiiimiiliiGMMiliiiiiiiiiiiiiiiiiiiiiliimliiiliiM555FEEFEEIEIEIEIIIIYEIEiiiEiiiiERHRiEiiiiIEiiiiiiiEEii1iEimmmimmim'iHimiminmininunnummmnmuEuinimmiumuimnwummuwuiumnumnnmuunnuus Page 158 - 1353535555willM5giuiiiwgwmwww.,,..,...i..iK.ii.H....niI,MU.,........i..,.i...,.,,..i..,...mm.,......i,.,i..imn.U.imi.HM...MV.i..,...i..i,.ii..,..,,..iW.i.H...H.....i.ii.......i.,i.,...i...i..i,.,i..,..,,.,i..i,..iK.,H.,.H,..iinV..i...WH.iH.U.,..ii..V......i...i..,inH.ii.i,W,V.....iiHiniK..H..iniwi..U.,i..iH,H.i,Hinii.mn.,im..ii..iin...ii.,,uiM.,i.Hif.im.H.,.......,......,...,.....n.....,n.....,......i..,...in......miiU.,.mm,.....n.,,..i.....m..,...,..,...s z 5 gm ,, ,.,..,...,,....... ,..,.......-e-.. ...,,.,,.......,,.., ,...,.. ..,.........,...,.. ,.., n.,,..,..,.. ,..,,. , .,..,..,...,......,..,..,,,.,..,,.....,..,,.,..,.,., - . , ...n,,..,, . ,.....,..,,.,.,.,,.., ..,.,...,,.. ,,.,...,.... .... ,,..,.,...,, M ..,...,,,..,.,..,,...,. V ..,,...,,,,,.,,.,...,,..,, . , . . ..,,.,,.... , . , M-. .,,...,,. W. ...... ,.-.N.h,-..- ..,. -s-.-.......,M-..,.....n...,,.,.u...,,.. ..: gnu.,.i.ii.m.mm..iimmmmiimimiimimmi.mimimi.m..ii..mn.ui.Wiii..iimmmmmiiimiimmwmmimi..inmm.ii.Wmmimmm..ii.ii.iimiummimumimmmiiiim.Winimmimi.mmmmimmmymimimimiimlwmmmimimi..miiimiimmmiiiim.-immii.ii.m..m.i,.ii1-mimiimmm..invmlmmiiiiiiiiiiiii,mminim,mi..i.m.m..ii.ii.miimm...miniimmwimmiiniimiI-mm..ii..umWimiiii-iiiiiiimiiiiiwg 5Igm,iiiiiniminimymm.iuiiiiii-.wimiwiiimi.ii1fii.Hmm.iiI-iinmuniiniuimm.iiiiiimmiliiinimimiii.iiiiinir-.iinuiiuimm,iiniuiviii.iiV..ii-1ii-ii-Iiim.iirimi1.4iiiiminiiuii-4iim.,iuiniiiiii--iI-iiiiri-.uminiiiiuii.-ii-.iiniinimmiiimiiiiii-.iwiiiiiiiiwmiiiii..imi.-i...ii.miii..i...mvmWiiiiin,Aliiii.ZiiIiiiiiiiiiiuiiid'MilliiIii1?iI,?iiilIi.ililiiI.IiLiIll?IliIllliili1llllilGillIiiFilIiiIIIQIQEIITIEEiliEiiiiiiiiil1EEEliliiiliilliiiiliIHQIZGZEXiliiiii5iiiiiiiEIFIZPIIETEEE5 sis :is 'ga Z 5 E i' 5: 5 . The Gymnasium is Used for Barracks SES EEE Mess in the Annex on Thanksgiving Day if s f..if..m.,,.,,i.,i...iini.iiH.,imH.....iim.,,,.....iim,mm..ii..H.,....inH.,i..H.,Wi.....,.....,.i..u.ii.i..,..m.,...mii.Mmi..im..miim..i..i..ii.,um.,miW..i...my......i..H.,uiK.,mi...Mi.1H.,i..i.Him..i...,Himmi.W..ii...W.......mi.....i...V.,...i.ii..,,.i..i.,....K.,...i..W.,...iK..i..,..H.....,...,i.,imH.,.,....i...,...i.ii.U.....imm,H.,Uim...i..inii,W.i..,.......i..i..i...,...,.,i.m.,u..i.m..u..m..,ii..mm..,,....m..1..,......,...ii..,m.,.,.,.,.m..i,ms,:.,.a - P a g e I 5 9 1mm..umH..Mu....m.,..H,,.......,..,,....K ...K H. n,.. U..,,,.m.,. .,,.,,,..,.. .H .,.. u..1...,..,,..,, ..,K, , ,..,,,.,,. . ,..,,.,,K..,,. ,HH,..w.m..,,.,,..,,.,,., .,K..,..,,..,..,,.. ,H,W..W,..,... ..., ..,..m.,, ,.,..,,..Y,...,.,l.,...,, W .w.,,,.. H.. w..,.., ,..Y,..,,HY..,..,,..,K.,YHWV..,K.,Y..YWW..WK.,H.YInW..W,.,,,,M.W,,W...W..,5,5W3,Mfm,HE5135,,inM,35,15H,5,55,15,5355555,1,55,U,3,3,ff3,5355,mfM31,3fm,M53,15,3,UH,35,4,T53,.5,3,HE..1,E55,52,WW,,.WNml,H3,H,,.1K..NHw.m..N.m......u...f5 225'-'.m,n,....F.mmman:::zmz:a::zznn.'r,.,,n:nx::n::1:::1zz:rummanaxzzz:::zna::::n:::::nma1mana:namza::::::::1:zz1rm:zzz:12:1an1:::::::za:zzazaazzz11:3:msnxzzzagqQ:1mas:1:snzz:1:11:11:aaazz:11:1zz:zz::zzz5:11xxx:xxx.:,.:,qs.,.zz,......,,.,,..,:.,,.,,..,,,.,..,,......,,..,.,,..,,.....,..,,..,,..,..,...,..,,..,,.,,.,,,.,,..,..,,H,..,..,N.,,..,,.,,,.,...,..,,....,,.....,,.,,N.,...,..,,.,,..,W,...,..,,.,,,.,,.,,..,,.,,..,,..,,.,,..,K..W..,.H,,,,.,,......,.,,,....,.,...,...,..,...,..,.,.,,,..,..1...,.m.......g22 EEE if 1 W EE I I 2 as .ggxnnum:ul1unnmH1rmnwnu1ulNInuvlrllvulmlmuvmrumuuvvrlwrmwvuvuml1vu1:mlnnnwunruwruwvuxvu1luxuxyuwu1xanxuruwwuvvuxnwvuwulxanxuwnv1:lvvuwvnxll1nuwInzuxvlnu1mulwuwvmmllmlmvmlu vmmvuxmn lu E? E ,HH,HWHInWmWmWInXMHHWHWWInXmWWWInWWNMHXmWinMimmmMmGimimmmMMIV1.,ZW1,..H.,...,,,.,,....,,..,,..,..,.,,.,,.,,.,,..,.,......,.,.,.,,....,.....,............,,,.,,.,,... ..... ..,..,,..,...!l.Ziff!lillEEZHIITEZ'EliKCI!EIIIEEIElf'IIIZ!!YZ!IEEIIYCEEDIIIIII21125EEEHEEISZEEII!!IEDillEEl'HEY!!!YUE!BIZEfflflII!!!llfl2311121251E!! H ' ' ''' ' '' '' ' '' '' ' ' '' '2 55 u u nu ru nwInwHwvu1vufuwmruwfu1lmnwruwulw1Hfuwmsu1m1nwmwuwmwuw1uwnvwnwrnwuwmwmwI4wu1fuwmrunuWnwn1numwnumwnwmwuwvumwW1uwufwuw1Iw1n1w-1wu1wmruin1nw1nuuwmwu1w.1uHw1uwmuI1wWwH1mumfmmwmml H Page 160 . .-...,...,-...................-,...v: mu I wwH1uwWHwUwruwm1H1H41HwyuWmwuvmwmmww-11Hwulnuwmmfuwmwn1nu1mmum1munnumvumumnHunInmmuuunmuuum.1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 1111 11 11 1111 11 111111 1 11 1 11 11111 1111111 1111111 111 111 1 11111 1 111111111111111111111 11 1 1111 1 1111111111111 11111 11 1 111111 Company' A Offcers LIEUT. MILTON L. WEISKOPF, Commanding LIEUT. WILLARD O. WASPIBURN LIEUT. HOWARD KARC Cadet Non-Commissioned Qhficers GEORGE B. MCCORMICK . . First Sergeant BUMP, FRANKLIN E. FLOOD, GEORGE H. HENDEE, JOHN H. KAUMHEINIER, LEON E. KINNAN, ARTHUR H. MAIER, VICTOR l. BAUER, ALFRED J. DONALDSON, CLIFFORD S. FISCHER, HARVEY C. HOLM, GERALD W. HOLTZ, WILBUR E. ABRAHAMSON, ABE BAINBRIDC-E, THOMAS M, BARTELS, RAYMOND O. BLACKNEY, CLARENCE XV. BLADON, CUTHBERT W. BLASING, ERNY E. BEAUGRAND, MARSHALLE BENTZEN, ROBERT W. BOWERS, NEWTON L. BURNS, JUDD A. BUCKMASTER, BRUCE M, CAIRNS, GEORGE W. CAPEK, CHARLES A. CHADBOURN, REUBEN C. CHAPMAN, JAY W. CHARMLEY, CHARLES C. CONLEY, CLAUDE S, DARRENOUGUE, R. S. DAVIS, JAMES B. DAWSON, FREDERICK J. DICKENS, PERRY A. DREKMEIER, ALBERT C. DROTT, ARNOLD M. ELMER, WILBERT D. EVANS, JOHN H. FIELD, MAURICE E. FORMAN, ABRAHAM W. FOSTER, JOSEPH O. GATES, HAROLD C. GILBERT, ALEX C, GLYNN, NEAL A. GOETTSCHE, FRED F. Sergeants MCDONALD, JOHN F. IN'1EDER, JOHN O. MOONEY, WILLIAM P. NEPRUD, LINCOLN NOLTE, CLIFFORD S. PENFIELD, AINSWORTH Corporals MANN, GUSTAVE B. POND, THOMAS H. ROSE, RUPERT E. ROYCE, HENRY B. SELL, VERNON W. Privates GRAY, WENDELL A. HARMAN, JOHN C. HARRINGTON, EARL T. HAWKOS, JULIAN H. HAUBRICH, EDMUND HOLM, TRACY C. INGRAM, WALTER J. JAMISON, ELCIE B. JENKINS, GLENN L. JORDAN, CECIL F. KLUETZ, EDWARD K. KNAUSS, BENJAMIN, E. KRAEMER, ELMER A. LARSON, MILO R. LEPKOVSKY, SAMUEL LORIG, ARTHUR N. LYNCH, DAVID C, MAXWELL, DONALD R. A. MCCALLEN, CLAYTON B. MILLER, ALLAN H. MUSKAT, HARRY NEHRBASS, HARRY L. NELSON, KARL O. NEWBURG, MELVIN R. NEWMAN, ROBERT T. OLSON, CARL M, O'MALLEY, WILLIAM P. PAUL, HAROLD H. PROKOP, JOSEPH J. PUGH, CHRISTOPHER E PURNELL, WILLIAM H. RALPH, EDWIN D. RESH, WARREN H. SCI-IRAMM, FRANK H. SMITH, LEWIS P. STEVENS, GEORGE O. THOMPSON, JOHN N. THOMPSON, LYALL E. ZUBROD, WILLIAM B, SMITH, RALPH R. WELCH, THOMAS D. WICKS, WILBUR J. TUFTS, HENRY F. REUTER, FLORIAN J. RINGDAHL, HARRY J. ROUNDS, HAROLD B. SCOTT, CLIFFORD O. SEIBOLD, RAYMOND W. SMITH, SANFORD F. SNYDER, ALBERT G. SORENSON, ROY STANTON, CLIFFORD M STEVENS, RALPH W. STRAND, JAMES L. TAYLOR, FRANCIS TETZLAFF, KARL E. THIELMAN, EDWARD J. THOMAS, THOMAS B. THOMPSON, ALVIN J. THORP, LELAND A. TIBBETT, WILLIAM R. TIERNAN, GEORGE H. TREAT, RAYMOND C. TUTTLE, KARL R. UHL, WILFORD H. VAN UXEM, ELMER W. VOLL, OBERT F. WEEKS, RALPH E. WEGNER, ARTHUR E. WELLS, RALPH A. WESTCOTT, RAY D. WHITE, PAUL B. WICKS, ORRIN D. WILLEY, HOWARD E. WOJAHN, CHARLES K, 11 11111 1111111111 111111111111111111111111111111111111 11111 1111 11 111111111111111111111111111111111111111111111111 111111 111111 1111111 11111 11111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 111111111 1 111111111 Page 161 111111111 1111111111 1 1 1111 11111111111 1 1111111111111111111111 111111 1111111111111 11 grulmmIIIIMIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmIInIIIITIIIIIIInImImImInIIIImIIIImIIIIIIIIIIIIIIImInImIInInIInImInImIIIIIIIInmyIIIIInIInImInnuImInIIIIInImInImInImIIIIIIIIInImInIIIIInImInnuInImIumIummIIIInIInInImIuunmnnmnnmmuIInImImIIIIIIImInInImnumIIIIInInnuImInnmnnumInInIIIIInIIIIIIIImImIIIInIInInImIIIInIInIIIIIIIInImInInIIIIImInIIIIInInImInInIIInIIIIInInIInImInnnInImmm:IIIIInImImnnIIIImIIIIIIIInumIIIIIIIIIIIIIIIIIIIIIIIII-1 5 5 QIIIIIIIWWIIIIIIIIIIIMIII.-I..II.-mf, II MIIIIIIIIIIIIIIII. I.II.III.w.m I HY' Y A -:SJ ' 52: .- I WN 'mf f .fa-'5 1 S if - Af Q , gi? ff Qi n: ' '- galil'Ei.-is-::,:effg-RTM PM '- ' -- ..,. n Hia .' 5 I . V ' I 5?,'::E,eg.5s5zipgATTEQRPA Q ' ' T p ,. Q: ao- ' LA .-T5f:Fv.':-.- ff' T331 W3 A A 5 20 5' A E5 fi' - T: 'gy - , PM X:5:,.,,....A,.:'.fI ,: , -alma, WA J ,L , bf, M. 1 K ' Wim' .IIIIIIm,III.III.II.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I A ,A -AMPS? v A 4. y Company B Officers LIEUT. WALLACE W. BROWN, Commimding I LIEUT. WILLIAM G. WALKER LIEUT. Tl-IOMAS E. JONES Cadet Non-Commissioned Officers DONALD C. BAUDER . . First Sergeant ALFORD, F. E. BRODT, C. D. CALDWELL, J. R. CULP, R. F. DANIELSON, A. C. DENISON, H. C. ANDERSON, D. BABCOCK, J. D. BELVACE, H, T. BROWNE, W. G. CHRISTIANSON, A. W. CLEAR, E. K. DATES, G. L. ABRANIOFSKY, EDXVARD A. ANDERSON, CLARENCE W. Sergeanls DOEOE, PAUL F. DORNBUSCH, A. J. FELDMAN, JOSEPH G. FERGER, W. F. GATES. G. B. HEUSTON, A. N. Corporals ENCLER, M. B. FORTNEY, R. L. HAHN, A. J. HALBMAN, H. HOLSCHER, H. HOPP, A. J. LOOK, W. O. Qprivates GOLDEN, REGINALD C. GRIBBLE, SAMUEL W. KELLET, W. R. ROSS, FRANK A, STOLLEY, G. B. STUEBINO, A. C. THOMPSON, S. E. TOWER, E. J. LUNDGREN, C. L. MOREY, D. J. PETERMAN, W. F. ROHDE, A. A. STABO, N. R. VOGE, C. D. PETERMAN, WILLIAM F. PETERSON, RALPH W. . A-I .,5::,.,2.fQ, . , .,.. ,.., x 6. I , 21' . . ATWOOD, JOHN T. GRIFFIN, THOMAS W. PIERICK, URBAN J. '- Q BAUCH, CLEMENT F. GRUHLE, ARTHUR H. PIETZNER, VERNER W. BECKMAN, FREDERICK W. GRUPE, ROBERT H. PRATT, LEROY J. BERG, CASPER R. GUNDERSON, EARLE L. QUINN, EDWARD W. A, BERNARD, JOHN R. HALL, HERBERT P. RALPH, JAMES S. :S BJERKE, JEROME O. HALSOR, IVIARTIN E. RAWSON, CHARLES A. EE BOGAN, NVOLDON HANIILTON, JOHN S. REINHOLD, FRED E. if BOTHWELL, JOHN S. HANSON, ROY B. RICHARDS, GLEN E. 55 BRINKERHOFF, JOHN S. HOCKINC, JOSEPH P.. RIEDER, OSCAR W. gg BROWN, ANDREW B. IRISH, FREDERICK W. RILEY, PETER E. 232 BURNS, JAMES P. JOHNSTON, JOSEPH H. RISBERG, HAROLD N. gi CAMERON, THOMAS L. JONES, MARION W. ROBERTS, ARTHUR O. Q22 CANNON, DALLAS E. KESSER, EDWARD F. ROSE, HERBERT A. if 2152 CASSERLY, RAYNIOND J. KIRCHER, JOHN E. ROSENBLUM, HARRY M. EE ,V ,V CHARNEY, SIDNEY C. KIRKHUFF, JOHN D. SHILDO, RAYMOND A. CHASE, DUDLEY KNEEVERS, EARL E. SHOWALTER, INORMAN 55 CLAGUE, COLEMAN KNUTSON, ROY J. SCHUKNECHT, ROY J. EE rg CLAPP, SPENCER KQENIC, LOUIS A. SHATTUCK, LYLE D. 52 SSE? IfffS??fER C 1IfSEUfC3e?S'jIS J A 215.335 ' 1522? 555 ,Arg 'A . . , . . Egg CONRAD, CLIFFORD D. LANCILL, ADDISON NV. SMITH, JAMES W. Q22 BANIELSOXIXII, JOHN JA EEACH, HIAIROLD C. 2MITHiJWVAL'lgER H. E55 ENzER, ILLIAM A . ESSLER, ONTAGUE TAM, OHN . 25 DESMOND, HUMPHREY E. LIBBY, GEORGE A. STEHN, RANDOLPH F. gg SOE!-ILEQ ARNOIPP W. LINDOUISIT, LOUIS ETONDALL, RALPH M. 5,5 V 5 Q A. OYLE, RTI-IUR . UOOPF, EONARD . TONEMAN, ICHOLAS DRAJESKE, WILLIAM H. MACCRADKEN, JAMES C. STRAND, HARRY E. gg EUNN, DfiRREL DL IIQAAAIEZTPREPSS, SEYMEUR ETRAND, ,ILOSEPH URKES, UTHER . C UE, RANCIS . TRONC, ABIAN . QQ Q11-'g?J'Q DUVAL, ALBION MCMURTRIE, ROBERT H. SXVEET, DONALDJ. DYSART, RAYMOND ' MEYER, FRANK P. SNVENSON, SEVERN H. if ESCH, HUGO E. MONTGOMERY, LEO C. TAMMS, HENRY N. 555 FANSLAU, AUGUST H. MORRIS, CHESTER TANNEHILL, HARRY S. EEE FELLONVS, KENNETH S. MORS, MELVIN A. THAUER, RICHARD C. if Qill , FENNER, EDWIN MULLEN, ROBERT A. THOMPSON, JOHN W. gg Q 4.1 F ISCHER, JOHN F. NELSON, CHESTER W. THORSEN, MARTIN EEE fix FRANZ, WALTER B. NEXVMAN, EMANUEL D. TOMCZYK, LUDWIC Ei? FRAWLEY, J. RUSSELL NOREN, HERBERT L. UHL, ARTHUR H. gg- IERENCI-gi PHILIE A. 8 ERIEN, QFSICHARI3 D. ww BERCEN, EDSON :iz 3 RITz, ALPH . ' EARY, OSTER . ALKER, AY . if . - CANNON, ROY A. PASCH, LESTER A. WALL, WILLIAM L. :A ,.',,,,,,.,g:,..:,.AQf' GERICKE, WESLEY O. PEACH, LLOYD WHITE, BURTON H. ii SIESE, QEROME EELLOXV, C5HAUNCEY ENHITE, WCITLLIAM SD if W 'A IESE, ALTER . ERLMAN, ACOB IECLER, EOROE i5f ' ' 'H W U IH I-I - II-1 I U1-'www-A -I In-I-II--II-I-I-:II III I -IIAM-I..II..I ..... . I... I.,I.w..,..I..,,.,...IMMI, ,.,.,,,,,,..,,,.,,.,,,..,,., .. ., ........ ...,..... ,..,... ....,...,..,..,,...,. ..., ....,..,..........,..,,....,,...,..,,.I,. ,..,... ,., .,..,...,.... I., .,,. .., ,.,.,. ...,.,,.,., ..,... gmgggg- ,,,,,,,,,,,, , ,..,..........,.- -.--,.... II. .. ..IIII...Im.I.II..I.I..I..II..I .I I.II..I..I..I. .III III..I..II..I,..I..,I..I..... II..I..I...I...I...I..,,......I.. .I II..III...II...I.,I..I.,I.I..II..I...I.,II..I..I....I..II.MI.I. II...III...I...II......,..,I..II..I..I...IIIII.I.III.,IIII..I.II..I.........I..I. ,III .IIII..I..II..I..I.,I..I..,..I..II.,..I..II.I..I..,...I..I .I..II.,II..I..I..II.,I.,II..I.I,...I..I...II.II.,II.I.I.III.,III.,IM..H...II.,...IIm.mm...TII.,I.IIII...I.I.II......I.IIIIIII.I..I..I.I.I..I.,..............,..,,..,.,, P a g e I 6 Z EE ,,...,.,,m...,m,T..I...II...I.,..I...,....I...,...,.,.,. ,,.,,,. ,...,..T..,... ,,.. TwI.,I...TIT..I.II.T,,.,......,.,...,..,..I l.,. T., ,..,,.,.. .T ,.,,.,. , .,.,. ITI,IITW..,.,,..T......I.Twi,mf..,IIwuwmw...I..II.,,...,,,.,...T,T..,.,.,Twmwwwww,...I.,I..T.,Iwww....w.2wMTI.TI..I..,.,.,...wUIWMW.T..,,..w,W.IJ.,..TT.,I...A.I...Tw,..E,,,..I.,,,.........T,IAII..II...TT,.,T.,,..,....,......, --T I I. I T I :ga 1 3 , . E52 SES il: SIE 235 2 S 5,5 . . , ..,, 1.5 , ,, Com an C I ' . . -'T Wznners of Com,bet ' gig I - 3 T 5,2 EEE ' ,sw 1---me M- - E E EI: SY , ,Ya 3 Tis ofifims TE I N ,Rifir Q 5-E C- 'R - I- f 51- I 5- fp ' .1 ,gd 5 ' LIEUT. HERMAN F. HEEP, Commandmg gig ,wx '-.'- GhTf , ,... 9, LIEUT. WILLIAM T. WALTON 55 A - TQ- -wj',c,,..', A -5 lj ' W.-1 ' 5,9 f I LIEUT. BETHUEL M. WEBSTER if his ,:.,5af1ys'3fA ,..: ,,. W '-' e fi. fi ' -' 3 w '. A--hA'.14' 2:2 f A' cz cl N C ' ' Oz O 'P'-5,-'.. .Z ,P-. I 1 , .- A a et: on ommzsslone fficers f f ' ADOLPH 0.1-ECKMEYER . . First Sergeant .-fir f' , , if: , S f-L- 'Ri ffm - f 'wtf Q. 3 nw' ergean S Y N -Rig 1' H ',':f-- R?Pf -.: I ' Q ft ' - 5 pggfifiifxf , BARNEY, TYLER D. FRULAND, CHESTER E. LUETsCHER,FREDERICKJ. jgji , SRi'..-Aqjg gig BROXVN, PORTER H. GEORGE, LLOYD MALzAI-IN, WALTER E. ' , BURNS, WILLIAM W. GRACE, HOWARD R. MILLER, GEORGE P. . -' 51' ,A -' CONLEY, PAUL C. KAYSER, PAUL A. WOLFE, JOHN C. 9,4-, E-a'2r:-T.,.m.T1,--A - - 1, , .., A FLOCAUS, WILLIAM A. KNORR, LINCOLN D. WRIGHT, SAMUEL C. A 5- am- -' I-' ' I-' ,- , .,.f Rv 1 - C afffiv- .E - or ora S . 2 1' I.. p 4'-' ' . Af ' sg- . BENNETT, LOREN HOYER, FRANK C. NOREM, LAXVRENCE E. , '- V, 4' H ' CANCE, JOHN W. LILLICH, JOHN E. REILLY, CLEMENT H. -V , DRIVES, ROY B. LINDA!-lL, GEORGE E. ROBERTS, GAIGE S. I., EDNVARDS, HENRY L. MARTINEAU, THOMAS B. SMITH, GILES V. 1 'LI HALLINE, EDWARD P. MCCRAY, JOSEPH W. THOMPSON, EDWARD G. , . HARDY, HORACE F. MCIVER, FRAZIER D. f.xf:T-,- ..,--'e'sf'e' -- '- ' 'rt ' , A - ' ' : 5-Sie f I -Km -f.. .,-.:::',::f:'-'ga-2.5: 'y L , y Q f ' prfzvates ::: ,HN 1 :8 1. Bias ' ' ALLEN, DANIEL L. FUCILLA, JOSEPH G. MOREHOUSE, LINDEN H. ALLEN, HARRIS G. GAFFRON, EDGAR B. MUELLER, ALPHONS R. 'Q - A ANDERSON, IRVIN R. GAI-IAGAN, PATRICK M. MUNSON, NORMAN B. ANDERSON, ORRIN A. GARLAND, GEORGE W. NEWCOMB, ALVAH L. ARCHIE, KENNETH H. GOESSLING, WILBUR W. O BRIEN, JAMES A. T AUGUSTINE, W, H. GREENBERG, JAMES E. OLM, HENRY W. -L J BARTH, ARTHUR E. GUNNISON, JOHN P. PIERCE, FREDERICK O. BAYER HORACE M HANSEN OSCAR P FRANCE HENRY C - B ' R ' H ' ' R ' V ' :A sm -2124 I A-Af-1 fx , - . - T - 1 J 323252 A353335 J HEIBEERJ ZKENIVC RQEEETDS A12i'SI'EE L .. A A ' A - - - BITTERS, WALLACE W. HOLSTEIN, BENJAMIN M. RICHARDSON, C. D. -f 2-,, BLUM, BRUCE M. HULL, PERRY M. RUKA, OI-IN P. jg. BORDEN, RUTHVIN B. JACOBSON, HUGO J. SALE, RVIN A. ,J BRONSON, CARL E. JOHNSON, NEILL P. SCHIMIDT, JAC A. ' ,fri BROWN, DARRELL T. KALVELAGE, GEORGE A. SCHOMISCH, NORMAN N. .. Q Q 5' BURT, ROLAND W. KARLEN, ROYAL W, SERSTAD, MILLARDJ. L BUSH, HENRY KIMBALL, DEAN P. SMITH, CLYDE W, A BUTTS, LEO V. KIRKWOOD, CHARLES A. SMITH, SHELDON J. ,xg C D E K C E S M H . , A M HAPMAN, ONALD . LUMB, ARL . PRAGUE, URRAY . A ff .3 CHARLSON, ROY M. LARSON, ARVID O. STARK, THEODORE E. fr 25, CLAFLIN, PAUL C. LEISER, FRED E. STAVRUM, THOMAS L. V, CONKLIN, ROBERT L. LEONARD, WILLARD L. STEEL, HOMER J. , ' COXON, ROBERT G. LEWIS, ROBERT C. TAYLOR, EARL A. V . ' 2 , CROCKFORD, WELBY H. LIBBY, ELZIE B. THOMPSON, ARTHUR H. Om.. 4:-'....,, ef, .Y U Xa A. CURTIS, FRANK C. LICHTENBERGER, A. C. TOGSTAD, KARL R. T DANA, WALTER D. LYON, CHARLES H. Topp, JOHN G. A, DAVISON, EDCAR C. MACKMILLER, GEORGE G. TORPHY, MICHAEL B, ff - , V ,fi DESMOND, ROBERT W. MADDEN, JOHN D. UGLOW, WILLARD L. A DODD, JOHN M, MARCKS, ELGIE C, VALIQUETTE, C. H. L,g,QQ,,1 Os DONNELLAN, ARTHUR N. MAXWELL, JACK D, WAITE, PHILIP C. DOOLY, JAMES F. MAYHEW, LESTER O. WEBSTER, CHARLES L. ,- ,, EOUGHERSY, LVM MCERIDE, PETER D. WEEMANHKINGHH. .- , 'Wg' , RESEN SXVALD . MC LAY EDWARD A. EISEL, ANS , ,. Q ' EASTMAN, KENNETH S. MCDONALD, ROBERT E, WHEELER, LYMAN E. - ' . ,,, lc., ,. ....,. .... , , ,, ,- ECKERT, JOSEPH F. MCFARLAND, ROBERTJ. WIDMAN, JOHN j fg EGAN, JOHN M. MCNUTT, REGINALD R. WIDGAND. HENRY B- . , . ELLS, ROBERT B. MCVEY, VANE H. WINNER. HARRY U. 5, FALSTAIEJ, GILROY O. MEYER, BARON D. ENOLF, WWTER EC 'vu'-A' A FRYE. MMETT R. MIEDKE, RALPH A. ISCHKE, ALTER . T. MILLER, HARRY I. . I I I 1 SIII.I.mmI.,..I...I.I.ImI..II..T.T.,I.II..I...T.,...I....TI..II.,I..IT.,,.,I,...I........,.T.I..,T,.T,..I..I......,..I.,.,,.,...,,,.,..,IIT...I,.,I..T.I.........TI.TTm.I..,I,.,,..,..T.T..,..T...IT.,T..I.TII.,I.I...T..II...TT.,...II...T..I.T.,I.,mm:ammiimzsxmsmznaszzzzmasaa..I...TTnnmssammnTanzaniaT...I.....I.....TI,....T.,...,T,.......I..T..T.,.......I.II.IT...I..Tm....T.,...WaI..TanT,mmzaas:nnn n':sa:m::::m,..m.I..T.I....,....,.,,..,,.,,..,., . Page 163 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I III III II I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I III I II I II I IIII I I III II IIIIII Company D Officers LIEUT, WILLIAM F. EINBECKER. Commanding LIEUT. MERLIN G. WARR Cadet Non-Commissioned Offcers LINCOLN A. SOLLITT . . First Sergeant BEECHING, CHARLES G. GROTH, HAROLD H. HERBERT, OSCAR A. HILLER, RAYMOND P. ARONSON, HARRY J. BARTEL, AUGUST J . BECKNVITH, WAYNE I. CARVER, HORACE J. FISHER, MYRON M. ADAMS, HAROLD E, ALLEN, THOMAS C. AUCUSTINE, HARRY F. AYEN, GILFORD A. BADE, CARL A. BAGGOT, GERALD P. BARACER, MILES E. BORGHARDT, C. E. BATES, WILFERD B. BEHLING, ARTHUR W. BOHL, WARREN A. BOROWICK, JACOB S. BRANN, AUGUST F. BRENZEL, CERARD S. BULLARD, CHARLES E. CALLANVAY, C. W. CARROLL, CYRUS K. CRAIG, JAMES M. CUMMING, HAROLD W. DICK, ADOLPH A, DICK, WALDO C. DORNBROOK, PERCY F. DREWRY, BEMROSE W. DRUNIMEY, FRANK E. DUWE, HENRY J. EAMES, CLAUDE F. EDXVARDS, M. J. ERSPAMER, OTTO J. EVANS, BURTON W. FREIBERG, WALTER E. FROST, SIDNEY E, GARLID, ANTHON P. GASPER, WALTEIl B. GASUL, BENJAMIN A. Sergeants HOPKINS, JOSEPH J. JOHNSON, CLARENCE L. JOHNSON, WINFRED E. KUEHN, WALTER L. MERRXCK, DALE M, Corporals GORDON, WILLIAM K. HUNTER, JAMES P. JACOBSON, HERMAN L. LOEWENTHAL, R. J. LYMAN, CARSON F. Trivates GAULT, HARRY C. GAUSEWITZ, WALTER H. GILBERTSON, EDGAR M. CIROUARD, ARTHUR G. CLEESON, ALBERT F. GOLDSTEIN, LEONARD G. GRAPE, LEON A. GROVES, ALBA J. HAIGHT, ROY J, HALLING, ERICH M. HARGAN, JAMES HUEMMER, FRANK R. JOHNSON, HARRY K. JUNG, WESLEY W. KETTERER, ARMAND F. KIEL, WILLIAM KOENIG, RALPH K. IQOEPKE, HERBERT A. KOSS, JOHN E. KOUTNIK, EDNVARD J. KRUEGER, BENJAMIN R. KREUTZER, GEORGE E. KROPP, CARL F. KUEBLER, WALTER L. LANGDELL, HAROLD A. LYONS, EDWARD E. MGMASTER, ROBERT F MANSON, CHARLES L. MATTOX, RONALD C. MILLIGAN, ROBERT W. MORTENSEN, EINER NICHOLS, LEE B, NOLTE, PHILLIP P. O'LAUCHLlN, F. D. MGCUIRE, HARRY J. RUFFOLO, FRED WALLS, MILTON G. WARD, ALONZO L. MAEGHTLE, DEWEY L. MAYER, CHESTER J. SAMPSON, GEORGE N. WEISSE, LESTER C. OLSON, HAROLD D. OLSON, HERBERT E. OTT, HANS W. POLLACK, SAMUEL S. POWERS, GEORGE E. RAMSEY, YUILLE W. REGEZ, WALTER A, RENNICKE, KARL H. REYNOLDS, THOMAS A RIEHLE, FELIX A. ROBERTS, DAVID T. ROWELL, LEXVIS J. ROWLAND, DAVID H. SCHAEKEL, GEORGE B. SCHICKEL, EDXVARD J. SCHOELLIC, JOHN G. SCHULMAN, GEORGE J, SCHULTZ, GEORGE J. SHERRY, RUBEN H. SIMON, MIKE T. STEVENS, LINTON C. VANDER KODDE, W. F. VAN HOUTEN, R. W. VAN VUREN, FLOYD S. VOIGHT, ARNOLD R. NVILLIAMS, DAVID C, XVILLIAMS, FRANK M. WITTENBERG. CARL T. WOLBERC, HARVEY T. ZIELSKY, FREDERICK A ZILMER, BERTRAM G. ZIMMERMAN, HARRY F. IIII IIIIIII I IIIIIII I I I II III IIII IIIIIIIII IIII I IIIIIII IIIIIIIIIIIIII II I II I IIIIIIIIIIIIIIIIIIII II II I II IIIII IIIIIIIII IIIIIIIIII III IIII IIIII II IIII IIIIIIII IIIII II II I II II III I I IIII I II IIII I I II IIIIIII II II IIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 164 IIII IIIIIIIIIIIIIIIIIIII IIIIIIII II IIIIII II II II 1 1 1111 111 111 1 11 1 1111111111 111111 11 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 1111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111 111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 11 1 1 1 1 1 11111111 1 1 111111 11111111 11111111111111111111111111111111111111111111111111 1 1111 Company E Officers CAPTAIN CPIARLES G, BABCOCK, Commanding LIEUT. GllWAN W. WEBB LIEUT. DANIEL B. BENSCOTER Cadet Non-Commissioned OHYICCPS BAXTER SAYRE ..... . First Sergeant BIGLER, JOHN BREUER, HERNIAN CLARK, BURTON? DROBKA, FRANK BERNHARDT, E. L. BULL, WARREN CARSXVELL, BEN CARTTER, BRUCE CRAIK, EDWARD CULVER, GLENN DOERFLER, FREDERIC DREWRY, CHARLES ARIENS, MANDO BANCROFT, GEORGE BARCLAY, SAMUEL BARLAND, GEORGE BARTH, CHESTER BEACH, MAURICE BEAN, WALTER BERARD, OVID BETHKE, RAIMUND P. BILLINGS, LEONARD BLAHNIK, VANCE BOEBEL, PAUL P. BOWLES, Jomv BRENAMAN, ERROL BROUGHTON, CLYDE BRUNNER, ANTON BUDDE, MCKINLEY BUCKMAN, GEORGE CAMPBELL, EVERETTE CARLSON, VAN S. CARPENTER, EARL CARPENTER, JOHN F. CARPENTER, OTTO CASPERSON, HELMER CHASE, LEON CUFF, ROBERT J. DAHL, LAWRENCE G. DAVIDOFF, ISIDORE Z, DAWSON, THOMAS DEWEY, BARTLETT DIDIER, ANDREW DRAIZE, JOHN DUFF, JAMES E. DUFFY, WALTER EBERT, REINHOLD O. EGAN, LAWRENCE ELSEA, STANLEY M. EISENBERG, LOUIS EMERSON, HUGH ERICKSON, ROBERT FALETTI, STEPHEN FIELD, REMEY A. FORD, STANLEY E. FOREN, FRANCIS J. FORSBECK, FILIP FORTNEY, NORDHAL FREDERICK, HARRY GATES, LLOYD E. GEURKINK, WALTER GOVIN, FRANKLIN M. GRIEM, WALTER GRUETT, ERWIN W. HABERLAND, WILLIAM Sergeants EVANS, RICHARD FACAN, ROBERT HUSTING, NATHANIEL LAGANKE, NELSON LAUCHLIN, EDNVARD Corporals HEWETT, WALTER HOLCOMBE, ROBERT L, KLEINHEINZ, FRANK LUTHER, MELVIN MCLANDRESS, SMITH MERENESS, LAWRENCE MILLER, HENRY B. PARKER, FRANK W. Privates HANSON, ROY E. HASXVELL, C. B. HAYNER, LEWIS HEILEMANN, LEWIS HEMBRE, HELMER HINKLEY, GEORGE C. HLAVACPIEK, JOSEPH A. l-IOLTAN, HERBERT HOLZBOG, WALTER C. HOMMERSAND, EDNVIN HORNE, DANIEL O, HOTTON, ALFRED D. HRUBESKY, C. E. I-IURLEY, JOHN IRXVIN, JOHN W. JANECEK, WILLIAM JENVETF, CARLYLE A. JOHNSON, ALLEN A. JOHNSON, NORMAN L. JOLLY, CARL JONES, ARTHUR N. KATZ, HENRY J. KELLER, ERWIN G. KEPPLER, FRANK KESSLER, LOUIS G. KNAPP, WALTER A. KNOBLAUCI-I, CARL G. KNOBLAUCH, GEORGE F. KOLB, EDWIN S. KORTEBEIN, ARTHUR J. KRAUSE, GEORGE KRUMHEUER, SIDNEY F, KUHLMAN, MILTON H. KULL, ADELBERT LAST, JOHN A. LEONARD, AUBREY LEVERENS, HOWARD LONG, WALLACE LORD, HAROLD LOVEN, LEO LUDDEN, ALFRED LUEDTKE, ARTHUR MAGISTAD, OSCAR MAHONEY, DAVID MASON, RALPH MASSEY, EARL MCADAMS, FRANK MCNOWN, GEORGE MEHRE, FREDERIC METCALF, HAROLD MILLER, VANSON V. MOON, JOHN MURPHY, WILLIAM NELSON, NELS T. PAULY, JOHN STAMBAUGH, PHILIP STRANAHAN, BEN WITTE, JOHN PFEIFER, OLIVER RAUTlO, EDWIN REWEY, OLIVER SPANGENBERG, GEORGE STEHN, RICHARD SUTLIFF, WHEELAN TOEPFER, GEORGE WEISMAN, JACOB NEUPERT, PAUL B. NORRIS, RUSSELL NORTHEY, WALTER NYHUS, WALTER PALMER, OTIS W. PARTRIDGE, WILBUR PETERS, RAYMOND D. PETERSON, HALMER A. PERSCHKE, CHESTER PFRANG, LLOYD PIERRE, WILLIAM PINEHART, PETER J. POSS, HOWARD N, POSTEL, CARL POTTS, TRUMAN REICK, CHESTER ROTH, PAULUS SALMON, LYSLE SCHNEIDER, CHARLES SCHLOMOVITZ, ELIAS SCHUELER, MILFORD SEARS, VORLYN SHREVE, RAYMOND SMEDAL, ERLING A, SMITH, ALBERT F. SOSALLA, JOSEPH STAUSS, WALTER C. STEIN, HOXVARD A. STOCK, DONALD A. SULLIVAN, LLOYD SYGMAN, SAMUEL TAYLOR, HERBERT C. THAL, ALFRED A. THOMPSON, JOHN E. THOMPSON, MYLES T. THOMPSON, WILLIAM TOEPFER, RAYMOND A. TOOMEY, FRANCIS E. TORKE, RALPH L. TURNER, CHARLES W. VANDERHOOF, CLARENCE VANDERVEST, WALTER VETTEN, CORNELIUS WALLACE, JOHN WASMUTH, WILLIAM WEHLE, ALEX F. WEHLE, EDWARD WHITSON, ARTHUR WILCOX, ARTHUR WILLIAMS, ALWIN WOLVERTON, ROBERT F. ZELLMER, ,ROBERT G. ZIMANI, NOCHOLAS 1111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111 11 1111 1 1111 11111111 11111111111111111111111111111111111111111111111111111111111111111111111111 11111111 1 11111111111111 11 1 11111 1 111 11 1 1111 11 1111 11 111111111111 1111 1 11 111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Page 165 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II H ' . ' ' I. I I. A - ..w:,-,ieiL:.:- V ,- 37 Om an D- A, .-I, f-,A .E O C 8708 - I gg., LIEUT. RALPH B. MCCURDY, Commanding ' LIEUT. JESSE P. WALKER 2 'IRNA -2 LIEUT. FRANK MCH. FERGUSON ' ' -2. R .vm fl I f Cl et 071- O77'Z7Tl1SSZO7'l6 CCPS : ISA :VI LOXVELL W. HIMMLER ....... First Sergeant ,- Q I Sergeant-5' A f 5 , BACHMAN, C. A. MITCHELL, WILLIAM K. TASCHE, LESLIE W. HELFAER, EVAN P. MORICE, ELTON K. TUCKER, CHARLES E. . HORTON, FREDRIC A. PHILLIPS, GEORGE D. WALL, FLOYD R. ,Q FJ KNOLL, ROY P. SCHLICHER, RUDOLPH WOODWARD, KING G. 3 WP SCHULZ, ERWIN P. - I :If UIQ,-ff.I.,..57a-, ' C -. ' I - . or orals L BERGSTEIN, LEONARD MARSDEN, WENDELL H. SHERBURNE, LOUIS R. A BAUER, CARL P. MASSEY, EUGENE A. TAYLOR, FRANCIS N. ik COE, ARTHUR W. MCGARTY, MITCHELL E. TIERNEY, EDWARD F . , 0' 1 GROESSELL, F. E. MERTES, JOHN P. TROWBRIDGE, FREDRIC , .. f 1 I HENTZEN, ERXVIN A. MILLER, RUSSELL H. TUTTLE, CLIFTON M. '-I - IIZIIPKE, GIIiBERT JW ISIOTT, WILLIAM A. VIVIAN, ROBERT S. '-iws, -v with-:L A EEBLER RWIN OSTERHUIS LESTER J W SON: E M . .L Au, A AQ, , , . , . IL I , DWARD . KOCK, WILLIAM F. PETERSON, MARVIN G. Cpriv a tes ABELL, GEORGE W. HARKER, CHARLES A. PENNEFEATHER, E. J. ACCOLA, VICTOR H. HARRINGTON, DELOS J. PETERSON, E. M. F ALLISON, ANDREW B. HARRIS, FORREST D. PHILIPS, CYRIL A. 1 ,- I ALTSCHNVAGER, EDWIN H. HARVILLE, CLIFFORD PIPER, PURCELL W. --f 2. ,IU -. .. 'R A If ANDERSON, LEONARD S. HARTWELL, DONALDJ. POTTER, RAYMONDJ. . BACKHAUS, HENRY HATLEBERG, C. N. PUESTOXV, KARVER L. I BAESCHLIN, NEAL HITTNER, VERNON J. PULLEN, RICHARD W. ,aiqfgfg BACLEY, EARL C. HOLBROOK, XVILLIAM F. QUISLING, SVERRE jj-Fi' BAKER, BURTON C. HORWITZ, LAZARUS RALPH, JAMES S. ' BAYLE, F. L. HOUGEN, HORACE P. RAUBE, HERBERT A. BEIER, EDWIN A. HOVDE, PAUL V. REPPEN, ARTHUR C. BEMIS, GEORGE G. HOYER, GEORGE C. ROLLEFSON, RICHARD .. gISCHOEF,cl5RITzK HUPF, WHITFORD L. ROGERS, EZRA - ' - - ' ORSACKI ARL . HUSTON JOHN ROEGNER H E .. C... ...R I ' I I - - -. I -sane-3 I EORST, JIXOIHN W. IRVINE, ROBERT K. ROLLEFSON, GERHARD L . LA- RAUN ERVIN JOHNSON NICHOLAS S RUBENSTYNE JACK IA. Mg , R., A .55 Q I I A I 5 j Q Ai BRENNER, ERNX'IN C. JORDAN, CLARENCE A. RYAN, PATRICK H. ' ' ' N x3f51- I BRICKBAUER, BENJAMIN JUNG, FREDRIC T. SCHAEFFER, MICHAEL E BRIDENHAGEN, CLENIENT KAISER, HARVEY M. SCHILDHAUSER, F. J. -Ziff '1'. A .- K - .II r I 1 BROWN, THOMAS K. BURDICK, ALLISON L. BURDON, HAROLD B. BUROKER, DONALD J. CALDWELL, HUGH IVI. KIDDER, EARLE E. IQITONVSKI, JOHN E. KLETZIEN, SEYMOUR W. KLUSSENDORF, RAYMOND KNAPP, MINER M. SCHNEIDER, EARL E. SCHULTZ, ERNEST C. SCUTTE, ALBERT G. SCHWARTZ, FRANK S. SEIDEMANN, ENGLEBER - ,M , 5 ,I l CHAPMAN, ARTHUR H. KNOXVLES, DAVID R. SEVRINGHAUS, ELMER gf, qi ' : CHEETHAM, HAROLD C. KORRISON, CLARENCE L. SEYBOLD, ERXVIN G. 2 gwE'CJf..Ay.5L Q! CHIPNIAN, WILLARD A. KROHN, IRWIN K. SI-IIMPA, JOSEPH F. f-gjfg. , COCHEMS, KENNETH KRUM, JOHN F. SLY, KIETH C. ' M -fig..- I K ' COLE, ARTHUR V. LAMBEAU, OREN A. SMUCKLER, ROBERT H. , Q COOK, BENJAMIN F. LAMM, VINCENT P. SNEIDER, ELMER F. S '!i'l!'1SlII,IqjSgf ,, DAHLE, ARTMAN H. LIEBERTHAL E. P. SUITS, FREDRICK XV. -f' ' aj DAKE, CLAUDE A. LIEBERTHALI PAUL R. SUTHERLAND, ELIAS J Q, A gvf' DEHNE, WILLARD O. LOCKXVOOD, WILLIS SUTTON, ROBERT N. 5 DREDCE, THOMAS J. LITTIG, LAWRENCE V. TEBO, ARTIE H. vi . 6- DUECKER, HUBERT C. LORFELD, GERHARD W. TIBBETTS, JOHN W. Q ,jbf'.e-,qQyf.-5- QQIQ-,4 DUNN. JOHN J. LUBAN, SIMON TILLEMAN, JOHN F. 'ir-5 ELLOS, SIMON F. LYDEN, PAUL F. ' TIMM, HAROLD D. ww Inf-5 Qing. fi -.QQ -V EMANUEL, XVALTER A. MADISON, FREDRICK W. TOOLAGIIXN, JOSEPH - L- - ENDE, ARTHUR TVIALLOXV, LOUIS C. TRIER, FRANCIS M. px. ERICKSON, MILO MARTEL, CLYDE W. URBERG, SOFUS 4 EVANS, JOHN R. MARTINI, JOHN W. VELGUTH. WALDEATAR yi,-T' yi, L G FALSTAD, CLARENCE H. MATTHES, CHARLES D. WADE, G. C. -S ,I 1 FARRELL, EDXVIN J. MCCONNELL, CLARK WALTERS, WARREN W. fm. 1,17 ,ig ,S IIEAIVKESTSHARLES E. MCDERMOTT, F. E. NVATSON, AILILEN S. 'viix 'Ti-'H-.' ' y . INSKY, ORRIS MCINTOSH, ROSCOE L. WEAYERS ARVEY H My FRANK, HOBARTJ. MILLARD, ROBERT D. WEOENER, ARNOLD A. In I 1 Q FREYMILLER, ERNEST F. MILLS, WILLIAM K. NVEDDIG, HARVEY W. Q55 - ,Hg ' ' wb 5 ' FUNK, ARTHUR C. MONTGOMERY, R. B. . WERBA, DANIEL R. ,P .main 15:5 GAARDEN, CLARENCE A. MURPHY, JAMES H. WIEDRICH, FLOYD G. - ' -- vi V f' -Wil' G A W N H W L L C ggi? N H 31. vi' GAUBATZ,A RTHER . NEBEL, gOLD C WHITE, . C. . E .Vi , by GORDER, RNEA, EITMAN, ERBERT . WILLTANIS, ?:RL . K - Iqfwgf OUGH,JAMES A. NELSON, ALVIE G. ILLMARTH, RANK J. ' N GRAF, FREDRICK R. NELSON, NVAYNE E. WISEMAN, JOHN W. up Mff 1 !S'. GRANT, HERBERT E. NETZOW, EDGAR O. XVOLTERS, HERBERT H. Afiygu .- ' 3, GREEN, WALTER E. OVERTON, ORRIN V. WRIGHT, HERBERT B. N' in 1 , Jn V, GROFFMAN, HARLAN G. PALMER, HERBERT P. WRIGHT, LA VERNE ,I'.. ... I A .QSM-:J HABERLAND, ERWIN J. PASHKA, EDWARDJ. ZUEGE, DAVID C. HAMMOND, R. W. PATTERSON, GEORGE H. ' A IIIIII I IIIIIIIIIIIIIIIII I IIIIIIIIIIIIII IIIIIIIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIII .I '-- ' -'-T'- --'----- 4-1--ilu-I-ii-L ----- - -A---A----V ' ' I II I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIII I II I III IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII III III I IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII I III IIIIIIIIIII IIIIIII IIIIII I III IIIIIIIIIIIIIIIIII If Page166 vIIIIIIwIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII A IIIII II III IIIII I I IIIIII II II IIIIIIIIIIIIIIII IIII III IIIIIIIII IIIII II I IIII IIIIIIIII II II I IIII IIIIIIIIIIIIIIIIIIAIIIIIIIIIIIIIAIII IIIIIIIIIIII IIIIIIIIIIIIIIII II II IIIIII I IIIIIIIIIIIII II III III III IIIII II II II III III IIIIIIIIIIIIIIIIIIIIIIIII IIIIII II 1 I E Company G Officers , LIEUT. LUTHER M. WELI.S, Commanding i LIELIT. OKLIE D. WASITBURN LIEUT. ALFRED K. IRION Cadet Non-Commissioned Officers DONALD A. STOCK ........ First Sergeant ANTHES, CLARENCE A. CRAXVFORD, GEORGE G. DONOHUE, JAMES A. KASTl.IN, GEORGE J. KUEBLER, GEORGE B. COOPER, l'IUMPl-IREY J. DONOXVAN, EDWARD T. EDGERTON, EMERSON W. FELTMAN, CARL H, FORD, HENRY M. ALLEN, HARRY D. AMADON, HENRY C. AMIDON, GEORGE W. BARTLETT, HAROLD C. BASS, FLOYD K. BAUER, JOHN H. BECKER, ROLLAND H. BECLINGER, RICHARD T. BENBOXV, ROBERT L. BETZER, CECIL E. BIENSTADT, BEN BITTNER, T. V. BROWN, CLARENCE B. CODDO, WILLVIAM E. CARSON, WILLIAM K. CLARK, MANLEY H. COLE, JOHN W. COOKS, HARRY B. CONNELL, WALTER J. COX, EDWARD L. DAVIS, GEORGE P. DOWLING, XVILLIAM J. DREW, EVERETT G. DREWRY, MONTROSE K. EBBERT, EZRA E. EHLE, GEORGE H. EVENSON, CHARLES R. FELLOWS, CHARLES L. FITZMAURICE, JAMES M. FLECK, WILLIAM C. FRICKE, WILLIAM H. FRITSCHE, OSCAR O. GATES, CLAUDE A. GEUSSENHAINER, F. GILES, CLAUDE R. GOODRICH, CHARLES V. GREGG, JOHN W. GREILING, WINFORD W. GRIMSTAD, REUBEN C. GROTKIN, MELVIN S. Sergeants TVIUELLER, EMIL A. OUWENEEI., WILLIAM A. PARSONS, CECIL P. PETERSON, XVILLARD O. RALI, IRVINGJ. Corporals FREESE, FREDJ. HAIDLE, ARTHUR J. JACOBUS, DELWIN C. ICLEMENT, IELMORE F. LENVIS, HELMAR A. LINDCREN, ELMER L. Privates GLVENTFIER, FELIX G. HAPIN, LEONARD W, HANSON, PETER HANSON, MAURICE NI. HARMAN, FRANR S. HASSET, JAMES C. HEBERLEIN, CLYDE E. HENKEL, LEO L. HERRICK, ROSWELL H. HOFFNTAN, FRANK A. HOFFMAN, WALTER A. HORNIBROOK, F. C. HORTON, HORACE B. HUBBARD, FRANK C. HUBBARD, HENRY S. HUEBNER, BERNARD W. INGEBRITSEN, HENRY D. JENSEN, HAROLD W. KLEEBERGER, GEORGE S. KNOTT, WILLIAM M. KRAEGE, FREDERICK H. KRAUS, HAROLD L. KURTZ, CHESTER M. LANGAN, EDNVARD P. LALLIER, WESLEY C. LARSON, OSCAR W. LATHROP, WALLACE H. LONG, DAVID E. MAGANN, JOSEPH W. MASO, CLARENCE E. MCGRAW, ERNEST A. MCMURRAN, M. J. METCALP, CLIFFORD W. MILLS, HARRY E. MOSS, HARRY E. MCLAUGHLIN, JOHN L. MOOTz, RAYMOND P. MEVERDEN, LEON L. NAPPE, EDGAR H. OLSON, GOLDIE R. RICE, ALEX TERRY, ELTON H. WALST-I, JAMES E. XVALTON, JOSEPH L. TVIANTHEY, ROLLIN H. PAULUS, RAYMOND L. PRIDEAUX, GWILYM F. SERY, RALPH J. SMONGESKI, 4PAUL P. PEACOCK, HAROLD I. PEARSON, CARL E. PETERSON, STERLING D. PHELPS, IVAN POPE, ROBERT L. PORTMAN, RAYMOND J. POTTER, JAMES L. POULL, LEROY M. RAGATZ, ROLAND J. READ, PHILIP C. REZEK, ROY H. RIETZ, HERMAN E. ROVE, OLAP N. ROI-ILPINO, ANTHONY F. ROLLESTON, LEONARD P RUNKEL, HERBERT F. RYNDERS, FRANCIS A. SCHUBRING, GEORGE F. SCHULTZ, RAYMOND C. SCOTT, EDXVIN I. SHARP, HONVARD M. SMITH, CLARENCE C. STEINMETZ, GEORGE M. STENEHJEM, LYLE C. STICKLE, THEODORE E. SWITZER, RAYMOND A. TIMMINS, BASIL J. TAYLOR, KENNETH G. TREBUS, ERWIN H. TURNER, ROY W. VIIADE, IRVING L. WVEBSTER, LYLE W. WECNER, GILBERT W. XVILKE, MARCUS F. WVHITHALL, EDWARD F. WOELFFER, ELMER A. WRIGHT, HAROLD E. ZAMZOW, WILLIAM H. wIIIInIII IIIInIIuIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III III I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I III I III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III I II II III IIIIIIIIIIIIIIIIIIIIIII IIII I II I I III IIIIIII II IIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIEQZ IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIII III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIG Page 167 IIIIIIIIIIII .,l. IIII l..,K .III ..,.. IIIIIIIIIIIIIIIIIIIIIIIIIIIII ..,K.,,..,K .IIIIIIIIIIIIIIIII..IIIII..IIIIIIIIII.IIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIII .,w.. IIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .,... IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ..,l IIIIIIIIIIIIIIIIIIIIIIIIIIIII w..,,..,..,K IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ,.., .IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .wh .I : .,, '- ffififx . 2 'N 19 RJR II:-I-IIA. I. . A N- '- :III-Sq.: - 1.-A 'N ,I-WI. JI N' . 1 5255 bf .MV- R! ... - ' .,-'2f'N ' ik I. ,If Af I -- f 5':.-,I Iv 5-55 -A. ,IA I . II. .-iI1F:174CQ:g5x7'2-H? 'I F .. .,,, I .I 5- W- RV.. A Q! .. -..I,- . . 5' -,D , :D I 'G 1' x1:3,,.III . ' -' 2' ' I . 4 X. .. '- 'X fi V' ' EZ .jJ.?3f1- - ' ,, 'V '- Comp any H Officers LIEUT. WILLIAM C. KENNEY, Commanding LIEUT, MILTON O. NARAMORE LIEUT. WREN MIDDLEBROOK Cadet Non-Commissioned Officers MAURICE M. HANSON . First Sergeant BLYSTONE, JASPER K. Cox, IRVING K. CURTIS, HAROLD C. DOUGHERTY, JAMES K. EMMERLINC, HANS F. BORGMAN, GEORGE J. BORLAND, OLIVER W. BRADY, HARRY W. CHANDLER, SHELDON S. ELLESTAD, GILES J. GILBERT, HARRY S. ABRAMS, RALPH B. ALVIS, HENRY C. ANDERSON, CARL R. ANDERSON, HARRY A. ANDERSON, RANDOLPH G. ANDREE, CLARENCE A. BAILEY, ROBERT D. BARTLETT, GLENN A. BEALE, GEORGE E. BLAIN, WILLIAM C. BLAKE, HAROLD L. BLIZARD, LESLIE BORK, RUDOLPH A. BROITZMAN, T. A. BUTTERMAN, ERNEST CALLAWAY, LESTER R. CAMPBELL, LESTER C. CARNACHAN, ROBERT W. CI-IUDACOFF, HENRY CLAWSON, DONALD G. CUNNINGHAM, M. H. DODGE, EDWARD S. DOLLIvER', ARDIN J, DONALDSON, C. W. DUBOIS, HORACE A. ELSTAD, EDWARD M. EMMONS, LANVRENCE E. ENGEL, STANLEY D. ENGLISH, DONALD J. EVANSON, JOSEPH F. FIEDLER, ELMORE W. FIEDLER, STUART O. FRANK, CHARLES W, FRIEDMAN, ABE FRITZ, VIRGIL F. GESELL, HAROLD L. GILLMAN, HERMAN J. GILLUM, JOHN E. GORSUCH, STUART F. GRAVES, SPENCER F. GRAY, PAUL L. GREILING, REUBEN H. GROKOSKY, LEONARD H. ' A 9f 'f-P frm ' ' vi ' pf 9 52 .352 'V' . -'- I - g -I sg? . I ,. . .,,, , I K. .qi-ov was.. I -any ,. b ---.JD I .. v, .k F'-211: if . ' D. 'J iII,jUfx ' Y 'l.:.. gli. , GSX... U ff: if!-'wrif' I 'lf' NI' I, ' T ' Liiilf- -I5 I- T535 - -.I 1,4 .ij-.I,. If Rf I A A ' -1' :f .g.:.I.2f . -,- I II I I. I A ., . ...iw ,.... , ,W ,R ...fm , ..,:5:7eE,-v,,.',.4,-gggxha .. 2'5 . ' IN .. .. , - 2 '9'..f'1WgI.. ,. 1 -X R-LII.,-A Ifiw A' FI. LT' ' -fa' 'I 'I 'R W' f 'Q n I M, ' ., -f w,,4n4IWwI .. ' kg.-' .- ag '.- I: -'f..f155NZYnLCV.l I I...., II.. ...I.......... I I I,...... I.I,. I I II IIIIIIIIII IIII I IIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII III I IIII IIII IIIIIIIIIIIIIIIIIII I IIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIEIISII Sergeants FLOM, MERVIN O. HALL, STANLEY O. HARRIS, LAWRENCE E. HILL, GEORGE A. HOFFMAN, HARRY W. MARVIN, ARTHUR D. Corporals GOLLEY, FRANK B. JAQUISH, ROBERT I. KEWIN, EDWIN A. KUEHLTHAU, EARL R. LARSON, RALPH E. MALLERY, JOSEPH B. MARTIN, HORACE P. Privates CROSSKOPF, MILTON W. HAGEN, ARTHUR E. HALL, EDWARD D. HA LVERSON. LEONARD S. HANSON, ROY F. HARRISON. CHESTER T. HENSEY, EARL E. HOFFMAN, GILBERT B. HOCLUE, BERNARD E. HOMSTAD, ERWIN E. JELLEMA, CHARLES JOHNSON, HALVOR JOHNSON, TVIILES P. JONES. CHARLES E. IQALK, BERNARD R. KELLER, OSXVALD L. KING, DONOX AN S. IQNAPP, EDWIN J. KOENIG, HERBERT C. KRfXUSE, ELMER G. KRELIL, HARRY L. KRUSE, ELMER R. KURTZ, MAYNARD L. LANNING, BRONVN C. LINDONY, CARL W. LXPPERT, ERICK W, LIIIINGSTON, PENN P. MATTS, LESLIE H. MCCABE, EUGENE H, MCCOMB, DONALD W. MCCONAGHY, DANA W. MGKONE, EARLJ. MEARS, CLAUDE A. MEEK, LOUIS F. MELVIN, JAMES D. MILLER, DONALD W. MILLS, DUDLEY J. MOODY, FREDERIC A. MORAN, HARRY E. MORTER, EMIL W. NEEL, MELLVILLE C. NELSON, GEORGE W. NEUMAN, OSCAR W. NEUMANN, HERBERT P. MURDOCH, HARELL A. ROGERS, ROSS W. SCI-ILUETER, T. L. STOCKER, ALFRED E. STRONG, THOMAS F. MITCHELL, MALCOLM RANDALL, EARL A. REEVES, HARRY M. RICHARDSON, NELS C. SCOTT, GEORGE W. WARREN, CARL A. NIEMER, ARTHUR W. O'BRlEN, HENRYJ. OICONNOR, WILLIAM B. ODEKIRK, WALLACE E. OLSON, OSCAR M, OPITZ, HAROLD F. PARADXS, WILLIAM G. PARKE, KENNETH N. PEHRSON, ALVIN O. PETERSON, LARS P. PFEFFER, OSCAR POPE, FREDERICK G. PRITCHARD, FRANK C. ROBINSON, WARREN J. ROSCHI, LESTER E. ROSENAU, IVIERVILLE J. ROWBOTI-IAM, NORRIS SCHREINER, FRED J. SCHMIDT, ARNOLD W. SCI-IRYYER, GEORGE L. SEDER, XVILLARD-J. SEITZ, OLE H. SLEZAK, GUSTINE SOLL, ROLLAND H. SPRESTER, CLAXRENCE F STAEHLE, KARL A. STALLMAN, CARL A. STANLEY, FREDERICK J. STEVENSON, JOHN H. STRANG, GEORGE H. STUMPF, VHIALTER P. THORPE, NOEL C. TRESNER, LLOYD F. VANCE, EARL R. WARREN, HONVARD V. XIVHITNALL, GEORGE R. WILL, CHARLES F. XVXLLIAMS, LEROY WILLIAMS, HARVEY H. WILLINK, GEORGE J. WITXVEN, NEWTON C. ZADECK, SAM ZERVAS, WALTER O. IIII IIIII III I III II III IIII III IIIIIIII IIIIIIIIIIIIIII IIII III IIIII IIIII IIIIIII IIIIIIII IIII III IIIIII IIII II III IIIIIIII IIIIIIIIII III IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIEEIGIZIEHIYIEIIIEEEIIRGZHITEIIEIIGFIUKEIEIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIAIIIIIIIIIIIIIIII P a g e I 6 8 I IIIIII IIIIIIIIIIIIIIIIIIIIIIIII III II I IIIIIIIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII IIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIIIII II IIII I IIII IIIII IIIIIII IIIIIIIIIIII IIIIIIIIII III IIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIII III III IIIIII IIII III IIIIII IIIIIII IIIIII II II III IIIII IIIIIIIIIII IIIIII IIII I II IIIIIIIIIIIIIIIIIIIIIYIIIIIII IIII I I II IIII II IIIIIII IIIIIIIIIIIIIIII II IIIIII I IIIII IIII II III II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII i Company I Qfficers LIEUT. PIOWARD R. JOSLIN, Commanding LIEUT. EDNVARD D. LIBERA Cadet Non-Commissioned Qfficers HARRY PEI-IRSON BEROFORD, ROLF E.. HANSON, LEWIS S. JENNERJAI-IN, CARL A. ALBY, EVERETT J. BARRINGTON, CURTIS E. BRECKE, ROY L. BYER, WILLIAM A. CHRISTIANSEN, HARRY ALLEMAN, LEWIS C. ANDERSON, ROY E. ASSMAN, ABE BALABAN, EMANUEL BARDOUCHE, WALTER J. BAUER, HENRY F. BAUMAN, LEWIS L. BENEDICT, IRVIN A. BERG, GUST A. BIRRELO, ROBERT BOECKH, HUGO E. BOORMAN, STANLEY H. BORNITZI-QE, HENRY BOSSENBROCK, W. J. BRIESMEISTER, RAY C. BRILL, HERMAN BROWN, WALTER N. BRUCE, JOHN N. BRYNHILDSEN, H. A. BURAN, TRYGVE O. CAIN, DEWEY J. CALLAHAN, WILLIAM B. CHAPMAN, GLEN R. COSGROVE, LEE P. CROSS, PAUL E. CUTA, ALBERT G. DALLMANN, H. F. DANIELS, CLARE R. DAVIS, LAWRENCE K. ELLIOTT, EARL W. ERICKSON, W. M. ERICKSON, HAROLD E. FALK, CLARENCE A. FARR, CHARLES L. FELD, HARRY B. FINN, LEONARD R. Sergeants IQOLLOCE, PIERMAN F. LACEY, JAMESJ. MAINLAND, KENNETH E. MILLARD, KENNETI-I C. Corporals GEWALD, HAXROLD T. HASTINGS, HARRY B, JONES, DELBERT T. KNIGHT, WILLSON H. LEWIS, WARREN H. OLDENBURG, F. W. Privates FORD, THOMAS FRANEY, HAROLD F. GILBERT, HAVILAND GULLICRSON, HILMER HALES, HARRO O. HANSON. ALFRED HANSEN, NORMAN HANSON, EVERETT H. HAUGEN, CHESTER A. HAYDEN, ARTHUR E. HOLMES, SETH E. HOWE, HARRY HUBBARD, RALPH C. HUGHES, RUEBEN M. JANSEN, PETER H. JASPER, HERMAN J. J ENSEN, J ENSEN, KELLER, ALVIN E. JENS C. ERWIN F. KETTNER, JOSEPH E. KLARER, SYLVESTER J KNUTH, RUEBEN C. KOEI-ILER, HENRY G. KEMPFERT, AUGUST T. KROHN, ERWIN A. KRUTH, ROY A. KUPCZYK, JOSEPH P. LANG, EDGAR F. LARSON, LEON E. LIEBRECHT, S. F. MCINTYRE, VICTOR T. MADDEN, JAMES J. MARSHALL, HUGH B. MESSNER, ARTHUR G. MOLZAHN, GEORGE F. MOUNGEY, L. D. . First Sergeant IREID, JOHN H. SERZOXV, WALTER H. SORENSON, FORREST L. PANKRATZ, LEWIS L. PETERSON, ETHAN A. PRIDDIS, CHESTER A. SCHMIDT, HERBERT W. WENNERBLOM, H. W. MULVANEY, ARTHUR R O'BRIEN, JAY OTIER, WALTER L. OTTENSTEIN, JOSEPH PARADISE, WILLIAM H. PARRETT, CHARLES H. PATZWALD, ELMER M. POPE, ALFRED B. QUINN, ROBERT N. REICH, GEORGE E. REICK, LEWIS J. RIEDERER, LEE A. RODEN, SAMUEL H. RUNGE, LEO F. SEDMIRADSKY, JOHN SEELEY, LEONARD H. SERIO, SALVATORE SULLIVAN, WILLIAM J. TAIT, ROBIN C. TERRY, FRANK J. THORESON, ANTON O. THORSTENSON, W. T. TOFT, RAYMOND G. TURR, RALPH W, UEBELE, ROY J. VITNEHAUS, FRANK WAGNER, LEO V. WARREN, THEASLE S. WAWRZYNIAKOWSKI, L. WESKE, JAMES J. WESTENBERCER, R. H. WILLIAMS, GEORGE B. WOLGEZOGEN, H. C. WOLINE, ERNEST W. WOLF, JAMES IIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIII II IIIIIIIIII II IIIIII IIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I IIIIIIIIIIIIIIIIIIIIIIII I II IIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIIIIIIIIIII I TIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IIIIIII IIIIIIIIII IIIIIIIIIIIIIII III IIIIIII1 Page 169 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIEZIFIEIIIIIIIITTIIIIIIIIIIIIIIIII II II III IIIIIIIIEIIIIIIIIIIIIIIIIII II II IIII III III IIIIIIIIIIIIIII IIII IIII III III IIIIIIIIIII IIIII II III I II IIII I IIII I III II II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIII I II IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIII III I Company K Oyiqcers LIEUT. CHARLES W. SHEPPARD, Commanding LIEUT. HOWARD H. BENTLEY LIEUT. JAMES E. KENNEDY I I Cadet Non-Commlssloned Ojfcers ALFRED VAN DE ZANDE . . Y First Sergeant Sergeants FREEBORN, VICTOR D. PETERSON, HOWARD STOLL, PAUL R. HENDRICKS, RAY A. POLLARD, FLOYD A. THON, LOUIS E. IQAPHINGST, LOUIS ROBERS, FERDINAND WELCH, LEE L. LOOMIS, 'IPI-IOMAS F. COFFIN, HARRY F. DAVIES, IRVIN HURLEY, CLYDE J. JOHNSON, LEROY J. KLEIN, JOSEPH L. LANCSETH, INCVALD ADAMS, CECIL P. ADAMS, CHARLES P. ALEXANDER, CHARLES L. ANDERSON, GOTFRED R. ARENT, IRWIN J. ARNOLD, ALFRED W. BABB, CLINTON L. BARTLET, ROBERT F. BARTO, WILLIAM M. BIRKHOLZ, CHARLES A. BISHOP, DOUGLAS I. BLOOR, HARRY BROST, ALEX J. BUNKELMAN, JOHN W. BUNKER, FRANK J, CAVANAUOI-I, H, W. CHELMINIAK, EDXVARD F. ' D CHRISTENSEN, HAROL CLACK, TXAARVIN M. COURCHANE, FRANK A. CRABB, DANIEL H. CULLEN, ELNIER J. CURRY, BERNARD H. DETMAR, WILLIAM DIETRICH, WILLIANI A, DOHENY, JOHN D. EDDY, HAROLD S. EIMON, PERRY A. ERDMAN, MARTIN A. FISHER, PERL FLETCHER, WILLIAM B. FRYSETH, SELMER O. GABBERT, ERVIN F. CIARBISCH, ARNOLD D. GROH, LEO P. HAMMERSBURC, R. H. HANSON, MELVIN E. HARRIS, MERLE E. HEDERER, WENZEL HEID, EDWIN P. HESS, EDNVARD E, SPARKS, RALPH E. Corporals LORD, FRANK H. MORAN, THOMAS W. NICKODEN1, EDWARD N. O'CONNELL, ALFRED P PRUEHER,WALTER J. REINKE, HERBERT W. fprivates HILAND, JOHN J. HOFFMAN, EDXVARD V. HOLDEN, MARK S, HOLSBACH, J. E. HOOPS, PIERBERT C. HORSWILL, EDXVIN E. JANKE, ROBERT F. JOHNSON, CARL O. JURANEK, ARTHUR W. KIKNIISH, FRANK J. IQENNDEY, XVALLACE O. KETCHUM, EDWARD L. KETTERHAXGEN, W. J. IQIMMES, JOSEPH P. IRING, M. IVI. KLAW'ESTAD, JENS PQLAXVITTER, OTTO A. KLOVSTAD, ELMER KNAPP, XVAYNE A. KNUTSON, ALBERT M. KOCZOROXVSKI, A. W. KUNZ, JAMES W. LAEMMRICH, P. J. LARSON, HERBERT T. LAVINE, ROBERT W. LEE, OSCAR LEXVANDONVSKI, W. LUND, ADOLPH LUNDE, HARRY O. MCELROY, M. C. MCINNIS, M. H. IMCKENZIE, ROY MCWEY, CHARLES J. IVIANZ, LOUIS R. MILES, STARRE A. MOARN, PATRICK F. MOHOLT, ONCLE E. MOUNT, CHARLES H. MUELLER, JOHN E. OLSON, PETER C. PAYANT, VITAL A. ROESKE, EDWIN D. ROMAN, ELMER M. SANDERS, JOSEPH W. SHARP, KARL L. XVEIX, LEO J. PETERSON, XVILLIAM F. PIETREK, PAUL P. POLUS, EDNVARD J PRINZ, HUGO W. RABACH, CARL W. RIKEAIISCH, FRANK H. REITEN, CARL ROEHRDANZ, R, A. SAIBERLICH, R. A. SCHEIDE, VERNON H. SCHNIDLER, FRANK J. SCHNEIDER, LESTER G. SELL, RALPH H. SHAUGHNESSY, JOHN E. SIMPSON, GEORGE W. SINKULA, ADOLPH J. SPEILVOCEL, FRANK G. SPREDA, JEROME L. STEVENS, IRVING SULLIVAN, DANIEL L. SXVANSON, ALBERT C. SNVANSON, FRITHJOF TAYLOR, OSCAR C. TAYLOR, HARVEY R. TENDRUP, HANS E. TOPEL, HARRY O. TOPP, HARRY C. TRUESDILL, LESTER H. USAREK, WALTER WVAGNER, HENRY H, XVARNER, LESTER E. XVEBER, JOSEPH F. WEISBROD, W. A. NVHITNEY, MAYNARD R. XVOIDA, FRANK XIAEGER, ALBERT F. YOST, IVTARC YOUNG, RAY M. ZENNER, EDXVARD ZIELSDORF, REINHARD II II III I IIII , IIIIIIII II IIIIIIIIII IIIII III I IIIIIIII IIIIIIIIIIIIIIIII IIIII IIIIIIIIIIIIIIIIIII IIIIIIIIIIIII I II II IIIIIIIIIIIIIIIIIIIIIIII III IIII IIIIII II II IIIIIIIII III III I II IIIIIIIIIIIIIIIIIIIIIIIII IIIIIII II III IIIIIIIIIIIIIIII II II II IIIIIII III II IIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIE Y IIIIII s I I Eli EI nun IIIIIIIIIIIIIII.II,.I,,,II,,,, .....I.,.II.II..I,.,,, . ,.,,. ........... I .I...,,.,. .. . .,.... ...,. .. ..... , .... ...-A..... ... ..I. ,...-........-,.... 1 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII III II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIII II III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIIIIIIIIIIIIIIIIIII -IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 170 .g, mmmmmInmununmnnuInwImImInnmInIImInIInIInInqInIIIIInIIIIIInInInwyInIIIIMMMIITERM!!IInInImIuunInImInInnmnuvwggzfgfyiylnvllwIIHIIMEInIInmmIInIInInInIInInIImmInMIIInIWInIIIIInImIIIIIIIIIIIIIIIIIIIIIII vm IIInIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIImmInInIInIInImInIInImnumInImImInIIIIIIIIIIIIIIIIIIIIIIIII IIIIImIIIIIIIInIInIInInIInInIImvmInInImIIIIIInnunumIIIIIIIIIIIIIIIIIIIIIIIvmmmIIImIIIInIImIIunumuumm -I EEE EEE vi .1 1 .51 'f C Ompany L ,wif 9-' Ei? 7' I: 'f'. gig 1-'.'5fj'.tw - q ,T ,I . C9763 . LIEUT. VINCENT L. DUNNE, Commanding f ' V-'if -'35 LIEUT. WALDEMAR F. WEITMAN Y 'IJ LIEUT. GEORGE SOMMER Vi F' 7 S1 '-fi l,1gB.s5i,F Q -1 C cl N C ' ' d O AMY' 1:-Tai .3 Cl et On' O7Tl771lSSlOTI.2 C6718 553 . f ,A :Tv-1 ' N 5 ,HARP 1 AEC ' 1' I Ei: ' . :iff .7 ARTHUR R. UPOREN . First Sergeant , Q. ' Ni' QT.-Lf,'I' 'Q , WIN.. ...J ,H ,A 7 wg Sergeants Rf, . F' :F -..- 'I-N E EEE f !.-fr' 2 E55 1, 1 52: ' 1:5 EE ' . QI- 3, 552 Q -A sh' II1-,J T filifzxf-lxfiff gif, I...',g3-iw. 1, -.. Q if? 51 5 ' L' '-'I 'airs 'A f .4 ' Q- Q ' '34 .ye . . '1 5257.1 S'g',if'. -WL -A ' :I -,,-:g.:sf f .elim ,. .. I -.A f 1 7'b i:gF ' IA.-?5' f ' I ga 3 A Is: 225439 gf- - .. .E ..... I-I I - --R-'g.,::1-a:'-.nw P? H -:f' - :' Q' ' W'1g.5Q .EE A .. . . A T li - 'Qlygg ..5-M. ...7 :-Nga,-4' 4- . . , 4' QI -sl: EU ' it r Qxbfgi fa I I ALCOTT, EARL L. BEHLING, EDXVARD A. BRITTENHAM, F. A. DECKER, GEORGE H. GROVER, H. J. HAIDLINGER, FRANK HOPKINS, H. D. ASKAY, JOHN F. BALTES, W. M. BROST, WVILBERT J. DAYTON, JAMES A. DORY, JOSEPH E. BARLOW, EMMETT A. BAUM, HARRY H. BAYER, EDWARD BENDER, CURTIS G. BERNINC, JOSEPH A. BERTRAND, LEE N. BLAGER, A. BONESHO, FRANK M. BONNES, BENJAMIN H. BROD, LEO J. ' CALLAGHAM, WILLIAM P. COTTS, PAUL W. HOWARD, ERNEST C. HOWARD, VERNON J. lqO'lT, W. J. LAVALLE, M. J. LOOMIS, L. E. INACCLOUCH, JOHN TVICCONAOHY, A. H. RJEYER, RAYMOND C. Corporals GROSCHMIDT, KARL W. OHNSON, WILLARD M KNAPP, IQARL F. NOOP, PAUL C. LEXVIN, OSCAR A. Qprivates JANKE, ALBERT C. JENSEN, EDMUND C. JENSEN, LEROY C. JOHNSON, BERT J. JOHNSON, CYRAL E. JOHNSON, THOMAS H. JORGENSON, ALFRED M KAMINSKI, B. A. KARL, VINCENT J. KAZMIERCZAK, P. S. KERWIN, HENRY R. KLAMICER, CHARLES MILLER, JOHN A. NELSON, C. E. NELSON, F, J. PETERSON, P. A. SCI-IERHART, WILBERT L. SCHROEDER, C, W. TIMM, H. M. IVIILLER, MERTON M. PARMENTER, MAJOR E. SCHROEDER, LEO L. SHALLMAN, ERVING T. THOMPSON, SIDNEY M. PARADOXVSKI, STEVE G. PAULEY, GLEN V. PECK, ELMER L. PEDERSON, OSCAR H. PETERSON, CLARENCE W PETERSON, R. G. PINEGARD, EDNVARD A. PORTER, E. H. QUALY, P. B. REKLAU, ARTHUR H. RATHSACK, BEN RAY, ROLAND T' CYRAN, AMBROSE L. IQLUG, GERHARD E. REUTELER, FELIZ H. DAMPIER, THOMAS J. KOEHL, JOHN E. RIPP, JOHN M. DICKINSON, HAROLDJ. KOSCIELNAK, ANDRENV S. RUDE, MORRIS DIETRICK, JOSEPH A. KOSHOLLEK, B. E. RUNGE, WALTER H. I, DIETZEN. MICHAEL M. KOSMATKA, G. F. SALTNESS, HJALMER M. DUNREL, ELMER C. KRAUSE, ARTHUR SCHEIDERER, IRVIN ,gg i- T, ERDMAN, E. D. KRAUSE, A. C. SCHMIDT, ENO A. V-E? f ERDMAN MARTIN F KUMMER WALTER N SCHUSTER HENRY , ERICKSON GEORGE A. KURTZNVEIL LOUIS P. SEBO, EDGAR N. ERICKSON: LAWRENCE R. KUSCHEL, ERTMAN M. SHERIDAN, WILLIAM D. ' V A3 FINGEL, FREEMAN L. LAATSCH, ALFRED G. SIMMELINK, EDWARD ff FLEINER, WILLIAM H. LABARRE, EMERY E. SMITH, EDWARD V , T3 FOGELBERG, WALTER L. LANG, OTTO SOHOLT OLE S. . ,g.. . . A C I FORSYTH, ROBERT . LANOENDORF, . H. SOWIN, LEO 'fin FRAKER, CHARLES P. LANZ, OTTO A. STAUDE, FREDERICK FRITSCHE, RAY LARSON, CARLJ. STEININCER, CARL D. I A A ERONK, EXLQVARD JH LEDIN, THEODORE A. STERNKE, ROBERT R. -1 AULKE. ALTER - LEMKE, JOSEPH J . STLUKA, FRANK J. 4 z, SILBERTSFN, VICTOR A. LEWINHHARRYEE. STUDT, KAI H. L .451 'Vi' Filif-' '31 'cn' :gi -' I O-M OPLEN VAR LODL, ENRY . TAITT JOHN GORMAN, LYLE C. MARKCREN, CCG. A TI-IEOEALD, RAY GRAMS STEVE J. MACMILLER, ARL . TOMCZAK VINCENT W. GREENWOOD, LOUIS J. MCINTYRE, RUSSELJ. UHL MELVIN C. .f '.f',,' GN Sz' , ' TAX, GUERIN, BERNARDJ. MILLER, FRED WARD, OSCAR HARBART FREDRICK MILOSKI, JOHN , WEAKLER GILBERT A, : HARTMANN, ARTHUR H. NEUSER, ARTHUR J. WEBB EQLE Tv Ng HEDDINC, LEWIS T. NOWAK, CASIMIR M. WELLQNSTEIN OTTO J g XXI! W, LII-2252.1 HEDIN, DAVIDJ. ODELL, GILES F. W W ' ER A ' I HENDRICKSON, JOHN E. OLSON, OLE M. ENZEL' ALT ' 53 - HOFFMAN, A. N. OSTWALD, WILLIAM H WERDER, .JOHN O ' HUEBNER, WILLIAM D. PACZESNY, FREDJ. WIRKUS. JOSEPH M' I I H .I,.I.,.......,..,..........., , ....,....,.......... I...,,...... .,,,..... I ,. . I ,, .. .I ...... . I... . ,. II.. . ,.,.......,...,...,,..., I ..,..,,......,...,..n., . . .... , ,,.. , ,,.I..,.............,,........,..,..,.......,...., .....,,.,,,,..,.,. . , . .,...,.....,,,..,.,..,.,...,......,I..... ..... ,.,,,,,...... . . .umm mum mmm IanIImInIInxmliiiKH?ii5UIilYFF1IIIuIIIInInIuIIuvInIuIImummmInnvIInInInIIInIInInIInIInInIInInInmm:IInInmmIInInnuInInIIIIInIIIIInInnumInIuIInInIInImmmruIIIIIIIIInuvIInmimiiliiffiinImIIIInInInKHIHEHIEEIYIHPIHIIIImzuImmunImInImInInIEEEHMIGIFEFIIIIIIIIIIERIGEIInummmmnnlniiIivInInIIIIIIIIIIIIIIIIIIIIIIIIII mm. IIIIIIIIIIIIIII Im mm mm mm: ImmIIIIIIIIIIIIIIIIIIIIIIII nmmmlmw num mm. IIIIIIIIIIG P cz g e I 7 I 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111u1111111111111111111111111111In1111111111111111111111111111111111111111111111111111111111111111111111In1111111111111111111111111un111111111111111111In11111111111111111111111111In11111111111111111n11111111111111 . 1 1 1 1111 1111111111 1 11 1 1 1 11 11 1 11 1 11 111 11111 1 111111111111111111111 1 11 1.1.5 Company M Qfficers LIEUT. LENVIS E. PARMENTER, Commanding LIEUT. RAYMOND WALLACE LIEUT. JOHN D. WATKINS 111 1111111111111111111111111111111111111111111 1 1 1 A Cadet Non-Commlsszoned Offizers KAI H. STUDT .... First Sergeant Sergeants BOETTNER, F. W. HENSEL, PAUL J. PETERSON, HENRY L. BRYANT, ALVIN W. HJORT, THORWALD O. PLATTETER, CHARLES F. CONWAY, HUGH LEONARD, URBAN C. SCHNEIDER, F ERDINAND DEUTSCH, I-IERMAN J. NELSON, GORDON E. ZEMAN, BERNARD J. Corporals AVERY, CLIFFORD W. HAERTEL, ELMER R. MORROW, SAMUEL E. BEHREND, FRANK C. HALVERSON, EDWIN M. PRESTON, DANIEL L. COMP, SYLVESTER J. JACOBOSKI, ALOIS L. RYBELD, RICIJARDJ. EDNVARDS, JACK C. JANKA, ALFRED A. STOWE, GARELD D. FITZGERALD, GEORGE C. JARSHAW, HOLIVER G. VAN LONE, ORLO W. GORSBUCH, MARTIN L. KINGSLAND, ROBERT D. WOLF, FRANK G. 1 Privates ANDERSON, ADOLPH H. HARDER, FRED D. OKERN, MEARL G. ANDRAE, ROBERT C. HARELSON, RUFUS H. PASSON, PETER P. ALCUMBRAC, WALTER S. HARTY, RALPH M. PAUL, ALBERT F.. BAILIE, RALPH J. HEYMAN, ALPHONSE PAULSON, RUSSELL BALSLEY, RALPH W. HINTZ, EMIL O. PELLOQUIN, HOMERJ. BEAVER, BERNARDJ. HIRSCKERN, OTTO PHILLIPS, LEE I. BLOOM, GEORGEJ. HOFSCHULZ, HARRYJ. PIKE, FLOYD R. BODE, ALVIN E. HOOFT, THEODORE A. POMIAAER, ARTHUR BOFINCER, WILLIANI A. HOLSTEIN, RAY E. PORTER, ALMON R. BORCHERT, ARTHUR E. JAERUCK, ALLEN PRAIN, WILLIS A. BRANDENBURG, R. G. JACOBSON, A. L. PRASSER, ERNVIN J. BROXVN, GEORGE W. JOHNSON, ELMER O. PRI-I-GHARD, JOHN M. BUDDEN, ORVILLE L. JOHNSON, FRANK O. PURPERO, CHARLES W. CALKINS, GEORGE D. JOHNSON, HARRY E. REGELE, JOHN H. CASE, HONVARD I. JONEN, HENRY G. RILEY, HONVARD V. CLARK, ADMIRAL D. KIXCPlADORIAN, PAUL ROHRICHT, HUGO A. CLARK, HARLEN G. KAPKE, XVILLIAM F. ROSERA, RYNOLD S. CLARK, HONVARD G. KAPPUS, CASPER E. ROYCRAFF, EDWIN CLARK, SHERMAN S. KEMl'FERT, AUGUST T. SCHACHT, FREDERICK H. CLAY, ERNEST G. KERSHAW, HERBERT A. SCHARDIN, RAY W. DAMASK, KURT A. TQILPATRICK, FRANK B. SCHMIDT, HERMAN R. DAY, CHARLES M. KINDT, MARK SCHUH, CLARENCE B. DEVINE, PAUL W. IQISSEL, HOWARD C. SCHXVARTZ, CHARLES F. DIONNE, JULE D. KLINIENT, HENRX' SHERWOOD, NVALTER F. DUPUIS, EARNEST KOELTING, NVILLIAM SIDLE, MARTIN M. DONOVAN, JCE E. KOHN, WALTER L. SIDLER, RAYMOND C. ENGLAND, ADOLPH P. KRAUSE, ALVIN H. SIKERRA, ANTHONY S. ERDMAN, ELMER W. KRISTZUMAS, JOE G. SIMON, XVALTER W. ERDMAN, PAUL O. ICURTZ, STEPHEN H. STICHERT, ERVIN H. FANKHAUSER, FRED C. LABEGKI, FRANK K. SUTCLIFFE, CHARLIE V. FEHRENDORFF, H. H. LAMBIE, OSEORNE T. TOZEK, PAUL G. FENELON, JAMES J LANGELY. ARDINAL J. TOMASHEK, FRANK GARDINIER, E. J. LIERMANN, F. M. TREDUPP, XVALTER O. GAULKE, WALTER A. LINDQUIST, CLARENCE W. UBER, ROY L. GORHAN, ARNOLD B. LUDWIG, ANDREW J. VAN ANTNVERPEN, ALVIN GOTTER, EARL LUTz, ELMER O. VOEP, ROMAN B. GOURDOUX, C. F. MAEGLI, ROBERT H. Voss, FRANCIS W. GRENWIS, GEORGE E. MARSGHKE, W. A. WESTPHAL, GEORGE P. HAACK, WALTER C. MARTIN, LOVELL J. WEX, EDWARD A. HAAS, SAMSON H. MORAN, ELROY J. WICZYNSKI, ALOXS S. HASS, ERWIN R. NEEB, SAMUEL G. WILEY, DANIEL D. HANRES, ALBERT E. NELSON, FRED N. WILSON, LEONARD HANSON, JOSEPH NELSON, ROY B. WISEMAN, HARRY A iiifffffffffffff' ' ' 'I ' ' I I II 1::II::I::1:II I s:::::I::::::I::e K'II' I 'I II I I'-1 1'1' IIIIII I I IIII I H IIIIIII III- IITHI II IIIII IIII IIII I II 11111111111111111111111111111111111111111111111111111.111111111111111111.111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.1.1111111111111111111111111111111111111111111111111111111111111111111111.1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111.1111.111.111.11111111111111111111,1111111111111111111I111111111.111111111111111111111111111111111111111111111111111111111111111111 P cr g e I 7 2 I 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 F11 11111 11111 1 1111 1 1 1 11 1 1111 11 11 1 1 1 1 1 , , ,, ,, H, ,,,,,,,,,,,,,,, 55 IE 1 11 1 111 1111 11 1 111 1111111111 1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Radio Company LIEUT. LEXVIS DE R. IVIONVRY, Commanding Cadet Non-Commissioned Officers FIARRY M. ASC!-HNGER . First Sergeant ACZNEW, FRANK W. ANDERSLHN, IRUDOLPH E, BELLMER, ALVIN M. DAVIES, CLINTON W. EI.LER, LINN R. HAHN, LAXVRENCE I-I. HANLON, RAYMOND J. IQREMER, DONALD G. LANNOYE, LORRAINE M. AHERN,'THOMAS L. BAKER, HARLAND R. BARTLETT, GEORGE W. BAST, MICHAEL O. BERC, CI.lFFORDJ. BEUST, CARL BEYER, HERBERT A. BIRKREM, OITTO A. BLANCHET, IQENNETH C. BRADLEY, GLENN P. BROEZEL, VERNE L. BROXVN, LYLEJ. BUCKBEE, MILTON V. CAREW, JOHN R. CLAFLIN, FOSTER C. CLEARY, LOUIS F. CLIFT, DELBERT L.. COOPER, MELVIN W. COOPER, LEONARD G. DAHL, WVALTER E. DELANEY, DENIS J. DILLON, FRED G. DORWIN, MILAN M. DUNIN, STANISLAW M. ECKE, REUBEN I-I. ELLIOTT, HARRY T. ENDERS, LEROY L. FADNESS, NELS L. FELLOWS, FRANK S. FERRIS, PAUL E. FIEDLER, RALPH O. FREEMAN, PHILLIP D. GANGSTAD, ROY A. GRAF, ELMER A. GREVE, ELMER J. GUESS, PEARL G. GUSTMANN, E. A. HARRINGTON, C. O. HAZEN, WILLIAM M. HELD, RUTHERFORD R. HENDRICKSON, LEWIS P. HESER, FREDERIC D. HETTGAR, EARL G. HILL, EVAN V. 11 11 1 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Sergeants I'lEIN, MARTIN N. HUBER, LAWRENCE J. KRANZUSCH, RAY F. Corporals LEUEENBERO, VERON H NELSON. RUSSELL H. NORBY, PERRY A. OLMSTED, LLOYD O'Rl7URKE, BERNARD T. PEKOFSKY, PHILIP Privates HILL, MILO L. HOESLY, HOWARD S. HOFF, GUY I. HOLLOWAY, JCI-IN M. HOLT, CLARENCE U. l'IUMPl-IREY, GLEN M. HUNT, HERBERT A. HYATT, FRANK B. IBENTHAL, JOHN C. JILEK, JAMES B. JONES, RUSSELL W. JONES, CLAUDE B. JOHNSON, CLARENCE JOHNSON, HAROLD E. JOHNSON, ROBERT H. KAASA, ORIN G. KELLOGG, HORACE E. KIDD, CLARE W. KIENOW, ERWIN C. KIRXVIN, PHILIP F. KRAUSE, CLARENCE C. KRUEGER, RAYMOND A. KRUSE, ORWIN H. LAMI, HERBERT J. LARSON, JOHN R. LECLAIR, CLARENCE J. LESTER, GEORGE E. LINDBLOOM, ALBIN J. LIVINGSTON, LOREN C. LOTWIN, HARRY H. MCDERMOTT, DANIEL J. MCDONALD, ARCHIE W. MACBRIDE, DOUGLAS D MACMILLER, CARL A. MAHAN, FRANK E. MATTESON, CYRUS P. MORATTI, LOUIS F. MOREY, DONALD J. MULLEN, GLEN E. NELSEN, HAROLD N. NELSON, CHARLES R. N. NEUENDORF, EDWARD C. NOHL, RAYMOND F. NOLAN, GRANT J. 1 1 11 1 i111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Page 173 1 1 111111111111111111 NOLTE, FREDERICK W. PEACOCK, CARSON E. WILEY, EARL J. PETTEOREW, PERCY D. PIERSON, ELMER ROEXVEKAMP, F. W. SUDA, GEORGE M. TENNEY, PAUL H. WOOD, HAROLD C. NORNESS, RECTOR L. NORRIS, ALBONJ. E OLSON, CHARLES W. OLSON, HAROLD E. O'MALLEY, FRANCIS J. OXVENS, LEO F. PAULL, HARRY J. PAULSON, CLIFTON A. PAYNTER, SAMPSON J. PEARSALL, MERTON C. PETERS, CHESTER L. PETSCH, HERBERT A. PICKER, PAUL F, . PRAY, CLARENCE E. PROULX, EUGENEJ. REED, CLARENCE REMOL, WILLIAM B. REYNOLDS, ROY T. REYNOLDS, JAMES A. RICHARDS, LLOYD B. RICHARDSON, JESSE L. RICHARDSON, ELMER E. RICGERT, ERWIN W. ROHERTY, LEWIS F. RUSKAUFF. BERTRAM A. SANDRY, JAMES G. SCHAEPER, JOSEPH L. SCHMIDT, ALFRED SEIPP, ERNEST W. SHEPARD, FLOYD P. SIKER, WILLIAM F. STEPHENS, LEON B. TAYLOR, DAVID TILLER, PALMER O. TRANTIN, RUDOLPH WALSER. RICHARD G. WVEGNER, KARL H. WENZ, CARL WERNER, GEORGE E. WINTER, WAYLAND V. WIRTH, HONIER S. XVRIGHT, WARREN F. 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 1 1 11 1 nmIIIIIInmIIIanImIIIIIIIIIIIInnnIIIImummIIIImIIIIIIIImIIIIIIIIIIIIIIImIIIIIIIIIIIIIIInnmInmmuIIIImIInImIIIIIIIInImIInInnnIInInImInImTuIInIIIIIIIIInIIIIIIIInIInImImInImInImInIInInIImIIIInIIIIIIImIIIIImuInumInIummmmIImInmmIInIInInInIInInIInInIIITmmumnumImnunumumnImuImInnuIIIInInIInImInInIIIIIIIImInInInIInInIInInIIIIInIInInIInInIIIIInIInInIIIImInIImIIIInIummIIIIInnuummnuIIIIIIIIIIIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII f T-ITIHH?TMRiTi1T'7F ' '?',......,.m.5..U. ' Q T 5'T ',.. ,,. ,, , . . , ,I , II, . .UI In. .T 7 'T I IIITMI'ii'iHTiiiiIIIIIII II II III III In I I HW... .III.Im...,...I..,I.. ..,.In.,,.,H.,,....,,,..,.,.,..,,.,,,,.,,,,.,,,,,,,,,,,,,,,,,, 4.1 n :sp x L : 'I153Z 'fZX'9- -'TNQ - A - 1186161 UCl7'fQ7'S C0771 C171 had s -K ,335 ...S,. m. WA- ..' VI: f Q . .. 9' .-:wg ..,, . A Im mm In IIIIIII Rszfibiw. f' I-Hi ,IHA -- 'A 1-fa-v'w-As-riff-R:.:'T . A ' 5 pm..--1. 'ill-E: - .ar-133' . A, earl? mei -.'1':1f.:-f - A . ,:,, . , A -JW .-gg. R'-.::: fif,'.'4 ...bf 5 , 5 'gi-,5i2::.. RQ A5 'f 'f :f.cEE:tS'Z'5:E-'fha ': V -A 1' 'f .45 ' ' 2. 'QL 'Vs' TX' . ' Zvffii f f If .1f.,-KE -F: ' - . f . :...:f,:f 1: Q ' ' ' -'4YI'.'A:1f ::Af:r1.a-S:A,.:e51n.R -Ogg. -. Ap. .X AA: .Z , ,K ziz- f A I. I- -,-. . :-f , f.4A,:a.P:..T... ,:,,. A .Y kg. T' gf 1, I 4 59,1 ' ,:S5:31w.,,,,. -iff:-va 1 ff -I '.':.IfJ. 5 '4,4-ny.. . 'gg 4 , ,. .-.542 ings! 1 '. KH .Q,f'5, - ' me zu 1, .. - VJ .,.,. . . 1' ,A '34 E 1a. A .. 3 A-A:-kilw.:.....1-1 6 ' fx-I.J.-Q 2:51 ' SMF- FIT'-.' 'TIC ' f- 1 . A R' ' . 0 N.. ,.,..5 A' I -A P Q. R'-,Q .- 1 Niffwe e,,I.q,:,..,.m-..,, , 7 5 --'v-- QI- X 11 .-A 1- A' ' if X . 5? .A-va ,AQ ,g ,wg:.-.YET . 4-R-1 .ZA N1w:m.?f'E' W ' :si -. ' . . .,f wwf P131 'ww ,. ,, A ., .X-,i,Mrn,. ,, . gang I. lf?-rx FTf f'.f75. ' 'x' N5 angzw. ,IA ,X lf -. v. .1....-1: 1 I , -Q '-TM. 145- ,. gala., ,,, ,K JI' ff :1 i5::..F. Ii-f - ' .. ...Z .... ..:Lzw,. EI ' ' V 2lr 1,.. ., vi 'F ' A.q,.3,3, . K :I Gifj F' R .- 1 -11-- A RI -'H Q .,., .1 .ARA-A ' ' Q QL? ....w,., .. ' .My-A 'fi Omcers LIEUT. LEE C. HERWIG, Commanding LIEUT. EARL J. HANAFORD LIEUT DONALD D. MGCASREY Cadet Non-Commissioned Officers EUGENE F. BESPALOW . . FIRST SERCEANT BENTON, DWIGHT F. BOWMAN, HAROLD F. CROLI., MELVIN W. DODGE, LEONARD GILL, HAROLD A. GRISWOLD, FRANK L. BAGON, IVIERRIT M. BALCH, HAROLD M. BAUMAN, OTTO W. CLARENBACI-I, RALPH E COLLINS DAVID H. AINSNVORTH, PERCY F. ALBRECHT, GERALD R. ALLIN, BUSHROD W. ANDERSON, OSCAR W. ARVIDSON, REUBEN D. ASCHENBRENER, E. L. AXELBERG, GEORGE W. BANDONV, CHARLES R. BEARDSLEY, GEORGE L. BEGLINGER, FRED F. BENSON, IRVING M. BIANCE, TONY J. BLOECHER, WILLIAM BRANDAU, EARL R. BROSOWSKY, ERNEST BUNDE, LEO F. CAPEN, HENRY W. CAPRON, CARCIL.L, COLLINS, COOPER, COTTON, COVELL, CRONIN, CHESTER A. WILLIAM A. SIDNEY R. CHARLES T. ALFRED R. ARNOLD B. PAUL T. DAVIDSON, JAY H. DIEHL, VAL C. DOCKA, TI-IORALF C. DONOVAN, CARROLL T. DUIPOIS, LEONARD EBENTIER, ALBERT F. EXVING, WILLIAM C. FEDDERSON, ALFRED L. FEIRN, WILLIAM I-I. FORD, RAYMOND FRAZIER, ARTHUR H. FRENCH, NEXVELL E. Sergeants KELSEY, CARL H. KNOERR, RIJDOLPH R. MEYER, ROYAL L. MONTGOMERY, W. H PETERSON, RALPH E. PIDCOE, WILLIAM W, Corporals FULTON, FRANKLIN D. HILLIKER, BELDIN I.. JAEGER, WALTER C. KING, WESLEY B. MGDOUGALL, R. K. MONTGOM ERY, ALVIN E. Privates FUCHS, THOMAS GARRITY, LEO V. COELLNER, XV.-XLTER H. GORE, XVARD A. GOTHAM, DONALD E. CIRANDY, WILLIIXNI N. GRIFFETH, STEWART D. HANSON, PAUL E. I-IEDDLES, DONALD F. HOLCOMB, CHARLES E. HUMLEKER, LARS HUNZIKER, CTI-IESTER E. JEANNERET, TOM E. JOHNSON, DAVID A. JOHNSON, IVIILLARD W. JONES, ARTHUR L. KEMLER, HERBERT J. IQESSLER, ALFRED F. KING, GEORGE R. KOEHLER, WALTER A. KOENECKE, PAUL M. KOHASKY, ARTHUR B. IQRENZ, ALFRED S. LANGE, KARL F. LESLIE, CHARLES E. LIEBERT, ARTHUR E. LINDQUIST, CHARLES R. LONG, JOHN R. LYMAN, ALFRED T. MAGFADDEN, ROBYN K. MCCONNELL, PHILLIP S. MCDONALD, FORREST R. MGKNIGHT, CLAIR MOULDING, J. W. MUELLER, LOUIS C. NEMETZ, VICTOR W. IIIIWIII.-IIIIIIWIII I .III III II I I .. . .. ...mn . .... .. .... . ,.... PESCH, ANTHONY W. RADKE, ORVILLE E. RAY, OTTO A. STILES, HUGH R. SLAKER, DONALD V. THIEL, WALTER C. NOTT, WALLACE C. RISTEEN, HERBERT L. SCI-IROEDER, GILBERT W. STEGEMAN, HENRY R. VITS, ALBERT L. NOLEN, VERL V. OLDS, XVALTER M. OLSON, CHARLES D. OLSON, SIGURD F. PENBERTHY, FRANCISCO PETERSON, ROBERT G. PETERSON, GEORGE C. PFA!-ILER, JOSEPH A. POKORNY, EARL J. PORTERFIELD, JOHN A. PRAY, CLARENCE R. PRESCOTT, CLAUDE E. REED, ROLAND V. RENARD, EARL J. RICKNIEIER, CARL H. RODGERS, PIOXVARD J. ROSS, GEORGE A. RUHSAM, MILTON W. SGI-IMIDT, RAY C. SPILMAN, CARL J. STEELE, LLOYD M. STILES, DNVIGHT H. STRONG, WALTER E. SUHR, ALFRED L. SUNDBY, CLIFFORD A. TESCH, ROLAND G. UBBELCHDE, PAUL R. VALENTINE, JOSEPH F. VENNES, LEON A. WVADSXVORTH, HAROLD V NVILSON, JAMES W. WOOD, WILLIAM M. WORKS, LAWRENCE P. ZELONKY, BEN ZEMBROSKY, AEE L. ZIMMERMAN, FRED E. I I I I ...II.III..I.mIII.Im.I I IIIII .I IIIiIIilEIIIII1IiiIiiKiiIiInIInInImInIIIIImIIIIIIIIIITIIIIITIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIImmmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIEIIIIIYIQRIIGEEIIIIIIIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIII Page 174 sr ' ' I I IIII I Che Regimental Band LIEUT. LEE C. HERWIG, Commanding HERBERT A. STOLTE, First Sergeant Sergeants NVILHELM, NVARD H. WOODHOUSE, IRVING Drum Major BONVMAN, HAROLD F. Comets BERCEN, JAMES M. MORLAN, LENVIS M. BERGMAN, ALFRED E. NANRIVIL, RICHARD M. BOWMAN, HAROLD F. RIEIQ, FOREST O. DEWIRE, DONALD S. SOLBERC, CLARENCE M. FOOTE, PERRY A. SPEAR, MARVIN S. HENDRA, CHRISTOPHER STOLTE, HERBERT A. JOHNSTON, XVILLARD A. THOMPSON, GEORGE T. IQERXVIN, JOSEPH j. 'IP-IOFLAT, GERALD B. LAMONT, DALLAS A. VAN SANT, FRANKLIN A Clarinets BERO, PAUL I. BURDICK, SYLVESTER O. DREWS, HAROLD M. JACKSON, MORRIS D. MELHAM, ARNOLD G. SUMNER, XVILLARD G. HOXVLAND, GERALD B. Trornbones BOLLINCER, PAUL E. SANDERS, PAUL P, HIRSIO, HERRON A. SIDIE, STANLEY R. RUKA, j. P. XVEGNER, .JAMES H. French Horns BENNETT, DONALD M. WARNER, W. E. CONGDON, C. C. WOODHOUSE, IRVING Mellophones WILHELM, WARD H. Baritones ERICKSON, CYRIL L. IIIIIIIIIIIIII II-IIIIIIIIIIIIIIIIIIIIIIIIII W I I I ummImmInInImInInIInInIInIIIIIIIIIIIIIII-IIIIIIIIIIII Tubas PAYNTER, S. j. VAN DE REPE, ABRAHAM C Saxaphones ALLDS, HALLIE L. LAYCOCK, RUSSELL D. Snare Drum CLARK, LLOYD S. FROST, RUSSELL E. CHAPMAN, HOMER D. KREPS, JAMES T. Bass Drum HINTZ, ELMER M. Kettle Drum VANDERBIE, ROBERT Page 175 II I I I III II IIII III IIIIIII III I III I III II II II II Cpersonnel Detachment LIEUT. RUSSELL C. KURTZ, Commanding Cadet Non-Commissioned Officers HARLOW H. PHASE, . . First Sergeant BALDWIN, WILLIAM S. BOGCESS, RALPH V. BONDI, EDWIN W. BURGY, JACOB H. CASEY, JAMES M. CHAFFEE, PERCIVAL V. CRAINE, EARL E. EDWARDS, LEROY E. EDWARDS, RAYMOND D. ELLINGSON, ARVIN B. FROHBACH, HAROLD O, GIERACH, RAY J. GOTTSCHALK, JOHN B. HARDINC, RAYMOND O. JACKSON, AMOS H. KATTE, MARTIN KATZENSTEIN, HENRY B. KLOTSCH, HARVEY W. KREMERS, GERHARD R. II.II..IIIIIIII..II.II.III.IIIIIIIIIIIIIIIIIIIIM II IIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III Page 176 Privates MABIE, EDMUND MAUTZ, BERNHARD M. MORGAN, CHARLES J. NEUMAN, ROBERT NODURFT, JOSEPH R. NUEBERGER, CHARLES READ, HARRY S. REIDER, GLENN L. SCI-IULTZ, ERIC J. SCHWENKER, HARRY E SCHENCK, EDWIN W. SINEGUB, JACOB J. STILES, RALPH D. STRATHEARN, FREDERICK D STEINSBERCER, FREDERICK WERNIG, CHARLES XVERRBACH, ARCHIE J. WITTENBERG, HAROLD W ZELLER, DELVIGNE R. I I Cfxfilitary Police Company Officers LIEUT. EZEKIEL S. EPSTEIN, Commanding LIEUT. FREDERICK L. TICKNOR LIEUT. ROBERT E. XVELLBORN Cadet Non-Commissioned Officers IRVING GOLDBERC . BUNGE, GEORGE C. HAMMOND, LORING T. LENZ, HERBERT S. IVIANN, BERTHOLD C. BROTHERS, XVELLINGTON EKLUND, OSCAR A. LANKA, LEO A. ANDERSON, BRADY M. BARR, WALLACE A. BLATTER, ERWIN W. BOERNER, ROBERT L. BRADER, JAMES L. BRANDT, GEORGE S. BRUMM, ROMAN H. BYBUTH, ENGVALD O. COMEY, FRANK A. DESWARTE, LAWRENCE C. EDWARDS, CHARLES A. FRANKLIN, NATHAN GOSPIAW, HAROLD D. GRAY, FRANK W. HAASCH, CLARENCE HALL, LAURENCE W. HANSON, FREDERICK R. HIECKE, WILLIAM A. HOGSETH, HELMER JACK, JAMES A. JANKOVIAH, ANTON J. JILBERT, EDWIN H. JUNG, CLARENCE S. KLENERT, WILLIAM W. KOLLATH, ALVIN KURANZ, ALFRED L. LIUM, JOHN L. ' MARGOLES, HARRY IIIIIIIIIITIIIITIII .II I .. . IIIIIIIIIIIIIIIII.IWMI...I...I.,II.II..I.. P a g e 1 7 7 . First Sergean! Sergeanls SWEENEY, HARRY L. CITIPPLE, ERXVIN R. WPIITE, CECIL E. NVILLETT, ALFRED E. Corporals MCDONALD, EDWARD M. MEYERS, BERNARD E. USHER, EDISON H. Privates MARSHALL, SAMUEL H. MARTENS, ARMIN G. MAYHEW, ANSON B. MOSS, WALTER K. MUEGGE, WALTER H. MUELLER, GUSTAVE G. NORMAN, BYRON E. PETERMAN, IVAN H, POLZIN, ALBERT L. Y POWELL, ROBERT B. RANKIN, EUGENE J. REICHENBAUM, DORE ROSENOW, HENRY J. SECEL, JOE SHAUCHNESSY, RODNEH' J SOLBRAA, BURNEY A. SPETZ, RALPH F. STERNLIEB, HYMAN A. STROHECKER, WARREN D SUNDT, GUISERD M. TERRY, EUGENE J. VALKER, CLARENCE A. VIERGUTZ, FREDERICK H. WEST, JOHN C. WILKE, MARVIN F. WILLOGROD, GEORGE E. WOLTER, ELMER A. XVREND, BEN I I Wisconsin Section Chemical Warfare Service TOP ROW-Eyster, Meek, Jacobson, Schneiders, Malone, Nesbit, Johnson, Coleman, Eldridge, lnnis, Coodrich, Leake Khorozian, Haas, Bauer, Hedgespcth, Axlcy, W. O. Davis, Whitmer. SECOND Row-Burton, Richdorf, Schlornovitz, Paltz, Hippie, Clarke, McConl-tey, Maver, Hoffman, Otis, Young, Ambcrg, Marsh, Littel, Grady, Bunting, A. G. Davis. THIRD Row-Bentine, Dennis, Cole, Citelson, Hilbert, Trachman, Green, Watson, Tilleman, Pleasants, Serles, Knight Bender, Heakin, Hart. The University of Wisconsin Section ofthe Chemical Warfare Service is a branch of the Medical Division, and has been concerned with a study of the effects produced by poison gases used in warfare, methods Of protection against them and treatment of conditions arising from exposure to them. The Section consisted during the height of its activity of eight commissioned officers, thirty-two non-commissioned olicicers and enlisted men, and twenty civilians. A total Of about seventy reports dealing with various phases ofthe work have been submitted to the Director of the Chemical Warfare Service since the establishment of the Section in July 1918. Most ofthe military and civilian personnel were discharged following the orders for demobilization during the morth Of December. MAJORJ. A. E. EYSTER, M. C., U. S. A. Officers MAJOR J. A. E. EYSTER, M. C., U. S. A., Officer in Charge MAJOR W. J. MEEK, C. W. S., U. S. A. ZND LIEUT. J. Y. MALONE, C. W. S., U. S. A. lsr LIEUT. V. C. JACOBSON, M. C., U. S. A. ZND LIEUT. E. F. SCHNEIDERS, C. W. S., U. S. A. ZND LIEUT. L. E. BURTON, C. W. S., U. S. A. ZND LIEUT. L. F. RICHDORF, C. W. S., U. S. A. Enlisted Personnel HEAKIN, N. W. . ........... Sgt. lst Class, M. C. LEAKE, C. D. .......... Sgt. lst Class, C. W. S. BENTINE, E. J. .... . Sgt. C. W. S. BENDER, F G ........ Corp. C. XV. S. DENNIS, J. L. .... . Sgt. C. W. S. COLEMAN, J. J ........ Corp. M. C. HAAS, A. C. . . Sgt. C. W. S. HART, M. E. . . . Corp. C. W. S INNIS, A. H. . . Sgt. C. W. S. NESBIT, R. O. . . Corp. C. W. S WI-IITMER, R. G. . . Sgt. C. W. S. WOOLLEY, J. R. . . Corp. C. W. S Privates, Ist Class, C. W. S. ELDRIDGE, J. M. CITELSON, M. L. HEDGESPETH, R. H. JOHNSON, B. L. PLEASANTS, W. H. SERLES, E. R. AXLEY, HAROLD DAVIS, A. G. DAVIS, W. O. BAUER, R. O. COODRICII, G. W. Privates, C. W. S. HILEERT, P. E. KNIGHT, D. K. Private, M. C. COLE, A. E. Civilian Personnel KHOROZIAN, C. G. TRACHMAN, H. I. DR. S. AMBERC FRANK GRADY EDWARD T. OTIS DR. C. H. BUNTING WALTER E. GREEN WILLIAM PALTZ DR. P. F. CLARKE J. S. HIPPLE J. F. TILLEMAN DR. B. H. SCHLOMOVITZ HUBERT LITTEL ALLAN S. WATSON Miss CLARE B. HOFFMAN HARRY G. MARSH C. J. WEBER Miss MARY E. MAVER Miss DOROTHY E. REID Miss ANNA Wi-IELAN FRED W. MCCONI-:EY mill.. ii.i ii....iw.i..i..w.i..i...i, IIiiIiiiinI.iiinIiiIiiiiiEimniviiiiiMEMililiiiiiliiiiiiillii Page178 WILLIAM YOUNG : :as if - 12 .5 . 5' m..ww..m.w .,,.. ,,H,...,...U.,,.H,..,,H,.M.HL..X.N..H..,,,.,m..,,.... ..,. ,-X.H,.HH.,W.WX..,..,,..,myV..umU4,...X...V..X,H,.UWL..W.UrmWX..XmlH.K..,V..nnN.1N..,myX.HH.,W,...,H,X......WH,,.U...M,,V..,..,H.N.NX..,,..,mlH.N.U1f.,V..,...,.H,..X.HV,HV..w.H.H..m.mw..fm,..XW,...,N,y.XW.y..,1.4H.H..W,,...Hmm,m...,.W.Wfm..mm..v..w4yHW,HW.N.W,Hy11.N.,XH.XK..,y.,V..,1.1,1.1X..,H.,.HH.X,..XV.,XmmumV..W,....Hmmm.w,..m.H..,1.,,.HL.,Xvw..m.,,.,,.m..!..W5 55 E 2 S 5 E35 512 EE 555 RE? W...mmm ummuum E35 E25 E25 gag Sze E 2,1 el: 11: aaa 312 Q......,,...,..,,.U...,.M,..H.,,,.,H.,..,,..,.U,H,,..,......nm..,,..K..,,..H.,...,.H,.H...,..,..,,..rf...,....XV..,...U....4,.,,.,,..,.W,..,.Hy..,...,N,..,,.,f..W,,H..,...H.,,.,,..,...V..,,.,,..,H.U.H.....,...K..H.,,.,,.H.,.,V.,,H,.....,W.W,.1,..m.H.u..,....,....W..,K.,N,.,m,...y..,K.,,MH.,.W,..,,..,,.,...,,,.H.,,.,,W,..,,.W,,......,,.,...,WQ..,.,...,,..U.,,..,...,..,WM...,,H,H....W1NU.,..,KH,.mu...M.,..,mu..N..H.,,..H.,H,,..,U.,...H,,H.H.,.,.,..,,....,,...,..,,.,.WH.......m..,,,,,,,,..,.,ma 5 2 ... u.,,..m.,,,.,,,..,....,.,,..,....W..w,H.A...,..H.....,,..m..,..,...W...1,..H.1...1..n..,,m.,u.,...w...,.n...k.mm.,n.1H.mm,.,am.H.n..,,.......m..H.,,..w...m..,....H.,,W.,..,..1..m..,,,,..,,..,..,,..,..,,.,,...,,.,..,,.w.,..,.,.u.,,,.,..,.,.,,.U,.,...K..,,.,,W...,.,,m.,...,.,..,,,..,,.,.....,.....,.M.,.,.W..,,.,...u.,,..,.K.,.,,.,.H..,K.,U.M.,,..,....,.....1...H.,......,......n..,K..,H,.NM.,.,,.....,,....W,m.....u...,.,m...u......n.,,,.m.,..,..,W...,m..M.,.H.m....,,.,,,,,,.W...na..uE I Page 179 m ...rK..mr.W.1rrn1HH.rH.1Y.,rV.,V..rU.1ur1V.1.m..1urH.rInmrV..r.U.Ur.Nmr.Hr.1rHrr..rV.,rHrWV..rrnmrH,um.mm..mm.H.Im1ru1.H.m.mm.m..w.,r.mm.mmWmW...wrK.-rmwwmm,Wmn,mm,mmmmfnm..um..Wm.um..mm.m...m..r..W.w..mW..mm.mm.Wrw..wmmw...mr..Wmrm...rmm,mmWWmrpmWmmm,.mm,mmvm..um..mm..,.m.mm.1mrV..rWrWrHH..r.HrHrV..r..mm.ww..r..m..rmm.mww..mmW 55-........,.mK.,V..rmr.frm11.1WU.1r..m.U.,V.,r......rH1V.,r..rH.H.H.Yr..,U.r,Hr.HK..rHrmv..r,..1.HWU.,V..1.NN..rK..W1mr.HrV.r,Hr..r..rmmrrV.rWV..rr.HurMr,HrHr...r..rrnr..rH.,..rnrrV..nrr.Nr..rnrr..rWrr.rWr..rWr.HN.rW...rr.,r..1r..r.HW.H1,HH.1.H11.r.Hr..,...rV.rrUrr..r.1rH.r..WWWrHr,N1..1V.,r..1mr...r..r.HN,rV.rV.,r..r..rK..rHr..r,..rurV..rrnr..r.MV..rV..H.r,.r,..V..r.Ur..rr..r..rr..rWV..r...H.rry.1y.1,..r,.1rm.Mr..rH.r.HN.HH.r.Hrr.rH.rK.,rW.r.UrV.N.HrV..r.MrN.UW-.r..r,..m,5' Government Inspection Cadet Corps, 1918 Prexy Awards Commxsslons IMII55M332mg,3355Im31333335312r135,mmfM3if3M3.3,,W3353M52I.EmI553mr35:3M,55M1.5315.325I35Tx..,..,...,,.,,..,W......r..,,..,..,..,,..,N.,..,,..,,.,r...,..r..r,,.,..,.,.,W.,V,,,wr,..,W..r...W..rK..rV.,,..,..rr..,..r...r..rum.,,.,,,.,...,...M.,,..,.W,,,.,mf..,..,,.W,,..,.W.r..,.nwrr.,W.,rL..,nm.,r..W...,.,W.,,,H,..r...,,.,mm.,mmr.,..,...Mrnr.ur...r..,rur...r1.1rmr..rr..r...,..rH.,,.,,..,,,.,W...H.,,M..H.,...,..,r,.r...u..w.,,E55 I L,,,L,,,k,,,,,,i,, II I II I II I I I . . .,,..,..,.,,,.,,...,..,..,.....,. ...,,.,,,.,.,.,,.....,,.,,..,..... ..,..,,..,...,,..,..,,........,....,.,,..,. . ,.... ......,,.....,,,..., , .,...,...,..,..,,.,,..,,,,.4,,....,..,r,..,.,...,,.....,...,.,,,..,.,...,.......,..,....,.,...,.. . .,,.,,..,..,... . ....,..,,,,...,,... . . ....- ......... ..,... ,... , ...,..,.,,,. , U.- ..,. ,,,-,-M,.,,,....-..-.e.....: , , .,,, .,,,,,,...,..,,..,,,..,,.,.,.,.. . , ,...,,..,,.,,...,..,,.,,.,, .,..,,..,,..,,.,,...,.,,..,,,.,,.,,..,...,..,.,,,.,,.,,,.,,..,...,.,...,..,r,,.,,,.,..,,..,,, , ...,..,,..,.,,,,.,,..r..r,..,,..,,.,,..,..,,.,,..,.,.,..,,..,..,..,,..,,.,,..,,,.,..,,.,,..,,,.,..,..,,..,,.,,..,...,..,...,..,,.,,..,,.,,..,K..,.,,..,,.,,,.,,..,..,,,,,,.,,.,,...,...,.,......,.,.,,.,U....H.,,...,.....,...,,.,,..,.....,,.....,....,.,,..,,..,,.,..,...M..,.....,.,.,,,,,,.,,..,,.,,,.,,..,.,,,,.,..,r.,,,..,,,.,,,,,,. n,.,..,.,.. ,,.,,,,.,.,.,..,,,,,,..,.,,,,,,,r.,,,.,,,......,. . , , F Page 180 1-.. 222 gg: QW555535355353335my55:3551mf5.5w1511mnn1.1wmw1HwIn1fu1mnl1in1InwHUInX.4lm1pnfnwfmnl1HwunInwWwmwL.w1vumwmwmfuHHww.11fnwInmwwHwInwm1mmwmwIn1InWnWInWuWWvuW1mlIn1vu1n1m1m1mMwIn1ulwvu1.11vuwwmummw.11uv1u1u11-IwrHwruwu1w1rmm11-um1In1uv1111In11.w1mN1.winwlm-I1X-11m11.1Xmm1In111wIn1ny1mulwX1.1m11.1,H4mmmfmmmmuwfuwyuXIn1u1w1.11.11Inmmwmm-mmH-1InN11XinwmwInH11fmu,1nu1Huuv1ynuH1uf1In1umm-mmwuwmm 552.11.11.111M1.H,..,,..11..11.11My1L.11.Nmy1.11V..1H11..11H11..11H,..W.HK..1..1,nm..W1.H1NV.44V..1W1.H1..1m1V..11.11.HU.WH1.H11.11.f11..1N,,.H1L.11.HU.1H.1W1..1w.HV..1V.,,1.1H.1X-11-1.1L.11.H.-My-.H.u..w.HH11.,,V..1.Hvm1U11.11H1N111.41H41in,V.1In,H11..11.11m,.H11.11.41.MN1.N1..XV.,X1.,H11W1H1NU,1..,.MX.H,H11..1X..XW1.U1.M1.XX...,H,NHNIy.1H41.MV..11.11WN.HH.w.um..,,..mwwH11H1.U1.HV.,1WN..N1W,H1H11WW11.4N.U1.111..1W1WX..1MN,H1.M1H1V.11H1H.1mN.H,m.m..W.....w.E 55 af..,,..,.N...,,..,.N.H,..,,..,,..,,..,,...,.,.H,V..,.H,..,.H..,X,HW..W..,,y.X.HX..,V.XK..,..H..W...,..,..,,H,H....,...H.,.,,.H,...K..U.,V.,,......,..1...H.,H,..,,.,,,..WK.WLH,..mn.1,..,,.W,.,,.HH,,..WH.,,.,L.,W..H.,H.,.HX..,K..,.H...,.HH...H...,...mu.,,..,W,K.,K.,X...,U,...Km,WX,WH.unK.,,H,,.y,,mm.HW.,,..N,.,,y.,,..,.HNH,K.,..,..HV.,WX,.H..,.1X...H.,U.,mu.N.,...m.,...,,.M,.,.H.,,..,,.....,K.,,..,...M.,.1...1...,,....H,.,,,..,.,,,.....,...y..,..,,..,H,..,,XH,...M.....,..H,H,m...,,.,,.,.,.w,i if 1nu-n1wInmlmy1ummwnwnumvmmmmmulmmmm.:ummmwI.1wn11.w1nin1IndUEnml.lMuEEmHAIEL4EmQlIElIiiiIEulummmmummmmmmmihnmumuunnwwI1wmfninwmmmmnmnummummmummmummmnnnnmummmmummmummmummmummmummmmumuwmmmHummmummmummmmummlmuumummmummmmmmmwunmummmInummm-X51GiQIFGIREMZTEEEIIFWEGQIGEYFIMIEIRIEIIEIEEH. Page 181 .., -I: 1- i.,.,.,.,,., ,.n. un.. ..., K.. ..., nm .,,...,.,.. HW.H.H.,.H,,.u.m.4...,,Hnu..m..,.,,..,,..,.m.....,.,..K., ,,., ..,, K.., ..H..,..,..n,..,,,,..,,.., ,..... H., ,l..,. M.....,...u..,..,..m.,,. .,...ll., ,. .,... .. .,l.... . ,l..,. ..,.,m,,m l.., . .,1, .,..1,..,..,l ..,. .1H.,...,I.,H.,W...,..,,.,H....,,...,.,mm.....,..,,......,...f....,. ...,. ,nn..,...,H.,..,.......,HQ.,ywg.w5,5,.5.w.,,:,w5,,wgE,,.555w,W..,,,.,.....nWH.,,H...mm...K..,..n..,.. ,..., W... ....... m.,.....,,HM...H.,,.W.,l..m....w..,,.,.,,..,.5 E, ,,.,,, N ,,.4,, -,,,,,,,v,,.M,,,,,.4, gughgnfhm -,,,!,,,,,,. ,,,4.v..,v,,V,44,,,,,,44 R A V,vnnlnunVnnn,A,,V.,,,IA,-,4,-'!..-...! nlbn ,QInVI,V3MW,,mmI,ffI:I:H1,55Eg5,5,EE,,,HE,ww1,mm,,,, .,,.,...,.., E.. ,..,,.,,,.,,.,...,.. , ,..,...,......,..,,........,... , ,.,,,,,,.1,..,l.,...,... n,......1,.,,..,, . ,....,..... , ..,,. . ,., .,.. ,. ..K...,.4.,. ...,,.....,... ,,,.,,,,.., W. ..,,, W. ,,..,,,...,..,.,,,,.,,,...,.,.,.,. .. l,,... W. .n,,, .W .....,. M .,..,,.u.n , ,... m.W.u. ,u1... ,m,..W.,u,..,......n....s,g nnmwmnnnummnwnumwnwmmmnumnwummmummuummm1mmm:wnmummwuumwumxummmwnumwmmm:ummmummm:umuwummmmznnummvnumuummmxnummummmwuiulwilxrixvinhlwiilwlulwiivInHzivElMInQI:i1Ini1Mini?inuiw:HMIIYIFMUIIIIHIIYIIISimiUIQIIEIITIIIEIQQIPIHIHYHQIHIIImillHHEWHGIFEEIIX5HEFifMCIIHIIEGIEIEIIIIIYQIEEEILHKQEEH5iGFilliiEiEEE:TfziEEEHnnuu1fHFlGhllIilmunmru1fIfEmYvE P Cl g e I S Z gm.mmU.....,H.M.,WWW,yn1...Y.HYWK.f1V.,um.1,K..,...V.H,..,,.HH.,.UW...,H.,1.1H.,,W.NY,..WN.1.HmlMmH...H,...,.H,.U,.H,.H,..1H.W1H,,..,H,XV.W,V.,,f.W.mV.,Wvm...mmv..1,H1H.1V..H.,1.1XXH,.U,mV..XWX..XX.MW,W,..,V..N.,NHH,,H1,..1...4H.,.MH.,H,1..1X..1W,1.,H.,HHH,VH,,H,.HH.M.,1.4,..,,H,..,,HH.,,..,,y.,H.,.HV..,,Hmm,HH.,M1.,m,WV..,,.,.mmH,WmyH.,V.WMVW.,nnW...nm...U.H.W,H.,.vmH.mm.mmIum.1.1,,.Hm1mml..4,...1.w.m.mmg 5gm.,W.,.,H.y...M..,y.,,.H,..,,..,..,Y..,y..,...rm,,..,..,....,..,H.,..,,...,.,,.M.N..,,,.,........,.,,......V,..Y,.....VY,.,um.,...vu,,..,,..,,..,,..,..,,..,,.,,..,,...,..,,.,...Y,,,Y...Y..,,,..,,.H...,,,,,....,,,.....H.,,,,.,,.1,.H,.H,..1,..,..,N.,,..,..1H.,..,...,...,..,y.,N.,,..,.,.,W..,,..,.,,,..,..,W..H.,..,..,,,.,...,.m..,,.,,..,,H,,..,...,..,,.,W..H.H..,..,,,H,..,N.U.,H.,,.,N.,W,.W.,...my,..,W,,..,W,..,,..,H.,,..W.,...,..,..,H.,.H,..,,..,...H.N..,....,.N.,,..M.,U.N.,,...u.,...,..,.....w.,...,......5g5 5 : s g E si 1 : 5 E 5 E 5 S 5 2 s 2 2 f E ss? E gg Ei 5 E 1 5 5 5 E si E E E E E E 5 E E 1 2 E as 5 g 5 5 s E EE S25 E52 E55 51- 552 Ei- zis as E22 I 2 Ii, SE E55 EEE 522 as Sai iii :fr :as gig Ex: :za l- E wwwwwwmy1:1fuW.1Wmf-.1XinmumInInH-1..1in11.4rnnn1-11H1Infm1.11.HWN.unL..1H,K..H.,V...mL..fm1.H.HU.1In1mWU.Xyn1-11.HU.1.Hml1-4InVH1.11InH1umm.HH.1fuV..wmL..nmH1H-1.Hm11.1W1-111H1H11H11.,XHX1-N1.11m1mmK..1m1mH4V..1.HrmulWlmvmH.1WV.,N.HmXH1u11HvmH.,1.1fm,HN1.umHmlnm....1V-.11fm1,WWm.mmu..muK..mm..m.,mmvu-..,..n..m.w..4v.m......mm....m.,....mu....m....,m...m-. I E ' : '- '- -'-- 'E .4 ...4..1...H.,YN...N...D...........,.,......u......K...........l.n.m...K..,.,....mm.m.....,V....n.,,.m..1m.m,...mfm..w.....,..i P a g e I 8 3 1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 L 111111 1111111111111111111111111 1 1111111111111111111 11111111111111111111 11111 1 111 11 .11111111111111111111111111111111111111111111111111111 1 111 1 1111 111111111111111111111111111111111111111111111EZ- 573115112GIGill251511115E1315515GLIEQTIIGIEIELIIJ115111IIS1111111Gi11111111155121121515E11FEGZQIEFIIEQIEIGiiIIIIIIEIIREIEIEIEIHQQI15111111112211211QiiiillIIIGLEGEZIEZIRISJillEi!Killiii?lil1111212111iii1215111iiiPIZRIRIIIHIIEISILE111111111111111111111111111111111111111111111111111111111111 11 1 1 1 11111 1 1 1111111111 1 11 11 111111 1111111 1 1 1 1 1 1 1 1 1111 11111111 1 11111 1 ,: ii 51.111111111111111111111111111.11111111.11.111.1111111111.111.111.11111111111111111111111111.111.11.11.111111.11111111111111111111111111111.111.111111111.1111111.11.11.1111.11.111111.111111.111.111111.11.111111111111111111111111.111111.11111111111111111.11.1111111.11.1111111.11.1111111.111111.1.1111.11.111111.111111111111.1111111111.11.1111111.11111.111.11.111111111.1111111.11.111.111111111.11111111111111111111.1111111111111111111.111.111111111111111111111111.11111111111111111111.1111111111111111111111111111111 1111111 11111 1 111111111111 1111111111111111111111111111111111111111111111111111111 11111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 1111111111111111111111111111 111111111111111111111111 11111111 11111111111111111111111 1 1111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111 11111111111111111 1 Page 184 .. ,...,:....m X.. ,.....,,..,,:A,mmm I b wid r r r i - ...,. ...-... I ......... ..... -. ..... N. ,..,. .,....... The Marines By Ll. Waller W. Muller, U. S. Nl. C. HE Marine Section of the University of Wisconsin was at nrst termed an experiment, but as the weeks went by, the men began to show real signs of that spirit and snappiness which makes for a successful military unit, The spirit of the Marines at the University was the same as would be found aboard ships, or in France. They were f always there to do the job, with the material at hand, and never coming back until it was Finished. In athletics the Marines came out with seven W's . This in itself proves a theory that a Marine never comes back until he has accomplished his mission. The lvlarine Corps says to its men very much the same as the ancient Spartan mothers said to their sons: lf you go into battle and lose, never come home, for there will be no home. , Translating this literally we get exactly what is told us in an Unwritten General Order. This indescribable something called lvfarine Spirit is no other than that which won Belleau Wood and caused its name to be changed and go down in history as Bois de la Marine. lt is the same that won Chateau Thierry in the fifty-ninth minute of the last hour. This same esprit de corps was in the heart of every man in the Marine Section, and if he had been given a chance in France or Siberia, he would have made the Badger University proud of his name. LT. WALTER W. fNflUl,TER IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIII IIIII II II II IIIIII III IIIIIIIIIIIIIIIIIIII IIIII III II II IIII II II II IIIII IIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII II IIIIII I II IIIII IIIIIII II II IIIII IIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIII iw N..,,vv,, - l-,l! N -l.,.l , ,,4A,4 ,,4,, I II IIIIIII III II IIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIII IIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II III II IIIIII II IIIIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIL El? 'Ei QI? EI El I , 55 EEE as iii SE Eli E ii: I l E Qle The Marines :fs sie ,V - LI, . ,I- . I .V Ei -- El: if I I :IE I sl: :,: I -., , I TOP Row-Kiel, Becker, Klug, Maack, Nelson Coleman, Pabst, Harley, LOOmis, Claxvson, Mayhew, Koehler. SECOND Row-Johnson, A. D., DeYoung, Morrissey, Evenson, Jellerna, Whicnall, Sabin, Leaper, Donaghey, Bieloxv. ' Rove, Moody, Zander. THIRD ROW-Baker, Christianson, Granberg, Krez, Mathison, Kesten, Cook, Groves, Greenberg, Lyons, Kucheman, Noble, Gotfredson. FOURTH Row-Spafford, Sheldon, Mansfield, Hirsheimer, Widmer, Blum, Margoles, Johnson, A. L., Trier, Keeley, Quarberg, Powers, Thibert. Ramsay, Dexter. The Marines LIEUT. WALTER W. MULTER, Commanding Non-Commissioned Officers SGT. WILLIAM M. YOUNG, U, S. M. C. , SCT. FRANK HOPKINS, U, S, M, C. fprivates I BIELOW, MARTIN P. BLUM, GEORGE L. BROGAN, JOHN J. CHRISTIANSON, CARL B. COLEMAN, PAUL J. DEXTER, STEPHEN T. DONAGHEY, JAMES B. ELLIOTT, JAMES R. GOTFREDSON, ROY C. BAKER, BURTON C. BECKER, ROLAND H. CLAWSON, DONALD G. COOK, BENJAMIN F. DEYOUNG, AUDLEY M. DREW, EVERETT G. GRANBERG, HENRY S. GROvEs, HAROLD M. HARLEY, HERMAN K, HIRSHEIMER, EARL S. JOHNSON, ALFRED L. KESTEN, PAUL W, KREZ, FREDERICK W. KUCHEMAN, NORMAN A, LEAPER, WESLEY S. LOOMIS, PORTER L. LYONS, GEORGE B. MAACK, ALFRED H, MANSFIELD, HERBERT S. MATHISON, LEON J. NELSON, GEORGE F. NOBLE, HENRY H. PABST, FREDERICK A. PADDOCK, JOHN M. Privates on Special Duty with Marines EvENsON, CHARLES R. GREENBERG, JAMES E. HODSON, ELLIOTT W. JELLEMA, CHARLES JOHNSON, ALBERT D. KEELEY, LAWRENCE C. KIEL, WILLIAM KLUG, LYLAS P. KOEHLER, WALTER B. MAROOLES, HARRY MARKLEY, PAUL L. MAYHEW, LESTER O, PONVERS, PATRICK G. A QUARBERG, LINCOLN RAMSAY, WAYNE. SABIN, DEWEY J, SHELDON, JACK G. THIBERT, FRANCIS V. TRIER, CELESTIN J, WI DMER, ROBERT J, MCINTOSH, C. W. MOODY, 'FREDERICK A MORRISSEY, JOHN F. ROVE, OLAF N. SPAFEORD, ALLEN WHITNALL, GEORGE D- ZANDER, KARL L. I JIQIIIQIIIIIIQII III II IIII II IIIIIIII IIII II IIIIIIIIIIIIIIIII IIIII II III IIIIIII I III III I IIIIIII III IIII I IIIIIIIIIIIIIIIIIIIIIIIII IIIII III II III IIII II III III III III IIII IIIIIIIIIIIII II IIIIIIIIIIIIIIII III IIIIIIIIIII IIIIIIIIIII II II III IIIII I I II I III IIIIIIIIIIIIIIIII II III III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIQ IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII III III IIII III IIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII' Page 187 ' ' I , Domgs of fhe Devil Dogs For three months the embryo Teufel I-lunden lived a checkered non-combatant. if 4' Career. Expecting eventual action overseas, they were as hard-boiled as a Marine , is expected to be, but the ups and downs ol S. A. T. C. kept tht Marine Camp in con- ' stant turmoil. - -is- Y N 55 X I. , I , ,y 3 -1 jf:-3, vi .11 Q I , 4 1 7 ,, .. ' l Peet , rv H-1:4 5 I ,.. 153' gf . gist ,. I, rs: as e ' . , -H NW : x N. -fi ' ' sf- ef:- W , if -1- 4 . M it, -:af CQ - It A ,f ll! A . . ,V . . ' 'sf I xx ,wi 1 - ,:w ':L - ! X s q 'WEVX H In CARRY ON, MENP' -,149 REVEILLE-10 A. M. W. h h. k ,f ' , f .a.4..4.4-I unifqlfm gli Iffiogrfip f' 4 ' 5 - f l There was no bugler in the Marine Camp, felt himsclfgqual 9' ,A and the sleepy birds were awakened in this to any shavetail Y ' n 'W m21DUCI'- . lieutenant and f P -1 F F Q s he always rated X my i X 0 ff A-. a salute, which 1 N 5 Q0 A -i ,ff he promptly ', f' 795944 :iff receipted. 4 if X 'X N , fqtfx . . .4 S4 1 Nl , X 'gy W fi ' AN- in I X 1, K W5 N. f wi T ' f -' M 'I ' l F N -5 Q pt if X ,Y X X 5.1 K M A .Q SL x l ' I, U W Q 0 ' W fi . 'Fw fr , . A 3- 14' 4 li T P at -- 'nf I . v . v I.. SHIFT QUARTERS! Ali! I , ' XJ' A . . ' N , Orders to move barrix were issued and carried ' , I 1 :3 X v out no less than I7 times A Marine did not rate A ,Ll .-ws' - o trciclc service 7555 Q CHECKING IN W, 4 .iff Given Z4 hours to 35 ' 4: hand in clothing on the is ' eve oidischarge. Every N ' barrel in kgadisor was A X, - u' tone 4- t'1 many V J glqtli? iiounds jvere con- - s , ' W fined to quartqers pendi 5 NS., if. 4 ing arrivalo t e civies 5 I i O NA ff, from home. - up 3 Fi i fe .M 2-.L-.z 'ii f ' , , . . . . Q 1 , 1 'S , , .QX I . A f vpgaq I.. 5 N - 'ffm ' 'Q ! 5 if ' x -ew:--Q -- Zkom 4 l,, . Q K. f - '- 2 I. ' see ,gs--e , ffvflflarky 20 A TYPICAL SESSION Between drill hours and when the call oi classes was buried in an atmosphere of smoke and bunk i Hiiiiiniiuimi.iimi..i..ii.ii..ii.immm iiii.iiiiiiiniiiiiIiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiii Page 188 Uoblilidmef U.5.VI. . X C Apprentice Seamen Company I TOP Row-Klann, Bertelson, Hedstrom, Grimshaw, Friday, Ourada, Engler, Evans, Lamb, Fuchs. SECOND Row-Borgers, Christcnson, Kaufman, Colony, Warnecke, Hanson, L. F., Gerhardt, Black, Coomber, Barry Lee, Koebl-ce, McDonell, Beck. THIRD Row-Daniels, Kerler, Bowman, Jourdan, Amundson, B. C., Dale, Johnson, E. D., Glaettli, Johnson, O. E. Brand, Langer, Hanson, C. F., Ives, Johnson,J. B., Bellack. FOURTH Row-Terry, Dorsey, Luce, Dawley, Evans, Clarl-c, Gibson, Horne, Ede, K. L., Cruger, Hanson, E. P. Kidder, Johnson, A. W., Cunningham, Lamboley. FIFTH Row-Gladden, Cooper. Larsen, B. M., Donnelley, Kirst, Brown, H. H., Hartzell, Edwards, Bartholomew Goddard, Grota, Anderson, Mantonya, Amundson, E. W., Sickert. Ojicers Navy Detachment IVAN C. MIX, Ensign, U. S. N. R. F., Commanding CHARLES H. WEAVER, Chief Yeoman U. S. N. HENRY ALBRECHT, Chief Master at Arms U. S. N. WILLIAM E. STRASBURG, Boatswain's Mate U. S. N. ADRIAN L. IDANITWERS, Cadet Commander of Navy Section Company I Cadet Ojllcers Company Commander . . . . . . . . ALVIN R. KLAXN Section Chief . . . . OTTO L. SICKERT . HENRY F. GRISNVOLD Company Clerk . ........ . AMUNDSON, B. C. AMUNDSON, E. W. ANDERSON, P. M. BARRY, L. G. EARTH, K. P. BARTHOLOMEW, J. F BECK, H. H. BELLACK, W. B. BERGMAN, M. J. BERTELSON, B. J. BLACK, R. R. BRAND, R. B. BROWN, F. H. BROWN, H. H. BoRcERs, N. D. BOWMAN, P. G. BOYNTON, N. R. BRYAN, R. BRITZMAN, H. C. CAHILL, E. G. CHRISTENSON, A. CLARK, R. C. COLONY, M. P. COOMBER, H. M. COOPER, A. W. CRUCER, H. J. CUNNINGHAM, E. S. DALE, N. C. DANIELS, W. E. DAWLEY, D. E. DONNELLY, D. W. DORSEY, G. A. Dosci-I, E. L. EDE, K. L. EDWARDS, A. W. ENGLER, H. F. EVANS, G. D. FRIDAY, F. J. FUCHS, W. T. GEHLER, H. F. GERHARDT, A. P. GLAETTLI, HERBERT GLADDEN, A. H. GIBSON, E. H. GODDARD, M. B. GRIMSHAW, R. B. CJROT.-X, B. S. HANsoN, C. F. HANSON, E. P. HANSON L F. HARTZELL, L. S. HEDSTROM, L. H. HEIN, G. L. HERI-IEIM, M. A. HEYER, H. A. HORNE, A. D. IvEs, C. E. JOERG, H. P. JoHNsoN, A. W. JOHNSON, E. D. JOHNSON, J. B. JOHNSON, O. E. JOURDAN, R. L. KAUFMAN, F. G. KERLER, E. A. KEYES, E. A. KIDDER, C. P. KIRK, C. H. KIRST, L. A. JUN I .mi mimlmmimyinmil-N-A-liimwlilmnwm uummmmInIininummIninwmmimiImummwiiiim Page 190 IQOEBKE, E. J. LAING, S. G. LAFLIN, J. M. LAXMB, S. J. LAMBOLEY, J. J. LANGER, J. E. LARSEN, B. M. LARSON, K. N. LECLAIRE, A. C. LEE, O. C. LINDEMAN, H. E. LINDNER, H. G. LUCE, F. A. LUND, A. B. LYONS. F. W. MANTONYA, W. G MCDONELL. J. F. OURADA, J. C. TERRY, O. R. WARNECKE, E. G. WARREN, G. B Company K TOP Row-Snider, E.. N., Young, V. D., Johnson, Weiss, R. C., Viech, McLane, Megorden, Stewart, R. D. Walraven, Olson, Vitcenda, Scewart,J. D., Rundorf, Nelson, Scadden, Schiller. SECOND Row-Will,J. C., Miller,J. I., Miller, K. C., Powell, Dean, Schulz, Sinex, Shock, Pitzner, Sabin, Putnam, Powers, Richardson, Peterson, Osmundsen, Mackensen, Talbot. THIRD Row-Gerhardt, Timm, Roetzer, Robar, Schoheld, Soref, Samelius, Weiss, RC, Turneaure, Maurer, Rittenberg, McLenegan, Schirmer, Slichter, Multer. FOURTH Row-Rosenberg, Smith, Van Roo, Nicolay, Snider, W. H., Oycn, Teske, Merriam, Shapiro, McKinley, Purinton, Thompson, L. N., McKaig, Paulsen. FIFTH ROW-Lammers, Morris, Karas, Thomson, Wilcox, Pastoret, Wilson, Fabian, Nickodem, Taynton, Reichert, Portman, Myers, Watson, McConnell. Company K Cadet Officers Company Commander . C. W. MORRIS Section Chief . . . . J. D. MCCONNELL Company Clerk . . G. B. WATSON Apprentice Seamen DAUCHERTY, R. L. MCLENECAN, D. W. ROSENBERG, B. W. STEWART, R. D. DEAN, H. K. EARLE, K. S. FISBECK, F. L. FABIAN, P. J. GERHARDT, O. A. HOWLAND, D. H. JOHNSON, KARL KARAS, L. L. KURTZ, H. W. MACKENSEN, E. H. MAXSON, R. H. MALIRER, E. D. MECORDEN, G. C. MENICK, H. S. MERRIAM, J. R. MILLER,J. I. MILLER, K. C. MULTER, L. M. MYERS, CHARLES MCKAIG, W. H. MCKINLEY, M. J. MCLANE, F. L NELSON, M. H. NICKODEM, J. V. NICOLAY, J. L. OLSON, J. H. OSMUNDSEN, O. S. OYEN, H. S. PASTORET, L. H. PAULSEN, C. W. PEACOCK, B. N. PETERSON, H. B. PITZNER, A. F. PORTMAN, L. J. POWELL, H. M. POXVERS, M. A. PRICE, L. J. PURINTON, S. M. PUTMAN, R. J. REICHERT, G. J. RICHARDSON, C. I. RITTENBERG, G. F. ROBAR, G. D. ROETZER, A. G. RUNDORF, R. L. SABIN, A. B. SAMELIUS, W. R. SCADDEN, F. H. C. SCHILLER, R. F. SCI-IIRMER, J. R. SCHOFIELD, I. P. SCHRAGE, C. T. SCHLIETTE, D. H. SCHULZ, H. H. SCHNVARTZ, R. J. SHAPIRO, L. H. SHOCK, M. R. SI-IOEMAKER, M. J. SINEX, G. N. SLICHTER, D. C. SMITH, F. E. SNIDER, E. N. SNIDER, W. H. SOREF, S. M. SPIELMAN, H. J. STEWART, J. D. Wim.-i...ii.i... I-.Iwi-wiiiiiiiiiii ininlimmmininiiIIIininmiinIiniiiiiiimiiiiiiiiiiiiii age 191 STONEMAN, W. F. TALBOT, H. A. TAYNTON, MARK TEHENNEPE, C. A. TESKE, H. O. THOMPSON, L. N. THOMSON, M. S. TIMM, C. H. TURNEALIRE, F. S. VAN Roo, J. A, VIETH, F. L. VITCENDA, T. J. WALKER, S. A. WALRAVEN, PETER WARREN, WILLOT WEISS, R. C. WEISS, R. G. WILCOX, RAYMOND WILL, JOHN C. WILSON, L. J. YOUNG, V. D. 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111ui1111111111111111111111111111in111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111n111111111111I111111111111111111111111111n111111111L 11 11111111111111 111 11 11 111 1 1 1 1111111 111111 111 1 1 11111111 11111 1 1 11111111111111 1111111 1 1 1111111111111 1 1 1 1 1 11 1 1 111 11 1 1111 1111111111111111111111171111111111111 11 111111 L Company L TOP Row-Porter, Sanders, Bach, M., Friday, Bakken, Schubert, Tiedeman, Hipke, Josephson, Marks, Bach, E., Andersen. SECOND ROW-Bluhm, Heilemann, VanVleclc, McGrath, Browne, Lewis, Schiffman, Hughes, Brady, Driver, Meyer, Thiede, Hotton. THIRD Row-Thompson, Archie, Schultz, Parkin, Robb, Fuhrmann, Assovsky, Ashton, Hubert, Lindahl, Sontag, Stolzc. FOURTH ROW-Stern, Hankin, Faber, Taylor, H., Neisser, Krivonos, Heseman. Bussey, Grady, Orvis, Marshall, Machlis. FIFTH Row-Docter, Ramsey, Ballantine, Caspersen, Beste, Seeber, Taylor, W., Schwentker, Hill, Hance, Skelley, Heller, Routt, Scott, Travers. Company L Cadet ODITCGFS Company Commander . . . DONALDJ. SCOTT Secnion Chief . . . RONALD W. RANISEY Company Clerk . . MYRON C. DOCTER Apprentice Seamen ALBRECHT, HAROLD T. ANDERSEN, VICTOR S. ARCHIE, ARTHUR J. ASHTON, SIDNEY C. ASSOVSKY, CHARLES BAC!-l, C, EDWIN BACH, MARIQ J, BAKREN, TESTER H. BALLANTINE, G. NEAL BESTE, CURTIS F. BLUHM, HERBERT W. BRADY, JOHN D. BRONVNE, EDWARD I... BUSSEY, FREDERICK N. CANDEE, KENNETH CASPERSEN, VICTOR H DAHLE, CRRIS B. DRIVER, CAMILLES O, EISELE, EDWARDJ. FABER, ARTHUR C. FREDERICKSON, J. FYFE FRIDAY, A, CARLETON FUHRMANN, CARL G. COFF, SIDNEY B. GRADY, CYRIL J, HANCE, LYLE S. HANKIN, HARRY PIEILEMANN, MERLIN F, HELLER, HERMAN G. HESEMAN, EARL J. HILL, CLARANCE D. l'IIPKE, ELMER N. HOTTON, HOXVARD S. PIUBERT, ELMER G. l'IUGl-IES, CHARLES L. JOSEPHSON, SELMER B, TQRIVONOS, FRED G. LEWIS, CLARENCE E. LINDAI-IL, JOHN W. MCCRATI-I, JOHN E. MACHLIS, SAMUEL A. MARRS, HAROLD E, MARSHALL, DAVID L, MEYER, CHARLES A. NEISSER, WALTER R. ORVIS, GEORGE C. PARKIN, CJ-IARLES A. PORTER, COLBY A. ROEE, EDNVARDJ. ROBERTS, GAYLORD B. ROBERTS, ROE ROY ROUTT, MYRON M. SANDERS, HARRY W. SCHIEFMAN, ALVIN J. SCHUBERT, C. C. F. SCI-IULTZ, EMIL O. SCHXVENTKER, JAMES M. SEEBER, TAYLOR H, SIQELLEY, XVILLIAM D. SONTAO, XVESLEY G, STERN, XVILLIAM STOLZE, JOSEPH A. TAYLOR, HAROLD P. TAYLOR, XVARREN A. THIEDE, JOSEPH A. THOMPSON, TRUMAN TIEDEMAN, LEONARD P. TRAVERS, CHARLES W. VAN VLECK, JOHN H. WHITE, CLEVELAND J. 1 11 1 1 11 1 1 1 11 1 1 1 11 1111 1 111111 1 1 1 11 1111111111111111111111 1111 1 1 1111 111111111 11111111111111111111 11111 11 1111 111111111111111111111 11111111111 11111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111li1i1ii1i1l111li1ll111111111l11l11111111i1iil11111ii1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Page192 , ,,,, 1111 111111111111111111 I 111111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111 1111 1 111 11111111 11111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111 1111111 1 11 11111 1 111111 1 11 1 1 11 1111111111 111 11111111111111111111111111111111111111111111111 11111 1 1 1 1 1 11 1 11111 11 11111111111111 11 11 1 1 11 1 1 1111 1111 1 111 11 1 1111111111111 1 111111 1 1111111 111111111111111111111111111 s E 1 Company M I f I , l TOP Row-Lund, Keller, Johnson, Moody, Kiland, Niederauer, Milks, Birkctt, Orsburn, Chapman, Cumming. SEEOND ROW-Joerndt, McKinley, Lewis, Gehler, Wolfram, Pieh, Fox, Seids, Wegemann, Evison, Smith, Janisch, CVCFSOU. THIRD Row-Schneider, Wigder, Wemple, Schlotthauer, Meier, Ede, R., Blomstrom, Blowney, Stemmler, I-leyman, Newman, Slama, Schujahn. - FOKRTH Row-Wilder, Uhl, Stearns, Zlpperlen, Webb, Dudgeon, Spettel, Williams, Scott, Rodems, Rusterholz, Oman. gg FIFTH Row-Brown, Loftus, Weber, MeNaI.Ighton, Oehrlein, Sinaiko, Adler, Fancher, Nyman, Mero, Kautz, , Anderson. Company M Cadet Ojfcers Company Commander . . CLARENCE V. JOERNDT Section Chief . . . . SILAS L. SPENGLER Company Clerk . . SIDNEY F. MOODY Apprentice Seczmen 11 11111 111111111111111111111 11 1111 ADLER, OSCAR L. ANDERSON, STEVE W. BENNETT, WILLIAM J, BIRKETT, PAUL J. BLOMSTROM, CARL A. BLOWNEY, RUSSELL P BROWN, EARL D. BURR, ALLAN R. CHAPMAN, LAWRENCE B. CUMMING, ROY G. DUDGEON, SIDNEY B. EDE, RICHARD H. EVISON, WILLARD A. FANCHER, CLAIR A. Fox, PHILIP C1. GEHLER, ERWIN J. HEISIG, WALLACE D. HERZFELD, RICHARD P. 11 1111.11.111.11.1111..1.1..1.11.1.11..1.11.1..1...1.1.....1.1111.1....11.1.11.1...11..1...11..1.. 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I111111111111111111111111111111111111111111111111111111111 HEYMAN, MORRIS A. HOLMAN, SOLOMON B. HOFFMAN, ARTHUR L. JANISCH, WILLIAM J. JOHNSON, MARVIN L. KAUTZ, LEO C. IKELLER, DANIEL l-l, KILAND, KARL G. KOLMAN, MYRON J. IQURTZ, LESTER W. LENVIS, JOHN W, LOFTUS, GERALD W. LUND, MYRON P. MCKINLEY, EDWIN D. MCNAUCI-ITON, LESLIE MEIER, EMIL J. MERO, SANFORD G. MILKS, MERRILL T. NEWMAN, GEORGE l. NIEDERAUER, FRANK L. NYMAN, GEORGE F. OEHRLEIN, GEORGE L. ORSBURN, OSCAR D. PIEH, ROY J, PUCKETT, WALTER C. RODEMS, LEO S. RUSTERHOLZ, CARL I-I. SCHNEIDER, HOWARD S. SCI-IWARTZ, CHARLES F . SCHLOTTHAUER, D. E. SCOTT, OWEN L, SEIDS, JOHN W. Sci-IUJAI-IN, ALVIN D. SEVERSON, CONRAD E. SINIARO, JAKE SLAMA, ELMER SMITH, ROY N. SPETTEL, MARCUS J. SPIES, GERALD A. STEARNS, RUSSELL B. STEMMLER, WILLIAM UHL, ALLAN P. WEMPLE, LEONARD C. WEBB, DOUGLAS J. WECEMANN, ALVIN A. WEBER, CARL J. WHITE, RICHARD J. WIGDER, BENJAMIN WILLIAMS, JUDSON S. WILDER, FRANK E. WOLFRAM, HERBERT E. ZIPPERLEN, WILLIAM DT .E K I I .a :IE E 11111 1 111111111111111111 11 11 1111111111111111111 1 111111111111111111111111111111111111111111111111111111111111111111111111111 111 111 111 11111 111111111111111111111111111111 11 11111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111.1.1.11111.11111111111111111.111.2 .111.1.111111.11.11.111.11.11.11.1111111.11.11.11.11.111.11.11.11.11.11.111111.111.11.1I:Iaz11:I.11.1.11.111.11.1111:aanameInIIIII.11.11.111..1111.11.11.11111111.11.1111111.11.11.11.11.11.111.111.11.111111..111.11m.mIIma:1.111.11.1.1.11.11.11.1.masmIamnimsiaizmamr '11111:ImzmaIm...11.1111.11.1111.11.11..11.11..IIImaI:zm 2 P C1 g 6 1 9 3 Is In.- HmmmnInmuluummnmummmmli 3123555355ggMy55M353mygfgfMyWwwmulnumwupnvmmumuwulvuulumnwulsunnmwuvmwuunwInmmwmnnInru1InmvnmummmmmwmmwnumwuwluvInmluunwInmln1lulmvunuruwmmwuwlnwuwnnmmfwmInnumunmwnumwuwuvwnwulmwyufmmmwInwnwnnwuwuwluwInwuwmmwInnnwInInwnwwnwmmwmlnwn1ul1uwunmwIn1nwKumwnvmwmmwmmmwmwnwmnulnmwummunwuwInunwmmunmwnwluwmumuummmnunumummummnmnmnf 3 alum..M4mwmInnwW-.1ullu1-.1my-I1ulmlmm1InIn1Hmm.1.HI..V..l.HHl1.Hmm1HUMulmmm,1InmyulmmlInlnm1In1InInm1H11H1mul1.Umymlnm1Inl.1lullmnll.11InH-rmmlulml.I1ln.Uw.Hm1lmInIn1In1I.1-.1mullmnnmlH1myInH.1H11.111.1lu1.I1H111.l.Unl1mm1...l.mm.mm111ll1l..1H1m1mH.u.1m1.H.iniiiliilinI-I1QuVdll.1mlii1InH1175li.1lilMdnInInInnh1.1ml-L1illi..m1-IlnuullmK11m-in1Qulm.il1Edidiiiliml517151516562EEIZLIIQIEIREIITIIIEE Useless Steamship Cardinal SE The Navy Prom-Kehls l-lall, Dec. 6, l918 if 235 H: sig 5 immm.fnnmvmmum.mm..mm : i : :y-..,...,..- .... .. .... .......... Wim.,,..,...U.,...,..wL..l5.....,......,.L.EEW...ml,.m..,.2..H..,.......:.l,..,,MM3..,..,,.m..um..,ul...nn...,..,..,...,.m.....,...,..,,....,,m...,...,..,...,..,m...v.........,..m.,..,...,..,..m.,ml.....,......,.m..,,.,...nu...H....y..,I..,...f.m.....H.,,.l............,H....f.....m..,mm..1......,.....m........,m..m..,,.m....,...mn..,1M.,..W...lV.f..,I.mn...,.......H......,.m.,..,..,.....,.,....,m...,,......1...,...w....u....ms55 1nmunuumulumunmumnmmmmuuuulluummmmmmummmumumumlmmnnmlnwmummmwnllnwmmm1mnrnmmummmmnummummmmmmwummmummufImmunInmnuulInunlnrinmlmnumInnmEIunumdumummlunnmiimnilmEE rnwnu:Emumnumummmmlmm1II11unmummwuumummmulnumunmuuummnunmnnmummnunummvumummuummmnumnmu-muni Page 194 Thlehcs F5 Pd' iiiiiiiimiiiiiiiiiii iiiiiiiiii iiiiiiii ii i i ii i i iiii ii i i i i iiiiiii i in ii i ii ii ii i iiiiiiiiiiiiii i i we iiiiiimiiiiiii iiiiuiiiiiii iiiiiiiiiuiiii iiiiiii i i i i iiii iii iii iii iii iiiiii i iii i ii i ii i iiii iiiiiiii i i i ii iii ii ii iiiiini ini i i iiiiiii i ii 5iiiiniiiiiiiiiiiiiiiiiiimwii Eliiiiiliiliiiiiiiiliiiii i College Athletics After the War By Tom E. jones HE past year and a half has been a great laboratory experiment in the develop- ment of human material. We should profit by the results of this experiment. lt has brought out strikingly the defects in the preparation of our man power. The nations hrst and most important concern during the period just past has been to develop and condition those recruited for military service. lvfodern warfare has demonstrated that thc carefully trained and conditioned man is still the most important factor in victory. lvfilitary authorities say that the condition of the American soldier was one of the decisive factors in the war. lt was because they pos- sessed the ability to think quickly and act independently in emergencies. These qualities they acquired largely through athletics. NVe have learned much about playing as well as fighting in this war. Cnc of the bright sides of the great struggle is that the interest of the general public has been nce of physical education. lt has emphasized the great opportunity and responsibility of schools with reference to physical training and I am conhdent that the future will see more athletics, rather than less, in the schools. Physical htness is just as important as mental fitness in making useful citizens, and a dehnite period should be arranged for it on the program of every stu- dent. One hour a day is not too much to give to this very important part of the students education. The new impetus will be along the line of intramural sports. Ath- letics for all and everybody in athletics. The normal and best way to develop intercollegiate athletics is by backing them up with hundreds in a good program of in- tramural athletics. Intercollegiate athletics will al- ways have their place in developing institutional loyalty and inspiring the non-athletic to better efforts. The competitive spirit is funda- mentally a good thing and needs to be developed in the entire student body. The strenuous, competitive nghting type of game instills in the men the spirit of determination. One of the definite lessons taught by the war was that athletics are of real military value. It was what supplied our men with the spirit that enabled them to do things which caused the German to gasp in amazement from his first encounter with them. Whenever it was necessary to put in just a little more punch in order to attain a result, our men went after it, as they did back on the old gridiron with the ball on the two-yard line, fourth down and the goal to make. This is the spirit that athletics put into every man-the Never Quit spirit, and the knowledge of this did more to beat the Kaiser than our bullets. It is common knowledge that the Army and Navy authorities were inclined to place college athletes in a preferred class as officer material. We have every reason to be proud of the war records of our athletes. Wisconsin has given freely of her best men in every sport and during this period we have carried on the athletic program and have tried to uphold the honor,of thc school in these sports. College athletics have passed successfully through this critical period and now is the opportune time to make improvements. We should not quietly drift back into the old channels but should take the new impetus given to sport to carry on on a broader basis than in the past. We should realize that this whole question is simply one phase of education and that a definite place should be arranged for it in the program of every student, Athletics are an essential part oi the education of every college man and the right sort of athletic training will go a long way toward building up a rugged and endur- ing citizenship, aroused to a proper appreciation of the imporla Tom E. jones iiiiiiiiniiiiiiiiniiiiiiuiiiiiiuiiiiiiiiiiiiiiiiiuiiiiiiiiiiiiiiiiiiiiiiiiii i mm iiiiiiiiiiiiiuiimiiiiiiiiiiiiiiiiiuiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiwi iuiii i ii ii iii iuiiiiiiii i in i ii iiiini i i i i ii i i iiniiiii ii i ii ii ii i imiii iiiiii iiiiiiiiiiiiiimiiitmiiiiiiimi miuiimiiiiiiiiiiii iii t ii i i ii ii in ii ii ii ii in I l r Page195 iiiiimiiii iiiiiiiiii gw.mm.nmmuwm gg 2............,... nwmummmnuummmunumm HERERIILI1.ummmuff?HIWRIIRZ-ZRZNREZHim.131iR1.n..u.n..... W. if. 9 L E6 59 il 2 , !'1 w 1 N ummmuvnmummmmmuummnmnuwnmnmunmmnunnmmmnmmunvmyummmunnummmummummmmmunumuInInnmummmmmvnmlinmyuvummmmmm-mnumnmummummmmmnmmmmmmummunnunuununmmvuwunummmnumummmmmmmuvummwummwnummmmmmunnmmnmmmnumuvxAuun11Au1u1n111Inx1mvnuvu1mumnumnmmmmmng lm.mmwwinmvummmm.w.wummmmmm1..m.mm-1..mum..W..ummm..ml...m.m.m....-.mm,.m..,..m.m.m...y..v...w.uw..m.1..,...mv.1.mm..v...m,......,..m.,..m.mm-1.W-m..mm.,I-m.m..m.my-1..,...H.H..-mH....,....m1.m.m.vWU.imW1.MLMnhinV..Q11i5'II511I11ELRJ1I5'li511I1111iiiRIHQQHIRZHQHEHEGIRSHWGLW.IIQZESZZZIRIITQEE .M,, U.,,7,v.nQ7Z 5 1ILumnnwmnmnmnunnmum Euinmhl.11..I11IIvR11?iR1??11?I1E111?R1iv , ,,,.. , .- 12111Slit21:L511111215:2L151t2:I111211:22it5n1:tt:2tt25Lt121211511L212511:5it21:2211tut5511251Eit512212::11L!1t:!1:'1Lt'11t'L2 : ' v'11 ' ' ' 'H'H 'H H' H'- 1 - W-1 1----M-'l--1'--W---v ununmvummnuwlvwnunumvnumummmyuvmymvmynummyNnu1uv1an1Inannn1InmmmuuunmmmmumummnuuvulwummmummmmvnvmvnumulMillillMN?lli13il1il?li?11li P a g e I 9 6 .mm1.mmminlmmmmu.m..1..v I. 1 K. 1.. .H mmymymmmy.mmnmmummu if 332 gf: H..,..,, 1 ,.Hm...,..,...,...,..,..,mm.,.HH.,um.,,.mmW...,.H,.mm............,, K..,. ..,.H,..X..w..1..,,.Hi..x..u.,,..v...,..,,.,,..,. ..1.K .W....,.N-M..m.,mwww55ww.m.1..15 .w..,......,H.,my.HW.H...1W.mm...ml.mm1m...umH.-...my...mum...mmw.,....,...,.4 ....-..1..-.1...1II.1.I...1.......m.,.m.,r ...x.m......1 m1lv?1ih1Z11nXIQ?11511Qlli?513HERB?RRM1QR1l3113?1iih.mvummmmmm 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111g ETE11111111111111111 111111 1111111111111111111111111 111 1 1 1 1 11111 1 1 111111 1 11111111111111111111111111111111111111111111111111111111111111 111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 111111111 111 111111111 1111111111111111 111 111111111111111111 11 1111111111111111111111111111111111111111111111111111111111111111 z The Athletic Board Q2 Hanson Mann Pease Spangler Elsom Nuzum Bauer XVoodward ' Ramsey Duncan Officers E: KING G. WooDwARD .... , Presidenz jj: ANTHONY G. ZULFER . Vice-President 212 CARL P. BAUER . . Vice-Presidenz S. LLEWELLYN SPENCLER . . Secretary Personnel XV Men Nan Men BERTHOLD C. MANN , . Football . . . WILLARD R. DUNCAN CARL P. BAUER , , . Basketball . . HARLOW H. PEASE ROBERT M, SUTTON . . . Baseball . . . S. LLEWELLYN SPENGLER ' MAURICE M. HANSON . . Track . . . . HSEUH H. HSIEH . . Cross-Country . . RONALD W.RAMSEY . . lVlinorSDOrtS BERNARDO W. ELSOM KING C1. WOODWARD 557142 Athletic Council JAMES FRANCIS PYRE . . . Presidenz THOMAS EDWARD JONES . . . Chairman SCOTT HOLLAND GOODNIGHT OTTO I.. KOWALKE CHARLES HENRY BUNTINC HALSTEN JOSEPH THORKELSON EDXVARD J. MCEACHRON IQING GRIER XNOODNVARD , tb . I - .1 - - js ,.1vv,j,: 5 -, 1 1. Q1 . . 123' . QD, I ..: Q' . r' S.-fs? in I 'V I A V , , X xx 1 : ' 'ALa11y Hall P 111111155 a EEE SSE if si: EEE :ig EE :ls E35 Eli iii is 1 4 if: 11 1 11111 111 1 1 1 111 11 1 111 11111111111111111 111 11111 111 1 1 111111111 111111111111111111111111111 11 1 11111 1 1 11 1r - 11111111 11111 1111 111 1111 111111111 11111111 1111 1111111 ,S111111111111 111111111 11111 1 1 1111 1 1 111111111 -1,., ,,.., ,..,..,,. 1 ,, ..,......., S .......,.....,,,.....,......,.... - ..,.,...,... u11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111 1111111111111111111 11111111111111111 1 11111111 111111111111111 111f Page 197 Elie Intercollegiate Conference Medal The lntercollegiate Conference Medal is awarded annually at each of the ten schools composing the Western Intercollegiate Athletic Association to the graduating student who has shown himself to be the best scholar-athlete of his class. The selection is made by the faculty and athletic council. The medal, of gold, was designed by Dr. Tait MacKenzie, of the University of Pennsyl- vania. lt was innovated in 1915. ' 1, 'fy .s:-.S 1 li - Tse ig: N , .. M... 1, -' -Q-iw . . 'i . 1, V ,l:,,f,,. , .AW- f6sa 1f5-W . H 5 V bf flffia ' . vi- -.X 1 Q ,. . I I . , 1 0 4 V -N S' z a . , Q, J Kennedy . f 1g,33 ', . -S as-1. .. wr f 1 M ,,,,, Mi... ,, V 'fl ' 'V 'f lv? .i i iff' V, if Burke 4 Martin Tom Kennedy was the first Wisconsin man to receive the medal. lt was presented to him the year of his grad- uation, in 1915, in recognition of his ser- vice on three 'varsity crews and on two 'varsity football squads, in conjunction with the scholastic average of 85.4 that he maintained for four years. Dow l-larvey, holder of the Wisconsin record for the hall-mile run, was pre- sented with the emblem in 1916, 1-le won three NV's in track, captaining the team his senior year, and one W in cross country. 1-lis average for four years of scholastic work was 91.1. Mead Burke, who won three NV's as a hurdler on the 'varsity track team, re- ceived the award in 1917, 1-lis scholastic average was 87.6. Burke holds the 'var- sity indoor record for the 40 yard high hurdles. Eber Simpson, Wisconsin's greatest all- round athlete, was the last recipient of the medal, being awarded it in 1918. 1-lis record of winning seven W's in three sports, added to an average of 84, gained him the honor. Eber played quarter and half on three 'varsity football teams, guard and forward on two 'varsity basketball tives, and filled in at nearly every position on the'varsity baseball team for two seasons. Wi. H-i..ii..,..i..,i.-1. .Hi..ii..ini.,i...i.ii.il.iimi.Hinim..,i..i..i..i.i..i.. P a g e I 9 8 ig . tt., fi .- fm 5 ::- - 'i 211 S- i 3237 W 1 l XE? tg 511 1 '2- 1 ll S' Q Harvey 1 f lesxmpscfu . W:-:-., an of wisaeffwx V 1, 4 agent, Q mms 15 f ,vm f f Q, 4:- ' 1 Simpson .iinim V ..,i.ii.1,w..i... .11-ui. 1 nmmmum in u u in n mmm P OOTBALL EAM Ojicers BERTHOLD C. MANN . . Captain CLARENCE F. HANSON . Manager GUY S. LOWMAN . . . . Coach THOMAS E. JONES . Assistant Coach HAROLD P. VALICHN . Assistant Coach MAURICE A. IQENT . Assistant Coach Personnel BERTI-IOLD C.MANN, W-Left Tackle WALLACE A. BARR, W-Quarter Back JAMES P. DONACHEY, W-Right Tackle WESLEY S. LEAPER, W-Right End JAMES L. BRADER, W-Left End MARTIN P. BELOW, W-Left Guard ROMAN I-I. BRUMM, W-Center WILLIAM K. COLLINS, W-Right Half Back GUISERD M. SUNDT, W-Full Back FRED K. SMITH, W-Left Half Back EDISON I-I. USHER, W-Left Half Back HARRY A. MARCOLES, W-Right Guard WALTER KUEHN, aWa-Right Half Back LYLAS P. KLUG, aWa-Full Back ELDRED J. ELLINCSON, aWa-Left Guard ROLAND C. SPRINKMAN, aWa-Right I-lalf Back OSCAR A. EKLUND, aWa-Right Tackle RICI-IARDJ. XVHITE, aWa-Left Half Back Season in Scores Wisconsin . Q 0 Camp Grant . 7 Wisconsin . . 21 Beloit . . 0 Wisconsin . . O Illinois . . 23 NVisconSin . . O Minnesota O Wisconsin . 14 Ohio State . . 3 Wisconsin . . 7 Michigan Aggies . O Total Points Wisconsin . . 42 Opponents . . 45 u.w.I..WtI..mII. I..I.IWIw.Ii--i..ii.wI IIIIIIIIIIIIItII-IIIIIIIIVIIIIIIIIIIIIIitIIIIIIIIuiIvimiiimmmiiiii Page 200 1 u i i The 1918 Varsity Team Carter Vaughn Klug Eklund White Ellingson Kent Hanson Jones Kuehri Barr Sundt Collins Smith Usher Lowman Leaper Donaghey Below Mann Margoles Brumm Brader The Coaching Stay? Wisconsins coaching staff, disrupted at the very outset of the season by a war demand which took Head Coach -john Richards to Washington and out of football for 1918, at times assumed the proportions of that record staff of 1916, when Dr. Withington, introducing the Harvard sys- tem here, had as assistants King, Soucy and Dougherty, who came with him from the East, and Buck, Mucks, and Driver, Wisconsin men. Vxfhen Coach Richards left for war work, the responsibility for the team's showing fell upon Guy Lowman, basketball coach and aide to Richards on the gridiron in 1917. Lowman was assisted during the season by Peewee Vaughn, a member of former 'varsity football squads, Tom jones, who had handled the freshman elevens for several years, and Maurice Kent, the latest acquisition to the Wisconsin physical education staff, who came from Iowa, where he had special- ized in coaching baseball. nvy rr af Arqm.,-'r 5 3 , I 'fa1?,g,:i5 A ' A 1 may I A .gy ga, f: ,V we-1 ,Qi 1 , 2 it P Ns ! f 7 4 1 '2 Q f Peewee Vaughn Assistant Coach Guy S. Loxvman 1-lead Coach i,.i..ii1.ii.1iini.1iK.ii.ii.iw.ii.ii.m.,iii mmiimiiiimiiimiiiiiiiiiiiiiiiiiiiiiiimiiiw ii Page 201 gg 0' 1 'Y' 1 NW J f ., ,, ff 91 4 ? Nl' X 4 ff 4 ' f g v , 4 1 14 tae' 'Y' 4 ew , f P? 141 I 'vc' Af X5 5 2 1,3 f 1 4 1 fa? I f ,f A an mx: ea, :X ,. ,. PM ?4'yf ' ,f 4 15,1 ,,., 3,5 , wage ' , M 1 4 0 rv ,W 6 K I 1 1 arf, ,K A 1 if 4' Q9 ' 4453, w -4 K 4916 4- I Z '5 Lieut. Tom Jones Assistant Coach J' ...,..,,. VF Smith Mann CCaptainJ Collins The 1918 Season - By Harold Gill '20 The 1918 football season at Wisconsin? Well, to begin with, let me paraphrase by saying It was not a success-and it was a success. Under the microscope which reveals only cold, glaring figures, and which is applied by the uninitiated public, including, unfortunately, some of the students here, Wisconsin's conference record for the past season was certainly not what might be expected, in the usual order of things, of a school which has always maintained a ranking in football on a par with Chicago and Minnesota as makers of gridiron history in the middle west. Based upon unfeeling figures, it was a failure, for the 1918 Badger eleven Finished in fifth place in the Big Ten. Won only one of the three conference games played. Won only three of the six games played all season. Scored a total of only 42 points, as against 45 by opponents. To those who have followed conference athletics for any length of tirne, however, with an eye to more than the material things, the record spells success. For such persons know that, out of absolutely the worst football material in the history of the school and under conditions which had never been even approximated before, an eleven was pieced together that on the closing day of the season might have given any team in the conference a battle for top honors. Words are too inadequate to describe the mess which prevailed at Wisconsin when the First call was issued for football candidates. A man versed in all the tragic lore of history, equipped with eloquence that might rival the Blind Master, is needed to tell of the disastrous conditions which attained. There never was a time since the first Wisconsin team stepped onto a football field, back in 1883, when prospects were so hopeless. Consider! Barr Getting Away for an End Run 1iiiiiii.iiini.4i-iiiniiiiiiiiiii.iiii.ii.mw.ii.iiiii.. iiiiiiiiinimiiiiiniiiiiiiiniiniiiiiiiiiiiiniiiiiiiiiiiiiiiiiniiiiiii Page 202 Ali' t, 4 v -1 L' I Q2 . 1 fi hi hifi : ' T J ' .9 1 41. 1 . ,PQ W1 , f 1 -f - v M2ifg0lCS Sundt Below There was not one football man in school, not one veteran, for the first time in history. There was one of the smallest squads of candidates ever known here, with freshmen, raw, unschooled frosh, outnumbering the others three to one. And from this squad was picked a team, composed almost entirely of first-year men, men new to conference football, a team which step by step, despite innumerable obstacles, was molded into a fighting, talented eleven that won its last two games in a decisive manner and finished the schedule with a burst of speed indicative of class, the culmination of two months of as rapid progress as was ever made by any team, I wonder if you fully realize just what it means not to have even one man back from the eleven of the year previous. Such a thing had never happened at Wisconsin until last fall. Such a thing will probably never happen again. Such a thing had never been even dreamed of. It meant. that the coaches were without a man who knew the Wisconsin style of play, without a man who had had undergone his baptism of fire in conference football. lt meant that there was not a veteran to build with. Carpenter, Scott, Weston, Gould, Davey, Kieckhefer, Sivyer, Bondi, jacobi, Keyes, Olson Mueller-all of whom had seen Big Ten service in 1917-LOST, not one back in school. And the coaches had been counting on having nearly every man of them back! Remained only Mann, substitute tackle on the l9l7 squad. As he was the only member of that aggregation back, he was chosen captain, and the coaches, regarding their pre-season plans sorrowfully, discarded them with a sigh and plunged whole-heartedly into the work of making an eleven out of the disheartening material afforded them. The material alone was enough to drive any coach crazy, but when obstacles began to pile up daily with the start of practice it is astonishing that the Mendota asylum did not claim a batch of recruits from Camp Randall. 1 Stopping an Illinois Drive Through Center 1.mirinrummnuInInummmn.rmwmm.u.r mmm. 'JLWMLEH .nu.i::!:w55l5:25:E-55 425553392 I 1minimummminrurummumwwmmumn Page 203 nu u r 4 in iiniuximiiiliviiiixiir urn ii v 1 im urn mum: is immuuni num ii n nun :ini ii nun n l in i i iv I ri I ni in , ui ,Sy i f em I 59? it fn Brumm Barr Usher ln the first place, the start of practice was delayed more than a week by the slowness with which candidates appeared. As stated before, they were, in the main freshmen and it was some time before they had adjusted themselves to university conditions, had arranged schedules, and had performed the many little duties incumbent upon entering college. In the meanwhile, a few candidates worked cut daily, waiting for more to show up. Then came delay while arrangements were made to permit candidates, all of whom were S. A. ' ' ' ' ' T. C. men, to practice, delay consequent with rearranging of drill hours, class periods, and the like. Sliding over these obstacles to practice, mountainous in themselves, we come to the season proper. The first games, with Ripon and Beloit, were postponed because of the flu, Whatever advantage of more time for preparation was derived frcm these postponments however was ff b d 1 ' o -set y e ay in conditioning caused by slowing-up of the practice as a result of the effects of the epidemic here. Then another blow descended on the Cardinal camp. Coach john Richards was called to Washington on a war mission which kept him away from the game for the rest of the season. I-Iurried efforts to get another gridiron coach failed, and Coach Lowman, who had been rendering capable assistance to Richards, was given the job, Finally, a date was arranged for the Beloit game, but the contest with Ripon was definitely cancelled, leaving the Badger coaches with the ''between-the-devil-and-the-deep-sea'' choice of sending an inexperienced eleven into its initial conference game with only one practice game under its belt or of scheduling the strong Ca mp Grant team for the first game. Camp Grant Forced to Punt s .ii.iii.1i.Hi.ii,iii.1i..iini..i..ii.w.wm.w.ii s I 1 u ii i , , , , i mm iiiiiilillii1lHEI?lilliilFiiiiiiiiii!iiiiiiiiiiiiiiiiwwi Page 204 mwiummmuumum is uviminm ini mmnu nun I r , Ellingson Leaper Eklund Deciding that at least two practice games were necessary, Camp Grant was invited here for the opening encounter, and the husky soldier eleven was returned victor, on a lucky touchdown resulting from an intercepted pass, by the score of 7 to 0. Beloit came next and Wisconsin chalked up a win, 21 to O, showing considerable improvement over the work of the Saturday previous. To the initiated, the playing ofthe Badgers in these contests was worthy enough to exempt them from much criticism, l:ut to the fans, accustomed to seeing Cardinal elevens score 50 point victories in pre-conference games, the outlook for the season was certainly discouraging, Then followed the hrst conference game of the season, against Illinois, at Camp Randall. Illinois had veterans. Wisconsin had none. That tells the story. Illinois won, 23 to O, but two of its touchdowns were the result of lucky recoveries of fumbles. Wisconsin threatened to score several times, but the punch in the backline was lacking. The Badger showing, against a team which later was accorded premier honors in the Big Ten, was all that might have been expected. A second defeat, at the hands of Minnesota at Minneapolis, sent the Wisconsin hopes lower, but honors accrued to the Cardinal eleven because of its great stand against the Northmen. Stubborn resistance throughout the game, with a desperate defense checking the Gopher marches under the goal-posts on several occasions, confirmed the prowess of the Wisconsin line. The offense was still weak, however, and inexperience spoiled several chances which might have led to scores. A 40-yard forward pass in the last quarter gave Minnesota its only touchdown and earned a 6 to O victory. Vxfisconsin stopped the Gophers four times inside the IO yard line. S- Smith Gains on the Scrubs 2 i wmv imimiimmiiiiii Qiwgufgww 4 I iiifiinilimiiiininiiniiiiiniiiiininimmiimiwwm rr Page 201' 1 N' ,fx . - .s :L A f -2 N42 , 9 iff':1 -xiii, R . .41 ..,-. 1 Wt 9 1 1 Brader Donaghey Kuehn The first Wisconsin win came against Ohio State the following Saturday, at Columbus, a strengthened backfield ripping through the enemy forwards for long gains and turning in a 14 to 3 ' ' ' S me to scoring was in the victory. The line continued its stellar work and the closest tate ca ' ' d on a field goal from the 25-yard line when the second quarter, when three points were registere Badger wall stopped further advances. The final contest of the season, against the Mic igan gri Thanksgiving day, was a stubborn battle, which was won by Wisconsin in the last few minutes of play, 7 to 6. The Badgers fought an up-hill game all the way, on a field that was covered with several inches of soft snow. The ball was so wet that it was almost impossible to handle, and one of the Cardinal teams best stratagems, the forward pass, was useless. On its playing in the Hnal pair of games, Wisconsin was entitled to ranking among the leaders. lt is doubtful whether Illinois could have repeated its victory had another game been played fol- lowing the contest with the Aggies. The team had found itself, had acquired confidence in its ability, and, greatest of all factors, the offense had become formidable. With not a man of the team lost by graduation, and a dozen or more men of other seasons expected back from service, one of the greatest elevens in history seems assured. True, ' ' h 'f not more, than at Wis- all the other schools will have an unusual wealth of material, as muc , 1 ' ' ' ' ' it that never admits defeat will do the rest. consln, but, given the men, the old Wisconsin spir Coach john Richards, who was called away for special war work hardly before he had started work with the eleven, will probably be back on the job, ready to pick up the loose ends and start a winning regime which should extend far into the years and place Vxfisconsin again on top in western conference gridiron records. h A 'cultural College eleven here on Smith Makes First Down Over Center 1 11111111 11 11111111 1 11 1 1 111111111111111111111111 1111111111111111111111 1 1 1 1 1 1 1 11 11111111111 11 11 111 11 111111111111111111.1111111111 1 11 11111111111111111111111 1111111111111111111111111111111 111111 1111111111111111111111 Page 206 EE 5 555 3 gnffmummuvlmlmwmlu1nlrmnnInwmwuvwvuwInmwnwwnwlnwInwInuvwmyInwuwnnwanwm1uwunwInlInmlnuynmwInwuwmwmwulwuwm1fnfuwwInmwInwulmwIn1mwn1nnwmwInwnlmwmwInruwvulInwInwnnmwnnllnlnlvmruwInwullnllnwullInlmwIHfulanlvurulwuwruluwlInlulmwmlInwInwvuwInmywuwmlVuwruwluw11mlmmmmmmn1uwmlInwIn1Inm1luvu1vulnlw1nmmlmmlmmmfm1ullullulIn1Inml1IHmwinlulvu1vu1lmmmmmmnmmfmnmmmmmmmummmuwmmuuf 5 551fiwhmnlhlliil1myvumH.Hmm11.illu1ln1Inm1m1ynm1V..lIn1.M1.11.U1.11vi..Inlm?In11.1.H1-Hlu1mlInlu1yu1-if1.iv1Hlm1ll1ll.1vi.1iulmm1H4lnl1I.1In1J.1ll11H1vu1In1-1,1ii1V..1ul1.I1lHWInwm1.Hll.11In.U1,H1.Hl1.1N.1H.mmmlmmml.11.Myu1H4l.HlI-Nlu1ll.1In1I.11.IlN-Illn1-.11ului,W1ul1I.l1U11H11HlW1ulmlUi1Lil1m1lnI,LFi.lJn1imInV2.1di1hiQH1156lidhi1IZAlil1QLlll?Pill5211dl1MilliiilMillIll?F-11Pill511311F711QiiGil?Fiiiiiliii1iii1illFill1Q21EillFil1FilU511275227Eliililliiilliiiiiig :zz 1 5: ' S55 Illinois Fumbles Near Goal Line j355w.m-1,Inummn..lmmf..nmmmlW.W...W..H.Wmum.H.Wm.H...vm.....,......,,mm...lw...,.m...,..,.Wyn,...umM...K.,Wmmy...Ml.N.umf..1Wm...m,..,...,..m........,my..,T,1l..,.m2wwEmmmMTH...mm....15ww5.2Emwy2ET...m,lm.....mlwm...,2y.H,.,,...,.w.....1Wmm.,..ly.,.m...mm....,,,y..n.u.wwmm..mm,......M.m.m..mun-...n:.......f...1...a is :umlmwanwummmunnnnnwlnwmwluunvulInMHETHMEHIREEREIHIREEMIREYEFEGWuvMGEEESEIEMEERE-nnmwHFEGHEIMluuilmuimnnuluummmmmmulnunumnulmmmnnmlummmmmnllnuulmmlmwnwnnInunmumnmlmm.unmmm'lmmllmmmmmmmmmlvuumunuuummlummmunmnnmuumummmmumnumummm111nmunumnumfmnmummmunmwmuuumnummmnmummmumnuwmu . Page 207 QE gi 5 M u 1 Why We QDidn't Win the Championship Next Fall-Oh Boy! Often, in the intoxication of unrestrained imagining, we've wondered how it would seem to watch some of the gridiron immortals back at Camp Randall. ln wild day-dreams we've been thrilled time after time by conjuring visions of Keckie Moll booting one over from 40 yards out, of Vanderboom crashing over centerg of Butts Butler smearing a play, of Coots Cunningham barking his signalsg of Biddy Rogers weaving through the interference and bringing down the runner, of A1 Tandberg striving for six inches and a touchdown. Now those fond imaginings seem about to become actualities, for when the early rays of the next September sun slant down on the white-lined Field at Camp Randall theres going to be a bunch of wonder-workers of other days back, Oh, boy! what a team were going to have! Imagine four Wisconsin captains playing on the same team. They'1l be there-Paulie Meyers, leader ofthe 1916 squadg Chuck Carpenter, captain-elect for last fall, Mann, captain last season, and Sundt, captain-elect for 1919. And-sweet patootie!-with them will be Davey, backheld Hash, and Kieclchefer, Scott, and Sivyer, linemen, all of of the 1917 eleven, who chose to smash the l-lindenburg line in preference to disrupting those of Wilce, Stagg and Williams. And-Doc, the smelling salts !-we'1l have from that same 1917 aggregation of pig-skin artists Bondi, jacobi, Stark, and Could, all backline stars, and Weston and Olson, performers in the for- ward wall, all of whom have been in service and have just been discharged from camps in this country. And when they take the turf next fall- When four captains are battling on the same team- When men are sitting on the sidelines or composing the third team because there are better men on the squad- IVIAY WE BE THERE TO SEE! iiiiiiiiiimiiiiii1iiiiiiiiiiiiiiiiiiiiiliiiiiiiiiimiiiiiliiili H H -1 -ummm Page 208 IE LLTE6M I Dec. Dec. Dec. jan. jan. jan. -Ian. Feb. Feb. Feb. Feb. Feb. Mar Mar. Mar Mar. GUY S. LOWMAN ANTHONY G. ZULFER ANTHONY G. ZULFER . HAROLD G. KNAPP . . CARL P. BAUER . . . RoscoE L. McINTosH . WILLIS M. FANNING . I-IARLOW H. PEASE . MILLARD M. BARLONV . FRANK L. WESTON . . ROY J. SCHNEIDER . Ojicers Personnel . W . . W . . W . . W . . aNVa . . W . . W . . W . . aWa The Season in Scores 27-Wisconsin . 28-Great Lakes . 3 0-Wisconsin . . 4-Great Lakes . 1 I-Northwestern . 18-Minnesota . . 25-Illinois . . I-Chicago . I 0-Wisconsin . . 15-Illinois . . . 23-Northwestern . 24-Wisconsin . . 1-Minnesota . 8-Wisconsin . I0-Iowa . . I5-Indiana . I6 43 39 I4 20 38 25 . 24 . 28 . 16 . 32 . 29 . Z3 . 25 . 29 22 Camp Grant Wisconsin . Coach Captain Left Forward Left Forward Right Forward Right Forward . Center Left Guard Left Guard Right Guard Right Guard Milxvaukee Normal . Wisconsin Wisconsin Wisconsin Wisconsin Wisconsin Iowa . . NVisconsin Wisconsin Indiana . Wisconsin Chicago . NVisconsin Wisconsin Conference Standings Minnesota , Chicago . Northwestern . Michigan Illinois Purdue . Iowa . Indiana . Ohio . Wisconsin . III.IIIIIIIninIIIImiIIIIIIIIIIImliwimmmml IIInInInIInInIInIIIImmunmimInumIIIIIIIIIIIIIIIIIIIIIIII Page 210 Won 10 IO 6 5 5 4 4 3 2 3 Lost Pct. 0 1.000 Z .833 4 .600 4 .556 7 .417 7 .364 7 .364 6 .333 6 .250 9 .250 uinimnnniwinlinlnummlrmmmviniyuvmlinlinlnlinlinlulniwIif1ui1nlmyummnimiuvwrniinmimwmiinwui1inmyrn1uvwin1uirmmvuv1ui1vu1u1nllnilrulinininvnninllminwni1uiruwinwmluiwuwinww1in1inwulmiimnn1ui1inin11nimiinmym1vuwannnin1m11munnvllvummiuifmilullulinlinmmmvummmuummm n r . ., .,lK.,1l..lH1lllW1.HlH.1..lH.1ni1.HmilK..H.1H.lml.H1...1.HWmylW1H.l.Hmlmlmy.Win1K..1N.V..1V.,1llW1..1my1..1K..lK..1ml.,,..,l.,,..,,..l..m 1 5 2 The Cl eam 1 E 1 gee 'Se Higbie Schneider lviclntosh Fanning Barlow Lowman Pease Bauer Zulfer Knapp Weston 1 5 Team fRec0rds 1 Wan 3 Games, Lost 9 Total Points Scored . 230 Opponents' Points Scored . 279 Free Throws Made . 40 Free Throws Missed . . 43 Personal Fouls Made . 61 Technical Fouls Made Z2 Field Goals Scored . 95 ' if Indlvldual CRQCOMS 1 le fee Ota Player Award Goals Throws Points 'X ' ffl I f - Knapp W 18 0 36 Mc Intosh W 19 1 39 3 : Weston . W 12 0 24 Bauer . W 7 2 lo Pease . W 7 0 14 Farming . aWa 4 0 8 Barlow W 3 0 6 Schneider aWa 1 0 2 13 f 1 Lowman Kent anmunmmmumminiunumminimm.numuninmuulininmumummmmmvinvminmuminmummmunumlininmmimiinlumimlminmlminimm1Himl'ENGINEluinlinlmlmmllvlinunmmlminmiMilli.iihill:himilliimiliihiiill1ininin.mlmuiin1il1inlminmimiinmluimlHIEEEIGIIEIEIMWW.mmlnilmmmmlliniminimlimliiil-IMEESSI5EiimTRmmmmiMiiiE.ummmmmmmuumlmlmlnnfmmnmm mum-mme Page Zll if K+ x - J ,,:,, ff ' ' 5 V 1 -1 ....f. f . ,.-l iw 121 -931 ' Bauer 1 f W2 fr 71, If 41 Wm? N, 5, f W X , ,, , iff f 'KX f 71 K 1 J ,X Ju iff ,f ,, 1 4 fi gf f ff' - I , f s F f iw af f f , Q, 4 ff X ,fff f If Jw, f ,f ' 'A ua, , v , , lf , f 1 I L if H 1 f i Ni a 5,1 L if ,, as as I iimi1.Immmiimwiww miiwuwmmm fi x Gif! . x A SL. . , 1 Captain Zulfer Weston The 1 918-1 9 Season It was the most disastrous season in history for a NVisconsin basketball team-a season char- acterized by the most inconsistent performances in years, a season which ended with Vwfisconsin in last place, after a brilliant record extending over seven years, in which time five western cham- pionships had been attained and during which no Wisconsin team ever fell below third place. Much of the liability for failure may be accredited to lack of material. XVhen the season opened, there was not a regular back from the championship 1917-18 quintet. Chandler, Brock REUIIJQ, WA' 1 :sd Barlow M X 1 5-:' . is 1. , .7511 X X . , f z 1 J ' ' AI Y' -:Q . ,ft 1 ,i i E i l 1 if., ,5 -T ,.,, ,fav and Simpson had been lost by graduation,Captain-Elect Zulf- er was at Great Lakes, and Swinsen and Maisel were not in school. Knapp, with Bauer, the only substitute of last year's team to win his was in service. Of the four aWa men of the 1917-18 squad, Fladoes and Birch were in service. Thus Coach Lowman had only this scanty experienced material to start with: Bauer and Spengler, substitute forwards, and Pease, substitute guard. From the freshman team of the year previous he recruited Fanning, center, Mclntosh, forward, and Barlow and Schneider, guards. ' Captain Zulfer, Knapp, and Vxfeston bolstered the team when they were discharged from service and reentered school, but much of the value of their return was lost because of their coming back at different times. Until past the middle of the season, Wisconsin was unable to put upon the floor ateam which had played as a unit in any previous game. 'Injuries to Bauer and Barlow added to the spirit of .mminiuinrvuiminin1ininmwmmnmunm i i 1 ummmnuumnunummmnmwwu-mum' - ml viiniiiI5iMMGEFEGEIIIYIIMHIIIIEFEPEIEIEIIFYINIH ' ' in i u v munummnwmmmimmiumn Page 212 ummimmm vim-mlm. , , ,, i v inimnummmmm-mnin ,, , y , Q ii yslllllfg r .Eel A Hg 3 Pease Captain-Elect Knapp le 5, 'Cf' -. - .40 iv f 32,1 X ' ,N , , gl, V ,q Maclntosh uncertainty that was in the Badger camp at all times, and the chance that Zulfer would be called back to Great Lakes was always present. As to the season proper, the performances of the Wisconsin team would have forced the might iest intellect in the universe to admit his inability to explain them. The Badgers reversed the usual thing and played their best away from home, they defeated Chicago Cand the lvlaroons had a title-claiming fivej at Chicago, they lost to lndiana, the weak- est team in the race, here, suffering a most humiliating trimming in the final game of the season. Again, when the Wisconsin Squad was in probably the worst shape of the year, lowa was defeated easily, 28 to 19, and Illinois was outplayed, even though the Badgers lost, 14 to 16. This was at the period when a last-minute shift in the lineup was required because of an injury to Bauer. The team looked good. Then came the next to last game of the season, just after Wisconsin had played its best basketball of the ,year and had beaten Chicago-and lowa won, Z9 to 27. Perhaps it is best to forget the past season and look ahead. Of the l919 team, only one man, Bauer, will be lost. Captain Zulfer, lvlclntosh, Fanning, Knapp, Pease, NVeston, and Barlow will all be back. And with them, we hope, there will be this winter a host of former stars, among them George Carl- .if son, captain-elect for 1916-17, Paulie Meyers, Maisel, Swinsen, Fladoes, and l-lemming. my Fanning N ..,,.,.,.,,,,,..,... ,.,....i H .M ..,..,.. , ,...i,..,.. .. ..,.,,,..,,, . , W 1 in in i 1 mi T A an mm unMiiiiii'5iiiZiiiiillm:nu uuuiiiHiiilliiiiiiililllllililiilliliillliiliiiiiliiliii in n I Page 213 :mmmmmmumummnmmznmumiinimianinimvvuumimmmmnmmmw in wunmrm num umm nm ii ii u mmnnmmmnnmiimiuiruinisuiniiniuiuinmunmiuminiuiuiminiiuiimviuiminiimummimumumuuummmm nm nunmmnuimuixv1iniimvvviwmiiiiimmmmm mivmmwmmumuiininiinunnunmmmumnuirnnumiinmiumuummmnuimunmiummmumummmmnmmnmnnL THE WINNERS Fifteenth-Annual Turkey Race E November 27, 1918 I-IESTER WADE, first . FINN AANESEN, second IRVING K. KROHN, third . ALBERT J. KNOLLIN, fourth , RAYMOND A. SWITZER, last , Distance-1 M miles Live Turkey Live Goose Live Duck Live Chicken One Egg Time of Winner-6 minutes, IO seconds The Sta rt R The Finish mi i ii ii ii in ii mm mn mm i mlm i i ii i i iii nn im i mm in H iiiiiiiiiiiiiiiFiliiliHXiNiiliiiiiiiiliiiiiiiiiiiiiimmm nn: Page 214 i ii mi ui nmimmu ui iiiiiiiiuiv nun mmiiniuiimiimn u in in nu ii mm ............. .. . . .. ....... .... ......... . .... . . ... .. .. ..... .. . .. . . .. . . . .. . . .. .......... .....L...M.... ..... . .. .M ...................... Ti'T1rTWr a msr .mmn.:na..r..1:naiz:................ ........... . .. . ............ ............... . .. ..................................................................................................................... ............... ........................ .. . . . ............................................... .. .... ..... ...................... T118 1 91 8 CPOSSTCEOUTZU' V Team Ramsay Loomis Brothers Manager Hammond Burr Captain Elsom Coach Bresnahan Oficers BERNARDO W. ELSOM . . , . Captain LORING T. HAMMOND . Manager GEORGE BRESNAHAN ..... . Coach Personnel BERNARDOCW. ELSOM, W PORTER L. LOOMIS, W WVAYNE RAMSAY, W ALLEN BURR, W WVELLINGTON BROTHERS, W Season in Scores Wisconsin-Chicago Dual ...... XViscOnsin, 235 Chicago, 32 Triangular Meet . . . . Wisconsin, 24g Minnesota, 353 Ames, 64 . . .sy f -w m eiw 4 Vfi.. 'vez-,J -.: .xr 3 .fi X. T i :Qt' T,J,.'c'V,. S ' ' ff, Wg.. ,y ,- , , 2 - ' ,. , 5-1 . N A, ,.4,. ,..,: M ff: fr- fc., R. ,. 1 ..- fi' ,, ,Ar' - .:,f.:.:fe 3 . .-Q.-. , T' sie 3 TQ. . ,.,,,,f .. ,U . km. . -4 -. R 3, , . 5.3. ,. iw 'L . 2 R' ' . 4 - ew . - g. .- - 'f xy ' H2 f , we , . R -- -.., .. , ., 1 1 ., ., 1 .f. 2 M , , ,. -, 22: ,-Ra g .. .Jim 1r, 4k.- kg' 1- , T 1 7 . Coach Bresnahan gfgyggvvggmilvingggigigw-M ........5Lg:,.!M.JWM ..... .............. . ...... . .... .. .... lm., .. .................. ................................................................... ...yi .WMLnlguimgmwww.Lv.................................................................................y..........5w..m.3........................ 1. um .. ...LH . ...... ........... ....... .M ............ . ..... ... .. .... .. .. . ..... .. .................. . ..... . ......... ......................... ...... ... .. ............ .. .................................................................W................................... ....... ........................... . Page 216 uimmimiiilmiimiuwi iii iii will in ii i ii iii i u ii iii i i i i in ii ii ii i i iwiii i iiii ii limi ii viii in i ii i i 'ini ii win gggzzanaxzzwmii iwW.,.ii..i.. i iiiinii iii., ii ii i. i. ii H.. i. i i. i EE Eli Ei EE 5: EE :lf ' l 'li f fav 'f - EEE V gf V x f P ., -- .N E L . ., 3131 .2 e 1 fi s ei, tmnj- V hwazwl' A' Sf,-1 . ' ' . ' ' if-T W ' 1 f , 52. ' 1, '7 l i. A -- . 1 L .V A l -3, all , .fi .,- 5 . 'f ,. . Q if ' f ' . fl l 4 assi, . :I Wm i 1 - Ramsay Captain Elsom Loomis Review of the Season Although no conference meet was held, whatever titular honors accrued to the cross-country season of 1918 undoubtedly belonged to the NVisconsin harriers, who proved their claim to being the best in the west by trouncing Minnesota, Chicago and Ames soundly and winning every meet entered. Chicago was defeated in a dual meet, and Minnesota and Ames were beaten in a tri- angular meet held at the close of the season. At that, the team was minus several men who had been counted upon to be back in school and to be members of the team, Captain-elect Dayton, Crump, O'Donnell, and Dennis entering service before the start of school. Meyers, another member of the 1917 squad, was in school I but not able to ccmpete, as were Ramsey and Nash, aWa men on the same squad. 1 3 . . , . . A . . ' Elsom Finisning First in Triangular Meet i 1 ,5- 255 E55 I 5xg.,W.,,...,,,m..i..,i..mi...,..,...i.ir.imiW.ii.mmii.i..i.mim.i.wiiiiiiiiiii i iiiiiiiiii-mm ii-ii ummm iiiviwi 1 iii i ii iv gymQmwlngmig,y,Ug1HL11QQ,,,,,,,,,,,,f i 1 'H Hi,gg,,,15J,5-W,-NM--,,,,,,,,H,5ggLLgL,-MLJ,-1 I if simsr a'r ':'V 'r'w mi. iii mir., iiiiiii i.i.,.n. ri .i .i i ii i ii i .i..i...iim..N..H....,ii..i.....i,..i..i..i..i,,,,,.i,....iii , .i i i N' f Page 217 J-11111111111111111111111 1111 111111111111111111111111111111111111111111111111111111 11111111 11 111 1 1111111111111111111111111111 5-1111111111111111111111 1 1111 11 111111 111111111111111111111111111111111111111111111111111111 1111 111111111 1 1 1 1 1 1 11 11 5 9 N1 'fm ww w Z Pr W4 J ei ei 15:44 1 411 me 1 was 111- 44651. N 1: W' 1 4 , QQ.. P 'sv 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111 1111111111111111111 11111 1111 11 1 11 11 111111111111111111111111111111111111111111111111111111111111111111111111111E 11111 111111 1 1 1 11 111 1. . 11. f 'f 1 Jn . .1511 , . 12 Q:-. . , 11 1 , , 01 Q C Brothers Burr Manager Hammond The team had a good nucleus to start with, however, in- Captain Elsom and Burr, a former man in that sport. The new material showed capacity for rapid progress and interest in the sport was not affected to the extent that it suffered from lack of candidates as did football. With ten veterans, Loomis, Anderson, Ramsay, Nash, Ramsey, Crump, O'Donnell, Meyers, Dennis and Dayton, who was chosen captain for the 1918 team but who enlisted before school opened last fall, back next season, as they probably will be, the greatest team in the history of the sport should be assured. 11 11 11111 1111 Elsom Finishing at Chicago 11111 111 1 11111 1111111111111 1 1 1111 1 11 1111 111111 11111 1111111 1111111 11111111111111 1111111 1 1 1 1 1 11 1 111 11 11m 11m111MM11I-l 11111111-1M11115gg 111111111111111111111111111111111l11f1111111 1 1111111111111111 11 11 1 1 11 11 1111 111 11 1 11 11111 111111111111 11 11111111111111111111: P a g e 2 I 8 Wisconsin-Chicago 5Dual Cross Country Run CAMPI3EI.I,, Chi, First ELSOM, Wis,, Second BURR, Wis,, Third LooMIs, Wis., Fourth LONG, Chi., Fifth Chicago, Ill., November 9, 1918 The Result WVISCONSIN, 23, CI-Iicfioo, 32 The Summary WVILSON, Chi., Eleventh Course-Five Miles Time of Winner-27.'5l RAMSAY, Wis., Sixth HALL, Chi., Seventh ANDERSON, Wis., Eighth BROTHERS, Wis., Ninth LEXVIS, Chi., Tenth Triangular Cross-Country Run The Result XVISCONSIN, First . , . 24 points MINNESOTA, Second , 35 points AMES, Third . ELSOM, Wis., First WILDER, Minn, Second BURR, Wis., Third LOOMIS, Wis., Fourth MOON, Minn., Fifth RAMSAY, Wis., Sixth STONE, AMES, Seventh KINGMAN, Minn., Eighth The Summary PREITENOROSS, Ames, Seventeenth Course-Five Miles Time of Winner-27 13 315 . 64 points LYNCTFI, Minn., Ninth BROTHERS, Wis., Tenth SWANSON, Minn., Eleventh FREVERT, Ames, Twelfth SMITH, Ames, Thirteenth ANDERSON, WiS,, Fourteenth FREVERT, Ames, Fifteenth MARTIN, Minn,,'Sixteenth Ninth Annual 5Dralce Relay Carnival Des Moines, Ia., April 20, 1918 Wisconsin, unlike in other years, was entered in only one event, the two-mile relay, in which the Badger team com posed of Crump, Elsom, Ramsey, and Nash, took second place, forcing the winning Chicago team over the entire dis tance The points scored in this event gave Wisconsin a tie for sixth place in the final ranking. Chicago and Missouri divided honors at the meet, the Maroons scoring 10 points in the relays and Missouri 6 Scholz of Missouri won the special l00-yard dash. IiniiiiiiimimiiiiIiiIinmiiiiIiiiiiiiiiiiiimiiiiiiii lim IimiiiinminiiiiiiiIiiimiiiiiiiiiiiiiiiiiiiiiiiiwii Page 219 :SSE?F5iii?iiEliQIIQEZIXZQ1killHQFiiiliGi1?iiiiii?ii?iiiMilli?GIQIIRFIEIZZRiiiiiiliiilii?IillillliliiilIilliiiiiiliiiillliiliiliiiQiiKillilliillilYEIRIIIEZERillIIIRIIGIHii?iiiMIR?ill521HEREIN511iiiEiiiiillillii?EIIIIIRSIIQii?IiiliiiliilIIQYEREIQEIZ1InMill?EIIRQEIRFGQii?.ISRQIIYFIIEIJEliNEWERiiiiiiliiiliiliiiHEREINlil521H.umInmummInNHummWH-ummufX.1umm.m.wmm..1..m. mmnmmmummmmvu11Invumwmummmvu1InvuunmummummmmwI.nm1uvm1mnwummm1H.H1mpn1mm1InmmumInpnWnWvuwHwuwInwminululmnInwnvmwn1uwwu1u1un1nwuwwuwvuunuwuvuuuuum1vuunumulummmwI-wmummufmumInynIn1uluH1mwI.NInummvuinuInnluHuNnwulmumvumwuwruwI-1mwufmummfnwiflwrlvwflgg N 551M,,M.11,.,,5.,1.,3,....W.H,..,,K..Y....M...Y,M.,...U..,,,H..,,,.,WW.,,..,.,.W,W...,.,,,...,..,H.,.H...YK.,Y..Ynm.,,.,,......H.,,..H.,,X.,,...,.,,...L.,,.m.HW,,.N..,nm..H.,,..H.,W.....,,.HH.,...,.,,...,..,..,,..,,.,H.,,..H..,.,,.....,,.,.,.....,..H.,..,H.,W......H.,...H.,,.,,..,WW.UH.,.H,WK.......H,.HN..lmin,,HH.1my5,33,,,m5,15,3m S..Av..W...,H.,Y.N.WH.,K..Y...,,.HY....,.,.....n.Y..,mm.WH.,...,nm.,,.N..,Km..,Y,H..,Y...W,..,,H,..,,..Y,..Wvm..,H.,..,WK..,,.,...,..H..,,.,,y..Y...H,Yy.YH.YV.YH.may.w.:rn..m,...,..,.mmW.1.,L.....,H..L..,H....MW.H..,...,.mu,1.U.,,..,......,...,..,...W...H.,..,L..,...H.,...M.,.,.H.,...WU.,..,Um.,,...H.,WH.W1.1,.HU.,i.,,.....,,..,,..,.....H.....m. Page 220 1m1HWmm1IninwH1Inulmnmin1.1Wmm1m1.11InulumuvmyH1vmnwm1m1nmnulumInnlvmlmmm-mmmlmmnnmmu: 1H1511lilIIILQIRIIEl?ILIQIIIRIIZ1EIREIIIIZHi?lil?iiliil1iiR1EIRiiiiil?iiililliillimlilIQSIIGIISIEGIGIIQIEZEIGE?iEi?lEiPiiREimm-Q2 X V I 5 v 1 r A I f 'nl A i I 4 J E mmmfuvmmumInummminwnwunnlvmumnuwqEE!mn35555355353tI335gggggfggfggggnsggyggmvgyggggyilgg Sill?RERiiiiii?hhminmninnl1mwynmmlWInhmmwun-umunuw-1rmmmmmmuummmmmmmlmllmmmmmmnmm HL ' 'I - -LI EA C6718 1918 Varsity, Qutdoor Track Team Ojicers THOMAS E. JONES . . . . Coach HARRY R. HEINTZEN . . Captain IRVING A. ANDREWS . . Captain LORING T. HAMMOND .... . Manager Personnel HARRY R. HEINTZEN, W, 120 yard hurdles IRVINC. A. ANDREWS, W, 120 yard hurdles, 220 yard hurdles, broad jump, pole vault WILLIAM R, MALECKAR, W, 100 yard dash, 220 yard dash, 440 yard dash, relay GORDON W. CRUMP, W, 880 yard run, mile run, two mile run BERNARDO W. ELSOM, 880 yard run, mile run, two mile run DEMMER GOLDEN, W, mile run, two mile run EDWARD R. XVILLIAMS, W, high jump EMMET j. lVlUELLER, W, javelin throw HAROLD A. GILL, W, high jump ALLEN SPAFFORD, W, 120 yard hurdles, hand grenade, pole vault MAURICE lvl. HANSON, W, Shot put, javelin throw, broad jump LEROY E. EDWARDS, W, high jump, hand grenade CLYDE L. NASH, W, 880 yard run, relay OTTO j. URECI-I, NV, 220 yard dash, 440 yard dash, relay, 100 yard dash C. HAROLD RAY, W, 440 yard dash, relay BERNARD E. MEYERS, aWa, two mile run RICHARD P. HERZFELD, aWa, Shot put, javelin throw EDWIN A. GALLUN, aWa, Shot put, discus throw ' The Season in Scores April 27-Wisconsin, 965 Ripon, 52M May ll-Minnesota, 72, Wisconsin, 71 May 18-Illinois, 81 Mg Wisconsin, 62M june 1-Wisconsin, 100, Chicago, 44 june 8-Western Conference meet, fifth place, 13M points Q, I FS ' ' , -' .INA ' ' Illinois Meet-Andrexvs Wins in High Hurdles I..I.IIInI.IIImmInI..mm.IIIIIIIIIIIIIIIIIII Il I In gun l M InummuiInInIInIInIInIuImIniInIIIIIIIIIIIIIIIIIIIIIIII Page 222 'innmumiumnmmmmiimmmimuuuumuiininininimmuiiniiiiimimu num iiiinininiiiiinuniummmmimmmini numiiinimiiiiiiiuiuuiiimimiiiiiiiiuiiiniminiiiiiwmiuiiin Iiiinmiminimmiinimininiiiv1iiiiiiuuinimiuiinuiiuiuwimmm mv Ininmmiiiimnnuunimiummmuwmwmmmiu i im limi iiiiliiiiwivpi in i I mm iwu ir i iunmuw iiimmiiwiuiiiii imiimw i in imvi mmm wiimu ii i mi 1 i immii mumiii ww mum mimiuui iimimimu wimuwmiwiiinnuimiimumuwm ii in im iwimw inn 'wwwmmimiiviiiiviimiwiiii I ii nm iiivmumiuuiviuvmi The 1918 Gutdoor Track Team Manager Hammond Edwards Gill Urech Hanson Spafford Coach jones Elsom Maleckar Captain Andrews Nash Crump Golden War Takes Captains For the first time in history, Wisconsin last year had three captains for one season in track, jimmy Peterson, stellar dash man, had been chosen to lead the 1918 cinder and field performers, but enlisted just before the start ofthe indoor practice season, going to Great Lakes. At a special election called by Coach jones, in which all the track candidates participated because there were not enough men in school to give the balloting a semblance of dignity, Harry l-leintzen, veteran high hurdler, was chosen captain, adn acted as such all through the indoor schedule and well into the outdoor campaign. Then he was called to Pittsburg for special war work. The mantle of leadership then descended on the shoulders of Irving Andrews, also a high hurdler, and Andy, although momentarily expecting his application for enlistment to be accepted, continued in that role throughout the remaining few weeks ofthe season, competing in the last meet, the conference classic at Chicago, just before enterin an ensigns' school. William Malecker, crack sprinter of the team, was chosen captain for l9l9, but enlisted in the navy and was sti at Great Lakes when the first track men donned suits this year, - Chicago Meet-Gill Wins With Bar at 6 Feet Page 223 ' ' uTETTTii ii V im ii 1 i '1Ti TlF im T i7'T'Ei 1Uiiv GEM?-4 v nu wmmnnmmmunnnmnummuiumnmiuii inininuniuiinimlmmiinumminumminmimm:uwimmminiinnmiiiwmilnuminmiinimnmwnnumumininumininiininiinlminuminnnuiinlmnummmiiinuiimiinwiviiimmimunininiiniiniiniininiiniuiininmuininunininuniniinummmmmilmmumummmuvmimumimmmnnmmnviniinnnimininnminnwuumnmiminmniminiimmmmiuulmlmmmmimnnuimummmunumnnuim 2SillIuiimRRmGiRiHiiiMiZi7?lirHEEimiEiiiiEEiEMFnTiFEi5EiiiEEiiiminnminmillninniniumminimiumiiiimininnniminninmuiinilmuiNiii15Wiiiiiiiiiiiiinininiiiiiiiiinininiiiimmiimmmiwmiimnum1inmimiinmyiniinmiii1iniminimmiinuiiiiiin1niinmiiininmiinmiIiiniiinniiininiinminiiimmimmmuiiinmiininiin116lliiililiilIIUIEliiiiiiiminiininimimiuiinmiinnumiuiimiinminvuimminuimimm s s s 55s..i...m..i..i....i.iimii..m.ii......,....... m '.m-mmmi...mnmiiiiiiimin.-ii-.1ii Iii Ray Hurling Grenade Hanson 1-leaving the Shot Review of the Season The 1918 outdoor track season was just what it was expected to be, a year which would have contented many schools minus the imposing record in that sport which Wisconsin has maintained in recent years. It was a season unmarked by record-breaking performances, but one full of development of young candidates. In the four dual meets of the year, with Ripon, Minnesota, Illinois and Chicago, the team showed its superiority in three, although Minnesota earned a technical victory after the Badgers had outclassed the Gophers over all the route. Illinois scored a clean-cut win over Wisconsin, its strength in the weights proving the undoing ofthe wearers of the Cardinal. Ripon was snowed-under, as was Chicago, while Minnesota's one-point victory was a result of a combination of breaks in the luck, all of which went against the Badgers. Fifth place in the conference meet at Chicago rounded out what was a successful season, a season which had been classed as one certain not to be a championship one from the middle of the indoor schedule, when lack of veterans precluded any possibility of a team of stars. The greatest strength of the team lay in its distance-runners, among the best in the west. lt was woefully weak in the weight events, as it has been since the days when Arlie Mucks, garnered his certain 15 points each meet. Most of the members of the squad were sophomores, so with the return of a majority of them and their consequent advances, a title-seeking team may be looked for in 1920. 1919 will probably be another season of development, as most of the members ofthe 1918 team are still in service or have been released too late to permit of their entering competition this year. - 3 , . ,. Illinois Meet-Crump First, Nash Second, in Half-mile 1nninmiiimmlimiimiiimi mimyiwiimiimiimmininmiin1in1niiniiniiiiiimmiiiiiimmii ii1uiuiiiiimmiiiimii iiiiimmimmiuniiiiinimininiiniin1ii1ininiiniminmiinlminlmuiimininimiinmyuimmmimnmu mlm mminimiimmimminimmmimiwiimwiniminmlmiiiiiiimwiiiiiiiniumiimimiminimnm..miwillMmiiigimiiiiiininiwiguiiniiIIIiuiimnmnmminimmim ummmimmnminimimimmiwmmmuiimlumnmininumimlnummminimimiiminmlm,mmnumminiimlmnumnummlmiiiinumiiiimniliiimiuimininiGiililiiiiliiminliiiumniiiiliiiiiliiimiiuimlmminimlmmlminlimmlm.mmumminnumimiuinmmminmlmlimmummnimimmmmmmmlmmlmummmmininnmmiiuimnmmminiinmnmmmiimmiiimmmiiiilmniumnmuui Page 224 ,ar--Q--Q .. - Eighteenth Outdoor Annual Con erence Tracie and Field Meet Stagg Field, Chicago, june 8, 1918 THE SCOREBOARD Q 3 L C I- .C 2 .LI 3 -, 3 Q Q E 5 E '91 L Q 9 5 0 Q E if IZ I E Q 1-' Q .C fl I o 5 E ii 3 3 E S ia 1- is 5 Q 1' 5 U 2 :Z m -O E P cu Q. cv Q gy: E cv .E '-s 'EQ bw 2 3 ?' Q o o T U ?' o T' E ?' 6 L C cu cv .- cu Q 3 3- o E o .Q Q N Q P gl 2 5 13 E 2 to 1- at 2 vi E21 C1 1 I S S, I O rr ia Michigan.. , .. 2 0 5 5 5 0 3 5 l 0 0 O 0 2M 4 DO 37M Illinois .... . 0 Z 4 O 2 0 0 O 3 l 4 l 6 To 4 To Z7 Missouri. .. . . 0 3 0 0 0 2 0 3 0 5 0 2 0 55 0 -3 24 Chicago ..... .. 5 o o 2 o T3 o 0 o 3 o 0 3 0 0 -2 18 wisconsin ..... . 2 0 o 1 o 1 0 o o o 0 0 o 0 in 'S 13 M Minnesota ...,. . . 0 O 0 O 0 5 Z 0 2 0 2 0 0 0 IM O IZM Drake .,.... . . 0 5 0 O 2 0 0 O 0 0 0 5 0 O O 0 12 Notre Dame ..... . . 0 0 0 0 O 0 5 1 5 O 0 0 0 0 0 O 11 Purdue ...... . . 0 0 0 3 2 0 0 0 0 0 5 O 0 0 0 O 10 De Pauw. . . . 0 0 0 0 0 0 0 2 0 0 0 0 0 O 0 0 5 Kansas. . . . . 0 O 2 0 O 0 0 0 0 0 0 0 O ZZ O 0 4M Indiana ....... . . 0 l 0 0 0 O O 0 0 O 0 3 O 0 0 0 4 Northwestern ....... 0 0 0 0 0 O 0 O O 2 O O 0 l 0 l 4 Ohio .......... . . 0 0 0 0 O 0 0 0 0 O 0 0 2 0 0 0 2 Ames ............... l O 0 O 0 0 O 0 O 0 0 0 0 O 0 O 1 School of Osteopathy O 0 0 0 0 O 1 0 0 0 O 0 0 0 0 0 1 The Summaries Event First Second Third Fourth Record 120-yard Hurdles . johnson CMichD jones wCDe PD Andrews CWD Osborn CMOD 315 315 Mile Run . . McCosh CCD Crump CWD Donnelly CMichD Stone CAD 4:29 315 100-yard Dash , Drew CDD Scholz CMOD Carroll C11l,D Collier C1nclD :IO Broad jump . . johnson CIV1icl'1D Lang CIllD Rice CKD Kreidler C1llD 23 ft., HX in' Two-mile Run . Sedgewick CMiehD Atkins CPD Moore CCD Crump CWD 9:51 Pole Vault . . Cross CMichD Kiefer CPD 1 Lang C11lD I tied 12 feet Ervin CDD - 880-yard Run . L. Hauser CMinnD McCosh CCD Roney CMOD Nash CWD 1:59 115 Shot Put ,... 220-yard Hurdles . Discus Throw . 440-yard Dash . Hammer Throw . 220-yard Dash . Javelin Throw . . High jump . . . Hand Grenade Hurl Relay Race . New Record Gilfillan CNDD johnson CMicbD Cilnllan CNDD Barlow CMOD jordan CPD Drew CDD Wilson C111D Osborn CMoD Michigan tied Illinois Wisconsin Nash Ray Urech Maleckar Baker CMichD Sylvester CMOD Weiss ClllD Speer CCD Anderson C111D Collier C1ndD grossglnsn CCD ice . Later CMicl'1D med Missouri 1111111111111.111.111.11.111.11.1.11111111111.11.1111111111.i11 G. Hauser CMinnDBohn CS. O.D jones CDePD Gilfillan CNDD G. Hauser CMinnDBaker CMichD Carroll SIMD Pike C111 Weber CND Davis CMinnD Zilglfhllfuil XcDFelilsCs1l1c11DD Wisconsin 1 . Linn CND Minnesota jtled Chicago Northwestern 11iiiliiGil1111liiiiiiiii1iii11111135151iiliiiiiiliiliilii M 'W Page 225 40 ft., 8718111 224 415 130 ft., 3 in. 152 215 134 feet 122 215 177 ft., ZZ in. 5 ft., HM in. 61 points out of possible 180 3:29315 if Wisconsin-Minnesota Dual Track Meet Minneapolis, Minn., May II, 1918 The Result MINNESOTA, 72 WISCONSIN, 71 The Summaries Event First V Second Third U h W D 100-YARD DASH Maleckar CWD will civil, D MILE RUN L. Hauser CMD Crump CWD Elsom CWD SHOT PUT G. Hauser CMD Schroeder CMD Herzfeld CWD 220-YARD DASH Maleckar CWD Mara CMD Urech CWD G11 W HIGH JUMP Egwirdl CWD ae E. Wi11iams qwp 120-YARD HURDLES Andrews CWD Heintzen CWD Spafford CWD DISCUS THROW G. Hauser CMD Platou CMD Gi11en CMD 440-YARD DASH McNally CMD Maleckar CWD Urech CWD BROAD JUMP Bierman CMD Andrews CWD Long CWD 220-YARD HURDLES Mara CMD Spafford CWD Andrews CWD .IAVELIN THROW Hanson CWD Mueller CWD Herzfeld CWD A Andrews CWD D . P . V W M d OID AYULT ongC D Slwilliamscwiwrle TWO-MIDEVRUN Meyers CWD Crump CWD GO1den CWD PIAMMER THROW Davis CMD Carroll CMD Schroeder CMD 880-YARD RUN L. Hauser CMD McNally CMD Nash CWD HAND GRENADE HURL-Won by Minnesota, 32 points to 28. F . I 1+ ' il I I, . - I Record 110 1-5 4:36 3-5 41 ft., 7 in. 222 1-5 5'ft., 9 in. 215 4-5 122 ft., 11 in 152 20 ft. 11 in. 226 2-5 157 ft., 7 in., 10 ft., 9 in. 10:30 136 ft. 2:02 u Maleckar Wins the 100-yard Dash .mmmIIIInImmIuimrIIInrmmmmrmmr ummIInumIIIInInIumuuIInInIInInIInuiilummnnrumn Page 226 .I mn, Im I m nmmnnmmuvmummmmr unmu ui uuuunmmimmmumm Wisconsin-Chicago Dual Track Meet Camp Randall, june I, 1918 The Result WISCONSIN, 100 CHICAGO, 44 The Summaries Event F i rs! Second Third Record 100-YARD DASH Maleckar CWD Urech CWD Buchanan CCD 110 1-5 MILE RUN McCosl'1 CCD Crump CWD Elsom CWD 4:39 2-5 SHOTPUT Grossman CCD Herzfeld CWD Hanson CWD 36 ft., ll in. 220-YARD DASH Malecker CWD Ureeh CWD Karger W. :22 3-5 Williams CWD1 HIOHDUMP 'Gill CWD Edwards CWD Dried 6 fc. Wilson CWD J 120-YARD HURDLES Andrews CWD Spafford CWD Ames CCD 115 3-511 Discus THROW Mueller CWD Hanson CWD Williams CWD 110 ft., 8 in. 440-YARD DASH Speer CCD Maleckar CWD Ray CWD 151 4-5 BROAD JUMP Andrews CWD Hanson CWD Kennedy CCD 21 ft., 11 in. 220-YARD HURDLES Andrews CWD Spafford CWD Hall CWD 226 DAVELIN THROW Grossman CCD Hanson CWD Mueller CWD 167 ft., 8 in. POLE VAULT Andrews CWD AWD tied 10 ft. TWO-MILE RUN Golden CWD Moore CCD Meyers CWD 10:02 1-5 HAMMER THROW Reber CCD Hammen CWD Williams CWD 89 ft., 2 in. 880-YARD RUN Speer CCD ' Nash CWD Greene CCD 2:00 2-5 Edwards CWD 12 out of pos HAND GRENADE HURL Williams CCD Hanson CWD tied sible 30 Spafford CWD points A 'k Equals Wisconsin record. McCosh Beats Crump in Mile-run Iummmwi-wwmmmvwilll.mlnm.mm lvuiinmlumlllnummumlmimmlli1in1mmmlumnuwii Page 227 mmn in Ii I Wisconsin-1 llinois Dual Track Meet Camp Randall, May 18, 1918 The Result ILLINOIS, 81 1-3 WISCONSIN, 62 The Summaries Event First Second Th i rd 100-YARD DASH Carroll CID Maleckar CWD Lang CID MILE RUN Elsom CWD Crump CWD Lewis CID SHOT PUT Weiss CID I-Ierzfeld CWD Schuh CID 220-YARD DASH Carroll CID Maleckar CWD Emery CID Gill CWD I-IIGHDUMP Edwards CWD Williams CWD tied f IZO-YARD HURDLES DISCUS THROW 440-YARD DASH BROAD JUMP 220-YARD I-IURDLES DAVELIN THROW Andrews CWD Weiss CID Emery CID Lang CID Carroll CID Wilson CID POLE VAULT Lang CID TWO-MILE RUN Elsom CWD I-IAMMER THROW Pike CID 880-YARD RUN Crump CWD I-IAND GRENADE HURI. Anderson CID I Duechler CID I Kreidler CID Mueller CXVD Urech CWD Kreidler CID Andrews CWD Weiss CID Urn CID Meyers CWD Anderson CID Nash CWD Schuh CID Spafford CWD Anderson CID Maleclcar CWD Hanson CWD Kreidler CID Mueller CWD Andrews CWD Colden CWD NVeiss CID Ramsey CWD Spafford CWD x Record 1022-5 4:41 I-5 40 ff., 3 111 :ZZ 3-5 5 fr., 10Min. :lb IZO ft., 6 in. 252 22 ft., 6M in :Zo 175 ft., 6 in. 11 fc. IOZZ5 I-5 122 ft., 7 in. 2:06 I-5 I9 out of pos- sible 45 points 1 Carroll Breaks Tape in Quarter-mile mmuiinInimimuiIinnlIiniimuimimiiiinli IIniminnuminuniniinIinimmimmiimmiimiiuimiuiim Page 228 Twenty-Fourth Annual Interfscliolasftic Traclc and Field Meet Camp Randall, May 25, 1918 The Result MILWAUKEE NORTH, 27 points MILWAUKEE SOUTH, 12 points MILWAUKEE EAST, 25 points MILWAUKEE DNASHINGTON, 9 points MILWAUKEE WEST, 22 points MADISON, 7 points STOUGHTON, 18 points WISCONSIN 1-IIOH, 5 points MILWAUKEE BAY VIEW, 1 point The Summaries Event First Second Third Record 100-YARD DASH Shattuck CMWD john CMWD Birkenwalcl KMED 110 3-5 MILE RUN Loomis CWD Lewis CSD Schilling CMWD 4:48 1-5 Sl-IOT PUT Jacobsen CSD Weisel CMED Schwenker IMD 42 ft., M in, 220-YARD DASH Spetz CMND john CMWD Shattuck CMWD 123 2-5 1-IIOHJUMP Dietrich CMWgD Loeb CMED 1-lurley CMWgD 5 ft., 4M in, 120-YARD HURDLES Lewis CMWD Stolley CMED Gill KMD :lo 4-5 DISCUS THROW jacobsen CSD jacob-Sen CMWgD Bracler QMD 112 ft, 4 in. 440-YARD DASH Spetz QMND Thompson CMBD jesko CMSD 155 2-5 BROAD JUMP Spetz CMND Landowski KMED Stolley CMED 20 ft., ll in. 220-YARD 1-IURDLES Schneider CMND Lewis CMWD Stolley CMED 126 4-5 JAVELIN THROW Norem CMSD Potratz QMSD Miller CMBD 153 ft., 9 in POLE VAULT HAMMER THROW 880-YARD RUN 1-IALE-MILE RELAY Landowski QMBD Schwenker CMD E. Schmidt CMND t. d G. Schmidt CMND 'C Eiring CMED 1 Jacobsen CSD Potratz CMSD Brown CMWD Graf QMND Mathison CMD Woschitz CMED La Crosse Milwaukee East ,Milwaukee North 4' New W. I. A, A. record. 11ft.,oMin 135 ft., 2 in. 2:09 1:39 1-5 I.. . Lanrlowski Breaks Record in Pole-Vault ImI..IInmi,mmI..IInIIIIIIIIIIIMIIIIIIIII In my .Im II InmiInImiuImInImimminInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ' ' Page 229 :gmmummmunvmruwvumnnmmmmmwmmmumInInmvmInnnunInfnmwmmmmwInInmInwwuwn1ummmnnmwInmnumumnumnumwanwnwmmHInInmwmm1n1in1mmmmmuwmfu1mm1lmnvmmm1nvm1uvfuW1myuwmXmmulummm1In1uwInXnmwnluluwmIn1nwuwunwInrnwInunmummm1uwmmwuwan1uwmuwmInm11-11nwmfuuuummmuInulwmwnw1uwuwnuummuwinununanuuuulvmminum1nwInXuwInummyn11.11nwmXmumnwmnunnmv 5 3-mnmK..fmHXXmmmummInunin1Mmmm'X..umlmml.1.Hui11fuMy1hillli?lilA2355ii?IGIGiGIIIEZIIIGIIHIZGiRINIIIISEQIQEIIIIEiii55?Giiliil55217211llIl?lIQlIIQi?QlIliiihlwliiillTiiiilil515115111555112111511IIEQIISIIIIQIEillIiiJillQi1311131151521Lil?IiiEEZlililIIEFilIll5.1,.UN1.N1.NL..WW-1-.1Wm,.11yuX.IX.H1I.,K..Wvm.Hm1..,H,yn1.1,H.1H,V.1mum.H.H,..,V..V..,.H,1.,V..V..H.H.H.HH.1.H1..1L..X.H1..umm1.1myW...XH411.4V..um.HN.X.Z1Li-1.L,25351mil,1-1mluiXyuNmui1dhE.iRiiiGiEREg dmfmXI-WwH.1yuX.H1H,WW1.Hmmm..mm..w, mm 4 . 5 5 EananmlUs1V.,,..,...,,..N.:In1,.,,V1P,E1,,.,,,,I,,,N1,5551:ffQ541513355151535.33551335gg3ggjgggggg3gg33gg355ynw551gmmmyrnwvuWvHInwuw+--4InW11wIn1InwI.1Uwyu1N1w11WXHX1.wVHnl1in1I.11.11V.11H1.I1WI.W.1w1.11.HW1.I1W1InH.1I.WH41H1InwI-fmruwuwmnuul1Hwm11.1H11H1m,H1I.1.I1W1.Hin1.I1HN1I.1W1N1m1m1.1Nm1H1m1.I1+IXXI.1In1H11.1NInV..1Inm1In1..H.1XInH.1H1uvX1.XIn1ynWNHuN1.umN.I1vu1W1H11-1yu11HN11I.N.I11HNIH1H1m1.11mNV.1lmmH.XvwmInN1.NNI.vmmfnumnmmnmnmmgg ,,,,,,,,,,,,,,,,, , ,W V ,Wmlmm 'ummm ,mm mmm W ml L ,,,,.,,.,..,.,,.,.,,.,,,.,,,.,,..,,.,,..,..,,,..,.,,..,,,.,...,,.,..,,..,,..,,,,,.,,,,,, .,.. ,.,,..,,..,,,.,,,.,,.,,.,,,.,,.,,...,....,,...,,,,,.,,,,,,.,..,,., . .,,,....,...,..,,,,...,..,,..,,.,,,.,,.,,.,,..,,..,..,,.,,,.,,.,,..,...,,.,,.,,,.,,,.,,.,...,,.,,,.,...,..,..,,...,..,,..,..,..,,.....,,...,.....,,.,...,.,...............,..,..,,..,,.,,..,,.,,,.,,.,,,.,,.,,,.,,..,,,,,,.,,.,,..,,..,,.,,...,..,..,......,.,. ......... .M .... . . . . ...,..4.. W mu my W WH, km.1VH1in1.41mW.HrmVHkmin1.I1yuWmW.1w1.11HW.HW.HH1X.HV..11.11.111.1V..11.1L..XL..W1.WInW..1InmwL-wnfWIHmw.IWWHw.HWmmm.1..mmmHfmV..W..X1.1W1.X.HWHXH,inN.M.H1H,m,..1.M1..1m1H,K..N.H1.I1I..X..,..1H.N.HK..1K..1I.11..U.Xm1L.11HNm1H1N.X.INnvNHNU.1V.11H1.11ny1m1.U1H1WH-N.HNH1in1..1m1H1I..1W1,w..,.wm.mm.., H.. Wm... .. 1 1 ms .. . ,. , . ., ....m., W.. 1....m...l.. P a g e Z 3 0 gnuimuiii Im IIIIII II I IIIIIIIIIIITIIIIIIIIIIIIIIIIIII E22 E55 EEE if as Ez: :fe EE ,ri I x E: Es Eli Ei? Z! EE r r EE EE SSE I E23 IIIII IIIII IIIIIIIIIIIIIII II uIImI mi IIIIIIIIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I I I, I I, ,I In, ,II , I , , I, H, H , H HI, Um , I '' ' W M'ii'iTiiliH'IiRiiiiiiiii5iiSEiliiiiiJiliGi I5f'ii'ii'iii '1iiiiJliiiliiiiiiiiiiii The Varsity Indoor Track Team I.,E.I-mv Y . .E . 17 -...V - - - Av- - Scheidenhelm Meyers L. Edwards Reed Hohlfeld Coach jones Herzfeld Blatter Mecartney Smith Hammond Hall Ramsey Fourness Hsieh Spafford Elsom R. Edwards Brothers Sternliels Shoemaker Pinkerton Pauly THOMAS E. JONES . . LORING T. HAMMOND . Ojlcers . Coach Manager Personnel ALLEN R. BURR, W, TWO-mile Run WELLINGTON BROTHERS, W, Mile Run RAYMOND D. EDWARDS, W, High jump, EDWARD B. WILLIAMS, W, Highjump RICHARD P. HERZFELD, aWa, Shot Pu: RONALD W. RAMSEY, aWa, 8804yard Run LEROY E. EDWARDS, High Hurdles EARL E. FOURNESS, 40-yard Dash, Relay LAURENCE W. HALL, LOW Hurdles, Relay HSUEH H. HSIEH, 40-yard Dash, Relay PAUL KAYSER, 440-yard Dash, Relay LESTER F. MOCABE, 880-yard Run PHILLIP D. REED, High Hurdles, High jump DON W. SMITI-I, Mile Run GORDON TAYLOR, TWO-mile Run Season in Scores A1 March 8-Notre Dame, 44 213, Wisconsin, 41 1 13 March 22-Flnished seventh in Conference meet I' I ' - A .. f 5 i -i e 1.4.7 P iifv I Qi:-is : Anfaf V. -. A I.-1 sz ' Meyers Hsieh l-lerzfelcl I ,.,,.,.,..... ...,,..,,..,,., . ,... ...,,.,,...,.. nu III I I I I I I II I liiiiiiiiiiiiiiiiiiiiiiimiiiliiiiiiiliiii5iiIiiEiiIii1iiiiFiiEiI I I 4' l'iFIiiEifH'iiIIiETiElf' Page 231 iii mmunwvuiummminniummmmmiinmiiimmmii .mmm .mmiii mm i iiimiiiimmimiiiirimiiiii Ninth Annual Conference Indoor Track Meet Evanston, Ill., March ZZ, 1919 TI-IE SCOREBOARD 3 L 'E 5 E C 3 L5 5 Q I! L, Q N Q C I .O E 3 E .D U L' -U 5 -Q i. 3 '-' G1 T. 5 U T. of I. cs -1 E 5 11 rl. cd gi 5 2 5- 5 in Q 3 a 2 Q 2 E 3 ZF I F cf 33 5 'Z 1- Michigan .... 7 I - 5 Z 5 3 3 I 65 3 36M Chicago .... 0 8 0 5 O 7 0 8 IZ 5 342 Illinois ,......... 4 I 2 l 3 IZ 0 3 2 2 ISM Northwestern ..... 0 0 3 I 3 O 5 0 I I3 Purdue ........ 0 0 O 0 I M 0 0 0 O 4K Minnesota ..... 0 0 Z 0 0 0 0 0 O Z Wisconsin ...,. 0 O 0 0 0 I 0 0 0 l The Summaries Event First Second 'Th ird Fourth Record 50-YARD DASH johnson CMD Carroll CID Cook CMD Miles CID :O5 2K5 MILE RUN McCosh CCD Long CCD Caskey CID Bouma CMD 4:40 60-YARD I-IURDLES johnson CMD Hamilton CND Jensen CMinnD Zimmerman CID :O8 440-YARD DASH Kennedy CCD Emery CID Butler CMD NVebster CND 153 4X5 Weghorsc CPD I HIGH JUMP Johnson CMD Linn CND D tied 5 feet, Il inches Brigham CID I TNVO-MILE RUN McCosh CCD Sedgwick CMD Moore CCD Burr CWD 9:48 Cross CMD I POLE VAULT Eilson CND Bucheit CID Y tied I2 feet, 4 inches Westbrook CMD 880-YARD RUN Speer CCD Lewis CCD Gardiner CID Birkholder CMD 2:04 Walla CMD SHOT PUT Smith CMD Moorish CPD tied 41 feet, ZX inches Corgas CCD MILE RELAY Chicago Michigan Illinois Northwestern 3:35 2,75 X Ties conference and worlcl's records. IiiIiiiIiiII-IiniiIIniinIiimwiiiiwiiiwii. IilIIiilllllillilIIlilillliliilliiiIlliiiIIIliiillililiiilliiliilli Page 232 Wisconsin-Notre Dame Dual lncloor Cfraelc Meet Gymnasium Annex, Marcl1 8, 1919 The Result NOTRE DALIE, 44 213 DVISCONSIN, The Summaries Event Firsl Second 'Third 40-YARD DAsI-I Mulligan CNDD Hsieh CWD Fourness CWD POLE VAULT 40-YARD HURDLES lVlILE RUN 440-YARD DASH HIGH JUMP rl-NVO-MILE RUN SHOT PUT 880-YARD RUN MILE RELAY Event 40-YARD DASH HIGI-I JUMP SI-IoT PUT BROAD J UMP POLE VAULT 40-YARD HURDLES 45-YARD HURDLES INTER-FRATERNITY RELAY INTER-SORORITY RELAY INTER-HIGH SCHCOL RELAY INTER-LITERARY SOCIETY RELAY Radamacher CNDD Reed CWD Brothers CWD Kayser CWD Edwards CWD Burr CWD Gilfillan CNDD Ramsey CWD Powers CNDD Cilhllan CNDI Meehan CNDD Barry CNDD Williams CWD C Gilfillan CNDD itied Douglass CNDD Sweeney CNDD Hoar CNDD Meredith CNDD XVon by Notre Dame CHoar, Colgen, Scallon, McCartney CNVD Edwards CWD Smith CW5 Scallon CNDD Taylor CWD Herzfeld CWD McCabe CWD BarryD Thirteenth Annual W Relay Carnival Gymnasium Annex, March 14, 1919 First Second Third Hsieh Stolleyl , Spctz I tied Edwards Reed l . Risteenl med Sundt Bach Herzield Marsh Gibson Sundt Merrick Pauly Lewis Reed Stolley Fourness Snolley Hsieh Sigma Phi Chi Psi Sigma Chi Hall Reed Scheidenholm Pickard Clague Muhlenberg Alpha Omicron Pi Chi Omega Delta Gamma Knollin Shapiro Spetz Burr YVisconsin High School Madison High School Stevens Paige McMurray Glasier Hesperia Philomathia Hsieh Meyers Pennefeather Anderson Iiiiwiiiiiiii IIIWIIIIIIIIIIIIIIIII 7illIiilillliiiiilliliiillliiiiiiiliiilillilliiiiii.IiIiI.II?limiIii Page 233 41113 Record 104 315 ll feet 105 415 4:51415 :55 315 5 feet, 8 inches 10:24 415 37 feet, 6 inches 2:09 415 2:50 215 Record 104 415 5 feet, 8 inches 36-feet, 8M inches 19 feet, I0 inches I0 feet, 9 inches :O5 315 :O5 415 1:44 115 8:43 l:l6215 l:l6 l15 mmimmmmim . 'Eimnmmnmmuw 1. H.. A EB- Cfhe 1918 Baseball Team Ojicers GUY S. LOWMAN . . . . Coach EBER EDWARD SIMPSON . Captain Personnel EBER E. SIMPSON, W, Catcher GEORGE K. MILLS, W, Second Base ROBERT M. SUTTON, W, Short Stop ELMER M. MCBRIDE, W, Third Base HOWARD J. HANCOCK, W, First Base ANTHONY G. ZULFER, W, Left F ield, Pitcher EDWIN F. SCHNEIDER, W, Pitcher ROB R. ROBERTS, W, Center Field WALTER A. EMANUEL, W, Right Field JOHN J. MCKEAOUE, W, First Base CLARENCE H. PHELPS, aWa, Pitcher ARMAND R. SCHILLER, aWa, Catcher HAROLD R. CHIPMAN, aWa, Right Field CYRIL J. BEAVER, aWa, Second Base -Season in Scores April 10-Milwaukee A. A., 12, Wisconsin, 4 April IZ-Northwestern College, 55 Vifisconsin, 4 April l4-Wisconsin, 5, Campion College, 4 April 17-Wisconsin, 55 Milton College, 2. April 22-Notre Dame, og Wisconsin, l April 27-Notre Dame, 15, Wisconsin, 2 May 4-Wisconsin, 9, Purdue, 8 May ll-Chicago, Og NVisconsin, 5 May l5-Illinois, 45 Wisconsin, 0 May 25-lllinois, 13, NVisconsin, 0 May 31-Chicago, 145 Wisconsinfo June l-Chicago, 55 Wisconsin, 2 Conference Standings Won Lost Pct. Michigan . . 9 l ,900 Illinois . . 7 3 .700 Ohio . . 4 2 .667 Chicago . 5 5 .500 Iowa . . 2 3 .400 Wisconsin . l 5 .167 Purdue . 1 5 . 167 lndiana . 0 5 .000 .1II.IT..I.HI.HinIII.T.II..I.HI..mii.mm.www.m IuwiIiiiEiilliiiiiEiiliiiEiiiiiiliiiiiiFiiiiiiiiiliiiliiiiiililiiiiumm Page 234 sg 52 232 21: EE if QE E15 il. si- 1 El 21 25 Ei E! 45 5? S E ,..., ,..,........... ,.., w.IL,..n. ....n ...,m,..,..,.,,,.,. ...u. M.,,.,..,.,,.,,,,.. ....,,,..,.......,..,...... .. .,n,, . ,..,..,,, . n,.,..,4,. ...,.,n.,,n,...,........,,..,..., . . .,,,.,. .n,, ,.,,......,..,i..,,., ,,,., . . . . .,,,,, .,,.,,..,.,.....u,..i,,,...4......,., . .. . .. . 5 gma::1nnnnmm nm1............1.......................................................................1................................................... ............. ........................................................................ .. .. . ...................... ..... .......... .......... ...... ..... . .. ................. ..... ......1.1::1::m11a:sms11:::n::...........................E 5 QL S - E ' 5: 315 S EE E T: 51' 5 E Zi lla fi iii SE' :Q I 3 rl 515 ' -l fi. E55 E : :le A EE- 5 ' E25 :If E25 -i Els 15' 'V :1 T T fl if . 'EE- 2: .Q Q1 E15 if :Q E 1 . I . I Battmg Averages 2 E S Games A. B. I-I. Pct. Hancock Z 6 5 .833 . Mclieague 4 10 5 . 500 Schneider . 6 l7 6 .354 E5 Mills . 6 21 6 .286 Simpson 6 22 6 . 273 1 . . McBride 6 19 5 .263 Q . . Sutton 6 19 4 .210 Roberts 5 l 18 3 .l67 A , Schiller 3 7 l , 143 A. Ei: . Emanuel 5' l6 2 . l25 5 Zulfer , 5 16 1 .063 5? El Eli 552 ' fl El? 252 Egjlgmllmlmnuuwnlnuunlmummmmvumnu1111111111nnnuulnuum11mnuan ......................................................... . .................... .........J,,..M..I. nlvlllnl ...nluww.3..........l......... .. .. .............m..M..w..M.'.w1...M5..Mwww.iw...5.E.M3W.HE...wm.u..u..m.l.,.:.M....L..M.............f.E i................... .....zszan111::11.r.mm '11'a:1......................... .................................rm1::a::1:n:1:nw ..mm:':r11........... ..1........... ............................................................. ... ..... .. ............................................... ........................................................ ................................................. m..........m...... '1...............5 Page 235 Inter Fraternity Bowling Sigma Alpha Epsilon---I9192Champi0nsA Alford Ohmsted Haley Donaghey Klapproth Gotfredsori Adams Standings ' Fraternity Won Lost Pet. Sigma Alpha Epsilon . . .... . 39 6 866 Alpha Sigma Phi . . . 38 7 844 Theta Delta Chi . . . 30 15 667 Gamma Tau Beta . 29 I6 644 Alpha Tau Omega , 28 17 622 Sigma Nu . . . ze ia 577 Phi Kappa Sigma . . . 23 22 511 Chi Psi . 1 .... . 22 23 489 IDdtaliappa Epsnon , . 21 23 477 Chi Phi . . . . 21 24 466 IDeka THLIIDCME . . . 21 24 466 Beta Theta Pi . , , 19 26 423 Psillpsnon . . . . 15 26 366 Tau Kappa Epsilon . . CJ 36 200 Philiappa Psi . 7 35 166 Zeta Psi . . . . . 8 37 156 Records High Team Average . ,... . . . Alpha Sigma Phi . High Team Total for Three Games- . Alpha Sigma Phi . High Team Single Game . . . Alpha Sigma Phi . High Average ...... Harold E. Marks . High Total for Three Games . R. R, Etter . . High Single Game . . . Gordon D. Adams . H1.11in1H1in1.41fuin1infH1.I11Humummwmlml -wwlmmminin11.11-41in1-I11-4imlwmimmmlu Page 236 827 2664 956 174 627 255 13145 225 I I I fi 577.8 1 91 9 Varfszty Swzmmmg Team Gutenkunst Rieck Holmes Bach Sollitt Stemmler Mackay Hindman Kidder Ojicers HARRY H. HINDMAN . Coach GEORGE E. LINDEN Coach f Personnel PRESLEY D. HOLMES, W, Plunge WILLIAM STEMMLER, W, Breast and Back Strokes CHARLES P. KIDDER, sWt, Diving CHESTER E. RIEOK, 40, 100 and 220-yard Swims, Relay LINCOLN A. SOLLITT, 40 and 100-yard Swims, Relay RALPH S. lVlACKAY, 40 and 100-yard Swims, Relay CHARLES A. GUTENKUNST, Breast and Back Strokes CLARENCE E. BACH, W, 40-yard Swim, Relay Record of Season i Wisconsin, 343 Milwaukee Y. M. C. A., 34 Third in Conference meet, 15 points. lil S- 1 .. .H i. i i ii ...H i. ii.. . ... .ii . H.,,aszazxiiflfliilllzzxzaaxzsszsmzxaaifillflflliffllifhanasa ., .. J'L:l'f lL'3 l'f'r wL':f 4 . 15I'L''2'52ilHlffllwmwklllflllffllllffilS Page 238 I E l Ninth Annual Conference Swimming Meet Evanston, Ill., March 21, 1919 THE SCOREBOARD U 'X U E 46 U I: 'Q an E gi fg T3 JE .E -- P P 5, QE CE fi? J, e5 TJ Q 'E Y 'E TZ C . - . . I U H 6 G1 S 3 3 3 3 O U fr LL. N CL. -- - wr l-' oi Chicago ........ 5 5 l 5 l 6 8 8 46 Northwestern .... 5 4 7 l 7 5 3 6 42 wisconsin ..... 0 2' 3 s 3 o 0' 2 15 Purdue .... 0 0 O O 0 0 0 4 4 lowa . . . l 0 O 0 0 0 0 0 1 The Summaries Event F i rs! Second T11 i rd F ourzh Record 40-YARD SWIM Ries CCD Branower CND Halley CND Hamilton CID 120 FANCY DIVING Beasely CCD Billows CND Kidder CWD Rossiter CND 220-YARD BREAST STROKE Daniels CND Stemmler CWD Lowry CND Strauss CCD 3:06 415 PLUNGE Holmes CWD Gordon CCD Grossman CCD Rossiter CND :34 415 lso-YARD BACK STROKE Daniels CND Stemmler CWD De Swarte CND Williston CCD 2:14 415 220-YARD SWIM Ries CCD Branower CND Alliston CCD Halley CND 2:48 315 100-YARD SWIM Ries CCD Branower CND Halley CND Piper CCD 1:Ol 415 440-YARD SWIM Allison CCD Whitney CCD Branower CND McMurdee CND 6:41 160 YARD RELAY Chicago Northwestern Purdue Wisconsin I 226 l 15 r mmm-mn i.m..immumm iiliEiiliiiii?KEIEFEZEISIIRiiiIiilimiiliiiiiiiiiiii?ilili?iii Page 239 Em.....IIwgIIIIIQIIw.iI.II.II...III..mI .n... III ..,n I I I II. III.I.IIIIIIIIIIIIIIII...I.I.II.II.IIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIII.II.I.IIII....IIIIIIIIIIIIIIIIIIII...IIII..I..II..IIIIIIIIIIIIIIIIIIII IIIII .I IIIIIIIIIIIIIIII...IIIII.,IW..IIII..III.II.MI.MINIIIIIMIIMIIIIMIIMEII.IIIIIIIIIIIIII.IIIIIIIIIIIIIII.II.II..III.,II.IIIIIIIIIII.IIIII.II...II.III.III..II.! 3 QWIIWIIIIIIIII.....IIII.III..,I.I.I.I..liIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII., .II I IIIIIIIIIIIIIIIIIII I I IIIIIII I.. III.I..ImI I IMI ...I .II I...III.III...II..I..I..II..I.....II..I.II.II.IIII...I.I..II.II..I.I.I..I..IIIII.I..ITII. I.I I 'I II I.I...I..I..I.I..IIII IIII..Wml..I..I.l...I..II.Il..II....Innmnm 'vH2 I I , i gwwe I I I I Holcombe Warren Heseman Rohde Tasche Woodward Schlatter Ojfcers FREDERICK E. SCHLATTER . Coach IQING G. XVOODWARD . . . Captain LESLIE W, TASCI-IE . Captain-Elect Personnel KING G. XVOODWARD, W, Tumbling LESLIE W. TASCHE, Flying Rings ROBERT L. HOLCOMBE, I-Iorse GLENN B. XVARREN, Horizontal Bar EARL bl, HESEMAN, Parallel Bars ARTHUR A. ROHDE, Parallel Bars Record of Season Varsity, 54 2135 Freshmen, ll 113 Meet with Milwaulcee Y. IVI. C. A., cancelled Conference meet, cancelled I II ...MII II II. II IIIIIIII .mi IIIWIIIIIIIIIIIIIIII-:I ImmunIlnmiIIIImIIIInImnIIIIIInnIIImm 2 I mmm lwmmmmu I IIIIIIIIIIIIII I-IIIIIIIIIIIIIIIIIIIIIII M nm V I I I IIIIIIIIIII III IIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIII IIIII III IIIIIIII IIIII I I IIIIIIIIIIIIIIIIIIIIII II II IIII III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIxIIIIIIuuIIuIIIIIIIIIIIIIIIIIIIIIII IIIIIII w Page 240 ra- ui ii i I I :mm 1 1 nr ir r in 1 I 1 , ,, ' I s Freshman-Varsity Gym Meet February 22, 1919 The Result Varsity, 54 213g Freshmen, ll I X3 Parallel Bars WOODWARDCVD ROHDE CVD f tied HOLCOMBE CVDD The Summaries WARREN CVD, first GOLLEY CFD 1 GRIEM CFD D Horse Flying Rings Roi-IDE CVD Dtied for mst WOODWARD CVD, Hrst DEWIRE CFD I TASCHE CVD, second. OHLSON CFD KATES CVD GRIEM CFD tied for third OLSON CFD tied for CAMPBELL. CFD Roi-IDE CVD Tumbling WOODWARD CVD, First DEWIRE CFD I TASCHE CVD I tied for second Horizontal Bar tied for second third mu nu i uimvi umm mum: nn mmnn Varsity Boxers .....mmimm.u.n ..i.m.....mmm.. m.n..,w..,.- l..,LL'lu1i....n..uLMw iniiuinuu :uv :uni mini A 1 4 ii... ...i.,..w..i.,i .H ii.. .im.Hi...i.i..i......i.i. .1 P a g e 2 4 I wmmmnummmummmmmmnmummmlmmvmnmmumyllmmmInnmmmfnnu,mmvulummmmruvrnlu1myynummmanlnlmlmmlmmumInmmm:lInnumnnummmmy1nvInuvnufnmmmrmmlmurlInluumInunmmmlnlullmurmymummulananlmnnlnllmvumumulurnnnrlanmlnlnluvlnumulm1uwlnluwmmllnluummmlum1InwnvInlnlInlnmummmmvvuul1ulummmummanInnnlunnuplvwllgmwnlmmmnmnnummmn ' 'i - l l nnmmlmln n ul l rl. mmm Immun rmInlmInmlmnmmmlwmulmymlnl.mmmummmumummmmmmn mm lnnnmnmlmnl I ummmummmummmmlul1vumm.uwlmlmwwllwmlul.Mun nnuwmm .1ImlnllInnllulmmmmnnmm.mwmwm ln um 1 ,lu nn ln nlmwmmmmmnml mmm. ummmmmmmuwlIn ur mm-mmlmlmm w The 1919 ivarsity Wrestling Team , Lueck Dahl Steinauer W Weeks Frank'in Mercer ' Kirst Nienaber Bontley Royce Williams Albrecht l-lembre JOSEPH C. STEINHAUER . . ..,.. . Coach HENRY B. ROYCE, l2O pounds JUDSON S. XMILLIAMS, l-li pounds ARTHUR C, FABER, 165 pounds HAROLD T. ALBRECHT, 125 pounds LELAND A. KIRST, 150 pounds CARL V, PETERSON, 175 pounds l-IELMER J. HEMBRE, 135 pounds Louis FRANKLIN, 158 pounds HERBERTJ. WVEEKS, over 175 pounds Ames won only dual meet of the year, 42 to 7, Weeks taking the only bout that Vxfisconsin captured. 1 Opening Round of Boxing Bouts 2 I ' ..l.m,.l...,,l..WH.,,..,...,...,l..,..,,.,,,,.,...,.,.,... , ., H .l V. . W... nl.. nl... .,,..,..u.,l,..l...,,.,.,.n ll . n l. n ....n,,. .l,.,.n.,..,.,..,.. l...,..l.,,..W..,,.l..,,.l..,.ml.,ll..,U,l..,,..,..u...,.,,..,.,,. W.. . . ...1.....,.,....u..l..lm...H.mm..,..,l...,.,..,.....,,.,..,..,,..,m....,...m.,.WE5 nunmnnmlm1lummnulnmummuunununlulullvulnumlnlllululmmmumumumvm1lulunlulnnlullnllulullnlvrwlu1lmulrnlulmllnlnnnumlanlnlullulln1urnllullullmullulnllululullulanlmvulnunlnllilllilliiliumrnlunnliiiiillillliilllliiilliliiilulllnlun1lvuul1mllnlnllilliiillililiiillllnnlmlnunmmlnllIIHIIFIGIFEIITHIIIIIHIIFIHHM11ululluunnumlnmnannumruFlllfmliluxnuuHEEEEHHElinnmnIEiGnmmnlrnlniiiinnllnvulmillnlllznnxzxu P a g e Z 4 2 Inter-Fraternity Basketball Delta Upsilon-Champions, 1919 - --Jig? ,N A , A AS . S f7 5K tg n , X ftp 1 .1:::,:,f:.. N, 1 1' fix 1 Q , M ,, - Nita ! -K K X f, . 4. -,,.?. L-. - l 1 ' 1 1 V, ,.- 'V 1 Q' 'ai ' 1 ' J ,IQ ., ' ig h . J Q , 4 I -.,k ,-if--' If T' . . 1 -i . ,gi evfrjitrl- K - ' ' jfis-.w 'V - -Y 'A 5' f Q, ' i f i ' 1 .5 .,.. s ' S -h-' ,, 1 i ii k-l, . , lax .Ric I ,I fggigji if 1, f 3 ,1955 1 .. 'yin--1.L..Qf', f , ' , Q' Qff, Q. Littig Dougherty Evans Harris Ryan , Warren Balch Holtz Kellett Records of the Season Preliminaries I Group I W L P Group 11 xv P CC. ct 'Alpha Sigma Phi ..... 5 1 .833 Phi Beta Pi . . . . 5 833 Phi Delta Theta . 5 l .833 Kappa Sigma . . . 5 833 'Beta Theta Pi . 5 1 .833 Sigma Chi . . . . 4 666 Triangle . . , . .3 3 .500 Phi Gamma Delta . , 3 500 Chi Phi . . . . 2 4 ,333 Gamma Tau Beta . . 3 500 Sigma Nu ..,. l 5 , 167 Theta'Xi . . . l 167 Delta Tau Delta . .,., 0 6 .000 Theta Delta Chi , O 000 Tied for first place ' Alpha Sig won first place on a ross On playoff Phi Delt won from Beta Group III I Group IV Chi Psi ...... E . . 5 l .000 Psi Upsilon. . ..,.. 6 OOO Delta Kappa Epsilon . . . 4 .800 Delta Upsilon . . . . 5 833 Phi Psi ..., . 2 .500 Sigma Phi .,.. . 4 666 Delta Phi Epsilon , . . 2 .500 Lambda Dhi Alpha . . 3 500 Sigma Alpha Epsilon . . 1 .200 Theta Kappa Epsilon , . Z 333 Theta Chi . . . . 0 .000 Zeta Psi .... . 1 167 Alpha Delta . . . . O 000 1 1 Semi-Finals Phi Beta Phi . , . . 24 Phi Delta Theta . . 2 Delta Kappa Epsilon . . 16 . Kappa Sigma , 12 Delta Upsilon . . . . 14 Chi Psi . . . . 9 Psi Upsilon . . , 12 Alpha Sigma Phi . 1 l Finals i Phi Beta Phi . . ll Psi Upsilon . . . ' 4 Delta Upsilon , . 16 Delta Kappa Epsilon . .15 Delta Upsilon . , 15 Phi Beta Pi . . . 14 Delta Upgilon , 22 Psi 1,lpSilOI'1 . . 1 l immummimmmmmiimlummmumimmnmmmmummi..1. H . 1 Iiminmwmumimumininimnmnnummiumnnmmum v i Page 243 Iimmmiivimwii -'D E A I - s. -.J I v VN PII V V tx fglzircl Annual Ice Carnival JOHN W. BRINDLEY . . General Chairman GEORGE MARTIN . . Clerk of Course LATI-IROP FOLLETTE . . . Night Carnival WILLIAM B. FLOREA Prizes and Programs CLARA WILLIAMS ...... Booth Mile Open CMenJ Chester E. Rieck, first Irving Cox, second Lloyd L. Pfrang, third Quarter-Mile CMenJ Chester E. Rieck, first Lloyd L.- Pfrang, second Carl J. Seifert, third Lake Mendota, February 8, 1919 Committee Quarter-Mile Girls' Doubles Kemp and Wilcoxson, first Gaik and Ely, second One Mile CMen's DoublesJ Rieclc and Pfrang, First Cox and McAdams, second Dougherty and Swan, third Ice Boat Race, Three Miles Liberty, Hrst I-Iermes, second Yellow Kid, third Wisconsin Maedj e . Nott . . McCabe . Warner Ladvin . Teckemeyer Hoclcegf Game LUDLOW NORTI-I . l-IILDA lVlABLEY l ' ' Tickets JULIA I-IANKS . . . . . Prizes ELEANOR STANCHFIELD . . . Publicity PI-IYLLIS HAMILTON. , . Womens Entries Quarter-Mile CGirlsJ Marie Wilcoxson, first Elizabeth Moss, second Auto Lyman, third Broad jump QMenJ Lloyd L. Pfrang, first Irving Cox, second Frank C. McAdams, third Miss Wisconsin, fourth Milwaukee While Squadron, 105 Wisconsin, 1 , . Center . . Rover . . Vxling . . . Cover Point . Point . Goal . White Squadron . . .Robleski Carlson A. Stoltz Schinner Zottman . Varel InrmmimimiInnumIimnmimimuir ImmiiniuiInIInInmlImInInmiInIimiiininmium Page 244 9WI.WwI.1mww..mw..vm,mmummm-IWmumH1MW1MN1wm.H..mm..vm.mm-M-mfm.mmmm.nwm.w.WW.Hvmmv.w.wm-mlmnmwmm..m.umu.mm.XX.1XH.XX.1XmXmWw..4mmm.mm.mWW,mmmm.vmnmH.X1.11W,..XXHXmX1.mw.m.m.W.-H.wwWmmumu,.H.m.nm,mmmm.,V..WH.W.Hmm...,.mw.mfmmu-wwHmmm,mm,mmuw.,mmWV..WH.1InmyIHmXX.1wmwmw-mmU.H-m1mmm..n.umm.mm.mm,w.u.mm.mw2 gn.mmm..-mmmff.HM.U.H1.Hmmm..wnm.n.mm.mmH-myWWW.HW1.X.UXmXInum.m.mw.m.w.mm.mmmm.mn.mmmm.Wmmwlmlmmfumm.m.hw-mm.mmWm.mmmm.XH4X.HWwX.1wmu.m.mwm-mmH4u.mm.m-mmmM-1mm.X1.XvmH.X,HXI.XmwmwmX.IXHww1.4W11v.mm.m..m.w.mm..ww.mmfm..Wmlm-mlmmHmlmMumW11.X1-411Hw,HX.HWHXV..XWmunmwmmm'mm-'mmmmmmm.umH.wm.m.wm.....3 w- ifi -1 . 'Q-'Y 1 Ei: 1 kv VN? Yelmwm. u,,a gl 7 QVV! .fa W, ,..... ww. NPV 2 43, marie' Haw N102 EEE I ' 1 E25 g ,, 223 ! ! l :EE WY I hsrh isa Sets ix SEE he P UCI, J 552 EEE in mmmnmmnmmmmmmnmnnmmnnnnmmmnmmmmmu 5 5 5 anY...M.,.N.Wm,.m...u.........u..,...,.m..,H.Y..,,..m.,...l......,.Hnm.,K.m.,..,.Hww.U.WH.umm...,..um..,..,...,.m..,.m..m..,.H..m.....,mW...nu...K..W,H.,,.....,...w....,.,....,,.,,..,mi...m.,.,.,,...,.H,..w..,K....m..mm.w...,,...,..,..,,.w....u...W,HW...W....,.W..,..,..,....W.....,um.,...,.,..,.m,,...,,.W,,,m....,.,W...K.,H.,f...,m..Kmvm...u........,,..mm.... E.m-:ummmnrumwvuummmumunxiniiiiiiiiiiiiiIIHEIIEEEiiliiunmmnnnmlvmnunuvnuuKMnnuunanmmmiiiEEEMEMEEIIEEEEIMEEGHEEEFEIWIEEE?MuiEP?M5riiu1?EYiiiPiEniEnuFHxvmmmumrmmmm:rmmm:runumrmvmunuunnumnu1ummmuwmwmmm1m1mmnumrmummmmInwrunuzuwmm:mvuwnzwmnnnumIninnunmuwmvnumu1nummmummmnunummm:ununnnuummummmmuvnmmnmnmnmnm P a g e 2 4 5' ,, E yumnnvmnummmmmuwInwmmnnmmwmmmrmwuwInmwanwmmmmnmmruvmwnwmmm:unfurnwsuwuwunummumwmmmIninwumm!un5:1wnunwuwunummuinwnuI4wnwInummmInmwwnwInmmmmmu1In1u1vumwinwmuwmmnlwInyuuH4ruulmnnwuunwunwWnnanummmumwrum1uuinnummm-mluIn1u1InnnwInmmmumwInmwInmuvunmmuunrmvuunvunummm:mwunwanwuumvwummmuwwnunuumunurwmumuuuuInrnuvuwuumumnmmmng QQfEMEGEiEl5RiiI..ImfluX.Hmil.1lm.Wi-nu1mV..1W1-1XmHmmmfuW1mullmmmmmlrunurnmwummm.XH4wH-inmwul1--mmmru1I-4fuwu1In1.mumWwuwmmwHWKmummmrmm1m.H1mummmulW,NH,nuimmmm1mlIn.in1.XyummmmmmmXm1uXm1.wmmmwuwwuwInInwruwmmmuInN.1H4uInmrm-mm...W.H1In1InmXummmwHwInmlInu-IXmy-mmmin1Wnlwmnlummm.1.iquiwmwmF?iIi.1iiiQLiiiiiiiiilliEil7ili1?iillElEi1IB'3 5 -1- 22 EN ,. if 225 if ES A :S :z 555 552 25: 555 ss: E if R: E if E5 555 E -- E Em :SE vm 2355255553213515553MMy55M3,5M3If3Q,,,H,:I53:53,5W,..1H.,.U,..1,...,..,,..y...,...,..,...,U.,WH.....,..,,,.,,..,.N...,...,....,.,W,..,.H,..,,M.H,..,y..,,U,..,WX...,..,...N.,1H...N.,,..,W,..,m,..4,..,H.,H,...H.,..,,..,.,,.,.H.,..,,..,,..,,..,.1,W,..,y..,...,.4M..XH.H..N.,...yW,..,..1H.XH.W,..,V.,,..,.HXmu.U..,WMK.,,..,,m.Hi..,......,...,,.,...,...,H,y.......,.....X.H...UH,m...mlH.,V..N.M...,.,.......1I.,X.mmH.K.,mn.MV..U.,,.....m........,...,m...m..m.....,as: . ,,.,,,..,..,,..,,...,, .H ..,..... . ....,..,.,.,,..,,.. ,, ...,.,,.... ...,,...... . . .. .... ......-.- ,..,,. ,.,.......,...,h.,....,.,,.,. ....... .. ..,..., ,....... ..... ..........M.W. ,...., .,........,. .. ........n...M....,.-.M,...,......,............,,.,.h.............15 .uwmmunnumnuummm'mwnmInnu,ummmmmwnumumInmumul1vuumwInummufwnumwmmumummmumm.H X ' ' ' ' ' W 'M ' ' 4 I1W.U,.HWH.W1.11.11.HW.H,..Y.Hlm.H,.HY...K..,.UWK.,mm.,..W,H,..1.HX..Xmu..M...,..,1HWm...,..m,,.m.,...1H41...K.,X..Y.W.U...,..,,H,..,......X.N..Xmn.,.......1.M,.m..m...,,H.in...4nu.H...U......,..4...,......,.H...,,H,.........4X...XM..mu..N..m........NW.H.HM....m.u.....wW..,.mm..n..1.uK..,H...u..,m..m.....m.mmmm.ma P a g e 2 4 6 EEE fi Eh sae W.. ,...,K.n.,.....,,... H.. ,... ...NH,...,.......,......,..., .,,......,.........., , ..,..,... , ,..,,........1...... .U .,.. .., ..,.., H.,,..,..,um.,,..,......,..,...,,. ,,,.,,..,...,...,.,.. ,. ..,,.. ,..,,,,,..,,..,,.,.,.,,, .,,.,, H. ,..,...,... , .,,.,,,..,.., ,H ,.,, , .,,..,,..,..,,..,,..,..,,... ,.,,..,..,,.w.1...,, .,,,,, ,. ,,,.,, . .,,.,,..,,.....,... ,..,,..,,.,,.,,,..,,.4,...,,,.,.,,...,.,..,., .1,..,...., ,.. ..., mm.. .,,...,. , ...,,.. , ,..,.,,...,..,. ... ,.,n. ,,,.,,..,,...,.,, .,,. W., ,..,.,., ...... ,,,. nn.. ..,.. U... ...K.. ,.., ,... ,..,,..,,.,, .,,, W.,,..,..M..1...u.,.,.,,...,.m..,,.m 52W,..,.......,,..,...,...,..nK..,..........,,..,......,..,,..m.....,u....,,......,..,...,...u.,,...,.,,......,..,,.n...,.....1...H..,..,..,,......,..,...,,.,,,.,.,.,..,..n..,,W.,,....,.,..,...,..,,m,.:p:,.::,.::.z,:..:.:zaz:::n:mana:annaazzzzzzaauzanaman::a::s1:a:z::1:::n:zz::z::1:anna:z:n:m::aasx:::::n:::s:za:zzQ:asza:Q:sz:amzzzzzzznzzzxzzzaamnzzzq:annauma:sssnanzzsgzzzzzszn:z::1z:zzz::1:agaaszanzmzzzqazzannasense::m:a:x:z:a::a:xmaszanzzznznamzmznnznzsasm....,..,,:m:mrunzmmmasznnmmfs2 E 5 552 E 2 S35 E , E EE 7 f ESE , iii 5 1 EEE W 552 iss EE EE 252 ii? EES EE EEE Ei? 3: -1 E55 2.5 E25 egg EE K , - : n 2 5 gggygggggggggggggggggglfgggggggggggggm55555gmmffgfgmmglmgE5MmgmnuummmmmmlnlummInummmuwm.m.mmulwmlmnluH.y.mm.m.n..u.11mumm-ummm.mmummm.-mmmmm-I--mmm.-U-.umm--1umwmmumw..H-mmwmw...H.mumlmlmmuumm.NmmmW.m...mmumulmlmm-mm1mmmmu-nl-Wm.-..mmmnm.mnmXInmmmmnummm.nmx.mmmW,-m,.mm.m.,m...m5 5 annmummluunmuvunnummmwmnunmnvmvu1numu1nnnuuunwsnwanummmwnumuwmannuummmnnanmmmumunnummwnunnmm:uvumuummnumummunmummmnuunwunumummmmmwummnmmmmummInwu1mnumInmwInummn1m1mmmxInmuinmmulhimihhilinnilmllnEluvilfiiiiiiliiviif1u1mmilinFIREmin:1ii:nivimmInmummmruwnmnumnumwuvnum:mmmwnum1Iavu1AnumuuummmmmnuuummumuumummnE Page 247 Second Annual Inter-Fraternity Indoor Sigma Nu , Sigma Phi . Sigma Chi . . Chi Psi Phi Kappa Sigma . Kappa Sigma . First Pauly Sigma Chi Stolley Sigma Nu Sundt Kappa Sigma Brothers Sigma Nu Reed Sigma Phi Hall Sigma Phi Kayser Chi Psi Pauly Sigma Chi Ramsay Chi Psi Knollin Phi Kappa Si Sunclt Kappa Sigma Knollin Sigma Chi gma Track Meet Gymnasium Annex, February ZZ, 1919 The Results . 34 Beta Theta Pi . . . 33M Delta Kappa Epsilon . . 31 Gamma Tau Beta . . 28M Phi Alpha Psi . . . 21M Tau Kappa Epsilon . 19M Chi Phi ..... Psi Upsilon ...... . 1 The Summaries 40-YARD DASH Second Third Fourth Fifth Knollin Fourness Sundt Stolley Phi Kappa Sigma Sigma Chi Kappa Sigma Sigma Nu 45-YARD Low I-IURDLES Pauly Pourness Hall Field Sigma Chi Sigma Chi Sigma Phi Beta SHOT PUT Bach Bricklzauer Blatter Barr Camma Tau Beta D. K. E. Beta Sigma Chi E MILE RUN Ramsey Pinkerton Knappen Dorries Chi Psi D. K. E. ' Chi Phi Sigma Nu 40-YARD HIGH HURDLES Knollin Stolley Collins Pauly Phi Kappa Sigma Sigma Nu D. K. E. Sigma Chi ONE-LAP DASH Stolley Fourness Kayser Stickert Sigma Nu Sigma Chi Chi Psi Phi Kappa Sigma 440-YARD DASH Pickard Scheidenholm Ramsay Dorries Sigma Phi Sigma Phi Chi Psi Sigma Nu POLE VAULT Klague Stolley Wolf, Phi Kappa Sigma Sigma Phi Sigma Nu ' Blair, D. K. E. t- d Woodward, Beta le Kinnan, Chi Psi 883-YARD RUN Brothers Ramsey Pickard McCabe Sigma Nu Chi Psi Sigma Phi Phi Alpha Psi STANDING BROAD JUMP Metzger Risteen 1VIcCalJe Stolley Beta Kappa Sigma Phi Alpha Psi Sigma Nu ' RUNNING BROAD JUMP Stolley Kayser Pauly Knollin Sigma Nu Chi Psi Sigma Chi Phi Kappa Sigma I-IIGI-I ,JUMP Risteen, Kappa Sgmal . S ndt, Kappa Sigmai Reed, Sigma Phi 1 fnrlcd Plzdluly, Sigma Chi Itiecl Ewald, Psi Upsilon FOUR-LAP RELAY Chi Psi Sigma Chi Sigma Nu Phi Kappa Sigma .mmniuiIininInimiinIiiIinmiiiiiiimiiiimw IiiiI.III.,IiiiiiiiiimmiiiiiiiiiiiII..IinIiiiiniimimiiiiiiiiimii Page 248 7M SM 4 3 3 2 R ecor d :O4 3-5' 205 4X5 36 feet, 9 inches 5:03 ZXS 105415 :l73f5 158315 9 feet 2:16 IX5' 9 feet, 3 inches 19 feet, 9 inches 5 feet, 6 inches 1:11 ' W. A. A. Board Wallrich Faville Bartholf Schulte Wise Hayssen Craighill Chadwick Weld I-IJ ermstad Fellows Gaik Patterson Ochsner Hamilton Williams JEAN PATTERSON . CLARA WILLIAMS . MARGARET SCI-IULTE LOUISE WELD . . IRMA HAYSSEN . , PHYLLIS HAMILTON GLADYS FELLOWS . WINIFRED BARTHOLF LAURA FAVILLE . ELEANOR GAIK . MARIE I-IJERMSTAD MARGARET CRAIGHILL RACHEL CI-IADWICK LUCY WALLRICH BERTHA OCHSNER . RIAH FAGAN L . GLADYS WISE' . . President . Vice-President . Secretary , . . Treasurer Outing Club President . . . . Hockey . Indoor Baseball . Basketball Bowling . Swimming . Archery . . . Tennis Outdoor Baseball . . . Track . . . . Dancing Graduate Athletics War Work Chairman I-lyacintha Murray mmmInlnIInniI.Nmi.Nmmm.m.m,.m. IIuinvIntmulimIninIuiImInInIInmumnnmnmm Page 250 . Im.. . 1 . . vm mum ulmmmummmnmmml uuuzuuum ImmmummwuwumnnmmmvummminmummumvurmmummwmnwwnummmummmwnuminvmummwmvvuwuwruwInmrnvmInm1mfmrHw.IwmW1ynwmvuwHuw1uwuwinwInmmuummuwunwmnuwInwnwummmmwvuruwruuuwmmvmvuwuuulwuwwuwruummanunuwInulwuwanummunvuumwInmmnvmmunnmn u 1 I ..,. . 'H W HW1 HH'''H'H'H'1H''H''H1 H 1H'1'H1'HHH'H IH'I1'HH 1H1H'1H'H H'1HI1H'1'H'I-1'IH'H1H1H11'HNH1H'1H'HH1H1HH1HW 11f-W 11fI11v'e i5.,......u..1...,...............,..,,,..,..,H.,U.,..,....M,..,.HN.Y...,..,Y.U,...,..,...,..,..,,.M,.,,...,..,..,,..,...,,,,,..,W,..1H,,.H,.1,..,,..,,.,...,..,,M.H,,.,...,,.,,..,...,,.,..,,.,,,.,,,.,,.,,,.,,..,...,..,...,..,,.,,,.,..,,...,..,,H,..,,N,..,H,,,.,..,,..,...,..u..,,.,,.,...,,..,...,..,,,.,..1....,..,...,,..,...,,.,...,..,...,..,......,,....U,,:,.,.,,.::a.,,.::z.:1:zzian:zz1:zz:zzz1:11511:az:azzza:1az:z::::::15:1:az:zzinn:::z::5::::::::z::::a::z::z:::::::1:::::azzn11z11::zzszaazzzszzzanazzznziszxa::::a:am:z::s:aL::n:x:a:zsaznzxzmzzzwuS a :gs ,4- 25 555 5 E52 E E EEE EE Final Emblem Weavers 'gs :E E E22 5 , E25 4. ' ESE ' ,hifi ' E55 E25 L.'f'-..Jg. -- ' :sf HE GLADYS EVELYN PALMER MARGARET ALICEFFRASER LUTIE MARIE NELSON 3 3: EEE -is sas 961709705 515 EE 555 E.- Egg ' sa: 555 SIE 55: :li 525 Eli gs: ei: -m ,- if EF Emmmm5w!.5H5W...,W......,..,.......,..H..,,.....H.,M..,.HW,.....,,...,.....N..K..,..,K..y......M..,AK...M...H.U.,,.U.UU.U.,H.,..,.............vm...mH.muum.,..,,.,,..,,..,W.,y........,,..,ug......,y.,,..1,.,H.H.,,..,......N.,,............,.W...,.....,...,H..,.,..H.,,..,...nm.,,mm,.....I,.,,..,...H.,,.....,1..H.H..,,.,y..,nw..,..,,....,,......H.W.,.H...V..mm.H.mnK..n.,......,,,.mm..m.my......f................m..,.,mm.,..,..,....1.....m........,..,,..1...f..,.s1E m...,,...f...,,HH.umM...K..N,1...H.,I.,W...I..um..Y..,.HW.Hm....,.....,..n...K.....Y...I...mU.WHmm...W.,..,I.,K.....1...X......mW.,......1y..H.,.............X..W...H.H.,H.,..,I..u.....,...K.,u....4..,,.HK.,um..K.........WK..nuK.........,.....1.....HK..,.........M,.,H...,K...M..,,...........u.,.,..,..,..,...X...,..,..,...H.,H.,.HX..,...1.4H.,H..I.,........M.,H.,.U...,,.,.,.m.u.n.:1a:mmm1.-'.,...mn,.,.W.,,.1,...H.......H....mmmaz5.1.ear,.......um..,...W..m.w......LE Page 251 'HmyWIn1nvm1mHH,mmlmrmin1num1u1Inm1mInrm1HWIn1.HnufuW1mym1I.wInwInulWm1InmyIn11.1mvu1yu1InnlunwuwInWu1ul1n1fuwI.wmvuwIn1Uun1I.wIn1I.1mw.IwInwIninmyIn1InInwIn1H1n1Wm1InwnmlyuwIn1Wmnl11.1vmynm1fumfmmwI.wIn1Ininm1rnnl1yn1u1In1nwInru1H11u1Inm1In1.I1mvu1In1u1.I1fu1mXI.uvuH.1in1mIn1.I1H.1yuulNu11.1NIn1n1InulXIn1uuK..wInm1fu1u1in1In1.I1Innn1Inm1In1n1In1In1.I1m1In1.mnXm1uvIn1mmyyu1In1mnnlmmummmmw-ug 2S16FilQiiilillFIZYFIIUZQIIZ1iiiQliiiiiPFI?lliliilIllXFIQIIIIiii1511151iiiHi?lil?lilHI?lilHIElil1Iii1ii1iiiIiilPilliii1lilNl1illPIIIFQIimin1mmmynl1in1I.wIn1.InuwI.1.H1-IXInHHmfu1In1InInwInV..1.Iml1InIn1H1I..w1.1InmwmW1mw.111.1WX1.1ul111V-1w1-4H.XWm1u1m1n1Inw.I1mnl1mm1uf1u1n11.1nnrnm1mnnulnnmrminunmXu1ul1.I1m1u1Wwu1in1In11.uynnl1mInumnl1min1munu1.1ynmuU.1InNnuvuW1In1InnuInnl1nuInnurumwnnmnn1u1in1nummfmmwInmwnnmmm-mlmumnggE H, ES 5 555531MENHUHUHuumEHmeE5mf1.151myin1ugEW.1inwIn1in1ufmw,H1m1nv1Inw1.wW1yu1m1vuIn1Inwu1In1mWInfmin1In1.1wInWInL..wInm1u1wuwW1mwnwm1mm1u1ul1Wmwmwu1--4mwinm1ru1-Hfu1Inin1InmWWynWInmWuwfn1u.Innl1ulXnwwn1furuwu1Inm1In1W1uNmW11I.1mmum1I-4InmwIn1uml1In1I.1in11-wm1H1nlummfm1I.1fumm.vu1.I1nl1InXmm1muWU.1InV..1In1InmlnnWmm1H-rmnumunnwwru1mnummymrllullvumglfwt-3555535 :K..wunX11.1myrm1In1mynuunnmmmwnmInlmmlW.1uv11.11In11,vm1InwulnnwuvwnwmwInwrnwm1.HinwmwIn1I.w1I.1mlmH.11fl1.Hwmm1W1u1in1In1.IWInwuwnlwnlmwfnwInmwmwuwm1mH+wu1mmynlwyuWwInwvuW11.1In11.1Inm1ulnuin1u1WN.INm1InnlXHXynWuWm1H.1InH-1.mmIn1u1lmInnlufuw.I1m1u1wHmyfn1inXInmwinm1mrmm1u1munw1Hwm1H1mnn1H1inWyunumunuU.mm-1nmnrmum-I1fnnum1an1u1mmynuummmmummmmummnmmmmlmmmm Page 252 Outing Club X1 , f Snyder Swift johnson Moe, Sammis Weiss Marohn Corey Hendricks Wagner Hughes Lewis Hayssen Hacsslcr Hammond Wise Board Members IRMA I-IAYSSEN . . . President DOROTHY HAESSLER . Vice-President MARIAN j OHNSON . . Secretary HEI.EN WEISS . Treasurer CLARA WILLI.AMS . , W. A. A. LILLIAN LEWIS . . Hiking HELEN SNYDER , . Coasting MARGARET SWIFT . . Skating SIGRID MOE . . . . Skiing MARION COREY , . Horseback Riding MARGUERITE SAMMIS . . . Bicycling MARGARET WAGNER . Picnicing EVELYN WISE , . , . Boating RUTH MGCLELLAND ELEANOR HUGHES HARRIET HAMMOND IRMA MAROHN . . Roller Skating LELA HENDRICKS AGNES SAMUELS Frosh-Soph Picnic 1 ii imiuinumInIminumminiiiiiuiuirmmimm I Ii Jiglilggwwiiimww- --4---l wg-MJSWH 5 'd M ' IinIinminiInIuimmmiIiniiiinnuimiiiiiiiiniiiiiiimiiii I Iiiiiimiiiiii iiiiiiiim I .II IIIIIIII. -Page 253 niInmummIImmnumIImImIIIummmInInInI1InImIIIImInImIInInInIInIIIIInnuIInInInIIIIIInImnnmnuIIIInIIIIuiInIInIIIIInInIInImInIIIIInIInIInInIInInnnInIuIInIInInInIInIuIInInIIIImIInIIIIInInIInIInIInIInnwInIInInIInInIIIIniIIIIInImIIIIInInInIImInInInImIInInInIImnIInInIInInIInInIInmImInImnnInInIInIIIIInInIIIIIInInInIIIIInIInInIniIInnnInInIInInIInunInImIInInIimmInIInIIwIIInuImmInIInIInInIIIIIIIIIIIIIIIAIIIIIIIIIIIIiummuniunniu WIIIIIIIIIII-mi. -IEEEESIMIEIRESFiM111l1?iiii i'l IIIIIIIIIIII-ATIIumliiiiiliinliiiimiInI1 I 11111141.1111 III. I II IIIIIIII IIIIIIIIIII wmiiui mm. I In 1 IIIIIIIIIIIIIWIIIIIIIIIIIIVI1 ,III II II I I mu Ir IIIII II III MII. II WIIIII II Hockey CHAMPIONS-1919 Peterson Skinner Schroeder Saul Everett Ashby Post Schultz Pleuss Head Fellows Patterson Williams King Varsity Team FRANCES DUMMER, '21 ELIZABETH HEAD, '19 LULU SAUL, '19 LUCILLE EVERETT, '19 HELEN KING, '20 MARGARET SCHULTE, '19 GLADYS FELLOWS, '19 JEAN PATTERSON, '19 IVIARIE WILCOXSON, '19 PHYLLIS HAMILTON, '20 SARAH ASHBY LUCILLE EVERETT GLADYS FELLOWS ELIZABETH HEAD KATHERINE BUTLER HELEN CARLSON ELEANOR GAIK DOROTHY HAESSLER CCapt.j SELMA ALBRECHT MARGUERITE CROSKEY FRANCES DRAKE FRANCES DUMMER MARY BABCOCR MARJORIE BLAIR MARGARET BRETHAUER FLORENCE BROWN FLORENCE KING JEAN PATTERSON MARGARET PETERSON VIOLA PLEUSS fCapc.D PHYLLIS HAMILTON AMY JOBSE KMgI-.J HELEN KING MILDRED KING ESTHER GRAHAM MARCIA HINKINS GRETCI-IEN LOOMER NANCY LORENTZ ESTHER CRAMER EDYVINA DEXTER RUTH DICKOVER DORIS LOVELL CLARA WVILLIAMS, '10 1919 JULIA POST LULU SAUL MARGARET SCHULTE MARGARET SCHULTZ CMgr.j 1920 MARGARET MCMEANS GERTRUDE NOETZEL ISABELLE WATERMAN MARGARET WESLEY 1921 HILDA MABLEY CCap:.J ELIZABETH MARRHAM DOROTHY SHAPER MILDRED SCHWARTSBURG 1 922 MARGARET POPE CMgr.b BESSIE SICHLER ELIZABETH SNIDER CCapt.J NORMA STRASS ELINOR SCHROEDER HELEN SKINNER CLARA WILLIAMS MARIE WILCOXSON LOUISE WELD I'l.-KZEL WRIGHT MARGARET SNVIFT CMgr HELEN THOMPSON MILDREO WARSINSKI KATHERINE SWITALSI MARGARET THOMAS IMA VIIINCHELL fl Games fJuniors . 9 Seniors . . . 5 T - fFreshmen , NOV' Slgophomores . 12 NOV' 14 Sophomores . . 3 ISOV' lgriophomores eniors . . 1 Juniors . , 13 uniors . . NOV' 7 Freshmen . I NOV' Isl Freshmen , 0 NOV' 25lSeniOrS . TimmInIIIHIIIIIIIIIIIIIIIIIInIImImiimimiiiImIIIIIIIIIIIIIIIIIIIII .ImiImimimi..IIIIIIIIIIIIIII1 mini mm mmInIIIIIIIIIIIIIIIImIIIIIIIII-ImVIIIIIIIIIIIIIIIIIIIIWIIIIII IIIIIIIIIIIIIIIIIIIII mlmImIIIIIIIIIIImImmmimIniiliiiiiiiilliiiliiilliifliiImnllliliilEiliiiiiiiilihumiminiIIIIIIIIIHIIIIImIIIIIIIIIImiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Iiiiiiumiiiiiiri mm.IIIIIIIIIIIIIIIImimmimIIIIIIIIIIIIIIAIIIIIII111111111111ImimuiimImmmimImIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIImmminIIIIIIIIII II: Page 254 In I I I In In WWWWI 1 I In I In II I Ir II IIIIII In I II IIII I IIIIII II Iwi I I I Indoor Baseball Hayssen johnson Lewis Reed Sinaiko Fellows KATHERINE BUTLER ELLEN CORRELL GLADYS FELLOWS ANNETTA DONKLE GLADYS FELLOWS IRMA I-IAYSSEN MARGARET -I OHNSON MARJORIE BARTHOLE KATHERINE BUTLER HELEN CARLSON LUCILE CHASE MARION GOSS MARCIA I-IINKINS RUTH MCCLELLAND PEARL MOSS ELIZABETH BENNETT AILEEN CASEY ELLEN CORRELL MILDRED CRETNEY Post Wise Varsity Team XVINIFRED MOSS VELMA REID MARGUERITE SHEPARD 1919 LILLIAN LEWIS ,JULIA POST 4 VELMA REID 1920 LOUISE INGALLS LAURA KREMERS IVA MCDONALD GRACE PATTERSON 1921 PAULINE PAEST DORIS PHILLIPS EVORA ROESSLER , 1922 AGNES GILBERTSON NORMA HOPSON AGNES IVERSON RUTH LINDSTROM Score of Games I Seniors . 28 Seniors , . . Mar. 3 Freshmen 14 Mar. 5 gunlilors V - juniors , 30 A Op Omores . Mar' 4I,SOpIfIOmOreS 18 Mar' 71Freshmen . . Page 255 Iviar. 1 1 1 Donkle LEILA SINAIKO ALICE TUCKER GLADYS WISE CLARA RUDER SOHNIA SINAIKO MARGARET SCHULTE GLADYS WISE MARGARET WAGONER HELEN WEISS EVELYN WISE HELEN WRIGHT MARGUERITE SHEPARD LEILA SINAIKO MARY SWAN ELIZABETH WATERMAN DORIS LOVELL KATIJERTNE ROWLAND MAE SMITH ALICE TUCKER Mar- 8juniOrS . . 32 Freshmen . . Seniors . . . 27 Sophomores, . 17 I I 4 I III I IIIII I I I II Im ini In IIIIII I :Im Bum T ' ' q3as7cet Ball King IVIAVIS CHUBB RACHEL CHADWICK WINIFRED BARTHOLF KATHRYN BOLL RACHEL CHADWICK KATHERINE FORWARD DOROTHY HAESSLER PHYLLIS HAMILTON MARGUERITE CROSKEY ALICE DAY , FRANCES DUMMER CONSUELO BURWELL VIRGINIA DORING LOUIsE FRITSCHE juniors . Feb' 27 Freshmen Seniors . . Feb' 27 Sophomores . juniors . . Mar' 5 Sophomores , Weld Chadwick Mar. Mar. Mar. Lyman Va rs ity Team FLORENCE KING AUTA LYMAN ' 1919 FLORENCE KING MARAGET PETERSON VIOLA PLEUSS I 920 AMY JOBSE MARION ,JOHNSON HELEN KING 1921 MARIE FEE MARGARET FISHER 1922 ELLEN COULD AUTA LYMAN MARGARET MCDOWELL Score of Games 5 Seniors . . . Freshmen . . 12 juniors . . Seniors . . . 12 Sophomores . . Freshmen . . IIIIIIIIIIWIIIIIIIIIIIIIIIInIImiiwwimuilim Mar Mar Mar. II .I my II. IIIIIIIII I Page 256 Chubb LOUISE WELD CLARA WILLIAMS LULA SAUL ELINOR SCHROEDER CLARA WILLIAMS MILDRED KING ISABELL WATERMAN LOUISE WELD AMANDA I-IANSON DOROTHY KROPF MARY ALICE NEWTON ELIZABETH SHOLES VESTA WOOD MABEL WINTER 13 fFreshmen . 31 juniors . . 30 15 Freshmen . 38 Seniors . . 39 17 juniors . . 26 Seniors . 25 :E EIIIIIIIIIIIIIIIIIIII...III ..., ...III ..,.. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.II.IIIII.IIIIIIIIII.II.IIIIIIIIII..III..III.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIII.I.I.IIIIIIIIIII..I.IIII.IIIIIII.II..I..I.II....IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ,,.,. III. .,..., IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIII.IIIII..IIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIII 2: iii ig mg 5: ESE ' EE EIS :SE Outdoor BCZSGZDCZZZ 255 K I SZ: Egg S EI i i I I I ' X I CHAMPIONS-1921 Fitzgibbon Kropf Sell SE Falk Sichler Sutcliff Sinaiko Warsinski Hinkins Shepard 1 918 ,RUTH BOYNTON EMMA DAMKOELER JULIA JOHNSON LUTIE NELSON, Mgr. gg RACHEL CHADXVICK ETHEL DUMMER ELIZABETH KENIJALL MARY RONDEBUSH RAY COOLEY MARY GLOVER CLARA KEPKE HANNAI-I SMYLIE I 91 9 KATHERINE BOLL FLORENCE KING MILDRED PEDERSON ELINOR SCHROEDER 5 MARIE HJERMSTAD, Mgr. MARION OLERICH MARGARET PETERSON MARGARET SCHULTE MARGARET JOHNSON JEAN PATTERSON LULU SAUL HELEN SKINNER l 920 DOROTHY HAESSLER MARGARET QUINLAN ELLEN TENNEY MARIE WILCOXSON SIG!-IRID HANSEN META SCHROEDER MARGARET WAGNER VIRA WINCHELL LOUISE INCALLS KATHERINE STACKHOUSE HELEN WEIss 1921 ADELE FALK DOROTHY KROPF MARGARET SICHLER MILDRED SWEET ALICE FITZGIBBONS ELSIE SELL LEILA SINAXKO IRENE THOMPSON MARCIA I-IINKINS MARGUERITE SHEPARD LEAH SUTCLIFFE MILDRED WARSINSKI I I . A - , , A Champirmship Game I EI, I S52 'EE EEE IE IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIII II I I I IMI I I I III IIIIIII II IIIIII IIIIIIIIIIIIIIIIIIIIIIII II II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II III - IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIulIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIII Page 257 III IIIIIIIIIIIII II IIII IIIIII IIIIIII IIIIIIII I II III III IIIIIIII I IIIII III I I III II II IIIIIIIIIIII. IIII 21111111111111111111111111111111111111In111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111II1111111111111111I111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I11II1I11n111I111I EQ11111111111111111 111111111111111111111111111111 1 1 11111 11 11111111111111111111111111111111 11 1111111 1 1 1111111111 111 11111 1111 1 1 1 1 11 11 11111 1 1 1 1 111 111111511111111111111111111111111 233 Track SWIFT SCHWARTZBURG CROSKEY STORMS ' THOMPSON CHAMPIONS-l92l 4 Varsity Team V 1 MARION COREY PHYLLIS HAMILTON MILDRED SCHWARTSBURG VENICE DONKLE GLADYS PALMER MARGARET SXVIFT KATHERINE GOODHUE LUCY WALLRICH 1918 MARIAN CLANCEY EDITH MARTIN GLADYS PALMER :SE MARION COREY CLARA WILLIAMS Z 1919 Egg WINIFRED BARTHOLF MARY FREE VIOLA PLEUSS ,gg GLADYS FELLONVS MARIE MITCHELL LUCY WALLRICH if llELENA OLESEN 1920 E E LUCILE CHASE RUTH JOHNSON JESSIE MECEATH VENICE DONRLE ELIZABETH KUNDERT MABLE SMITH :QE PHYLLIS HAMILTON MARJORIE SCUDDER 1921 ELIZABETH CHANDLER MILDREO SCHNVARTSBURC- MARY SWAN MARGUERITE CROSKEY RUTH STORMS MARGARET SWIFT KATHERINE GOODHUE HELEN THOMPSON Track Records l-lurl Ball Record Hop, Step, jump Marion Corey, 19-63 fr. Z in, LUCY WALLRICH, '20-Z9 fc. HZ in. Basketball Throw V Running Broad jump KATHERINE GOODHUE, Z2-74 fc. 9 In. MILDRED SCHNVARTSBURG. '21-I4 fr. 10 in. Baseball Throw GL.ADYS PALMER, IQ-226 fc. 3 in. , Q javehn Event T1wmm1 ..1.. ..1..11., .Mm,1 N4I. .,1111111 .11 1.11..11 1111 ..11 11.111.1.11 111 1.111.1.1111..1.1 11 ..1,. 1.111 11.1111.11.1 11111 W1 11111.1111111 1.111111.1.1.1 111.1 1W11m1WwW111W ..11.1 .111 .1.1111 1111.111111.111111.1..111. 1.11.1 11mm 11.. 11111111..1..1111111.11.111.11111.11 1mWWmW111WWmmWMWWwWm1 111.. .111..1 1.1.1 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111Eililiimii111111111111NME111111111111111111111111111111111111111111111111111111 PageZf8 1 1 1 11 111111 1 1 1 1 1 111111111111111111111111111111111111111 11 111111 1 11111111111111 1111111111111111111111 11111 11111 1 111 1 1111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111 111111111 11111111111111111111 111 1 11 111111 11 1 1 1 111111 11111111 1 11111111111111111111111 11.111111111111111 C34T'c11er K Lak.-- .. - A , A , Johnstone Kundert Urban Brownell 1918 MARIAN COREY MARIE I-IJERMSTAD RACHEL CHADWICK IRMA IVIAROHN 1919 MARY JO!-INSTONE ELIZABETH KUNDERT RUTH MARIE URBAN 1920 SADA BUCKMASTER VERA jERc GRACE GLEERUP DOROTHY MCLAWRIN I q 6717118 1 l 19l9-CHAMPIONS Conine Paine Crass Conklin Goetzc 1 11 -1111111.11 .1 .1111 1 1 11 11 111. 1 1111111111 11.1. 1.11 .........1.. 1 11... 11111. 11.... 111111. .11.. 1 111.1.1..11.1..11...11111.11111111111 1 E .1...m1w1w.w1111.11. 1111111 11 1.1.111111rnvnrmnmrz''mmamnzmmam' 'T4r: '11n 'TT 1 11mmamF''r VT1'-11111...mmmm.1 '1..1....:1111ammm1'T'.. 111. '11 rTT 1 -'1 ..I'f 111.11111111111111111111.11111 1.......1 T -'-T -T...1. 1 1 11. 1 Page 259 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IWEEIIHIIITITIIIH I II II IIIIIIIIIIII I IIII I II IIII II I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII II IIIII II I IIIIII IIIIIIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIII IIIIIII IIIIIIIIII II IIIIIII IIIII IIIIIII II III II I II III III II IIII IIII I IIII I IIII IIII I II III II I IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII Dancing ADA BENSON 1 LUCILLE EVERETT IXAAVIS CHUEB ANITA DONKLE MADELAINE GOLDMANN LEONA HICKMAN ALICE NAFFZ DOROTHY BRIDGE ADELINE BRIGGS FRANCES DUMMER Class in Dancing Dancing Honors 1918 IRMA MARQHN DOROTHY REITBROCK ESTELLE SAWYER 1919 SOHNIA SINAIKO PAULINE SHORTESS J ULIA POST MARGARET SPERRY CLAIRE WHITE KATHARINE WHITESIDE CERTRUDE NOETZEL BERTHA GCHSNER MARGARET SCHULTZ 1920 MARY BUSHNELL DELMA DONALD DOROTHY EVANS ELEANOR GAII4 1921 JULIA HANKS ELEANOR RILEY I II II I III I I II II IIIIII I IIII IIIIII III I II III IIIIIII II IIIIIIIIIIIIIIIII IIII I IIII III III IIIIIIIIIIIIIIIIIIIIIIIII IIII II IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII III IIII III IIII IIIIIIII III IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIII III II III IIIIII IIIIIIIIII IIII IIIIIIIIIIIIIIIII II IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III IJM .IIIIIIIITII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIHISIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 260 fi 15 If if l 2 Z s ! I E 2 555 -,- -,,. pi.,i..i.,.ii..i...iii...i...im.w.i.,i.l,.i ,.,, ..i..i..i..i,iiiii..iinH..i,.ii..i,Hii.iiHii.1iH.i,i.....i.i..i.N..i..ii.., ..Y,...... ii, ,.1,. . Y,,.,,. ii ..,,. .iiii..iH.V..imi..i.m..i.i..,i,.i,w..i..,.i.i.,i,.,,.,,..W..,.i.w..i..,,.i.i,., ,..,,. iir.ii..im,.iiiii..iiiii.ii..ii.ii..H..i.ii.ii.,..i.ii.ii,,.i..,,..,,.i..,r.,. l.YY...,.. W YY.. ii, ,.1,,. HW.. ,,l.,,.,,,. ii., Y.,,. .wi Y..,,. .i.l,.ii.l..i ..1,..,,,.,,..,,. i ,.,. N ,,,,,,.,,. .i ,,.,, i..i.i..i.1i,..i.......Hi.HiK.,H.i,...i..iii..ii.,,..,...,...i.m.,,.., il. -5' 5 -1: Z E57 :li f g 5 3 2 i 51 .in i i ,2- E, is ,Q 1 is gl Ig Ei il. -i E 2 L sit if' aii . -- 2 -l. -si ga if , . 1 if , 'L . Ii 5 ?'E - I ,. -5, -, I gi. 5 ag , -3 553 'Z 5 -3 EQ 1 ig is I i 5.2 5 1 i , Qj , iss 5: , 2 I i 3 , , 2 . 3 I 3 i 1 i I 5 ' LA DANSE DE LA FONTAINE I A student artist's interpretation of a women's dancing class at Wisconsin. Even the most colorful dancers appear 'glum gouache' with an unaesthetic background, or in the colorless gymnasium, says the artist, 'But touch up the rhythm ofthe body with the rhythm of musiqvand flexible imagery, and there Hashes forth at once the charm ofa sum- - mer night dancing for joy ofthe high season. 12 ,, 1 E35 sig i ,la Elf Elf 21' wumninmnmimmuiiuiiimninnunmiiuniiiimiiiimianinnmrimnmirimimiimumnmimiimniiwnmiminmiiniiiniiiiiiiiiiiiiiiiiiiiiinwmmiiiniummmiimiimiiiiEliiMEiuiiiiiiiiiiiiimiiiiuiiiiiiiimiiimiiminmiiliiiiimiiiiiiiiimimmiimmimiiiiiliiiiiiiEiinmmiiiMEE.mmmiimnmiiEi5MMiiEiilEIiiiiliiiiiinrmmmiiiiEiEWGlMEnirwiEi1iiiiiiiuiirm5EiilEiiiiinEB.imrnmmiilnium-mlmiiulmmiiillimmi-in E Page 261 in -5 E H ,.., mm..K...K..,W.,l..,..m.....,..,...m .w..... .,.....m.,,.m..m.,.. w,..... M.,K..Y.H,..,H,W...uw.,nm.,,...H.,K..W,.,,..,,.,,,.,,mW. ,...1. .WW..Y..Y...Y..,K..N..m.N..,..1..., ..,,. .Y..w..,,m..W..,..N ..,,. ,...,,.,, .,,.. u..,,.H.m., w.., ..,W.,,.U.,,..4..,H.,,.,,..,H,H.,E.,in,K..n.u..,,.,,.w.,.,3, ..YK.., V.,H,H.,Y..Yy..Y..,H,,..,K.,U..K..W...H.,L..,..,In,..m.,...,..m.,..,,.. ,..1 ...W.HY..H..Y,.,.H,W,..,...,,.,H.Y..,K..Y,.,H,WY,.,V..WY..WK..W.H.vm..H.NK....HH..I..H.,um..,,..u.w.,,..mm,.,..m......1 .ggggwgggg5553:15555555mmE53555ufWvm.HkmW.H1.-4yu1m1nuV..W,..,..mm..mmwf..V..1V..1.HH..1.U.HWXnu.MmyV..1WyuXH.Wm1W11.4V..1.Iwm1In1.11.H1H1H.11.41.11.Urm,H1.H.HW..11HkmK..X..X,H1.HH.1.HN.WmW1.HV..1K..mw.M1..XI.,H.N.1XH4NI.1H.,ynnl11.4WmfWulNL-11HNmX..XWN.HmyIH,...mN.UN-N1.Nrm..W,1.1,.UNEuufmfH55M353353mlE555gmfmwmgm555ggi5533M53553E5me3355953323355gf553fj5wQ1n2EgEgy: gE 1wInwvumlmlmlumm1wmnnwm1uwwmunwInm1imIn1uwfmfnWW.1Wum-numlmlmmI1wH1mWInwInfu1pu1pn1nmmlmuumwuMundi.luiulwfuvuWRiiiLiu1Qi1ni?nuri:hi?liillilPMEli'ii1FII?ii?ii21iiR1Qi1iillii1iiiliQREIILIIREZILEMQIIIIIRlilrmH4rmdunuluinuInnmmlliumummmlmumunmXInnlNInmuInmunuInuwmwlmlnum1ww.1ummmmnmmmwnvmmm.mlumyunuummmfHXulNInwInInufmmmunuinwInnnummInfmlmummmlmmu11nvmmmmnmunmlnnmx Page 262 :gs . - ass - - '-E EEE EEZ gwwffmMQQMM,mfgffmwmfMw.3w...umy.HT!www.,myV.,H..,.m...,H.Km,..um...,..,11.1mWmm.umH.,Mmf...W..m.1W.N...1inmy,..,...um.HWV..V..W..V..Nm.m.HM...ufH..W..K.HmK..NK..,Wmmm.WImV..N..NWmm.mnKmmmu.,H.NV..mmm1.1KmWH.,mm.W.Wm.mmH.mmm.HrmH.W...,..,.M.HW.HW.mn.mm,H,W.HWX..H..H.H.mminX.Mmm.um.,H.H..,...m,m.H.M.mm.H.Um,..H..f...um.m-3 E gm,.....,H.,,...l..,.......Y..,..m..,..,,,.,.,.,....,..,.,........,.m...U..,n.r'f.K..,...,..........,...m.,.m..,,..,,.....4,..,,...,..,V.H.HH.,H.Nmn.,.M..,...W,.m,.,,.,,..,..,,K..mli..,..,,..m.,..Hy..H.,WH..,W......,..,,H,,..H..WW,...,.m..,W......1...,...,..W..,,,H,..,,..,..H..W.,.....,,..,...,..4H.,..,...,,,.,..,,..,..1,y..az,...H..,...,W,..,.a..,..,..,,..W.,,.u.n...:,......u.,,..,Wa..,..,.,.,.n....,......mm,,l....,,...,..,..1,.N,,mn...H.,.,.,.:,,,..,...,......1.:,..,,,.,,:..,...,:,..u...,l.,.a.,..:E3 5 gg 2 5 2 2 E i Si: EEE EES S52 E55 iii 555 ii? EEE 52 555 sf? si: sis :is E55 355 EEE 232 sis 225 EEE -.. .F gee - : E52 :z: :,. gif .V X -.- ,5, :.: :F E EE sgs Q- 525 333 EE ij SE EEE EEE :ss ,F SQE : . E-I Egg gg- EEE 2:5 E : Ei .Ez .- :F E42 EL .1, T EEE Ei? EXE E25 '25 if EEE :gi 555 sis EEE :iz -.- .V 3 zf- .52 EE Es: Eg :iz fi: :zz .i- EEE -K: -!- E35 555 ri: mn u K -I mum EGFIPET- EE mm 52, Eli EEE E 255 512 515 2 5 E35 ESE af: 2 im2WMm...r.m....,....,,m,..,...,,.m......,...,..,...H.U..4...M-MyvmK.,..w.....m.,y...,..,..,,......,,,,,.,..,,.........,..,,..,..,,.....,,..,...n..,.,,.,,..1.,,,..,..1..,H.,.N...m...1..m.U.,i.,,....,.H.,mmW,..,..w.H..,..,,..,,.,......,..,,,.,......,..W.,...,..,y.,,3,......,..,,.....,,..,...,..,...,..H..,..,,..,...,.H...,.....,,..,..,...,..,,..,....,.,,..,...,..,,.,,..,...,,.,...,..,.,.,,.,...,,.....,...,.,.,..,,..,..,...,,.3.u.w.n.,,K..WW.WW..n.......m.....,.K..,.,..m...,..,.,,...s, lg 51mnmnuunnmnunmmnmummummmnnmunnwanunhniihiniiiiiiiiii55151iiiiiEiilliiiiiliiiGRPIIIIFIEiliiillHHHiiiIilliiililEiEIUiiiliunl:iiMilli:nnMuumummmmumvm:wnnmnmmmmmruunvuwInLumummwuwwlunumnum1mmmmmuuninwvuwmmnu1HfnunnumwmnlunwmInwnwnummm:-mmyuyuumInulwwHnuummm1mInumInmamnummumlummwvunyrmnuInmmm11mmmmnummunfffnxzunnmnlmmlwlmmmmllnnmnmuuq Page 263 w n muunuu u1Ininmwm1mInwInn1wInmwuwmyInrnWn1min1invmIn1Inm1H1wInmfn1inin1mmwmwInnlwmwI4wIninwHWm1m1I-wInwInin1nwInruwInm1in1InvuwInmwInwnwH4wnXmwnml1u1m1m1mInmuIn1uumnl1In1Innl1u1ulXInInuInmwnfnnvmnlwmuuwmanwmmwanwnvnvwmmmwwnwanunInwanwmmruwnumrmunummummmumg gmvmInmnmmmwInwInmmumInmylmnwInmwLu1uwmm1mwInnlin1mul1inwuwInnumXnNIn1nwmm1In1mummwmmnml mmm u H V 5 gnmmfm1mfmmmvmmmlw1InmlH1unIninX1.11.Hm.H1mrmmH.W11.1.HH.U..w..1InmmUI.wInnlmf1InH.num1.1wInmwH4W1Inin1ulW1H4InnuWwmm11-1.H1In.HMwH4w.NmwH1WwuvinW.41Wmm11.4mwInni1ihm1Inin1HJRul1InH.1In-.I1HIIIIGIQili?IiIlilIi.ii.iiil1iiR51NIRGI1,IR.H1HQiii1il?iii?E11IHZIQRIIILIIUIREIILQIRlil1EIILIIIGIiii?FIQIEIGIIERIZSERIIIJGIIQLIIRH1151IEQRIEIHZ1lilNIEHSEliiiiiillIIRESREZIEIRiiilIIRIIIiiilliiiii1iiliEEREEEG!Ri?512153111QIZEMIZQIIITEGIIHTSEE Ei? EE EEE age EEE SE SES Zi-2 N- 253 :gi E35 222 5 gligggggggggiggg535gggggglggggjgjyggggjlggggg35111531355555535313gggggiggiggggggggflggglgglfgym353gf355-imwW1...u.W.Humm..W,.mm...1..,.Humm......,M..,..m.1.H...,.mu1..1...mmH...y.UKw..W.m-.Wu.1H..W.U...L..uw..Hm..,m,.m..,..,NWN..um.Hmum-mm-mm.m.n..1H11H.,.m.mmw.m.m.11-mnmu..1.m.y...,E.nw..nlu.mw.m....m..umm..1.1--mm-1.-.1..mm.,mmH..X.mm.m..,m.,m..mm.,..41.m.m.m.n-lm-w 2 5 mmmmummmmmmumwmmmInwmvmrnumlwnn-mmmmmmInW4WW...nw.mmmmmwmmmH4wInIummmlmmwnummummmlmlwmllmummmmmmmmmumInummm-mmlnmwIninmlmmmmmmInummmmnwmmluInmummmumm..ummmummmu-mm,mummnlmlmmmmllmnumm..nmmmlmwwvmvu:mmnmmmuuum.umvmlmnnmmmmulmmuummmlunIlmwmmunnumnmnmnmnns Page Z64 HCH-VH-E?S 1 Y . s i i 5 1 nmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIII III IIIIII IIIIIIIIIIIIIIIIIIIII III IIII IIII IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIII. IIIIIII IIIIIIIIIIIIII IIII IIIIIII IIIIIIIIIIIIIIIII IIII IIIIII IIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Quarbere Wisl-Inefsky The Liberty Badger I LINCOLN A. QUARBERG . ..... . , . Editor-in-Chief BEN IVI. WISHNEFSKY . . . . . Business Manager Editorial Stab? Associate Editors WHITNEY N. SEYMOUR ALLEN SPAEFORD DORIS SIMONSON, Womens Editor FLORA HEISE, Assistant Editor FANNY MILLER HELEN RAMSEY ERNESTINE JENISON MARCIA HINKINS GOLDES KISCHEL JULIA HANKS ANNE HUMPHREY , Died for Democracy Section MARGARET LEWIS, Editor VESTA JONES, Assistant Editor P, LOXVELL J. RAGATZ, War Editor EEE War Correspondence MARGARET IVIELAAS, Editor FLORENCE GERKEN, Assistant Editor PAULINE POWELL DOROTHY POWELL RUTH JOHNSON E Fraternities HARRY W. BRADY MAURICE M. HANSON, Editor OWEN R. TERRY Q Sororities IRENE HALEY, Editor MARGARET POPE LOUISE INOALLS FRANCES RYAN ALETHA WHITE I 5 Athletics HAROLD A, GILL, Editor JOE R. SHERR 1 I Seniors MARION MCCABE, Editor MARCUERITE GOODING, Assistant Editor Organizations X ELIZABETH HOOPER, Editor MILDRED CLARK, Assistant Editor Activities ESTHER J. WANNER, Editor HELEN ARCHIBALD 1 Satire - KENNETH L SCOTT. Editor MARGARET KIRCH, Assistant Editor HAROLD O. PINTHER HESTER ROBINSON EDXVARD H, ROBERTS WALTER K. SCHNVINN ROBERT K. THOIIIAS Special Features ADELIN BRIGGS, Editor I DELIA PROUDFIT MARION KINiBALL ELLA SCHUI.z DOROTHY KENNEDY I Wfomen's Athletics I MARGARET MCMEANS MARY FOXVLER, Editor SADA BUCKMASTER Forensics JOSEPH B. BEACH BERNARD E. MEYERS, Editor SIDNEY F. MOODY Photography CHARLES E. FANVKES GEORGE B. IQUEBLER RAGNHILD SKAAR HAzEL COUNSELL Editorial Assistants HELEN SNYDER HAROLD O. FROHBACH HOWARD A. GLADDEN GERALD B. HODOINS RUTH IVIARTIN HAZEL WOLFE ELEANOR GAIK DORCAS HALL LUCILE NUTTER DOROTHY MEAD MARY WOODARD Art KENNETH H. HARLEY, Editor GUNNAR G. GUNDERSON, Assistant Editor g MARY BOYD DOROTHY SHURTLEFF ADRIAN DORNBUSH GRACE GLEERUP LAURA KREMERS WINIFRED MOSS RACPIEL STEARNS EDNA GAPEN GLADYS HAWTHORNE CORA MAUTZ LUCILE SELK FRANCES TUCKER I I I i III I I III II IIIIII I II IIIIIII II I I IIIII III I I III I IIIIIIII I I IIII III III IIIIIIIIIIIIIII II IIIII IIII IIII II IIIIIIIIIIIIIIII II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII II II I II IIII IIIII III I I I I IIII III III IIIIIIIIIIIIIIIIIIIIIIII I I IIIIIIII IIIIII IIIIIIII III IIIIIIIII IIII IIII IIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIISIIIIiiiHIIIIIIIIIIIIIIIIIIIFIIIIIIIIIIIIIIiiiiiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII P a g e 2 6 6 i.i..,.......,.ii.W....,.5,.,,!w.,iii,w,,w,.,w,,i.w.wiW..wi.,.M,f,..i.i,..M.,Wil..i...H.,...iii...i..iii..ii.i......iiiii......iiii.i..i,..ii..iii.iii..iii,..iim.,iimm.,i..,..i,..,...i,..,..i.......i..,..i,..N...,......ii...,...,,.i..i..iiii.,i...,..,,..,,.,.,.ii..ii.ii.,....,...,...ii.,...i..i.iii.,i...ii..i...,.i..iii...i.........i,iii....iii........ii,.i.....ii.,i..U...,..H..iii..i....i.,...iii.W.ii...i...i..,,..,,..,..,....i......i,ii..,...,..ii.i..i......i2 :5: 555 .,. zs: 35 EE gs: :gg .V ii: ,E aa 5E is E5 gmmiuinmuiiiiiimnmi-imiiiuiiiiiiiniiiiiiiiiiiiimimiiiiiim.mini:-iimymiIiiummuimiiimiinumm.mm-iii-inimii-immmi ii miniinimmi-iimlmiinmini'Em-1.min,IiiimillliliiilillililllliiillliiiiliilIIZQIZIITHIlliiliilEllllilllillllWiliiliiiliiiI5UPliHilIillliiililllliililii1iiiilliiiiiilliillliiilillll75211illliiilliiiiliilllliiIIIGHIIICEIIlliilliiiillllliFliliillEillliillllllllillillilillilllllPlliiiilllllliilliiIilliiiililFilllilllilillllllllillilllllillfllilllilililiilillilliiililillliliimllggE -fi si: gli 232 EEZ Ei? ': Hanson Gill Simonson SpaHord Seymour ' - i . 'Y ' lk-' , ' 3 . 3 532 555 ,wg , .ggi gf, il' W 5' - I ,x -31 ses Sara 1 , ' f if , , will ' - J . - ' fsifgj E52 :-: A Vfi- , , -4 VV . wg wi Egg NSV-5.1 ' wg . ' '- 1 . , iz- . , , 1: ,,. 'U 3 - i , i -5 K K --xii kg-gi .i --.1 wr VV V we EE ' -Eff, 13,113 l . . 3 li. 3 ' 5: 2:2 2. .QQ ,Vg s.:Vii 4 'f:g,:,,Lf:1.-'ff +V 'J f . i' ,VZ , ' '. ,bg --- iii 2 ' -- ,,,qv-e-eLf.Le,1QziQ.'.:wiff.,--:..,:,:.4.g,f,.fx 2: if Lewis Gunderson Scot: Ragatz McCabe EE Fowler Harley Warmer Hooper Haley iii V, 4.-. f ,.--..-, ,V.,V , .. - 7, 7 --, ,e , , ,,,, WW-.. ,,,,,,o,,,,,.-e 2,2 ,-Q., , J. VV Vf71i..,.,, Q i- V ? ,,m+.C , ,,, . K , ry , A k jsmjwhm ::: aff. 253 - -. ,-. .. ,A -wg.. ,V -:fry -. 224, -. ,. ' V453 f4,:..3V.:,f - - ,, V- . ggg -V -V 1 i -:.V- Vp - ,. , - iz? , , ..,, f- fa'-M --- - -' f ., 1 ijw V f :gg f- V, -x , 2 - '- ' 1 f '- VV 1 V EEE ,. ., i A V.. , W .,,, . . .. Y H WV-fV:.i1V:.f -Vww , -f L iw :zz EE ' - v-v- , , 2 12: ,ri - 4 V' . A. .. T' Q, 4 V, img .,.f ,gN'i-y -3:31,-vfg W 4 gggw- gag V V Briggs Chu Brown Kitchell Olesen --- ,W yf:yV-ffegyi. .. 29:5 WQV.-'xi-,J f-X f 'V - Q V -'- ffl -' - V 1 ' V. 'V , V V' L :zz ,Q QV- , ,, V - - -1 -. 1 , Vi, V ,.,.. .,,-,vig - ,,,. . V, , Q, --- E55 ' ' ,- V - , ' , - . 4 V, - K ' --- M L ' V ' , L if X' I.: 1+ X eifgiiiz ' efiizfi - 'f . 'fa , : v: -- MI.. ., .Vfx 5, 1- iii ' 'V ' - ' 1 . V. ' -,. fizwff ' f - iv ' V: 'V ' ifvfff . 'V f1::,f Vs.:-' ' mf . . ff? ' ' - I '. --- V - V ff??2 V ' i 1 . ' 'V f- . Converse Ivlelaas Greenberg Hanna Fedde Eli ERIEEIGIEGiiiiiiiGiEEEiFi1EiEiiEHlEiEGiiiEIiiIEiiiiiiIiiEiiiimiiiiiiliiiiiiiiiiilGiiiiiliiiilliiiiiwiiiiIiEGiEiEFiiEiiEDiliiiiiliiiiiiimiiiiiiiiiliiililliiiiiiFIIEESHRERHEEIZEIEEEHEECIEiiiiiiiiiilliliiiiiiiGiiiiiiiilEiiiiiiiliiiiiiliivilliiiiliiGiiimiiiiiiiiiilEGiGiIiiiiiGiiGinmiiiiiiiiiEiiMEEiiEiHKiii5nIiiHIEIiEIIEiiIEiIIIIiIII11Iiiiimiiimmiinuiiiimiminiiniiiumimmnimimmm-mm-wiimmiiimmmimuuiiimiiiiiiiiiimiiiiiiiiiuiiiii Page 267 nn O o o 91 :S cm 12 I o c.. VB. 5 U7 EERIEIEIMIEIEEEIIEIIIEIIFIiiiE.liT'E..flT. F'I T ...... . ... ........: ...................... ................ . ....... a......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................:....................................................................................., ........ . .... .. ..... ...... ...... ........................................................................................................................................ ............................... .............. . ....................................................... .. .... ............................................................................. .........................................2E -Q X ,V . , ff... .-f, . .- 4-.ft ...,--.1-M -..:-fm.,-Q.,.V:.f,'V...,,,, 2- V.3..W.-g.,.:Wf -,-. ..V..,y.V 0,1 - Veg.,yfgggg-Vfjf,:: 5-..'f.3V2x2,Eb':1.'12Qf'.32V6:-ta.:jg1.fg,.i.:jjf1,j1.,,q-ifgf -f.V.:f'::E.'5j'.V'.-25-ff,if-w.:::?Li4?iL4a.4-xiii.: .- 1 ' -ESR X25-5.2 2 ,.. ' 5. .U g ' -f 72 . f F'?. If 'sl '-:Sf HTH - 57221 : I f 2' 2 V 1 Ill V49 : . 5:5 X 7 1, is A 'v -' 3.6 .J ig.-., J' .12 . .. . ..,. .ESM ,W . ' 4 Ramsey Meyers I-Ieise Counsell Clark Snyder Shurtleff 5 2 : : : :: ':: :: '::2:2:22:22:2222222:22:: :'2':2222 222'2:22:2222221:22222:::2::22:::2::22:22:222:2:2:22:22::2:::::::22:222::22:222:22::22:2:::2:2:2::22::22::222::2:::22:222222222222:2 2212: 2:2 ::2 22: 2:222:2: 22 2:2 :22:22u2:2:22:2:22 22::22:2 22 22: 2:2 22: 2: 2:22:2L::22 2:u::22 22 2::2::2::2:2:2::2: :: 2:2222 2::2::22222 2: :222::2:u22:22:22:222 22:2 22: 2' 22w:222:w2::2:2:::22:::2::2222L222 22 22 22225222 2:222:22w2:: :22:22:2::2 2: 22:22:2: 2::::::22::2 2222: :2 2222 ::: :22 22:22u2::: 2222222 22:22:22 222 2:2222: 2:2 :2:2:2 22:2:222 2:122::2::2: :2 :::: 2:22 5fg:::a:::2::::::::::z:::2::..:::n:::2:::::::::::::2:a:.::::.z.:.....:2...:................................................................................................................................ .. .......... ... .. ... ... .. .. ........ ........... ........................... .. .. ..................... ........... .............. .. .... ...... ............ . ,E - E22 E E Ez: 5.5 aes Egg 525 ,. . ...... . ... .. ..... ,, .. .....-, .. S22 -.41 .: --.- Q N. wwf. 2 f Q .. - -. -1 9 5: 55-732 C' ' I ., L W 1 'IVV '-,.w'.'1i ' W Uv . '2 U. A V. -3? 2 nw - x- X' 0 :V I 3 3 bv -. 2 '1 2 ' ' U' ' ., .T 2 ' is H 225 Sigffi 1 L4 TE' ' 91 1 V 'Mf1Gf'f9 v. . , ' :W -- '2 f ,. O. ' ' ' 13 2 Q.. .. . '2 . . .. Sz Z -.ESQ U1 : .. Q WS -':' 2525: O 3 .w . 2. 1 2 . 2 . rg.-1 .VV 4: 1 -- , N..-5:'.g1::2f'f.'g1s,.f 512, 4 . .,.:-.-'- by i2 - 4 f' A 5 E2 o :QI ' 4.99 .QQ . if f Sw '1 2 29:2 f-.54 5- 2 2:5 O : 2 A . z - 2 X N xv N . hwy... .. 3 :gg Q .Q -V ,,i,k.,,-g,,4 ...gg 3 .,,.,. . N :IX 3 .0 , ,V,.....q:.:., V , . . T 2: S. E cr 7 Z3 2 If .. . Q 2 B ga' -- N 9, 5 C .52 3-3, 5 23 .2 .4 '-.g5 S' efg. 4 f ' ..,,Z:::pf..1'f? ' 2 xg 5 2 nw 52' 2. ' ' f ' 1 r V5. .Elf 2 14' 2- V 2- D WZ. '2 2 f':V ' 55 2 X X V f ' 'Q . A2 X: nfltfifsaf'25is-.-2mffiif.f232Qi1?fQ Q52.z-m.w,.w.k,,.?'4,sw1ff...fgfQg-,gil 2 3 2- ' ...W A ' 2- 5. X wi -'. E'f, ? 1 ' I-55:5 J M - ,. :WEN 211 2 . f, - r ., 5' 2.: . A .3222 C L, . rv .1 2 . -- .Wie - 2 U . 0 0 .. 'Q X X Q 2 -- 'E 15214. , Q f i 3 Z 12:2 f. i1 'V E :2 M: 1 ff: ,, S E ... .RQ . -XX. ,., .V.. - .- x., 3.1. I . ,1 ,. YK wh VA.: 3 I, V V Qllv A P. E : .- . - X - Q - V . - -: - , Qs... .2 V 3 2 Ni' 2 .' 'P - - . . - A - 33 :-La. 5' H . L :.,'..:: I? :L . .yxiigi E 3 1 N.,-Q . :ji Q: W '-'- 4 , . r ' .VE E 1 I: W... .. .... . ...,.VQ....x.W. 4: 4-fl M7741 'lgggg-E Q.a..n . - M555 I 2 ff Sf. 3 iii . :V lv ' - V U, 9 5 Z9 cn :gt . 5. 1... .. - ,. V.. .ff ,. -. C. : .V .. Y., - 1- I- x , V --::- Y . - 211.4 4 ', rags -.. .-,Q ,N M . .. ,- MX., -1 . X H. UM... 3' .2 ,V ,., . , I pr . .. I4 ,Az .., A.. . ,. .1 V. . 2 5' .. 9, 5 .gl 5 .. ' 212 cl 55: -1 :AQ ' . iw, f Za'-3. 7: wifi V -V 1 - 11 ,-2.9: 2 ,. ' - , -' Vs ' ' . . 52 1922 -. -' .. ' -1 2 : ' : we - V . V --- me M 2 '2 EEE X' , f f ' riff :EERE 2' ' i , a.: 1, . 1.-Y.. 1 ' L E .- M 2 , ,A 21.3 .. +1 2' ' E215 22.4 V 2 . 22 4 V ' 22 E , 2 Z rn '. W A :nf Q ' P-2 - O Q Q r Q, 2 f o 1 .2: 5:2 -. sz-' 1:2 4 E: 2-5,2 -1 11.54512 ij. 4 Vf- Lrg, 2. .. ' ,' , ' ., . f A w 223125. 2 q....., ' 9733 - 2 ' H? rn 264' ' E W5 if y,: ' Ez. 5552? 2 ' N . . 1 iw.: '3 - T EE S..-,.3, . , V , WQ4.. G :gif Jn.. ., . 4 f 77 .- , . - :- 5 , 735. ::-- -y,,Q...,, n . - O -. O E ..-. 2525 ii? Q . f FF. il Q' K' ' , S E' . if-. Y- 5 4 . K 'Q - 21 ' '- . 2 E .A Q 3 X - .... Y - 2, I - : ' . Q-VN.,5m..h.J.-., U 2 N 5555 f -. -L -..,. . .Q .fi 5-. :.,...-:V-V': ' Q.. :leaf '-2 -'P . .PQ - - Z. ' fwfr-w':'jf 'jahj an . ' .h v ff 'U ...S 4 H FY: 2 21-52-.2 -. F! if , . W ' 2: ,wr Vi: Q . . . 4.2, 3 25.3. 12: ',-I.. l- , .f J'i2'E27 ,I W ' 1 ' ' .:., '-. 1 -5: 'j' 92 , i Q r Ag, f ' -'..'gg,I:.V4':Z K-421, Q... g W.: A 'ti Q' ' 5' 2 ' ' 2 5 ' 29.25 .V ' V' ' ' V f., V mf' :n V 2 .V V 55 ,, nga? 5352, h '- h W : , Jjitgf rv 1 , h .r . V t - 1. 55 , f. ' .1 ., gl 1 1522: ,QW X 2 ,Q . . 5 s ? ' . f-,Q V A 2 ' 5,22 M: Q 5 ,. , 2 . , 2 2 13 , .. .. ' Q : ' fav.. - . '2 52 .... 2 2 U' . fi f - X, 3 ru Q, L 5 2 . - 2 ' .0 2:-Se' - ' f .Leaf fm :vw -'2' 2 7' N 5252 ffm. .. . I . f E 5 - tw? ' . -f ' V H f 2, f f- ' H x me . ,iff .,.,L,V,44 I , ' W fy 2 3155 'Tl 5 ,, -- I Egg rf. iz, , .. 'Sag' U, .Wag VV.. U, g,ga,i .V, - Vj. A 3 3 - ix? 2 :f2:?2:: 7- 1:31 33 3:11352 45.29-f ' . .-f ' -fkifg -. -14.20 .-. eff 5- 2 . .. ' Riff! X W . 'j..., .: 5:2 Ly-535. ffpx .. 5.5.4 3 -,-Z.. my . V, - 4 Q ...N .,--.,..:..' ,. V . .. 1...-:Xl fn- ,., - ...W ,. 2 : -' an U- 2: ' ' ': 5 . Q 1' . H .f 2 -1 , 23.3 in X --2: EN: 0 - - . ' 1534-.2 2 - . . J .242 5' Mb! ' 1 :wif D 1 ff. S- 2 2 :T ' ' 2- . . 2 . , 1.1.2 M 1 'Q . - -if ' -. 5 : '-. 1z.1'?'1R. ,iff 'A 'ti Tflfff-5: .ff 112:24 'VV ' L 'J ' :Q 5.3 Y' 2 'V ?x- ,-QWQQQQQ -v,-QV.-...U '- : 522 as EE EE il: :III ll ull I2 ll ul: ll :lu 222: I .... ' fy. -,. .., .. Page 268 EIIEMIEWIIIIIIIIQIEIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIInIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I - ,gun EE :Ei Els EEE sie I IIIIIIIIIIIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Ez: iI....,.,. ,,.... I..I...., ,..,K...,..,..,., U... I ..,,..,..,...... ..1.. I . . w...,...,,,.,... I.. ,,., ,.,,. , ,,.. ,,..,. II .,,. ..,.., I .II ,,..,,.,. .....,........,.,,, I ,,.,,,... ,,.1,.,.. . I ,,,.,...... . ,..,,,,,,,...... ,....,.I ,,,,,.,,K,.,..,,.....,.. ,I .I I ..,,,. ,,.,.,,,.., ,.,1 . . . I . .. I EES EIS sg: gig ...A its A V A , ,y-3 - 1 . f , A. . .f-Q. . :fl '. ' A E E yn I, , W I.. ,kv .uf fy J- . I ' I kA-l -4 'QQ' QE 1 I, KV f ' Q I 5 ' 2724 If 41, :is W C X in - i' h A . 4 A h e gg K I, ' I - I . ff -.1 'I E52 '71 SIE I P 1 z. 555 I ' ' hifi. - ' ' .. ' ' - fifv' SE L. . CA. ea: . .E-: , ., ,, ' .L A , ' Robinson Kremers Schwinn VVhite Ryan McMeans Hinkins Humphrey Miller gg: A s-,-f- eg E: +87 I ,Q ' I ' 7 . . In ' ee ' I . . 4 ,, I .. 3 . A .I 1 2 fy .Qs J 1 - 5 , I Z' 'ft , I I' 2. 4 V X. V J, ff, fr f' 'w t . f iw 2 . .cf ..YA., -.Y..-f -.f-....v ' - W- -wc A , ---N I 5 Buckmaster Beach Gaik L Hanks jcnison Schulz Mead Woodard Hawthorne TT:-R'-'--T .... E.. evee . Q ' .1 ' 'i3'f . - , 1 -I et- W:-... -4 if It I 1 I I .- A I, A, U I- wk Il . If ' f - , E2 , 2, Z., , gg: 23 mf, - 2 . ii I3 I Qi .ig M , . ggi , ,. e1E2f-.Qj:i 'let A - fi , J ' 3 it J , Eli I M . If I t- , , ., ll - fi f ff- .- . - - I ,. 4 . -1 -:ae Y It , yi - f . sz - 1' ', ,. ' A ' A fg- 5,:- 3.5 3 f ,fi , . Ingalls Parsley Wittwer Sherr Tucker Pope Prentiss Martin Pabst 1 feet f .V fe f Y, r . 4:5 'vf-f , 72 J . .fv 4 . ' 4 2 ' A - -A I A . I ' - -1-It -.-. . --Q f I '- . -It, 2 a. - ,. If' -:pt-IA. , V --,-' .. . , --'- . .rt-'t A -ze: .1-fe. 1.1 eff- : . , M. .I Its A 1 . . I gi .. - f ,,', ' . - I . . . - - . , . ggi . -A . ,. f . . ,. ' ,, s.-,-ver' ,,.. I , ,. L-iw--efl'rwfe41--Ll-2--' -- - 'f ew- ---- .at--is--2-E-f-fi -- 1 -fn ' ' 1 J 1 rw ' QQ Kowalke Glassner Olds Wilson johnson Martin Allen I IWolfe Kennedy ' I ,. Business Staff A A Executive ' ' MARGARET BROWN, Assistant Business Manager HELENA OLESEN, Office Manager JAMES E. GREENBERG, Circulation Manager MARY CONVERSE, Circularization Manager VIRGINIA KITCHELL, Administration Manager KATHERINE F EDDE, Advertising Manager -. KEATS S. CHU, Accountant cg Administrative ' HORTENSE BASSETT, Private Secretary DORIS BEARD, Assistant Purchasing Agent FLORENCE I-IANNA, Purchasing Agent MARIE WITTWER, Secretarial Assistant MAEEL SMITH, Collections BORGHILD I-IERREID, Secretarial Assistant Sophomore Assistants JULIA OLESEN GUINOR HELBERG TAYLOR l-I. SEEBER MAURICE E. FIELD LYDIA LACEY WINIFRED TITUS WILLIAM B. FLOREA Circulation LANVRENCE E. EMMONS MARY A. JOHNSON GERTRUDE OPPELT ERWIN T. MOHME THOMAS A. REYNOLDS RAYMOND J . RYAN g f ALBERT K. ORSCHEL OLE H. SEITZ EDWARD M. WILSON CHARLES S. SCHNEIDER OSCAR C. MAGISTAD 5 Assistant Advertising Managers BEATRICE BEAL SOPI-IIE BLAUL LELA HENDRICKS DOROTHY WARE Circularization , EQ f JULIA ALLEN ALFRED BAUER l lELEN OLDS MARION PRENTISS ADA WILLIAMS Advertising if ROSE GLASSNER GRACE GLEERUP MANNIE PARSLEY 5 GERTRUDE KOWALKE PAULINE PABST RUTH RUGCLES - CBodger Staf Pictures Courtesy of Portrait Shopj ESE iuiwIIIIIIEEEEIGiiiiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIimiiiiiiiiEiiIIIIIIIMEIEITMEIIEEEliiiliIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIEGIGIEIRREESETIEIIIIITIEHIETIZESZEIEIEESEGIIITIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIFEEGGEEZGHEEEIIIIIIIIIIIIIHIEITEEMIBIIHMIIIIIREHIEEEIMHDEGHIGESGIIIKIIIINIIIIIIIIIIIIEEMIISZEMIIBIMEiElTiRiEiiiSEIIMEIEFIIIIIIIRIMIT Page Z69 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII1 mnuunmum wmmm In ' ' ' ' ' ' ' I ItwiInImunmttmmmmt D...-Rf--f 1 I --N-t- M...-----f. ' 2 , V. 5 .' -If -ff . , ALT, vi , I ,, .1, .4 fy , R- V ., ---, , . . k,.. .R I . Y ,gi AmmI1t,mtfmk.c,,4 A ' ' ' .ug S ' f 41' 2 .-.iff R. ' I .Mlmytmm-A 2, f V 2 QR I- .- ' I ..,i,.f 14. N if 2' -if :xv If .iif----Q-6223535 ff522:2ti'4:., A ' III. VV I 'W I z ., W: Q .R . f?EiE3.jil'1' .5 A,sw,wggff Affiffggswygrfmt-1 1 ,Q -, . ., ' f- 1- -f..-itt:.i.g:,.:.i5f1Q.,.g- . .g..- -ii f Eff,-fw.f4f,af-fs.-sES.imwrfxaf5,,, f' ,.,,, 451-Z. ggztw--1 f tim:-1, 5, EEE- E m- , ' fig P-2:54 L, .,.,, .- ' gg, wat-N-3531153 writing-k5g,2+-ggtgfzf ,. , ,. ifNZ4f-.- T '1 ':fJ 531.1 'fl -' MQW' f'?31it-:Z'??Ef- I -were , ta, A-, +f.-aA?-w'f-f2:1:fm-,f,c+:wgs5g-,,- I ,, , Q, ,,Eta,,,4,,.. sw, , Eltxuqzf- -57':52Ti,'?'2 3-A-Z Qsfnff-f: i2fQ2f?51C1bmusriss2v ta. ' 'U:41'::'1 . . . . . .Q I, W- ..s,, gg., ifwm.. ,, s, ,.-. . ,,,, ' at 'A ' , A B Ifqsrmiai ., 1'atf- Spas, I 2: . 'fR:f:sf Mf'?l mm: . . -'::E1::.: f::':.-:Q-I f QS- 5 ,J ,f ' ,g r 4 12: ijyff, -SE2f:A,..E4i1f, I wr:-f ' , I X , -,sfk-A 'R T--211: , fit gi , ,uf-Lvlkejfh .rf -11512 'dt-25 sf' Q-1-.pf-E ,f-i..qf52 -A..- , E ., . , Q5-5E5xb pe , W -vias V LL, Y., . ,,,1,, , I ,Hz-L-s,A,-a'fE. A ' MTE 1 A SRREHI1 . , I N I, ,.- N, - . A .,.. , ..,f - , Iv , A--i. Lk.-uno' I Y ,I I f . f, ,. i.,,,Il 2 LI.. Rf-, gs , 5 The 5Daily Cardinal News Staff OWEN L. SCOTT, EDWARD L. DEUSS . . Managing Editors LOUISE LUDLUM ...... . LEONARD ERIKSON, MARIE WILCOXON . ' .,.. -E.,-E--. 5. ,.,-., - --r News Editor . Assistants BERTRAM Cv. ZILMER .......... Athletic Editor ELLA SOHULZ, MARGARET KIRCH, HOWARD JONES, HESTER ROBINSON LOWELL j. RAGATZ, ............ Desk Editors GERALD B. HODGINS, HAROLD M. GROVES, CHAUNCEYJ. PELLOW . . Eclitoral Writers j. LEROY HASENPFLUG, WALTER K, SCHWINN . . . . Skyrockets MARIE BODDEN, IRMA HAYSSEN, MARGARET WILSON, FREDERIC W. BECK- MAN, MARGUERITE SCHULZ, CHARLES L. MANSON, LEON KAUMHEIMER, MARION BERGESON, ESTHER BRUNKOW, KATHERINE HICKEY, CARSON F. LYMAN .............. Reporters Business Sta-H. HENRY SCHATZLE . . .... Business Manager WALTER E. MALZAHN . . Assistant Business Manager ELIZABETH HOOPER . . . . . Advertising Manager DELIA PROUDFIT, IRWIN MAIER .... . . RICHARD SCHOMBERG, CLARENCE V. JOERNDT Circulation Managers ESTHER ROBERTSON ....... Business Assistant . Associates ELLIS VANDERJAGT . . . .....,. Collection Manager HELENA OLESON, KAREN FALK, HELEN TURNER, MARGARET LEWIS, HENRIETTA SOHAFFNER .....,,. Advertis ing Assistants SCOEIZ Deuss Hooper Schatzle Hmmmma:Iilimisgmmmr.,.....,.,...,s......t.-..- .,., ...M .... ,.......,,.,,..,,..s.. ,s........-,....-.... . Page 270 sn E6 il Ei El: 'Q uw:ummnmuyugmununummnumnnmumInmummwmmmmvumwnunuuvwwrummuummwmmnmanwummummnnwanrmununWnlnmwrnwnumnun1+nnumvuwummruwmmyvmmrnnumwnuunmwvu1vuun1m1nwnwwInInmnInunvuwInwrnnnmwInwInnl1In1u1vunnluwmwnnInwv1wmwvuwanmamvmmwum.unumvmwuanuInwvunurmvmrunnmwruwvuummwwummuvumvunuInmrnurunuwmnnnuvuvumunumunnmmnmumumInnmummummmng -nsummfmnlnummmflmmmInvm.umr1.I1rmmrmrwWnumrmrmnlrmrmummmun1mlmunannnnurunummrlmrmru1Imummuummmm ww ry ummm 4.wmmmm1fum.mm.mwmmu 1 m H4 W 1.ufm.m.m.mnu In w I .www L.mVIIZPIGEWIZYIIQGIRIITEIEQEIIZIIIFFI mn HWRIQEIYIIIEEEIFIUIH H UEILQIIIEIEII NEW5611541IIIZXQGIIQILEIFIIEEILiillinru 5Z.W?iiGE7?IZiE7Hluwun'?lIILmum5Z 555 :EE EE sa 32 S2 Z-3 5-2 ,is 212 if V35 Q 0 -M'-2 f 4 pf.rmefrm-faww:'ww--f-rv.-W7-W---.-.f Iii v-ff. iff- geR2wgf-j:s1E5grQq-g,gz,f 521. :,:1c-.gf-: Y,-' gf-,, s ' ' ' ' ' .'.u-yfggeby ,J ggi Q A 21: J 2-fa-. '- h ' .-.. - sg wggf, ' 11,35 . ,...'-12 my f ,, E. 6. - , W , ' ,XSS .' -4' P, GW? 1. ' -Q? C 'J . H- 'vm fi.:-' if A 'oi f 1.1 . fi? E32 f ' ' fn ' r gas ' H -tg ' s Q I . , -5 ,ff '-cm: 21 EE -55 zz' - ' - - x -' 1 - -, , ' 5 2554 7 7 gas 5? -. .,.. ,:f, . V 1 Aw- , s ,.H..--1-- .A..-.QL L- - - - - -,,.,f --. -. --.-..- --..,..-. -. ..,. --..--.. .-. . . . , - ,haw ,. EEL , . . El: Ludlum Zrlmer Hodglns Groves Pcllow Wxlcox Ragatz Si- !! :iz -1- -' rr' A'--'F ' : ff' r- fr J f m Af , ' fl- or .g - V A -r 252 5 . gh I ' I f eg-1 f ,. I gg igi H - , Q., 19'f' -. - . ' ---if sis -E v p',' .mf ' , I , '-' ,Z SSE - ' .- Q, , V' fn, E55 - S Q A -ff' fi' 1 'dy . 2-5 X ' ' Sri - . ..,,. . -,,.-,. .,,g..,.-:... .. ,. .1 . , L - Egg 225 Erikson Schulz jones Kirch Robinson Hasenpfiug Maier E E SE - 2 gas 5 5 Q5 . . . - -f . 552 5,2 f I .- .fn . . - wa 55 -ff E: .+ . ,Q-.a: :':-.. gf'-2 -. - gg Axffg e' , 1 1 332 2 2 1 A41-.12-: ,iw - 3513-4 .gin H' 5 Q , - - ' , gig r , f . r ' 1 554 5 -V Q-: N.. Q53 1 .. . I fig, I H .ggi .W M I :.e::-H., -Q. U v 7, -vb rg 1 gm 52: 2 :1 f. ' iii?--3 M A T r. '- 2223 f - pw 'A 's 1 1 .. - . , .yogi ' , 5-E ,,55,1f ,L .QQ-,t I , f- --L --W , - ,,-r -of '- - 1. Q . 5 gg -AK' ' 555 -ZfFifi'1'-' F 1'7 f - if mi ' f i? , ? , V 5:11 .-5 gg- X :5.. ,Q .. - A V f. ,, H - , s- ,af Mi :sg me-mf-.,:. Q.: j ,:- - 7 3-1.3.1, Q f 3.15 I A , 4 .I ,gf L 2 4 X. 54 5, v::-,-,-:.- V , -,M AY WW, , WM N .. - . . 1 - . . If N . 1. gig - V, Ggwffgg if wW75Z-'5i,Q1xQ:N5 P Y' QM! W 3 ' ' ' Lewis Proudfit Olesen Turner Schaffner Baker Robertson 1,5 32 Cardinal Board of Control GARNET KLEVEN WHWNEY N. SEYMOUR Q25 :xl 5 :gs 235 ALICE PORTERFIELD ELEANOR STANCHFIELD -A ETHEL VINJE Stanchfield Kleven Seymour Vinje Portcrfiefd nllnlmnlllvllxllllLllllllklllkllllllltlllllvVlllilmlkllllhlmllllmlmvlKIIVIIIIIHLIIUIANIllIHHIUVIHHVIIAIIIKIIInlMIIillHIAIIIIIIHIIVIIVIIIVIIAIHNINIIIlllllllrlllllllllmhlllIllIllHlnllkulullllnlllullllblllVlnlllIllklmllllllklllluhllilllKIIIIAMIIllllllnllulllIllkllvlllulllllxlullmmllUI!KIIAVIJKIIUIHIIIIIIIIIUIILIIIKIIHIMIIIVIAIHVIIIKIHIHllllllllllllllulllmllllllllumillNKlltllmulmlulunlullxllmlnnnmllllmlmllllullllurmlluVIInlNvllulluulllunlllnullulllvllullnunlmnllullunllulluullunnlullllllnlE Page 271 glmmmmummmmnumInmmH.mmmmulmlmHInmmvuH.mminfnulmunummfuum-mmynmummKmmH4rnulHummmmummmvuHInmrnmumumminmm-mnnwnvmuwuulmuInmm.mwwfumumummyninmm.ummululHuwfmmmmumnumInfuummunInmmu.mmInInulmumminmvmnnnummummuwnumunmumvmInrnmumm,mmmn-ulmmmnwmummmumummmwwvunlmumnunumuummmwmumvnnnnnmmug 5 5gm.-1mmmmm.m..,ulK..mm.mnmmWmmmmuvWummm...W..mmm.um.HV..um.mmmW..mm.mm.UmmU.mmm,Hmmm.HInIninmWmum-.4mWmH.ummH.H.mxmmH-1.inmlmumIn.Hum.,umm.HN.unWW.MH.um.mmminmmwmm.UV..um.mmulummmml.HInumm.mmmumm.mmInInmnm.mmInmum.mmmulumm.mmIn-mnmm.vmmH.mm.wwInH1mmmmH.umnhnhlQ..151163LIIZWIGIIEEZEJEZGHIHZ E --- --2 Q......,..,.H.,,..,...,..,,...,,..,..,,......,.,.H..,...,..,,.H...,,..,..,W.,,.,,..,X.,,...,,.,..,,...,,H,..,K..,..,H.,..,,H,,..,...,..,,.MK..,..,,..,...,..,,..,..,,uala.,..,nm.z11.11amasszauazzaaanasnamanan:zzsansmananuananaz1zu:aaaan,ann:ansimswas1:1aanamassanunsasxanazsxaamaans:az1:sqcan:azanasainma:zacanmainmms.mm,..,..,,..,...,,...WK......,H........,.HH,..UX...H,,..,,H....X..,...,..,..M...,.,,..,,..,..,...,,.....,.......,...mn..,..........,....,.,K..H..,......,......W,..,H...,.,m..,l..,..,..u...m..f Page 272 - ' ' I' I 'gyzmtu A . -f-W fr -- it., - -- ' - Pa' - ' , F 'ff-emu., E L , Zgfsvowg:--..,,.? 1-zfzzyizweonsfa V Wwismpyf... , I f? ', .. I '- J alfa I we Q06 zlerafyf' I I . Pfazy I .fffaoazme I-...N 'Q 90,0 .4110 I gm V ..I-,N ,, t lp ,fffaynfmo V Quant, AMPE X - . f ness., y,,..m. 1 ' fm .W.iL,...t , ..,.iL,ii.,,i X W , ,4., W , AA.. , - .WWMM ..,. 4 an -M. ' 5,5 A ' All ,, . Ia are 5 - an 1 IA.. I IA- .IU Lim I ,4, , we A NIA. I. Rm. ma T5-s.,,,,'L' It 5'-ffm-f A, wIIIf'm.,I...I 77' ' EH- if 'ik-1.,, 4 MN' MIA. Dllmn 1- Rui, .,I 1-,,, I1.mmIf ' M- 0-M V A.. Is.,,,,, r-f-limi. Mr --im. Q. nw, .AJ du Yes-war G-neu-mrwu fm- .. pm A -,-55, ' w...,,M W, fs. , ' I -2-Q-up MIXNWKF' ' .,.,Mw v N , ..I..,.W,.. Wy, A W'f::z:m,.,. L nur:-Q.:-may .,.,....n.,.,,..t......f ...,,,gmL..,m ',,..,.,,...,.,, We-,Mu -M. A ,,K:::L:-W-N V Q-.zggm -w..,,.L,, .W t., ..., 5.1 ,M X , ml M ml W.. .M . ,,,, I o..,,..Iw 4 , x.X' J N.....I. uv F 1-N.-, up , N' - rw A The Wisconsin Literary Mczgazine ' An Exchange of lcleasi' -wb. mud Editorial Board IVIILDRED EVANS ....,., Editor-in-Chief Associate Editors .JANET DURRIE ELSIE GLUCK FRANCES DUMMER KARL HOHLFELD RAARIAN FELIX BERTHA GCHSNER ALICE VAN I-IISE Business Stay? KARL I-IOHLFELD ,.,..... Business Manager ADOLPH GEICER . . .... Circulation Manager FLORENCE FINNERUD . . . . Assistant Circulation Manager A Business Assistants RACHEL CVWMMONS FLORENCE I-IANNA KATHERINE FISHBURN ' RUTH SUNDELL GEORGINA SMITH Fishburn Durrie Geiger Hohlfeld Commons Gluck Felix Van Hisc Finnerud Evans Ochsner n ! N W laf1EI::Jgf1 1 I ' 'm12:22:2!15l2 X Hn H H X I H I 'I'I'I'122:miami2:erm1:11I 1 1I'I:IIiEEi5E2E552EEEH5:-I3:w,.H, ::m::2:222wmsff::2Mm::2f2:2r ...... Page 273 ,..,,, ,,n, ,,,, - -I an ---M IIAI I-MM---mmm IIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIII M N Imummmxnmmnx IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlmmmm Im In I IIIIIIIIIII IIIIII my II I 'I IIII IIIIIII IIIIWIIIIIIIIIIIIIIII I ' InIIIIIIIGIEEIRiBiGEiiEIEIIIEGiEiiREGEIiKI1HiEiEIE ' MT 'M 'n ' ' Im. II IIIIIIIIIIIIIIIII JmmumIuIInmmnInI1 mu II I IIIIIIIIIIIIIIIIIIIIIIII I I n 4 I I I II I I II I :Iv In II nLLIlImgggmILIIlvgp,g1Igg5gg 'I'l at mm! 'lll NIVIIIIIIQIIMLWIM 2 s . ' Y . V . 'XI UUH.ZE'l,e K . , mba Q. A 4 - ,Gm R, 39,X599,6qa'f g . 1Eh8907l8in 'GlI11SC9W5m , Rx X-, 1 W X I f : ASE 4., 1 X. 1 i f - .1 I 1 ' I - . ' '1 I K I 'Vx' I f Al A .Xl xt .,2,A I .. I . I , '4 I I I I 557142 Isconsm Engzneevm . Honor Roll CAPT. CHARLES I. CORP .,.... Chairman Board of Directors RAY E. BEHRENS . . ..... Manager W. EDWARD BLOWNEY . . ..,..,. Editor ROBERT B. BO!-IMANN WVILLIAM EERICKSON FRANK I-I. CIRVES I The .Smpf FINLEY L. FISBECK . . . Manager GLENN B. WARREN . ....... Editor HENRY W. KURTZ WVILLIAM B. BELLACK PHILIP j. FABIAN ETHAN W. SCHMIDT MERRILL B. GODDARD WVILLARD A. KATES Board of Directors PROP. L. F. VAN I-IAGAN . .......... Chairman PROP. j. G. CALLAN PROP. J. G. D. MACK PROP. F. E. VOLK ' PROP. E. BENNETT - Fabian Katcs Schmidt Warren 5 Kurtz Fisbeck Bellack I IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II In IImnIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII: Page 274 Zi: gsi E :i E2 isa sgl sg: I iii :EZ E22 I iii .I- sas :Ia .5 .I- ass :MMI,I,I,,,,,MIII,IIm ..NLMM,mw,MI .,,,, ,,,.., . LLm,,..m.l,,, .,,. I.. . -My,MLMIWU Nvvi uMl,,.lII,,l,I,. .,..,,..,, .. ,,,,,, ,.,,.,..,,,.,,..,,.,,..,,,i..,,.,,..nn,..,.,. I . .,., . ., .. I. I. .I E ' at 0' ! : Q. . r . .... , , , .W., . . . f f g ? I' . il ' N-m f - ref' f ' P . - 'ws I ,S AW - . .. ,.: ,-., tgp. ifaif - ,fn ' ' 62153125 2 .N ' j f . - l I I fr , - I: T' ' ,gf A 4 - ,gg My -I .m sgqqgzrv- g'.g I:f:..Ix.. -- . 0 i 1' .243 3 '?5'- '. ' -'ffkfafw ..7?f- 'Ii .I- 43 C M ' 8 . A'Brains with Business -Publislwcl by the Commerce Students ofthe University E Editorial Staf Ei? CLARENCE V. JOERNDT . Editor-in-Chief 232 XVALTER R, NEISSER FREDERICK S. STUHLER Assistants to the Editor EWART K. CLEAR 15 PROP. EDXVARD I-I. GARDNER . Faculty Editor-in-Chief 4- . Business Sfaf 3 WALTER E. MALZAHN . . . Business Manager WILLIAM METZKER I Z lst B . M iii RALPH STH-ES I . .aol-S' Clfl O LlSll le-SS Uflflgel' HAROLD R. NOER . .I . . . Advertising Manager EF RICPIARDJ. LOEWENTHAL . . Assistant Advertising Manager SANFORD F. SMITH gg? ARCI-IIE UERRBACH Advertising Assistants : . CHARLES I.. HUGHES ig 5 RONALD C. IVIATTOX . . . Circulation Manager MARY C. FOWLER . Assistant Circulation Manager in Faculty Advisors 252 PROP. WILLIAM A. SCOTT PROP. EDWARD I-I. GARDNER ?f' PROP. STEPHEN W. CIILMAN PROP. FAYETTE I-I. ELXVELL 5 I , S CLEAR NOER FOWLEP LOENVENTHAL STUHLER 2 NEISSER ,IOERNDT GARDNER MALZAHN MATTOX a QE 2 a I ii: 5 a 155 E imInnIIIIGIIIIIIIIIIIIIIIIIIIummIEITrIIInmIIImnIInuIunmIImIIuIIIImImnnInmmnnnnmnIIImxmnuIIIIImnmnImmIIwIIIIImIIIIIIIIIIIIIIIIIIIIIIIIIII I III IIIiTME'PMiIIEiI:IIIIIIuIrIuIIIIIIIIIIIIIIIIIIIIIIIuIImIIInIII:mIIuIIIIIIIIIIIImEmIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIuIIIIIIIIIuIuIIImuIIInIuuIIuIIIInInIIInms Page 275 V 4 1 ,-ni-m...m mmm g3..,...mW.....i. . ,ff ,... . ' -f ., 4 L i . , ,.,,, ff , W .y,,fn3?g' st . - 1 ..f3ifi?T.iQfi1l:Ri! g r ,M ip Z i i . ,,.,...--'Q'-',,f .fjf' JIT, ' 4 ' .. ..,, i. - ft gs-A f f- ' Wlgajggfi-,121,!,.Wf f ..f:-egg!!-.4. ., ,.f., W -X . . .'-- : .,., .i ly jj- - L-L--f--' Q . kv kk ,, l . gfffg N , ,Ze 1 - nw.: -T V V . '- F V ff -ar K -:ft MJ. ' fi fx .A-fwarewr ii.-fe l aww-J - a-if . , U. 1 Y- . 1 f- tr-g. ' . -'S ,e 2 I. i, - . . RH'-, ,, ' is-:.:::fazw V-1 ,' Y YQ may ' R i r 1 .. N YEA..- ... . -.s..Ea..,.. i i A 'Nj--r-v-.1-A , for R e' t 1 E gt The Re imental Ea le was the onl S. A. T. C. re imental ma azine ublished in the United 3 States. Three days after deciding to have a company weekly, the First issue of the Eagle appeared on the campus. The first issue was a magazine of 16 pages. The second issue contained 20 pages, with an abundance of cartoons and reading matter. The third and Final issue appeared with a colored cover, and contained 32 pages. Two thousand copies of this issue were printed and sold. With the clemobilization of the S. A. T. C. the magazine automatically ceased publication. Editorial Staff E. K. CLEAR, C. j. FOSTER . . Managing Editors BERTRAM G. ZILMER . . Athletic Editor C. IVICDOUGAL . . News Editor GEORGE DECKER . . Humor Editor Administrative Staff JEROME O. BJERKE ....... . Business Manager GEORGE COHEN . . . Advertising Manager C. CASSERLY ...... Assistant Advertising Manager IVIILLARD SERSTAD, ARTHUR UHL . . . Circulation Managers M. LESSLER ...... . Sales Manager LIEUT. J. D. WATKINS . . Censor EE Decker Uhl Cohen Casserly Halling Lessler Serstad McDougal Bjerke Watkins Clear Foster f i l 1 i mmiiiiiiiiiiiiiiiiiiiiliil5iREiiiIiIIiiiiiiiiiiiiiiiiiiiiimim MT ' t'n M ' ' i m' 'W '1fin:?mImmi Page 276 4 w 1 5 E 05 e - . ' MM . . 1 6,15 55l9wfaumn ,gc 691950 in 55' f329wtozw1 33'0x9iW'll llwuwffagagiue Etum1lSE91i0,99S Glumufcgaa fl Qmgnguw y : f 5'lf '1P W t l 5s::51Sil?iEi'jZ:J11'.' il 0 A if ll t ' ' ,R ,:j - - ,,,,, i H : ' F 1' iv'?ff'e-'1 '::' ,V , 'fi-' ' E '. I ' i ff f'PH1.- L f ' ' D pi . f Q .:,, S :::.:.' mlm-hqswifl l l? 'A,f! 'S Y-4-L .Jl A l4!iZ...'aLC5Cl3l ',l .:.i.-.-'li p '-4-fm::: mga. ,H :Zinn ll Che Alumni Magazine Ojzicial Organ of the Alumni Association of lhe Universily of lWisconsin 3 The General Alumnz Association Membership: ls open to any student, graduate, or former student, or any person who has been or is affiliated with the University, Object: To promote the welfare of the University and to encourage the interest of the alumni in the University and in each other. Numbers: Membership is made up of more than 4,000 leading men and women graduates of 5 the University. b Fees: Two dollars a year, including subscription to the Alumni Magazine. When the Old Grads Return 5 , , -1 -f-'m---- , 4-41-ff-ff-f1'f'ffff- ' ' -Lf1l'N-A .,,, ''W- L '2f'f LlLi?H f1 ' 'n's 1' t : l '''w ME5?EE??l5izig Page 277 mmmmnvmmmummnmnnumvumlmnuulun,mmnn.mmmmnn1mmlmummm.mmmWnummmmm,nuulmum..1mummm1InInmlm1mnlwInvu1Inummmul1.mmmrmmvmulunIn1InmvmkmmumummmmmmnnnlwInummmnlmlmwInyunl11HwInnum1InfuXInuninunH.1yu1HXInm1mmXinrmin1InrmnumnlulHI.1H4Inunmymnunlmlny1Inru1InvuX'mm.Hmvmm5-I1mLgNm1ulmyuuummmgmvmnn.mmunmumlmuunmunmqg E 55lmmum-1mmEMEKiFiiiii?iiRi1?iZiFiiiiiiiiiliiwililnhi!Ehwn1innuInfmwuvinmwnumm1uvmwnlmmmInmmummmmfm1ufmyI.wruwmulwnwnlwuv:mmunnnmummmrm:mmannmuwInmunvmm1mmnunl1m1mvu1InlmmmuInnnmimuvnunuInmymnnmfmmwm1ynunInInunin1m1uNmNm1nrmmm,1InvmInm1mmNmmuininNIn1Ininmyul1Wunumlmmmuwmnfuul1WInulwwuwnu1InrnwInnumnummm'wulnnnnnumnwuunmuumlmgg -5, -., 5:5 555 :gg 11: ESE 525 555 :is EEE :sz sas 555 sas EEE EE -sas 355 z 531-ggmwgfggywgggggigygymml3515!M13,X554X.51I.,W.U,1.1H.NK..1.HXV.,w..W,.m.,..m..,Wm.mm.mmmm.ww.mm,mm.WL..WL..XH4X.UN.Xy..L..H.mm..H-W.HH.XmX..X,HX.IXK..X..XWX..,,.1H.1V..1H,H..WU.X..XH.1..U.,,y.XH.,H.H.,.H.H.WH.,..XV.,XWIn1UXX.I,KuN.,W.HHXm1Nmw.Hw..wInU.wmw.Hyuum.-nm.m.n.m.mmmw...m..1mm.uw..inWuv.WH.X..XInunWUmlunmmWV..W.um..WL...H.WmmXrm..m.um.m.mmmmm-uni -4, mm,mm..K..YH.Y.mY..,,W,,.Y,,.H..,K..Y.NY,.,H.YV..,Y..YV..,,.,,.NH,...,.MY..,H.Y...Y..,W,.,,Ka.,.1an1anzz:,anin19:11:112:1an:as1inii:1:mixisa:ia5:91:mmmuman1:11:izza:15:11:51:ismanain151mm:1:si55:zzz:Imaz:5:51an5:1as1:511asfanian:iziii1inLi:faq:sinsinsin1:91asiii:an:inin:inimtiesi:zzz:1:21zisiiiiissisisziiiisiin:nazianmiGmini::GaiiiHmanmsic:iz52:1:5anisfilm:mmmmxziniiiainmismnimianaziwizniimnzzmzzniui.um......,un.,....1,.....m..m.,,u5z.1a, P a g zz Z 7 8 :sz I 4 I zu Harfesfoot Dramatic Club Incorporated Moore Hemsing Lindsay JOHN W. MCPHERRIN DAVID W. MOORE JAMES M. LINDSAY JAMES BRYDEN C. HAROL.D RAY . PROP. JAMES M. O.NEILL JAMES F. I-IEMSINO N. BRADLEY I-IIOEIE WM. K. I-IOWISON ALVIN R. KLANN JAMES M. LINDSAY CARL W. MAEDJE I I Sumner Klann Higbie Mcpherrin Ray Morice Brvden Ojfcers . President Vice-President Manager Secretary Treasurer Honorary Members Mem bers - .. x . Kline., 5:- R. 1 9 III..I..mlm.-I..-,IIII-.Iml-.I-HI-IIIIIII-...II IIInIIiIiiIIiIRISIIIIiiiiiiimiiiliiliiiiiiiii?iiSIiiIii1CmmI Page 280 PROP. JAMES F, PYRE WILLIAM MCCOY JOI-IN W. IVICPHERRIN DAVID W. IVIOORE ELTON K. IVIORICE C, HAROLD RAY WVILLARD C. SUMNER I., nm I I.m.m..mI II u In Edwin Booth Hodgins Crownhart Schramm First Term ARTHUR N. WVILCOX ELLIS A. STOCKDYKE . . RAYMOND E. HOLGOMEE . ROBERT M. BREXVER . . CLARENCE F. SCHUBERT . EUGENE HUGH BYRNE ERNEST ADAMS CHARLES EDWIN BACH ALFRED J. BAUER JOSEPH BRIDGE BOLENDER JAMES L. BRADER WILLIAM COLLINS JESSE GEORGE CROWNHART HORACE KLEFFLER DEAN ADRIAN DORNBUSI-I LEONARD FREDERICK ERIKSON HAROLD MANSEL FIELD HERMAN KENNETH HARLEY GERALD BURCH HODGINS Adams Harley Schubert Holcombe Holcombe Ojqcers Second Term . President . . J. GEORGE CROWNHART Vice-President . CLARENCE F. SCHUEERT . .Secretary . . RAYMOND E, HOLGOMEE . . Treasurer . . . FRANK H, SCHRAMM . Keeper ofthe Mask . . ARTHUR N. WICOX Members in Faculty SCOTT HOLLAND GOODNIGHT Members in University RAYMOND EDWARD HOLGOMEE ROBERT LYNDON HOLCOMBE MALCOLM MECARTNEY FREDERICK OLDENBURG ALFRED MOORE ROGERS FRANK HIGGASON SCHRAMM ALBERT SCHAAL THOMAS LEROY SHEPHERD CLARENCE FREDERICK SCHUBERT THOMAS FOSTER STRONG WILLIAM WAGNER RODNEY WELSH STANLEY WELSH ARTHUR NOBLE WILCOX A W, -, .I M3545-I.: .w.m..I..I mm.Im..IIIIIIIWIIIII I 5 yggglggggglvg ii?ii1iii1iiIiiiIi?iiiEIIEIIIIIIIIIIIIImImIIIIIIIIIIIIIIIIIWI Page 281 IIIIIIIIIIIIIIIIIIII I -.!IIIIIInIIIIIIIIIIIIg25935333 IIIIIII I Im I IIIIIIIIIIIIIIIIIIIIIIIII I II I I I I I I In II I II I Red Domino Samuels Little Hanks Dennett Ryan Fleming . D 'SmIth M. Smith Ochsner Chubb Durrie MItche1l Ojqcers MAVIS CHUBB . . , President BERTHA OCHSNER . . Vice-President JANET DURRIE . Secrezary MARIE MITCHELL . Treasurer MABEL SMITH Domino Honorary Members MISS GERTRUDE JOHNSON MISS MARGARET I-I'DOUBLER MARGARET BELKNAP MAVIS CHUBB RACHEL COMMONS DOROTHY DENNETT FRANCES DUMMER JANET DURRIE CATHERINE FLEMING DORCAS HALL JULIA HANKS HELEN HARPER I-IILDA KIECKHEFER MARY LITTLE I IGIIYIZTI Active M embers I . , -.eq Rf T 1- ,L Q Safe' :IN A Page 282 MARIE MITCHELL XVINIFRED MOSS BERTHA OCHSNER ELEANOR RILEY FRANCES RYAN AGNES SAMUELS LOUISE SAMMONS MRS. R. F. SEYBOLD DOROTHY SMITH MABEL SMITH SOHNIA SINAIRO MARGARET TITCHENER illliliii??iiEiiiimiliiiiEIEEIIIIEEIIEIIIEEIHZII I Twelfth Night l R , V , 1 9+ Parkmson Briggs Schultz Loughlin Donaldson Coburn Ramsey Harrington Haley Tucker Colby lvlozingo Willman Miller Serwatius Cumnock Harker Lathrop Strong Radford Smith Ojfcers MARGARET LATHROP . . President ADELIN BRIGGS . . Vice-Presidenf HELEN COLBY . Secretary MAUDE MILLER . . Treasurer HELEN RAMSEY GERTRUDE JOHNSON ADELIN BRIGGS ELIZABETH COBURN HELEN COLBY BEATRICE CUMNOCK MARGUERITE DANA MAR JORIE DONALDSON MYRA HARKER JULIA HARRINGTON IRENE HALEY CONSTANCE KINNE MARGARET LATHROP AGNES LOUGHLIN Honorary Members ARIEL MGNAUGHTON Active Members Wardrobe Mistress ELIZABETH HUNT MAUDE MILLER ARDIS M. MozINGo MARY PARKINSON HELEN RAMSEY RUTH RADFORD MARGARET SGHULTZ FLORENCE SERVATIUS HELEN SMITH MARGARET STRONG F RANGES TUCKER CHARLINE WACKMAN MADELON XVILLMAN KATHERINE PAGE WHITESIDE I ImmmInruImInImInImmnnnlummnnnn IIInInumInInInnmIIIInInrunfvmIIIIIIIIIIIIIIIIIWIIII Page 283 IIIIIII IIIIII I II In II I IIIIII II IIII I II IIIIII II I IIIIIIIIII I I III I I I IIII II I l l ' 'V oclvil Fuller Opera House, April 24, 1919 The Acts H: A. Contortionist-George W. Martin B. Behind the Beyond -Twelfth Night Dramatic Society 'g ig Characters: Madeline Willman, Charline Wackman, Ardis llgflozinglo, Fliances Ellen Tucker, Adelin Briggs, Margaret .' I ana ulia arrington V fJI:.- -.refer - ' 'r ' -- - -- -A -- -- -I - f C. Melody Mixers - Kate Fedde and Peg Kirch IE' ,. D. W. A. A. in a series of interpretive dances ,I',ff3f3q35 The dancers: julia Hanks, Bertha Ochsner, Eleanor Riley, ,,,, Gertrude Gleerup, Dorothy Bridge, Gertrude Noetzel, Mary Parkinson, Agnes Samuels, Louise Samrnons, Louise Weld, Marie Hjermstad, Francis Tucker, Elizabeth Waterman. W Frances Dummer, Adelin Briggs, Lee Bacon, Margaret Schultz , E. Comedy Prestidigitatorn-''Sparks' Dodge 13. 72, F. i'Signs and Wonders by 'Field and Companvu l v-ji Charagers: Harold Field, Alfred Bauer, Charles Hughes, Fred- 'I I eric ldenberg , 'Aii 7 G. The Golden Doom -Edwin Booth Dramatic Society Costuanes and scenery designed and produced by Adrian Dorn- ' ' US ' E Characters: Clarence Shubert, Ray E. Holcombe, Frank Schram. Marjory Donaldson. Thomas Strong, Robert Holcombe, llzllagold Field, Alfred Bauer, Frederic Oldenberg, Gerald , :aff-xiii , . o gins A ' fl Production directed by Ray Holcombe and Adrian Dornbush i'Assassins of Sorrow-Charles Carpenter and Fred Bickel H. Overtones -Red Domino Dramatic Society Characters: Katherine Fleming, janet Durrie, Flora Filtzer, Hilda Kieckhefer I. A Few Topically Typical Tunes -Horace Carver and Philip Reed J. The Minutes of the Last Meeting -I-laresfoot Dramatic Society Characters: Willard Sumner, William McCoy, Leo Fee, Bradley I-ligbie, Wesley Tuttle, Floyd Hewitt, john McPherrin, Alvin Klann, james Lindsey, David Moore, Elton Morice, Harold Ray, James Hemsing. K. Pi Phi Pholliesn by the Pi Beta Phi Sorority jazz Chorus: Aletha White, Helen Archibald. Catherine Bur, Thelma Johnson, Agatha Hahn, Dorothy Hollands, Marion Pierce, Autentia Porter, Hazel Wright A jazzmine Buds Chorus: Katherine Tenney, Helen Clayton, Grace Goddard, Mildred Kern, Lucille Kessenich, Helen Ramsey, Gretchen Schweizer Fascinating W Boy: 'iTommy White, Marge Donaldson and Chorus HERBERT M. BAKER . RONALD C. RAMSEY DAVID C. MOORE . . ALVIN R. KLANN . GORDON E. ADAMS . . WILLARD C. SUMNER . , OWEN L. SCOTT, Chairman Production Sta-If Production Manager JAcK BIGLEI2, Chairman, FRED C. KELLOGG , . . i Asst. Production Manager Program and Floor . Stage Manager Joi-IN W. MCPHERRIN, Chairman, .JEROME BJERIQE . 1 t Asst Slave Manager Adverlisme' Union Busintfis Manager JAMES M. LINDSEY . ..... Property Master Musical Director MERRILL C. GODDARD ....., Electrician . . Puldicizy RALPH BLIRT, ROLAND HANX'K5, CI-IAIzLEs READING h Property Assistants Baker Ramsey dill III II I I I I I I II I iiiiiiiiiiiiiiiiiiiiliiiiiiiiEZREEFIIQIZIEZK I E i i' 'i ''W1 T ' TiFiii 'fT'TI ' ' I II Page 284 gmmmunmumnuunnu1mwuf1InwfuuufuvwHwInnuinwmwfmvurm3Wwgmwnfrmin1In1Hw1uwInwuww.1wInwInwnwInwuwvumww51wnwunIn1HwrnwnvwInmmwInfu1fn1Inru1H+wHwIn1.I1vu1yuw.11mnvvmwWufwInm1fl11.ImmmmmmmInm11-wu1.1unmwHwrnXInfu1mwInruuIn1uwruXuu1n1muyuwInuIn1nwIHwuv1uwwnwW1uuuuurn1m1uw1uwruuInwInwuwfuwmwInrnwmwInwuwmwnl1mmwnnnuruwmwInruwmwnuwrnnnnuwInvuwInwInnnw+uwul1u1uwInuvufuwnmrnwmwnmnmnummmwU 5T...-gmmmmEmmi:mm:WX:Zan:ml5:M4WinW'iluhXmXvuMmWH5mlmn:RmlmKW:WM5:MIman5:1inanmmingm5:mx:an1Wmmmmm.- ..,...,...,..,..........,,..,...... . .,...,. .....M .....,.. W.,...,.,.. .....,... . .,... , . . ,.,... . ..,.., ,..,... .........,. . ,..,.. ......,.............. ,... . ..,..,........,., , .,...,,...,,,.....,.,.,,......,...... . ..,. ,. ,.... . ..,,..... , . . , ..., ...,......,...,..,,., ., .....,.,,..4,,. . ,.,,..,,.,.,..,..,,. E,, . ..1,..mu.HL..X..,H.....WV...H,.....U,U,..,,..,..,L.....l.......,...,1.,H.N.,1H,N.,..M.,V.,,..,,..,K..W...W,.U,..1W,..,.......H.H..,,..,.H,..,,..WH.W,..,N,W,.4,..,...W.W..,..,..mmv.ww..,H.,-H...1.HL...X1HummH.1...4...N.Hmm.,In11.,V..1In11.XN.W1.1,Hm.m.mmmm..555 E55 ii: gy ESE :ss ' sr S! EEE . wiq uwmvow'L ' .V'.' fyyfffzfr fi 5? Ei , 55 dw 5:5 E5- si EEE E Es: E E. if E2 ii EE- E 555 E55 ESQ ' ,.: nn nv 55 EE mn mm mn mu mm nm gg5.....,......,...,,..H..,...,.,.,,..,..,,......,...,,..4,......,.....u.N...,M...,..,..m...W.,..,,.,,..,,...,..Y..,..,,..,X.,H.,..,...,..,...n.,..n..,..,,mmmu.,..,,..H.,,..,..,,.,,..,..,WW.,..H.,.H...H.,...H.,..,......1Y..Y...um.,...W..,..,..,Y..H.,,..,..W.,...,..W.,..,....,n,.W..,...,,.,M.,...V..,,..,..,,..H.,,,.,..,,..H.,,..,......,,..,..W,...W,.....,H.,..,,...,.n.,H..,..,..,,...,,.,,........,,..,.WK...m,...,....,,m.m.,....n.,..n..,,.,.,.,....,.x...,,...M,..,...1..,,.,l.,,.,.,,.,,.....,m...,...,5E smnmnmmmmunnunnuumInwInin1znfinlmiiiniIii?iii?FEllllliiPUSH?HiEEEIiliiilQIEFIIIYIIEEIHEFHIiliiiiiiEHIEEIEEEEiFQIIEIIGFIEEEEIIEEIli1ii?EEiiiYi1UEiiEiiIiiIiiDiEii?PFIEIIIIIRQHQIIPISIEIEI1mvmlmEEG:umwInInmvInwmInwuwnuInfuwmmummInnuuumnunumInmumInunnvfmmmm.ummmInnunl1uuummmHmIn'mm1mInwInummmmnnmvmInmmmmuummumnmmmnnummumInummInummummunmmlmEi?EE5EiiIEmui1E mn mu Page 285 nmmmiumm I Inu n u I I n II um II ru II I mu I num uinusuIummmuirniumnnmiminiinvmimuuinmig mmm, . .IMI . ...nm .I H. I .I .I..I........m....... ..I,.II.I,-m.I.... mi.II,..,...i.-InM-mm-mmnmimi-mmImunmn.nm.m2 665718 S. A. T. C. Frfolic The Minstrel Show Production Staj LIEUT. RALPH I-I. MCCURDY ARTHUR N. WILCOX . . BRUCE CARTTER, MELVIN LUTHER . LYLE BROWN, ROBERT HOLCOMBE . HAROLD FIELD .,.. . Director . . . Manager Business Assistants . Property Men . M alze-u p Man Performances Fuller Opera House . . University Gymnasium . University Gymnasium . Program Thursday night, November 14 . Friday night, November 15 . Saturday night, November 16 'EE .E as :gs ES EEE 525 a 52 35 is E E53 1 Boxing and Wrestling Matches 5 Wisconsin Tumblers -Q: K, A ' WOODWARD TASCHE GOLLEY 2 ln Fair Hawaii ' Hula-Hula Dancer: DONALD MARVIN 6 SOPVUHU 3010, Female lmPGfS0 lf1fl0'1 E Soloistsz WALTER HEWETT, NELSON LA W- WARSINE HGANPE O h f 10 - 7 Minstrel Show 35 awauan rc astra? plqces Interlocutorz L. N. THOMPSON Chorus of 8 Hawaiian Maidens , 5 Endmen. 3 Exhibition, Double Manual of Arms IIQIAVE IVEAHONEY C1-ICURTI5 M ARRY WEENEY AY OLCOMBE ERVIN FLOM' CLARENCE DONALDSON WALTER HEWETT GEORGE BARTLETT C. O. DRIVER LEO RODEMS ig 4 M ' l A . MZ:SZEYwkwardgiuad jiggersz NVASMUTH, RODENTS TTON . . . . , BART!-ETT LOUGHLIN Eccentric Violirust. KREPS Q gg CARSWELL NUHU5 jazz Orchestra: HUB LENZ, Director CRAIK POSTEL Grand Chorus of Twenty-five Voices 5: gs 33 In Page 286 T mmmmniwunummimnmmmmn ,...m......?irn-n.mmaEmmiimm.. ..,.. ........ .... -. .,.. .....,.. 5G7ze University Band WIVLLIAM E. YATES ' Conductor Conditions were unusual this year with regard to the band and many Obstacles hindered its progress. The first quarter a band was organized in the S. A. T. C. Its progress was slow because of the limited number Of rehearsals. After the demobilization of the S. A. T. C. we were left without a band as only a few members returned. At the beginning of the second quarter a new band was organized. This band promises to be a first class organization in a short time. With the co-Operation of all band men here in the University every effort will be used that the standard of the University bands may not be lowered. Personnel Piccolo I-l. A. STOLEE HEAD W. B. K 4 F. A. AN ANT . ONESTEEL OEHLE1 D. S. DEWIRE J. S. I-lEss u es I-l. GLAETTLI C. A. HOPPERT Clarinets P. C. QUENTMEYER I.. W. MORRISSEY M. D. JACKSON A. G. MELHAM R. C. MATTOX M. B. GODDARD Saxophones D. B. TERKEL L. M. KELHOFER I-I. L. ALLDS Comets W. P. HANSON D. R. LAMONT mi u u I mmmwmmmu nm: mmuimmummmimummmmn mmmimnumun uumumummun:mmmm:imnmwmummnnu W. W. JUNG F. O. RIEK P. A. FOOTE I-I. P. BOWMAN Trumpets C. A. BRODT C. CAMPBELL Horns D. M. BENNETT G. B. WATSON I-I. M. HUCKUK B. MACQUEEN H. J. DUETSEH Trombones W. J. SEDER J. I-I. WEGENER W. J. KLOSSNER P. SANDERS P. E. BOLLINGER Baritones C. ERICKSON E. N. PETERSON Basses A. C. WILGUS L. E. JACKSON K. K. CHEN Drums T. M. THOMPSON R. E. FROST I-I. D. CHAPMAN E. M. HINTZ mu nm mminTmmlmuimumummmlummunmunmnmun I ui I ii nmimmu.mmmmmmnumuimmumiiuiimniluunmmmiunmuunmnunmuui Page 287 niuiimuummmmmmnrmmnummnnmmm m The University of Wisconsin Glee Club Fa k Gnagi Adams Slalcer Carroll Mackay 1-lasenpflug Wolfe Gregg Hexvecc Coon Moody Goddard Sharp l-lintz Schxvmn Smngh Driver Burdick Swinney, CDirectorJ McNamec Fenner Walker Roberts Officers RUSSELL M. FETTER CAMILLES O. DRIVER ERNEST ADAMS GORDON l-l. SHEPI-IA ID CLARK j. CARROLL MR. E. E. SWINNEY l'lARLAND B. WALKER ELMER M. l'lINTZ . ALI ISON L. BURDICK CAMILLES O. DRIVER RUSSELL M. FETTER JOHN W. GREGC WILL GNAGI ERNEST ADAMS GEORGE W. COON XVALTER K. SCHWINN CLARENCE A. FALK MERRILL GODDARD CLIFFORD E. lvES Personnel First Tenors SIDNEY MOODY Second 'Tenors First Basses Second Basses IIIIII.IIIIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 288 . . President . Vice-President . Secretary . . Treasurer Business Manager . . Director Librarian Accompanist j. LEROY HASENPFLUG SHURLEY L. MCNRXNIEE WVALTER W. l'lEXVET'l' EDWARD l-l. ROBERTS ARTHUR W. XVOLFE GORDON l-I. SHEPHARD DON V. SLAKER HARLAND B. XVALKER RALPH W. lVlACKAY HOWARD M. SHARP OSCAR E. SMITH IIII II I The PI adform Beach Wishnefsky Groves Review of 1918-19 Forensics The opening of the university year in the fall of 1918 found practically every star NVisconsin debater of the past two seasons in the service of his country. Most of them were commissioned officers. Two of them, Guy Black, '17, and Harold E. Kinne, '18, were killed in action. Out of the chaos of the Hrst quarter-the Student Army Training Corps, the joyful celebration of the armistice, and the return of many students who had rallied to the colors at the country's call-after this rapid turn in the tide of affairs, the university entered on the after the war period, and forensics revived with the opening of the second quarter in january 1919. The First Annual All-Forensic mixer became a reality under the auspices of the Forensic Board at Lathrop 1-lall, Feb. 15. Members of the five literary societies, Athenae, Castalia, 1-lesperia, Philomathia, and Pythia, participated in the very successful event. One representative of each society made a short speech. I-larold M. Groves, president of the Forensic Board, was chairman of the evening. Fletcher C. Cohn, '20, of Athenae, won the final oratorical contest and the honor of representing Wisconsin in the Northern Oratorical League contest at Northwestern university in May. His oration was on The Short Ballot. Keats S. Chu, '19, of I-lesperia, was awarded second placc with an oration on i'China and the NVor1d Peace. Chu, who was elected president of Hesperia during the second quarter, is a member of Artus, honorary economics fraternity, and is also president of the Mid-West Chinese Students' association. Marguerite L. Schulz, '21, of Pythia, and Charlotte J. Calvert, '21, of Castalia, were elected to represent their societies on the Forensic Board following long contemplated action by the board to provide for women representatives. Miss Schulz won first place in the sophomore oratorical contest, and Gladys E. Riggs, '20, of Castalia, was awarded Warren first place in the junior open oratorical contest. imiiiiiiii myI.i.iii-.ii-ii-iwiiiwii i-ww -ig iggiu iiifiiiiiiininmiluiiniiiiiiiiiiiuiiiiiMiiiniiwwnmwwm I Page 290 HW' Hayden Cohn Chu The Agricultural Literary Society reorganized and elected officers: Elmer R. Clark, 'l9 president-, l-lugo A. Stoltenberg, '19, vice-president, Nels T. Nelson, '19, secretary, l-larold I-I. Cole, '20, treasurer, Bruce L. Carter, '20, sergeant-at-arms, Charles King, '20, was elected to the Forensic Board. Athenae and Philomathia will meet this May in the annual joint debate which looms up as the biggest forensic event of the year. Government ownership of railroads is the question on which the Philcmathian team will uphold the ahcirmative against Athenaes debaters on the negative The scheduling of the intercollegiate debates, which had been cancelled because of the dreary outlook in the fall, met with so many obstacles that the attempt was given up. The freshman oratorical contest, the joint debate, the Northern Oratorical League contest at Northwestern, the sophomore semi-public debates between Athenae, Hesperia, and Philomathia, and the annual Castalia-l-lesperia and Pythia-Philomathia parties, in April and May, will mark the close of the l9l8-19 forensic year. The inter-literary society championship in debate and oratory will be decided by the outcome of thejoint debate and the semi-publics. The winner of the joint will receive four points, the loser two. Each victorious team in the sophomore semi-publics receives one and one-half points. Athenae won the championship last year, and already has six points towards this year's honors, Hesperia has four, Philomathia none. Prospects for next year are hopeful. The Forensic Board is co-operating with Prof. J. lvl. O' Neill, chairman of the public speaking department, in efforts to arrange for several intercollegiate debates in 1920. The Regents' appropriation does not cover necessary expenses. I-lesperia, this spring, will choose her joint debate team to meet the Athenae-Philomathia winner next fall. 'The oratorical contests will be held at the beginning of the second sem- ester as in previous years. All of the literary societies have been holding their regular weekly debating programs since the opening of the second quarter. An increased interest in forensics has swollen the membership of every society, the women have been granted representation on the Forensic Board, the -Agricultural Literary Society has been reorganized, the first annual All-Forensic mixer has been held-everywhere there is an atmosphere of progress which predicts a banner forensic year for 1919-20. Schulz l ......EEEEEIEIEIEi!............EIEEEYEIEEIIIHI!fl!!f!!!..,..... HW ' U 'N'3 ! umuuiinimiuiiuimuiiniinimmumnnuiiiminmumiin iilfiljLilimiilim,iiiiiifiiimlul 1 Page 291 g1ggg1g111g3u111-1151511515111 1111131111g111g15!1199151151 1 1 1 111 111111 11111 1 1111111111111111111 111 111m3111n111m1w11111111111111111111 111111111 11111111 11111111111111111111111111111111111 11 11111111111111111 11111111111 11111111111111111111111111111 1111 111111111111111111.1513gE ...1..1..1..1....11 ...1......1... n........ 1 ......... . ..1...1..1...1....1.. , 552111 11111111.11.1111.1111 EE 3 1 ' ' ' Y Fr' . olnt Debate 1 JJ, 1 lx 5 - Y 5 4831 Annual Joznt Debate Mayf, 1919 ATI-IENAE vs. Pl-IILGIVIATI-HA Gov. EMANUEI. L. Pl-IILIPP, Chairman Question: Resolved, that the United States Government shall, within Eve years after Nov. ll, 1918, own and operate all steam and electrified-steam railroads doing an interstate business. PI-I I LOMATI-I I A ATI-IENAE Affirmative Negative JAMES M. I-IAYDEN, Closer BEN M. WISHNEFSKY, Closer E GLENN B. WARREN l'lAROI.D NOER WHITNEY N. SEYMOUR lOHN I-I. VAN VLECK EE E! e e s El VanVleck Wishnefsky Nocr L.,,,,,gg,ggwgjggllhlv1g3,wmg,M mmmmmm 111111111.1111111111111..11.11.1.1.11..1.111111,1....1,.1.1. 1 11. M. 1 MEL but1.111.1211.111.1111111111.1111111.1.1111..1..1..1.111...1..1.1..1......m.11..1.....11...111.m.11.1...1..:- 1111111111111u1111u1111111111111 1 1111 1 11 1 1 1 1 1 1 1111111111111111ii111111ii11111111i11ii111111i111111111E ' 11 111 111 1 1 11 11111111111111n111111n1111111u11u11m1111111111uu11u111111i111111111u11u111111n11u111i1111111u1a1e Page 292 gn E E E 5 5 E E E E E E E E , .1 Ei gi ummmniiimimimuiii F umm..mm..i......ii 3 E S 2 2 ls E S 9 E 1 E 5 E 5 E 5 um mmm mmm if Ei ngimq E mmmmm uuummmm ummm .mmmimm Ei Ei at si Ei ,I 21 51 if Ei E! E E E Eff ae W 3 ' 1 i H' oznt Debate f v 3 Hzstory of the joznt Debate The '91 Badger printed in 1890 says of the joint debates: These contests are the pride of the institution, their participants the heroes of the college, the realization of the grandest possibilities attainable through service in the Cliteraryj societies li 4' 3 each succeeding struggle confirms the truth that in the production of powerful debaters the University fof Wisconsinj stands foremost among the educational institutions of the country. The first joint debate was held at the Chapel in 1867 between Hesperia and Athenae on the question of the constitutionality of the reconstruction bill of the 39th Congress. Hesperia upheld the negative and won the decision. Burr W. jones, Madison, Wis., widely known at present in the field of law, was one of the three members of Hesperias winning team in the Hrst joint debate. He was also on the Hesperian joint debate team which lost to Athenae in 1869. President Charles R. Van Hise of the Univer- sity of Wisconsin, who died in the fall of 1918, was a member of the Athenaen joint debate team which defeated Hesperia in 1879. Francis E, McGovern, former Governor of Wisconsin, was on the Athenaen joint debate team which won from Hesperia in 1890. The late United States Senator William F. Vilas, ex-United States Senator john C. Spoonerg the late john A. Aylward, United States District Attorneyg judge Evan A. Evans of the United States circuit ccurtg Prof. Elmer Robinson of Leland-Stanford universityg Dr. H. L. Smith and Professors Chester Lloyd jones and julius E. Olson of the University of Wisconsin, and many other prominent men served on joint debate teams. Victory in the joint debate carries with it the debating championship of the university. Athenae, Hesperia, Calliope, Lionia, Adelphia, and Philomathia are literary societies which have figured in joint debates. There were nojoint debates in 1870-71-72. The debate this year between Athenae and Philc- mathia will be the forty-eighth annual joint debate. The joint debate has gained nation-wide prominence. Many of the debates have been printed and filed in the Historical Library. T Hayden Warren SeYm0Uf ..i..i..ii..i..w.ii.m 1i..i..m.,..ii.w-i.,i miiiiiiiiiiiiiiiiiiii imiuliiilmniiwui Page 293 mn I I I I III In I I I I I I Inu Im IIII In Inu IIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIII un: I In :ff Q A 1' Af A 1: f . I . N211 I W ,,,- 1 A 2 A.,.A . A 1 I .LC I I A - -iii , tg '.-- :Iii ,.vA, AW ' J 'i'11 if ' CD4t11enae M embers 1919 MAHLON H. CARADINE PHILIP F. LAFOLLETTE PAUL H. CONWAY HAROLD R. NOER JAMES GREENBERG CHAUNCEY J. PELLOW BEN F. WVISHNEFSKY 1920 MAX ALBERTZ RUDOLPH R. KNOERR ALFRED J. BAUER SIDNEY F. MOODY JOSEPH B. BEACH LINCOLN QUARBERC FLETCHER G, COHN WVYMAN S. SMITH PERCY F. DORNBROOK RALPH D. STILES LAWRENCE HALL JOHN H. VAN VLECK KENNETH HARLEY GOODXVIN B. WVATSON GERALD HODGINS FRANK E. WILDER 1921 BRUCE M. BLUM CHUNG LUI SYDNEY C. CHARNEY 1SADORE A. PERSTEIN XVILLIAM D. CONNOR XVILLIAM H. PIERRE FREDERIC A. DOERELER FRED RUFFALO FRANK E. DRUMMEY TAYLOR H. SEEBER MAURICE E. FIELD ARTHUR C. TAYLOR CLARENCE E. FUGINA FENG TSAI SIDNEY B. GOEE JACOB M. WEISMAN FRED G. KRIVONIS ALFRED E. XVILLETT IOHN C. LOWE WVALTER E. WOLF SAM ZADECI4 1922 HARRIS ALLEN ARTHUR AYLWARD MELBOURNE BERGERMAN JEROME O. BJERKE PERRY A. FOOTE ALFRED KESSLER CARL W. LINDOW .III..m..II.II..II.III.IIIII..II.w.II..II.II.III.I IIII.IIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIII Page Z94 GEORGE C. LORD DAVID J.. MAHONEY BIRNEY F. IVIILLER ALBERT K. ORSCHEL RALPH B. SPENCE SAMUEL SYGMAN ANTHONY C. TRAYCER uni 1 i in i i ni runner iii iii :min ir rniirmiiiriiiiin i i ui iv i I I Cbithenae Moody Bauer Smith Drummey Spence Hodgins Wolf Lowe Dornltarook Perstein Miller Docrflcr Lord Pierre Fugina Greenberg Hall Willett Quarberg Kessler Van Vleck Goff Pellow Harris Stiles Aylxvard Albertz Wishnefsky Noer Beach Taylor Cohn Foote Cha rney Weisman Sygman Orsrhel Field Bj erke Ojicers HAROLD R. NOER, JAMES GREENBERG . . Presidents RLIDOLPH R. IQNOERR ...,. Vice-Presidenz KENNETH HARLEY, RALPH D. STILES . Secretaries SIDNEY F. Moom' . . . . . Treasurer Athenaas History At the very beginning ofthe university, the need of a good literary society was felt, and, largely through the efforts of Prof. J. W. Sterling, Athenae was organized in 1850. Two years later it was incorporated under the laws of Wisconsin with Levi Booth, Charles T. Wakeley, George W, Stoner, 'D. K. Tenney, Francis A. Ogden, and George Woodward as charter members. Meetings were first held in North hall. Athenae won every home, two state, and one inter-state contest during the time that the uni- versity was a member of the Inter-State Oratorical Association. The I-lon. Robert M. La Follette, present senior United States Senator from Wisconsin, won the inter-state contest in 1879. Since the nrst joint debate in l8o7 between Anthenae and Hesperia, Athenae has won a good majority of the debating championships, which have been a source of friendly rivalry and the means of stimulating forensic activity. Athenae is proud of her history in both war and peace. Her members came willingly to the nation's support in the Civil War and in the great World War just ended. Former president Charles R. Van I-lise of the university, former Governor Francis E. McGovern of Wisconsin, Paul S. Reinsch, United States Minister to China, and a host of other prominent men were Athenaens. 1 ii . .1 uiimiiuiiiiiiiiiiiiiiiuimmimmimmiiuiii 1 'M ' iminiiimiiniiniiiiinmimmiiniiiimiwmimmiiiiiii Page 295 IIIIIII II I I I nI I I II Is ..A, . , ' EEE. A. -Mgsyf 1'c:::Z9' ' ' .24 S . .. .,I .... A S, .,,, . . - 'N-.Al-,..q,.-I. M- . - 1 ' 12121-' - 1 - ,. 1 . ' JOHN A. ANDERSON KEATS S. CHU EDWARD L. DEUSS ERNEST F. FREYMILLER LEONARD BERCSTEIN HERBERT BEYER JOHN W. COWAN JAMES R. ELLIOT ERWIN A. HENTZEN STEPHEN ASCHENERENNER KO KUEI CHEN EWART K. CLEAR HAROLD O. FROHBACH JOSEPH G. FUCILLA EARL H. HESEMAN PAUL P. BOEEEL WENDELL BONESTEEL HOMER B. DENNISON Hesperia Members 1919 HAROLD M. GROVES ROBIN HOOD IRWIN T. MOHME OSCAR A. OLSON RAYMOND J. SUCHY 1920 WVILLIAM STERN 1921 1922 OLAF N. ROVE .IIIIIIII-Im IIIIIIIIIIIIIYI InIIIII-IIIIIIIIIIIIIIIIIIIIIII,IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 296 FREDERIC A. HORTON ROBERT K. IRVINE HOBART H. KLETZIEN BARON DEHIRSH MEYER BERNARD E. MEYERS WVILLIAM F. KOCH CLARENCE C. IQRAUSE LESTER LAUN HARRY IVIUSKAT EARLE J. TOWER JAMES H. XVEGENER EDMUND J. PENNFEATHER HENRY B. PERLMAN JERRY H. QUAM H esperia Hood Laun Hesseman Rove Freymiller Boebel Chu Krause Hentzen Koch Cowan Kletzien Suchy Groves Meyer Fucilla Mohme Perlman Deuss Muskat Metzker Chen Pennefeather Frobach Meyers Aschenbrenner Ojfcers - HAROLD M. GROVES, KEATS S. Cl-IU . . Presidents ' ROBERT K. lRv1NE, JAMES H. WEGENER . Secretaries KEATS S. CHU, BERNARD E. MEYERS . . 'Treasurers Hesperiefs History Hesperia was organized in 1853, three years after Athenae. A charter under the Wisconsin laws was secured the next year with R. W. Hanson, G. W. Perry, A. W. Lathrop, R. W. Hubbell, W. F. Vilas, T. D. Coryell, and S. W. Botkin as charter members. The first meeting was held in South Chapel, which was lighted by tallow candles. Magna Parens Virumn is the Hesperian motto which the members strive to verify in war and peace. I-lesperian debaters won the Judges' decision over Athenae in the first two joint debates held in 1867 and 1868. l. S. Leavitt, F. S. Stein, and B. W. Jones were the members of Hesperia's first joint team, which successfully upheld the negative on the question of the constitutionality of the reconstruction bill of the 39th Congress. Hesperians are rightly proud of the excellent record of the society in war and peace-the Civil War and the World War, and the days of peace that intervened. Col. William F. Vilas, charter member of Hesperia, was a member of President Clevelands cabinet. Former United States Senator J. C. Spooner was an Hesperian. Congressman E. E, Browne of Wisconsin, Prof. J. F. A. Pyre of the university, and prominent men in all walks of life are numbered among the alumni of Hesperia. Cvuy Black, '17, closer of the Hesperian joint debate team which won the decision over Philo- mathia in 1917, was reported killed in action in France during the summer of 1918. Keats S, Chu, '19, at present president of Hesperia, is one of the most brilliant Chinese stu- dents in America. He is a member of Artus, honorary economics fraternity, and is president of the Mid-West Chinese Students' association. .mmm-i.. i.lv.mw..iiw.w. iiiiiiiiiiiiliii?iiiiiiimlmwlmHumif1in1ml-miwiiliiiimm Page 297 . Y, I ' AWE , .K,., 'gps' , f If ,:.,:.4AV:,Iy ,3 ,A Q 7 if .ui J ,V .V .5 .?.g,.,6E , .5 if ' , 'x ' . ' , .. , A jg V,,V . ' Ph '1 1511 ' 1919 THOMAS W. CAPE NILS E. STABO JAMES M. I-IAYDEN GLENN B. WARREN FRANK A. Ross JOSEPH O. WILSON 1920 HENRY W. FRICKER RUDOLPH J. SCHLICHER EDWARD P. IQEARNS XVHITNEY N. SEYMOUR FREDERICK W. OLDENBERG SANFORD S. SMITH GEORGE D. SPOHN 1921 CHARLES ASSOVSKY GLENN J. FACBAULLEN WARREN A. BOHL I-IERMAN B. HALPERIN THOMAS J. DREDGE ANTHONY W, PESCH JOHN M. EGAN T. FOSTER STRONG JOHN V. GILBERT GEORGE I-I. WVATTERS LEON E. IQAUMHEIMER LESTER C. XVEISSE DAVID W. MCLENEGAN LORELLE A, XVOLF 1 922 ROEERTJ. CROWLEY CLAUDE A. GATES MAURICE A. HIRSPIBERG JOSEPH H. JOHNSTON A EUGENE J. TERRY InIInIInIInIInII.I.III-III.4I.-I.m-Wm. InIInInInIIIIIIIIIINIIIIIIIIIIInII.IInImmmwum-ww.. Page 298 DEAN P. TQIMBALL DAVID M. KUPPERMAN VICTOR W. NEMETZ FRANCIS D. OJLAUCHLIN i i Pltilomatltia Weisse Kimball Cape O'Laughlin Crowley johnson Terry Bohl Egan Assovsky Oldenberg Seymour Hayden Warren Kearns Strong Fricker Stabo Smith Watters Wolf McMullen Schlicher McLenegan 017i cers JAMES M. l'lAYDEN, GLENN B. XVARREN . Presidenls WHITNEY N. SEYMOUR, SANFORD F. SMITH . . Vice-Presidents CHARLES Assovsxv Secrelary GEORGE D. SPOHN , Treasurer Philomatliiafs History Young, self-reliant, persevering, and successful are epithets that Philomathians are proud to use in describing the merits of their society, which was founded in 1886 to meet the need of another active literary society which could provide more frequent opportunities for exercise in rhetorical work than could be obtained in the older and more crowded societies. That they succeeded without any banner high advanced betolcening them either great or the sons of greatg without any catalogue of precedents or names of mighty alumni to stir them to exertiong with nothing to rely on for success but their own industry and perseverance, is the boast of every Philomathian. Since being admitted to participation in forensic rivalry with Athenae and Hesperia-the youngest literary society, Philomathia, has proven her ability by winning many joint debates and several university championships in debate and oratory. 1-ler young alumni are beginning to take their places in responsible positions. Among these are Julius T. Dithmar, Assistant Attorney-General of Wisconsing Ernest N. Warner, prominent Madison lawyer, and a host of others who cannot all be mentioned. Gustavej. Wright, '15, Madison, Wis., who was a member ofjoint and inter-collegiate debat- ing teams and Northern Oratorical League representative in 1915, is typical of the calibre of men that Philomathia is turning out for her country's service in war and peace. - Wright gave up his life on a French battlefield during the summer of 1918. inimmiiimmiimiiiiiimwiiiiww-my 1iiiiiini1iiiin1niinmiiiiii-iiiiimmuiiii Page 299 1 1 ri Pythia f,2dmf?wRQX A p . M 9E?g?':fs5s5 52 Oficers . President . Vice-President MILDRED PEDERSON . HELEN BORCHERS . LOTTIE GRAF . EVELYN PHILLIPS . . . . - Secretary . Corresponding Secretary In I I uv: VIRA WINCHELL FLORA I-IEISE . JANET LINDSAY . MISS ABBIE MAYHEW . . Treasurer . . . censor . Keeper of the Archives Honorary Members MISS ARIEL MCNAUOHTON MISS F. LOUISE NARDIN ELIZABETH ALLING LOUISE BEAUCAGE OLIVE BERRY I-IELEN BORCHERS LOUISE EMERSON LOTTIE CRAP DOROTHY GREENE V IOLA I-IOLLENSTEINER DOROTHY DOPP FLORA I-IEISE HILDA GERDS FLORENCE GERKIN LILLIAN HANSON FERN BUSBY GUSSIE GREEHECK MARIE I-IAAS ESTHER GUERINI ESTHER I-IEISE Active Members 1919 BERTHA YABROFF 1920 VIRA WINCHELL 1921 1922 IWI.IIInIInInI.HInIIn.HI.II..II.IImmIIIm II.IIInInuwInInIInInIIIIInInIInIInIIIIIIIIIIIIIIIIIIIIIIII Page 300 MISS A. M. PITMAN MISS BLANOHE TRILLING MRS. CARL YOUNG MARGARET J OHNSON ROSE NEWMAN ELEANOR 0'L,AUC-HLIN EVELYN PHILLIPS MILDRED PEDERSON MILDREO RUFSVOLD BESSIE TAYLOR FLORENCE WHITBECIC LOUISE INGALLS ,JANET LINDSAY MARGARET MCMEANS ISAEELLE QUARBERO IVA RANKIN RUTH LANZ DOROTHEA LEVI MARGUERITE SCI-IULZ DOROTHY SHANER ELEANOR SHEARER -4 L i 1. .In I.. Ii mi. ii... mi.. I. II . Hi Tythia .YT I 7 . 3 cfs, . I' Newman O'Laughlin Emerson Alling Hasa Gerken Gruenbeck Shaner Taylor Berry Lind Phillips Gerds Borschers Rankin F. Heise Halford Beaucage McMeans Hollensteiner Yabroff Levi Lindsay Winchell Pederson Quarberg Guerini Dopp E. Heise Review Of the Year Americanization was the theme about which the work of Pythia centered this year. A certain portion of the time was set aside for the Studies of the countries which have been sending immi- grants to American shores in recent years. The home environment of Russian, Polish, Aremen- ian, Greek, Italian, and other incoming folk has been investigated in an attempt to arrive at a more complete understanding of the contribution they make to western civilization and Of our problem in making them American citizens. Speeches were prepared from time to time which were adapted to various types of unassimilated Americans. The psychology of the immigrant was studied and practical methods of dealing with him as an individual were worked out. Original programs and debates dealing with problems arising within our national boundaries provided variegiya Special features such as a pageant and the celebration of National Night have been provi e . . While Pythia exists as a literary Society, like every Other organization, she has felt that her problems must deal with questions arising out of war and the period of reconstruction. Thus, while the program of Americanization appeared one of vital interest for the college woman to consider these days, yet the training in speaking and writing and thinking that should be devel- oped by a literary Society, has been obtained by the methods used in approaching these contem- porary problems. Pythia, this year, also originated a plan for a national federation of women'S literary societies. The plan received enthusiastic endorsement by all the leading Societies of the colleges of the coun- try who find it desirable to affiliate for the discussion of problems and policies vital to their several Interests. Women 'S Annual fDebate May 2, 1919 Castalia vs. Pythia Question: Resolved, that all conscientious objectors now held in military prisons should serve their full terms. PYTI-IIA CASTALIA Ajirmative Negative MAROUERITE L. ScHULz, Closer CHARLOTTE J. CALVERT, Closer ELEANORE C. SI-IEARER JOSEPHINE I-IINTOEN ESTELLE R. STONE ELIZABETH KUNDERT First Annual All-Forensic Mixer Lathrop Hall, February 15, 1919 General Chairman-HAROLD M, GROVES, President of the Forensic Board Arrangements Committee-JOSEPH B. BEACH, chairmang music, WHITNEY N. SEYMOUR, publicity and tickets, HAROLD M. GROVESQ hall and re- freshments, FLORENCE WHITBECKQ program, VIRA WINCHELL AND JANE MARSHALL Speakers , HAROLD NOER, Athena HOBART H. KLETZIEN, Hesperia CHARLOTTE CALVERT, Castalia FREDERICK W. OLDENEURG. Philomathia MARGUERITE L. ScHULz, Pythia Chaperones Assistant PROP. LUCY -GRAY Assistant PROF. AND MRS. I. W. JONES mi..I..m. I iuiiiiiimmi .awwwummm-im imimi. mmm., -L-LLLMMLQILM ' mmmanInIiIImyuiiimiiInummmmiiiimiimmimiiim Page 301 u nu 1 I I I I I ui I I IIIIIII II is I IIIIIIII IIIIII Ii. I um Ccdialia Calvert Oestreich Sutherland Kennedy Parker Loomer Hendricks Kundert Odegard Sawyer Pointer Higley Gregg Cook Olbrich Ayers Lee Weld Noetzel Hintgen Durch Oestreich Sinclair Markham Riggs Cleveland Jacobs Moe Marshall Kiekhofer Hadley Smith Gaik Coe Jones Ostlund Dawson Winter Hammond BradFIeld Robertson Weber Stofflet Ojicers GERTRUDE M. JACOBS . . . . . President MILDRED I. SINCLAIRE . Vice President CHARLOTTEJ. CALVERT . . Secretary RUTH M. SMITH . . . . . Treasurer HARRIET E. HAMMOND . . . Music Direclor M embers Graduate MIRIAM B. HUBBARD 1919 LOIS A. DAVIS JANE R. MARSHALL KATHARINE A. FEDDE SICRID W. lVlOE JOSEPHINE HADLEY ETHEL J. ODEGARD DOROTHY HARRISON MARION G. OLBRICH FRANCES L. HICLEY LOUISA PARKER MARIE E. HJERMSTAD HELEN B. SMITH DOROTHY E. KENNEDY RUTH M. SMITH ELIZABETH SUTHERLAND - 1920 H, ALMA BRADFIELD lX4ARGARET l. LEE CATHERINE E. CLEVELAND ZELLA G. LOOMER ORPHA M. COE MARGARET C. MARRHAM MARY CONVERSE GERTRUDE M. NOETZEL ROSE M. DURCH ELVIRA W. OSTLUND ELEANOR A. GAII4 GLADYS E. RICCS LELA HENDRICIQS lVlILDRED I. SINCLAIR JOSEPHINE HINTCEN ANNA B. STOFFLET ERNA L. KIEKHOFER ESTHER E. VAN XVAGONER ELIZABETH KUNDERT LOUISE B. XVEID 19.21 CHARLOTTE J. CALVERT HARRIET HAMMOND MABEL L. COOK DOROTHY JONES HARRIET l. DAWSON ESTHER M. ROBERTSON lVlABEL J. GRECC VIOLET TIMLIN LEONORE WEBER 192.2 ESTHER M. AYERS CAROLINE M. OESTREICH LORENA E. OESTREICH I 'M' iiiiiiii5iiiiiiiiiiiiEiIrinuIiiiGiHiiIiiiEiiIiII Page 302 RUTH POINTER FRANCES M. SAXVYER MABEL XVINTER Ei E E5:.,..I.....I.,...I..I,..Ii.I . I I . an I II 1 I nu II II I Agricultural Literary Society? Sly Ports Massey Kolb Sears Price Didier Klussendorl J, Wilson Stoltenberg Scauss Metcalf Remsburg Wilcox Clark Kuckuk R. Bocrner Schueler Kuel-In Grant Koehler Taylor Kull Blomquist Woelffer King Carter Harris Behling Presidents . . Vice-Presidents . . S ecrel ar i es . . 'Treasurers . . . Sergeanls-at-Arms FRED L. BEHLING ELMER R. CLARK NELS T. NELSON BRUCE L. CARTER HAROLD H. COLE WALTER H. EBLING BUSHROD W. ALLEN ANDREW B. ALLISON JOHN J. BLOMQUIST ROBERT L, BOERNER HELMER C. CASPERSON ANDREW P. DIDIER HERBERT E. GRANT FOREST D. HARRIS Second Quarter ELMER R. CLARK HUGO A.,STOLTENBERG NELS T. NELSON HAROLD H. COLE BRUCE L. CARTER 1919 IOSEPH O. WILSON 1920 AUGUST NELSON 1921 NVALTER C. STAUSS 1922 RAYMOND KLUSSENDORF EDWIN S. KOLB EDWIN F. KUEHN ADELBERT C. KULL GEORGE F. MASSEY JR. ELMER A. WOELFFER Third Quarter C. HOWARD KING JOSEPH O. WILSON BRUCE L. CARTER WALTER B. KOEHLER HAROLD M. KUCKUK OSCAR Z. REMSBERG HUGO A. STOLTENBERG ARTHUR N. WILCOX C. HOWARD KING WALTER B. KOEHLER HAROLD M. KUCKUK CLARK MCCONNELL HAROLD H. METCALE RAYMOND J. PORTMAN TRUMAN R. POTTS EDWIN E. PRICE OTIS W. PALMER EARL E. SCHNEIDER M. W. SCHUELER VERLYN F. SEARS IKEITI-I C. SLY DELORIS A. STROMMER LEWIS W. TAYLOR ' EDWIN M. WILSON I,....,......h......,......-....,..,...........,,....,. ....,.......... --.-....-.... -............- ,.....,-2L2L.....L..,'L'2.......,.........., 1222222222222 2' ' ' '2 ' ' nIImIIIIIIIIIuIIIIII II III Il In uml I III I I I II urn II I II I II Il IIIIIIIIIImImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I T ' Page 303 wInnnulrwuvwlmkkkmdvnmuumwmw w in1I.1Phsm,Rumi-wimmmu 6719 Forensic Board Seymour Deuss Meyers Groves 0jQcers HAROLD M. GROVES . JOSEPH B. BEACH . Athenae JOSEPH B. BEACH Seniors HAROLD M. GROVES Hesperia EDWARD L. DEUSS HAROLD NOER GKWKQB'-Dk nr 'X QW' NX sf' vi WEA 'f or if 1 if fi? S A AV K Nwkfi YQ? N 2 WMQEW ' Ffh' ft., K.. ff Q ,fwge .A , , -sv X Hey . 5.1.1 +125 - '- W ? f gifs i A . ' '-'o .J- umm.H.HH.Lvm.HmL.m.m.mm.mwm unmsumumuwwuwwInnuIuwuwwuw1mummmlwmm Page 304 Noer Beach . President . Secretary Philornathia XVHITNEY N. SEYMOUR junior BERNARD E. MEYERS 5TudQrxT5elf Govermueni' mmurm n I I I r I I vw num In :ummm I 5 Clie Student Senate Readlng left to right-Ross, Duncan, Hall, Seymour, Warren, Noer, Smith, Birge, Beach, Brown, McPherrIn Mann, Hanson, Bunge, Travers, Quarberg Ojlcers PRESIDENT E. A. BIRGE . President Ex-Ojicio HAROLD GROVES President Pro-Tem WYMAN S. SMITH Secretary Members W...-.viz ef-g.. f - ff. Wx.- PORTER H. BROWN GEORGE C. BUNGE FRANCES W. DUNCAN HAROLD GROVES LAURENCE W. HALL MAURICE M. HANSON BERTHOLD C. MANN JOHN W. IVICPHERRIN IvmI-ImyInII.nmInInIInumwnmmwwl IummulInIulImInInIInumumumlmml Page 306 l'IAROLD R, NOER LINCOLN A. QUARBERG FRANK A. ROSS XVI-IITNEY N. SEYMOUR WYMAN S. SMITH C. WESLEY TRAVERS GLENN B. WAl?REN CHARLES L. WEBSTER ,,.. ......... ,.,.....I.......... gummumunuunIvuummIInvmIInummummnummmuummInnInmnummvmInInnInIInIummmnuunnumumummmInImIInHmmmumInImIInImInummIInInumInnmInImInIInrmumInIInmvmIInumInInEnIInInmlummInImlnIInInuwInummImmnlmmumvl mm II mmumnmImIIIInInIInrmmIIuIunnnnurmInIInvmvmnuInIInIInvmInummInIInIInvmIInnuvuIInummvmnunuImmInImnnInIInImImunIInIunmnmmImunv I ,ImnummmImmnumuImunmmmumunmInInInIumnwnmmuImImmmnInmlIInmunmnunnnImummunmImmummmmnIImInIInmnInrmnnInIInummmmmnvmumInImmIInunmmInmmmnmInumIIIummInImInImummunInImIuIInIInumInImInIInIInInIIwInIInIuIInIInumInInIInIInunInIIInInIInInIInumwIuImImumInuvInInInnuIInInIImunvmmInIInIInmumnnvmImInInummnnmmmumumummmmmn g The Student Court E SIDNEYF MOODY . . . . Cluef juszzce ALFRED N HEUSTON Secretary Seniors JOSEPH R. FARRINGTON ROBERT D. FITZGERALD -JAMES M. PIAYDEN EDWARD B. WILLIAMS KING G. WOODWARD juniors HENRY F. GRISWOLD GEORGE D. SPOHN 3 EI E is l-mnum-.mmlummmIummmnummm.mmmmummmummmInwmvImmmInmnmmmIm.mmInmmInInI..I.mmInnumImIm-mmmmH-.Im-M-mn InInInImInvmInImImIlnygnlInI111.55311IIIWIBMIIEI1335513533335wwwg555wII.w.ImI.mmmnumIm-UI-u..mummmu..m-IImInnummm,ImummHIummmImmmmlmmmumm.IIII1.IIIIIIIW-mImI1nmm-In,ImIm-mmmmulmnuw-IIIIII Ir mmmnummnmmunummummmmInmmmmmnInnnInmmmmI.mmmmImmmImm.mmmmImmmm,numImInnumnummImmIImnImImmmInmnIuummuIunmnuu1InummInummInIunmmInmum-IIIIIIIIIIIIIIummIIIII--IIIIIIIII-IummInIIuunmI-nIm.mmummIm.mImmmmmm.IIm.mmmmmIInImm.mm..InImmunummmmIIImnI.nuIn.-IIIHIIIIIWIInIummmImImmImnummm.mmuIn Page 307 uumnunmmummimmunmmimmnmmm I ummmimnmiummuui I II I 4 ivnmuinmunmmnumuniIinunumuummmumnm mmnmm mImm.ImmImnmImimmmimim muy muuium I I I 1 I . .I I .II I. I I I..m.m,...I..Ir...n.Imi..i...v .1 uni mnvmmriimnmuI--Immmmnmmiiiiu .mini ummminiunimuumnunmzmunnnunnuimng C5718 Student Council Bartholf Seymour Wallrich Haskins Kates Faville Qua rberg Groves Parkinson Reinking Mabley Klann Hamilton Spa fford King Deuss Smith joerndt Beal Beach The Student Council, originally organized in 1917 as a Council of Defense, is a joint committee Of men and women which is elected Once a year. The Council manages various affairs dealing with both men and Women, such as the war drives, service flag, and Bill Purdy fund. lt has been placed in charge of the Memorial Union fund by the memorial Committee. Ojicers PRESIDENT E. A. BIRGE . Honorary President DEAN LOUISE NARDIN PROFESSOR W. A. SCOTT . Honorary Vice-President.: PROFESSOR W. T. ROOT . EDWARD DEUSS . . . President LUCY WALLRICH . Vice-President FLORENCE KING Secretary ALLAN SPAFFORD . . Treasurer WINIFRED BARTHOLF BEATRICE BEAL MARGARET CRAIGHILL EDWARD DEUSS JANET DURRIE LAURA FAVILLE HAROLD CROVES PHYLLIS HAMILTON CvLADYs I--IASKINS MARCIA l-IINKINS I I Members KARL I-IOHLFELD CLARENCE JOERNDT NVILLARD KATES FLORENCE KING ALFRED KL.ANN I-IILDA MABLEY MARIE MITCHELL MARY PARKINSON JEAN PATTERSON I..I..I..m.I I...I..II..I-.H.w.I inGiliLiliiiiiiiLiliiiWiliiiliEliiiiiiiiiiiriiiiiliiliiliiii Page 308 iiil ALICE PORTERFIELD LINCOLN QUARBERG JOHN REINKING WHITNEY N. SEYMOUR HELEN B. SMITH ALLAN SPAFFORD LUCY WALLRICH BEN WISHNEFSICY DOROETEN B. WOOD ALICE VAN I-lIsE .. ............ ,.T......,-......- m nmmnmmmmummn nmmn-if -E EEE FE :EE E35 EEE iss EEE Egg E E E EE EEE EEE Sig K. :F E2 EEE E55 SEE EEE sig .f- 25: EE E25 E22 5 E Qi? .Z .E ESE :EE E E E .E E E E E EEE iii qs E E EE E-5 EE Ef- E 55 gi 55 si: I e l- EEE E E is s SIE .gg :Ia EYE sig Er: sie I....u ...W mi ...mega mm gas E55 :rg Egg 5 :gg YE 'E .E fe Eg- .F mimiIimIIIIIIIIIIIIIiiIIIIiiiiiiriiiiiiiiiiiiiiiiiiiiiiwiiirinimIiiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIriimiiiiiiriiIiiiiriiiiriiIIIIIIIIIIIIIIiiiiiiiIiiiiiiiIiiiiiiiiiiIiiiIiiiIiiiiiiiiiiriiiIiiiiiiiiiiiiiiriiiiiiirriiiiiiiiiiiiiIIIIIIIIinIiiiiiiIiiiiiiIriniiiiriniiiIiiiriimiiiiiriiiiiiiiiiIiiiiwIiiIIIIIIIiimIiiiiiiiniIIIIIiiIiiiIiiirmmiiiiimIiiiImriiiiiiiiiiiiiIiiiIIIIIIIiniIIIIiiiIIIIiiiiiIIIIiiiiiiiriiiiiiIIIIIIIIIIIIiiiiniiimiiIiiiIriinmiiiIIIriiiiiiiiiiiiITIIIIiiiiiiiIIIiriiimirmIIIIIIIIIIIIIIIiiiiiivviiiiiiininiiiiiiriiIiiiiiiiiiiiiiiimiinrii , Jn,.,.,... ....,.. ,,. , un,,,Kun.,u.,,,.. ,. , I ..,,.,, ..., . I I In ,..,n..,...,. I n...n..,,n .,,n.m.u,.,n,,... ,.,,..,,.,,.,, .. .u...,,., ..,,. ,,, .,u., ,.,,, I .., ,, ,,.,..,,,,... ,.,,., .. .. .,u , , ,.,,,., .., .......,., ,,.,. , . .K I . I ....,. ....,. ,. ,.,..,,,. ,,.,, I , ., ,. ,.u..,.., L.. ,,,,,.,,. .. Q F44 T 9' s 9 2 kauri r TPITHF 2 K Q .. - - . n C 0 C DL Executive Council HELEN B. SMITH . . . Presidenz VELMA REID . . . Vice-Presidenz MARGARET CRAICHILL . Secrezary PHYLLIS HAMILTON . , . Treasurer AMY JOBSE . . . . Censar Chairman DOROTHY HAESSLER . , . Azhlezics LOUISE WELD . . Religious LUCILE NUTTER . Musical MAVIS CHUBB Dramalic OLIVE BERRY . . . Literary ALICE PORTERFIELD . . journulislic KERAN FALK . . . Civic GLADYS YVISE . . . Senior MARGARET NUZUM . . junior VIRGINIA CONKLIN . Sophomore IMA WINCHELL . Freshman Legislative Board :Ee ELIZABETH ALKING LAURA FAVILLE MILDRED MARCH ELEANOR SCHROEDER ADDELLA BOIES OLIVE BERRY MARJORIE BARRIE GRACE BORDELON FLORENCE CULVER RUTH COFFMAN FLORENCE COLLINS CARYL COATES REITA CLAPSADDLE ESTHER COHEN DOROTHY CARLOCK RACHEL CARPENTER VERNA CARLEY JEANETTE DUNWIDDIE FLORENCE DUMMER MARY DAVIS EDITH EWALD MARY EDELMAN ANITA EVANS FLORENCE GRAPER EDITH GRISWOLD FRANCES I-IOLEORD VIOLA HOLLENSTEINER ETHEI. HOLT PAULINE I-IOETZEL RUBY I-IAWN MILDRED JACOBS MARION JOHNSON RUBY JACOBSEN GERTRUDE JACOBS MILDRED KING ESTHER KREBS MARGARET KRAUTH MARGARET KIRCH WANDA LUZINSKI LOUISE LUDLUM TILLIE LEVINE MARGARET MELAAS MARY MARTINEAU GLADYS MARQUARDT FRANCES MALN HAZEL MURPHY RUTH MARTIN GERTRUDE NOETZEL MILDRED RUFSVOLD VELMA REID ZELPHA REID KATHLEEN ROBINSON KATHERINE STOCKHOUSE MILDRED SINCLAIR MARGARET SCHULTZ MARTHA SCHOCKE EDITH SHEA VIVIAN SEEBERS CATHERINE SCHULER ESTHER STACY MARGARET SPERRY JULIA TURNBULL VERA TEMPLIN KATHERINE TIERNEY ELSIE TYSTON MIGNON WYMAN CORNELIA WRIGHT KATHERINE WHITESIDE MARGARET WOODRUFF ELIZABETH WEIMER MARGARET WADE DOROTHY B. WOOD DORA WHITE CLARA WIGDER LOLA WHITE CORDELIA YACI-:EY ANNE YABROFF LEONA YERLY I I i EE i 'EE I I z Winchell NVcld Haessler Berry Chubb Porterfield Falk Hamilton Coiikiiii Nutter Niizum Smith Reid Ciaigiiiii wise EEE E35 if 3' : Eiiii-iiiigiiwimgmgiiiiiiiriiiiiiiiriiiiiiiririiiiiiiiiiiiiiiiiiiiifiiiiiiiiiiiiiiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiriiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIiiIiimiiiiiiiiiiiiiiiiiiiiiiiimiiiiiiiiiiiiiiiiiriiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iii I III ii iiiiiiiiiiii iiiiiiiiriihiiiiiiiiiiiiiiiiiiiiiiiiiiI iiiiiiiiiiiiiiiiiiiiii riiiiiiiiiiiiiiimiigiiiiiiiiiiiii Iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iiiIiiiiiiiiiiiiiiiiiiiiii.i..ifiiii!E smiiiiiiiiiIIIIIiiiiiiiiiiiiiiiiiiiiIIIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiriiiiiiiiiiiiiiriiiiiiiiiiiiiiiiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIIIiiiiiuriiiiiiiiiiiiiIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIiiiIiiIiiiimiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii Iiiiiiiiii iiiiiiiiii ii ii i ii iiiiiiiiiiii iiiiiiiiiiiIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiIiIIiiiiiruiiiiiiiiiriiiinii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiz Page 309 1 11 E 311111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111 1 1 11 111 11111111111111 1111 11 1111 1 1 11111111 1111111111111111111 11111111 1 1111111111 1111111111111 1 11 1 111 1 1 1 11 1111 11 11 111 111 111 11111111 11111111111111111111111111111 111111111111111111111111111111111111111111m 5.......,...11.....,,.....1..11.W..1.1....11.1.11 ......1....11.,...... ......u.... ..,. ..1..1 ....1.......,..,. .......1......,..1..11.....,...........1..................1.1..,1......n.........11...1.1...1........1.....,..-......11.....,......1,5 EE111111111111111111 111111111111111111111111111111111 111 1111 11111111111 1111111111 1 11 1 11 111 1111111111111111 1111111 11 11 111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111 1 1 11 1 1 111 1 111 111111111111111111111111111n11111111111111 1111 11 111111111111111111111111111111111111111111111111111111gEE are iw . ,df E My 1 ,39 sf Vets' ff' s 51 Union Board Ojicers HAROLD C. CHEETHAM , President LAURENCE W. HALL . Vice-President RONALD W. RAMSEY , Secretary GORDON D. ADAMS Treasurer EE M embers GORDON D. ADAMS LAWRENCE W. HALL HERBERT M. BAKER LORING T. HAMMOND E JOHN A, BIGLER STANLEY D. O-SI-IEA HAROLD C. CHEETHAM RONALD W. RAMSEY ALFRED H. TAYLOR E 1 1 O'Shea Taylor Hammond Bigler Ramsey Adams Cheetham Hall Baker ' 111 1 1 1111111111111 1 11111111111111111111111111 11 111 111 1 1 1 11 1 11 111 111111111 1111111 ' 1 1 1 1 1 1 1iiEi!1221G31IHHiiiii?IIIEIIYEIKISTIIIQISIIIGYIIHIZPZIIEIIYFIRIIIZI 1 111 1111 111 1 111 1 111 1 11 111 11 111 111 11 Page 310 E E EEE EEE s s E12 aig EEE E15 SE 552 E, ,EE sg: SE E 525 si EEE Ei? 555 552 ESE EEE E55 SEE E12 EYE EEE EEE 552 :sg EEE SE e 255 EEE Ei? :EE 1 s 1 1 1 1 a 1 EE E35 EEE Eg 1 1 1 1111111111111111111111111111111f 2 1111 111111111l1111111m1E peciiayl CCCXSiOIXS gmmnnmmnnuimmuniinnmmnnunnmnnmuumnumn n u in i rn i I mmiuinmwiiumy i 1mmiinumuhuivvigiiviiviiimiiviiv u numiunmmmmnummnmg ' mnuummmnmn iummmuniummmnmummuu . limi... iiimiimiiimmiiiiii mmuiiu mimmmmnm nmummummumm-E -E E53 sig E35 EE E25 512 EE s al EE E52 Els ex i s 2 min -5 i :sg 5 2 5 ii ii 1 Th J ' Va CP Q UTIZOT' I 07037 T'O7Tl State Capilol, April 25, 1019 Ei 1 i 1 Harley Haley : KENNETH HARLEY . Prom Chairman lRENE HALEY . . . Partner ' The Committee Chairmen ' 1 LAURENCE HALL K . . LEONARD ERIKSGN Assistant Prom Chairmen ERNEST ADAMS . . . Music gg CHARLES D. CULEERTSON Prom Supper 1: ' F. QMAR GOERLITZ . Boxes lf LORING HAMMOND . Homecoming AMY JOESE . . . Programs i JAMES M. LINDSAY . Ways and Means JOHN W. MCPHERRIN . Publicity CYRUS PHILIPP . Reception HAROLD RAY . Special Features ROLAND RAMSEY . Floor ROEERT L. REWEY Finance ALVIN R. KLANN . , Decoration HENRY S. WELLAUER . Transportation The 1920 Junior Promenade was given in honor of Wisconsin's returning soldiers, and was known as the Victory Prom and Homecoming. It was the first ofthe famous Wisconsin Proms held for two years,-the First post-war Prom -and with the beautiful state capitol building as the setting, was perhaps the greatest and gayest of social occasions Wisconsin has known. For the first time, Prom-time was at Spring-time, the event lzeing held during the latter part: of April, and not dur- ing the middle of winter, as in previous years, Thus the occasion lent itself to the charms of soft spring nights and the youthful dancers, including the returning warriors, impressed with the fascination of a Homecoming Spring Prom, found in the 1920 Prom, for a time at least, what they had been yearning for-a return to the joy and youth of old 35 Wisconsin. 5: ...i i V al:zz:allllllfllflllzaasaalane:1ffllllilllllllllllllllllflznaa1 i , i i 'T' Page 312 is i inn ii iii iii ii .mi i iiiiiinniiiniiiiinwiiii.iiiiii.iuiminiiiniininiimii.iininiiiiiinmiiiiiiiiiiniinmiiiiiiiiiiniinimni1inimmiinmiinimyiniinuimmmiiiiiiiiiimmiug g,mi.ii.,,...f..i..iumm ..,.. .. ..,,...,..n,.,,., i ,.,,... ...,...m ,,.,,...,.. , K.., ,ii ...,, .,...,...,.. n.,,... ii., ....., f. ..nn...,n,... mm., ,.,,,n.n.K.,,,.,,..,..,...,,.,, . .,,,.,...,.,,...,..,..,,,.,,,.,., ...ii ,....,,., i .,,..,,.n..,,,. ii. ,,.,,...,.., i..i,..i ..,.., . ..,.. i..i.,, ..,1. mm..W.,..,...i.Hiii,ii...i.H,..i..,i.i..,,.i..u.ww, mi.. .. L5 iii EEE EEE EEE iii egg sig 252 E EES i EE ,EE EEE 525 fi EEE EEE S52 Erikson Hall Ad-3mQ Cullwertsfn Coerlitz e Han'mond jobse Lindsay Mcpherrin Philipp . , . M., . Ray Ramsey Rewey Smith Wellauer We Sen che Pace iii 233 :ss :ga .i..,... ., ..,i, , i.,,,.,...,......,,.,,.,.i.,,..,,..,,.,..,...,..,,..,,..,..,,.,...,..,.,..,..,..,..,,..,..i..,,..,,.H.i..,...in...,,...,...,.,..,,,.,.,..,. i .,...,,..,......,,.,.,,,.,...H.....,,,,...i.,,.,,..,,.,...,..,,..,.i,..,...,..,..,,..,,.i.,.,..,.,...,i.,..i......,...,.,...,,.....,..i,H,.,,,.,,,.,,.,,.,...,,.,.... i ,i.,..,..,,..,,.,,,.....,..,,..,,.,,..,,..,..,,..,..,..,....,.,,,.,..,.,.,,..,...,..,.. i .....,, m ,..,..,,..i.,,..,,.,,,.,...,,.,,..,,.,,.,,,....i.,,i.,,...,, M., ...,,,,.., i .,,.,,..,,.,,,,, ,,,..,., i .,,.,.i.,.,,.,,.,..,. .. .,,i ii. ..,...i...,........,.........,..,,.,...,......W....,..,... , ..,.. . ..,........ i.,..,,. - ....., - .,.,n. -- ,..,. - ............,....,..,.....,.,....,....,..,....,,..,..,..,..,.....,..,......,.,......... W, .......... . ,... . .... ..,.- ..,...............,.. , ..,,. . .....,,..,.. .,.., ...... ,. ....... , ....... , .i..i ,.........,....-,,--,..-.,-.--............ N H F.tmmuunuunnnnnninnimummmimuiuniuiiunwmuuuunmimnuinmmumimuulumluumllilulmuxumllnumilunumimnmiinummmmum:unimlmmmimniinmvimmunuimuinmmummumnumimlmmuumm:inumininlmunnmmimulumvmmuiruummummnunininiimminummminimimmnmniinuimiuuuuuinnniiunmininnnunmmiumuiimmmmunmiuumnumnu ininiiinnumnmmmnmmiumxuuninmmnmmm. Page 313 gmmmmummmnmmnmummuunmnmmmmnmnlnvnllrnmnlmlnnlwmgEmgwgfmgummlgluEmmynumlm1InmmvmwuwInnummmm:wlmInunmnumummmmmwInwuwfnnumwannuulnuum:munuwwinwIninumInnlwmmwmulnunnruummwmmnunummmInvmmuannuannnnnanwmanwvumnunumvumy:mmwu1vuruunmummynuuvnummwmmwul1Inmnuwnnumwummmanm1mnum1mm:uvunnumummnunnnmnwnurnmung Z 5gmmmmmummmmmnmmunmmmmmumInummmummummmu1'mmfu1m:mm1InInInvmwrnulmlinmm.wmmmru1mwInInwInnuwInInfmnuuwmmywnwmmwmvmInvuwInwummmmm1u1Inhum1mli-hiuiiviilwlimi?iiixiii1IREM!!EEIiiTEiiiii1EISJEI1hi1iivrinnXm1In1nvm1InfnunnnuvunlnunuInInulwmin1InmXH4myInm1mm1Invmmmm'nnnummumuumnnWuIninwInW1mmwinuufInwvuwu1InwInnumwynummnumunmmuummumnmg5 3 Es -E Si as E52 5 Egg 5 5,5 E SEE S Ei -2 SIS Z EE 3 iii 2 gg 3wM....,....,..,,..,...,.N...,.m..,,..,...m,,..,............,,...,...,,..,...,..,,mmU.,,.,,...,...,..,.,.,..,,..,......1...y..........,...,..,,..,..,,..W.,,..i..,...H.,M..H..,...,..1..,,...,..,vm..H..1..,H.,,..,..,,..,..,,..m,,...,..,...,..,,..,,.,..,,..,,,.,..4,,.,.,1,..m.H.,...,..,..,,..,,..,..H.,,..,..,,..U.,,..,...,..,......,,..,...,.,,i..,..W..!H.,,.,..,,..,H.,,..,.,,,,.,ny.,..2..,:wwTMgmfw1,5mfmf15532:3QMmmugwmfgw5E5.,...,..,...,,..,,.... m..,...m..wm.,....N,..,.m..,,..m.,H.,,,m.....,...vm...,.m.m.....Im,.,.H.,...,,..,...y,.....,..W,..,...H.,,.,W...,..mm.,H.,,.m..,..,..w.u..u ..,. ,1.H1.HL.,XV.XH.,m1..1H.XUXX.HV..X.HN1.NNV..L.,,w.HN.HN..,.HX..,...,..+...X,H...,.H...y,.,,...,..,..,...,..,...,y..,..,..,,..,,..,..,X..,..,K.,,.H...,,..,..,.HW,..,..,X..H.,...N.,U.,inim.H...,N.N.H...W.inX..,,W.HX.HX-IX--4,W...,...,..X...1.W.HnuL.,...,,...H.,H.,..f...1my.Hmm,,K..,..,H,,W,.HV.,X1.,H.WUmm...X......,,.....U.U.IVf.mm...m...m-I.. Page 314 E fi: 5,5 225 mmW1mInnInummyuH.1,mmmmumlfmlmm-um..wf.mlWm.NmXmWmH.wmlmwmwmw'mmummmwww-wwmmnmmnumnummm:uw-11-umnumIninnl1uvH11H1uvnlWumynmmy..myXyuV..H.1H,mwluummlnmmmmmmmuwwHumwmmmlmummmm'wmmmvmvmmulynwmyuWmmvmulmyHwWmmy.mmMummm.mmmww.-,mmA-mmm-mmmmmmfmwin1mmfmm'mmvmmvmwyumlm'mmmymnumwInfumrm1u1ruvu,mm1.-mmm.. . .... . .. .. ., , . .. ..- vllwlvfl'vwwH1vwnf-I-'wwwuvwmmmm-vmvwmm:mwwwuwwwmumm-w.wmmm.1m,,..,..,,,.,...m.,.,,..,,,,.,..,,,,,,,,,,,,,,,,,,m,,,,,,,,,,,,,,,, . ,.., - ,.-....,.-4...m...-... .,,,. .,.. .... -., ...., ......,.....,,..n...,....- ..., W.. .,..... .n...... ....... ..-,.-- ,,..,,. 1 - 11fn1mv...mm-1umw..w.vm E 5 , Umm.w.,.m...u,mm .U..,K..,.,,. . ...,,.,..m., ....L....,....,f.n.H-..w...,..L.,,...L.....m.m..,...,.,,....,...vm.m..,m.,,...NWmm.,..,,..,...m. . '1 s :IE .,.,,..,...,..,,,.,,.,,,.. W ,.., H: 525 E 5 ESQ 52 ESE ESE EE 215 sf 552 E :: iii Qi? 552 :F EEE iii 352 :z EEE .: 55 The Big Party-April 25-ze, 1919 EEE :F 5'511umwvwvmnnunummrmmvw 1:-umm ul 1 1 51WVIW-M-HXmgNU-mumgl-3mh5-W33515-:55mgwww1513tm559:95:Hgamay:mminIInTugMI!!in3QUin52mmf!EEE213:3M355umIww5:1M3552my1.55ufwulinwup:HwInmw3.ww.1wmV..wIn1.1w.Hfl.wnyw1.XInmymWIn1.11H1in1I.wm1.I1.I1m1.11in1u1W1.11In.HwInm1H11-1minwuwinwInIn1.I1uv1I-wWinmvmn1N.IXInm1u1inK..,inmlmuum1H1m11.WN.1InmyInIn1InN.1InmmnuIn1Inm1H1inI-I1.mm--1mX1.1mum-uwInM1m-.mnanuInmumummmInuvurm.I1fuvwInrm1mmmm.--mum-1fuumm1Inm1mXmyuv1InWM1m1m,mmum1.4H.HInmXmmy1In1.1nnvmmyummmmnmfvmmymyH.1M1InwI.mum,rmmnmmlwnaig , uwnvmymmuunummwmwuvwmuuwInunwmmwrnwuwwnunwuxmwnmmmwwuwruwmmwzuwuwmmwnzwrlwnumwnwuwwmuwwnwvummwuv:mumwrnw:mumrnwnunwuwruwumwwuwInrumwrnnuwumwwnwuvmulwruwuvnunwunwnvwmmwInwnwmmwrunummwnvwmmmwruwummuruwllullulwrumulwrnwuvmmwnumnummwuwuwmulwmxuwmmrumnu:mmuvnnnumuwuwumnrnwumxuvxnumm1myuwmm1uwvu1mmunwnmvunxuwnmmusuwuvmmunnuum:uuvumm:nnwmmmxmwimmuvnuummunwummmu1vuwnumxunuwummuvunnumumuumm:numummummnumunuvunumwufwmwmmumnummnuwynnumnuuInmummunwmmwuvnnmumnnxn11wmvununfHiFiiFl1rlMfUilwxl5 zmmmn Eamummmmnm mi vi nn I n mmm n miummnuv mm I ni 1 u mmmuuu FT ' I r A i n i ui 1 i r un: rm nnmmmmm I1 I iummuf1i ' Dedication Qjp Muir Knoll Deciicatory Exercises j une 18, I 918 Program Introductory ...... .... Song, The Blue Bells of Scotland Dedication ....... john Muir in College Days .... john Muir's Relation to Modern Science . A Word from a Room-mate .... Presentation of the Muir Knoll Marker HON. THEODOREM. HAMMOND Assemblage DR. CHARLES I-l. VILAS, '63 . JUDGE MILTON S. GRISWOLD PROP. CHARLES E. ALLEN, '99 CHARLES E. VROMAN, '68 THOMAS MORRIS, '00 john Muir and Scotland ..... . PROP. ROBERT M. XVENLEY Song, Auld Lang Syne ....,....... Assemblage . The Mound was named Muir Knoll in recognition ofjohn Muir, who here first received that instruction which opened an acquaintance with hidden problems of the Scientific world, the after pursuit of which brought such luster to his name. The Muir marker is directly at the roadside, perhaps 200 feet from North hall toward the lake, the Muir locust between. nnummrg O3 -X ,yml .k., mn ,,.., 4 - ft ss? o-f -vi -. V of ' . ' fivifff ' if -21 Nw, Q .' - .L get a, N- .4 32 ,se,1.-cqQ'g+iLsgsz.g,3bK5?S5es . '- 1 av, , ,-55, 1 , f f 1- ' PSFL .. ,, - , A ri A v ' . f . , f '15-5152.1 p sf E I F K L 5 I L ' A , . Q! . ,,,,, -My-mmMMWM-WIMNDMJM,,........,..,...,..u...,... .,i.w.,..n..f..,.ii.if..r1..........i.,,...,...m..E Page 316 is E E 5 is E E IE s E E E I E .EE 5 EE EIS Ei? EI Es :T EE 52 il ES :E E EI EI El Z5 El -5 l 5HEwfl n ' ' ' TEEiWiii?fmGETiTZiiMWHWMG 5 :ig EE E 2 IE Eg TIE EI ETS 'Z EE I af gt iii Keystone E52 Keystone is a society composed of the presidents of women's recognized organizations. It E-- originated the method of regulating womens activities by inaugurating the point system to abolish a monopoly by a few girls upon these activities. This organization also affords its is members an opportunity to become more familiar with parliamentary procedure. EIS E E EEE Ojicers MARGARET SCHULTZ . , . President its EEE MILDRED PEDERSON . Secretary 'E Members f VELMA REID . . . Barnard MILDRED PEDERSON . Pythia S GLADYS FELLOWS . . Blue Dragon MAv1s CHUBE . . Red Domino 555 GERTRUDE JACOBS . Castalia SADA BUCKMASTER . Red Gauntlet Ei AMY JOBSE , . . Census HELEN SMITH . S. G. A. MARGARET SCI-IULTZ . Chadboume EI.sIE GLUCK . . Suffrage 'E . . MADELON WILLMAN . Clef Club KATHERINE WHITESIDE Theta Sigma Phi E FLORENCE BEATTY . Euthenics MARGARET LATHROP Twelfth Night EYE ANN BRIGGS . . . Glee Club JEAN PATTERSON . W. A. A. EDWINA DEXTER . . Green Button LOUISE LUDLUM . Womens Page LUCY WALLRICI-I . . . Mortar Board DAPI-INE CONOVER . Yellow Tassel LULU SAUL . . . . . Y. W. C. A. I 52 . :IE E Buckmaster -Iobse Willman Lathrop -Iacobs Wallrich Briggs Conover 3 Ei Pederson Saul Beatty Ludlum Schultz Fellows Smith Reid Patterson K i III I I I I I III I I.. II.I..I.I..I...I..I .I......II, ....I...I I., I .I...I.IiiiiiiiEiEiiiiiiliiiii..I..I.Hiiiiiiiiiiiii?I..I... 'M ' mif'f ifiifI I Page 317 E i 1 1111 111111111111111 1 1 1 11 1 1 1111111111111111111 111 1 1 11 11111111 1 11 1111111111 1 1 11 11111111111111 11111 1 1 11 111,111-A1-A1-in 1 11 1 11 1 --1--111-M11113351111115131 1u1M1E11111111u11 111111591515 TTEYEGHEZEEGEWEFEMYEETTT' 1 1 T' i 'i i1 1 11111111111111111111 1 11 1111111 11111 1 111111 111 111 111 11 1 1 1111 111 11 1 1111 111 1 1 1 111 1 1 1 1 1111111111111111111 11111111111111111111111155 -1.- -1. 5 5Blue qlragon l Blue Dragon is the senior won'1en's organization. lt maintains a co-operative house for uni- versity women which has lately been endowed with 55150 worth of Liberty Bonds-S100 by the class of 1918 and S50 by the class of 1919. Uficers , GLADYS FELLOWS . . President WINIFRED BART!-1oLF . Vice-President Louise EMERSON . Secretary MARGARET SCHULTE . Treasurer 1 :ii 1 1 Schulte Fellows Bartholf Emerson :F sig 252 515 EE '1 11 ' 5g,gmgA1,w,31gg1, 111111111111111111111.1111111111111111.111.111.1111 111111111111111111111111111111111111 1 11111111111111111111111111111111 1 11 111. 11111111111 11 1111 1111111111111111111111111111111111111111111111x15 111 1 11111 111111111111111111111111 1111111 11111111111111111111111111111 11 111 1111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111115111111111111i1l11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111: Page 318 Eli li lg sg 4 EE 1 W ' ,E fl 2 f if ls X X I ' W ' f ' f f, X X Q f X ff X 'll my 5 X svx i , L ' .X X4 i e- N' ' X- ' X ,, D XXX R .. X K During the past year Yellow Tassel, the junior womens organization, has done its share of Red Cross work. Under the junior advisory system, Yellow Tassel has advised and entertained f lner Green Button sisters. Ofcers DAPHNE CONOVER . . President HELEN SNYDER , . Vice-President HELEN RAMSEY . Secrezarv MARJORIE BART!-1oLF . Treasurer Q2 S Snyder Conover Bartholf Ramsey 3ii::::::::W ' ::::2::1uu1:uu:uw::l:f:t:w:u: ' ' f 1 ' ' H H' ' ' H:::1::f1::f:1!:::::::u11::1::ef::11:1:::u:1ssu::::: '.u.L::u, .,., :J Nm' ' LIU I '1' 1 Q5gygfiflliliilifkliflgqpggq la Page 319 gm111111m111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111 111111111111111111111111 11111 11 11111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111u11111.11111111111111111111111111111111111!5-111111.A1151141111111111r1111111111111111111111211111111111111111111nm1111111111111111111111111111111111111111111111111111111111111111111111111111111111r111111mm11g 55a1m1111111iEEF1ZiiME iEE i11HE 'H1iiiii?1iGii5ii13iElHil1 'l llTmi'T'ii 1 l'11111111 1 111111111 11 1 11 1 1111111111111111111 1 1111 11 111 11 111111111111111111111 111111 1 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 111111111111111111lHT1i111111111 - 11111111111111qg 525 Eli ,F - 1 1 1 E E Red Gauntlet ei- as .,- E E Red Gauntlet is the society for sophomore women, which was organized in 1913 for the pur- pose of bringing the women of the class into closer personal relationships. In the fall the 51? EE. .,: members of Red Gauntlet entertain the senior women and at intervals give social affairs for their Ei: E15 E . 'E own members. ff 1 2 E55 EE ggi E15 Ojicers SADA BUCKMASTER . President Ei E MARY PARKINSON , . Vice-President - i - AGNES SARLES , . Secretary :if 32 HELEN Cru. Treasurer E 5:5 1 Q55 Sli E35 :L ,E EYE ze- :E s I 1 Parkinson Sarles Buckmaster Gill QFEEEQIEEEELE 1 1 1 1 1 1 1 1 11 1 1 1 1 1 1 11111111 11 11 11111111111111111111111111111111111111111111Eii 1 11111 1111111111111 1 111111111111 11111111111111111111111 1 11 111111111111111111111111111 1 11 1111111111111 11111 1 1 11 1 1 1 1111111111111111111111111111111111111111111111111111111 111111111 11111111111 11 11111111111111111111111111111111111111111111111111111111111 11111 11 11 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111: Page 320 Ei 215 IEE 1 is gunum EE E Ei nu mu: :mv 1 1 inns: s In u wx r u vu umnnmmmm Wk ummm.. .um Ei u g, va 5 f N f Ei JJ A , x f QQ f S., I ' fa. Green Cgutton Since the founding of Green Button society in 1912, similar organizations for women have EE been a part of the life of the freshman women. Spreads and social gatherings tend to unite the members of Green Button. Oficers EDWINA DEXTER . . President MARGARET THOMAS Vice-President MARY WOODARD Secretary KATHERINE ELY Treasurer Thomas Woodard Ely Dexter Page 321 -III nu.,K IIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIII .,,..,,,.,. III.IIIIIII.IIII.IIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII .4,. IIIIIIIII ...xy III l.w,.,,.. IIIIIIIII .,N. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIII.IIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII..IIIIIIII.IIIIIIIIIIIII.III..IIIIIIIII.IIIIIIIIIIIIIIII.IIIIII.IIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIL E Y. W. C. A. Weld King Rogers Johnson Boll Pleuss Humphrey Rogers Simonson Saul King Pos: LULA SAUL , VIOLA PLEUSS . MILDRED ROGERS MARIE HJERMSTAD . LUCILLE ROGERS LOUISE WELD . FLORENCE KING DORIS SIMONSON ANNE HUMPHREY MARION JOHNSON JULIA POST . . AMY JOBSE . . GERTRUDE KING KATHRYN BOLL . Of'-icers Cabinet Committee Members . President Vice-Presideni . Secretary . . Treasurer General Secretary Church Affiliations Conference' Meetings Membership Publicity Religious Education Social Social Service Ways and Means H j ermstacl Church Ajiliations DAPHNE CONOVER GRACE FINUCAN ELIZABETH KUNDERT DOROTHY MACLAURIN Conferences BERTHA BLAUL MARGARET BRONVN SADA BUCKMASTER KATHERINE JONES MABEL ROGERS GLADYS WISE Meet ings ANNE BRIGGS AGNES EWELL HELEN HARPER JULIA ALLEN MARY BAECOCK KATHERINE BARTHOLF MARY BRIDGMAN HELEN CHEETHAM HAZEI. COUNSELL ELIZABETH HOOPER CLARA HOOVER GRETCHEN KUEIIPER MANNIE PARSLEY KATHERINE ROSENEERRY Membership BERNICE ALBRIGHT EDWINA DEXTER JOSEPHINE HINTCEN GRACE HUBBARD CONSTANCE KINNE LOUISE MCLAY MARGARET THOMAS CORNELIA WRIGHT Publicity DEIRDRE Cox LAURU KREMERS MARION PRENTISS AGNES SAMUELS HELEN SNYDER Relig ious Educal ion BEATRICE BEAL RUTH LANZ ZELLA LOOMER MARGARET MARTINI MARGARET SCOTT ESTHER WANNER -Social MARY BELL CONINE HILDA MABLEY Pl-IYLLIS HANIILTON LAVONNE HANNA MARY PARKINSON HELEN SKINNER Freshman Commission AGNES EWELL ESTHER HAVEN JANET HOLZER GLADYS HOSKINS VIRGINIA JACKSON MATILDA KEENAN CATHERINE MEYERS CARYL PARKINSON RUTH REID ELIZABETH SEHON Social Service LOUISE EMERSON DOROTHY EVANS GLADYS HOSRINS KATHERINE JOHNSON J EANETTE LAMB MARY MCHENRY MILDRED PEDERSON XWczys and N160 ns lVlARGARET BELKNAP FLORENCE DAY RUTH DICKOVER ALICE NAFFZ LUCILLE NUTTER MARGUERITE NUZUM ALICE SPENSELEY ETHEL STOCKDALE MARGARET THOMAS HELEN WHITE IRMA WINCHELL MARY WOODARD III III I IIIIIIIIIIIII I IIIIIIIIIIIIIII II II IIIIIIII IIIII II IIIII I IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII II II IIIIII IIIIIII IIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIII IIIIIII III IIII III III III IIII III II IIIIIIIII IIIIIIIIII III I I I IIIIIIIIIIIIHIIIIIIIIIIQI I III II IIIIII I IIIIIIIIIIIIIIILI IIIIII II II III III IIIIIIIIIIIIIIIIIIIIIIIIIIL IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIiIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII IIIIIIIIII IIIII IIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.. Page 322 mrnumuvwuwnnzufumnmwunrmnumwmunanwnvanwUwru1rn1mwnw1n1in1nw1vuwuwwnwinwinwuw1u1in1nmwI1wuvwfu1uwrnwmwfuwuwul1uwwuwfuwmwnwwruwnwmwIHwnwwuwruWmWwInwInwmwuwwuwInwuwwu1in1m1u1yu1u11n1ruwmwuwwH1fuwunwuwmwu11n1ruwIninwvuuH1unwwuwruwmwuwmuuwvu1muuuwnuruwruwI-4mwanwuwm1vuwuufuuIuwuuwuwmumwuwwuwm1anrmmuuuuvurnwH1wuwnlwmwmuuwwIX1yu1nw1n1m1uumwnwwuwwuwwuwmwmrnwnvunwvuwmvuumnwvuwmwanuvuwuunvwmuwnvnnmnk : m.m..Wmm-nn.furm11.1,V.H.1mn.Hmm.1..,M..NH143321521311,1il553525IiiYES5551ElIIIEEIIIIZPIS522512151NlIi5GilIR5211iiiH15511EYESJil1I.-Ui?1FIRFIRI5JillQi,in1..Ji5T??iF.57E?iiI..HH1yi,1E.11Z.1.f11..1XV.1...X1.2,.HW,.411.1,I.1m1L.,,..,X.1,..X,..,.A,W,.1,W1l.1IllG321lilGil5,,,I5.11J.1ii11Qi1,ll3215.11H271121Lil1iiFill5511E51,W1QM1Q211L11Iii1IliIll?5215111liSill1lilQiiNlil1FilIii,Iii1LEG1Lil55111571P511IllIii1illiii1IliQlil1Ili1Qi?15?1P211I?1I511Ill1lil1II11ll1lilGilH211ll1PQI1lil1Fi1PFiIiillii1Gi1Ll11i?lE'i3 F us I 1 '12 see ,V 'Is 5 , , ,, 5 Af.. Q5 5 E is ,I ! E E 1: EE 55 E: is 22 EEE E53 ees sms 255 gi .1 q.......,,....rr,......,.N.U.mK..,..m.Mmmmm.i...,...uN,.HH.Wfniii:aim..1anizA51zminmamamzniimznzninmiiminanansnxnimLiam.'F..uz1:m5411:anznziaznmiGuzman..U.Y,H...,.HWW.HH.,.Hl...k..k.m.,mn.WH,H.H..,W..,W,..,W.UmH.H.,,.nm,W.,,ml..,K.,,.,...,..1H.,..,W,..,..,,W.,,K.U.,,W..,..,..,,.,,K...H,,mmH.H..,.........W...KH,,.,..,H..K..H,..unK..W.HW,.,,.,....,H...,,....H,,..,...H..1H,.1,K..H.,,..,.,,H,M...,..mm.,,...........,.,,...,m.,s Page 323 mm iiiiiiwiuiniiimmii. I . mmm- in inmm,..mi..mmim.iimi M. .mi Consumer is League Officers M1R1AM O'NEIL . . . . President DOROTHY WOOD . Vice-President CONSTANCE KINNE . Secretary ADELAIDE PAINE . ....... Treasurer Executive Committee MARioN PRENTISS . ....,.. . Publicity MARCIA I-IINKINS . . Legislation FLORENCE COLLINS Extension MARIE ESCH , . . Social ADELE FALK . . . Program MANN1E PARSLEY . . War Work ADELAlDE PAINE . . Finance MARGARET DOERR . . . Exhibit MILDRED P. RUFSVOLD ........... Education The Consumers' League of the University of Wisconsin was organized as a branch league of the National Consumers' League in 1909. The aim of the National Consumers' League is to abolish child labor, unsafe and unsanitary work places, long hours for workers, and the sweat shop system. A series of lectures by prominent workers and promoters of the National League has brought the aim of the League to the students and awakened an interest in the vital problems of the work- ing world of today. I J Rufsvold Prentiss Parsley Collins . Esch O'Neil K, Falk A. Falk i i inmiiliilliiiiiiiiiiiiiiiililiiiiiiliiiiiiiiiiiiiiliiiiiiiiumi Page 324 seg I ,-5 235 5- .,,.,.,..,,K.,...,.., - . ..i. -- - .- - .- .-.- K.,K. ,.., - M-M,-IM ,- -- . -- - . -- iE'EEi-TEIEUEIIM' TT T ' T- n M M'Tm ' V 5 Ii? ?'f 1 Z9 OTTZQ77. S O771Tl'l8T'C8 U The Wcmerfs Ccnfmerce Club was Organized March 7, 1917. The purpose Of the association is to bring tlie wcnfen who enter the Ccrrmerce course in closer contact with each other and with the activities Of the Outside world. Q23 Ojficers if HELENE THOMAS . . . . . President 3 IRENE HENSEY . . . Vice-President ELIZABETH ANDERSEN . Secretary E52 223 MAROUERITE HEINS . Treasurer , Members 1919 GLADYS PASEWALK HELENE THOMAS 1 920 I ELIZABETH ANDERSEN MARY FOWLER ORPHA COE IRENE HENSEY GRACE MCRAE I 921 , SADA BUCKMASTER JENNIE HOFFMAN I 3 IRENE DAHM HELEN ROTH RUTH ESTVAD CAROLYN STATZ KATHLEEN HARRISON HELEN THOMPSON I MAROUERITE HEINS ANNA WILKINSON HILDEGARDE WIPPERMAN Thompson Anderson Thomas Whipperman ' Fowler Heins Buckmaster Roth Hensey Hoffmann McRae Paswaik Harrison Statz Estvad r'a'I M':1-m'aif' - I '- Tiki-f---1 . .. - .- - - - -- -- -- - -- -- Page 325 3 nn uminm. .im 1 . ... .. . . .. mnmmmmmunmummmummmnimmmi .. mmm -Wmiiiwuiuuiuuiniimmmi 1 Woman,s Equal Suffrage League A Aim To further suffrage propaganda. To aid in the spread of civic and political ideals among the women of the University. Ojicers and Cabinet ELSIE GLUCK . ....,.. . President HELEN RAMSEY Vice-President MARION GRATZ . . . , . .Secretary Lois MCDONALD ......, Treasurer LOUISE LUDLUM . Chairman Publicity Committee MARCUERITE NUZUM . . Chairman Program Committee IRMA l'lAYSSEN . . . Chairman Nlrmbership Commiltee Nuz ,im V Ludluni Ramsey Mc Donald Gluck Hayssen mm nmmmuimwminminuimiinmmuiuni Q iiumminiiiiniimiiiiin.wm..m1iwmim I . wwmllmvlwlm vvwlv-v'v'W 'W1 Page 326 E52 53 111111111111 11 111111111111 11111 1 1111 1 1 1 1111 1 11 11 111 1 1 1 1 11 111111111111 1 111 1 111 1111 1 1 111 11 1 1 1 1 1 1 1 1 11 1111 111111111111111 1111 V101 Wxv. 1'-1111! 11111132 QJIUEZIIY ' E li ii I5 12 1s 15 is gf 1 X-' fx 1 5 Z ii- 1 l 1 l 1 lp-Xgm ' vm., l Xl 13 I E 1 Eutlienics Club Euthenics was organized to study home economics problems and matters relating thereto, and 1 .E '- 1 . . to create a social life among the wom zn of the Home Economics course., For the last two years, Euthenics women have aided in lVIadison's charity activities and Bel- gian Relief work. This year they have assisted in social settlement and reconstruction work in Madison. 1 Ojfcers FLORENCE BEATTY . . President FLORENCE GRAPER Vice-President is JENNETT DUNWIDDIE . Secretary lVlIRIAM OlNEIL . Treasurer QE Ez 1 1 if I , Kirk Burnham Luther Tucker O'Niel Cooley Bollenbeck Graper Schmidt Dunwiddie Walker Sutherland Beatty Kyte Gough Firiucane Madison Qi Ei? 2:2 E' 1 1 11111111111111l'111111111l1111l1111111111 111111 11111111111111111111.11111111111111111.1111111111111 1 11 1 111 1111111 111111111111111 111 1 l11111111111111111.111111111111111111:11fillifllffa11111111111fflElifillflfflffllfn:1m1 1 1F5f'if M'1 1 1 1il'f:l1r 1i1111111111111111 11h511nim1f ':1f11rm1m1 1n111n 115'r 'Er1115'uhif5?l5ffff?ll'51 11:1'l5Hii?1 Page 327 in I I +I n ii I In I I I mmm :iff H TA Ojlicers MADELON WIVILLMAN . Presidenz AACOT BORCE . . Vice-President LUCILE NUTTER . . Recording Secretary MARIE MCKITRICK . Corresponding Secretary KATHERINE FEDDE AAGOT BOROE ANNE BRIGGS AGNES BURKE DOROTHY DENNETT RUTH DONALDSON GUDRUN ESTVAD KATHERINE FEDDE HELEN HARPER MARJORIE BARTHOLF WINIFRED BARTHOLF MARGARET BELKNAP DOROTHY CARLOCK Active Members FRANCE HIGLEY CLARA HOOVER ELEANOR KRAEMER MARIE MCKITRICK DOROTHY MARTIN CLARA MUELLER LUCILE NUTTER MARCUERITE NUZUM Associate Members FLORENCE FINNERUD KATHERINE FISHBURN MARJORIE LACY . Treasurer MARION PILPEL DORIS SIMONSON MARION SPRING VIOLET TIMLIN IRENE TOWNSEND ALETHEA WHITE MAEELON WVILLMAN MILDRED WVINNIE DOROTHY LEVI ADDIE PIEH ESTHER SAYLOR GRETCHEN SCHWEIZER Kremers Timlin Hickey Fedde Willman Winnie Hoover Miller Borge Estvad White McKitrick Martin Pilpel Spring Burke IniI.IiII.IinImininIiiiI.Iimiiw-Iiimiiium IniuiIInInIuiImInImII4IInInIuIminiiuimumimim Page 328 ...in Im H. in in I. Im. .II I. mi I. .I -,mlm-Munn ' I I I mmiiiii mmm 5 I 5 I . ' '23 , 4 'J . if i . ,U 1,1 1 U1 A ., 1 6, , I 1? Girls ' Glee Club PROE. C. I-I. MILLS , . . . Director Ojicers . . . President . S ecrelary- Treasurer ESTHER NEPRUD . . . ANNE BRIGGS . FLORENCE NASH . . . Librarian First Sopranos AACOT BORGE DOROTHY CARLOCK ALICE CRORY JOSEPHINE DARRIN DOROTHY DENNETT ROSE DURCH RUTH DONALDSON MARION BENDEKE FRANCES BLISS ANNE BRIGGS GRETCHEN DUNAWAY MARGARET I-IAWLEY DOROTHY BASSETT GRACE BITTERMAN GRACE GLEERUP HELEN JAMIESON ANNA CRAUN DANA CARRELL MILDRED Cl-IICHESTER MARY FOWLER GRACE GODARD JOSEPHINE ,JORGESEN I-IAzEL KELLOGG EVELYN LEE ESTHER NEPRUD LAURETTA NICHOLS I-IILDECARDE WIPPERMANN Second Sopranos JANE MARSHALL RUTH PAYNTER RUTH POINTER MARY SAMMIS First Altos SALINE LARSON NANCY LORENTZ MARIE MCKITRICK MAUDE MILLER LUCILLE NUTTER Second Altos KATHARINE FORWARD AVEL GAUSMAN MARGARET j OHNSON VIRGINIA PASLEY MARIE SCHILL MARION SPRING KATHRYN TENNEY LUCILE PESKE DOROTHY MARTIN FLORENCE NASH FLORENCE SERVATIUS DORIS SIMONSON HELENE THOMAS VIOLET TIMLIN LOIS WUERTEL MAR JORIE SEXTON RUTH SHEPHERD LILLIAN SODEREERG NORMA WEISKOPF MARGARET JONES MILDRED WINNIE DELPHINE WOOD Pointer F Olckmeyer Bliss Gleerup Fowler Forward Nicholas Shepherd Sammis Whipperman MacKitrick Winnie Timlin Dennett Briggs Donaldson Kelloggf Godard Durch Paynterllh Nash jorgerxson Weiskopf Tenney Lorenz Borge Bassett Bitterman Nutter Simonson Spring Teske . IH. . ,.,, Q .....,..,,., ,..,, I,..,,., I . .I .....,I.,,,,,..,,.........,I, ,.,.,.,,.,.,,. , .,,..,..,..I,., ... i.I..n.i. I I,,..,I,. H. I,., ...IIm,.n.i.,i.Wn.,.,I,Tm 1 I .T 'r u I F 'Iu'i'11 ' ...I..mmmamIazzaaumzIammszasnzv' I.,.m-'- -,,i,.I..m.Im.II...II.,IIr..I.-rm 1 Page 329 mmmummmmummmummmmnummmmmnwunuuuwanummufrurmnumru1mvmmmnumwnwpnwuvunummnnnumnwmmmmumuwmruwzuwminwnwmummmmwInmynwm1mvuummfu1mInwInruwmmummInwIn,H1Infmynm1Innl1mmumInfu1nvm1InmXI1XmummuumnmmwmfummumvuInwuumwIHmnlwvu11mmmlmInmymfuuuwmmumvuulum1InfummmnnnmnufuwmmlmumInmvmunmmwummmnnmununvuummumumuunk E EEE-151-Slimnli-MEIIHQHHImmy1vihhQi-milInmm,mlWnl1H-vminmm-1muh1-I1inWlm1mmWW1mmvmIn1mmm,vu1Invu1mmInlmmvminmymmyInK..wIn1flwInwHw-.11InIn1m1-I1HHU1m11.1m1ynul1Inin1.Hnl1mWInmnumumunmmlmmfn1mul11.4inwIn1.11IninvmW1U1Inm1In1.HmwI-wmX-IXW1-I1mW1In111XInnum1I.1mInmlm1InmXul,uvH.,.-Xvm.HK..1HAwillhhli.vmmvvmInI-.TmIIAEIIIIIHIEIIQIIZIFQMEIIHIIIIIZiiillil?iiiEli?il???iEii9Ui1ElliiiiIiii!'5 E E35 Ei? 1 1- ,...1L..1H....U...1.m...QN.,...1...1...,H.1.H1.M1H1H.X1H1.N.,.m.v...wm.,,..1fHX,mmW,...,.U,H.WV......V...,.mm.H,...W...1..,...,...,...1,.,...,.HH.1,..,...,..1...,..,...,.m..W., W.. 1. : Y 5 N . mm E., .,,,,,.,,.,,,,.,,,, ,,,.,,,,,,, 4,,.. ,.,,,,,,,,. 4..,, ,.,,,,. A.l, ,.N..'...,-..-,v- llnrllrl , l4.'l-v.-,.-vv--!v-4 v.-vV-,vlA!.-l H .-'..-v--A--.4.-4,,l!VVI4lll.llXl-lv---v----------'v-'--44ll4'..,..,.ll r I U A A . , . W WW1.1...X.HK..,..,K..1.H.H1H.,H1V..,..1m...,...,..1.H1..,......1K..U.1.H...,..,,W...1.11U.X.1WH41..11.1L..11H1W...V...-I.mf,H11.1H.1.H1.U.H,,I1my..,In1.H1.H.HXI.1H1myH.H..V..1.HN.U.H1.HmyK..V...KmIHN..NU.1.M1M.H.Hrm1ynmHmm..1...,.m..m....mu u...um.wm.52T-Twig f,nvrmwInnnwffywLu1InunnmInwfuwunmlmwInwnyVfnin1lmmnnvu1nn1nuInnnunfnwmwuw1nwfmInwInwmwmanwruwInnuInwmmwInwmwnwfuwfuwu1wuwrnwuwnlwmunfnwuwrnwuwwuwuvwuwwuwWwuwnnwuwruwnumwnwuwwmulmIn1u1mwInwnwInnlwnwm1nwmnl1InXuumnWul1mulru1nfwH1muHum1Ininunfuu1m1mmummwInunurnwuunnumyInwuwfunuulun1unvmmwmnnmmm:ufmvuwInInunnuwuwnumumvumymyInnuvumywnuuvunummumuunun'mmunmyummumnulum? Page 330 unummmnmmnmmfmmmwmmmmmmnnm.fmmm.mmmmummm mnnmumg P, ..... W,,..m ......, .. ..u.K... . .,.,.... U, .,... mu ...,..,..... ..,,. ...,,,..,..4...,... N .....,.nK M. .,,.., , ,,,. , .......,. . .,,..,,..,n. , .,,..,...,. ... ..,,..,....,. , .... ,.., .n.,. W. ,,....n .,. ,,l.,,.. U... .,,.n... , ,..,,,,,, .U ,.,..,,..,.. ,,,.....,. ..,,.,,.,,......,... , ,K..,.,,.. 4. ..,,.,.. . .,..,...,.., , ..,,,,,..,..., , ..,,.,, W., ..,.. ,..,. ..,,..,..,.. . .,,.,... , ..,,,.,,..,...,....., U.. ,,.. H., ,..,,,., , ..,..,.,.., ,.,,..n.,. ..,,,.. , ...,.., EW-...,.,.M.-.M.-.M...,,,, ,.............. ... ..,..,. W.. ,..,... .,,...,,,..., . ...,....,..,.....,,..,... ,..................,.,,....,..,,.. ,,.. ,,,....,......,..,,.,..,...,,.,..,..,.........,,.,.......,.,.. , . . ,.,,.. ...,,.4,......,,,,......,. n ,...,.,,...,...,.,,,..,..... . ...,..,...,..,,......... . ,.,...,. . ,...,......,,.,.,,.... W . . ,.... ,..,,.,...,.,...... , ....,,...... - , ............. , ..,........N. ....... . M., .,,,,.. - ...,,., . .... 5253. .u.u H ..,. M n.....,..,u.,....... ,......,...,.....1,,.,,..,,..,...,,,...., u....,,.. u. ..,.,,.u..., , H ,,,...,..,...,.,.,,.,,..,,.....,,..,...,...,.,,...,..,...,..,,..,,...,.....,......1,,.,...,..,...,,.,,,.,...,,..,..............,..,..,...,,,.,...,...,..,,.,...,...,,.,,,..,.....,,..,.,.......,,...,,.,...,,.....,....,.,..,.,....,.,.... 1 .,,..,...,.,.,..,,,.,,..,.,,,..,......,,..........,......,.,.,..,.,...,,,.......,,..,.......,,.....,K..,...,.,.,..,.....,....,..,,....,.. H .,,,.,,.,......,.,.,,..,...,.......,..,,.,,..,,..,...,,..,,.,,,,..,,,.......,..,.n....,.n,... M .......,, Q ,E EEE EEE Ei? 552 22 Q1 14: 545 v E55 E55 L E52 :iz S age 223 H EE- EEE 1 Ef' si! gig 522 X asf EEE ,,..,,V-,...,., 5 5 EQ, ......u. , ..n.,n.,..,...,...,. , ....,.uu..,..,..,...,......,u.u. n...u1.u...n.n. U U .,..,...,............,,..,....u...u...,.,....,..,,.,. , .,,,.. . ,,..,......,,..,.,,..,......,..,,..,..,.........,,.....,...,...,,....,..,......,.,,,..,.,........,. n ..,...,..,.. , ........ Eu .,,..,. ..,,, ..... ,mm!g,,,5n,,m..,M...m ..... ,M .... 5,H,,,,.,.,m ,.., M..22mf,.,m..1,235,,,w,mM55,Ht5255,,1Mw,W,mWwm,mwwMm ..,.,,.,,. E,,,m..,.,..,i ' ' inJiT1iiT1i1mmuRiFEE1?i1iiilR1ERiR1ii1liiIEIH3RR11..EGmmnlwummmummmulnnnummmmmmuulml1uvunmmMwin1mmulwululunvml V Page 331 ii: :X- in sis 1 35 gmmummmnmmumummmnuumuummmunu1numunnnInwuwmnInummmmummmmm:wInnmmmmnnummnmnmunummunanummInunmumnumnumruummnumnumummmummm:mmnl1ummm1.mmmwInmmm,ummmnunumnumnumnnnuuumymnnmummunnuvunuunnnnuunwmnumnumwanunvumymwmmuInmwInummummmfmnnuynwuwIn1mmnnmynuInummuannunumwInm1mnnnumumuuumunmnmmnnag E g 2.Hnn.m..m...mu...m.munu.um-llmmumm.mmmmmummmmm,.m.HH.,.mmN.11.1vm.m..m-.mmmmmmlmmm..1mmmnmum.-1mmm.-.ummfunummm....mm1.Hnumum.mmum....mlmm.,mV..um...mm.H....mu.H,mm1...nw.,ml,mm.mWK..,mmmyH.mfH.,Km.HmH..1.mnnuum.1.H.HM...-1m.H.rmV..,.HV...mm1mml.H1.E.m.wm.m..um.,uiIiiGiiC5ITiHIiiiEGiKHI5EREliiIIiI.'iiiii1EiZiiEii551Ti5EiZ.7H'fS7I?ummu.-2 55 gas 222 ESE - ,E ass 1 51: -1: l E55 :zz Eg: EE g ggggggggggggggwlgggggggumwfugm551555wwug...nmInummmummmlM1.mmm1In.mm1mm-.1mm,rmU.unvmmummulmmmunm.m..v..1 E E munmnwummnnunumvmvunununmmumvuxzunmmnnmuvmvmmnmnwnummwummmnunuummmvuiilvnliinnwunHIHHUIIPEGilHi1iiiiillmiii1iH mwanunununanunnnunummmnuummnunmunmunnuInunnuannnwuvnnnuruwuwnumunnnwnuunnu1uwnnnnw:mnmnmummmruwmummanunwnnanunummnuwmnunnummmmnnumnununuunmmnnnunmyunum:wvunuununmuuwnwumnumnurnnuuunxmwnmnnmmma 5 4 mmummInuvunwInulwmnufnununInwmnuulmm.numnufuunnnmnnmm.,nuInfmnwfuwInInw.ilm1In1I?winwulw.hInwmmwu1InwInmmmmlmmlmmInnnnu'mmmummInummmuuummmnummm.ummmulmmmmmnunum1InummInummmnu.mm1mm:umnmuumnuummuwmmmi Page 332 ii Er E :IE -V .vu..vu.n..........nnnm..m...m..u.nw...unm................................... ...ng if 1.1 .5 1, 1: '..... 'E '.... ' '!w1!!!!!!!EHf!f!fElfvul!u!:!H!:!!l5::!!l!!1!:12:1251E!EEMIMHBEKIEEHEIllflrllllinwllfflfElfIE!!tflfflfiftillllfflzlfulilff!:MU!!15!!1!!l!!:55!2!!1Elf1!!!!l!!!!!!1!!:I!!l!f1!f!!!!!!!!M!HltlrlllllfllffSiu!!!!!!U!!1!!2!!!!:Hill!!!E!!!!l!!1r:!i!1fI!!112222251525 '1!'!1 '1 ! rf 1 f1 ' ' 1 ' '1 '1 ' .M W-- . ..,...... E51................................................................................................................................................................................................................................................................................................................... ... ...... ...............:.:.....1::..:..:....:n:zzz:m:a:.ni:nizazmzazazis::.1::m:1.n:z:1z::.:mamz.:5i:.:z.:::.z:.:::.:::::::::z1:11z:i::::.::.1:::::z..:.zz:15:1n:11:m:1I9:amnzzisznznznznzzsmzzs.....:a.:...........:..............rg15 ,if is E15 2.2 E35 EEE EEE E22 2-2 553 EE EE 55 E35 Eg: EE E.. :EE .Eg TEE E55 if 5.5 ' 215 :ii ' EXE ff: . 1 U. of W. Girls Hold Smoking LS Their EEE .-f-f Rlgfl!,Bl1fRduselol,wcUptolt 4 51- Ei? ge. v......r..-. :.... ..!a........ rf... .1 ' ' 525 Es. . U.. .1 r..s..4.. E.. E: Broun n 1.luww... ilu.. a...a-'.:4' .. 'ls 5. N BMW Baum In an Jllw-. lr I. S: lm... wp- .r..... . ... ' .... ..... .2f..lI. 21,,,m ,I' .ES ...- .......TT'.. 1.1.2 ...TZ 71. ...... ....L..3r1........T .5 ....... .. ....... .. W xrr:...:: .r viz 1 -H . gif ....... ....... ... .........., .... ....... .. ...,,, gmgn, gn-gg 5 g - ...... .... .. ............ .. ....... ... ....... .:..... .. ....... . ' 5 -, ....... ....... ....... .. -.... ... ....... .. ....... ....... ....... .F 'UJEIK STUNTS AND ACTIVITIES f.mf ff-ww www- Egg ....-h.,...-......:l... .. ...m...., 'H 'M',,'jwu-- , 52. E, . .... w - .,- 5.5 .... ....-.... ....-... .... .... ....... ' Amu... . ....... W w-.... E55 AS I GLU PY 'DCIE V ' 2 2.i...'3.T.2',iZ'If i'LL .-FW-Cf- f ... :'a:::a:.-c'::' Egg ..v.....f.... .............4 N... ... .... I-ww -.H-pw...-., .M .... .. ... . Exe E 1 ,,,,,,,, ,,,,,,, ,,,,,,, ,M ,, ,,, , ..-. .... ....... .... ...... gig 5 , Vw. :.:x.ly.1..h.:..... .... ....... -.. lgmmdzlzz ...:.u....:. .. f., EF - Bwomigxgouw -....... .:'.r:'.-:..::..'w, .Q ....... .W M .c...'.'::z :is ....... ....... ...........- .... n... 5 Jw-' rm H v- ....-.... 5,5 2.5 905.1 GL ., .-mf r:'?.x...:f . . ::L'...?'n 432- 12 T-.3- ..:r:.1 :r':.t af: I A ...L ,qt ...Q .... .. ... ..'K'..... ..- ...M rv.. g: ::uAwum-1 or .r...b:...... .... 15 GI S S WA.: , ,..'.5:' ,.q-'j2....-54 '.. :::::':::.::x: n M --'W 'f 2. 'zz E.. ,. - .... 0 v n...na..u........ 'YH .,. .. .. ..-. -.5 C0-ED C5-RDINAL Y.-A gh v ?1wf'f .,..H-L ,.... -.-....... .... ... ....... NP.. ,.... . . Ss. aaa el 401, what 0... .... .... ...... ....... -..-....... ....... w...-....... ..l.1....1 ' ' 5:2 - N ,.-W.. N, E, J. ..-...,......., ....... .....-. .... ..:.:'5:r..,.1-m 5.5 bl .... M.. A .a .,. .Q 1... .. .. ... . ...........-, ........... ... ... . .... ....... ... .... .W ..- . Els ,W ,...., ,.... A... u ,.. ....... ....... ....... .. . . .... .M .. ' S.- EEE fm... N..-AIN, ... 'fun ffm. ....-...... ....... .... -....... .... ....... 31?-I..'.Y..'I M ers :fg .M .,,. F... ,,, ......w..............4................. ... . ....... .... 'X ' 5.5 :gg :LM -va ,. 9-'QL ,....-K ,, -.... .... .... .-..... 1-... .... .... .... .. ..... ......'S7I. S L'1'.I f' :ra Ee? ' .1' xv- ...w ...4 X... W 'M do -ww ..- ....-.... 0. ....... . .... ... f-.... I.. :fs Sokon i.'5.'nkt...-g:,..- ff.. -f:,..... L'..':..'f.:.:z .'f.:.. :u':.:: M ... . ,.':. -V N- 'M--1' 292 5.5 .... ... ....... mg-, . .............,.. E.. 552 SPQYES Pi- .T..-fi. 131253. 11 5' Lij.. ,'.L...3'!!. f. '1. .....'3.. 2f'.. 'S'.3 -T.l'S'...'211 2.17. '3. 1' E., ,N Ag -, , .... .. .... .... .,. 'Z E 2 E.. sq G -.... .. .. ...,...... ... .. .... ....... .... .. ld fx: E55 Nun B , ....... ....... ....... ....... ... -....... ' 2.3 sig :wx Aw... .... .... ....... .. ....... . 1 - -'---W 5:. EEE G ...,............... A 5,5 ... 'up elm., f .,: . . 1 931. la L, PHE . ss: sr: M '4 T. lh. ' ' - , . Hs gs. XX K Jw... 'M BY BARN I E . sr. sie . M.1 'w-.. X ARD GIR N 00 225 EEE ' ffm. 'H mf B-1.1 r 5 Q 4' Egg .... f'T.'2,'f--.. fn.Z f-f. ' 'M-vu......,., P100 E.. , ..., '1..,.,, . ,kg ..-.,7Hh... 70-... mm um., ,,, fm-S .hobo 61707. 555 ff . - '1' fff9:f:T. 'lf :'f. 154'-12' 'Wk . f 3'f... 0000 ii? ,....fgi.--- E ,',5j.P', 5.3. .'f.'.'ggn.?.i7 .H-g,' .... '.'g-fn... ....... 5. 'Q .43 ',4.,'Q 'z,A,04- jf .s ,.. . ,,, or n. f .1 ,,,, 'rn ....... ' - -- , 5 3 :SE ..2'f '..1- 1-ft . n 5: ':I?. 4 U'bf .? -4... Lim 'I da--J ' 'Q Wt '4. 3 '2 v'f 041- 252 :gg -.rf o' , b.,,'- r., mv iz, n., n.,.p ff. whim gnu. hm, Haunt.. owe. '.,,.1G4,.l,4'h,,':a,'n,oh E.. 255 .,.-- ...-- C 'u.,, Sum f W 'fha ' , ' Md -1. L. '- - va f' '- 0. 0 ,fnprf ahh, 255 sf: ,. -- ,..-'.. f' M-.. , rn... -'f! ff.,, H -.... ' 'M-1-1.. .. .jun fb If 'vw 'wwf 4 . w 4 555 . ....-f' --M - '.... l'ln. '-'lv.:'N4l mf.. .... - 1- 1.. ,M 'i - . 4- '4- '4.' df. 4.. rg. mf sis gg. .-- ,. -N n... 3 ,,,:-f .., m..,fN x, Dj... I wr.. ... ...,,., M fn... ., mg., -,ff ,-mls, .,,, 5.5 L- ' .... x.. Ms. 1 f a. -'...'I:A..,,'1- ...o.. '5'-- ....., Lb- '.... nj. 64.9. 'e. f f Z.. .. , ,..- . Cn. hu... ' A La funn... 'ml u ' . 'W 1 qu -1. .55 M. - - --' ... w- JZ' '.... o.. - m.,'2 fn,NPu rs. r.u...,. 'w...., 'v fq,'v ' - S.- 55 b, -:K iw.. 5 .f a ,U ,H ., - 5w......-1......, -- . rv ,,-. 4, - g g 1 f- I, n...,fH'BZ'ff 14,134 '6fm1','j2y.N 1.E'l'l'tv....'1 'N?'m-. .. ' 0413 1 4 453' :ig ,....--, ,,.ffT.---S51 U, .., .fbi o.,,, 5....,,A:.. Dem. gf-I-Z. lm... Hanna... 4 4. ' 1 gig . - ,. - gf ..fv1 .. ., mi P. , y..,Q7c.,,1 .n..,,g,,f gEw... n...-Lf' hu.. E Q PQ 5,2 E.. ' ,. ':1...- g...... -v.. gp: mp., -. .. . H-u n...., g-f ,,f'2,,'b 'fisbflbe sg- gag -- - .- - ' P- C '-1 M ' L. 4, E,- sis .l1 v' . + Z2--- 'Q wx lp E.- g ,,....Z. l Q N W 4 E5 E., N.. :,. - H 4. Q. 4. 72' 2.5 iff - ' - . W '1Zf3Z.:7 nQf'3 3 +. ' , Ca-Ed Mermand Brealu Ice I-Tim With my QQQQ Qf? e '41 0: EEE E.. . , , . 5: EEE Foot to Take Furs! Plunge IH Mendota .!':ff'i' M .Qf :., EXE 5:2 - '1. 41. W. 4-t.'1. '-HV Ulu . 512 mm-L... .-H.. ... ................ ... ... ........... .... .... ....... .... ,gli 4:3 'v.Q, 'ff'Q'N.,, b 0f.Z ,of'?f CMJSSPN, Ii? :H ... . ... .. . ....... .. .. W. .. - . . . . 1.5 .......... .... ...I S-......i'Z.. ....... ... ,.... '5T.o4'v '.f','qf:l' 120140. 'W' L 4Pp ' ' Egg 9, .. ..... ,.... ,.... .... .... .... ... 51'-W-gk. wr.. .. ....... ...... .... ,,, Margin: shaywb' ,fy 54,1145 Somali dns FW EE S, 9 -.. .... ............... .... o,,,-'gmggdy -M -1-H 53. -f. . 'lv -4 41 4. 411. 'DAY E.: 5.5 969. 4, ... ........... ..., ,.... ... ... n 'v fo. 0 'M' 'f 'Jw ' A+. or Mo --- .ef . 0 xx .. ..,........ . .... ....... . . 'hm Mm T...--....... ... . lv'-.. -., ..,'v, 'w -. - ha., 'Carr cont E55 E55 big' 5X Q. A ....... .. .. . .. ... V ' - '- ....... .. ....... .... .... ... ....... 'mf lv . wo' 'L 1. my or-. ,, -im E52 ,A-2,?'px'Ygv0e,,ng.g1.:I,:q E K:.:'..J..S..I'.2. I. ....... .... ...... rg3.33535147515-I-.3-53-5-umW ' LQ' 42-1'E.'j,-.'f'g1 '-6 '..f sm, W MW, f 'fw E., Qov-gn.-N Q9 ..q,.i,.- ,..f,.. V .:........ ....... .......... gm H -M .47 . W f..1, f 7'27 Q' AJR- .. Q ,,.-tg.::.,.:0, .:3,.x.:1,,.... N Q 5-........'...... ..... ... .... ...- ..f,Z',,'f1T-...7:-1Z1.T,1,- -51.553 bw o.,,,v0...ji malzbgf. l...1...-.ZZ'y,? 2:2 sig nw x r, .-' . , f'--.-M f. .. ....... ...... ...... . ... .... ... '- .. ff - .' fr-. w.L. ' . if .-'1,Ig,.- l.gS.1rT-f:..1, .1J m:r...r:r:..11:rz.::.:7 :..::H:1 JH -F 133.3 T-2. W' 2571? 3972.9 ill ,.-, X .W ...,.- ....... ....................... ' 'D' ffm '-I M' RQ, - ffl' 'f W- 'ow' wa - EE E.: -v .-f c-'AM' 'HQ 59' .... .. .......... .......... ... ' 1 ' -v.. 'Ym ' f H .1 L' U. 1. ' :f: 5:5 ww-' ,w ..fA.w,sP ....... .. .... .,r .... ... . ' B3 'u ' P'f' W H' -'H M' 'f' f-. ' H.. 'f . ' 'Q ' iii Eg. ,. .. .V .. . 1. M M xv... .........., ............... -.... ... . .. fi '-0. M ,f. -.... '-- .1 wiv.-gi-.gi-4' .z..:...1,' :.:.':'m:r,.m: .sr:w:::.::'.'-Qii1.f'4E'5:l' ....j2.Q..:-Tir' .E Egg ,,. 9.5. .M ,......a.... ....... ....... .... ...., ......,.......,.... . f. 'H' ... f. -. ' '1-...JM .411 .. 5:2 .A W HHH... ......:........ ....... ....... .... .... ....... 90 ... -.. '-.. 'f.. 1: .A .-.mxPr:...sz.. :..'::1:LLf :'.'12:?.. 'U ' W 'W M -me 0' 'n EE .nk-.-ma...::LzT2.Ln.:....... .......... .......... 15.3 257 2 f.:Rf.T'12f.T. 'A' he-T, :::l2 'ZfZ 4':f', '-3'7 -.T..'L' if m.......'..m'::3.L': ..32::r:.:':':1f'm' 1' 0 'fi M511 '-1? .Evra-' M- fm.'Jn'.2:2:.:U:a..':u.1 :rz:5 vw:r1p'g E,53TP.'5E1'l'2'Q' .,Qf'.gf-3 g.,o QQQ. ,:f27.:0'i12.:gH.::M-7:'.f'2m5?' if? ,. -w- -'nw' Q. . -. .., 4 ...Z fb-'Q-mx H- Egg 6 . ....... ,N an so ... A, ...W ..,,,a'..,n, .., N.. 3,3 555 . 1 CX, 4 . 00.15, -.,, -11 .,,,, fm., I-af., M. W'-1 .. 5.5 gf 5,65 v 4 1. 4-u. QM - . ... rf-.. .. lf... lf- H- f . Wt. W.. W 1.-ff.. 'M .3 ff' v- .A 1- 'Q MQ . , -. 'f-1-..2 -1.. H... , fm.. ' Zi' ..3.G:i.v Z.. :.. M Q... Q5 'ff.mf.. if o on ef . w ..v' .1 T., E fm.: . 'lf -. L. 1. W.. ' .. 'ww ' 1'-.Z ' ' m gr- vw. .v J- ,pw .,, RE -. , '44, .. fa Q, 5 .... 3... hc, hz... . 3. ..: Mwififf-:r?3f'?X .2'F '.5'9 22.zQ hw 1:'f 4?'f5. ' 'n5 1Yf'L'::l.-.2'EH-'J'z?f21. . '. -- 9' . K .M . no fa.. r. fv..,,, Q. M' H .Y E25 :gg 4,.ff,,..:,. 6.4, ...sw . af... Wm. ....,,,nu.. BQ., M f'+..,q:'g3.,, 046 00 QQ H: iii P10 .4 .GQ-1',. 'Q'.- ,vjy rv., 'e.., l, ur 4 R15 ., ,, I ,F 0 49 SE iss ..1.Z4 .1' .W .,.- ' 5.4.9 ' 'fr q '-.. '-'f hm 'lf 'l 4 '44 'ZW E.. .55 . ,A .f' .-A ,,,,...r,.w Q- ... Mg. gnu., -...,4'-...go '-1 , If 416. of1.:g,.'. ' ,. f ..1f one -. . hv. .W .. fn., I - ' ow, X Q . 6' I :ss - .4 -,fe ,,.. ww .e',,v,..x U-ww e..,, Gem., ACH., Q4 eq-'41, 6,4 7' .H - vm . .0 .v ..- .0 .. w...,'-nl , ff.. 0 ' .. Q. 1 .. ...........,.... .... . Mn. n..-fa. '-..- f 1 Q, 1.5 .19 BX ,.x- pf' .0 o' .. QW m Wa., IA. 41-rv, fu I., '-gf.-, Pm fo 4, see -wr.-' . ' .1'.1w ..1' .v .G ' sr 'He 'Wm M- ' 0 fb, x Q., Eg. W' .4 xv v' .1 .X xv ,dv .A IA. in fha H . .- '44 'fr e 'Q I QQ ' If-E.3kil3:i'.'v3E'.?5E'55 'N ' -:fZf??.:,e2.,?-fyfovi. 4' . -.':.w..f3- gm-g'i-fi.-tr.-' 1 ' .ww .:f..'ggM'Zf..3'f'?f.. . .X wx- ef '.3 1tW ave. Qf.:.1NfaQ.fQ.. -- :EE W X eb' x .. B Q' me X 'I -E5 E.: v.......wL 14, 4. .......-. ,z 3vA5QI:1T3'.2m3'T 'Zf3'B3Yt 33. .VN . 3il2'4'l2 -'Z'Qf?.:f'i'05'.1'? sag -X .H M- A v- ...X .- .G Q., H. ff. 1-- .- -W.. K. .... Q. . ,fo ..,.,,f. fa.. , f. . . .+N,.Qx,.Xgv,.sw.-2. -'bw l J., 5 4,505 .www .1 Q., fg.,, ,,, ,of ,ig vw..-'A .f ,...l,..-1 .bf 0 J! . . V awgqbf, ,gems mag. 1-,1 J 2-: .... , . ' JVC, 21 ..,'f.'g- 'wa , ff., 4,,4.,4v Q.. .- + .-'..,w f 'MM '04 mf 05 Q X 40 '5...f'iZQ.0.Z'f l'1'5' Qv - ..'aM'0 'W-ff' 5E g.. :.. EEE EE 5: 5 jg.........................................................................................................................................................................................................................E.........5.M...........!......................H...mm........mg......ZnM....w...mE2E:Hmmmu2.5.2Y..mm...M..DS....mxwwT2E.E.M5.5.3...3...mmm..25.2..E..!m..TTm.mw..g....................2 I 'M' W 'M ' W ' ' ' '' ' ' ' ' ' ' ''' ' ' .1'.. 'az51.L..1im...m...........aammxiznana..1az....5..5............................................................................................................................................................................................................................................................................................................................................ 'A..................... Emunl ........................................................................................................................................................ . .... P a g e 3 3 3 5 I mm' M--vjmw ,-M-Mmm., I 1 I I I In I IIIIIII II Chacibourne H4111 Ojicers GRETA SCHULTZ . . . . . President MILDRED SINCLAIR . . Vice-President ALICE EDISON . . . Secretary MARIE BODDEN . . . . . . Treasurer EVELYN LUDLOW . . . . Social Chairman MARION STRASSBURCER Keeper of the Archives Activities 1918-1919 Oct. 19-Matinee Dance for the News Girls Nov. 28-Thanksgiving Party Oct. 26wCorridor Spreads Dec. IO-Formal Dance Nov. 7-14-Initiation Week Dec. 15-Christmas Party Nov. 20-Peanut Bag Rush V jan. 16- Silent Night Feb. 8-Faculty Dinner Ludlow Harrington Schultz Bodd en Sinclair IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII I I I I II I ImIInInIiwumuluullrlllumIIIIIInIIIuulnlllmulmlnm I 5 Page 334 gpm-1 E a 1 is na I IwmwuwwuwH4wlu1H1wn1fuwUw1.11H4wnwwI11mwu1wnwnufl1wmmw1HwIn1uwwn1w1H11141ynwwnwInwuwW.11H4wnw1.11Inwu11u11nwuwXI-X1uwinumwn11u1inum1n1WwwH1Inwnwwuwm11n1H41H1wu1ruwuwunwvuuuw1nvwu1wnwmwwnmwnmmmmnuvs ,,..,...,..,,..,,..,,..,H.N.,,H,H.,,,,,..,Y..,..,,..,,..,..,,.,,,H,..,,..,...,,.,,H,,.,,.,,,..,..,,..,,.,,X.,,.,,,.,,.N,,.,,.,,,.,,.,,X.,,..,,..,...,,..,..,.....,,H,.,.,,.,.N.....,.,.,.,,.....,........,.,.,..H,,....K.,..,.......,,......,...H,,.....,,.H.,....,.,.,.H,,..,..,...,...,...,,.,.. H. EE , ,.,. mv-- 535 , EE E52 SEE ag: 1 1 E52 EE if 25: E25 iii E35 25 EEE X EEE w 522 gig Q sga E iii 1 EEE fee w is: 255 I Egg E55 i 355 22: N :Ez 522 , ii? 21: X Egg :za X ess :E :ia E15 . ifBm..k.m..m1W.....Q,um.....,H.,..v.mmmm.,.HXnu..W1-1,mu.,K..1.N..H..W1mm1..,,..,..W1.U,ml..L..,,.muW..,1.V,......,..X,.WW..,.MH.1K.,,...W1..,Km..,,.X1.W1.H11.1..H..,.H.nw,1H1.muU.,.Nmm1H,...W1K.,1.w.1U.,1.U.mn,,UWmX.1,mmH.W.ImlN..,,mmmXWH.,www1,.11nu.,N,1.M,H,.H...MX1.1,uv.,,.1,mm,Iy,,.U,.,,.,4.u,Km.,,N.,,.W.H,V..,W.,N1.,,.NH,W,H,.W,..,xNW..m.,.mnNV.,muWmy,mm,.1Xmmn.:vT,,..mmiTTZEE .....,,. ..,. .... ..,. ..... ,. ..., ..-N Mi I 1 I1XU1,Humwm.wm.mH1.H1.1XnfL..WH,1.W1HXK.,H,1HW,.11in1..1,.,X.1XX.1XL.111WXmW..WH,,A,W1.1,UXWyX,..XWUW1.WX.N,1.WW.XWNW.1Wy.1,UWW.HXWH11.UHWW.HmH..W.H.flH.H.mmH1,N.m..m.m.um.........m w lmwwInin1nvwHwIninwnwwnwnnvuwHw1Iw1InmwnwinwnwnwmwuwmwUwmwH11n1nwin1uwwIwwn1nwmwm1.11InunmwwIwwnv1n1w1wuI4wn1wnvrnulvumvummmwww1 ffmunwIwwlummuwwmmnlww1wwInununnuwuummnnwwnwmnuwwIxxnxuwxnwwnnnuuuwnuuwuuuu1xmxmmxmmuluuumnunulmu I Page 335 mnmmu.u.mmum.mm....m......n 1 . mm..mmn.............mu mmmnmummmnmmumnfmmmmnm I minnnruuummmuwmmmns rmnn mm .muunu u .nm .I nuvvmuu nun uxnnnunumiiu mmmummununnumnvmxium.nmmninuimiuwuiwuvnumluummnnmmunu 1 in 1 v n umm. mn lr nr .... ... ............................. ..................... . ....................................... ................................. . ..................................................... ... .. .. . ............................ ...... .... . ....... .. ......... . .. Oct. NOV. Dec. jan. Feb. Feb. Feb. Feb. ...... .. . .... . ............ CBar'nard Hail Ogficers VELMA REID . . . . . I-IARPJETTE WILSON . . ELEANOR STANCHFIELD . HELEN SNYDER . . . CLARA MUELLER ADELE FALK . . . . GERTRUDE JACOBS . . DOROTHY BELLE WOOD ELSA BERGER . . . . 5-Party for Freshmen at A. T. O. I-louse Mar. 26-Freshman Initiation Mar. 18-Christmas Slam Party April 17-Tea for Chaperons April l-Mock Prom May ll-junior-Senior Cabaret Dinner Dance May li-Valentine Dance May 22-Washington Birthday Party june . President . . Secretary . . Treasurer Social Chairman . Music Chairman . . . Librarian S. G. A. Representative S. G. A. Representative . . Fire Chief 9-Reception for Old Barnard Girls 17-St. Patricks Party l-junior Aoril Fool Party 20-Easter Egg I-lunt 3-Mothers' Week End 4-Vaudeville 18-Informal Dance l-Senior Swing-Out Snyder Mueller Stanchfield Wood P .1 g e 3 3 6 Jacobs Falk Berger 11111 1111111 11 111111111111111111111111111111111111111111111111111111111111111111 1111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111 1L 1 11 111111111111111111111111111111 111111111111111111111111 11 111111111111111111111111111111 111111111111111111111111111111 1111111111111111111111 1 111111111111111111111111111111111111111111111111 1111 1111111111111 1 11111111111 ' ' 1i111i1'- il1E211iiGii?11111E11iiiHi?111H711ii11111121511G11H11111FII1E11311111121111112111111il11i111111111111H111111111111111111111111iiiEli11111E2111311211E11E211151113111111Fil1il11111121111111111111111Ei?1121III1Fil11111111111111111 l1 'i1l1 i1'i '1'1 '1' 11111 111111111111111111111111111111111111111111 11 11 .11 1 1 11 1 1 111 111 1 111 1 11111 11 111111 1111111 1 1111 1 1 1 1 1 1 1 5 1 1111 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111 111111111111111111111111 1111111111111111111111111111 11111111111111111111111 1 11111111111111111111111111 11111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111511311Q111111111111111111l111r 1 1 1 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111111111.111111111111111111111111111111111111111111111 1 11 11111111111111111111111111111111111111111111111111111111111111111111111111111111111E11III11E11Zi11i11Ii11ii1Fil?li11ii1iii11i11E11iiiI1i11ii1il1iii1ii11i111i111111111111ii1I1il1i11i11ii1iiii1i11i11i11iiiiii11E11H1111lil151111112111111311I1liiiiiiiii1ii11i11iillii1ii11i11ii1iiiiii11111IGIiliiiiliiE111111Ii?P1131111111111i1REi11i11111li'1111 1 Page 337 wmv I Inn QjNla11oney ,S 515 Lake Stree! RUBY JAGOBSON . House President Graduates ' ELIZABETH COBURN RUBY JACOBSON KATHERINE NEERMAN 1919 BARBARA I-IARKNESS MARJORIE LACEY 1920 ESTHER BERRY AGNES LYNCH MARGUERITE DANA MARGUERITE MOE MARIE GRAMS MARGARET MORAN KATHRYN KELLETT GERTRUDE OPPELT 1921 AGNES O'I-IARA IDA SWANCUTT MARY ANN ORSCHEL RUTH SWANCUTT BEATRICE S1-IERBURNE I-IAZEL TOMPKINS 1922' ANNE ALEXANDER ELIZABETH LOCKWOOD ESTHER FERTIG MARGARET MCDERMOTT MILDRED HOCH GLADYS SCHILDHAUER EVELYN I-IUNT MARION RINGER FRANCES JACKMAN RUTH ROMSON CLARA JOHNSON MARIE TIGI-IE MARGARET WILLIAMS I I I I. I I :InIIIHfiiiiifii?5iII:nI:1InI:afiii5555ifilfiifiiiffiffinsazzz I I I I. IIII. I I Page 338 .mmmnm.,vm.mmmxH-U.,mw.w.mU.W,mmnw,mmWH.ml,HM.,...1...W...W.,.WWnu...mmm,HYmy..H..um...vmkm.mmH.v.,,...k..,rm.HWW..U.,um.mmK..Wnw.WW.HH.,H.Y...,..m.,.m,HWH.W,.m..w.,.NH.,,HWmm.W.,.WK..U.,H.V..uw.H.HH.,H.H.WW.,W..,H.,H,WV..WW.,N.,.HH..W.umW.HH.,.H,..H..,..H..H..,.N.H.......uw..WKm,HN.,H.W,...,m.......H.,U.H..U.W.umW.,....W...vmlm,H,,.m..,..,..W..,, 3gn..u.4...,...,um.,nm..WK..1...,..4,.HH.,nm..U.H.mmH.,......w....HH.,H.N.,Y......,.......,H,KmK..Wm.,IHWK.,H..mm.W.m...Ww..1,..,H.,,HH..Y.,W..,,..1H.,.HH.,,.m.,1.,.,.m.H...1.Mum..H.U.mV.,W,WY..YK...,.....H.HH.,K.w..m..u.....,,fH.HN...V..N....W.mm1HN...H.W,W..W.,lminH.,V..,..wm.Hm..H,W,.w..1.m..,m,mH.,K.,W,H.WmH.,..v.W.,,,,.,..,,H.,.U.m.HN.,W.,...,W.mw..1.,.,..,...,,mu...myHH.,H.H...,..,..,...,...,...K......u.E55 E : 5 5 E g: 53 E 5 Q 5 5,gyggww325151135155315.1mWH4nmInvuwfmnlwmummpwInvu11I.1nuruummInwn1mwInWwuXmmmmrmyuInwHWIn1.IwmmWHInH1fn1-I11.11InmwnwummmuwnwmmmwinfuwlummuwInrn11-MmmnwwmmumuwInWuvmmyrwWul11.1ynXInmMHynm1uwm1InmXummmInI-1ulm1H1XuuunmHInmm11nw.11IninNmmvmW1HX1-11mm1u1,HH.un.yn1m1.11WNInyuN1HInH.1H1in1inV..mfTWww.1m1mmXW1W.Uuwmgyxfugfgugufgmylwf QmwmwInwu1yn1InnumlwmwnuInmywmwnwmwru1mnuunwanummwmMvii?iii1ii?LMii?iiiI1N151iii1Milli?iii??iGEQ51ii?iiiGiiiilliiiiiiMGE1ii1G11iiIEEEiii1iiilidRE1liwiiiIIEGEEEZIiiiwilGi?hhInlmmwnw:mmunInmmymwInm.mmwlnulwH.XInIn1HXHHInWm1lmmmuluwInmmunmwrnwuwmmnlmmmmwXn1mmmmwwuunmwmwmmw1HinXmXnXWWnumuv11wmwH1mfInmm11.mmn1mfInmmm.mmmwn.1fmuu.mmmmy,mmwmmmnmmmummmvm Page 339 I I I I I n I In u I II IIIIIIIIIIIIIIIIIIIIII Ye Garth Inn 606 North Frances Street ADELLA BOIES MARTHA ALWAY LUCILLE AUGUTT ELIZABETH BENNET ENID BROWN KATHERINE BURTNERS ELSIE GRABER MARGARET CRAICPIILL FLORENCE DAY PAULINE GERLING ADELLA BOIES DOROTHY EVANS DOROTHY POWELL ADELAIDE ADAMS KATHERINE BARTHOLF RUBY BRITTS AGNES EWELL DOROTHY I-IOHN EVELYN I-IOUGHTON 1919 1920 1921 1922 House President LOUISE INGALLS MARION KIMBALL GARNET KLEVEN MARY ANN LOXVELL GRETCHEN MUELLER LUCY WOOLERY DOROTHY GLIERNSEY KATHERINE STAUFFER GRETCHEN ScHwEITzER PAULINE POWELL MARGARET NEAL CLARICE WINCHESTER SUSAN LEARY DOROTHY TERANT CAROLINE SCHWEITZER JULIA WATSON VIRGINIA WOOLERY LEONA WRIGHT PM mm nm mm mmmImI IIIIIIIII I .II Im. I I I In In ...WI...IIIIIIIIIIIIIIIIIIIIIIIII I .mmmuu A I iiiiilEiiliilEiiZEi?iiiGilIIIIEHFIESIIEYERIIEIEIHII' I I I I I IH I HH''HW' W l 'f 1 'X' Page 340 Red Qhlill 257 Langdon Street LEONA PRASSER ELIZABETH EHR MIGNON WYMAN . House President 1 91 9 IRENE QPGENORTH MIGNON WYMAN 1 920 ALMA BRADFIELD . CLARA HOOVER HERMANCE TESCHNER 1 921 MARJORIE I-IALL 1922 ELIZABETH BABCOCK MARION Goss I-IORTENSE BASSETT DORIS LOVELL MARGARET CONLEY I-IARRIET MANSFIELD JOSEPHINE DORING FLORENCE MILLER ELIZABETH VERNON ELIZABETH WAGENBRETH 49--- Mz w ,Page 341 I In I I Qradford 'S 613 N. Frances Street A ANNA G. BRAUN MARJORIE BLACK MILDRED CLARK FRANCES HIGLEY ELIZABETH I-IOOPER GLADYS JOHNSON EDITH NOLL ANN BRAUN FRANCES MALM LAREINE MCKINNEY MARGUERITE DOUCHERTY GLADYS I-IADLEY MADELINE HANCOCK MARION AYERS FRANCES COCK-IRANE Adult Special MARGARET ERBE 1919 1920 1921 1922 IIIIIIIIIIInII.IImmIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 342 House President GLADYS PASEWALK JANE PINE DELIA PROUDFIT MARGARET SCHATZ MARJORIE SEXTON MARLYS SHAW GRACE PATTERSON MARGUERITE PATTERSON FLORENCE WRIGHT ALBERTA I-IELLER DOROTHY MEAD EDITH PINE ALICE LINCOLN ALICE WILKINS White's 517 N. Lake' Slreet MILDRED RUFSVOLD . House President 1919 LUCILE BORN BETTY NYSTROM LEOTA CAMPBELL IVIILDRED RUFSVOLD FRANCES WALKER 1920 DOROTHY LEVY 1921 SOPHIE DEHLER ESTHER ROBERTSON ISABEL FARRAND JUNIET SPAULDING ETHEL GILDEHAUS BERTHA TIGAY MARGARET KIRCH CLARA TIGAY 1922 LOUISE FRITSCHE GERTRUDE GILLETT HELEN HAFFENBERC GRACE I-IEMINGWAY KATHERINE MEYER LUCILLE WEST IIIIIIIIII-III IIIIIIIIIIIIIIIIIIIII 11NIMHIIIII-IIInInI.IIInII.II.II..4IIIII.m.III.IIIIIIIIIIII Page 343 OLIVE PETERSON RUTH POTTER IVIABELLE ROGERS ARLINE SANDER ALMA STRAIGHT T m v r 1 1 T H n T 1 4 ur Tm x nm 1 mmmuummuuum:Tuuumummuuumuunrlnvmnu num u Dewarlc 's 230 N. Brooks Street mm mm umm nu un rum HAZEL MURPHY House President I 91 9 MILDRED PEDERSON BESSIE SMITH I 920 FRANCES KLASS HAZEL MURPHY JENNIE MARTIN CLARISSA PATTERSON 1921 IRENE GARDNER - MARY ALICE NEWTON MARY VOORHEES I 922 A ESTHER GUERINI MAUDE MOORE E BEULAH MCCOMB DOROTHY SHANER LYDIA SCHULZ . .... ' 'l 'f T'1. . .. . T1'mmf :L ii.H1?'G'i ': ' ' . .. :mzanzasaaiwiaffiizzznazaannzsanznnma .. . . ... ...... .... Page 344 Sig Els ESE EEE is :ii E32 ef E S Sig E55 E55 EEE Eg: S-E 522 5,5 E35 I 5. E32 :Ig EES E22 E25 555 EE 525 :if E 2 555 555 EE E32 255 E45 sig EI: E55 E55 sag Ei: -E 555 sig I s s a a s 1 I S55 EPS EE E!! Q 5 2: ,..........,...... H H. .m.,...I..... - Illllllllrlllll I II II Illllllll Q'! E1!!1ELf!1L.,J'Uf'!lJW1! ' .m.mm.m Mun kumm I N M nan nm n nn I unnuuuux I wx n I n I :I rm: num n :Inn un nu nr uv Imuum yy n my In I Inf un: n uunuuu Siggezkob 311 N, Brooks Street LILLIAN I-IANSON ELIZABETH ALLING FLORENCE BABCOCK HELEN BABCOCK HELEN DODD LILLIAN HANSON EDNA J ONES MILDRED BROOKS CAMILDA COUTURE nu ummmmInfumuInInummmummInInummmu.ummmIm.. nu u u :mum nmunummnm I Iuunmnunuuu uuumunnumn n mx In 1919 1920 1922 um ml If -mmmmmmm mm. In mm. u IImmumummumunmnnumuummmum Page 345 House President INEZ MERRILL HAZEL ROSE CAROL SMITH NORMA PELUNCK GERTRUDE IVIARGRAFF RUBY ROTTIGER CECELIA HAVE F RANKIE NELSON ..... I m'.....,.i.5.,,... ..,...,,.im,,........ ,.. ...... ......... NAWWWWWWWWMWHWMNWWWWWHmmmmmmmmmmmmmmmmWMWWWMMWWWWmmmwmmmwmmmwmmWMWMMWWWWWWMMWWWWWMWWWW NHMUA, rTmTnW,. , nmAT.,m T N A.HuAn.m munmHTmm.Hnm.H , . , , ,,mH. .H. .W A T MW., MHAWWMAAWMT HWnmAWAmMAwW.mHHHwmwmmmmmwmwwmmmm l Owen S 271 Langdon -Street RUTH COFFMAN House President RUTH COEFMAN 1919 ,,. Q. LL. IVIARTHA YOUNG 1 920 JOSEPI-IINE PEARSON PAULA RUDER S 1 921 HELEN CONWAY 1922 MARGARET BUTLER VERA HERMANN JULIA COLEMAN JOCELYN KNIGHT IVIARJORIE BLAIR ELMA STAAB ELLEN CORRELL V IOLA THOMAS ANN VAN ARSDALE ..... .. ,,., . ,,..,,,,..,,..,,.,,. . ,, , ,, .,,, , .,T.,T, .,1., , , ,,,,,., ,, ,,,,,, ,, ,,,,,, H ,,,, , ,...,..,,.,...,..,,.,,,.,.. , T .,u, ,..,,..,..,.,.,,.,, ,,,. ,,.,,. ,,,.,,,.,,. , , . 1ITIfmm:wmmumnmulnnumumnmy nlunuumumnlnnmmnummmnn uvuTmmmmmummmnuum uanvmnmnmmmmnnmmmmmuuuman munuummvTmTInmTmTuTmniliiiiii?EWiiiNillii?iii?ilIii5iiKiiYiilEii1iiTnmmuunnumummymmmmnmnu I uummuummmnn:mmfmrunununmmummmunImmuummnuuummm nmnmmmumunuummnmnummmummmnnumnmmu Page 346 gugIIIWIIumu1mumInumInInIInunnnm1ummInIInInIInnnImInIInIInIwm1InIInIruIImInIInIInInrmnnnuInIInIInIuInuvmInImIInInIInIuIInIrmInIInIInInIInIInIvuIuIInIInInIInIruIInvuIInIInInIIuIInIInIIuIInIInIInIInIInInIInInuInIInIInInIInIInIInIInIuIInIImInIIIIInIInIInInIInIIIIInIInIInImInIInIInnuIInInIIIIIInInrmIInmIImInIInIInInIInI11IInIInIInInIInnuInIInIInImmIInnnmmIIInInnnnnruInumnnummummmummwummnmnx -I sis E's 2ig.....w.,11....I.11.11.1111 IM,.1,...wIm.11.1.11.,1..1,......,mm..,..,..,,...I..mm..1........,.m...II...I..I....I......I.,I.,,..I..,I...WI,.....,I..1..v..1....M1.11.111.I.1.1...I.1.1,1 I 1 I I . . I I . .,..,..,.,,1,Inw.1.1.,.,w.1I.1w,,I.ImI.ww..,,.1I..m.I.u.,.I., I.1I.1I.w.1,,Wm1.1.I..1.wm.m.,1.1.w..,HW.,..,,..,.,.I.,...I..,..I..,I..w..11...,..I.......,.........,. 1. :ss if 5 E I W ar s 212 708 State Street ESE E52 QE EI: :ss E15 -if - gg FLORENCE COLLINS Q . . House President W I 920 FLORENCE COLLINS 1921 FERN BUSBY 1922 EE FLORENCE BROWN PEARL LITCHFELD JESSIE RUSSETT JOSEPHINE JORCESEN IENYD 3 LUCILE MURTA MILDRED STIC Cach ' 602 North Francis Street S , KATHERINE STACK!-IOUSE . . .. I-louse Presidenz I 91 9 FLORENCE DONACELSKI KATHERINE STACKHOUSE I 920 5 FAITH ARMSTRONG MILDRED LAWSON IVA RANKIN MABLE I-IEDDERICH E MARION ROTH l 921 ' LORRAINE IVIATI-IEws ' I 922 MARY ADAMS BOYD WINIFRED Moss ALICE TUCKER AMY COYLE IRENE WELSI-I I I 2: III I I II I I .Juana .... I:u:::::ILw:2u ,... I II I mxummummmImnummmmnnmmmummInInmumInInInumInIInnuInInIumumnnInnmnummInInImImInInIImmmIuImImInnuIuuuInInmuInInm1nI1InInIInImInInImImmImmunInIuIInIInInImnuInInImImInmnIInummmInummInInvmInIInmIInnum1111InnnInImmIummmIInummmImInIInmlInImIInIn1111mIImm.mmum11m1mnmn1ummmIIIIIIIIIIIIIIIIIIIIIIIIImmmmuII1ImImmmummunmnnnunnuu111.11111111111111 Page 347 EIIInIInInvmIInInvmIInIuInIuIInummInInInImImInIInIInInIunmInIumtImInInIInIuImnuImInInIInImmmImInIInInIInIutInInIInIuIInIInInIuunIuIInIuInIInIInInIInIuIInIutInInIInInImunmtInInIIIIIIIummumwnmumInInnuInIInInInunIInInIInIInInmtImInnuutInIInInIInInInlImInIInInIInInImInIInnnInInIInIInImInInumuIInInImInIInvmInIInInIInImIIIInIInIuIInIInImInIInInIIIIInmnInIInIInIInIInIunnuIInmwumuunmlm In Immmmn umm nImmIIInmumIIuI.Im.IIIwmwI.4Im ummm IIntIInInIInImmInIIIW4InImInIInIIIInIImInInIInInIInInIInImInInInIImmInInlInIIIIInInIInIInmIInInIntIuIntInIInInIImInInI.IIInrmInIInIItIInInIInIIIIInInIInIuIInIInInIInInII-4InIutInIInInIInmIInImInmtInIInInIInIInInInIInIInInImInIInInIInIInInIInIInIIIIInImInI.IIInInIInImInmtInIuIInIInInIInInIInIntIInIIfImyInnnInIntIInInIInIInIInIInnnIImImmmIIIIwv-1 Frawley 'S 620 Langdon Street RACHAEL CARPENTER ,.,.. . . House President LILLIAN BIERBAUER VERA BIERBAUER FRANCES FINLEY CECIL ARPIN ROSE BEITLER Adult Special LILLIAN FRIED Graduate LYDIA ANDRAE l 91 9 BARBARA PEARSALL 1920 ELSIE HARTMAN 1921 1 922 HILDEGARDE MAEDJE HELEN WOODRUFF Ellsworth ,S 248 Langdon Street RADA ROTH RACHAEL CARPENTER IMOGENE JOHNSON ETHEL BASTEDE ESTHER NORTHRUP DOROTHY CARLOCK I'IARRIET KUPFER MARION BROWN MARTHA BURGESS HELEN J OHNSON I 1919 1 920 DOROTHY CARLOCK 1 921 GLADYS HADLEY 1 922 EVELYN LEE House President HELEN UZZELL ESLIE SCHMIDT CATHERINE SCHULTZ ALFRIEDA SCHMIDT .I I. I, ..,. ...,,..,,.,,., . MI. Im, ., .I.I...I,.,I...I.,....,..,..,. . ...,... W., I I,..IIII.,I..II..I,.II..I..,I..I...I......I.,H.I..,I.I,..H.,,..I...I..,,..IW.I..I.,I.,I.Imu.III..,..,I..,..,,.w.m,I .II..,...I,HI..,...I,I,..,,..I...,..m.....IW.,...II...I...,...I.m.:5E ImumnumInIInIImInIInummm:ummInIInIInInIInInInIInmmmmmImInInIImInmtInIutImInIlmnwlmnmmmImmIIIIInIInInEERiiI'ii1QiiiiiimInmm-mmInnummrmInInIInIuIInI-IIInImtnwmmIInmm'm4iwImiiiimiIhnIhiwiilviihivInIInInIInImutInImIIfIInIuIInInIutInmlmm.mm-mmImIIum-IInImImmInInIIIIIInImiii?EQIIQJEDEIUZHEFQIIIUIMQLFIEIEEmumInIImIIIIIIIIINIIIIIIIIIIIInnuInImInIIInIIumuIIIIIIMIEIIIIEQIIHIEEIIIm' Page 348 gIIummnmmIIInI I I I I I I I I I I - llllyl 'WM I nun In I Im: I I Ium III EI Es I 2 Elgum-uIw lxrvu II I :III lu- I nxvunwnuw num lvnuv mum If :I I I I -I wwf- I I I I A. C. Ag Cottage 1311 Morris Street MARGARET WADE . . . . House President Graduate 1 MARY ROGERS BETSEY MADISON 1919 IRIS COLDWELL - I-IAZEL WOLCOTT MARGARET WADE HELEN PERKINS 1920 ANITA BURNAM ISABELLE JOHNSON ELIZABETH MILLER FLORENCE GERKEN LAEL METGALE HELEN PAULL RUTH WOLFE CB1ue Qragon Inn 435' North Warren Street JOSEPHINE I-IADLEY . . . House President 2 Graduate I NORMA DAVIS 1 1919 LOTTIE GRAF BERTHA YAEROFF ALMA LUESSEN 1920 ROSE DURCH .IOSEPI-IINE HADLEY GERTRUDE NOETZEL ELSIE GIBBON JOSEPI-IINE I-IINTGEN LOUISE WELD 1921 GRACE MGLAY IIIIINIIIIII IInIIINIIIIII-mm-III. I I InImInIIIIIInInIInIIIIInIInII.IImmIIIIIIIIIIIUIIIIIIIIIII Page 349 I M' I I 5 IIIIIIIIIIII IIIII Royce ,S 515 North Frances Street IVIARIE VAN ERMEN .... House President Graduate ANNE CLARKE 1919 1920 DOROTHY KYLE MARIE VAN ERMEN 1921 EDA CAPELLEN VIVIAN WILIQINSON JOSEPHINE I'IALSOR 1922 EVA ALFORD SARAH GALLACHER IVIARCELLA EGAN ELIZABETH KATZ OPAL GRIFFIN Qfxlortarf Board Cottage EDITH HADLEY . . . . Hoase President Graduate ELLA MARTIN 1919 1920 LOUISE BEAUCAGE EDITH HADLEY I-IAZEL HOAC- EVA TURNER I 1921 MABEL GREGG CHRISTINA WEEKS I P I ' IEliEl!1H1I!!1iff1551511lil?I!!lllfllliflffllfllflillll ' I I. I I I II.I.III..I......II..I..III.II..I..I...II..I.II... Page 350 I 3 Grady S 708 Langclon Street FRANCES DUMMER . V' 'H V' . 1-louse President 1919 MARGARET FRITSCHEI. HESTER WADE 1920 GERTRUDE HOACLAND MARY WHEELER 1921 MARION BENDEKE MARION FELIX FRANCES DUMMER LOUISE FINDCH ANTOINETTE FEE F 2 MARY IXACHAMPTON HARRIET XVALTHER 1922 RUTH ANDERSON ARDIS PETTIGREW ANNA BINGER CLARIS PETTICREW HELEN CHASE MARION RINCER ELIZABETH GRAFF IRENE SPIKER MARGARET 1-IAWLEY ESTHER STOWELL MARY JANE LUCAS IQATHRYN WHITING LEILA IVIEAD KATHERINE XVICKWIRE S 11 'd ' 315 North Mills Street ELEANOR SCHROEDER . . House President 1919 FRANCES LEVY ELEANOR SCHROEDER 1920 LILLIAN BISSELL 1-922 I ROBERTA BRIGGS BEATRICE SANREGRET HEI.EN KNILANS I-IYLOS SNASKALL H 1 l2flfff!2...lJ!i ..J..l1LflLJllYi!-..!,2ffTLl..JIH!f!22UIL ,J.'2fY!!!L!LiL,!LlLTf2l!Ll'l!2. Page 351 an r I Wisconsin in the Wczr ISCGNSINS war-time spirit is the theme which inspired the artist in the creation of this painting. Wisconsin's I-leroes, the gallant men who volunteered liberally and gladly are shown marching away from the great, white dome which stands for Wisconsin, the University of Wisconsin, and all of the great institu- tions of a great state. Above the allegorical figure of Forward, the symbol of Wisconsin spirit, hovers a mar- tial air-craft, and in the background is shown the outline ofa battle-ship. On land and sea, and in the air, Wisconsin sent the flower of her manhocd into the great struggle for democracy. Victory, with sword and laurel wreath, flies beside them-our boys, ,who have brought honor and glory to their Alma Mater, and a victorious peace to the world. :mv in munmuummnmi Page 352 iSCOlXSiIX. irdfie isconsin's Holt offffonor will for- ever remain her greatest heritage. On it stanb imperishably in- scribeb the names of more than 4000 of her stubents anb faculty who have an- sxvereb the nation's call anb enlisteb in the fight for liberty anb fltfumanity. Some have serveb in the ranks or on beck, some have playeb their part as oflicers, still others have kept turning the Wheels of essential inbustries, but all have been inspireo by the one great ffloeal anb have bent their efforts unceasingty to the one common enb-the vinoication o Eemocracy. One hunbreb of these valiant men sleep in foreign soil: as many are re turning rnaimeb or wounbebg twenty five are wearing military becorations fllt is the spirit with which every wiscon sin man is imbueb that has given this sityunivera place seconb to none in t e war' annals of the lanb. 4J7n,,m. HONOR ROLL ,ll-l--1.1 W.- :Z ,,,,ZZZZ :ZZ ,W ff. ri'-iy' Z 'K . . . . . . Z .1--2.i'I ,,,,,,,, egg- Z if Z Z is5,,,,,,,,,,,,,,,MW,,myWW,,,,,,,,,,m,,,,,,,,,,,,A - - ,,,,,,,,,,,,,,,,,, w,,,,,A l--- afwyf,,,,,,,W,,WW,,,,W,,,,,,,,,,,,,,,,,,,,,,,,,,,,i Z f 7 . ' 1' Z - f 7 Z TNVNVR RVL L Z ir? at Z Z 3 Z Z 4 Z' Z 2 if 4 Z 2+ f -IV Facult ? Z Z ' 7 7 Z Z BEATTY, ARTI-IUR, assistant professor of English. GALPIN, C. J., assoc. professor of agric. economics. Z Z Zi? Social. Y. M. C. A., Paris, France. Social. Y. M. C. A. gt Z Z . Z BENKENDORF, GUsTAv H., assistant professor Dairy GILLIN,J. L., professor of sociology. Z Z Z 2 Husbandry. Social, American Red Cross, Civilian Relief, 'g Z Z Z Food Conservation, Dairy Division, Washing- Chicago. Z Z ZWWZ ton, D. C. GRAY, FRANK, instructor of physics. g,,,,,,Z BAscoM, GEO. R., Major, Sanitary Corps, Camp Pike, Government. CSubmarine Detentioni. Z5 Z5 jg Arkansas. HAMBLETON, JAMES I., instructor in economic entomol- Z2 'Z BLANTON, SMILEY, associate professor of Public Speak- ogy. I A Z: 14 Ing 2nd Lieutenant Field Hospital Corps jj jZ I I . R, - ll I Z2 XZ Captain, Medical Corps, Psychiatric Replace- HAMILTON, ARTHUR, instructor in Romance languages. Z5 Z2 Z ment Unit, A. E. F. U Social, American Red Cross, France. ZZ Zi ,Z BONNELL, J. K., instructor in English. HARALSON, M. F., instructor in pathology. r Z5 Zg jg Government, instructor at Naval Academy, Government, Assistant Surgeon In U. S. Public ZZ 5Z ZZ Z Annapolis, Md. Health Service, Vxfashington, D. C. gg Z2 ,Z BRADLEY, H. C., associate professor of Physics. HENMON, V. A. C., professor of education. gZr Zi Z Major, Chemical Warfare Service, Washington, H Captain. d hi h Z2 Z2 ff D, C, OPKINS, P. Fr, instructor in topovraphy an IU way if gf Z2 ig BRADLEY, R. F., assistant in Romance languages. engineering. O U 2 lst Lieutenant, Infantry, A. E. F. Government. Z Z BRYAN, G. S., instructor in Botany, HUNT, ADA, instructor in home economics. g 'Z Z 2 Captain, Infantry, A. E. F. Dietitian. I r Z Z Z 2 CAMPBELL, O. J., assistant professor of English. r ll-TIS. L. Ll. IUSYYUCEOI' In mL1SIC. Z Z Zi? Government Committee on Public Information, Er1glr1CCrS. A- E, F, V gt' Z Z Z Princeton, N. J. JOHNSON, W. E., instructor of English. 5 Z . , CARLETON, P. W., assistant professor of Chemistry. Seaman U- 5- N- . , . if Z Z Captain, Chemical section, washington, D. c. J ONES,rQ3,rIEgEIfjLg0YDaPr,3fCSrjQf Of Pogleal Science- Z CARPENTER, WM. S., instliiucrgor in Poiitical Science. KELSON Tj EFZAQ 1235 this glnggsggrrrrg ' Z Z 4 Base Hospital, A. . . K ' ' ' . t' t f f h Z Z CERF, BARRY, associate professorofRornancelanguages. ELLEY' elglitrlfrggf assls an pm essor O Omg Z Z Captgmrr Chemlcal Warfare- I-'ason Omccr' A' Food Adngngtration Lecture Bureau, Washing- Z Z Z 4 . - - . . . ton, . . f , Z 2 9fHAMBER'1AfN-Eh glsxucmf In muslc' KERXN'IN, ARTHUR R., professor of military science. Z Z ZZHZZ Uma ' . ' ' ' .' . Colonel, Infantry. ZWPIQZ Zz 52 CHISHCEM' agstruqor ln pattern makmg' LENHER, V., professor of chemistrv. ff ZZ Z? Z aptain, viation. Major Chemical Service Section Washington if ZZ fi 9 CLAYTON EDW. Plant Pathology. ' ' ' Z if Z5 I ' ' I ! Zz 2 Navy , , , LEITH, PROF. C. K., mineral advisor, Peace Conference, Z' 'QZ Z3 3 CLEMENTS, C. R., instructor In mathematics. paris ,g ZZ ZZ ,Z GovrXr1rIrgCS5I,iSi?6IgUCi0f 25 Naval Academy- LIPPITT, LOUISA C., assistant professor of physical edu- if 4 ' - cation. if Z? CRAWSHAW' DL' pfofessof of manual arts' . Head Aid in Reconstruction, Base Hospital No. gg Z2 52 Captarnprlllrrlrioisb Ngtirigal Guang axd Prgiienr 365' Ar E. ph 35 ZZ fimif o ca emic ui Ing, . . rmy c oo A. A Y hr - r - - r 4 - V cg sf Z Z of MilitaryrAeronautics,' Urbana, Ill. LIVINCE-3E'rgfrrS,r5fEC In agmc engineering Z Z - 1 .. . 1 Z Z CUMM1N0S,gNA., assistant In agric. engineering. U. LORENZ, W, F., asgocrare professor Ofmearcmer 2 Z Zig D r E - . . , h . Major, Medical Corps, A. E. E. gi, Z Z Z AHM- .' 'I 'nstrufator 'U P. yslcs' MARTIN, LANVRENCE, associate professor of geology. 5- . Z Zig D Lri-eulgznegit, Field Artillery. Major A E F at Z 4 7 IEHL , . overnment. ' ' ' ' - - , 5 f Z 4 - - . IVIATHEVJS, J. H., associate professor of chemistry. 4 Z Z f DENNIS, A. L. P., professor of history. Y A P M - 4 D f V 1 Z gt 2 Captain- Mill'-ary Imelllgence DIVISION' War MEEK WALTER J3.aZsscic?alSe: professor of physiology. Z Z ir Z DRANE Rolgglplrarament. XI,f3?lr:i2g5QL'.ID- gg . 'Major, Chefnical XVarfare Service. D Z Z f f , 4 , Ins ruc r I- ini a me Icine. VI , C- E., f f h - n 1 y Z ' Z Captain, Central American Medical Laboratory. 1 ENDIlX5Il2Jxcl'fT,SignaI Cg?pc?SBl.Il?eaE.,I dflfiifiation. Z Z 2 A' E4 F' . . MIDDLETON, W. S., associate professor of clinical medi- 5 Z Z Z DRESDEN, ARNOLD, assistant professor of mathematics. Cine' 5 Z ZWHZZ D SOcrfllWAmerrCan RC? CYQSSI France' Captain Medical Corps Br. Ex. Forces. 2 Z Z2 2 YKEMAI . ' pro SSSQT O muslci . . . IVIITCHELL, R. S., instructor in English. 2Z 2Z Z2 ,g Social. Commission oIr5TCEaInIng Camp Activi- private I: A gg 5Z Z5 'Z ties, ashington, . . MORG , B ' ' -' f fc 3 sy f, , . . . AR, . Q., assistant pro essor o erman. -X fl if Z2 2 ELDR1Dfi lnstruceolf m Rhyics' F M Military Intelligence Dept., W'ashIngton, D. L. EZ n leuvnant' Cast rt' ery' Ortrcss On' OESTERLE, J. F., assistant in chemistry. gZl Z2 lg 'oe' ra- , , I Chemical NVarfare Service. g gg EI-SOM. J, C-, SISSISUMIF Df0fC550f IH Dl'1yS1Cal CdUCaU0U- OTIS, DANIEL HENRY, professor of Farm Management. 5 Z5 3 Captain, Medical COYPS, FOFE I-G8VCl'1WOl'Kl l. Y. M. C. A. Agricultural Reconstruction, Paris, Zi Z Kansas- , France. ,Z ZZ Z2 Z E-YSTER. lr A' 5-I Pf0ff5S50f Of Pl'1X5l0lOgY- - PAXON, F. L., professor of history. E2 eZ as ,Z MaJ0'- Medical Corps' UYHVCTSICY 0fWiSCOr1Sin. Major, Historical Branch, Ceneral Staff, Vsfash- 52 MadIso'n, Wis. I V ingmnr D- C. Zgwgg FERNBIERQ, L-, IUSFFUCUOF In Eflgllshr PIERCE, R. C., instructor in engineering. ZZMZZ Z f riva er I A Aviation. f f Z Z FILEs, H. Instructor In English. RICHARDS' H. 51, dean of Law School- Z Z Z 2 Medical COFPS- , War Trade Board, Washington, D. C. Z Z Z FISH. CARI- RUSSELI-.,Dl'0fCS?Of Of hl5f0fy- I h ROEBUCK, -JOHN R., assistant professor of physics. gf Z Z 3 Social. llgssaciate ibiregrtor gnfvrfbmlngrician dUrI1- Pressure Expert, U. S. Eaval Experiment Sta- Z Z 7 . 4 versi y nion, on on, . ., ng an . tiOn,NeW1,O,-,dont 0,-,rr V E V 4 Z Z FITE. A- G-. IUSUUCCUI' In ROVYIZUCC MDSUZSCS- ROUSI-I, A. J., assistant professor of agric. engineering. Z Z Sergeant- Government, Food Production War Work. gi, Z Z Z FLJLCI-IER, C. S., assistant professor of physics. SAUGSTAD, JEssE ROBERT, instructor in music. Z Z Z 2 Lieutenant. Ensign, U. S. Navy. 9 Z 2 :kr ii Z Z 5 5 Z Z 2 f Z f f , , Z gy,f,,,f,,,,,,,,,,,,,,,,,,W,,,f,,WWf,,,,,,,,,W,ffm,W,,,,,,,,,,,W,,,,,,wwf,,,,,,,,,,,,f,Z,W,,,,,,,,:,W,ffMW,,W,,,,,,,,,,,,,,,,W A ,f ,,,,,,,,,,,,,,H,,,,,,,,,,,,,W,ff,,,,,,f,W,,,,,,,,,,,,,,2 Z X Q V 5 ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, , ,,,,,,,,,,, 3 V ,,,,,,,,,,, 5 I ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, V f W A W Page 354 1 1 11, ,,,,,,,,, 11, 1,11 u 11 1, ,,,,,, 111,111 1, W,W ' 7 1 I , ' 1 1 1111 1 11111 7 7 at if if it -A' it ia 7, 4 g A ,A Q if if it af reg gr 7 7 Q7,,,111,1,,,,1,,,,11111,111,111,1,1711,,,1,,1m,,,111,11,1,17 ,W,,,,,,,,,,,,,,,,,,,,,,, 1, 'ik X! ,,,,,,,,,,,,,,,,,1f11,11,11 7,11,171,,,,,,,,,,,,,1,,,1,,WW11,1Q,z11,,,1111,,,,,L11L1,1, 7k 7 7 7 V I I . 7 ,rx AVA RVLL 1 i 7 9 ' 7 it 7 I 7 SILvERcRUYs. ROBERT, instructor in Romance lan- TURNER, JENNY, instructor home economics. 7 7 7 ff ua es S ' l T h' ' ' 4 f 7 7 S S . Q I Ocia. eac Ing blind soldiers. 4 7 7 7 Government, Belgian Legation, XVashington, VERRILL, R. M., instructor in English. 2 7 7 kg D- C- Field Signal Corps. 7 7 2 SLAUGI-ITER, M. S., professor of Latin. WALTON, I H.. associate professor of chemistry. Z 7 7 ,tg Social. Italian Red Cross. Major, Gas Defense, Engineers, A. E. F. 7 7 7 SOUCY, E. W., instructor in physical education. WESTUWAN, W- L-i DFOICSSOF Of l'1iSt0ry. 7 7 7 7 Lieutenant, A, E- FA Govcgnnsient, Bgkan States Expert. Peace 7 7 7 1 . . . . on erence, aris. 1 7 77,72 STEINAUEB' -l' Ce lnstructor m PIWSICQI educarrorr WVISE, CLARENCE, assistant in chemistry. gpm, 7 f, ,7 Chief Petty Omcer Navy. - . 1, f 7 7g 7 ' Q ' Private, U. S. Gunpowder Reservation. gg 27 7 TRILLINC, M., associate professor of physical WVITI-IINGTONJ PAUL D., assistant professor of physical 72 fi 7 I rl- , , e ucation. ff 47 72 77 XV?-if Camp C0mmUnlllY SCFVICQ- ' Captain, Athletic Director, A. E. F. 7? 7 TRUEBLOOD. CHARLES K... lnSKl'UCt0l' ln English. ZDANOXVICZ, C., assistant professor of Romance lan- if 75 1? Government, Special Expert, Bureau of XVar I guagesl 72 77 7 Risk Insurance, NVashIngton, D. C. Lieutenant, Infantry. 77 9 74 77 77 7 74 77 77 4 92 67 75 4 ff if fc ,7 H 77- X ' ' 2 if fs 4 G cl d U d if ra ucztes an n ergrfaduates 77 fi 7 41 if 72 7 fi S7 777707 Graduate Stl1dCl1llS EICKER, G-EoRCEWg 2nd Lieutenant, Coast Artillery, QMA7 7 4 I OBERTS, ARD ., lergeant, Corps of Interpreters. 7 7 7 2 ANpERs,T. L.,CaptaIn, Construction Division, Q. M.C. ROUSH- G- Aw Cflliialn, Ordnance. 2 7 7 7 BERGHOFF, CLEMONT A., Znd Lieutenant, Marines. SATTREM, ALFRED MELVIN. Z 7 7 gg BIRD, DR. FRANCIS, Znd Lieutenant, Ordnance. SCHMITTI BERNADOTTE, Znd Lieutenant, F. A. 7 7 2 BLOMQUIST, ARTHUR W., lst Lieutenant, Infantry. SCHILLETER- A- E-. Sergeant- 7 7 7 kg BOYER, D. A., 2nd Lieutenant, Infantry. SCHRENK, W. T.. Private. 7 7 2 BRUCE, HAROLD R., 2nd Lieutenant, Field Artillery SCHOP-GER. A. W.. Chemical Warfare Service. 2 7 7 CAN1-U, ABEL, Infantry, AZE, F, QCOTT, MILTON H., lst Lieutenant, Infantry. n 7 7 7 Z CONREY, GUY W., Industrial. SEARLES, CARL C., Chemical Warfare Service. De- gf 7 7 Q7 COOKE, REGINALD, British Expeditionary Forces. CESSCCI- . 7 7 7- V7 COURTNEY, OLDEN KEY, Government, Dept, of Ag' SI-IERH, D. L., Private, Chemical Warfare Service. 7, 7 7 7 COXEN, IAS. R., Government. SMELKER, W. W., Private, Ordnance. 7 7 7 7 CRANE, MILLARD, Captain, Q. M. C., A. E. F. SMITH. GILBERT, Medical CorDS- 2 7 771177 CUSTER, JOHN SHERMAN, Y. M. C. A. Secretary, Paris. SPP-HR, WALTER- Sfifgeflni- 77 27 7? 17 DANCE, BENJ. DIXON, TAYLOR, WILLIAM H., Govt., Bureau of Standards. 77 7 DAVIDSON, ROBERT M., U, S, Navy, TISDALE, W. I-I., Government Bureau ofPlant lndustry. 72 57 72 '7 DAvis, DANIEL E., lst Lieutenant, Q. M. C. TITUS, E- G.. Captain, Sanitary Corps 72 27 77 57 DAWSON, THOMAS BAiNBR1DgE, TONVNLEY, l-IOBERT C., British Expeditionary Forces. Z2 77 17 rDOPIER'ltY, JOHN A., Lieutenant, Infantry, A. E. F. VALENTINE. HOWARD. ISU Lieutenant- 127 77 47 Killed in action July 20, 1918, VAUCHN, FLOYD L., Government, Federal Trade Com- 72 73 Q7 'EICKE WILMER H. Private F. S. A. E. F.. Killed in miSSiOn. E7i 77 Eg F R action Nov. 4 l9l8. WHALINO, HEISKEL, Lieutenant, Aviation. 75 79 27 ILTER, AYMOND 72 27 77,1177 FINCH, V. C., U. S. Shipping Board. 18 750,77 7 Foasres, O. w., Infantry, A. E. F. - . 80 . I 7 7 Z FOWLER, WILLIAM' Social, Y. M. C- AA DopsON, JOI-IN M., Major, Medical Corps. 7 7 7 7 FREY, CHARLES N., lst Lieutenant, Sanitary Corps. 9 7 7 FULMER, HENRY L., lst Lieutenant, Sanitary Corps. 1881 7 7 7 GARDNER, MAX W., Government. S H , 7 7 7 GIBBS, WILLIAM M., Lieutenant, Sanitary Corps. MITH' OWARD L Government' Qulm' Ecuador' 2 7 7 tg sGiEssil25-8 CHARLES, died at Camp Dix, October 3, 1884 7 . , , I , 7 7 7 Ho R - 7 7 7 1 sTMAN, . E., lst Lieutenant, Infantry. - - 7 7 7 t, 2 HEDDLE, JOHN R., Private, Machine Gun Battalion. RICHARDS. RAND A., Brigadier General. 7 7 HEDRICK, ARLY L., Captain, Engineers. 1886 7 7 7 -IIIEMBRE, I-IELMER J., 7. 7 7 7 oHNsoN, A. L., Aviation. BELDEN, ELLSWORTH BURNETT 7 7 771,33 KEITT, G W., lst Lieutenant, A. E. F. In general charge of Y. M. C. A. service among Z 7 75 7 KELLEY, FRANK J., Signal Corps. Officers Central War Department' headquarters, 270027 75 7 KELLY, NORTON G., 2nd Lieutenant, Artillery. Camp Custer. 55 gf 17 KOLLS, ALFRED C., Chemical Warfare Service. ' Z2 27 73 57 KRUGER, FRED O., United States Navy. 1888 72 77 IioBEIIE'I', EUoENEClntegareter,lArmy of Occupation. JOHNSON MORY B A t D. t B f T 72 E7 ff 17 EE, REOERICK ., n ustria. - , f- SS - 'rec Of. Ureau 0 fans- 'E if LOTI-I, I-IG C., Sergeant, Znd Class, Naval Reserve. Porrarlorrf War Trade Board- 77 f7 UNDY, ILBERT, 72 27 MALLONEE, Louis D., Znd Lieutenant. 1890 7 7 MEHL, PAUL, United States Navy. H C , , gg D 7, H MOORE, CHARLES E., Captam Infantry . IMICI-IE, HRISTIAN, Lieutenant, Pacific Naval Coast 5, ,7 I I ' ' I I 75 97 MULHOLLANB, L. G., Infantry. Guard- , Z7 727077 MURPHY, ROY V., lst Lieutenant, Sanitary Corps. SHEPARD- JOHN' Surgeon- Medlcal COVPS- A- E- F- 77,177 7 7 SNOBLE GEORGE B. Lieutenant Infantry. Died of 7 7 7 7 wounds July 28 1918. 1891 7 7 . . . . , 7 7 ORT, A. A., Assistant CIVII Engineer, U. S. N. URDAHL, -1-I KU Federal -I-fade Commission- 7 7 7 -kg ORVIS, W. E., Government. 7+ 7 7 7 PATTEN, STEPI-IEN, Private. 1893 Z Z 7 PECK, E. L., Chemical Warfare Service. . gt 7 7 7 POTT, ROBERT, Aviation. BABBITT, ARTI-IUR, Captain, Q. M. C., A. E. F. 7 7 7 REID, ALBERT C., Government, Bureau ofConstruction. COSGROVE, JOSEPI-I, Captain. 7, 7 7 7 CROARK EUGENE VJ. Cadet Aviation. Died In Camp, JACOBS, I-I. I-I., American Red Cross Service, Italy 7 7 October I8 1918. ROGERS, CHARLES B., Government. 7 7 1 7 7 9 f 7 if if 7 X ' I f 7i'7 Zi 7 7 711111f11fff111111111f1111111111111111111111111111111111f11111111f111111111111111111111111111111111111111111f111111111111111ff111111111f1111111111111 1111111111171111111111171 111ff111f11,-1111111111f11111111111111f1111111111111111111117 7 Q .t 7111011 1111111111111114111f11f1111112 711011111117 7111f111111111f111111111111111f111111111f11111f111? K 7 it it at if 1 f 1 1 in jk is 7 M P ag e 3 5 J' K xxx f Page 356 Q Q EQ .x.xx..x,x,,.,,x.,X xxx. ..X. N S ,x.,x,..,x.,,NxN.NxN,,N..xx..xsN,x.xx.x..,.xxx t S X QQ QQ QQQQ QQQQQQQ QQ IQQQQQ QQQQ,,.Q.QQQQ,QQQQQNQQQQQQ Q, K x QC Q Q Q Q Q Q Q16 Q Q Q Q Q Q43 QQQ Q Q U-,u.k..L..-I-yn U3 R.. Q-. Q, Q Q Ssaassmag 5? '5555'i'E:a Q Q -4-lmO?fr-r Z owzm mmoxmmr I' :E fn- W- -SN X g v--1 x 711 -mn Q Q X Q ',Iy1wv'moZ FH-new-Omg Howmym- -EW . O Fr- T. P11650 , WZ-m5 m Zm 1-:pg Q Q 30312555 5252255111 52-wwf? Qca-Z? mggjgagig 5225592 1,1225 X Q I U 1 mm. ' I ,mg-J -'r WP-PZUJ oc0.+' -' -F' 'mm 'm- Q Q- Q Q Q-Pm-S-11 1'-c-Qgwp Q0-.Z O -U Q- -c-:. m -4-40 m Q-.Om 1' O' H175 L-W' C0214 Q Q Q S Eguvg m, U3 'mo' CQ- Q -,SmUL.QI 5 -I-1::gQDU m' ' 73.277 QE? ZV7I0IXm OZ-ll-4 gas' fun Q Q Q43 mmgg 2Z r1m UC.:0z:,O: 571: ,vi Zi? 32 -Z0- ' -CTU: - ' Og OCUPU1- Q0 33- ff' ZOL'-1-1 SiQ Q Q wzw 171:-E S0 I QT... mm -QP7' Ol-47' USR-' 'mm 03 Ig --7520 H Z 75 moo- Q Q X Q rr! -4 . m77:-0:1 Z0 ,F an-n fw,,,Z1 QUE- Us Cys' 'Fm UZ U-77' RI' Q Q Q Q -lgl-50-1-' 02101: wi, 30wID'U,Q1 'ca 1 wgmm 11,-fsfffbw-Oo-r CIJ,4H1-gms' ISP' V20 SYN Qi'Q :Cr-num,-5-fn Wmjjl Tomo: mUC9f Q gnc: -1942 UE. 3'S'!'c:: 1-5 HWY' Sl- :gm QQ Q 'Q H og,- Of,c,g' Pr-3,Z rf 1-Sowfw --SW Z' M H: fQCmP,fv'f'1 I- 12,05 .4-'Z OU Q Q Q Q g:,'U-min' gm mm' --QQOOS' - Q5-151 -- FU' g'11ZmQ5' Ei 2-m.-mgm? Zig. 5: I . gg, 1Q.E,m3 Q Q Q Q 7JP25'E:sD' 5'mT4O-'5'W' 'F OO' ' ' O9 ,..5'2.C 0 9,1-1 571 S03,5'3' EIS ' Q ZH5' UO'9f-- Q Q QQQQQQQ l fn cn. om'O -'U N-CUZ mm imma 33' -1394 ' ' 3' .- -HZ 90,-, 'UD 0.-1 f-ffimii Q Q QQ :Q ,.. . C rf P-1' f-Q rv- rv P-I cn? p-A , U, g..1 V : 'U 3.4 ra. pg . , - 5.4 - 5. ,.4 ...- ,.4 Q Q 2 2-3392-5 2 2 Q11 2 Qssgi 2 ? nfvm 2, 2' 3 33,5 X5 Q nam gg SPP? 3 Q5 QQ N ' 50' N 'C 5 v-1 5 1'- Um: o Go Qs 0-'Z' Uoc P OVW 5' .4 'U :'H- QQ '75 'UWM 2555 535 2,529 girngspg 233 11 0 EEF Q02 P52 'A 511112. Q QQ QQ 3237 ' SJGEUU 59, avg. E, 5'f1 D ' --0 ' 'DR m - 'S002 C'- S ' XS ES .mo Z-3 -5-1-152 C10 92. gm ,1,,, 55,0 PZ V Q14 - QQ Q-n,..j, nl QQQQ :PEW Q ' O-U-1 v- Q-1 L4, U: DOO ' 4 -1- 0 QQQQ 'QQQQ -.-1 O :QU -U O.- m-- -:H rv Q v0 0 QQQQ QQEQ cl O -135,1 M o -ff' -U Url - :Om -1 QQQQ , , . . pu ff w Q-Q -1. -o QQ Q Q QSQE BGSU P, 6 C 5 C- mn Su' fn QQQQ QQ QQ . gg- Q1 ?f ya .0 rv . UBL 5077 ' Q QR QQ QQ . -1 ITJ V, -Q 0 Q QQ QQ ff A m 51' 0 U, O QQ QQ 3 -1-1. . D . no X X: QQ ru . ' on QQ QQ z '11 U, 513 QE QS Y' ' : 350 'QXQQQQQQ 417 -1 QQQ-QQQ ' QQ QQ QQ QQ QQ QQ QQ QQ QQ QQ QTIIIQ 5'fTli55E:E519.3f9?Q99E??E if-5 f5'g'r?5xQEU 2??55?55Q? E? 25 f719?E?Z?255'I 415599933 ?Z55I313199?w5 QW :J-ZZ U 0 qppqn Imam-,-E '-..w- .. r- -no n 02' b Hmppoww 5 QQ SQ E-31053570 C'-I7qf:,mm:: --lm,UmU1Z7: ZCf V'Z0Wm 5 LL by-lE'11'5mUZ'4 Z-ct 4ZU1C1Z7Ul ,ug-,4Z2I:73'O3' QQ QQ wpwmwfpgggmyggxwr Ziicc--mo? Cmwggizgg F, EN 4215532055 mUF'5U1gg1Q1S -:Mgr---','3,Zm5 QQ SQ '-11:41-,U 111111. Zum'-'m ,rm-45-M545 '3z0wz7 'z,,w.4 or QdUm'Qwm'Z.O Mm Wxzwg 5'1ZmZ:,'-IZ?-ff' QP QQ F' 7' Voir--4 Wlfjapb? KZFUF' -4 V -FE'-do-1717- 'Z3cm7' 0 70:9 'um ZW O -' 'EO-Wm-1 U1 QQ QQ mgrlw ..1,,. :fo O .wr ,11-- 2,.N,Lm zz Ozm,-O gow-, 212 ,1.g.gm mizfff 119, cn ,,,-1 Q,1,111O Q QQ QQ M- 'Z ,U wZUg .1 M1-,OZ Z- o o1Q07',U :sm -1--wryyoff . mcvwz' O, -IS'-OO' :9. QQ Q2 QQ -r-' Q03 m 4- 3,-I'- UCUIUF - -1 1- Fw O' z' fm- UJQ. 1- O aa. fx H49 FQ-002' puldrv U U1 2-.zmmmfvawc QQ QQ QQ -I-Q0-1 'Zhi-mm: Q- 1:0 mwom . mrm. -mm Qrfw.-, 'UOr-U, xmqmxm V ,111-.C -ago-Com ,Wg QQ QQ QQ mmg- ,U -gmc w C-n Ispmn :CW 211 .71-I Dx Om ,---on-1:-.11--. z,1FmE-4 1 Q.,,,-wZr,,. QQ QQ QQ Qmw .'-75. IPI:-I wx 5511 win- U- r11E--- ,HO -1 PU 0. QM '0:Z .c-Q m Z m:V'. o-I., - QQ QQ 2 E,v'D2Q'?w'WOS.1 Z H1 554-Svgwff' Qmm-of-Ez-T9 P2 '5'SQ1wE0ZQ4FPmCu.40Z' 00 z.453g,Q?1Dn W0 1.gn-1'lZQg'gEgf 2oCQg.2C2 gmwznga U1 .4 305- 2305,-ff gs fgpcqgzgpogggn Q: - SQQWEE O-:17,,2Q-7111105 QQQQ Q 2 1 . -- C . -' L-' J zu f-f na rn Nl., ...rn Q'-U 'za 5 QQQQQ QQ QE aw 5OfLS'P12o1O89f1-2 U- 2 9--- --wwf wmv: - vw- ' 5 .NEP Z mg-1 PEI 4 wma- 5 QQ QQ QQUUQ' Ssmgc- ,Dngmw ,022 22 0 22- 35. 11.5590 OO oagf 74' 1.--!'4OP,:Z -C: - me, Pg- o - 5--Q-. Q5 55 FS 'if'-45 -1:3459-D-'r : NG: mrn 5 rr-4--5' gif 5 ' J :WEP P--P' ' Q'-mn 0 O--1' F102 Z TIHQUP Q Q 5. . 1 -1 H, . -.QQ Q -:LI ,cha O- 3, . N ...Q. QQ QQ :OH OP- mc -Pmnlj P-' 'Oc-qi --S ff P -'-- PU, f'5?m-- 1-1 O-4 09- -1 C 03,51 my rf- N n-I Z P ,.. 2 bf' n-I 33E:TZ9mx?f Zmp?fQL,2?, 2 Qg.1',3m2'ig153 5, 3 ggggmgv glgggni Q3 gg 5 57n5'p22ffulffJ5'1n,2g Pg mgifg 3 325 5,3 2333.2-E gg QQQQ Q Q -DMT 'f'-nn- ' rm -Q1 - r-,mr - cn MQ -1 - ul 5 Om 1- 5--mm H wg ---.mfvp .w cn--2'--w Q Q Q Q 1030 r1K- --O'T1m KTI- 5 Q iff-1: ,.. ::5O33,B QQRVE. 3, ...' 'fm bali- 3--0 O- Q,-R115 Q4 -1 Ng ' W:-'W Z5 Q Q Q Q j:.o,,Q .mOru.,, x In Fflmqmmj, 5 ww-5 555 52 gg -1-,---3 mmzgfflgm o J-5 14 mp 5 om' ru Q Q X Q 4 r C 'UPS :- 's :SIS O -- Qc 0 O-0' -F' fn' -W, ' '5fvf' Q Q Q 'W 71 asf 5, 55 23252 sw QQ-GQPPQ5 2021 H325 3 if Q Q Q Q Q Q Q . mm- 5 f'-1 3:03. 'Q S -P - '-. -. fl no :mag 0 -rwofv 'N -1'- 0 Q Q Q Q '-2 No-2 m-5 Fri- -4 P D, 2 -n '11 0930 -WS' P3 0' 5 'T70- 3' 75 o Q Q Q Q 'TWIN 'USN 'pf' 'gp' 5- mm -fn 'U '52 of E. 'U ' m ' '5' 'V -1 QiQ QtQ ..-1 gf.,-1 www 1-1 O- -1 -1 B, UO M150 HE, DQ N m Q- U Q Q Q Q Q4 .-W 2, -' P -m rn S-n P11 Q nh-1 5-49.3 - F- - D- 0 w Q Q Q 'Q ' 53' 'Um' CTI . - - - ' V' -'Q4 305- IP Q-1 fn 0 Q' Q Q13 P F1-sg, 0- - fri 5 'D - ---M ' Hn, . F' 7' 5 QYQ Q Q V - Q. 3-f, -n - 71 71 . P1 mf m gm W Q Q Q Q -nm. Q. , O -- 0 . m 'Tl 511 Q Q Q 'Q U1 v KT! 7' U1 0 ' SPN ' QQ Q A1 P1 Q V 2.1 W fn Q Q ' 4 . I cn- n ru 5 Q Q Q Q Q Q xi Q 4 X N Q X Q..,Q..,,.,QQQ, QQQ. A 1 N ANmmQQQQQQQQQQNQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQ.-QQQQQQQQ..QQQ...Q.Q..QQQQQ XQQQQQQQQQQQQQQQ-.QQQQQQQQQQQQQQQQQQQQQQQQQQNQQQQ X Qlfx-ml-wa-wgxqmgi Q 1+1+1++'Q A Qywgwgf Q Q wrfilrwx- Q 5 1 , 5 5 I S I 1 4 xxx f W ,,,,,,,,,,,,,,,,,,,, W, ,,, ,W ,,,,,,,, W ,M 4 N, M, W W, 4 , 4 11 'lr at ir 'Ar -k ir ,R if wk .Ay J, ,A .5 4 Z i 7,,,,,,,,4ff,,,,,,,,,,,,,,,,,,,,,,,,,,,,W,m,,,,,,,,,,,,,A ,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,,,,,,,,,,,,,, 4,WW,,,,,,,,,,,,,,,,,,,,,,4,,,,,,1,,,,,,,,,,,,,,,,,,,z,,,, Z 7 4 7 7 4 4 TNVNVR RVL L 4 4 7 4 4 7 7 4 4 7 4 if 4-k 4 7 4 4 7 7 4 4 7 7 4 4 7 4 if fi' 4 4 4 . 4 7 7 4 MILIS J M LANGE FDNVARD Ph l D' - A Y M C A 4 7 f 1 . , . ., I , - , ysica Irector, rmy .... A f Z MONTGOMERY, H. S., lIst Lieut., Balloon Corps, A. E. F. LESLIE, J. W., Znd Lieutenant, Aviation. 2 Z Z 4 MORTON, CHARLES, Lieutenant, Infantry MEANWELL, WALTER E., Captain, Medical Corps. 4 Z Zig EASE, CEIDEIIA, ECIAL, A. EIR. A E F IIyIitiiaasiAi,JIgP., Lgeutenant, A. E. F. 5-kg 4 4 ELSON, HARLES ., Zn ieut,. nanny, . . . ATIWICK, ergeant. 4 7 Z QICHTER, Iljieutenant, IAvK1tioxn,IiX.IE F. IEICHARDSJ, MORRIS, Captain, Infantry, A. EI F. Z 4 4 AROENT, . ., ieutenant, . ., W . . -. OBSON, AMES 'LEXANDISR, Lieutenant, In antry. 4 4 Z 2 SIMON, EDWARD M., Captain, Ordnance. SOHERER, ANDREW C., lst Lieutenant Ordnance. 2 Z 5 2 VAN ZANDT, JEROME G., Y. M. C. A., A. E. F. SHERMAN, WILLIAM G., Infantry. 4 Z Zymgg WALLER, FRANK, Social, Director ofMuSic. SIMONDS, l'lERBERT R, Captain, Engineers, A. E. F. 3544045 gf WILSON, R. W., lst Lieutenant, Aviation, STEFISEN, Du LYMAN, Lieutenant, Medical Corps, Gen- ZZ Z5 52 YEXVDALL, J. A., eral Hospital, Manchester, England. gf if 45 ZZ STORER, DAN, Sergeant, Medical Corps, A. E. F. ZZ '7 74 4 1908 SWENIIOLT IIELMER Captain Engineers 4' 'Z H ,, . . I - . . I , I . I XI 3 A E P O WNBUTTLC' FWQAVIECE 43 gi BBOTT, LLIS ., overnment. ILLE, Ouis ., . '. . if 2x Z2 22 ANDERSON, VICTOR, Lieutenant, Field Artillery. WALL, JAMES I-I., Ensign, U. S. N. ig BAKER, H. W., I 4? Q4 BALCH, J. NV., Captain, Iznginecrs. 1910 gg gg gg EALSLEYIII-IENRYIE., Lieutenant. Engineers, A. E. F. A O III C 7. Z4 ENTON, OMER Lieutenant, In antry. Lwoop, M. J., Sergeant of r nance, lst lass. 45 if BLANKENAGEL, JOHN C., Infantry. AMEN, l'lAI'lI..AN, Aviation. gi COLBURN, GUY, Y. M. C. A. Secretary. ARNOLD, EDWIN B. Znd Lieutenant F. A., A. E. F. gg Zami? EOLLINS, IERTI-IUIR L., IPIrivate,xlnIIgaiItry. IQ-rwooDDMARIgN I9IrtlCnanXeeS A E F f 1 OULTER, OHN EE, ajor. I-. . AILEY, ANA ., . . ,I .A. ecretary, . . . f f Z 2 SCROWE, GEO. D., Sergeant. Died of influenza at BAKER, EGBERT EUGENE, Captain, Dental Corps. 2 Z Z g C Camp Mills. L II M C BARKER, D., U. S. N. I I 5 g 4 A4 UDAHY, MIcI-IAEL, lst icutenant, lx. V- . BEEOHER, DENJ.,I..ICL1lCI'12lI1L, n antry. 4 4 Z EISQUE, R. C., CapItlainAAviationiieetion Signal Corps. IBELL, HERBERT C., Lieutenant,AA. LL. F. 2 'kg 4' 4 LLSNVORTIHI, PAUL ., viation. . Ii. F. BELSKY, C. J., Znd Lieutenant, A viation. 4 4 Z FISHER, AUGUST, Liesutenant, Infantry. BICKEL, H. L., lst Lieutenant, In A. 2 7 FLOETE, FRANKLIN G., BOON, LEONARD, U. S. Sl-.ipping Board. f 3 7 fi GAEBLER, I-lANS,U. S. School of Aerial Photography. BROCI-IENSRATER, HERMAN. 4 f 7 7 4 . . 4 X 7 Q GILLISPIE, JAMES E., Lieutenant, Engineers. BREVVER, JOHN D., Iflajor, F. A. A. E. F. g Z Z if GRAFF, B., Captain, Engineers. Cl-IAMBEIKLAIN, G. W., Engineers. 4 ji Q GRONERT, TIrIEO, G., CONICEY, C. D., JR., Ist Lieutenant, Infantry, A. E. 3 g Q 4 HOOD WM. F. Infantry A. E. F. CSRAVEN, ALEX R., Znd Lieutenant Artillery, A. lg.. I-. Z 5 gum? JOECKEL, CARLTON B., Captain, A. E. F. CROWELL, GEOROE G., Lieutenant, U. S. N. 5 g 22 JOHNSON, J. CORNELIUS, Private, Infantry, A. E. F, DAVIES, F. E., Ilnfantry, A. EI lr. Zgnmgg Z2 ,Z KEMP, WALTERJ., 2nd Lieutenant, F. A. DAVIS, DAN, Lieutenant, Engineers. ,gg gg gg 22 KENNEDY, FRANK M., Major, Aviation. DAVIS, L. W., Captain, Engineers. lgg gg KRUESI, FRANK E., Lieutenant, Infantry. DONNELLEY, EMMETT A., Major, F. A., A. E. F. gg Z3 54 IIEUENTIEI O. O., lX6I:ajciII-, g.nI5Iineers. FREEMAN, COURTNEJ D., IIIst Ilft., Infantry, A. E. F. I4g gg fi 47 OTH, ERBERT ., . . . FUCIK, IROBERT A., 'cast rti ery. 44 Z4 LUDER, ARTHUR FRANK, Infantry. GILMAN, ALEXANDER, 2nd Lt., Engineers, A. E. F. Z3 gf jg 42 LUEDERS, AUGUST HENRY, Medical Corps. I CLICK. G. A., Metrolog. Section, Signal Corps. 42 Z3 gf MATTHEWS, W. W., Graduate Pilot, Aviation, A. E. la GRAEISER, FRANK JOHN, Hospital Corps. 36 jgwjg NELSON, O. H., Lieutenant, A. E. F. I HARD, WALTER, Government. gg Q 4 REHN, W. A., Znd Lieutenant, F. A., A. E. F. HARNES, WM. W., lst Lieutenant, Q. M. C. 4044447 Q 2 SKINNER, JOHN S., lst Lieut., F. A., A. E. F. HIDEARD, CLARENCE, Psychiatric Unit, U. SI N. g Q Z 4 SMITH, C. A. I'lOLONSCI-IIED, ROBEllT, lst Lieutenant, Engineers. Z Z 7 fi SOREY. RAY, Lieutenant. RACCONNEL, L. S., Lieutenant, A. E. F. I 4 I 5 g Z QIPAYLOR Base I-loRpiEalFA. E. F. IIQXIAARTIN, IEIEELMAR G?O.UClgenIQIical Warfare Service. 5 'f' Z 4 4 ROOMAN, ., ngineers, . . . UELLER, EOROE ., . . . 4 f Z WALMSLEY, S. M., Lieutenant, Cavalry. I NAFFZ, CARL, Lieutenant, Infantry. 2 f Z 5 ig FWALLBEIX, HILBERT C., Captain. A. E. F. Killed in NANCE ARCHIBALD Ordnance. g Z Z Z action, Aug. 21, l9l8. NOIKTHRUP, I'IARRY C., Lieutenant, Infantry. g i, 7 6 4 WIEMANN HENRY, Lieutenant. PIERCE, J. A., Captain, Engineers. I 4 Z WOLFF, HERMAN W., Corporal, F. A., A. E. F. REBER, I-IUOI-I J., Znd Lieutenant, Coast Artillery. Z Z 2 PLAMONDON, GEO., Sergeant, F. A., A. E. I-. I Z Q 4 1,909 RICHARDSON, W. D., lst Lieutenant, Infantry. 1 Q yI '4f NET, EORCE, n Ieutenan , n antry, . . '. HIPLEY, . -i ., aptain, n an ry, -. . '. 1, HI, 77 A O 2 ti L4 t I f A E F SCHULTZ'gDAlINCW Cavflrf' t A E F 4 7 Zi E2 BALL, EDWIN,Q. M. C. SI-IOREY, RAY, lst Lieutenant. 'IZ fg gENSON,V9UY, W C M CI I C A I: SKINNER, JOHN SHARISI Zcridflcigutenant, A. E. F. fi if ISSEL, AYNE ., aptain, e iea orps, . R. F. STAFFORD, H. S., Y. . . -. ervice. 12 5 4 if BOETTCHER. ARTHUR, U. 5- N. I THIESSEN, F. C., Shipbuilding Board. gg 22 BURRITT, CHAS. G., lst Lieutenant, Engineers. VAUGHN, J. RUSSELL, lst Lieutenant, Infantry A. E. F. fi Z2 CARTER, FRED, Medical Corps. WATSON, C. F., lst Lieutenant, Engineers, A. E. F. gi gg gg CENFIELD Field Hospital E. F. WI-IEELOCK, GEOROE R., U. SIN. I I I ,Z 72 Z2 COLEMAN, A., Captain, Engineers, A. E. F. WILLIAMS, FRANK E., Captain, Military Intelligence 52 5? Z2 ,Q CONLIN, WM., lst Lieutenant, Infantry. Board. 52 Z5 if CUDAHY, JOHN, 2nd Lieutenant, Q. IM. C. WOODIIOUSE, E. J., Lieutenant. gg 57 DAVIS, JOII-IN J., Lieutenant, Aviation, A. E. F. 2? fi F . ' l A. . '. 'Z ' Fgxiifb, Siiiiey, 5.i5aLgSf5if5nt, C.. A. E. F. ' 1911 Z Z FISHER, BOLAND F., Medical Corps, A. E. F. ALLABEN, GERALD R., Captain, F. A., A. E. F. 4 Z Z 4 GAPEN, CHARLES E., U. S. Food Administration. ARNOLD, EDWIN B., 2nd Lieutenant, F. A., A. E. F. 6 Q Z g GARNER, HARRISON L., Captain, Engineers. BATCHELOR, ROGER P., lst Lieutenant, A. E. F. 4 ,i Q Z GAYTON, OSCAR, Industrial. BATZ, RUPERT J., Lieutenant, F. A. Z Z Q 3 GLAETTLI, J., JR., Engineering. BELLACK, KARL O., 2nd Lieutenant, F. A., A. E. F. 5 I Q Z GRAEBNER, GEO. J., Lieutenant Colonel. BENTZEN, F. W., Sergeant, AI. E. -- g f Q Z 'g HARVEY, H. V., Sergeant, A. E. F. BICKELHAUPT, CARROLL, Major, Signal Corp, A. E. F. 5 g 5 HEISE, GEORGE W., Captain, Q. M. C. BICKELHAUPT, WM. VERNE, 2 f Z Z g IIQIOGAN JAMES M., 1-t Lieutenant, M. G. F. BLAOKEERN, PALIIL, Hospital Corps, A. E. F. 4 Z 4 4 ESSENIcH, HARRY, Lieutenant, Infantry, . . I-. BLAKE, ARRY, ieutenant. 2 i 4 4 'ke 4 4 f 4 1 X 4 4 4 7 4 +4 4 if 4 I 4 4 I 4 4 4 7 f 4 4 7 4 4 4'k 4 f ' ' 7 X . ? ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,.,, 2 I W , U, , ,,,,,,,,,,,,,,,,,,, ,,,,,,,,,.,.,,,,,, , X wm7 Page 357 Wf4'f:IZZ75lW 1111 11111111114 X f 4 f Zi' Zi' 4. 4 1 4444 5 4 4 4 xx A .Wx X , N' if W xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxx 4 5 4 4 5 4 4 xsxsxx S xxx 4 4 4 4 Z 4 4 41982 5 4 I 4 4 f 4 MP4 f 4 4 4 4 4 444444 44 '4 4 4 7 4 4 4 4 f I 44 44 4 ,4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 44 f 4 4 f f 4 4 ,if 4 gt 4 Zi' I 4 4 4 5,4 ff fi 4 4 4 X I 4 4 4 4 74 fr 4 4 4 4 2 2 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 N xxx 1 if 'k if A 4 . 4 444444444444 4 44444444444444444444444444444444444444444444,44444444444444A 444444444444444444 4 4 44,441 4414 if SSRRRRRRSRRRRSR Ss Rx SS St ' af xxx RVN VR BLATZ, RUPERT, Lieutenant. BOYLE, WM., Captain, A. E, F. BREW, H. M., Lieutenant, A. E. F. TBRIGHAM, STEPHEN O., killed in action at Chateau Thierry, On August 3, l9l8. BROWN, TIMOTHY, SR., Lieutenant, U. S. N. BRUE, H. N., Engineers, A. E. F. CORP, CHAS. I., Captain, Sanitary Corps. COSTELLO, MARK O., Sergeant, Aviation, A. E. F. Cox, TIMOTHY BROWN. CROWNS, ARTHUR, Lieutenant. 'CURTIN, FRED, Died of pneumonia. DAWSON, CHARLES, Sergeant, Hospital Corps. DOERR, HENRY, A. E. F. EDMOND, HARVEY, Lieutenant, Aviation. ERNEST, FREDERIC A., Sergeant, A. E. F. FLINT, ALFRED T., Lieutenant, Q, M. C. GOGCINS, I'IUGl-I. GREENE, J, H., Infantry. HAACK, T. T., Adjutant, Aviation. HALVERSCHIED, R., Infantry. HARTMAN, RALPH C., Lieutenant, A. E. F. HARVEY, WILLIAM, Lieutenant. HILL, CHARLES R., Znd Lieutenant, Aviation. HOWE, W. C., Lieutenant, U, S. N. HUTCHINSON, F. P., Lieutenant, F. A., A. E. F. JAASTAD, H. O., Sergeant, Infantry. KIRCH, ANNA, Government, Internal Revenue Dept. KLEINPELL, ARTHUR, Hospital Corps. KLUND, E. J., TLAMPERT, 'SASAES B., Colonel. Died in France, Jan. 13, l l . LEWIS, LEON L., Captain, Infantry, A. E. F. MCMAHON, F. B., Lieutenant, Medical Corps, A. E. F. MGMILLAN, C. L., lst Lieutenant, Infantry. MACLAREN, A. R., M. M. lst Class, U. S. N. MANN, KARL, Sergeant, Ordnance. MEYERS, IRWIN A., Captain, Q. M. C. MORRIS, GEO. LEE, 2nd Lieutenant, Infantry. NORRIS, HAROLD H., Research Chemist. 'MUELLER, BENJ. H., Lieutenant, lnfantrv, A. E. F. Died of Spanish Influenza Oct. 3 1918. MURPHY, PETER, lst Lieutenant, A, E. F. NELSON, EMIL, Corporal, F. A. IXIICKELL, G. H., lst Lieut., Engineers, A. E. F. NOYES, HASKELL, Lieutenant, F. A. OCHSNER, ALBERT, Medical Corps. PFEIL, PAUL F., Aviation. PIERCE, MAURICE, Diplomatic Service, Russia. RICHARDS, ARCH E., Private. ROBERTS, HIGH I-I., lst Lieutenant. ROSS, WALTER C., 2nd Lieutenant, Ordnance. RUSSELL, WM. SCHMIDT, HERBERT EDGAR, Captain, Engineers, A. E. F. SCUDDER, CHARLES M., Captain, Engineers, A. E. F. SHAW, L. J., lst Lieutenant, Ordnance. SLADKY, ALEX., Captain, Ordnance. SLATER, P. B., Lieutenant, F. A., A. E. F. SPITLER, W. I., Lieutenant, Infantry, A. E. F. STANLEY, STEWARD W., Major, C. A., A. E. F. STEPHENS, ANDREW. TAYLOR, HENRY STERLING, Medical Corps. TEMPLETON, KENNETH STUART, Ensign, U. S, N, TENDALL, R. G., Captain, Infantry. THUE, M. J., Chief Petty Officer, U. S. N. TINDALL, FLOYD G., Asst. Surgeon, Medical Corps. VAN CLEN, THOS. C., Znd Lieutenant, A. E. F. WARREN, DAVID M. WATSON, R. D., Engineers. WECNER, ARNOLD A., Aviation, A. E. F. WIESE, OTTO, Chemical Warfare Service, A. E. F. WILSON, SYLVESTER, Captain, Engineers. WINTON, OTTO, Lieutenant, Medical Reserve. WILCOX, HOWARD V., A. E. F. WINHOLT, W. F., TWINTER, OTTO, Lieutenant, Medical Corps, Harvard Medical School. Died of pneumonia, Wash. June, 1918. 1912 ABERG, WM. J, P., Government, London. AUSTIN, EDWIN C., Lieutenant. BARCLAY, A. J., lst Lieutenant, Engineers. BILHEY, H. E. BLOMEYER, ROSCOE, Engineers, A. E. F. RVLL BOARDMAN, R. P., lst Lieutenant. BRIGHTMAN, GRANT, Sergeant. BROKAN, V. S., Master Engineer, Engineers, A. E. F. CHAMBERS, CARROLL, Major, Infantry, A. E. F. CLANCY, LESTER M., Aviation. CULBERTSON, H. E., U. S. N. DAHL, EDWIN O., 2nd Lieutenant, A. E. F. TDALEY, FRANK, Sergeant, Field Hosp. Sanitary Depot, A. E. F. Died of Wounds, NOV. 20, l9l8. DAVIS, DANIL., Captain, Q. M, C. DAVIS, JAMES E., Captain, Infantry, A. E. F. DEBBINK, HENRY L., Znd Lieut., F, A., A. E. F. DUNNEWALD, PAUL W., 2nd Lieut., F. A., A. E. F. DRUMMOND, T. B., 2nd Lieutenant, A, E, F. DUFFY, FRANCIS R., Captain, Q. M. C. FARNHAM, W. E., Naval Aviation. FOERSERF HARRY R., lst Lieut., Medical Corps, A. O FOSTER, FAYETTE, Sergeant, Coast Artillery Corps. FRAZER, GEORGE. GREENXVOOD, A. E., Sergeant-Major, Artillery, A. E. F. GRIFFITH, W. H.. Captain, Engineers. GIKOTOPHORST, CARL, Engineers. HARSHAW, MYRON T., lst Lieut., Infantry, A E. F. HEADLAND, OSCAR, ' HOGAN, DANA, Engineers. HOLMES, DONALD S. XHOYER, T. R., Znd Lieutenant, Infantry, A. E, F. Killed in action,July l8, 1918. IESEN, HERMAN L., Private. JESSUP, NVALTER E., Lieutenant, Engineers, A. E, F. JOHNSON, ED. E. KADISH, HALBERT L. KELLDG, THOMAS. KEPLINGER, L. B. KING, RALPH, Engineers. KNEELAND, M. D., Y. M. C. A. LAUGHLIN, EARL C., Bureau OfStandardS. LAXVRENCE, JAMES, Captain, Chemical Warfare Service LEVITAN, ESTHER, War Risk Bureau, Treasury Dept LEVITAN, MORTIMER, U. S. N. LILLY, L., American Red Gross, France. MCGRATH, C. B., Major. MCQUAID, JOSEPH JOHN, A. E. F. MANN, WALTER, Znd Lieutenant, Aviation. MARSH, L. K., Lieutenant, F. A., A. E. F. MAYER, G. F., Q. IX4. C. MEARS, GEORGE S., Private, MERKEL, R. H., lSt Lieutenant, Aviation, A. E, F. MILLER, GLENN, Signal Corps. MUNRO, DANA G., 2nd Lieutenant. NASH, LEO, Accountant, War Department, France. NOER, OYVIND J., lst Lieutenant, A. E. F. NoRcROss, E., lst Lieut., Aviation, A. E. F. NORSEMAN, EDGAR, lst Lieutenant, A. E. F, ORTON, WM. R., Captain, Infantry, A. E. F. PALMATIER, HORACE, F. A., A. E, F. PETERSON, F. P., Aviation. PIERCE, M. XV., Lieutenant. PINTO, RENE NV., Znd Lieutenant, A. E, F. PLEISS, PAUL, Lieutenant. PORTMAN, ANDREW N., lst Lieutenant, F. A., A. E, F POTTER, CLIFFORD B., RICHARDS, ROBERT, Lieutenant. ROGERS, HOXVARD, Lieutenant. RUEDEBUSH, HANS, Sergeant-Major, A. E. F. SCHNEIDER, MARTIN. SCHREINER, ALF., Private, infantry. SCHROEDER, W. H. SCULLY, JOSEPH FRANCES, Lt., Medical Corps, A. E. F SIMPSON, HAROLD G., Aviation. SIZER, RANDOLPH S., Sergeant, Infantry. SKINNE, ROGER D., Field Ambulance Corps, A. E. F. SNYDER, CLARENDON S., A. E. F. STENGEL, A. L., Government.. STEVENS, ELBERT C., Y. M. C. A., A. E. F. STOPPENBACK, FRANK E. STORER, HAROLD W., lst Lieutenant, F. A., A. E. F. SULLIVAN, WILLIANI K., Lieutenant, Infantry, A. E. F 'TAPPING, W. G. THOMPSON, WILLARD C., Medical Corps, TOBIN, EDMUND PETER, Q. M. C., A. E. F. TOEBAS, OSCAR T., U. S. N, TRAYER, GEORGE W., lst Lieutenant, Engineers. VEERHUSEN, H. H., Lieutenant. XVALTER, J., lst Lieutenant, Engineers. fflfffnffrlfffffn1111ffffffffffffffffffnffzffuffffffffffn:ffffnffffffffffzfffffffffzffffffffff1Ifffffffffffffffufffffffuffffffffnfffnfff 1fu1ff1fffffffnf1111111111furfarff1141114-fuffffffffffffffff1nfnffffnfffff11111111111 4 ,.,,,,,,,,,..,,,,.,,,.,.,,,,,,,,,,,, , .,,,,.,,.,.,, , .,,,,,, ,,, .4 , .. ..,,,,,,,.,,,. , , i, .t ,k 4. , , A if if if f' if 'k 'Av 'A' 'k X . f 4 l Page 358 'N' W 4 44444444444444. 4 4444444444444444444 K 4444444444444444444444444444444444444444444444444444444444444 N xx 4 4 4 4 4 2 4 4 4 4 4 E E 4 2 4 4 4 4 4 4 4 4 4 4 4 N X . ,ar 4 4,4 X 4 4 4 4 4 4 4 4 4 4 4 4 4 k xx 4 4 4 4 4 4 4 4 4 I 444 4 4 4 4 4 4 2 4 4 4 4 4 4 4 4 4 4 4 4 I Zi 4 44: 4 4 4 jx 44 Z4 4 fr 4 X 4 4 4 4 4 4 4 4 4 4 4 4 4 m 444444 444444444 4 4 4 4 4 4 4 4 4444444444444 4 4444 44444444444444444444444444444444444444444444444444444444 A 44444444444444444 Irgywwwww , -A- t if Q 74444 441 i' i ii 4444 4 'v44A FXVNVR WASI-IINCTON LAWRENCE Zncl Lt. Aviation A. E. F. XVASSONMJOSEPI-1, Captain, Engineers. WEBSTER, E. M., Lieutenant, A, E. F. XVEIR, JAMES H., lst Lieutenant, Infantry. WVESTPHAL, W. C., lst Lieutenant, A. E. F. 'IXIVETI-IERBY, L. P,, Australian Imperial Forces. Killed in action February, 1917. WIEBOLDT, E. F., Lieutenant. XVILMOT, MRS. ADA I'IOPKlNS, Statistician for English Food Administration, London. England. WVHYTE, MALCOLM, Lt., Engineers, Archangel, Russia. WILLIAMSON, ROBERT C., Znd Lieutenant. WILSON, L. K., lst Lieutenant, Aviation. WVITTER, Lieutenant, A, E F. VXIOLF, JOI-IN, Ensign, U. S. N. WOLF, VJERNER P., 2nd Lieutenant. XVORTH, PHIL D. ZNVEMER, RICHARD, Lieutenant, Q. M. C, 1913 ADAMS, CHAS. L., Sergeant, Artillery, A, E. F. ANDERSON, EARL A., Lieutenant. ANDERSON, FRED, Captain, Infantry, A. E, F. BAKER, PAUL E., Lieutenant, Aviation, BALDWIN, RAY L., Ist Lieutenant. BALLARD, ROSCOE F., Private, F. A. BARRETT, GEORGE A., Red Cross, A. E, F. BEANS, HAYT E., M. T. C., A. E. F. BEEBE, GORDON A., Lieutenant, Engineers, A. E. F. BILKEY, H. EDW., Social. War Recreation Board. BOHNSON, VAN LOREN, Captain, Engineers. BOISSARD, RICHARD, Mobile Operating Unit, France. BOULWARE, JUDSON POWELL, lst Lieutenant, M. C. BRADY, L. J., 2nd Lieutenant, Engineers. BRIGHT, G. N., BRIGHTMAN, HERB., Lieutenant, Machine Gun CO. BRINTNALL, P. C., Sergt., F. A., A. E. F. BRONVN, D. A,, Surgeon, Med. Corps. BRODESSER, R. A., Ist Lieutenant, C. W. S.. A. E. F. BUETELL, ROGER. BURNET, GILBERT, Aviation. CAHILL R, H. lst Lieut. C. A. C. A. E. F. CARTER, HOMER M,, lst Lieutenant, Medical Corps. CARY, CLARENCE, Hospital Corps, CONNELL, J. J. CURTIS, EMERY B., Aviation, DAVIS, H. A., 2nd Lieutenant, F. A., A. E. F. DAWLEY, PAUL. DICKENS, RIDDELL, F. A., A, E. F. XDILLON, HARRY, 2nd Lieutenant, Infantry, A. E. F. Killed in action. DOWNING, S. K., lst Lieut., Aviation, A, E. F. DUNNEWALD, PAUL W., A. E. F. D.YE, JOHN, JR., 2nd Lieutenant. EASTHOPE, STANLEY R., Infantry. ELLIS, CHAS. W., Ambulance Service. ELLIS, GUY T., Ensign, U. S. N. ENGLISH, NORMAN, Lieutenant, Aviation. EVANS, JOHN, Ensign, U. S. N. A. FARLEY, THOS. J., Ensign, U. S. N. FARRAND, 1. W., Sergeant, Engineers. FITCH, W. R. FOULKES, HOWARD T., Lieutenant, A. E. F. FRARY, PAUL V., 2nd Lieutenant, A. E. F. FRASER, E. M., Ist Lieutenant, Engineers. FREUND, CARL, lst Lieutenant, Medical Corps. FREY, ROBERT R., Sergeant, Engineers, A. E. F. GEHL, EDWARDJ., Lieutenant. GEORGE, MARSHALL W., Znd Lt., Aviation, A. E. F GORDON, STANLEY, 2nd Lieutenant, Artillery, A. E, F GRIFFITH, GEO. P. GROON, SAMUEL B., 2nd Lieutenant, , GROVES, ASA B., Lieutenant, F. A., A. E. F. HANSEN, JOHN E., Lieutenant, F. A., A, E. F. HARRISON, STANLEY, Aviation. HEINZ, ADOLPH, Infantry. HEISE, HERMAN, Lieutenant, Medical Corps. HOOO, FRANK VICTOR, Chaplain. VLA IQEFFER, RALPH, Aviation. KIRK, STANLEY B., Covernment, KIRIQ, WM. E., U. S, N. KLIEEORTH, ALFRED, Lieutenant. KNAUSS, GTTO A, KOCI-1, VINCENT, lst Lieutenant, Medical Corps. IQUHNS, GEORGE R., Aviation, A. E. F. LAMPERT, B. H,, Lieutenant, Engireers. LAMPERT, HAROLD M., 2nd Lieut,, A. E. F. LARSEN, H., Lieutenant, Engineers, A. E. F, LAWRENCE, MORTIMER M., 2nd Lt., Aviation, A. E. F. LESTER. JOHN KING, 1-lospiral Corps. A, E. F. LEVIN, ISIDORE, Private, Chemical Warfare Service. LEWIS, LEON, 2nd Lieutenant. LEWIS, -1-1-IEODORE, Lieutenant, Infantry. LOCKEN, ENOCH, A. E. F. MCCONNELL, C. F., Sergeant, Hospital Corps, A. E. F. MCCRORY, WALTER, MCEACHRAW, W. W., 2nd Lieutenant, Aviation. MCFARLAND, M. F., Aide, Pershings Staff, A, E. F. MCGRATI-I, R. D., Captain, Ordnance. MCKAY, JOHN GORDON, 2nd Lieutenant, A. E. F. MAOILL, DONALD G., lst Lieutenant. MAPLE, D, R. MAREK, FRANK B., Ist Lieut., Medical Corps. MARKS, HARRY CARL, Hospital Corps. IVIARTIN, JAMES G., Sanitary Corps, MILLSPAUGH, JACK W., lst Lieutenant, F. A., A. E. F. MOORE, HINMAN, Ordnance, A. E. F. MOORE, HERMAN. MORGAN, LYNN, Captain, A, E. F. MORCENORTH, A. S. MULHOLLAND, O. S., Private, A. E. F. 'MURPHY, WALTER, Lieutenant, Infantry. Died Oct. 13, 1918. NOYES, EUGENE C,, Field Artillery, A. E. F. PARMENTIER, D. M., Captain, Infantry, A. E. F. 'PECK, HELENA P., Yeoman, Died at Washington, PETER, A. G., lst Lieutenant, Q. M. C. PETERSON, BASIL. POXVELL CHARLES HEALY Red Cross Service A. E. F PRIBNOW, ARNOLD F., U. S, N. PRITZLAFF, JOHN C., Lieutenant. A, E. F. RAIN, ERLINC. O., Lieutenant, Med. Corps, A. E. F. RATTER, JOSEPH C., Aviation, A. E. F. RAVN, E. O., Lieutenant, Medical Corps, B. E. F. REARDON, R. S,, Research Div., C. W. S. REBER, H, J., 2nd Lieutenant, Coast Artillery, A. E. F REIS. ALVIN C., Captain, Balloon Corps, A. E. F. ROBERTS, W. C., Lieutenant. ROWLAND, MARGARET, Red Cross Unit, A. E. F. RUNKEL, EDGAR E., SCHMIDT, ERXVIN RUDOLPH, Captain, M. C., A. E. F. SCHNEIDER, ANDREW, lst Lieutenant. SHEA, C. P., Social. Field Sergeant of K. C., A. E, F SHEA, EDMUND B., 2nd Lieutenant, F. A., A. E, F. SHEFFER, RALPH J., Sergeant, Q. M. C., A, E. F. SHERIDAN, JOHN E., lst Lieutenant, A. E. F. SHOOP, SIDNEY, Lieutenant. SIVGER, ALLEN W., lst Lieutenant, A. E. F. SLAGSVAL, OSCAR, Lieutenant, A, E. 1-. SLICHTER, SUMNER, F. A. SMITH, EARL, Sergeant, Camp Zachary Taylor, Louis- ville, Ky. Died Oct. 13, 1918. SMITH, R. M., Lieutenant, Infantry. STAVRUM, SIGVALD. STIVERS, CHARLES PAUL, Lieutenant. TAYLOR OHN Lieutenant, Royal Field Artillery ,J . - XTHOMPSON, CARL, Lieutenant, A. E, F. Killed in action, Oct. 1918. TOPE,-OLIVER E,, Sergeant, Infantry. TRUITT, ALBERT C., Q. M. C, TURNBILL, ALAN JAMES, Corporal, Engineers. TWITCHELL, EDWIN. TVAN RIPER, JOHN, Lieutenant, Chemical Warfare Service, A. E. F. Died Dec. 27, 1918, WATTAWA, JOHN, Attache, Am. Leg., The Hague. WEBER, HENRY, Infantry, A. E. F. WAHL, F. R., Lt., Aide-de-Camp, Infantry, A. E. F. WEIL, EARL, Private, Ordnance, I'-ifiitil wt wk R S26 gr sw Sir N . R N Nl' R R X E! gills R R RSD SE Rs RS Rs Ss Xt Nt Ns gs XE SSR Rs R: Ss xxus 'gyms Rs Ri R: Rl ss R9 R: ss S S R My ks . R sit Q . it N sw N gi S gl' R 'NM HOPKINS, W. T., Ensign CAsst. Payrrfasterj, U. S. N. HORNADAY, WALTER C., 2nd Lieutenant, Infantry. HOSKINS, MARK H., HOUSEHOLDER, G. M., Lieutenant, HUGHES, ROBERT D., lst Lieutenant, Ordnance. JANISCH, HAROLD, U. S. N, JOHNSON, ROBERT H., lst Lieutenant, F. A., A. E. F WENDT, C. A. WHITNEY, E. N., Engineers. WILCOX, FREDERICK, Lieutenant. WOLLIN, ANDREW A., lst Lt,, A. E, F. WOODWARD, S. C , Aviation, ' YOUNGMAN, FRANK N., Lieutenant, Infantry, A. E. F 41111444414444444444444f4ffz44441111111114111110111144114f14a4f4444444f44ff414444444444444444f444444144404444414444444444444444104444444444444444444444444444444444444414f4444444444444444f444444444444444444444f444444f4444444444444411 1 444444444444444444444444444444444444y4444444444444 y444444444444 444444444444444444444444444444444444444444444444444 W Page 359 U ' 4444 4 444444 4 4 4 44444444444444444 4 4 i' W if i' if W 4444444444444444444 I 4444444444444444444444444444444444444444444444444444444444444 ffffffffffffffffw . ,,,,,,,,,,, Ziftftty Z Z f-iii-ki'-kg Z 4,,mf,1fm,11Md,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, , , mm, offfmffffwfnfffffffwwfffffflfffmmmffwfffffwf, Z Z 4 15 4 2-ks: Z 2 Z f A Z . 2 Z Z Z 1914 - HENDRICKS, J. H., 2nd Lieutenant, Engineers, A. E. F Z Z I 3 HICKOX, SAMUEL S., Government. 2 Z Z ALEXANDER, A. HADDEN, lst. Lt., Aviation, A. E. F. HOFFMAN LESLIE Radio Section, Signal Corps. Z Z Z ,ig ALTER, FRED. HOWARD, NEAL F., lst Lieutenant, Sanitary Corps. 3 Z I Z ANDERSON, STEWART, Lieutenant. HOUCHTON, LOU, Engineers. Z Z Z Z ANGLEBLICK, R, C., lst Lieutenant, A. E. F. HUBBEL, WOLCOTT W,, Znd Lieutenant, A. E. F. g Z 'tg ARMSTRONG, R. N., Znd Lieutenant, Infantry. JACKSON, HELEN HUNT, Social. Y. M. C. A., France. Z Z Z Z ARNEMANN, GEORGE, Major, F. A. JACKSON, SYDNEY C , A. E. F. Q Z Z 2 BABCOCK, F. G., Ensign, U. S. N. -JAMES, HERBERT H., lsr Sergeant, Coast Artillery. Z - Z ZZWZZ BACHHUBER, LEOJ.. Ensign, Paymaster, U. S. N. JENNETT, RAYMOND, 2nd Lieut., Infantry, A, E. F. fg 'fgZ Z5 gg BACON, VAUGHN, Znd Lieutenant. Aviation. JONES, ALEXANDER, Hospital Corps, A. E. F. gg Z2 BAILIE, J. M., 2nd Lieutenant, Infantry. KELLEY, P. J. 522 Z3 gg BAINERIDCE, ARCHIE, Lieutenant, A. E. F. KEITT, G. W., Captain, Chem. Warfare Serv., A. E. F. 5 Z2 EAIRD, A., Et Lieutegaiat. C EEMP, SALPH, Cosrporal, Z gZ 3 5, AKER, EO., aptain, a oon Orps. ERR, PENCER, viation. - . . . 9 if Z2 BAKER, Ross, Chemical Warfare Service, A. E. F. KIMBARK, H. R., lst Lieutenant, Machine Gun Co. Z1 Z2 Z7 BARNETT, V. V., 2nd Lieutenant, Infantry, A. E. F. KINNE, B. I., Government, American Legation. Berne. V ZZ 1: M - f ff Z5 55 BASSETT, NORMAN D., KOESTER, C-. F., Lieutenant, A. E. F. 9, Zg gg BAUM, G. K., Lieutenant, F. A. KRANZ, I-IERMAN E., Engineers. Z, ZZ Z2 gg BECKER JOSEPH A. Infantry. KRESS, JOHN, Lieutenant, infantry, A. E. F. I2 ig BENNETT, FRED C., 2nd Lieut., Aviation, A. E. F. LAMPERT, BENJ., A. E, F. IZ, ZZ ZZ BERNARD, BURCHARD P., Corporal, Ordnance, LAMSON, FRED W., Private, Infantry, A. E. F. Z' Z5 gg BICKELHAUPT, IVAN A., Captain, Engineers, A. E. F. LAYMAN, KENNETH F., Captain, Infantry, A. E. F. Z ZZ Z5 BLACK, BENJ., Hospital Corps, LEVY, EDMOND G., Corporal, F. A., A. E. F, ZZMZZ Z Z BLANDING, JAMES L., 2nd Lieutenant, Infantry. LILLARD, PAUL, lst Lieutenant, Infantry. 2 Z Z 3 BLANDING', VIRCII, L., Lieutenant, Infantry. LOBDELL, W. L., Aviation. Z Z Z Z EOUCFIEIEJLDZ Igvliation, A. E. F., Italy. ESXVRY, L., Enggneers, ACE. F. C M h D d Z f 4 OWEN, . ., n ieutenant. I ACH, DNVARD, ergeant, amp uster, ic . ie g Z Z ix? BOYLSTON, JOHN W., U. S. N. of pneumonia, March, 1918. 2 7 Z 2 BRADISH, R, P., Znd Lieutenant, Infantry. MCCONNELL, STEWART D., Aviation, A. E. F. 2 Z BRANT, C. W., Lieutenant, F. A. MARKHAM, BURTT J., 2 Z Z g BRAYTON ARTHUR, Sgt.,Medical Corps, A. E. F. MARTIN, J. A., Znd Lieutenant. 2 Z Z BRECKENBRIDCE, WM. L., lst Lieut,, Engineers, A. E. F, MENNINCER, K, A., Asst. Surgeon, U. S. N. Z Z ' g BREWER, EVERETT R., Lieutenant, Aviation. MILLARD, M, B., lst Lieutenant. 2 Z BREWER, JEROME S., Sergeant, Hospital Corps. IVIILLER, GILBERT A.. Private, Signal Corps, A. E. F, 5 ,Z Z' Z ERICGS. ALIIEAN, Eggiriieers, C I MILLERLWVINI. Engineer? 2 Z f 4 RINDLEY, ENJ. ., ieutenant, ava ry. ISCI-I, OUIS ., Ospita orps. 4 X Z Z BRUCE, MALCOLM, lst Lieut., Infantry, A. E. F. IVIONTGOMERY, E. B., Yeoman, lst Class, U. S. N, Z ,WZ Zgfffgg BRUM, LESTER F., 2nd Lieutenant, Q. M. C. MORGAN, LYMAN J., Captain, Tank Service, A. E. F. 2' Z3 gg EUEHLER, EMIL, Private. MORRIS, VICTOR, Captain, Engineers, A. E. F. Z Z2 Q2 BUNDY, HARRY, lst Lieutenant, Medical Corps. MORRISON, ELTON K., Lieutenant, Infantry, A. E. F. lg Z2 gg BUSER, ARNOLD A., Sergeant, Infantry, A. E. F MURCAN, L. J,, Tank Service, A, E. F. Q5 ,ZZ Z2 gg CAMERON, M. REGINA, Am. Red Cross, France. NIYRLAND, ARTHUR L., Assistant Paymaster, U. S. N. ,gg Z2 32 CARPEINITER, IEUSSEIFL H., Captain, Aviation. 'NELsON, JOII-GN, Lieutenant, Infantry. Killed in ac- Z2 gZ fg 2, ,A5E, ARRY ., n antry. tion, ov. 20, IQIS. if if Z2 Q? CHRITZMAN, CEO. M., lst Lieutenant, NELSON, N. A., Lieutenant, A. E. l-'. Z3 'CLARKE,,BRUCEAW., Lieeuttsjg-Ent, A. E. F. Killed in IIGIEWNUGAN, D.GH.,CA. E. F.I I A E F xg 11 actwn On uausr , . YE, AMES ., aptain. n antry, ' . . -. Z2 if ZWMZ COBAUGII, HARRY, lst Lieutenant. O'CONNOR, A, J., 2nd Lieutenant, Aviation, A. E. F. fffffffg Z Z COE, NOBLE M., lst Lieutenant, F. A. OFSTRIC, HAROLD S., 2nd Lieutenant, Infantry 2 Z Z g CANARD, HAROLD M., A. E. F. O'HARE, BERNARD, lst Lieutenant, Medical Corps, ' 2 Z Zig CONELY, CHARLES L., Infantry. Otiveiz, JOHN, Coast Artillery. 5 Z Z . 3 CONSOER, ARTHUR, Lieutenant. OTJEN, CHRISTIAN, Captain, Infantry, A. E. F, 2 Z Q CORK-EY, JOHN, Lieutenant, Ordnance, A. E. F. PELLETTE, ARTHUR, Lieutenant, M. G. Bn., A, E. F. 3 Z Z ig COUNVIN, LEO V,, lst Lt., C. A. C., A. E. F. PETERSON, O. P,, Lieutenant, Aviation. Q Z 2 CRILE, DENNIS W., Captain, Medical Corps, A. E, F. POMEROY, H. S., Engineers. Z Z Z-gg Ciwwett, JOSEPH A.. PORTER, CLAUDE T., Captain, F. A., A. E, F. AZ Z ' ' 3 CUMMINS, JAMES A., Lieutenant. PRIESTER, HENRY C., F. A. 2 Zi Z DALLWIG, H. C., Chem. Warfare Service, PROCTOR, JOHN. 2 Z Z 2 DAUBE, D. O., Quarter Master Corps, PURCHASE, R. T., 2nd Lieutenant, Aviation. 3 Z Z DAVIES, JOHN P., Lieutenant, Aviation. QOALE, MILTON N, 2 Z Z Z ISAVIS, IgllARgI.1aIXijI.,I?nd Lieutenfant, F. A., A. E. F. REBER, L. E. Z Z ywffw AVIS. A ., fl iwlletlelnt. - viation. REICHERT EDNVARD E. Lieutenant. 1. Z if H D W, . ' ' 1f ?f fx 19 EMMINC, AYNE. REPLINGER, ROY L. f, gf DEWEY, ROBERT S., Znd Lt., A. E. F. RICHARDSON, L. H., Zntl Lieutenant, Infantry, A. E. F. ig DICKSON, CARL G., . - ROBERTS, G. F., 2nd Lieutenant, Field Artillery. 3 Z5 DOANE, RALPH Lieutenant, A., A. E. It ROBINSON, BYRON L., Nledical Corps. Z gg E DOECE, KARL. Lieutenant. Medical Corps. RUBIN, VICTOR, Lieutenant, Infantry. 1 Z2 gg DOHR, JAMES, Lieutenant, Ordnanqe. RUNDE, RALPPI T., Sergeant-lvlajor, A. E. F, 2 gZ EESNERIEIJRI. SCFECRUEESEEVK-ill COFPS- glUSCH,IL-IAIRRYLF., lst Lieutenant, Infantry. 5 gZ fg 44 l -. UEIUCCFS. - 'A - ANDS, . .. ieutenant. 2 ZZ ELLSWORTH, CHARLES W.l, Lieut., A. E. F., FYGTICC. SCI-IELY' PERQY' F, A, f Z2 ENCSBERC, R. W., Zrld LlCLltCr'lal'It, A. E. F. SCHADYJAME5 ALBERT, 2' Z? ERICKSON, KENNETH, lst Lieutentant, F. A., A. E. F. SCHMIDT, FREDERICK J., Hospital Corps. 3 ZZ Z2 if FENN, CLARENCE, Captain, Infantry. SCHWTT, H, Cu Ayriation- Q if ZZ Z'-MA? S581 BA LIS'-XCEEIVE. F. A.. A- E- F- gEYMOURCI-ELEN, American Red Cross, Washington. ZWIMZ , , , . ., via Ion ,... HAFER' , , 1 Z 2 GELATT, ARTHUR, Lieutenant, Infantry. SMH-H, KENNETH BU 2nd Lieutenant. 2 Z Z Z GETTLEMAN, N. F., 2nd Lieutenant, Engineers,A. E. F. SORENSON, E, DW Amlgulance, g Z GILLIS, JAMES P., lst Lieutenant, Marines, A. E. F. SOOTAR, DOUGLAS RW Hospital Corps. Q 2 Z Z Z GODFREY, ALFRED LAURENCE, lst Lieutenant A. E. F. SPERRY, CARLTON, Lieutenant, F, A., A. E. I-. Z Z Z EABERMAN LUCIUS- Emlgflr U' 5- N- STAFFORD, R. R., Field Artillery. 3 Z Z ALE, MERLIN C,, Lieutenant, Grclnance Dept. STAUVUEM, S. A., lst Lieutenant, Infantry. 3 Z Z .tg HARPER, C. S., lst Lieutenant, Medical Corps, A, E. F. STEVENS, BERRY T,, Infantry, Z Z Z EQYESjJ.RB.,IEnd Lieutenlhantni AAEEFF SSTEVENS, S. S., Private, Inlfantry. Died in France. Z Z Z 5 AD, . ., ieutenant, . ., . 4. . STRAUBEL, C. W., Field Artilery. 4 iZ 7 i? Z Z 5 i,Z Z 3 2 if 6 ii? 2 Z Z r Qfffffmffffffffm1ffmfffffffffffffffffffffffmffffffffgffffffffjfffffmffmffffwwff113ffffffffmwg,ffmffffff?1ffff,,mnfmff1fff,WwwW1wwfmyfm1Wmffmmf0111111111121ff',muffwfffffffffffqfi Z ! I ,,,,,,,, ,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,, 2 L ,,,,,,,,,,, 5 r ,,,,,,,,,,,,,,,,,,,,,.,,,,,,,.,,,,,,,,,,,,,,,,,,, Z 'li' ir ai ni if ir ir ,,,,.,. , -it it if ir ir ik RZ I Page 360 W, 4 44,0440 4,44 . 4 4 ,,,,,, Z 4, gf A Ag f if if I 4 it if if if if ik Af Z tZW,4444,444,441,,m,4,4,4,,,,,,4,44,,4,,44W,,,4,4,,,4,,,A ,,,4,,,,444,,,,,,,,, 4,,4,4,,,,,,,,,,4,4,4,444444,4,44444,44,,4,,4,f,,,,,4,,,,,,,,,Z qt f 4 ' 4 Z rxvnva RVL L 4 4 4 if 4 4 kf 4 4 4 4 f 4 Z 6 4 4 4 4 4 if 4 4 iz 4 4 Z Z STREHLOXV, R. R., 2nd Lieutenant, F. A., A. EF. ELLIS, F. C. Z Z Z tg SULLIVAN, DAN T. ELLSWORTI-I, CHARLES WEST, Sergeant, Engineers. 2 Z Z THAYER, CHARLES, Ensign, U, S. N. FAVILl.E, JOHN. 2, Z Z tg rl-HXVAITS, FRED G., Artillery. A FIEWEGER, T. E., Znd Lieutenant, C. A. C. Z Z Z TORMEY, ALBERT R., lst Lieut., Medical Corps, A. E, F FLODEN, F. J., lst Lieutenant, Infantry, A. E. F. 2 Z Z 4 TROTTMAN, NELSON S., Lieutenant. FOOO. HUOH M., Lieutenant. Ambulance CO., A. E. F. 2 if Z Z VANCE, PRESTON T., Field Artillery. FOSTER, WILL A.. Captain, Infantry. Z Z Z 4 VAN CENT, C. E., Lieutenant, Field Artillery. GELEIN, EDWIN, Captain, Infantry, A. E. F. 3 Z Z Z VAUOI-IN, DON, Lieutenant. GILBERT, A. L.. Private, Ordnance. Z Z Zgwgg VINCENT, JAMES, Lieutenant. Died in Camp. G.I.LE'FT, JAMES MONROE, 2nd Lieutenant, Ordnance. 411444, Z WAITE, OAKLEY, lst Lieutenant, Infantry, A. E. F. GLASPELL, DEAN, Captain, F. A. 5 eZ Z3 44 WVALKER, GORDON. GLASSNER, WM., Sergeant, A. E. F. Z Zi 22 WALLIS, JOHN L. GLEICIQE, HARRY. 2 QZ Z4 42 WELLER, DAN BRONVN, A. E. F. GOLIJShilI1'l'I, E, L., 2nd Lieutenant, Engineers. 2 WETHEREY, BARON R., A, EEF. GRAEWIN, ROBERT, Lieutenant, A. E. F. Z EZ Z5 gg XVI-IITE, IRVIN ARNOLD, lst Lieutenant, A. E. F. CSRAI-IAM, XVALLIS, Private, Marine Corps. 2 Z5 gg WVILMOT, LEMUEL ALLAN, Major, Canadian Battalion. GIlI3ENE, l'lONVARD, Major, Engineers. Q ZZ Z2 YEWDALE, RALPH BAILEY, Sergeant, Machine Gun Bn. GREGORY, CBMOR, Lieutenant, Aviation. Z Z? 1915 f'IAI.I3Yl,il'IAR1Ii!'f lirivate,IAk E. F. A - 2 ZZ ff if 'ALL, RED ., st ieut., n antry, .E.F. Z Z! Z5 52 HALL, RAELVILLE C., lst Lieutenant, Aviation, A. E. F. 2 ZZ ADAMS, HOXXVARD A., 2nd Lieutenant. HALSTEDLJAMES, Lieutenant, Signal Corps. Z Z4 QDAMS, NXILLIAM gielultenant. Infaigttriv, E. F. lIjANER. l'AJ., UPS. IC gg x2Mj4 LBERT, RTHUR ., n ieuteriant, . . 1. . ANSEN, LVIN ., igna orns. Qmjf Z 'Z QLLEN, CI-IESEER, Istllfielutenant, A. A E F IIIIIARDIN, 23ddLieuteE?nt, Qviation, A. E. F, 2 !Z f 4 LEXANDER, OSEPI-I ., ieutenant, rti ery, . . 4, ARTER, .V . ., r nance etac ment. 4 f Z 2 BAILLIE, JOSEPH M., lst Lieutenant, A. E. F l'lAUMEIlSON, CLIFFORD C., A. E. F. Z Z Z BARRETT, GEO, A., Am. Red Cross, France. HAYDEN, VAN B., Znd Lieut., Aviation, A. E. F. 2 Z Z EASEY, Liellitc-:nant.U S Y IIZIEALD, IEOXVAIEJ Igwlilind Lieutenant, A. E. F. Z Z f 4 EMIS, ALTER, nsign, . . I . EATI-I, -ARL ,... 4 f Z ig BELLOXVS, HARRY H., Lieut., A. E. F. HEDOES, ROBERT, U. S, N. Z Z 5 BERGER, Louis S., Ist Lieutenant, A. E. F. HEEFRON, DONALD, Znd Lieutenant, Infantry. 2 Z Z BICKEL, JACK, Private. I-IEIDER, HARRY B., 2nd Lieutenant, A. E. F. 2 Z 5 BIRD, BYRON, Construction Section, Signal Corps. HEINECKE, WALTER W., Lieutenant, F. A., A. E. F. Z Z Z ig EISHOP, GEOIEGE M., ghei-nicalIWfarl'are Service. I:ilI2MENxvAY, H., Axationld A Z f' u, OLLENBECK OSEPI-I ., aptain, n antry. ENDERSON, RTHUR A ., st ieutenant, w viation, 4 4 Z Q BLAKNEY, GEORGE P., lst Lieut., Ordnance, A. E. F. HENDRICKS, CSENEVIEVE, Government. 2 Z Z 5 BOUCHER, C. K., Aviation. HENRY, LEVI L., Aviation. 2 Z ERADLEXI2 WM. R.BMo.unted Military Police. ' IQIOOINS, DENALD Hblst-Lieut., M. G.rBn., A.AE.g.F gg 3Z gg gg RAGG, ENDALL ., ieutenant, ILDRETI-I, ICHARD .. ieutenant, n antry, . . '. 42 if Z2 'BRAINERD, GEO. EARL, Sergeant. Died Of pneumonia HILDRETH, WM., Field Artillery, A. E, F. Z5 gg an October 6, 1918, at Camp Taylor, Louisville, IFIOAO, CI-E+.RLESvxD.,2Sggeant, Infantry. 1? if y. ODSON, RED ., n ieutenant. 42 sf Z2 BRECKENRIDGE, W. L., Lieutenant. HOLDEN, E. D., Aviation. BRESHNAHEN, GEO. T., Athletic Director, Camp Grant. HALLEN, EDWIN, Y. M. C. A. if if EREWER, THUEOW, llsxt Lieutenant, F. A., A. E. F. HOOD, W., 2ngLieutei1agtLA. E. F. F A 3Zl fi gg RITTINGHAM, . J., - viation. OOC, HARLES ODGE, n ieutenant, . . gi QA Ziyi? BRODDA, F. W., Sergeant. A. E. F. I'lUMPI-IREY, KENNETI4, Lieutenant, Aviation, A. E. F. Z2 gZ Z Z ERUOE,IlgfIALcOi.iigALieutenant, Infantry. SUTCHINEJNRE. H., Ist Lieutenant, A. E. F. ZMJZ 4 UDIG, RED, a io. LIOHES, . . 4 Z 2 BUELONV, EARL F., Hospital Corps, A. E. F. HYDE, WILL C., Lieutenant, A E. F. Z Z Z BULL, BENJ., lst Lieutenant, Infantry. JACKSON, JOE, 2nd Lieutenant, A. E. F. Z Z Z 5 BURNS, THOMAS E., lst Lieutenant, Engineers. JENES, HAROLD, lst Lieutenant, Infantry, A. E. F. Z Z Z , BURNETT, GILBERT W., Znd Lieut., Aviation, A, E. F. JENKINS, J. F., Private, Z Z Z ig CARPENTER, MILTON, Zncl Lieutenant, A. E. F., Russia JOHNSON, ARTHUR N., Lieutenant. 2 Z Z CARTER, RUSSELLJ., lst Lieut., Infantry, A. E. F, JOHNSON, D. P., Aviation. Z Z Z fg FCARY, GEO. A., Aviation. ' Killed in airplane accident, JOHNSON, FRANK E., lst Lieut., Ambulance Service. Z Z ' Z Kelley Field, Nov. 8, 1918. JONES, DONALD K., Znd Lieutenant, F. A., A. E. F. Z Z EATLIN, ERA M., Znxd M. C., A. E. F. EONES, IFIRED Rx5I3uI3L,dGLOvernment. F A 2 1 fp ' HAPIN, SUGENIE ., . . . ONES, UCH ., n ieutenant, . . , , f Z Z CEHASE, PAUIHW., Znd Lieut., Aviation, A. E. F. EEEAHMER, EXDJWARE C., Infagtry, A. E. F. 2 Z f 4 ASSERLEY, . AMMLADE, M., ergeant, viation. 5 f gyfffji COHN, MORRIS S., Private, Aviation. KEDNEY, HENRY S., 2nd Lieutenant, F. A., A. E. F. Z Zi Q3 CONNELL. EDW J., Lieutenant, Ordnance. KENNEDY, MARTIN THOS., Sergeant, A. E. F. gZ 2Z Z4 gg CONOVER, FREDERICK L., Major, Sanitary Corps. KIDDER, CHAS. J. FZ EZ ZZ SONRAE, POWELL, lst Lieutenant, A E. F. IIEILE, R. 1gndlLieIutenant, Engineers. ,g if OON, . . ITCI-IEL, . ., st ieutenant, n antry. 9 5 Z5 CORNISH, MYRON, Sergeant, Aviation. KLOTZ, C. H., Ordnance Inspector. 24 Z2 gg CRANDALL, J. S., Engineers. KNAPPEN, RUSSELL S., Lieutenant, Engineers. ,j gZ Z2 ERUAIPKI1-XJRTIIlJR Ng., lieutenant. ENIOHTLI MINNE ACNEB Vga?xIDepartment. 4 if 22 AVID, ILLARD ., VlaElOI'1. OOH ARRY, nsigri, , , -. , gZ Z2 gg DEAN, HARRY C., Sergeant, Infantry, A. E, F. KUMM DAVIS Corporal Machine Gun Bn. 5 ZZ ZZ DETIENNE, EARL, Naval Aviation, LANGLEY, THORPE M., Lieutenant, Infantry, A. E, F. 2' gd Z2 DICKSON, H. W., Aviation. LANV, H. B., Aviation. Z, Z2 DIETZ, DELMAR L., Q. M. C. LESTER, ROBERT GAYLORD, lst Lieutenant, Infantry. 22 gZ Z4,,,,gZ EIXON, HUNITETLIAP V E A EINGVOLBD, C. - g2,,,2Z f 4 OOLITTLE, . ., rivate, ngineers. OOMIS, . . - 4 f Z Z DOWNEY, FRANK E., Zncl Lieutenant, C. A., A. E. F. MCATEER, J. R., Coast Artillery. 2 Z Z Z DRAVES, A. R., Sergeant, Infantry, A. E. F., France. MCGINELY, EARL A., Lieutenant, F. A. 4 Z Z if DULON, L., Aviation, La Fayette Escadrille, A. E. F. MCKAY, ROBERT C., F. A. 2 Z Z 'DUXBURY, LELAND R. Died at Great Lakes ofSpanish MCKAY, JO!-IN, 2nd Lieut., Infantry, A. E. F. 3 Z Z influenza. MACHOTKA, J. F., Private, Aviation, A. E. F. Z Z 3 'EATOUOH EMERY, Sergeant, Infantry. Gassed on MANLEY E. P. 2nd Lieut. Engrs. A. E. F. 5 Z Z E Sepalo 1918. G IXIZARSHALII5, HONVAIPILI? Pi, Alyiation. Z f . Z DMONDS, RAWFORD, overnment. ARTIN, ATRICK ., st ieutenant. 4 f Z Q EISEL, T. G., lst Lieut., Chem. Warfare Serv., A. E. F. MOFEATT, HAROLD L., 2nd Lt., Engineers, A. E. F. Z I I f 4 9 4i:4 f4 4 4 4 4 4 fi 4 if Z 64,14ffmfffffffffffffffmfmff44144444441414,444fffffffgggfxfzgzZmffrzjzxzggfgjfzgff 454744f44f4m,44,,444,,,4 4 W4 fffwffffffffffffffff 4,4444,4.444444,444444414044444444144444ffffwffffmfl Z 4 i if if at t if if ,,,,, , ,,,,., , ,,,, , ,,,,,,.. ,,,, , ,,,,,,,,.,, , if ir ir if if if if 4 M Page 361 S mx S 5 4 , ,, . W, M ,,,4,,4,,, w,,,,,4,,,,4,,, , w Z . if it Z .1-if ,,, Z i t tr It i t t Z X f 5 fffffffnfn, -f 1111 X Z 7 7 Z f if FNVNVR R VL L 4 4 4 4 4 4 4 4 4 4 Z 4 4 Q 4 f Q4 4 f 4 4 4 4 f 4 4 f Z 4 4i Z Z 4 4 Z Z IXXIORAN, MICHAEL D., lst Lieutenant. ' 1916 Z Z tg MOORE, ROCER E., Instructor in Mathematics for 3 Z Z 3 Light Artillery at Camp Zachary Taylor, Louis- ALEXANDER, ALISTER, 2nd Lt., Cavalry, A. E. F. 3 Z Z M ville, Kyw Digd October 2, 1918. A E QLMON, C., Engineers. A E F 4 , 4 OOREHOUSE, M. LFRED, Medical Corps, . . F. LVORD, . C., lst Lieutenant, . . . 4 4 Z Z MOSES, E. W. AXIDRAE, GEORGE l-l. J. 2i,Z Z tg MUMMERT, MAURICE M., Private. ANDREW, EDXVIN L., 2nd Lieutenant, A. E. F. Ag Z Z Z MURPHY, HENRY Died of pneumonia April 3 l9l8. APPLEYARD, G. S., Captain, F. A. Z Z Z g NEUMAN, LAWRENCE. AYRES, A. O., Captain, Engineers, A. E. F. g Z ZVWZZ NEUPERT, EMIL, U. S. N. BARRETT, N. DATER, Aviation. Z,,,,,,Z EAPELKAFC. J., Zndgieigenant, Eggineers. A E F XBARTIJETT, WILLIAMJGH, Diedgrorn ipinlal meningitis, Z2 54 ARDEE, RANKLIN ., ergeant, ngineers, . . . an. 28, 1918, e erson arrac s, O. 43 ,Z PARMENTIER, D. M., Lieutenant. BASH, F. E., Ordnance. Z5 PASSMORE, ERrc W., Chief Boatsxvains Mate, U. S. N. BECKWITH. RALPH M-,Serizeanl Z2 22 PEACOCK, K., Lieutenant, Medical Corps. BEHRENS, P- E., Znd LIC'-1ECn6nE. A-. A- E- F- gg Z5 PF151-ER' FREDERICK W, BENEDICT, FRANK W., Zfnd Lt., Signal Corp, A. E. F. Z5 ZZ EOOILIXCI. Yg.,ILieutenant, Infantry. QENISH. CPFC- Aa, Zigi' LICUKCYEUC-tl Zi ,Z OSS, , 4, leutenam, ENNETT, HOMAS DMUND, via ion. Z2 Z, 4 PROCTOR, ROY, 2nd Lieutenant. 3ERME. CHAS- Rn Q- M- C- 'g E4 Z2 ,2 RASMUSSEN, JOHN P., Lieutenant, Engineers. BEF-RYMAN,,BR0WNELL, 2nd Lieulenanl- 25 ZZ 'Z RATH, FLOYD CECIL, Sergeant, Medical Corps, A. E. F. BERTELINC, C- N.. 2nd Lieutenant- ZZ Z3 'g REID, J, WU Signal Corps' BEYERS, ARTHUR E., 2nd Lieutenant, Infantry, A. E. F. gg Z2 ,Z REUTER, EDW- C., Infantry' BEYERS, BERT J., 2nd Lieutenant, A. E. F. Z2 gZ I I , K ' r ' ' ' I ZZIMZZ REYNOLDS, EDXVARD S., Captain, M. G. Bn., A. E. F. Bl-0ECHl?Rt RAY- 2nd I-ICUUSUSHI, Infantry- Killed in ZZMZZ I 4 R F A action on July 30, 1918. 4 X Z 4 RICH-1-ER' REDERICK ' BOCART FRANKLIN B Med'cal Corps 7 Z 4 4 IEGER, HARRY W., Ordnance. i '- , ' ' 4 f Z Z ROACH, PAUL, Znd Lieut., Aviation, A. E. F. BOHN- RM-PH My Indusfflal- Z Z Z Q9 ROBINSON, P. K., lst Lieut., Infantry, A. E. F. BOLLMAN' C' C Lleumngm' Infantry. . 3 Z Z Sono,-F, MEKERIELI S ' Eggarg, QLEEJRIEED B., lst Lieutenant, Aviation. Z Z f 1 , - , . . Z Rgiiitmiq Eciietnmtnt BOYLE- RUTH M. Y- M- C- A-. Frame- Z Z 4 ' ' - ' BR XNDENIBERG EARL W Y M C A 4 Z Z 4 ROGER? LESTER C., 2nd Lieutenant, F. A., A. E. F, BRQNT 5 A Hoqpxal dems - - - 3 Z f 'ff OOT, oss. f 1 - -- - ' - 4 if Z 2 SANBORN, FREDERICK, Lieutenant, Cavalry. EFINK' SISANT-EY-, InfamfY- A- E- F- Z Z . ' SCHAAL, ALBERT A., lst Lieutenant. ROWN - FH Lleufenam- 3 Z SCHMIDT' W Aviation' A E F EEZESQEEEABER S Ensit-n U S N Z Z 2 CHOEPF, EO LAWRENCE, F. ., A. . . - ' - -r 1 ' f ' ' 4 Z ZZMZZ SCHOOL, ALBERT A., lst Lieut., Medical Corps, A. E. F. Ft A A' E' F' ZWMZ Z5 gg SCHROEDER, CARL, Lieutenant, Infantry. EUR ' 'HQJRACE Z5 42 29 SCHWARTZ, GEORGE M., 2nd Lieut., F. A., A. E. F. NHAM' ' 4? 24 f f - B H W l f 4 If Z? si SEEMAN JOHN Sergeant Hospital Corps A E F URN5' - A' n army' . 4 :Z 42 26 SELLS JVACKSOILIJ lst Sergeant Infantry BUTTERBAUGH' GRANT' Afmy Field Clerk- 22 YEZ SIMMONS JOSERHE lst Lieut Medical Corps A E F CAMPBELL' MEREDITH' Prlvate' Medmal Corps' ff 'EZ I , , ., ., ,... . ,I 5 Z2 EEFITATLEIEDRCIAEIRQILIMER Lieutenant CEQESE1-fxiIAE'l:'IEQiI allT'lagt' . I Zg gy ' ' - ' ARLSON, AVIDI ., n ustria gg Z? ZZ gal-'QEIIZEEEEQIATLCBN W., Zrid Lieutenant, A. E. F. CARPENTER, ELBERTY U- S' N' A E F ZZ 5 5 1 , - V fi 5 Zeng? STEARNS, I'lARRY,l lst Lieutenant, Infantry, A. E. F. EQEEQQA'fgg:ncfIi,?-FlgLEHI5gg?55P?:2i'pQnKingb ' ' ' Z Z STEELE W. S. Lieutenant, Infantry. ' . ' ' ' ' 5 ' Z Z 4 STEMBLER F L. Znd Lieutenant A E F CARTER' VINCENT, AVIQUOUA Z Z Z Z STWERS E RMMON Sergeant ' ' A ' EASSERLY, HEALNIRY Lnliiengtenant. QOIEI. C. A E F Z Z Z tg STOFFEI: ARTHUR Aviation I-IICKERINC, LFRED. ergeant, r nance, . . . Z Z X ' ' , ' . . if Z 2 STOLTZE, NORRIS S., lst Lieutenant, Infantry, A. E. F. CLANCY' JOHN F ' Qylamon 3 Z Z it? STONE C H lst Lieutenant Signal Corps A E F SLARKE' LQLE C'wleuEfl,?am' IW f 5 - 3 if 4 4 ,, ' ' . ' . ' ' '. ' LIFFORD, HAS. M., emica ar are ervice. 4 Z Z 3 STORER, WILLIS D., JR., Lieutenant, Artillery. Died of CLIFFORD WM. FQ, Sergeant' Hdqst, A- E F- g Z Z ,S Wounds? A L. . CONNELLY, ROBERT M., Aviation. 2 if Z Z TURTEVANT RANK . Ieutenant Infantry, Killed CONNOR, EDWINJ., Lieutenant' Infantry' Z 4 4 amon 00 9. 1918 Conoven, PIARVEY, znti Lieutenant, A. E. F. 4 4 Z EULUVAN' COLBERT' Llcutenant' Infantry' CONXVAY, CORNELIUS, Znd Lieut., Aviation, A. E. F. Z Z 2 TWENHOL5' CASPEE- A' Et FM d. l C CRANE, RAILLARD, lst Lieutenant, A. EF. Z Z 2 ALBOT' EORGE' ergfaam' 6 'Ca Orps' CROTHERS, WENDALL H., Private, Aviation. 4 Z Zymei TIFFT, THOMAS, 2nd Lieutenant, F, E. F. CuLNAN,JOHN, 2nd Lieutenant, Marine Corps, A. E. F., 4 Z Z5 Z TILLMAN, FRANK W., Lieutenant, Aviation. CUSICK, ED. TIMOTHY, Medical Corps, A. E. F. QZNUZZ Z, rg TORMEY, ALBERT, Lieutenant, Medical Corps, A. E. F. DAVY, GEORGE F, jg Ensign, U, S, N, 42 TREMBI-Y, JOHN MCC., Y. M. C. A.. France- Dieitens, I-I. F., 2nd Lieutenant, A, E. F. YJv?k1igCHLM6RVIQ:lI- ,Enslifnf U6 5- E F ku d , DISTELHOIRSTDFREDEAF-Znd Lieutenant, Infantry. 55 gZ Z5 ff . . ajor n an ry . . . I e In DOPKNSI , W A, , , 42 5 Z2 W actllgn Q-ut-X153 1918- DOXVNlNG, J., U. S. N. A 42 74 ARNER- t -1 - - F- DOWNS, FRANK EMMETT, Medical Corps. E 24 Z2 WEBER' GEO' M Ist Lifiutenamf Q- M- C-Y A- F- DUECKER, NV. W., 2nd Lieutenant, Infantry. A. E. F. 'f ZZ ZZ WEBSTER, W. B., Captain, Am. Red Cross, Russia. DUNN. CHARLES Bu Private, A, E, F, Z2 Z' gg WE5'-Et HERBERT WH EAGLES, LEON K., Sergeant. 12 ZZ Z4 gg WHEELER, CHAS. E., Sergeant, Infantry, A. E. F. EASTMAN, WALKER P., Ordnance. 22 WHITE, S. B., Lieutenant, Infantry. EDER, ABRAHAM J., Ass't. Paymaster, U. S. N. Zamgg WILDER, P. W., 2nd, Lieutenant. EDXVARDS, E. B., Captain, F. A. QLWZZ Z Z WILLIAMS, D. H., Lieutenant, Infantry. EDNVARDS, P. J., Cadet, Aviation. 3 Z Z Z WILLIAMS, ROBERT N., 2nd Lieutenant, A. E. F. ECBERT, P. S., Znd Lieutenant, Engineers. Z Z Z Z WILSON, A. V., lst Lieutenant, Infantry. ELDREO, GEORGE, A. E. F. g Z Z 'tg WILSON, HENRY M., 2nd Lieutenant, C. A. C., A. E. F. ELLIOTT, JAMES, lst Lieutenant, F. A., A. E. F. Z Z Z WVOLCOTT. OLIVER S., lst Lieutenant, Infantry. ELTON, MORRISON, lst Lieutenant. g Z Z ig WOLFF, ARTHUR C., Sergeant, Ordnance. ETTER, ARTHUR E. A 2 Z Z XWOOD, FREDERIEC, Lieutenant, F. A., A. E. F. EVANS, HAROLD B., Govt., Food Administration. 2 Z f 4 OUMANS, OHN ., emical arfare Service. FALSE, ROBERT N., Aviation. 4 Z Z ZII.L1sCH, SCAR C., Sergeant, A. E. F. FARDY, MARTINJ., Medical Corps, A. E. F. Z Z ZILLMAN- H- A-. Captain. Infantry- FELLOWS, H. E., Sergeant, Ordnance Dept., A. E l-. Z 4 4 7 f 4 -'4 4 4 4 4 '4 4 4 4 4 4 4 lf? 4 'k Z 4 '4 4 Z 4 4 4 4 4 4 -4 'Q 4 Z Q41411114ffwfffffff4444444444444144444044444114111444114fgzzjfgffgzgjzgzfggzffmfzgffgizzffflZgfgfffjzZZZZZZZZ,,flNI55554jjzzjffffffy 14,444,444,WM4,144,444,ffffffffmwfffffiff112 Z R U D oe N ui or N S N 111111 11 111111 X 4 1 1 ft X Zi' 1 Zi' 1 fi' 9 9 Zi Zi' X Zi' 1 1 fg Zz 42 Za fi if 12 12 fe 1 1 4 E 1 1 1 4 1 1 1 1 Z 1 1 2 4 4 1 1 1 1 , : 1 : s 1: 4 4 if 9 1 5 1 1 12 1 1 xx 5 5 5 1 1 1 'f' 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4 1 A . . , 11 1 11111 . - 1 1 I 1 1111111111111111111 1111111111111111111111111111111111111111111111111111111111111A 1111111111111111111 f-1111 Zi 1 .. S , SWS New ASN S 7 5. 1 4111! 'E t Q at -1111 xi' f 1 1 7 I PXVNVR FISHER, E. W., Zntl Lieutcnant, Coast Artillery. FITCH, JOSEPH, U. S, N. FLICKINGER, D, W., Ist Lieutenant, Infantry. A. E. F. 'FOxvLER, WVILLIAM. Died in Camp. FORDYCE, JOHN. FRAWLEY, JAMES R.. SR., Lieutenant, U, S, N. FREEMAN, WVARD B., 2nd Lieutenant, F. A. FULTON, ARTHUR D, GALEX', S. B. GEHRING, R. W., Znd Lieutenant. Infantry, A. E. F. GIESE, JOHN W., M, G. Brig., A. E. F. GITTINGS, LEROY, Lieutenant, M, G. Bn., A. E. F. GOLDIE, WM., Aviation. GOLLMAR, HERBERT, Industrial, GRANT, G. G., Lieutenant. GROVER, STEVEN F. HALL, FRED M., Lieutenant, Infantry. HAMISTER, VICTOR C., Government. HARDING, W. H., Hospital Corps, A. E. F. HARVEY, DOW, lst Lieutenant, F, A., A. E. F. HASS, IVIELVIN I-I., Marine Corps, HAVERSTICK, GEORGE W., Ist Lieutenant, F. A. HENRY, C. L., Engineers, A. E. F. HOEFLER, THEODORE A., Ensign, U. S. N. HOFFMAN, OTIS, Aviation. HOHMANN, JOHN S., Private, U. S. N. HOLWAY, ORLANDO G., Engineers. 'HOOK LEON B. Cadet Naval Aviation. Died on October I4 1918, HOUSTON, HAROLD H., Lieutenant, F. A. HUTCHINSON, EARL W., Znd Lt., Aviation, A. E. F. JACKSON, ARNOLD S., Private, Medical Corps. JAMES, RAYMOND H., Lieutenant, A. E. F. JAMESON, JAMES A. JAMIESON, ARTHUR, 2nd Lieutenant, F. A.. A. E. F. JENSEN, BEN, Ordnance. JOHNSON, A.J., Industrial. Chemist, JOHNSON, GEORGE A., Lieutenant. 'JoRDAN, JULIUS L, Died October, 1918. JORDAN, R, W., Ensign, U. S. N. JOSEPHSON, CLIFFORD I.. lst Lt., Aviation, A. E. F. KELLEY, K. N,, Aviation. KERNAN, THOS. H., 2nd Lieutenant, Engineers, A, E. F. KESSENICH, A. M. KILAND, INGOLF N., Lieutenant, U. S. N, KIMBALL, ARCHIE, Ordnance. KING, KENNETH, Lieutenant, Infantry. KINSEY, J. B., 2nd Lieutenant, Coast Artillery Corps KITCHEN, DOROTHY, Hospital Hut Service, A. E. F. KLAPP, GORDON, Lieutenant, F. A. KLOSER, MARTIN, Lieutenant, Sanitary Corps. KNUDSON, OSCAR. KRAEMER, EDW. C., Ist Lieutenant, Engineers, A. E, F, KRAUSE, EMIL F,, U. S. N. LANDRY, WALLACE. LANPHILL, J. B., Ist Lieutenant, F. A., A. E. F. LEGLER, FREDERICK M., Transport Section, A. E. F. LEWIS, CHAS. M., Ist Lieutenant, Engineers, A. E F. LIGHT, JOHN, Engineers, A. E, F. LINK, OTHMER, Yeoman, U. S. N. LINLY, ROBERT W. IJQFTUS, GEORGE E., Hospital Corps. MCCOY, FRANK A., Corporal, Marines, A. E. F, MOCUTCHIN, JOHN A., Ist Lt., Infantry, A. E. F. MOGILVARY, EATON, Ist Lieutenant, Aviation, A. E, F. MCHENRY, ALAN T., Aviation. MCHUGH, GLENN E., Lieutenant, MCINIES, EARL, Sergeant. MCKINNEY, JOHN V., Captain, F. A. MCMASTER, PAUL H., Private, Infantry. 'MACNISH, GEORGE C., 2nd Lieutenant, Infantry, A. E. F. Died July 2, 1918. MADSEN, A., Corporal, Infantry. 4 MAURER, C. N., Ist Lt., A. E. F. 'MAHRE, RONALD, U. S. N. Died September 26, 1918. MARGARIDA, JOSE, Captain, Infantry, MAXWELL, ARNOLD. MEAD, FERGUS, Corporal, Field Signal Batt. MELAND, N. B., Marines. MELNIKOW, HENRY P., Base Hospital, A. E, F. MERRILL, HENRY B., Private, Gas Service Lab., A. E, F. MEYERS, E. R., Ist Lieut., Infantry, A. E. F. MILLER, GILBERT A., Private, Signal Corps, A, E. F. MOON, HERBERTJ., Industrial. MORRELL, ROBERT K., Engineer, A. E. F. IVIORRIS, DAVID B., Aviatfcn. 1111111111111 11111111111111111111 RVLL MUELLER, B. C., F, A. MURPHY, RAY V., Lieutenant, Chem. Warfare Service NELSON, CONSTANCE, Chief Yeoman, U. S. N. NEUBERT, EMIL, U. S. N. NEUBERT AIILIIN K. INIENVTON, MERRITT H., Infantry. INIICI-IOLS, M. I-I., 2nd Lieutenant, A. E. F. NIEDERAUR, PHILIP, Ensign, U. S. N. NISS, I'IERMAN, Cavalry, A. E. F. NOBLE, 'IRI-IOMAS B., Medical Corps, B. E. F. INIORTI-I, REYNOLDS B., Sergeant, Field Artillery. O HARA, OSCAR, A. E. F. CWLSON, SIGRUD, Aviation, OLSON, WM. A., Sergeant, Signal Corps, A. E. F, OPSTEDAL, J. A., Ist Lieutenant, U. S. N. ORR, EDXVARD B., Marines. OQSFIEA, HARRIET, Government. OSTRANDER, IRALPI-I, Private, Infantry, A. E. F. PARFREY A. C. Radio School U. S. N, PARTLETT, RAYMOND C., Aviation. PAYTON, M. A., Lieutenant, Aviation, A. E. F. PEASE, FREDERICK J., Znd Lieutenant. PEASE, WVARREN J., Znd Lieutenant, F. A., A. E. F, 'PERRHQQALPI-I, Captain, Infantry. Died Nov. Z2 PETERSON, EvAN. PFEIFFER, REUBEN R., Lieutenant, A. E. F. PHELPS, RAY, Engineers, A, E. F. PI-IILLIP, HAROLD WM. F,, Lt., Infantry, A, E, F. POCKETT, L, C. PONTIUS, THONIAS T., Lieutenant, Infantry. PORTMAN, E. C., F. A. POTTER, H, I., 2nd Lieutenant, Infantry, A. E. F. PRADT, L. A., Lieutenant. PRATT, D. F., 2nd Lieutenant, Infantry. PRECOTT, INAITCI-IELL, Medical Corps. PROUTY, EVERETT, Lieutenant, Infantry, PRUSSING, A, W,, Field Artillery, A. E. F. PUFFER, RAYMOND K., Captain, PYKE, ROBERT, 2nd Lieutenant, Aviation. RAMSDELL, GLENN I,,, Lieutenant, RANK, GEORGE ROBINSON. RAU, HAROLD L., Lieutenant, A, E. F. REQUA, E. L., Field Artillery. RINGLING, MATTIE, Canteen Work, Y. M. C. A England. RITTER, L. S,, Lieutenant. ROADHOUSE, XVILBUR, Aviation. ROBERTSON, SCOTT L., Sergeant, Medical Corps. RODRIGUEZ, SUMNER, Private, F. A., A. E. F. ROOD, J. Q., Captain, A. E. F. RUDER, GEO. L., Captain, F. A., A. E, F. RUSCH, HERBERT, U. S, N. RUSSELL, SAMUEL W., Q. M. C. SADLER OMER T., Y. M. C. A., A. E. F. SALTER, R. C,, 2nd Lieutenant, Sanitary Corps. SCHAD, ALBERTJ., Private. ' SCHAFER, F, B., Lieutenant, A. E. F. SCHIERZ, E. R., Ist Lieutenant, Engineers. SCHINDLER, DONALD, Lieut., Engineers. SCHWEPPE, ALPREDJOHN, Government. SEYMOUR, S, LELAND, 2nd Lieutenant, Aviation. SHAPIRO, NATHAN, Ordnance, A. E. F. SHERMAN, JOHN KING, Aviation. SIMMONS, HORACE D., Corporal, A. E. F, SIMPSON, GEO. L., Captain, Infantry, A. E. F. SLABY, FRANK J., JR., lst Lieutenant, Infantry. SMITH, EARLE EUGENE, Aviation. SMITH, FRED S., Captain. SMITH, LYNWOOD I-1. SMITH, WINFIELD, SNYDER, JOHN, Sergear-t, Medical Corps. SPAYDE, K. C,, Engineers, A. E. F. SPENCER, CHARLES E., lst Lieutenant, F. A., A, E. F. SPOHN, DAN, Lieutenant, SPOONER, TRUMAN R., 2nd Lieutenant, A. E. F. STAVRUM, EDNVIN R., lst Lt., Infantry, A. E. F. STEIN, WM. H., Private. STEINBRENNER, H. P., Captain, Infantry. STEPHENS, GLENN W., Lieutenant. STEVENS, GERALD D,, Aviation. STEWART, BERNICE, Government. W STONE, RALPH. JISTORER, WILLIS D., Znd Lieutenant, F. A., A. E. F. Deceased. ' STORIS, ALBERT M., Aviation, 1 01111111111111111111111 111111111111111111111111111111111111111111111111111111 111111111111 1 1111111111111111111111111111111 11 111111111111111111 11111111 1 11111111111111111111 11111111111111111111111111111111111111111111111111111111 111 1 11 11111111 111111111111111111111111111111111111111111111 11 1 , ,,,.,,,, 'ff , ,1111111111111111111 11 11.1 1 5 1 5 1 111 3 1 f ' 5 5 7 911111111111111111111111111111111111111111111111111A 11111111111 . Q111111111111111111111111111111111111111 1 ' ' 1 1 1 w Page 363 f 1111111111111 l I u l I i I i 111111111111111111111111111111111111111111111111111111111111 11 ' - - muQQQ-QQ-QQQQQQQQQ-QQQQQQQ-ww Q ' QQQQQWMQ-Q-QQQQQQQQQQQ.QQQQQQQQQ-QQQQ-QQQQ-QQQWQ if 4' 'f' 14' lf' W 'F ' 'V 1' 'F Q -1' If W' If Q 74' 'W' 4' 1' 'V W' YQ SQQQQQQQQQQQQQQ-QQQQQQQQQvw.QuwQWN.QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQCQQQ-.QQQZQCCQCQZQQQQQQQCQQQCZQCZCGRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ2IllQ2212X121llllllllllI1122111113.3.Q11211lxQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSY E . Q Q Q Q Q Q QQ QQQ QQ - Q Q ii .555 5550555595555555555555555555555555555 5? 5 55555 5555555555 55555555-?l5'5'E'?E'r7????3,2 ? 5? 3 :U Wofomwu www: :1zUc:5'::::::mmo xx:--u Q- rf 0 Of 'Z 0HH-mm--w 2'xZZZZ'7'mmmr20H'42I'WxHm I Q N Q O' o '11-xmmiw ,.,,-33m S U- ,,,..4,,.w,,,O,,,m,.Z-Q IH I U1-,mfno :gx-4-mm,-vw, wm Fz5z'om,,g0n-Qwooffm w Q Q Q 51O7gm30 mzzw'5w3!'3'-4C-5'5 ZzU1' u-ZZOomf 2- 5:1 m fWQ.1.' v-zfrzmfrwf-1 oT,'l7UO3'f,,mw:-P'm-:,. 1O:mW1,2'-I ' Q Q jg mmcposvi...nq,,.,-,pZ!Z-lFZZ3,3,5m:'IZ- Uzxp -,U m-5-pvomoowibzgzbo-Em-omz-Ho5gc,f2p1EEo-sy, pm:-iw-EPT Sig Q ,,ow on-IwQ.,r-1102, - 2,1-momomrr--Z5 -2-my Z0m:I'5nwzwg.wCb3qforrf1Om,,w? zrg Z,-.gkjfy Q Q Oo H- -10 :Q- .CQ-O Likmv 21,-av QQ? I o-1 rn U1 mm --rn -7:- 4-eF?'w m- IFF'-.71,, L- -- U' Q Q 3 C53- CU: ml-:ml mo co:-IO -I Z- 1'-I o-'71 wil' Cm--'V WZW- I-L-' MI :Q 0- :U -P255 Zw or-O: QM' Qlnf Q Q YQ S'5m9'w 11'4 Z2zvvr'U9fFf'w::-Am'I'J'1 mmoic aim --aQ'3 Ufmzm R-' U12 7U 'FmmOz7Pm0:'kH z f 3'UU'-I,44 ' H232 '- HWY - Fwr m' U- z ' 0'Ca-m fmz mm O50 - w X'T11-'r1C- bn O W 7' W - ZPOU 'PWC L.o--mO:-Wm: 'rim Q Q Q -im I' 3--45, 2.44, 3,-IZ-3, wgw 2 m-471:-,,O1, - J-gs..O-sfcbm W,-u.,:' z rm-I .-no 2 ZwT,..41,, 73. Q Q Q AXIP 0 -cm' Q2-ms O:m'- 7' '4'-075250 HZ GOI wo '4 U-W2 I5 'E?1OI1vOC3w-47'--2l'U-In'- 'X'o Q 5 31-,, .ZCQ., r-z ..-3 Z ,aw F' 1- L71 -Omgm 3, xooz mfjm U 01-vlvm 75 Q00 ., J 'l Ng. - pu, 5 U Qfg S -N'-1 '- pl' m ' -ww Qs- 577 Www -IO Z - '-3. - '1vr U1-' 5- mm' 711: Cm :vUV' 5 lT1l 0O gu3I ' Egg!-'QP' J S' Q Q ' Dgwmgg- ?w3,.-KSPODU-5-3 I-3 rg: 5 53: DOME . . UUE, - ZLL LTIICWN-50 71. 90u:Om Uz:vCn- - Z: E-UU3,5-03 G-5' Z Q Q Q CQ,o.52:m'U,4EQ,O-05.39, wo.-..43,-DPI mm 5-5 0 P9,Ff'-- ,Of-.K-1 ::,, :1 7-1l:f3,' 51114:.wg ,U -:ICWQI crm N Q Q N ' --0.011 33-go S'-I 'N' 2 W' cbs- F1520 EQZQ6' o 'wEl5 V2 -- Qu' Z9-mpfvl ,O -xml-' Um: O., l m'V g-- f '5'.'4 3 Q 5 S MCU 'l f'4O7'l: FUBCE '55 -A Zn---fam. O' m 51'-S2 ' f' uv:-1 l-- C Z,,,7u-.l 'fv 3'--5' 30:2 ES: O. Q Q NW 'f'mE55 '-'z fQf'R'91 -Q -Nw 23n7?7'l'53N'A5 54U1 'A 1-' 53.-'UA E 5 50-'.f'fQ C3P3l'Z fvv'm E6 'm ?3SCo?:f 35'g CNHC 5 Q EQ ZE,nmffc'5'gU,I::5'gmSw: g-,gn -QUOQ34... :tIg.N-mg ' QD ws? -:Q rv ar.. g,g55-bg Q-Vf'-nE,C5E, .,.,n-- 5.2 f-fgg.-Q Q- Q S QS .4S.C'g'...,-- SCH? .22 QW SE-V 03:0-r9-5 -1,-, 3,,... '-,gg 50,12 IJ ,..F'2,-,Ummg 9,4-Tim,-,G-. l-ngii 4-Q...-. Q,f',,,: -- Aww gg '0'Q,f3:,c21f-1-invggxffg :x l :,?, .mOC3f5',,,l--130-Z-Uco -1 ,I 'Wm-- QQ 9' I-mggfbcv-3,:f-'O f-. :SWK-0 -img 'nw 9, 53 Q QQ f'nP:1'D.w5'3a.N'5mZ- ZW Km' 5 Ofvg-'5 5, l-U30 2 150-8 :1 3 r'CC :' OWS' H2I'49'25-f- !?::'1 'SVR :1??J :s ff ? 2525:-fifggafg 3 5.25 af-353 5 wif, gs 10 -555552 g 5,2-.:Z?fa,-5 E-'sfy' Swag, Emma 3 QQ : ff... .H ' U7--3 go -1 :s. ' : Q cf' -- on fu- H ::A,.. ' :my 5-1 -of-f my 515 P-fiihia ma 559 552255 532: 12?-52 S T5 552327125 Ln :Snap-E-0 255. 5,2712 ?' jQQQQ is ' -53,-1 m':T'VVE,E,,LT'O '93 nag- 5' Q51 P, Om' 'S l :pm W S - O: ' I :bww ' F-N' gn-IQ, 5102 - 511 5' QQ W 515' -QTSHNDE F03 'f-Q svoffarm' - -Q -- C D 0 E?b?P:m2- DQ -r1DQff-- 55' 0 ? 24' QSQQ -n sw 112,235.32 ga P-Sp: Q 25771 0:5 9 V1 F1712 P 2 Smm MS ' 55, Q75 MP WS 51 Q, QQ ' W' www --' ml GQ :Q 5 MQ -n J. U 0 - ' F, :Q 3, 'nm' - QQQQ QQ - Q4 - . 1435, Q 9 . 'Tl - fn rv an . P - 'U W QQ Q Q Q frj , ja -1 3 - 5 .,, 0 . N m Q 'TJ'-1-1 m U1 AO- -- 1 -1 gg gb. .yy m 3 FD m 5 5 -, , 51 ... Q4 Q4 . . , 'Tl -- 4 M4 U1 'Fl mm 3325555 'Z OW Zig 'M 3 5 TF Q Q0 h EY - .. - ' 9 IT1 . C m IT1 G 0 'Tl E5 , '11 Q -1 . , Q , S. 3 QA - ., ,S O F 71' vw Q' 8 F1 12 sn Q 11 3 3 V 5 NN - Q QQ IQ QQ QQ EQ 3332? UUUUUOnOmoononononnoomomonnomoomnmomoonmmmomfuwcuuncommonon co zzzzziszzszaesaaaaassessszsissizaazsszaza22X222asss5252525235?5??55?5????555????5i55?5?5Q V ----- -1ZZZ0 X'vZz1ozf4I r-C72:v7v7vl'wmZ mmmxw rn 4xf Q-U, ff, 0 -am rn .. Q mmmjlizz mmm! -- M U 5-4,0 ig zu-aw: 4zZzxxH 304 foo:-Ohwzzzoomf-E .gmc-g n-n 1- QQ ---mm--m5 Um1,, ,U m4Zf-z2-?Ff?Qm! f'Um- Zm 0:40,-gwmmimxrmmmmQz,P1ZEZxxo,,,:v:zuo5'7,202--mmggpxog 0 if 7UOl1'1O?'ZZw F75'C7'E54 T '5 -az QJT' ' 5 'Z FU-'Oz Z:m 17 wr'2'PH 'f-- 'f !'1 1-0 'mF 'I2 'bW'UjI3v2zF'm Sfmw? QQ 0542 Qgmir Z ' -75 m m07: mi-Z mm lm 5 ,,Cj-.I-1-74-r ZZ3W ' S O 7 Z '- 'av-Num, U7'n 5-' 'nr-3 :Q - 00,051 7U U---Q5-f--Zwmggxg 7, mo r-Q-L' Z1 '11 l IIZUo1mo.Im - :xp Cmm-a-ammormo N QQ 452712 Q- I-Pwvgmnw gg -LP? xo0.7U.--io PU P momr-iabmcm .-5052 Z 05 -'zgmm---ozw-0 Q Q Z77OUICy7Um' PW C,-, C2 UZZfT, Ul gpQ g' 04- I'k'L'3'CmUf7? 4:-Dv -47'F1oWrn ' r114O 'QEm Q: Wpq :Q Zn,-fC Q :Q 175 O-,mg-mmpmmxmfrr 1. U15 :gr O Cgw,-. WP -00UUOp 'U71Zm7O Em7of'j:EfU,-'-'2S',7,3,0I I , :FI-P S- -.'-'-4 Q QQ 'O7jml--wz'om-vifvfffz- -I' 52 Fgp- mmffib wm?'0F'I 1021222171 m-4-wmi rw: 3'-1'3:,U' rm P M- bm' 'U O' 'N Q SQ U73'U1,gmpfj-ZZm 'Z'N?V l'1'? 'UJ jjwmyp' F- --.ml ' gzmmypro- Z- 'UW' E77UFf17'O7, Z ,.3gf0l-'FZ OTIW3' S CUFF qxxi QQ m'4W'O'z-- no7 'f?0 :AQ 12114-O- 5'X' 2UU'r1g-ZQQNF' J Q-wr-'-4 335:11 -IFf mUT14wU7U7'7J-CESUfQIwW0ZZZ',S1 -- -QQQQ is EIZAOZZU MZQWF QU- ...Q-O35'l 3qW?,--J C J 00:10, UU' J gbmzi' 9Z:'I1 mml 0-5 m3'I-mm'0QOm XX -0 OU. U53 .' w-fs-'Qu.N---mg-Z Fm qqQ,0 Ig'pj 'farm '3'.U--PU mg Q QPF' JE' 'Uzuwof-'M gc 0,555 -I P1 HP5' E' Q f,,gC3w3',3Q3,N3?g5EmgK.- 8 gh Fgr- Xazigag- : 3922- 5- Q5 Zm17,E'QOgSP1,Em 5- 52- 5 fi 2' '53 IFSO 32,02 252 Egg- 'S.'1vg-3f eE,EQ:o'3S355- '9.:1UO-54'L.g5'S' :Er D-'Co ZFQ ng 27c:r'5'S 323: ,QOQQSEJ KFEZB Q ' ' ' -. ' ' . G mf' '-A ,, : o nw- .4 sm' '-' nu.-V: is - are :Epox ml-' V' H8- ' 2'-'cnwfzxmzzwl-UE Q33 C F94l iW C0- sm ECCOFGOO ' -O--,rQ.- CT' no--' w Ogg nw ff Q -v -' 3,1-v :Om ,mn O- In f-:wk-wfrj :mmf-f --m,..G,or-f 5 mon.,-.C -1 Fm NO- Q 3 ,,-15 U,-fl C O..--. ,AS g wQ'Em mE 2. 9,13 :CILZ E,3O5'm g:3f m-350 Qnmm Eg:-' f-1 :gn m O'gNNR':sl ---32097 C-:QU-ng ' SLNQ9 N Y Q H f 5g-r1rv'f' UQ: N 3'W ,-gm. L-'mJ 5'3:Of-vw 3T'F'5 923- mg' - f-ff-f:: 'lc05 5-7gnn'04-1'E,g4' V1 0' I-'g55Z r1 Q X Q - 6'f',:5' rw f' HJQE. :nf --:s,.1-f'3fw5'Zf, 'gi 9, 05205: fQ:w5f,f'3m3f1Clf'MnvL--Uw,4w3 Fnvwawggn---902, Q Q Q O gs H3 Q10 'q- mm 'Ewa f:?,UD5m- 5., -UIT7-3:-I Opf-f 5 5 Dug?-rr Wm,-, 9'5 --.'g 5gg,':rv:,'O2 an Q Q 5 712' EQ vga, 32 32551 5555-5' H 2123551252 S. E?-Tggf'?-w5E22,mQE' -3gZf' f'S'5'afF:gfQl Egg E, Q Q ' --5, 5' 3 .l -Q 5-'-W - D Q ' ' x: 4w 1fJ '-'.' rv I-'G Q. xl-Q E 5 9' PS: -211 1355? ZZUWSQ iv E053 F3 S 05,5j42'?P1E-gaf'g'aF1H Em 25 SFR-35: 5 Q ' -... . --.. rr V rf 5' ,O -- g :x '. ' , yr in g :z X 8 uf E? O wp, Pg? Q -53,2 Q E3 ?- QS. 25 m ?P?.S!'?QS:',T '0'MEL 9 ab 23, 5' -C:,'Ll3x P Q ' 2' P fn iii?-3 521' 5, F P12 Sv 5 -QQUEE' -3332 5 in Q P3 9402951-2 rw QYQ Q g, 0 ' --.rr1sf- Zb- Oy- 2 Q 5'-1. 3,g4 '-- ' mam:- Q x 2 9' W 5 0215 m QQ 3, 5 5 il 'f'1?'ZF 5555- ffl 1 A1 5239 F1 Q ' - 413, ' Q . -' , '1-H-4-1411: ..,-3.3 - Q4 ' Q 5 P' .211 W ' m m m mfr, -wmsem 1 ' gf, z 'Q 2' 7 ' ' ' 71- 'QW Q E Q Q Q P1 P1 1 vw P1 F1 F1 ex X Q S 'Q Q Q S :Q 1 'P 4 1' 1+ 1+ W 1' 'P W ' 4' 4 'F 'F ,X ll if 'U' - 4' SX Q Q Q Q Q Q Q Q Q N Q Q S. Q Q Q X XS QQ QQ QQ QQ QQ gl XX QQ Qi X XQ QQ Qi is QE QQ NS QQ SQ Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q SQ I Page 364 fllfflflllllfffllfh 4 Z Zi' 4 4 Zi 4 f Zi' gi' ? 4 1 5 5 7 4 WX 7 g. xxxxxxxxxxxxxxxxxxxxxxxxxnwsxxxxs it ir t t t Z afnuunlulllf 'I R 4 uf444114444441444444144144444444444444fffmffwfffwfffzfffd DEYHLER, R. W., Znd Lieutenant, Signal Corps, A. E. F. DENPIELD, GEO. AUGUST. DEYLITZ, PAUL L.. Captain. DICKEY. DEAN R. COULD, STEPHEN G., Znd Lieutenant, Cavalry. GOWER, ARTHUR WM., lst Lieutenant, F. A. GRANT, EUGENE L., Seaman, 2nd Class, U. S. N. GRANT, RALPH A., Captain, C, A. C., A. E. F. 5 DIETZ, EUGENE F. GRAPER, LESLIE G., Industrial. 5 2 'DOCKEN, CLARENCE O., Sergeant, Q. M, C. Died in GRATTELO, H. E,, Private, Cavalry. Zig France, Feb. 10, 1918 from spinal meningitis. GREGSON, WM. FULLER, Znd Lieutenant, F. A., A. E. F Q 2 DODGE, CHESTER C., Private, Radio. GREUNKE, E. A., Lieutenant, A. E. F. Z g 'DOHERTY JOHN A. Lieutenant Infantry. Killed in GRIEM, ROLF, Aviation, gym Z action July 20 1918. CRIMM, J. EDWARD, Znd Lieutenant, Aviation. Z, 2 DONNELLY, JAMES STUART, Private. GRUBB, WALTER F., Aviation. ji Q DORSEY. LYDIA LOUISE, Government. , GUNDERSON, BORGE CARL. g DREW, FLOYD R., GUNDERSON, NELLIE MAY, Government. QE 2 DROTHING, HENRY O., lst Sergeant, F. A,, A. E. F. HABHEGCER, ELMER O., Medical Corps, A. E. F, Q, g DUFFIN, LAUREL, lst Lieutenant, Infantry, A. E, F. HAES, GUY S., Infantry g BOXVNING, JOI-E1 F., Ewsign, U. S. N. SAGEN, Zlnldllsieutenant, Ordnance. fi 4 UDDLESTON, ENJ. ARRISON. AGOART, M. , , 2 EASSON, SANFORD, Sergeant, A. E. F. HACOPIAN BEDROS, Govt. Airplane Inspector. Z7 2 EATON, STARR, Captain, Infantry, A. E. F., Killed in HAI-IN, EMANUEL, Lieutenant, Aviation. QE Z action on Sept, 15, 1918, HALLOCK, NEIL, lst Lieutenant, Infantry. A. E. F Z2 2 IEBBEET, GEORCKA, Government. IIZIIALLS, J. Eg 2nd Lieuiinzgntlqlnfantry, A. E, F. fi 4 BY, AMUEL, viation. AMILTON, RADFORD ,... Z2 2 EDLER, R. C., Aviation, A, E. F. HANSBERRY, JAS.-H. Z2 3 EDWARDS, EUOENE F., Private, Field Signal Corps. HANSON, JULIUS 1'., Private, Signal Corps, 5 'ff' Z EDNVARDS, THEODORE. HARBACH, RALPH A. Z 2 EGSTAD, I'IERMAN M., Sergeant, Q. M. C., A. E. F. HARDY, JAMES E., 2nd Lieutenant, F. A., A. E. F. 5 2 EICHORN, HARRY LOUIS, Industrial. HARPER, BENJ. L., lst Lieutenant, Marines. Zig ELLIS, ROBERT C., Aviation. HARRINCTON, RICHARD, 2nd Lieutenant, Infantry. Z Z ELLISON,.E. C., Lieutenant, Aviation, HARTUNC, RAYMOND C., Ensign, U. S. N, Z ,tg ENDRES, OTTOJ., Captain, Infantry. l'IANVKINS, ESKIE TI-IEODORE. A Q g ENGLEHART VICTOR, Captain. HAY, DONAI.D L., Ensign, U, S. N. gh 5 ENGELKE, LEROYJ. HAY, ELLSXVORT1-I, Sergeant, Infantry, A. E. F. 5 Z ERNST, N. C., Aviation. HAYDEN, ROBERT M., Znd Lieutenant, lnfntry. Z 2 ERWIN, GRANT WEST. HAYES, ARTHUR MICHAEL, ESSON, VICTOR EMANUEL. HAYES, CHARLES, lst Lieutenant, F. A,, A. E. F. Z- g ETTER, R. R., Sergeant, Chemical Warfare Service. HEIDER, FREDERICK ALONZO. 5 2 EVANS, W., Lieutenant, Artillery. HEIMERL, W. A., Corporal. Q 2 EYERS, WILLIAM, JR., Engineers. HELMER, OHN H,, 2nd Lieutenant, Infantry. Z 2 FALGE, RAY L., Sergeant, Engineers, A. E. F. HELMLE, M. C., Field Artillery. ,Q FANTA, ERXVIN K., Lieutenant, Infantry, A, E. F. HENDERSON, BURNE O., lst Lieutenant, C. A., A. E. F gg 2 FARLEY, DONALD, 2nd Lieutenant, Aviation, A. E. F. HENDRICKS, W. C., Lieutenant, Infantry. Z2 2 IQARLET, JJL., Zigi Iiiegtlelnant, ILnIfaIEI1try.G B EEVENER, JE K., QSM. C. O d ,g ,g ARRAND ACK . n ieut. ac ine un n. EYMANN DGAR, ergeant r nance. FEENEY, JEROME-J., lst Lieutenant. F. A. HICKEY, JAMES SHERIDAN. gg 2 FELLMAN, J, K., 2nd Lieutenant, F. A., A. E. F. HIOEIE, I-I. G. Q, 'Z FELTON, I-IILEERT O., Lieutenant, Infantry, A. E. F. HIOSON, FRANCIS D., 2nd Lieutenant. Z, 22 FIEDLER, A. C., Lieutenant, F. A. HILBERT, OSCAR F. jg FIELD, HARRY W., Sergeant, Machine Gun Battalion. HILDRETH, R. P., Captain, Infantry, A. E, F. Z+wAg FISHER, ROY F., Sergeant, Medical Corps. HILL, EDGAR R.,.EnSign, U. S. N. 7 2 FISHER, CARL V., Corporal, Infantry. HILL, GEORGE O NEILL. Z Z FOsGATE,,FRANK P., Infantry. HILTON, EARL, Steam Engineering Dept., U. S. N. Qi? FOSTER, CARLTON H., Sergeant, Engineers, A. E. F. 1-IODGSON, ALBERT LEE. Z 2 FOWLER, DWIGHT S., Private, Engineers, A, E. F. HODGSON, H. E. Q 2 Fox, OSMON, U. S. N. HOMANN, FREDERICK A., Ensign, Navy. Z 2 FRATT, CHARLES D., Aviation. 'HOOK, LEON BECK, Aviation. Died at Seattle, Wash. 5, 2 FRANCES, HUGH H,, lst Lieutenant, A. E. F., France. Oct. 14, 1918 of pneumonia. Z i Z FRAZIER, CECIL AUSTIN. HOPKINS, EDJ., Aviation. 3 g FRAzIER, WM. C., Sergeant, Infantry, A. E. F. HOPPE, ALFRED G., Znd Lt., M. G. Bn., A. E. F. gf 2 FREEMAN, CHAS. M., Znd Lieut., Aviation, A. E. F. I-IOPPERT, ARNOLD H. Q 5 FREUND, WALTER E., U. S. N. HOIST, EDWARD GUSTAV. Z Q FRIED, D. G. I-IORTON, RAY, Infantry. 5 2 FRIEDBERG, JOSEPH, U. S, N. I-IOSER, HAROLD J., P. O, Z7 g FULLER GEO. lvl., WIS. State Council of Defense. HOUGAN, O, A., Ordnance. gg Z CEALBRAEJTH, VICTER ld A H IHIOUGHLA-ND, CLI? SANEOPiDd I - fi '4 ARD, I-IARLES ., ie rti ery. . OVDE, AROLD RTHUR, n ustria . Z2 'Z GARDNER, MILTON LEROY, Sergeant, A. E. F, HUGHES, DANIEL PATRICK. Z2 si GARIBALDI, FRANCIS, 2nd Lieutenant, Q. M. C., A. E. F. I-IUGHES, F. L., Znd Lieutenant, Infantry. 42 GARNER, LLOYD M., Captain, F. A., A. E. F, HUGHES, FRED P., 2nd Lieutenant, Infantry, EARRICAJN, GEIOIRGE A.,2Lg:titenant, Infaxtry,-A. E. F. EUOHESGIVM. R.iXZndELieutenanR Orrdfgiance. fs 79 EISSE, or-IN ARLIN, n Ieutenant, viation. USSEY, OSEPH ., ngineers, . S. . 'Z GETZLOE, LESTER C., Private, Medical Corps, A. E. F. IRISH, FOSTER W., Infantry, A. E. F, Zi ,Q SEVERS, CE-.RL, gaptain, A. E. F., Russia. EACKSONWJJKMES AFJR., Medical Reserve. 42 2 ILBERT, HAS. . ACOEIE, ALTER . fi 42 GILL C. A. , Infantry. JANSKY, CYRIL MOREAU, Government. Z2 22 GILL T. A., Engineers. JEHLE, CARL W,, Ordnance Inspector, U. S. N. gIlLMAN,gARL, I-geld Artillery. JENISOIGJ IVl65RG.itcRlig', Assistant Egitcgr, Wogneds Div 4 LEICK, ARRY AMUEL. ,ar or , ommittee on u lic n ormation. Z 2 GLoOER, WM. H., Government. Died of pneumonia JENKINS, GEORGE. U ' Z . 2 at Washington, D. C., October 2, 1918, JENKINS, JAMES W., Field Artillery. Z 'ig GOCKEL, ARTHUR P., Znd Lieutenant, Infantry, A, E: F. JENKINS, L. N,, 2nd Lieutenant, Ordnance. Z 2 EODPRIEEY, ALERXIQJ IUAVQREGICE, lst Lieutenant. XJENKINS, L., Znjl Lietatfant, F. A,,FAAE,E.E F f 4 OFF, AROLD ., . . . ENNETT, DWARD ., n Ieutenant, . ., . . . Z Ik? GOLDAMMER, CHAS. J., Ensign, U. S. N. JEWETT, CHAS. 4 F ' 9 if GOOD, SAMUEL P., Sergeant, Ordnance. JOHNSON, ALBERT S., 2nd Lieutenant, Infantry. Z g GQODING, L. E.,-Infantry. JOHNSON, C. A., Infantry. I Z COULD, E. F., Lieutenant, F. A., A. E. F. JOHNSON, CHAS. FRED, JR., lst Lieutenant, A. E. F. 4 4 ' ' Z 'W 4 Z K 4 1 4 2 i Z Qflffxffxxff 111fizlffxlfxixfl2211111111113714711111411411111111141111414ffffgfffffzffffgfgjjjgffffgfgfzfxfjjifgffjjf111441ffffffffnffffffff14144144411111111111rf1111144114ffff11y1411uffffffffffffffffffzff . ,., ,,,,,,,,,,,,,,,,,,,,,,,,,,,.,,, ,,,,,,,,,, 4 I 5 I ,, ,,,,,,,,,,,,,,,,,,,,,,,,,,, , ,, ,Z 4 I I 'i ,.... .... ui fr Rr A S+ If W X 1 Page 365 ' W ,t 1 A f Af it , funfnfznffzuffr 41111ffl11111111111I1111lfllflflnfflnlrfzffl0111011114111 15.1 E 'fffff ff fffffe ' i i n w f it t 4 f- -t 4 I! ,1,m,,,,,,,,,,,,f. ww, mama uv' I 4 ,t t t i ,t , L'.'I ,,,,,,,,,,,,,,,,,,,. Wffffffffffffff I-,ffl Z . . Zi ywffffffffWfffw,,,f,,f,,f,,f,,,,,,f,,,,,m,,,,ff,,,,,,fA t ' t' ,,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,f,,f,, -A eww,,,Mm,,,my,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, f Z f A f INVNVA RVL L if 7 4 7 7 vw nk 7 2 2 7 4 4 7 it f ft 4 4 4 gt f JOHNSON, C. G. MENCEL, J. T., St Lieutenant, A. E. F. 2 7 JOHNSON, RALPH, Ambulance Service, A. E. F. MERRILL, JOHN ., ieutenant, n antry. ,fi Z JOHNSON, ROBERT C., Zncl Lt., Engineers, A. E. F. XIVIERRILI., JOI-IN F.,, Ist Lieutenant, Aviation, A. E. F. ,, Q 7 f JOHNSON, WM., Coast Artillery Corps. Killed In action. gi 7 OHNSON, W. S., Heav Coast Artillery. MIDDLETON, FOREST C., Seaman, U. S. S. Kansas. 3 4 Y , . , ft, JOHNSTON, CI-IAS. F., Ist Lieutenant, Infantry, A. E. F. MIELENZ, H. F., Q. M. C., Coast Artillery. gt Z JOLLEY, ALBERT R., Sergeark O. M. CK H d S 13 MILLARDDPAUL Sergeang d L. I f 3 4 I' ONES EUGENE B., Lieut., viation. i e ept. ILLER, AVID ECKWITH, n Ieutenant, n antry. 4 Z J 1918. MILLER, EDMUND, Government. Z Z, JONES, E. MORRIS, Signal Corps Inspector. MILLER, GEO. E. h gin, 7? JONES, VICTOR, Znd Class Seaman, U. S. N. MILLER, GI-ENN H-, Medical Corps. gg Zi JUDELL, MAXON F.. 2nd Lieutenant, Infantry. MILLER. IVAN. Avlatlon. 72 KAFFENBERGER, LEONARD L., Infantry. MILLS, J. A-. JR-. Ensign, U- 5. N- 72 X 1 - - - - I Z5 KAUFFMAN, CLARK E-I U- 5, N- RMITCHELL, JOHE1 L., llstchfuteriant, Aviation. Killed 7? KEELEY, CLARENCE A., Lieutenant In action une , , . In rance. 72 WKELTY, ASHER E., lst Lieutenant, Aviation, A. E. F. MILL, ARTE1-IUR Mqlvletllical Ccgps. 72 Killed, Sept. 26, I9l8. ONSER, DWARD ., aster ngineer. 42 KELLEY, KENNETH M., Lieutenant, Pilot U. S. Air MONTOOMERY, F. H., Base Hospital. 75 Service, MOON, Jos. N., Sanitary Corps. Z2 Z2 KENNEY, EDWARD L., Industrial. MOORE, 5-TEX? WMA. lllgdulitfial, F A A E F 72 KIDDER, VELOS B., Aviation. MOORE, . ILLARD .. ieurenant. . .. - - . 42 Z2 KITZMAN, WALTER L., Lieutenant. MORGAN, GLEN, U- 5- N. KLETZIEN, ADON15, Sergeant, Ordnance. MORRIS, FRANCIS J., Infantry. A 2? 75 KLETZIEN LOYAL H., 2nd Lt., Aviation A. E. F. MORTON, CHARLES DELOS, Ist Lieutenant, Infantry. gg Zim, KLONTZ, VERNON EARLM E 1xMiOSHER, JA BE Llgutenant, A. E. F. ZW' 7 KNICKERBOCKER, JUDD ., ngineers. URPHY, . ., avy. I 4 Z KNOCKE, LOUIS THIELMANN, Industrial. 'MURPHY, WALTER, Lieutenant, Infantry. Died 2 7 KNORR, ARTHUR H., Private, Infantry. Oct. 31, 1918. - I 3 i Z 2 KNOTT, ARTHUR W., lst Lieutenant, Infantry. NACHTRAE, LAWRENCEJ., Aviation. 5 7 2 KNOTT, RICHARD FRANCIS, 2nd Lieutenant. NAPIECINSKA, PETER A., Ist Lieut., Infantry, A. E. F. 2 Z KROHN, VICTOR, Lieutenant, A. E. F. NELSON, BYRON C., A. E. F, g 7 LADE, A. W., U. S. N. NELSON, LESLIE V., Industrial. ' Z Z LAMPERT, WILBUR. NELSON, T. C., lst Lieutenant, Sanitary Corps. g i 7 LANE, RICHARD K., Ist Lieutenant, Ordnance. NETHERCUT, DONALD W. 5 Z LANCE, ALEXANDER D., lst Lieutenant, F. A., A. E. F. NEUNENSCHWANDER, ADOLPH, Infantry. g ii 2. LANGHOFF, CARLJ., Znd Lieutenant, Infantry, A. E. F. NEVIN, WM. A., Private. g . Z LARKIN, BERT, Lieutenant. NEWTON, LOUIS C., Ist Lieutenant, F. A. 3 Z LATIMER, ARTHUR G., Lieutenant, U. S. N. NICHOLS, W. C., Social, M. C. A. g 7? LAUGHLIN, JOHN L., Zncl Lieutenant, Infantry. NIEMIND, ALFRED R., Private, Infantry. 34,0 ZZ LANV, VINCENT O.,Eanadian Royal Aviation Corps. NIKON, EARL K., Igdustriial. 4? LEROUSRY, CHAS. . OELE, ARRISON ., n antry. n 42 Z2 LEDERER, CARL S., Sergeant, Ordnance. NORDMEYER, CARL SORIES, Industrial. Z2 LEONARD, LOWELL A., Znd Lieutenant, Infantry. QOELTINGI5 WFALEER WM. S I C 45 LESTER, WM. P. ORTON, . ., ergeant, igna orps. ,g 72 LEVEN, MAURICE, Q. M. C. NUZUM, RALPH, Lieutenant, F. A. Z2 LEVIS, GEORGE, Lieutenant. OAKEY, WARREN, Zncl Lieutenant. LEWIS, RAYMOND B., 2nd Lieutenant, A. E. O'CONNOR, Clarence W. - gg gg 'LEXVIS STEPHENSON, Lieutenant, F. A. Killed near OESTRICH, CARL R., Sergeant, Q. M. C. gig, Verdun Oct. 31 1918. OCDEN, DANA P. - ggm, Z LIMBERG, LELANDJ., Engineers, A. E. F. OLSEN, HENRY J., Medical Corps. g 7 LINDBERG, G. H., lst Lieut., Infantry, A. E. F. OLSON, HAROLD C., Lieutenant. Q Z ig LIVINGSTON, EDXVARD M., Medical Corps. OLSON, WALTER. A h 3 Z 4 LOESCHER, CLARENCE A., Znd Lieutenant, Infantry. PALMER, ELBRLDCIIE AvIat8nSANE. F. 2 i f LOOMIS, ORLANDO S., Q. M. C-. PAMPERIN, A. ., nsign, . . . 5 7 LORD OHN B., Znd Lieutenant, F. A., A. E. F. ' PANCOAST, WM. 2 7 I , . . . , Q LOVE, JAS., Lieutenant, Infantry. PARSON, LEONARD B., Private, Aviation. g - 7 LUCE, ROSCOE R., Sergeant. PATTERISON, L. L., Musician, A. E. F. g at Z LUDDEN, HOMER J., 2nd Lieutenant, F. A., A. E. F. PATTISON, LESTER L., Infantry. Z Q it 4 LUEBBEN, GERALD A., Lieutenant, Infantry. ' - PAUL PARRY H., Industrial. 3 Z LEUTSCHER, HAROLD N., Sgt., Base Hospital, A. E. F. PAULSON, WALTER P. A gi Q MACARTHUR, HUCH, Aviation. PAYTON, JAMES M. Ist Lt., Signal Corps, A. E. F g Z MAEINNIS, EARL C., Corporal, Infantry. gEARCE, RUB., Eggineers, A: F. Z fm, MC ANN, RAY F. EDERSON, OHN n ustria . 5 gf MCCOY, LESLIE L., Medical Corps. Y PETERS, HENRY, Aviation. QAM, gi MCCRORY, RAYMOND JOHN, Y. M. C. A. War Work. PETERSON, ROGER F.,'Infantry. 72 MCDOWELL, L. B., Znd Lieutenant. PIEHL, CUNARD A., Lieutenant, Ordnance. pg 4, . ,, gg MACFADDEN, W. S., Sergeant, Ordnance. PINNEY, ARTHLQRJ., ESXIBYIDGS. gg fi MCGOWAN, MURRAY. ' POE, HARLES OY, overnment. . fg MCHUOH, KEITH S., Ist Lieutenant, Ordnance. POPE, CHARLES Base Hospital Unit. 72 MCMULLEN, CLEVE A., Sergeant, Ordnance. PORS, WM. E., Lieutenant, Infantry, A. E. -F: 25 Z2 MCNEIL, JOHN E. PORTER, RAYMOND E., 2nd Lieutanant, Aviation. 35 Z2 MACHLIS, JOSEPH ARTHUR, Corporal. ,I POTTINGER, CLARENCE Ah., S. N. gg MACKENZIE, J. N., Znd Lieutenant, Aviation. - POWERS, MARTIN A., Aviation. gg MACOUN, CHARLESI-ONrMOORE, Lieutenant, Infantry. PRANCE, ELMER W., lst Lieutenant, Ordnance. gg MAHLER, H. P., Zncl Lieutenant, Aviation. XPRIDDY, WELBORN S.-, Lieutenant, Infantry, A. E. F. 55 72 , MALLOW, RAYMOND S., Lieutenant, Infantry. Died of Gas Poisoning IH France, May 29, 1918. gg f ,.,,,f 1 , , 1 vm! 4 ' MANDEL, HERBERT W., lst Lieutenant, Infantry. PRITCHARD, OWEN J., Industrial. . 4 f . . . , 7 MANECOLD, JOHN R., Lieutenant, Signal Corps. PROCHASI-QA, J. F., Private, Field Signal Battalion. Z 9 MARSH, CARLJ., Fedei'al'Trade Commission. PUETZ, HAROLD, Engineers. gb Z MARSHALL, HARRY L., U. S. N. QUAIL, JOHN J., F. A. gi 5 MARTIN, AUGUST H. I QUICK, V. H., Infantry. D g 7 MARTIN, BYRON HAROLD, Lieutenant, F. A. RAMSEY, RALPH EDWIN, Captain, Infantry, A. E. F. 5 7 - ' f Q MARTIN ROSS C., Y. M. C. A. Secretary. RANISDELL, BAILEY E., Lieutenant, Aviation. 4 2. 7 MASSEE, RICHARD D., Reg. Sergeant-Major, Engineers. REESE, GORDON B., Lieutenant, Archangel, Russia. 3 Z lk MATI-IEWS, AUSTIN R., Ensign. REICHERT, JOHN W., 2nd Lieutenant, Infantry, A. E. F. Q MENDELSSOHN, ISADOR W., Sanitary Corps. REINHARDT, JOSEPH A., Government. 2 5 it 7 Z A ek 7 2 2 R , Z iiwifffifffifffgfffgffgffffffffffffffffffffffffffffffffffnffffff ,nf 1111111111fffnfffffffnfffffffffffffffuff ffffffff ffuffff aff ffffffnffffnfffffffffffzffifffifffgfffifq f . . , g ,,,,,,,,,,,,,,,, ,,,, 3 Z ,,,,,, N25 2 i 7 I 1 I 2, is if 4 Q A I 1 I Page 366 WR c .. If!! is Q 5 X 5 5 5 51 52 52 52 js 52 5: yi 52 52 xxxxxx 3 s 1 1 s s 1 1 s 1 1 1 , txt 1 111 1 5 -A-A xxx X xxxxxxxxxxxxxxxxxxxxxxxxxxxNxxxxx xxx 2 s s 1 1 1 1 1 1 1 1 1 sxx xxxxxx xxx ' 1 5 1 11 Z: 5 5: Z2 1? 52 1 Z . i gxvxxxtws xx N 'TJ n Ou N ,U . ox xi 1 Z1 1 5 52 5 5 5 5 5 1 . 1 5 5 5 1 1 1 7 1 1 5 5 1 1 W' 1111 111111111111 ir 'A' 'I ik 'A' if if 5 :111i1:21ii1::i21'i f 1 5 1 1 111111 0111 71111 5 1 1 5 5 5 1 I FXVNVR ROBERTS, MORGAN E., Lieutenant, Engineers. ROBINSON, ARTHUR H., lst Lieut., Infantry, A. E. F. ROBINSON, GEORGE. RODGERS, CLARENCE, Aviation, A. E. F. ROM, ROY GEO., 2nd Lieutenant, Infantry. ROSENHEIMER, M. W., 2nd Lieutenant, Infantry. ROSS, BILLY E., Radio, A. E. F. ROTHWELL, PAUL T., lst Lieutenant, Infantry. ROUTT, D., F. A., A. E. F. RUDE, THEODORE A., Industrial. RUEDEBUSCH, KURT C., Ser eant, A. E. F. SALSMAN, THOMAS J., U. S. SANBORN, PHILLIP G.. Aviation. 'SARCENT HAROLD, Znd Lieutenant, Infantry, A. E. F., Killed Nov. ll, 1918. SAYLE, GEO. W., Captain, Field Artillery, A. E. F. SCHAEFER, LEO H., Infantry. SCHAFER, HAROLD G., Industrial. SCHARDT, ARLIE, Infantry, A. E. F. SCHELLING, E. W. SCHILLETER, AUGUST E., SCHMIDT, DIETRICH, Lieutenant. SCHUBERT, ARTHUR F., Ordnance. SCHUBRINC, ALBERT H. SCHULTZ, GEO. I-I., Base Hospital. SCHUNK, OLIVER H., Industrial. SCHUSTEDT, F. N., Aviation. SCOTT, A. F. H., Captain, Aviation. SCOTT, EARL W., Industrial. SEIDS, JAMES V., Medical Corps. SELLS, JACKSON J. Sergeant, Infantry, A. E. F. SERVICE, GEO., lst Lieutenant, Infantry, A. E. F. SHANK, CARL BRADLEY, Lieutenant, Infantry, A. E. F, SHEARER, HARRY A., Medical Corps. SHOLL, LLOYD B. SHORT, R. D., Private. SI-IUEILEBARCER, FRANK D., lst Lieutentant, C. A. C. SIDDONS, FRED P. I-I., Lieutenant, Coast Artillery Corps. SIEVERS EDWARD C., Sergeant, Machine Gun Bn. SIMPSON, GEO. L., lst Lieutenant, Infantry, A. E F. SINNE, FRED E., 2nd Lieutenant, Aviation. SIZER, F. M., Zncl Lieut., F. A., A. E. F. SKABO, REIDAR, Corporal. SKIRM, JOSEPH, Lieutenant, Aviation. SLICHTER, LOUIS B., Ensign, U. S. N. SMELKER, W. W., Ordnance. SMITH, CARMAN B., 2nd Lieutenant, Marines. TSMITH, EARL, Sergeant. Died Oct. 13, 1918. SMITH, HAROLD D., 2nd Lieutenant, Infantry. SMITH, WALTON K., Foreign Royal Flying Corps. SNADDON, ROBERT, Y. M. C. A. SPERRY, DONALD D., Infantry, A. E. F. SPICER, MYRLE H., 2nd Lieutenant. SPROESSER, W. C., Industrial. STEELE, CLAY E., Sergeant, Q. M. C. STEINHAUCER, RAYMOND, Chief Petty Omcer, U. S. N. STERICKER, WM., Industrial. TSTEFENSON, P. LEWIS, Lieutenant, Artillery, killed in action November, 1918. STILES, P. G., Lieutenant, Marines. STONE, HOSMER W., Private, Medical Corps. STREHLOW, PETER C., Aviation, Canadian Army. STRELZIN, MORRIS H. STRONG, EDWINJ., Infantry, A. E. F. SUHR, LEWIS D., Lieutenant, Sanitary Corps. SUKEEORTH, HOWARD A. SWAN, HAROLD, Requisition Department, A. E. F. TAMMEN, THOMAS B., Marines. TAELILCOCK, ARTHUR F., Sergeant, Ordnance, A. E. F. TAUSSIG, WARREN A., Lieutenant, A. E. F . TAYLOR, GLENN E., Private, Engineers. TAYLOR, PAUL SCHUSTER, Lieutenant, Marines, A. E. F. TAYLOR, RUSSELL F., Znd Lieutenant, Infantry, A. E. F. 'TI-IOMASi?. A., A. E. F. Killed by loomb June 28, THOMAS, CHAS. G., Ist Lieutenant, Infantry, A. E. F. THOMAS, CHARLES S., Lieutenant, Aviation. THOMAS, FOSTER K., Znd Lieutenant, Infantry. THOMPSON, JOHN A., Industrial. TIKALSKY, CHAS. W., Sergeant, Ordnance. TILLMAN, ARTHUR G., Army Y. M. C. A. TREBILCOCK, A. F., Private, A. E. F. TREE, ORVILLE T., Ordnance. TRUITT, JOHN WM., Private, Medical Reserve Corps. TYRELL, DONALD W., Znd Lieutenant, C. A. C., A. E. F. UTEGAARD, THOMAS, 2nd Lieutenant, F. A., A. E. F. 1 if I 511111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 ,,,,,,,,,,,,,,,,,,, ,,,,,,,, ,,,, 1 ,,,,,,,,,,, , 111111111 111111 1111111111111111A REIS, CARL W. REQUA, FREDERICK L. REYER, l ILIGO, Chief Storehouse Keeper, U. S. N. REYNOLDS, RUSSEL B., lst Lieutenant, Infantry. REYNOLDS, WM. L., Sergeant, Infantry. RICH, CLARENCE EUGENE, Znd. Lt., F. A., A. E. F. RICPIARDSON, GLENN C., A. E. F. RICKETT, H. W., 2nd Lieutenant, Infantry A. E. F. ROBERT, CPIAS., Ambulance Service. ROBERTS, HARLONV P., Captain, Infantry. 'ROBERTS, JOHN BASIL, Lieutenant, Infantry, A. E. F. Killed in action Aug. 4, 1918. VIGNERON, E. M., Captain, C. A. C., A. E. F. VANCE, SARAH, Government. VAN EVERA, Radio School. VERNOXV, J. REXFORD, Engineers Reserve. VAN PATTEN, EVERETT H. WADSWORTH, R. L., lst Lieutenant, F. A., A. E. F. WAGNER, MELVIN F., Motor Transport Corps. WAI-ILE, WALTER E., Ordnance. XWALLRICPI, WILLIAM, Lieutenant, Infantry. Killed in action, July 23, 1918. WALTON, CHAS. W., Ist Lieutenant, Cavalry. WARNER, IROBERT L. WATSON, ELMER E. WVATTAWA, JOHN, American Legation, The I-Iague. WATZKE, LOUIS A., Sergeant, Coast Artillery. WEAVER, R. O. WEAvER, WARREN, Signal Corps. WEBB, WALTER R., Sergeant, Radio. WEBSTER, BYRON G., 2nd Lieut. Infantry, A. E. F. WEEKS, LEWIS G., U. S. N. WELLER,C. GRAFTON, 2nd Lt., Infantry, A. E. F. WELLS, JAMES EARL, Government. WENOLER, HAROLD, Znd Lieut., Aviation, A. E. F. WERTI-IEIM, FERD E., Ordnance. WENCLER, HAROLD, Znd Lieutenant, Infantry, A. E. F. WERBA, ARTHUR, Private, Military Police, A. E. F., WERMER, WALTER ALBERT, Corporal, F. A. WHEELER, SYLVESTER L., Aviation. WHIPPLE, NEWTON D., Aviation. WHITLOCK, HAROLD P., 2nd Lieut., Infantry, A' E. F. WIENER, OSEPH B., lst Lieutenant, Infantry. WIENER, ., Lieutenant, A. E. F. WILDE, EDWIN, Hospital Unit. WILES, G. M., Assistant Paymaster, U. S. N. WILGER, CHAS., A. E. F. 'WILLIAMS, FRANKLIN C., F. A., A. E. F. Died of pneumonia, Paris, May 18, 1918. , WILLIAMS, ROBERT N., Znd Lieutenant, A. E. F. WILSON, WM. B., Znd Lieutenant, Infantry. WISE, MENTON B. WITI-IINGTON, JAMES S., Sergeant, Marines, A. E. F. TWITTHUN, ELMER WM., Government. Died in camp, Oct. 17, 1918. WOLF, CLARENCE N., Chief Storekeeper, U. S. N. WOLVERTON, FRED M., Private, Infantry. WOOD, I. W., lst Lieutenant, Infantry, A. E. F. WOOD, JOHN M., Government. WOOD, RALPH H., Government. WOOD, RAYMOND, Lieutenant, A. E. F. WOOTON, ROBERT. TWRIGHT, GUSTAV. Killed in action, Oct. 8, 1918. WRIGHT, HOWARD F. WRIGHT, MERTON LA MONT, Aviation. WRIGHT, OMAR B., Sergeant, Ordnance. WYATT, RALPI'I M., 2nd Lieutenant, A. E. F. YOUMANS, HENRY A., F. A., A. E. F. YOUNG, CARL F., Sergeant, Ordnance. YOUNG, HAROLD B. YOUNG, ROBERT A., U. S. N. YOUNG, WM. M., Ensign, U. S. N. ZELLMER, CARL E., Medical Corps. ZICK, WM. JOHN, Engineers, A. E. F. ZISGHKE, I-IERMAN, Lieutenant, Marines, A. E, F. ZU JEDDELOH, HENRY J., Private, Infantry. 1918 ACHENBACK, LESTER W., Sanitary Train, A. E. F. ALEXANDER, A. B., Lieutenant, A. E. F. ALLEN, GEO. B., Government. AMBLER, FRANK, Army Y. M. C. A. ANDERSON, ALVIN, Corporal, A. E. F. TANDERSON, MORGAN M., 2nd Lieutenant, Infantry. A. E. F. Killed in action Oct. 5, 1918. 111111111111111111111111111111111111111111111111111 11 1111111111 11 1 f 11111 7 5 4 l 1 5 ' 5 1 5 7 111111111111111111111111111111111111111111111111111A 1111111111114 411111111111111111111111111111111111111111111111111 ZW! X I ! W J f 1 'lr if t 'k 'A' 'A' I 1111111111111111111 1 011111111111111111111111111111111111111111111111111111f111111 'f'f'f ' 7 ! 11 1 1 , 1 111 111111111111111111111111111111 11111111111111111111111111111111111111111111y11111111111111111111111111 i N R RNR1M ws 1 1 1 1 1 2 E 1 1 1 2 1 2 1 1 1 1 1 1 , 1 1 2 1 1 1 1 1 1 1 Z 1 1 2 5 1 1 11 fi gf 7 1 5 if 71 Z1 5 1 ff Z1 K Z , Q Qt at Z 1 1 1 1 ' jil- RR , - xxx A 7 757157 5 VIII' If 1 lffffl 1' if 'Ii' ir it f Tk 1 'k .. 1 , 1 it -Ar if i. tk ll? 1 4 1 5 1 1 7, ,,,,, I 1 'QV 1 I 1 Q 4 . I 1 1 1 I 1 1 1 1 -1 1 1 Z 7111, 2 11, ir gr. Ik 7,114 it ,I-5 INVNVR ANDERSON, CLIFFORD M., Chief Radio Electrician. ANDERSON, EDXVARD OSCAR, Medical Corps, A. E F. ANDREXVS, ARTHUR M. AUSTIN, CARL N., lst Lieutenant, Engineers. AUSTIN, KENNETH, Aviation. AUSTIN, ROY, F. A., A. E. F. XAVERY, HERBERT L., Ensign. Died of influenza NOV. 12, 1918, on board U. S. S. Hubbard. AXTELL, WAYNE O., Captain, Engineers, A. E. F. BABCOCK, W. C., U. S. N. BAHE, KENNETH E., Znd Lieutenant, F. A. BALCH, CLEON F., Private. BALDWIN, JOHN, Sergeant-Major, F. A., A. E. F. BALMER, STANLEY L. BANTA, G. V. BARGER, ROBERT L., U. S. N. BARKER, HONVARD FRED, Ensign, U. S. N. BARLONV, RUEHL, Sanitary Train, A. E. F. BARRETT, Arthur E. BARTLETT, HARRY O., Znd Lieutenant, A. E. F. BASCOM, DEANE S., Ensign, U. S. N. BAXTER, ROBERT A. BEACH, R. W., Lieutenant. BEEMAN, LYMAN A., Government. BEHLING, FRED LOUIS, U. S. N. R. F. 'BELL A. Foss, Lieutenant, Aviation. Killed in France October, 1918. BELL, DOROTHY, Red Cross Nurse. BELONVSKY, HARRY S., Znd Lieutenant, Hospital Corps. BENKERT, ROY FREDERICK, U. S. N. BENNETT, JOSEPH G., Ensign, U. S. N. BENSON, ROBERT H. R., Lieutenant, Aviation. BERG, EDWIN L., Aviation. BERN, ARTHUR, Q. M. C. BERTELING, C. M., 2nd Lieutenant. BIART, NAT, 2nd Lieutenant, Infantry. BIERSACH, HENRY L., Hospital Corps. BIGLOW. LOWELL R , U. S. N. BILL, J. RAYMOND, Seaman, U. S. N. BILLER, JAS. R., 2nd Lieutenant, . M. C. BILLER, JACOB R., Lieutenant, A. . F. BINNEY, THOMAS H., Sergeant, F. A. BIRCH, IMOGENE, Government, Social. BIRD, GEO. E., Sergeant. BISHOP, LAXVSON W., Ensign, U. S. N. BLACHLY, LOUIS B., Corporal, Infantry. BLACK, JOHN H., Sergeant, Government. BLAIR, JOHN C., U. S. N. BLAKE, GILMAN D., Artillery. BLISS, MADELINE, Government. BLOMQUIST, GUSTAVE E., Znd Lieutenant, Engineers. BOARDMAN, NEWELL S., Aviation. BOEHNE, JOHN W., Private, Ordnance. BOEING, JOHN K., Q. M. C. BONDI, HOBART E., Lieutenant. BUROESS, CHARLES M., lst Lieutenant, Field Artillery. BORWELL, FRANK C., Ambulance Corps BRADFORD, WM. R., Aviation. BRAGG, R. R., Cavalry. BRANN, A. J., Engineers, A. E. F. BRANINE, I-IAZEL, Government. BRANT, HOWARDJ., Infantry. BRAUN, EDNVARD J., Medical Corps. BRAUN, HAROLD, U. S. N. BRENDEMUEHL, ALVIN G., Sergeant. BREYVOGEL. A. L., Social, Overseas. BRENNAN, H. E., Infantry, A. E. F. BRENNAN, ROLAND E., Lieutenant, F. A. BREWER, ROBERT M., Private, Infantry. BRIGGS, PAUL A. BRILL, WM., British Army in Egypt. 'BRISTOL, FERN, Infantry. Died of pneumonia in France, March 9, l9l8. BRITTINGHAM, EDW. G., Naval Aviation. BROCK, HAROLD W., Sigzal Corps. ' BRODY, LAXVRENCE, Q. . C. BRORBY, MELVIN L., Army Field Clerk, A. E. F. BROSSARD, EUGENE E., 2nd Lieutenant, Aviation. BROWN, ALOIS A. BROWN, DOROTHY, Statistical work, Shipping Board. BROWN, LAWRENCE M., Sergeant, Infantry, A. E. F. BRONVN, NEAL W., Lieutenant, Infantry, A. E. F. BROWN, SIDNEY T., Signal Corps, A. E. F. BROWN, STACEY, Znd Lieut., Infantry, A. E. F. BROWN, MARSHALL F., Medical Corps, A. E. F. BRUNKOW, QRVIN R., Sergeant, Sanitary Corps. 11 1 1 fn RVLL BRYANT, HAROLDJ., Aviation. BRYDEN, JAMES A., Sergeant, Field Artillery. BUCHANAN, PERRY B., Zncl Lieutenant, F. A., A. E. F. BUCHOLTZ, A. O. F., Government. BULLEN CRAHAM, French Aviation Service. BURLINOAME, LEROY J., lst Lieut., Field Artillery. BURNSIDE, HARLOW, Captain, Infantry. BURRELL ROGER A., lst Lieut., Aviation, A. E. F. BUSH, HENRY H., Private, Medical Corps, A. E. F. BUTLER, C. R., 2nd Lieutenant, Aviation, A. E. F. BUTLER, JEANETTE, Government. CALL, LLOYD, Medical Corps. CAMLIN, W. J., Infantry. CARADINE MAHLON. CARPENTER, BYRON, U. S. N. CARPENTER, DON W., Captain, Infantry. CARTER, W. J. J. SCASEY, MARCUS T., 2nd Lieutenant, Infantry, A. E. F., Russia. Died of pneumonia, Sept. IO, l9l8. CASEY, MATTHEW J., Chief Petty Officer, U. S. N. CASEY, ROBERT, Radio. CHANDLER, W. S., Hospital Corps. CHILDS, MARSHALL H., Engineers, A. E. F. CHRISTIANCY, CARTER C., A. E. F. CLAPP, G. H., Infantry. CLARK, ROBERT H., Naval Aviation, A. E. F. CLEARY, THOMAS L., Corp., Infantry, A. E. F. CLEVELAND, W. l., 2nd Lieutenant, Infantry. COLE, EVERETT L., Ensign, U. S. N. COLE, MANLY G., Sergeant. COLLINS, CLARK S. COLLINS, HAROLD C., 2nd Lieutenant, Infantry. COMMONS, JOHN A. 2nd Lt., Infantry, A. E. F. .Russia CONATY, BERNARD M., 2nd Lieutenant, Aviation. CONELY, BROOKS L., Engineers, U. S. N. CONLEY, JOHN G., U. S. . PCONNOLLY, JOHN MARK, Warrant Machinist, U. S. R. F. Died of pneumonia on Dec. 21 I9l8. CONNOR, EUGENE P., Government. CORNISH, HARRY B., Private, Hospital Corps. COUTURE, ARTHUR J., Industrial, Island of Malta. COURIE, EARL G. CRAIG, WALTER S., Lieutenant. CRAMER, HERBERT L., Ist Lieutenant, Naval Aviation. 'CRANEFIELD, MARION C., Lieutenant, Infantry, A E. F., France. Killed in action On July 3l, 1918. CROWELL, S. D. CUMMINGS. JOHN H., Aviation. 'CURRIE PAUL MONSLER, Lieutenant, Aviation Pilot. Died in airplane accident on Kelley Field, May 27. 1918. CURTIS, KENNETH, lst Lieutenant, Infantry, A. E. F. CURTIS, WVILLARD L., Sergeant, Ordnance. DAHL, EDNVIN J., Aviation. DAHLNIAN, ARTHUR F., 2nd Class Seaman, U. S. N. DALLY, XVALTER R., Coast Artillery. DANIELSON, JESSE A., Private, U. S. N. DAVIS, DEANE G., U. S. N. DAVIS, DUDLEY, Znd Lieutenant, F. A., A. E. F. DAVIS, TRAYTON I-I., Aviation. DAVIS, RUSSELL GARDINER, Lieutenant, F. A. DAY, DAVID ELLIOTT. DAY, KENNETH S., Field Artillery. DEMING, JOSEPH BYRON, Corporal, Aviation. DENNIS, CHAS. E., Industrial. DENNIS, CLAYTON S., Corporal, Signal Corps, A. E. F. DEQUINE, GEO. P., Engineers. 'DODD, JOSEPH C., JR., Engineers, A. E. F., France. Died from Wounds, April 19, 1918. DODGE, NEWELL P., Znd Lieutenant, Infantry. DONALDSON, CHASE, 2nd Lt., Engineers, A. E. F. DONOVAN, J. R., lst Lieutenant, Infantry, A. E. F. DRAKE, A. I., Elec. Znd Class, U. S. N. DRAKE, RONALD J., Electrician, U. S. S. Agamemnon. DREXV, EARL F., Private, Ordnance. DROW, EARLE F., 4th Army Corps, Artillery, A. EDF. 'DURGIN, TRUEWORTHY O. D., Ensign, U. S. N. Died at Great Lakes, Ill., on October I, IQI8. DURST, WILLIS H., Private, Medical Corps. DUTCHER, H. R., Lieutenant, A. E. F. EATON, EVERETT H., U. S. N. EATON, HOXVARD O., Znd Lieutenant. EDNVARDS, EVERETT C., U. S. N. EDXVARDS, W. DONALDSON, Ensign, U. S. N. ELDEN, EDWIN S., lst Lieutenant, F. A., A. E. F. ELLIS, NED R., Private, A. E. F. 11111111111fn1ff,1ffffnffffffffffnfnfff10111111111110ff1111111111111fffffffffffffffufffffffffuffffffffnffffffffffffffufm ffffffffffff11111,1110ffffffffffffffffff ffff0,11fn1myffffffff1111111111ffffffffffffzfffffffffffffffi f 7,,,,,,,,,,,11,1111,1,fmmy,,,,,,,1,,,,W1,,,14 ym,,,,,,,,5 gm,,,,,,,,,,,,,,,,,,,,,, , . .. , . . L 1 , ?9'1iA'i'4i 4li'1frI 2 if if 1 iii f ' f , ,, ,fu KX Page 368 'f ff 2 mf, ' 4 1 1 if ir 'A' if 'A' 'k 'i l2 'ffl' fl 4 ' ' 1 I 5 Qu Q 'U sn on N w oQ Qo x 5 1 1 A . .QQQQQQQQQ QQQQQQ QQQQQQQQQQ-QQQQQQQQ-.QQQQS , .xxxQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQ ' Q,,,,,,,,,,,,,,,,,,,,,,,,Q,Q,,,,,,Q,,,,,,,,,,,,,,, . Qwxfu-x-ruff Q Q 1-wx-mr Qugfgfgx Q :earn-xxx-5, Q Q QQQ QQQ QQQ QQQ QQQ QQ W Q Qgx ' Q QQ Q X, Q x Q Q Q QIWQ Qi? Q Q Q13 Ex- Q Q IIIIII I 000000000000 Q0000000000 Q -r1'r1'r1'n-r1'rz-nhn'11'r1'r1'n'm'1'r1'n'r1 'n'n'r1 '11 Q Q E wbwrwmgbggggccwwwwwwwwww 0ooOO0r'gI':rf1mQQQ9 OQQQCCCEE71WOOOOOOOFr'l'?n,-vmmlfiz'-pbQglqglggggqggwgl Q QYQ r1WZZZZZZA:r'5g54c:3o,:.':Qzf:'w?g Zczggowggmw-5-1-H33 ggxzrzpmwmmbf-Xzggpmgbgwz1z5I5cwwnv:1::..,,mm:'p-ol. 25.4 Qi Q Q fswssasmsgzxgngaargazaaa mfgigamwamsmmm 22555m52555w,,g,mmm5Ug522mQ5-55s2a5g555,555 555 Q Q !f'nmZZzzzn,,:v'm,.m,,Q-l ,iw --'- Paz.mzzgsuzgwrz'?,wmmz-Z.-wgp.w5.gO,,-n-s:li-- mwmozzcr,-om..oo--Q 5.80710 Q Q1-Q :Z - '- x.f-IOom-- Z-'Q 70-UAE QP- U U ommz-,pn 5. 75C-rnz-:'I.Z0mzooz ma:-5025 zz-L..wzg--55m Qi., Q Q 0-' 2.3, - 'r-I w Oy I-2. -pf U,Q-7U '..4C'Jf-3g3l jj:'.-4:+1U- I 0 0 -U ' orwmzz-Q52--. OOF'-rp o ..0- Q X Q ' QSZO 2 F' mqmmnm-lm '3' U7 7:-Ol . O 33- -.1-' 0 Q-IZ7' Z 5'7::I:1WQI41bm5,' '-4-- 0 -5 I-. I' ' zp- O EQUFZ 5 Q Q O7U3.g:,:7U3,It IZ. 7'ZF'Z:Umm -4Q- ...I-pg, mo' ,Tl '41-05'3CyT rnbo :CF'5,,C-mb -K-1,1 m IFIQ OZ 5 O --4 Z0 Q x Q .55 Hrooo.--1-5-,, :url 55120.-5 mmm U51-uf -5-zzfrvvmo U30 5-.Z- bP.,2':.OU5TU:Zrwb --wnb Q Q12 - I FZI 2-42 ,L R-71 E51 V0 .'-'Z-r-5- 'UFJQWQ C1 02757 k-.x3,7oCI- Z 'Wg 52,0317 ' Cp-C ,-- 7UOV'Z7Up9O3P,: 5 Q Q 'Um'U8 CS UpQCmxmmCE3'ff1C 1' 7' 'IWZU' ff' U o3'm'-C-z1mZ'-LIQUZ POE? W' aWm3'P'-U'NGZm0l'7'3:-I 2211- 3 Q S Cml 5r'3b7' gas' 711' Z3U'Z'U17u75'f:...2 :O53Pm,7' UOL.2D'1U4ZZ,?,r'+UUUf'1 U I--5077-4 -iOTn'u-4zC4U'3 -923'-f'V I: Cxr-up Q QQQ 4 ZF' Q mgmw U'0U1r'U-IM m 7-'2f:'ZZnZ1-fcn-UO::- -525'-. mm-? Jm 'Iv-r-': 00--.'T1Q.lTJU F,'?0'ZC M- H if Q Q Cn? C.g'2O.U: -,4IP1m'-O -Un-fl'.:g 1-'-I0 1.- 4 'Z,. V--In--4 'W 1-' KT1- ZmN-2F'c01-- J O-5-Zywcn :wg Q -: '- -' . 'Tl ' '- -- U.., UIF' - ' mn LTIUU- '-'l-'HZ4 - 4-i C--'UQ' Z ITD' ' '-- N' F X Q Q 5 71' E V'4Z QPU ZW' ' Z l f'-'V moz- -- I-13, ' Off mi N 0-1.' 3:33 JU7m ' I-1 -' N 3 Q Q S Z Uo.Fnm-xmO- 551 - '-'-6- 77- A1 ' - Z--CCL -10.-.rv :,UIE'Um:s452-5' Icnff QUHIZM: -5- 0 -P10-F' J Off, Hgh QZJZ 'UVWN mm' O Q Q 3 -1,5 42-Bmw, an-1 5 Z -Qg...Q5nZ5fE2,O2.'z135'ff.S.5-.,571731:qfvU'1.:!vg .850-,O 'Zi-. '51,-5? COC-5,2Q.,,g :5 5:3175 Q QQNNS 4g',Z0'3 5'q5'Y2,3-'rg Cmlbm O- C 4-+:15.,.-,g,-Cn-gfmmgs 09,552-F-5.5 FU,-ac-OUT CZ5,-Q04 in --OG-:Q-l E ,-,E.Om:,l-of-PC'3.Q. 4-v--ln Q Q Q ' -- -4 cv ru -, U1 G QP ...,l I rv'1 0-IGO , 0... .......'-W: 91343 X QEQQ 55 2355525 Eggi Q 3 5E535i?5EFsS535E EmE5m5g5mg3Zi 3555 555555, E 55525555555 5255 QQ QQ '- 1 ...-- D 'm - mf-f ' ' - :ww '40 - 53 mz551f'-- Q 5. -ff Q: A .. QQ Q5 g 25.52 5 L-'OA' U S F'-OPS 'S' ' Onom 35, mn ff- 'mmm -0. 5,5 dw :S - 3 -0001 5 n 05 QQQQ 0'-Q HZ -:B in - '55 mmm P '. O ::r 1. mCZf '-m 54-0 5 3-F: w 'ADONFU G : -b QQ QQ rv em mm Q .ff ,...,,O,-H5 Jw moo. m -1 no. 3 . Q4 3 Q :x ,y1:sQ5 B, 3 -Zn an-,,, 5 ew. QQ QQ Q. Q4r3P:15' o C 'Tl U5 39155 ami' 5 Dm,rr1 0- - O ,un Jw JP'-v ,7 'T1F' P5-, - .-Q 3. J 5:1114-U D 2' QQ QQ -- - 'rm -1 ' Ja Q 0 -N: 3,-r. m wUm5 . :S , Z . 04- 55- 1' - 'Q F' awww- :1 Z m QQQQ 5 wma B -w 5 5 5 55555555 5925 Tw S 5 5 z 355: 255 3 ?'5 Q 5 50 S B ' 2595 QIQQ Q5 it O 'no' Z - ' ' -1- 9.S'1'-'Q' - 95 ' 2 5' 'J ' Emma, F3 O E '4 U ,T '13 ' 5 T1 513- SEQ XQ QQ . 3: U' '-1 uEf40 '3 2 Q f Q Lv' O Y' ' ' w 'F' C . T' 5'- QQQ QQSQ 9, E ' Tn- on ' w '5:'7J - 5' W If P3 P msn' 3 U1 - QI-n QQ QQ QQ -o ' m 3, lf- S5 5' :x 0 - ' 5 -1 - P 'Q Q U, F1 CL OM. Q32 QQ QQ fn 3, ITT 5 - NN -4m UQ - P Q S I-rg , 3, mv 24 0 Q - P MEAL QQQ QE QQ ' - ,Tl 0. m ' 'S' '52, f Q Q ' :. fn S 'Tl -1 go? RS? - , - . 3: ,., Z - ff H QE ES U7 ' oo- pl C O T1 91 'TI ' cu ' ml QQ QQ - 'n - Q .E B ' 1 - 'U -1 2 r' QQ QQ -n - mg cn 0 71 ln F7 mA ' W 'Q '-E XQ EQ . --. - cz. ' - ' ' U QQQQ S z 5 1 5 W f 35 XQQQQQQ ' . - . O. XQQQQQQ QQ QQ QQ QQ QQ QQ QQ QQ QQQQQQ 5555555555555 5555EE555E5E555f55555555 55555555521555555555555555 f5515521I51 X: QQ mo:-.5-zzmmnmm '-egrmr m 5 054 frm- O-nm-nm'ZZ f'f'0'L.54aw 5'9i'92LL m ' ,'PP P QQ QQ 3545:-,,,.,.:g--an zm ,ug-I mmmzzzzzzvmooox. -2024-7 .--nu,-.1 01521-f'r-oc wwmz-ZA-4-Sanz -nf'-4'44Q2CFf'5' xQ QQ - m. - . gr: z F U11 yvy-ywmwwwwwzgncmmw z-II1mwQ- ':0---- -GJ - ZUUUUUZ- ,xmvw-mm-mg QQ A2255 55 qw 255.5555 m5fO5-mfM55255551Zmwwzgagmszfafmmfps QQ QQ rn IZ-55.251-H gm- :Q 0-..7UZ'f1ZZZZZZ5E3Q! Z ?3.g0.F'U'.g4Z-4Z-m- om-45 -Up. Donny? mxzf ??wnEZo- QQ QQ 0092725-'HZ I5 'Iw: IO0mzfQ c:o7 ' FM.-0 r- 74 'X 'obrow Z-2 -ZwKW2L5d-OFZEXZQ '::z9ZQ- QQ QQ 353, 533,55 ,9g?nQ1f1y3?pC.mgf f1QEM5gzvnrj00O'25',55Eg,'?,Q5S7,'51zrQ,Iw1w5Em32,39 4- ?1Igf5g'5zz4,I9L,z7,gQgQz1- - mfg QQQQ Q5 0 w0?Q. :,ff'1mI:W'z'Uw'1'r0mO9'fmI5m5f'f53m'f:ZO -w0'Z'25C0Uf5'EQ?19'u.Q- 1'O'b '222C-AHF -. 595550552 qiixi QS QQ 7035-I' omwPZZvO2S-125:-ZS E O Swfo :7UW 3'?.'7 U:'ff1ZZ',F-1WZOZPU ,:5'Z-L 33ZQ0 'rOf5 2:4-4 WFDQS-40 QQ X: QQ -5 'nmmrrz-,-56, 45:11 0,,,P1:4OmzmS 3, 'f1:Q4OCC:,Z-x :onvm-I4 cLO.mZo5m. 000510 I bw- gzg QQ QQ QQ --C - P -I -no.-UEJNU W1 ms r-U-21155.12 Z.:-C 3, IV' I--4 -NMI' -.-w.5z---P.-- O5 7115055-0'1'l WP' , QQ Nr QQ mg 'FHIKHIWOS GW-Cgimg Z' ZF -'-vm-U75 rf1r'f1-.rf1:f'o - ' Cum U0 7' 'ml FCM n'lmmF'Om- V QM QQ QQ 0 W m ,5,:,,,,m U1-o.,.m,z -5. '11 m0 0 - mUcn.4.7: ,: fy Q- 'C5,.Z y,:10rgIF'l o 2'--4-' BUZZ: INQQQ QQ QQ 500. 53,1---wU57i:C1 -z.nQ.,-05-!'U9lhoC5E,F2l-y-5,'- ,B -U-If OmE,,,5.,mI. 0-I,WZm go Nwqwgnncw El 5 QQ.. QQ QQ W9 9.4: 05 og Q50 iff r11m Nm-- ' 4- Q nn.: Z 214 'Uni ' - ' 'fQc:um' O' 'O' m. QPFI Og-,0cn:'F1' Og A U QEQS E55 5553935IWgE5Sb?w?m3S3SQcg?5g5 52wEEZQ 50 5555? QgCS55Q?5g:gE?x?E55 gb.525iP-ZC5Q 52 QQ SQ 534 ---p.u'og:,' ,. Er'-1J9.40'0 '.,'5,'Q5'3cL2' -RSF? :x Ng 23 JO- -,w2J5'.-Q fSf:,0 wwgimrlz :F'l f+'5C1'5m-'QD 3, QQ QQ 'Ng' 0 -'o 40 :Q-Qf ,.1:,'unmU'O F QffF05f-', F' Camp? rn :sn nf' :.l- 0,,'5',,! :,3f- Pg-Oo' Fmn Q-0.517 3uQ---YJ-, Q-45 -U-1 X2 QQ 5:-f CFOS '1bm-1 --H5-Nwfurmlori'-2 f-e500 .mfv fn :S 0.0 - :1-- 'N rv .-Q' -1 :QQ Emir- . 3'0n - C14 QS. wxxxxw QQQQQQW ,.,-Q ' .-...N-1:10. Wmwm --sn. 7' :rg '-Z-135-'-' 3mN 0 ro O qua: -5?-5 - ml?--OmrQ,'T1f-15-1' l-' m,pcCF'O VW- Zn- E Q Q -O U7 W 5 r-fog OC' 50 5 'OQf-fU7Q-l4- V915 Uh-153m rv l 3 IH C Q 53 .'2.O--1' --na,-,f-'-S N 5- SS-'-1 Q' 'HH 5 Q Q :1 . 100 :-5 :nn : 'C-'Greg-'14 - 35?--1-M15 ' -Q on nf, .-,C5 0 mo- : 2-1.1:-5 5 5500, Z- Q-1 Q Q Q ' 'OmfTcna OW ,.':'wCff-.'Z- 5 Z-rf w gm WD ml Mn :'U-oQ'UC'53?'rr4-,g-yo, 'Swain -E Q4 Q Q Us-15-,mn :IS 511--mm, ' ng. Uv.-, ,.3,E-- 0 'gm Q, Km- 5- --5 c fwa' -:asf-om Q O' Q Q95 23?-52-P S5 5'i2-,QQ22wF'15 Q' SQ 55273 Q5 SO O51 5 W' i3V'1?f?Qf35'5 Poffss 5 5 as 2wQ,,5'5z5225 fn 5 55C QQ 0-5 5 5-Q5 Q 'f1S5,PfQ2 1529 'Qui 5 M5 pn FE' 1457 fw:a'-N0 'rl 5 . ' P11 o. 0 9. ' mx 4 .'mP: 5? Q QNQQ - 'wg' Q4-5 -Sm: mul' ' 350 -5 Q - :Q w fv w - - uw? C Qi- Q Q C 21 53 Qgi? '52 C fz 55 Em S5 C m 5 2 Q mm P1 Jim w 5 5 . , . L V, , Q sn T3 ,Q pimp, 0,5 w 3 55 Tam ,nag 3 ,F1 my pm Z Q, Q Z S - SU, Z 5' Q 0' Z- -1 r' ' 75' m' ' Q - 5? mm 5,5 - 5, - E51 A 73 P1 F1 - Q Q m 'r1, we 5 3 'ri 'ru 'n Q Q3 Q - -, - I , . . Q QQQ QI? Q Q Q Q Q Q X Q Q Q16-Q Q15 Q Q Q E Qyxxxixxxixxxixxxismixxxxxxxxxxxxxxxxxxxxxxxxxxxtxx xxxxtxxtbrzzrxtrrtrwzwwQQQxxixxxixxxmxxxixxxxxxxxxxxQ:X:?m :mxEm?:Qxxxxxx?xxxixxxxgixxxxstxxxxxQxxxxxxxxxQxxxxxxxxxxxxxxxxxxxxQxxxxwnxxxxxxxxxxQxxxxxxxxxxxxxxxxxgxxxxx QQQQQQQ QQQQQYQQQQQ www? E1 S Q Q Q Q N , f ff funn, ff sw 1 1 5 5 5 f W , , ., f,,,,,,,,,,,,,,W 111f111111111111f 5 . ,i 4 ' 4 . e . ,,,,,,,,,,,,,,,,,,, 11111 1111 111111 if - l 4 .t i, t -i t t t 4 4 if if it if ir -k -k 4 -..1., 1 '14 4 4 ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,4 LL ii 1. 4,,,,,,,,,,,,,,,,,,,,,,,,,,,,,W,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, 4 4 -14 L L 454 4 4 4 4 4 4 4 f X 4 4 4 4 LACEY, JAMES J. OVERBAUGH, MERRILL H., Infantry. 4 At 4 4 LANDER, MILES K., Ordnance. OWEN, GORDON, Private.. 4 4 4 4 LANG, ARTHUR. OWEN, HALSEY T., lst Lieutenant, Infantry, A. E. F. 4 4 4 4 LANGE, HERBERT A., Engineers, A. E. F. PROBST, FREDERICK L., Government. 4 't 4 4 if L W ' ' V W A ' ' 4 f f i 4 ANGE, M. W., Znd Lieutenant, Engineers. PACKARD, ERNON .. Vllat-1011 7 4 4 Z LAWRENZ, ROY H., Engineers. PAYTON, JAMES M. A., Aviation, A. E. F. 4 4 LEE, BURR EDWARD. PEACHEY, JAMES. 4 4 4 Z LENTz, ALVIN E., Infantry, A. E. F. PECK, H. B. h 4 4 4 4 LENKEL, ROBERT W., Corporal, Infantry. PEDLEY, T. A., Lieutenant, Infantry. 4 4 47,44 LEVY, ROBERT F., Ordnance. PELKEY, HEBE H- , 4,,,,,,4 44 LEWIS, ROY Eu Ambulance Corps, PERCANDE, ARTHUR GEOI., Radio. 42 44 42 IIZIGHT, ROBCEERT F., E-iviitcg I'l'ank Corps.I f IIZERKINS, JOAI-IN R., list Lieutenant, Infantry. 44 X7 64 INDBERG, USTAV ., n ieutenant, n antry. ETERSON, RTHUR . 7 gf LINDOXV, RUDOLPH F., Industrial. PETERSON, JAMES D-, HOSDiK21l Corps. Z 44 4g l-,1P5C1-IUTZ, I-I, Sq Field Artillery, PETERSON, OTTO N., ,Field Signal Battalion, A. E.. F. 4 34 42 24 LOGAN, LUCILE, Government, Shipping Board. PETT, HARRIS G., Private. 4 IIZOOMISLIJOHN L.bCofpoExl, Hospitall Earps. A E F EHILLIPS, QAIEJLD, lst Lieutenant, Infantry. 4 9 Zf ORD, ERBERT ., st ieutenant, n antry, . . . HILLIPS, . . . 4 E! LovERUD, ALVIN M., Private, Field Hospital, A. E. F. POLACHECK. STANLEY. Enslgn, U- 5- N- 42 54 MCCLURE, R. A., 2nd Lieutenant. POLLACK, HARRY A., Sergeant, Ordnance. 4 42 E4 MCCOY, WM. J., Marines. PORTER, CARL E., lst Lieutenant, F. A., A. E. F. 4, 54 42 MACDONALD, ROBERT PAUL, 2nd Lieut., F. A. PORTER, JOHN E., Aviation, A. E. F. 4' '4 42 MCGINNIS, DONALD WM., Chief Storekeeper, U. S. N. PORTER, PAUL, Corporal, Infantry. 4 94 45 24 MCINTOSH, CHAS. T., lst Lieutenant. POTTINGER, CLARENCE A., U. S. 44044 410,14 MACKENZIE, AMES N., Sergeant, Engineers. PRESCOTT, D. S., Lieutenant, Aviation. 4 4 4 MCKINLEY, EORGE, B., Sergeant, Infantry. PRIBNONV, W. H., 2nd Lieut., Aviation, A. E. F 4 4 4 4 MOMANUS, JAMES F., Znd Lieut., C. A. C., A. E. F. PRITZLAFF, EDNVARD F., Sergeant, E. F. ' 4 4 4 4 MCMURRAY, ASA R., Aviation. PRIEXVE, ELMER C., Private, Chemical Warfare Service 4 4 4i.g MCMURRAY, MORLAND J., 2nd Lt., Infantry, A. E. F. PROBST, FRED, Government. 4 i 4 4 4 McWILLiAMs, GLENN, Hospital Corps. PUCHNER. I. A.. 2nd Class Seaman.-U. S. N- 4 4 4 MCWILLIAMS, JOHN, Private, Hospital Corps. PUTMAN, RUSSELL L., Cadet, -Aviation. A 4 4 4 IKAAACHOWSIEI, JOHN EIENVARD, Prgaltie, C. A. C. SUISG, EIGSESSONFANIESLAVi51ticoinAFcgeigAn.E F 4 4 1 AHLON, ARADINE, er eant, . . UI LE , is ., s ieu . ,... , . . . 1 4 4 IRAAALLOY, ED1iVARDJ.,Sriggate, Avialtloni A E F ERXEDER, LESTER Xmblst Litgatenant, Coast Artillery. 4 f ARSHALL, ICHARD ., er eant, . . ,... AMSEY, LOYD . ecease . 4 f MARSHALL, THOS. GEO., Assitant Paymaster U. S. N. RAMSEY, JOHN R., lst Lieutenant, Aviation, A. E. F. 2 4 4 MARSHALL, WM. H., Sergeant, F. A., A. E. F. RASMUSSEN. VILAS, Interpreter of French, A. E. F. 4 4 4 4 MARTIN, CLARENCE, U. S. N. RIETZ, O. A. A 4 4 44,1194 MATHYS, LOUIS, Marines. REID, WM. H. E., Aviation. 41111124 MATTUSCHEK, ERVIN, Machine Gun Battalion. REIF, CARL W., Ordnance. 4 42 44 MAYER, CI-IAS. A., U. S. N. REINHARD, RAYMOND, U. S. N. . . 4 MAYO, F. P., 2nd Lieut., Aviation, A. E. F. REMSBERG, OSCAR Z., lst Lt., Machine Gun Batallion. 3 44 45 44 MEAD, HAROLD W., lst Lieut., F. A., A. E. F. RENTON, ALLAN, 2nd Lt., Machine Gun Bn., Hawaii. 4 34 MEIsELwITz, A. W., Coast Artillery. RHODES, EDWIN JAMES, Sergeant, Aviation. 5, 45 24 MERRILL, W. D., Hospital Corps. 'RlCHARDSON, JAMES M., Znd Class Seaman, U. S. N. 45 4 MEYER, ERNEST, Field Artillery. Deceased. gg 45 24 MEYER, WM. FRED, Private, Infantry. RIHA, JOSEPH W., Coast Artillery. 42 MEYERS, PAUL D., 2nd Lieut., Aviation, A. E. F. RILEY, HAROLD F., Q. M. C. ,4 4411144 MILLER, EMIL, Infantry, A. E. F. RINEY, GENEXIIEVE, Government. 434,54 4 4 MILLER, FORESCIS FP S. dA I C IEOBERTS, 5-LEQVEY, Sergeant, Signal Corps, A. E. F. 4 4 4 , ILLER, OHN ., rivate, e ica orps. OBERTS, . . 4 4 4 MILLER, JAMES C., Private, Machine Gun Battalion. ROBERTS, UNIUS S., lst Lieutena.nt,.F. A. 4 4 4 tug MILLER, RAYMOND, Ensign, U. S. N. ROBERTS, ORGAN E., 2nd Lt., Engineers, A. E. F. 4 i 4 4 4 MINKE, A. J., Engineers, Inspection School. ROBERTS, ROYAL A., Navy. 4 4 4 tg MOFEATT, EDWIN A., Private, Ordnance. RODDEWIC, GIL. F., Government, A. E. F. 4 4 4 4 INIJIIOODY, ,QEOIEN L., Assistant Instructor in Hosp. School. SOGERS, ALFREDCIQAL Hog 4 t 4 4 OORE, . . OHSENBERGER, . ., r nance. , f 4 MOORE, GEORGE T., Machinist's Mate, U. S. N. ROOT ELNVOOD, Private, British Hosp. Corps, B. E. F. 4 in 4 4 MOORE, GLENN EDWARD, 2nd Class Seaman, U. S. N. ROSE, Louis. 4 4 IFZIOORE, IEOEERITJ Iiieutenant, Infantry, A. E. F. Ross, lDIOROTHY,l-Goxgrnrnent. A E F t 4 4 ORSE, . . ,... oss, ERBERT ., ngineers ,... 1 4 4 4 MORRISSEY, R. P., Sergeant, Ordnance. ROSS, WM. H., 2nd Lieutenant, A. E. F. 4 4 44,44 MUELLER, ALFRED D., Private, lst Class, Infantry. ROTH, E. WVALTER, S. N., F. g 4 gg IVIUNGAVIN,-IAMESF.,QUEil't61'l l'laSl2Cl'SCl'gE8I lC,Q.M.C. RovE, LOUIS C., Private, Aviation. 440044 45 54 MURPHY, MARTIN, Infantry. Row, FRANK D., Corporal, Hospital Cores, A. E. F. 42 45 24 MUs1LwITz, A. W., Coast Artillery. RUMPEL, ARTHUR H., Private, Sanitary orps. 41 NASH, LUCIUS B., Ensign, U. S. N. RYALL, E. V., 2nd Lieutenant, Infantry, A. E. F. 4 NASH, NEIL E., Infantry, A. EDF. RYAN, WM. D., Private. I ' 45 44 NATHAN, WALTER S., Machinist S Mate, U. S. N. SABERHAGEN, E. E., Engineers. . , 54 4 NAVE, C. W., 2nd Class Seaman, U. S. N. SAECHER, CARLTON E., lst Lt., Artillery, A. E. F. , 45 54 EEWTONPJAJ EGRIS, liladustrial. QAUNDERSNFAIRFAEGC 4 fg 2, ICOLL, . ., . . . CANLAN, ARION ., overnment. gf IIZIIIELSEINLJA. C., Cleief PetFyFOfIilicer, U. S. N. ECHACHT, HRRLANDLG.SHQspital Corps. 4 fi Z4 IEMAR, OSEPH, orpora , . . CHLIcrER, LLEN, . . I . 4 gf NUzUM, WILLIAM, Ordnance. SCHLOESSER, WM. C., Industrial. 457044 NYHUS, PAUL, Znd Lieutenant, F. A. SCHMIDT, CLARENCE, U.AS. N. Q 444,44 4 4 ISIYHUSCWALTER, LEeluEena3tSFNA. ECHMIDT, EDWINA2l'iClgi.3El,1I1Cl'I3nC, Coast Artillery. 4 4 4 , DEN, ONSTANTIN . . ,... CHMIOT, ARL ., n ieutenant. , 1 4 4 O HORA, R. M., 2nd Lieutenant, F. A., A. E. F. SCHMIDT, OSCAR W., 2nd Lieutenant, Infantry, A. E. F. 4 4 4 OLIVER, GEO. P., U. S. N. SCHNEIDER, CLAIRE, Radio. ' 4 4 OLIVER, MYRL L., Aviation. SCHRADER, ALBERT LEE, Radio. 4 4 4 t4 OLSON, V- A-, U. S. N. ' SCHRADER, HERBERT E., Sergeant, Infantry. 4 4 4 OLSKEFSKY, ALEX. J., Private, Ordnance. SCHRANG, EDNVARD. 4 4 4 4 O NEILL, CLIFFORD R., Znd Lieutenant, Infantry. SCHREITER, HERBERT G., Private, Signal Corps. 5 4 OSBORN, GA A- I SCHUBERT, I-IAROLDJ., 2nd Lieutenant, Infantry. 4 4 4 OSGOOD, WAYLAND, lst Lieutenant, Infantry, A. E. F. SCHULTZ, ARLIIN D., Aviation. 4 f 4 i . 4 x 4 2 2 4 4 -A-2 2 i' 4 4 'A' Ik if if IA' iv ir ...... ,... , Z2,.1111llllllliillllliillllllli111111111112 'lr 1k ir if -A' 'A' 'A' 4 4 44W4 f . Page .370 Q 5 , 5 I xxx QQ E Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q QQ QQ NX QQ Q: QQ QQ QQ Q QQ Q. Qs QQ QQ QQ QQ QQ Qs Q5 QQ X. Q Q2 'QQ QQ SQ QQ Q Q Q X Q Q Q Q . Q Q Q 1 5 x.x,...s.x x,sx..s ,x,,,xx,x. ..xx,,,,..,,.x. S 3 x.xsx..N.xx.xxN., Nxxxx Q ,.Nx.x.Nx S 5 .,.x.X.xs.xx.x,.s.,.,..xx,..x. ...x.x,......xxxxxs S x f Q Q I- Q Q Q- f Q Q I Q f' Q X' iQQQKQQQKQQQKQQQRQQQQKQQQQQQQQQallIQC-KillCCQQQCCCCCCCQCCQCQCQNCICQCIQQCQICQX-.QQQQQQQQQQQQQQQQQQQRQQQQQ-QQtxxxxwRCCCCCCCQQCCCQQCQCCQCQCQQCCQQCCQQQQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQ QQQQQQQQCCfill:R112QQIQQQQQIQQQQIQIQQQQQ-QlllllllI1l1iQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ-MQQQQQQQQQQQQQQQ QQ' Q Sxxxxx Q S X Q A-Q E1'Q Q Q X Q Q Q Q Ql'Q Q cn cnmcnmcn cncnmmm cncncnwcncnmcncnmw mcnmcmnmmm cncncnmcn Q Q Q - wcnuzzns-ooo-Wwzzozf-e mmz. - rn '- - 33333: 5m - m 'f Q , Q Q Z mmm:o7u:v2r r r'I r'r mpg yqwr--:mm :Zz-'7U3QCZ CCZ MZ WU xr-0-I -:pw -vb:-17112010-'r 7v'-124 Q Q Q UXp:U::zzzNNww r'xZ02 mxC:7'3g.4 ETH., Q po., .Zm H-'QmcFrmFmuv-Ur'wZwmIIII1-nrCmZm-sm:EbxwF1-momww--4 . Q Q Q -1'w'U1mmml11'33I5EmOImZ m !'QV'm-3'wEg5navZo-Z wm4 Zff '9mn1m2F'1c:f-47:1 'mmZWc1? r'r,5-m7',.'7'-r-rf'b0'Z5 Q Q tg 'Q-- g-cwwwwnmf.p.Z'z,-QIQPUEQZQ. 15-.,m -m-131.-2251-'wgfwwgy7124--0173505-Qw'w6mmOxo5m.l.Z9,.pz,mgE,O,,., sim Q ISI'7 5E'0CJ'-1-1'a.. 4-4m'-r1zO'-OmmC3O-egF5 110'3'P'-MOZEM L' ZU74QU0 1 mC'Q7f I 5?'Um'Z1'QIw' 7'Qf !'15'1 3 Q Q mm'Q?E'OU7IE2m'mpIT1' Im:Qz--13,-q-qzzgsimz QQQQQZQQQI-2wmCOm-3 .o-Igro-9C75'PfUm2D'!-ZO'F1g,i nf' ,..-IO Q Q Q ww-oi mv--lmrf1oQ,',UQ,.,'-x.QzZ-mfg, w-0zCQ',.FH-om:Qf'm2QZ,-r'1f'3:HU zQ-:.4fI'W ',WH-HPQ-71'gZ'.-nPrQBZ,,fQ.12V1'i QIQQ Q-Q mm, pqrpwqnm-ugwzg wzg-r-:O U7,C,41-mg-mg Jzfmok-2IW,,:,4Q-I:-og 5'3Pp: I-gmmk-.m :vc-ElmoUqm?4UQg-:c,,.c M711 Q Q Q f11ww'UbZ! '-121-nox-S,'2Om.mo IOW-W -wg,7J l1-157 Q: 'mZ-HUT, U-C7'ZQ1-Of,f'mm0f-'4g-,Q:O'4 O- F-:Sr-0 Fr-7U7'w'7'f'nfv'Z 3 Q Q Wkxlqn QP rmm wE mCyZ'm'00wHrCQ: 3 Pow 5r?UwwS-m ':U:3'mO-S l4Smqv1Im OZZU-mm H'G'U QlfQ ig f114Ir-V' ZUU-,f.lm 'l 0 4'.IQ-S.'N2'U-:- I-0110, rvO'P'. U73 -.fQQ- N,-UI Um-Q :4Z'U3.'OQ17'zIF7- -'ZIzmlQmO-4 S.Q zswmm. K : G- Z-rw'-ng mfhm-D5 -1' ' 'ipln -Q '-'5 -N- ZW: Qgb- -1: :Dwi C --UQ P 1? ' ' ' Am 4 ' TU-UCUPG, :Q-Q Q Q S OQ'?,!PUg Fm-2 3' QU: nam.-32'-UDQNJQWUWQ fl 2:39-m :.4cn'i3-.Q.-4 'NSD 1-QCZ45-N.Q,.1W7m:,m 15-.,.F'H'9f 0.3213 Q Q Q ' 'MN' imc' fewyzbggff' 5f,U5.2' J01 .f.5U1mr'QP 'PPO' O-ww 'opt-rj' -'GWB ' 217 OU- ' N: E0-35:'?Dq2m5 OO' mF'Ug I-Omg-'Y f'vF1 S S Q .-mg Z O H -1. 1 Gwinn. :.3Nl' n2,Q,o.,,,- Faq ,mb wkgvv-. Cm-lj., Fw.. ., J 3D.w005-an 54-qi :aww Q, C,m:,-I -12 Q Q Q w cJ-751' 511 'QQ-7':'.,. :Sw Q 4--ng'-Q1fv,,n -Qr GC go. 5501141 sniqpw -'Q I--C Q --Am wife TJJ9, :Em -4-wo ,Q Q Q QQQ E?r3QQZQ5gQfa?3Q2Eg5 vga xgEEQ?Ea s55sgg555msEm5 QQ? SEQ? F522 555ggg2i33szE5ZwgQE5 33 QMS QQ --f , , '1m , g-. Qrv ' . 4: N., -1 I-fn .-.' . :1 ,-V., ru 4: -IQQ ... -Q ' C vw--rj 5'-' , -Q. ro if mmm WO ml- '3Q4:m Em.-v DV' O f-f3 '5 14 --Qf'OQ-J -Z - ,Q :mn --- GP' 0f CQbf l'Q-Q I Z'-'U 3 rv ' x QS Cfiggm QRQW' ni'-3,m,?,reQ-O E-mg' ,, :QPQD-OZ - S5-U:-sgc, 3,39 miin FI Z2 C0 'G234 a:U,rQ3m CQ -Qmcm ' 3 QQQ 1-fo,-,. un GCN---3,-1O..,: :sm-1 3:5 on 5 B, -1- 3, .mm-O.. J 551: 'PQQ gl Q33,-O4-'m2 .H ,.,-.3 -,T QQ S :1 CY' --'53-'FD:. oNmfl mfr' 5 DQZDFQ . :Q .T 5. ff D C4 - JN -'EQQQOQTQ4 wxv Q, Q mf' 5: QQ aim of gn-m 'zgwgnv :nw Q gang: wg Qsw QP 'Za is 5 Q2 as 'w'ZwQw Wg JU- an Q QQ ggff, gp, N' C. mmf- gym 053 :s -0: :W P7 ... CD51 2. gow mg an :1- Q V' QW' E,-1-1' - 'Q'--271 :QQ QQQQ Q . -. -nA 53,.,..D G., :Q ---f-.3 :N IAQZ om ,Ng-1.,. .C - 5-f UQ WMD Z 210, ff. QQ Q QS P? - 2- 'TJ '4.-Q 5--0 mf! mv Ozrvf' 11 'A UV- :Q wg: -:s 0 53.91. Q0 ffl 5 - QQ Q .QQ - 55 . 4,,- '-5,500 51 ' E-:FV . :Tn .4 '-rl :sm-. A- C 5 O mm 71,-0 c O - Qc QQ Q QQ 3C 3-1 'Ja Q-fm,-3 f-v Nw 37 , ff,mQ . P ...Q W-fm -1 3 - QQ Q IQQ F5 S3 m5Z m?22, QP Q52 :C Q QV2 P W m 4 mg of E HQ ESM QQ :s, F, 3,- fm'-1. -m mg- Q4 - 5 m 7. 5 om Q ' 35 QQQQ Q 2 - -' Q acf . UQ- ' Q Q F - .Q w - 'M ' H Q'QQ QQ Z ' rn 'n - VU M 5 :ww :J - . H U '. U 'Fl- QQ IF' 5. ..fQw ' 'U 'UPA-SQ .' - 3, 'U 1 Wm Sh -5 Q QQ x . - m 4 - - . Q EQ T1 3' 77 ms mZ Z . Q 3 X 3 E1 mA 'Z -'55 W 'rl fn 'f 5' To E QQ ' - -nf 'U 4 - Q H - Q QQ 'rl .' ' 'F T1 fo O0 .QQQQQ - ' ' ' WN Q QQ QQ Q QQ QQ Qi as 4 II? UJUUUJUJUJCUUUUJUUUUCUED 'UUUUCUUUUUJPJPBPBPDPDPZPZPDPDPDPDPPDP NN'4 5 ' ' SQ gjggogjgaggggjrqmwzqgjggargajga gjmmmmmrwwswwzb Wgbwwgjgzzzzzgggggggo pgbgggg-riff 25555555555-f QQ fum'3'0ZZUZm-Q-'izcopngzzwm -amcO 27 c-.Zfwwwmz-i5Mv - mr mQ'3O'-xiZwF1?PP?'UEoF'm 'Fi'l':A3595 N sg rZgZQpQ5E33ggppgggzfgpgzzisbwzgiagmmggniggggggggfmg Ffggwgiighwgwiiigg-gwf?g,UO55g+5 X 3 m ' '-'-' . 21' ' -Zrn' - '..-: - '-ax-. ' :. -- QQQ Q 55555Ugzaopgzi2?mZ92O?i.-NFg?Q5mgEg5Fg25w-Im3gf:?QQ Z?2?g25ag?531WFm75fP3?E252zEx9QQ CIQQN QQ .- K.. . -lx Z-mn-np x'mm,: rv: w mo ,o .' ,W rn 31 r' c 4, -c,' 47-..-,Q :,, g P c: QQQQ QQ mfgrvgbifmmgm 'P A'7'I'r-I'1'4uQ0V'Z- ZW.-P m'Q-55'UcI:'E7USZm7Zz Fmfig OW9'mfQ 5 4OmQQf'mz-4O'Q:-Efmwif' 'NQQQQ 53 '1'o3Q 5 2U'U'3,3QE72?QZ39QomWC'Z'm Qwgfofuml' 27's-ZS:-c-'wig 7 mwO'QFf4'mf'mS51f 4f1 wo 10-ofhmgm E QQQQ SQ 'nzmuw -nmOg:11S.4 zfw-w -Owmm'U'Z -'H .wi 'L' -wr-m0 2-409 Ohms-15 53'-4'Crm4,,EU11mr-551 -- -,WZIM IXQQQQ QQ : 2 -XC' PMQ--mo'F'UZE 't':: 2-Fri-Z02'Q' Z 'U-l 4P3b :'Qn:F'U': Zr- -CWI 4:Q f'rr-.mo--o-WW527' 'ff QQQQ Q - ' U3-ff-QCD. N -NU. 324 ' -- BZ W- 'Wg-.Z-I . - '11 O' - Og Om am ... CZ. ,.-N 'F1 F' . Q' 3 If IPIWUUQQ E70 '4---'N 74 UJ' Q 9- 5 0 i elm' -1 m ' r- :Q ang -1 O-lTlf'V 1 0- N ml- Q W3 EU? U- - 31 ITL 4 Q , .. U, C. O... - UZBA :Tl Omwy, po Nga: QM: U ,I-. . 3-.. Q .... ffg I- :JUJQ -.3 sofa ,. Q QQ - - . P o -. Q.. No. 39 ff-Q - :. :O - C 'V Zi: 5 Q .vw -, - . m- ummm mmf-fwma T1- Q3 0,1 Q NEED Q'-GSO'-',,,: 3 1 :xg-mane! UF: mo- -Z f-v-nm 5-ma fzmcr--..-Oo.Qo CU--5: r:.f.5-3 Tl, U, QQ FFJQOOF. E.,,: my m - 0513. OCQJ- Sf - sa, wg., Q :QC-UOCQ. si: -. 5 ,.. wgnf --- O: -'uwaognffgf-2' OBQQ rf On QQ Qwmo- n - - '59 -- --OmCIbZ'f-f fvcw Q-' -I '5'.,-,33,.., Umm If-44'Oog.:4 ,.--.-.'uP. ca-' F:-i1 Q Q 'U U7 'Q 075m rv- H 4 -'fl 0- - UU--NME-Omg' Q Q9 510001. QQ 11004 '4-1 -14 mac--Q11 Q QS 'T1ug'UA 'I1 97,'Tl.,Z' ' 5-5mg,,Ull g ---' ,HNCOC Q mmg. 42. 30-UQDIQP ,.4 SSD' mf-f Q, 4 4 .,-Q-, - -'O-4-- ini- 0 Q yxxxxxxg QQ 'WFS' Q4'2 Z3. K, -T O- ,'5 'ZOUW'f5'A 53:1 :ffl N- FH-:moz Qo -'w:ZU9'Z: Q SVSU: 55 2 0:f cnf-EEN Q Q NW svn? mm -9' -Q4 3 ZC':g'p'5'-5'U '1 01 O. ZUNZ :sf DME , 'T'v 'B '5'3fAD 'JDJ' C 'Q'?f 3 Q Q ff-li: '-inn 5 ..-1OZ.f-'N Zora. E. Z5 SE. 93. :TNPPHU-1 Q BO 5 Cf, :x Doo gf- T1 52. Q Qs X , ,. . 0' S 'V 5? Q-Q 9'-1 msn -3 Z ' cn mmm Q. -Q: 'FM U1 -000 3 ':5C'U :1 P :TI ZW - Q Q S 570139 -'U-5-' Qc D 5,03-S1-fi ' - ' 5' 91:11 0 mnpmbw' :J O33 Q '5 f fQ 091 cs--b'593:s Q Q Q :SEN 91:11 - 5.-8535, 5-:D -gf UQ.-,ff ot :gQ..4r UQ any :x ..,m'gn-1 0- 52, :fo-5.5. Q Q Q u3 w3PlT1 20 JP J 5 '1' 9--Q 'V ' 27' 3 m r1E5' 5' 'pi 5' 'DD S5 P FQ- -1:1 Q Q .X 5.1. ...vi . F, pub... --. Um rrvry-rl H- L4 ..,.,O Q U :sm L3 . 5 on Q Q Q m VVQ, -1 - P '-'Sim N3 3 - --'Q Q ?n 'U I '-' . QP' -1 I X L Q 2' 7 ,g W F BC lam Q2 Fwy ?5 Q 1 SS a is 3 Q2 3 W -nm QQ QQQ QQ sf' .- QT. wg, -34 3,-1 gn - 'F' ' fa: U O ' gr 'Q Q Q Q mo 71 EU, 3,-. Q - 3, :zv m I' Q2 :,- 3 O 71 -:TTI Q Q . ' . I Q' ' 'I 1' N .12 52 Q?-i Q FU- Em 1 E- H 51, +1 Of Q QYQ Q ' . . :. Q Q E '3 N' E I W m S Y Q Gm U Q Q Q 1-Q Q. ' S 1 : Q UQ- Q - Q Q 3 2 Q ' 9 T 3 51 F m 5i,Q Q ' ' t ' Q 'Q i-Q Q Q Q Q Q Q Q X , 4 X 2' iiixgixxxijQQQQQQQQQQixTxQQQQQQQxxgtrtrtttttrrrxtr2:1XQrzrrtbrttrrrrrtrrrrgxxx QxxuxiwiwinixQQQQQQxgQQQxtrrrrxrrtQQQQQQQQQQQQQQQQEQQQQQQQQQQEQQQQwivQgxxxxxxxxxgrr:XtraQQ:XrrrrtrtrttrrrQrtttttttttrttttttxEQQQQQQQQQQQQQQQQQQQXNixxxixxxi t 'Q X - Q N Q ' Q Q.,Q..Q..Q.M.QQ.Q..Q......Q.QQ.QQ..Q....Q 4 X x Q 'D sn an N w Q1 Q. A 5 1 5 5 1 5 5 xxx Ns K QQQ 1 11 M A Q., , Q f . . 1 ' I . V Id- I 4 ' , ,. ' I awffmnfw-if win-Trina-A1 7 it21111111111111111111111111111111111111111111111a11111111111111d I . 11 411111111111111111111111111111111111111111111111111111111111111Z at Z f f f 7 1 -4 RVL L f I 4 4 Z 2 V 4 1 4 5 4 if af 1 1 1 f f f 6 2 5 4 if fir A f .1 4 f 5 f ' -A P LMMZCICI USNRF ff 1 1 BRAAK, GAIL VANDEN, Znd Lieutenant, Aviation. FISBECK, INLEY -. - - rl SSS, - - . . . f f Z BRAUN, A. C. FISHER, RICHARD G., Ordnance. Z Z I 2 BRENNER, ERWIN C., Private, Engineers. FITZGERALD, ROBERT DRAKE, U. S. N. 5 5 Q if? BREXVER, RICHARD W., U. S. N. FITZGERALD, LLOYD, Sergeant, Infantry, A. E. F. gi Z 9 I2 BREWS-I-ER, HERBERT G,, U, S, N, FLADOES, IVIARTIN O., Private, Hospital Corps. 3 I Q Z BRIGGS, N. R. FORSYTHE HARRY-IH.ECanadianAROgal:Flying Corps. Z 7 , f BRITTINGHAM, LOUIS. FOSTER, ARTON ., ngineers, . . . 4 7 Z 2 BROWN, GEO. E., Ensign, U. S. N. FRANK, R. A., Sergeant, Engineers, A. E. F. 2 Z Z 2 BROWN, HARRY H. Private, Machine Gun Bn. FRAWLEY, JAMES R., Asst. Paymaster, U. S. S. Shaw- 5 Z 5111111 BROWN, REUBEN, U. S. N. mutt- 4 311211, Q Z2 Z, BRUDER, EDGAR G., U. S. N. GALLUM. EDWIN A-. Artillery- gg gg Zz ZZ BRUEGGER, ERWIN K., Private, Infantry. CAREER. FRANK W-. Hospital Corps, A. E. F. M 24 BRUNS, DARWIN, Medical Corps. GARNER, EDW- G-. Avlatlon, A. E. F. 1: if X 1 1 1 . . 11 , 1 Z2 Z2 BURGESS, C. W., U. S. N. R. F. GAVENY, STANLEIOH K., Aviation. gg ZZ ZZ BUTLER, MERRILL F., Sergeant. GIBSON, J- CURRIE, Infantry- 52 Z5 sg +CAIRNs, WM. B., Sergeant, Infantry, A. E. F., France. vGlBSON, PERCY D., Chief Petty Officer, U. S. N. 72 jg Killed in action July 30, 1918. GILDERMASTER, EUGENE O- , 22 if Z' Eg CAHOON, EDWARD D., Ambulance Service, A. E. F. 96LDERMAS'ER, H- EOYIJOYSI- CK-HSE AYUIIXYYECF xg 4 CALLAN, J. G., Government. ILMORE, LBERT ., ieutenant, viation, . . -. 95 gf Z' 2 CAMPAIGN, HARRY JOHN, Chief Petty Officer, U. S. N. France. Died of pneumonia October 3. 19l8. Z CARLSON, GEORGE, lst Lieutenant. GLEASON, BERNARD ROBERT. C-21DC211'1 A- E- F- sg ZZ fi CARPENTER, CHAS., Lieutenant, Naval Aviation. GLEERUP, XVM. WESTON. . gg W 'Z CARROLL, LAWRENCE K., Sgt., Hospital Corps. A. E. F. GOEDECKE, WALTER S., Znd Lieutenant, Infantry. 92 gy f f Z5 13 CASS, DANIEL E., Aviation Section, Signal Corps. GOODING, RALPH. - E Zami? 2111? CHARLSON, MELVIN R., Assistant Paymaster, U. S. N. EOTPREIEOIIEI, If-IIENRY L., Aigiaxonllk E F g Z 7 4 CHASE, LYLE R, OULD, . ., ieutenant, . ., . . . 5 X 5 5 CHARMOCK ROY J lst Lieutenant Infantry GRASHORN ROBERT A. Pvt. Hospital Corps A. E. F. 4 K y 5 , ., , - , . . - 7 4 4 if CHIPMAN, HAROLD R. GREDE, WM- J.. 1 f Z 2 CHUDAEOFF, GEORGE, Private, Hospital Corps. GREEN, J. H., Infantry. ' Z CLAYTON, T. Z., Znd Lieutenant. A GREENFIELD, RUSSELL S., Sergeant, Ordnance. 5+ 5 Q 2 CLEARY, MAURICE, lst Lieutenant, Aviation. GREGORY, MAKLEM W., Corporal, F. A., A. E. F. 3 Z Z CLEVELAND, CHESTER, Cadet, Aviation. GRIEVE, GILBERT G., Naval Aviation. 2 7 Z COCHRANE, JACK D., Captain, Q. M. C. GRISWOLD, MILTON P., Naval Aviation. gf Z Z 5 COFFMAN, RAMON, Hospital Corps. GROSSE- JOSEPH A-. COYIDOFGI- 2 Q ffl? COLE, HAROLD H., U. S. N. GURNEY, WM. W., U. S. N. k Z Z ' ' COLLIER, ROBERT, A. E. F. HACKNEY. J- 5- .IR-. COFDOYHI. Engineer? 3 Z Z Z COLLINS, CARL H., 2nd Lieutenant, C. A. C. HADDORF, CARL, 2nd Lieutenant, Aviation, A. E. F. g 5 Z Z COLMAN, CHAS. E., 2nd Lieutenant, Infantry. HADVES, MARTIN A. Q Z Zfngg COMPTON, DONALD ELLIOTT, U. S. N. EAKER-j MILTON A., Privage, Infantry. Igfwgg gg 3 COMSTOCK, W. T., Private. ALL, OHN LExANDER, ergeant. 32 4' 4 CONGER, PAUL S., Corp., Q. M. C. HARDELL, ROBERT E. 45 Z5 2 CONLEY, CREDE H., Infantry HARDY, EARLE W., Aviation. 22 3? Z? ,Z CONLEY, EMMETT J., U. S. N.A ' A ITIATCH, VERNON V.., Sergeant, Hospital Corps. 42 3 CONLEY, HENRY HAROLD, Chief Electrician, U. S. N. HATCH, ALLEN, Private, Engineers, A. E. F. 5, ,Z Zz fi CONNELL, ARTHURJ., Medical Corps, A. E. F. HAY, WM. J., JR., Field Artillery. gi Z1 ,Z CONNELL, JOHN W., Private, Hospital Corps. HAYDEN, CLENIENT DONALD, Private. gg 5? fi Z5 CORINE, GEORGE A., Inspection Division, Ordnance. HAYES' LOUISJ-, Aviation. 9? 27 CORSTVET, THOS., Engineers, A. E. F. - HAYES, MATHEW R., Radio Electrician, Navy. 7 '5 COSGROVE, FRANK W. HEALD, GLENN F. 4211117 1 7 3 Cox, OHN VANBRUNT, Znd Lieutenant. HELGREN, FRED ., Yeoman, U. S. N. Z 5 1 1 . . . . . 1 J f 1 Cox, LINTON A., Ist Lieut., Aviation, A. E. F. HEMSING. JAMES F.. Private. Marines- 4 A Zi, C G CHAR ES l f t HENN ERNVIN J Aviation 7 7 X f RAI , L , n an Ty. A - , ., . - 1 , X Z KCRAIG, -HARRY, lst Lieutenant, Aviation, A. E. F. HERRICK, D. L., Sergeant. Engineers Z 5 Killed August 30, l9l8. HERZ, ROBT. T., Private, F. A., A. E. F. 2 5 Z g CROWNHART, J. G., Znd Lieutenant, Infantry. HERTZER, J. O., Sergeant, A. gi' 7 2 CRUMP, KENNETH M., Corporal, A. E. F. HETH, LOUIS, Naval Aviation. Z Z Z 2 CUNNINGHAM, LAW., Sergeant, Ordnance, A. E. F. HEWETF, FLOYD F-. HOSpital Corps, A. E. F. 5 7 . 2 CURRAN, FRANCIS R., Lieutenant, Infantry, A. E. F. HITCHGOCK, M. L., Private, Infantry. 3 Z 4 . 1 . - - 1 y Zi 5 EURRAN,-JRELFIg., 2nd Lieutenant, Infantry, A. E. F. SIGBIEE3 N. B., N3vglIAviation. I 1, gt Z y 4 URTIN, . ., ngineers. ' ILL, ILLETTE, n ieutenant, rl antry. 4 y Z 3 CURTISS, FREDERICK W., 2nd Lieutenant, Aviation. HINDMAN, HARRY H., Instructor, U. S. N. Z Z Z Z DAME, RALPH WARD, 2nd Lieutenant, Infantry. HIPKE, Lucius W. 2 Z 3311112 DAVIS, MELVIN K., Industrial. HODGE, HOBART V., Marines. idling gi 3 DAYTON, WILLARD L., U. S. N. HOLCOMBE, R. F. gf Z2 2 DODGE, HAROLD A., Private. HOLE, DEAN. D A H 14 9 DOHR, DONALD, Private. HOLMES, PRESLEY ., rti ery. sg gg if Z BOONANEGERALDJ., Aviation. HOLMElSi G. L., Iiergfagt,-Infantry. 11 A 11 I 4, 1 OYLE, LMER M., U. S. N. HOLT, AROLD ., a io. 1, M Z3 gf DREW, FRANCIS L., Zntl Lieutenant, F. A., A. E. F. HOLzBERG, P. R., Ordnance. if ZZ Q3 jg DREW, FLOYD, Aviation, A. E. F. HOOD, ROBIN, 2nd Lieutenant, Infantry. 3 Z2 2 DRIPS, WM. C., U. S. N. HOOK, H. P., Sergeant. 52 42 7 DUNKEL, ELMER S., Government. HOPPE, PAUL E., Private, Coast Artillery. 1: if 4, 1 , 11 ,y ps 4 EATON, HAROLD A. HORN, WM. E., Lieutenant, A. E. F. 25 if W 5 EBBS PAUL ALLEN Private Field Signal Bn A E F HORNADAY H B 55 If 3 Z , . . ., . . , . . 1 1! Z5 If EDMUNDS, WADE M., Corporal. HOYER, ED. L., Cavalry. 22 if Zami? IEGER, HAROLD. HUMMEL, FRED E., Americangfgld Service, A. E. F. jgmjg 4 4 ICKE, CARL A., Lieutenant. ILETT, WILLARD E., Private, r nance. f 4 Z Q ENDRES, HUGO J., Captain, Infantry, Canal Zone. IVES, CLIFFORD ELIHU, U. S. N. 2 Z ERDMANN, ARTHUR A., Private, Ordnance. JACOPSEN, ROBERT L., Army Field Clerk, A. E. F. gi g Z . 3 ERDMANN, W. V., Chief Petty Officer, U. S. N. JACQUES, J. T., lst Lieutenant, F. A., A. E. F. Q Q Z Z ERNST, L. W. ' JAMES, BURTON E., Private, Hospital Corps. 2 g EVANS, HARRISON,.U. S. JEFFERS, AUSTIN P., lst Lieutenant, Infantry. A. E. F. gf 5 Z Z EVJEN, HENRY, Private, Signal Corps. JENKINS, LYLE NEWTON, Znd Lieutenant, A. E. F. g Z 5 ig EXLEY, ERWIN W., Industrial. JENNINGS, B. CANPORD, U. S. N., U. S. S. Oklahoma. 5 f ' ' Z FAITH, DON CARLOS, Znd Lieutenant, Infantr . OHN, HENRY A., Lieutenant, . M. C. 4 f 4 1 5' . 1 y Z FELT, GUSTAVE R., Marine Corps, A. E. F. JOHNSON, CHARLES W., Ensign, U. S1 N. gi, g I f ' 4 I 7 Z 4 A 4 4 2 6 A iz fi' 1 1: 1 4 j 75 4 4 f Z- 2 4 7 M A g i HKMW111x111x111X111q11111111111151111553313311111111Z1ZZZ1m1111Z1111111 11Z1:11111111111111111 111111111 111111111115 I1 111111 11111111Y111x11i1111Z111111 111114111q Z V L Y . . . 5 35 M 1 , 1,1112 4 d 9 11111111111111111111111111U111111111111111111111 1 5111111 1 ' I ' f NK S R R R R R R R S R R R R N R X R Rt R X R S S R R R R R Rx R R R. R: Ns Re R: R: RE Rs RE RE RX: RE N: Rx: XS Ri RE N3 x SX R S R R R R N R R N R E R S S E X R R Page 372 W Ill 'I' if i' 'A' i' 'A' W r IZZZZZZ, -sir 'k i' i if if fo s s 5 E 2 1 2 , : 4 4 , E 5 5 1 2 E 4 1 r 4 : 5 15 XXXNXNQ X Q X X Q X X X X X S Q X X X X X X X X X X X X Q X X X X X X X X X X X X X X Y Q X Q X X X X Q X X S S ' 1 - 9 I X S 2 X X E X X X X E X 7 5 1 155151 4 1 555115151. Z lv' v ,,,,,,,,. ,551 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXXXXXXXXNXXXXXXXXXXXSXXXXXXXXX XX JOHNSON, HARVEY C., Private, Infantry. JOHNSON, HONVAIKD L. JOHNSON, . BERNARD, Corporal, Ordnance. Joi-INSON, OSCOE E., U S. N. JOHNSOE RUSSELL L., Private, Infantry. JONES, ELBERT W., Government JONES, GEO. G., Yeoman, U. S. N. JONES, JAMES H., Seaman, U. S. N. JUDEVINE, W. K., U. S. N. JUNCCK, FRED W., Private. KAISER, WM. T., Sergeant. KANE, EUGENE. KASIKA, WM. H., Ordnance. KELLOG, HORACE B. KIRCII, J. G., Ordnance. KENCHEL, JOHN. U. S. N. KING, CHARLES l'lOXVARD, Tank Corps KING, RALPH, Seaman, U. S. N. R. F. KINNEY, J. L., U. S. N. KINZEL, LESLIE, U. S. N. KIRCHEN. PAUL E., U. S. N. KLASSY, ERNEST R., Private. XXXNXXXXNX NX -k KNAPP, HAROLD C.. Private, lvlarines. A XXXXXXXXXXXXXXXN KNUTSON, O. ELMER, Ordnance. KORNREICH, EUGENE, Aviation. ty KRAMER, PAUL S., Private, U. S. Infantry. t. 1 1 5 , 5 1 4 5 1 1 Z 5 1 5 1 1 1 A it 'k if if 14 5 1 1 5 5 5 5 5 1 5 1 51 If 'I ff 5 5 5 1 1 5 5 2 t, i Q gi gi' 'I 9? I KRESS, FRED R., U. S. N. I KRUSCHKE, WALTER F., Private, Ordnance. KUENZLIE, ROBERT L. XCQIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX'SXXXXXXXXXXXX KURTZ, PAUL H., U. S. N. LACEY, DAVID R., Znd Lieutenant. LADXVIG, W. J., Private. Artillery. LAMPERT, E. H., Ordnance. LANGE, W. H., Private, Engineers. LANGEMAK, WESLEY E., Field Signal Corps. LAPPLEY, GILBERT F., Infantry. LARSON, GEO. W., Private, Ordnance. LASHER, PHILIP H., Private. LEMM, MARUOG CARL, Hospital Corps. LEHRBAS, LLOYD A., Lieutenant, Aviation. LEONHARD, GEO. J., U. S. N. LEVIAN, ABE, Infantry. LEVY, EDWARD DAVID. LINDSAY, RUSSELL G.. Ordnance. LINEHAN, RAYMOND F., Lieutenant. LINK, OTHMAR C., Yeoman, U. S. N. LINS, CLEMENS M., Field Artillery. LITTLE, HARVEY BONNELL, Marines, A. E. F. LOBERG, JESSE B., U. S. N. LOEB, RALPH E., Infantry, A. E. F. LONSDORFF, A. J., Engineers. LOOMIS, CASEY VAUGHN, A. E. F. LUCAS, SPENCER A., Corporal, Aviation. LUHMAN, ROBT. A., A. E. F. LUPTON, A., Corporal, Infantry, A. E. F. MCCARTHY, E. J., Signal Corps. 3 MGCRAY, SIM THAXTER, U. S. N. 3 MCGINLEY, J. R., Captain, Machine Gun Bn., A. E. F. 2 'McHUGH, KENNETH, Field Artillery, A. E. F. Killed 1 in action. MCINTOSH, ROBERT B., Lieutenant, A. E. F. MCKAY, JOHNQJ. MCKEAGUE, JOHN J., U. S. N. ' MCMAMEE, S. L., 2nd Lieutenant, Infantry. MOMANUS, JAMES F., Sergeant, Infantry. QXXXXXXXXXXXXXXXXNNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX MCWILLIAMS, GERALD S., Aviation. MAACK, F., Lieutenant. JONES, ONALD C., Znd Lieutenant, Cavalrv. KAHN, HERBERT lVlANDEL, Seaman, Znd Class, U. S. N. KAYSER, PAUL, Sergeant, Field Artillery, A. E. F. KESTER, HONIER, Sergeant, Signal Corps, A. E. F. KIECKHEFER, HERBERT M., Pvt., Hosp. Corps,A. E.F. KOENIGER, EDWARD RUSSELL, Ensign, U. S. N. KUENZLIE, DAVID B., Sergeant,F. A. A. E. F. LA FOLLETTE, PHILIP, Znd Lieutenant, Infantry. LEHMAN, DONALD G., Private, Hospital Corps, A. E. F. LEOPOLD, FREDERIG, Znd Lieut., Engineers, A. E. F. LOBDELL, HARRISON, American Transport Service. LORIG, ROB-'T. A., lst Class Private, Signal Corps. MCCABE, WM. JOHN, Sergeant, Machine Gun Bn. MCCANDLESS, DONALD, Field Hospital Corps, A. E. F. , MGCOLLUM, GEO. WILLARD, Private Infantry. 2? MCCOLLUM, EDGAR D., Private, Engijlaeers. McCoY, BRUCE R., lst Lieutenant, . P., A. E. F. MCMURRAY, ORA, lst Lieutenant, Aviation, France. MACQUAID, JOHN H., Private, Infantry, A. E. F. RVLL MAILER, ANDREW ROBT., 2nd Lieut., F. A., A. E. F. MANDEL, WAl.TER R., Yeoman, U. S. N. MANSFIELD, ORAL W., Lieutenant. IVIANTONYA, W. G., Seaman, 2nd, Class, U. S. N. MURCUS, L. PORTER, Zntl Lt., Aviation. MARKUS, NORBERT W., Zd Lt., Mach. Gun Bn., A. E. F. MARLING, llOBERT N., Motor Supply Train, A. E. F. MARSHAI.L, O. H., Private, C. Artillery. MARSHALL, CHARLES R., Sanitary Corps. MARTIN, FINELY F., U. S. N. MARTIN, JOSEPH, Aviation. MATZEN, HERBERT J., Sergeant, M. T. C. MEIHACR, ALBERT W., Private, Mach. GunBn., A. E. F. IVIEINKE, NORMAN T. MEISKOTHEN, EDWIN E., Coast Artillery Corps. MENGELBERG, WALTER R., U. S. N. MUELLER, W. E., MEYER, PAUL, lst Lieutenant, Aviation, A. E. F. MEYER, LANVRENCE, Ycoman, U. S. N. MEYER, ROSS B., U. S. N. MIKNA, ALOIS, Private. MILLER, CHESTER J. MISHELOW, EDWARD, Sergeant, F. A. MITCHELL, JOHN G., lst Lieutenant, Infantry. MONK, ROB'T. WM., Yeoman, U. S. N. MOORE, CHARLES F., Royal Flying Corps, England. MOORE, DAVID W., lst Class Seaman, U. S. N. lXflOORE, WARREN G., U. S. N. MORMAN, WADE l'lAMPTON, lst Lieutenant, A. E. F. IVIORSON, ORSON S., Private, Q. M. C. MOSS, CHARLES W., Harvard Radio School. lXflOLlLTON, FRANK S., Private. MUELLER, EMMET J., Znd Lieutenant, Artillery. MUELLER, WALTER EDWARD. MUNI, ARTHUR J., Private, Ordnance. MURAT, WALTON B., Industrial. MYRLAND, EIEL, Ist Lieutenant, Hosp. Corps. A. E. F NADEAN, LOUIS B., Signal Corps, Aviation. NAFZIGER, RALPH O., Infantry, A. E. F., Russia. NASH, GEO. W., Lieutenant, A. E. F. NECLEY, WM. H., Znd Class Electrician, U. S. N. NELSON, ERNEST D., Private. Sanitary Corps. NELSON, D. VANARD, Infantry, A. E. F. I SNELSON, HOXVARD G., Foreign. Canadian Expedi- tionary Forces. Died in Stormer, France, of pneumonia. NEWBURY, EDNVIN, W., Infantry. NEwcOMER, D. A. NICOLL, EDWARD WM., U. S. N. NIEBERGALL, FLOYD A., Marines. NIGHTINGALE, KVM. J., Radio. NOER, HAROLD R., Bandmaster. NOTBOHM, ALEXIS W., Hospital Corps. OBENAUER, V. J., Aviation. OLIN, W. G., Sergeant, Ordnance. OLSEN, WM. O., U. S. N. O'LAUGHLIN, JOHN R., Lieutenant, Infantry. O'MEARA, WALTER A., Private, Coast Artillery Corps. ORMOND, ROY B., Aviation. OSLE, WALTER, U. S. N. OSBORNE, R. H., French Service. OSGOOD, WAYLAND, lst Lieutenant, Infantry. OVERTON, ROBERT E. L., Lieutenant, F. A. OWEN, RAY S., Captain, Engineers, A. E. F. PAGENKOPF, HENRY A. PAIN, CHARLES E., Corporal. PALMER, JOSEPH F., Sergeant, Iniantry, A. E. F. PALMER, RUSSELL R., A. E. F. PARK, BENJ. H., Tank Corps, Br. Ex. Forces. PARK, LYMAN B., 2nd Lieutenant, F. A., A. E. F. PAUTZER, FRED M., 2nd Class Seaman, U. S. N. PEPPER, JOHN PHILIP, Lieutenant, Aviation. PERRIGO, BURTON R., Znd Lieutenant, Infantry PETERSON, CARL E., Cavalry. PFAHL, CHAS. ALTON, Coast Artillery. PINTHER, HAROLD O., F. A., A. E. F. PIRSOL, T. R., 2nd Lieutenant. PLUMB, WALTER GERALD, Aviation. POINDEXTER, EARLY W., Ist Lieutenant,EAviation. POLACHECK, JEAN L., U. S. N. POLLARD, SETH W., Aviation. PORTER, LYLE P., U. S. N. POWELL, HENRY M. POWERS, GEORGE, Ordnance. PRATT, HAROLD J., Ensign, U. S. N. PRESSER, ERWIN J., Sergeant, F. A., A. E. F. 111 1151111 1111111 11111111 115111111511111111111151111111111111111111111151 15111111151515111151111111111151511111511111 111 1 11111111111511111 51111115111111111111111111111111115111,-1 1 11111115111111 1111111 1111 11 11111115 1114 f 1 , . 1 1 5 W55155115151111511555151515,5,115115,5551551,551514 7551511555115 5511151151551,,511515555,5155515,15,555510511 , , . 5 5 5 I 1 5 . . A-Ar 9 ,, .. , if 1 11111111111111111111111111151111111f1111111111111 1 1111111111114 9111111111111111111111111111111111f111111111111111 WWW 1 Page 373 fffffffffff I 11 ,,,,,,5,,, 55 , - 55,55 ,,,,, 1 A , If i i i Y 'k 'k f ,,,,,,,,,,,1,5,,5,, Q5115,,,,5115,,5,,,115,,5,,,,55,,,,,,,,,,,,,,,,5,5 ,,,,,,,1,,1, f I 7 , 5 1 5 W N 'U xa :IX N XX., N -:X 5 h Q Q I Q NNXVANXNN 'xN N'Nx Q h Qxxxxxxxsxxsxsxxx xxxXxxsxxxsxsXxsxsxxsuxxxsxssxsxy A X X 1, if i- 1- 1- it :W 1 QQ 1- Q X Q- Q- if 1- M' if 1- 1- N- E- 1. S SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXX XXXXXXX XXXXXXXX XXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.S S X X X S QS Xi,,X X X X 'X X Q X X N- X X. X cncncncncncnmcncnmmcnmcnmcn X -ff25229252522aa-zzfa122vw:af:?QQ2a-rss? X1 X gm-4-4 Hmf' of . ,. My :,:,:,3Fo.4 mmmbbfb - Y' Orom-4QgmomwmmmcoZ P 0-4:-mz-:,mmcq rf1 X- X 5 X z'N'I'31341555Qgxxff'SEMJQUggzqfgigzzzzmmmwmirW Wf 7JCO05 '3'P?'0m mz-XmmrL-fnmxw-mmmUm :zP'4x0wW11wNZm X S Q X mooo5 .yl4Em-22712-Zz-X5-,..E-Inf-my ---- -4-az:: ZUr'f,IUP1!'1I2f'4'j,m5Cg2?'W,Z --'1:wm,mwgOZ71w71mI4O,'go0mrQ5zZ2:-I?1'5' X 'X Nik '-W-W-pmg bw' x fnpww Z'm-m7'0:1'O7O7J'r1m ' 3'?'z 5pz':1N-Z-igawmrl U 'U '-IZZ9'zl6'i 7 Sw m5 '-u1mfT'ZP-Z X13 X X OUIJZ- 77 fn rl- EIL- mp - . QWFWZZ ZOO- - - . HIWUKUX- -U uv ' 405050 I' . U? -n. 357101 . X X X 5 fmiiirm' 5: FWICUL-:UZZ3'35?f'Z5', P154 Oigwmm -SPPJVU7'-x 1mQ-7'Z no c XFBMWCZZO 02-350 K-21 3 'Fm E. 3 X 'Tl , . cz m C 71 , , 1 F' Q. L, Z O o 4 m-Z X X X gn I 71 . l- ,Z, Z A :X W o -0 71 , Db 71 77 X X S X -5,EZ2Z?:..nWQ,i'f1OEg2'Zb7joQOZIQ-mga--aUmE29E2gZ2Sr -2z:'UEufZ::XV5wP7JbE-Fzgomofigfl y,wgwZ:I:ZoE SmFfgjL7mWy X Q 5 5 11040 Um0mU '-P 'QF'- : Gm- FZ 'EAW 'iibfffoqffl :c3ZF WFW2: r 'U I'm3'U'53'7U4Z 4'3'f U' WFFWZUVH S 5 X X -Z-rf -XU 3:5 viz- U--'wp 2 O Q -fr-Wm wwf-C z F K mO3'F1w0:uCS'r1gz'wz E11-H01 :Wy-103-2 1-1 gunz X. X S13 ' ZUZ 55owZ4vwCUUm CL-U,5'-UWVZUW ---Ur-HCI'-I-5-3-?'f-2r'OZI'QWmWq ' :O H'::z7'h,Wf'UF.2-F:-'f :OQz1 'Ewa' iff? X X 'DFI Z5 -1.55m -3 :-- -rn' JJ' 'wx 1' 7'QX4mq5' 'HwEcWUZ'42 HZLAC 4Z5O'r-43a -52 O2 Z ml-uw Z XXX X X -.- . UU mm- HCQU . ww' WI m 111 O mimi -m- 5 IFF, M-4 Loi- - Jn- F- Im- 5440- 1 0: ,Zu-cz: UC- X X X S 2 ' - 1 FUSQ5- wi F- FD PD- CTV FO: :. C- So nk-:DZ 5-IQIQ: rf1-- 1 Zinn-1' :sw D ZQUI- o' 01- - an - X. 9' 'E X S Q X AJ Nm? Z5-13930 l-gy jul' X ,U 511012 43- O-U-szj J w. C SZF' IP: - ' O... - I-3 Cgg H-U Qg. III-1 Zvzk -Ulu,-0 ,..: Z' TIUP- X Q XXX-XXS 3 Bw C0710---U1-,-42 m Cm-X :'U5' wffcn-1 22' 1-Sq? . ear ' F FPYOW- -Ol' Z-.3- Q-wfm J Zi '0m'E,7X:1-X --::E'5'w -U11'C S X XX TX - QUE 5- Z l33,Z' Q Elm' - ' 'So SF' GJD-1' 'Ummz l45!', C O--' 03 QE' 'f30m- w E, m9,9,-1ff- QSQJ! Q- 79Q fUZ. X Q N2 W F099 FDU' w- . UWC 9' OOM 4 0--'V - 23-9 3-:x ' FD so -'DON 4011 'C -5' 'g-sho 7:'Um 'D' H50 l :-Suu-1' Aww 'XX XX Z --ws. ' Q5 of' 2- 5 - Zh' 5:1 1. m r fam D-X :ff f'-- ff nr' -.- 42 . --,-D 'n- U-aw Q---5? m-- FD , 4, 2 523 ZZHFW' 3 'Big 32 Egg-1 E055 Z 3'-Q Z EEPT? Q5139E'g'-E-?Q'?lE??E z 3-'-: XX SX 5' af- 5 '11 cu: ' ' '-' - 5. .U - -X 'I Mffawrv '1 5 Q Cn-- ' 'ff -'- ,-,oX4O.5 1-X - P. XIX XX 0 up aw X gn. :S 59 nz, gnfrgv X: B 53: -Fr: gin P, ff gjjmmrv 903, 'Pm 2'UJm:s- - P. X XE XX yr rn- Q: ff- as 3 5m 5 022' X43 P ,., - ' gm- :sg 01191: I: 0. Nga: GOO XX XX :Z msg my 5 H :M Q aa P -2 W - H ws-nm PU ,fn 3, nf-BPNVQQ ssss NSN 5' 22- U74 H Q 'O 2 5:1 SX ' E2 fn 33 3, 3f 'G2:3 5113? .PQ -1 '59 M-5m XXNX gg XX ..' :15 '1 , o m m an Q -V 4, m rf Hn: Qt- - ff 9.5 lT15 ,,,w QXX X x 1 U3 . U3 I X4 , : ,., , rr XX X if X 5 X 202- 2- P' Q? 0? MP-fn W1 X- sv- -CRX X5 I 5 21 ' ' GS P P G S Q4 'im 9-5AmT11v-2 'm'kfJ'F1 N 2 F' ' . ' Z. - '- - . . :Q X Q S 21, Q 5 O X -3, ilg mv Z5 X, 7 H Q X - - . , ' ' .. XXX QQ Xi 3, 5 J 0 , RF- 3,2 - ' - Q XXXX X C -U1 -1 fn -, . :XXX QE XX X . , U I ,Q X Qt fb U, m un ITT m. 1 X: XX F7 . . '11 - -11 - , 1 QAXXXXX - - ff ,A-'1 XXXXXXX 'ra Z -n -n 'rm - SX HX - - - ,f 1 QQ XX f - I . X X ,V X S5 X3 1 N , XX X - ' XX XX X X- ' Xz:::XX .. - is V ' NNN 6 a a z a a xx .X - N X3 sX E7??5UWQJE?1j'?????9J??????55355555533 Lmf545425ff545255555555fffffgSQQQSf??fffff5f?5Ii?E37T'5'5E!E'E'E3E' XX XX ,,,.,.wmn .I -U rm 11-mv CCWWWO Irrztrmmmmmmwz-mwbb:-hz r- X -, XX XX C.....UmxzC7'7'7jE75xQw'f,:2Z,-UUUUUWWD-lm an-swcccvvzvo--'r'Z5,f f 'm-H-mmz1zl---on-1-aznwwz-:1:Io7jZ3 'Z,'0OE:-S2000 xx--. X5 EX SR' wC7'I-I'5- F -ITJZJP oooo -r-N Z?'O'L. 'NO--'.-zzzuw rf'mZ 'U'ZwWg-i7'4k--mz3 -wmgvr-f-of EXW XS 5X Q,VZ,Z'1'1-- :- 5-7 32-no'rJ5 ZzZzSl--' - I-Q73O7'ff1m7UUT1mv5'15 500l-2xO5F'SQUL-MO -',,'2 OQ-img-imzzzmmggzm XXXN NX 9 rzo-.7'7J 'DPg1.OImf5I ':u2OU3,' '-4,1102 'IPQO C-X710 S 'X.. ?:-NIE, 4wX,'O PUw U.-FOQ2:- ' :r'p'II-CU qfixx SX XX Z-af 2om,Pr- Wm, 1',,,,-- U3,::3,U,.. F050-'45, uf 2' CQ mm Oxwb I-ormiliiwm-',,3,1OZ,,f-m'r1O U, .n-x-4,00 XXXX X5 SX bmfn-IP-4ZW3':u Z'IE mZga-'67' 71:-r 4' Eimg, 7Uf'U'557O:CU'?'-4-.,7f'-:PCO--152: Ffwgmz- 7.12-'Oz--73: Us-mmo-S IXXXYX XE XX 2113, :X UmC-12WCP:ZfXU Z5:'Q..-nmbayl 5,2 UZCDXUQU F1 Egwfqm ,,,Cw,l'm,Q,X.. XqZ1.wm -47515 32,21 7-1202 7, XX X X: :X 3, mNmX.wvOw4-4.1 W- 1 -3-yi X4 .-f,,0g-,:- -3'ZCom:Z'.V'wWo'W7-m-If -S Z.4Cf,, WNW DP. XXXX QQ XX .wg ram.,-o :-0,m3,03,c:mCz,- 2 Q rn - zU'iU,4m,7,D m - W., . O Ogg- ?P:X:O-Z, 5-3,p7,w INXXXX XX XX - : 5 ' CL OZCIFDWO -77. Fr- TWU BU 77L.'X-'Cz 05' 4 Jvffl 'U I- uw- Jw UNU- o - Or- 55 wgggg- rn 5 V' SRXQ XS U3 rv U, jajjnm - J M' O' U' 77' PNK' 2. NFIEWWDZ Q-1:-sfgnyyuq' 3 F'-Og 'U-1 4 2 U10-E ,J rr C030 5' XX XX QC5' rv-E-nf mom Zjfg ' 31 :girl-ggrw 'Ik 2,51 91: 0-001 UQ 55 : CU-'H Q5 Tl -1 F-'EEN In VU' r- 4 Z' 'VF' zm72 'C N1 N ' 5 105'-0. -7'-Ow 424-r-Q :r 'HD - Qo r 0 05:12 -N5 0 'U -----CFD ww- 0o1hr1-- .3J'f5--cn -' H X: XX vgm. cm:-- W P o - W-, -. 4 mm--C f- -40, - 7o-.m- Jw, - Q- Sf or-, 04- -n 2 ff'-. . QI Q -ww 'no' 0 X X ' F- W 77 'L ,. zn . - ,,, :s P . 9' ... 'nc 'O cn A qw C . gz SSL-91l:,zZi5' 3- EQME, 299- RU, f' H Ugiw fSi'ErSgXf M532 6:15, 5-35402 QPOQ :ig Ea U, 5-5332-52315 p. Egfcagw, 5712? 933.3 tggiioz Q1 IS 92323. 2551131 Q? Zag gm ag-ZZ Eg 5, 14053 gg, . ggcg' Q55 HP, SWS X X rrj n m-RE, - mi? ' na' .nv cnc GQ 0 WDP '1-19: ' ' 4 l ' -W' 3,3 ' ww ' CTUY CD Z 39 D 'UQ-n 3 5 S X ,UQ ' f' yn 3Q.:sg -- P-Xl - 9713? an --- ':s-,-1 no -,O 00.3 5-. .swf-X ff Q 'Tl X X X X 3 D34 '11 FP, ,rp wo: D f-rn Q-3 . . rv N 3,-. '-Q -. H51-r f' fn- rn - - Q X Q X an 411 Zmmii , ., - ' ,X ZUJ3: rv Nz: :PC rn C Q. ,A f-f Um- O - m --F' u, X X X 2 5' 9 --2,9 X m Z-2--V 2 -a D--P ' Q Sinn, 2 0 'L wm PO nbz, PYP: X X 3 5' Q' '11 Eb :P -ng ' 33 im 50 320 25'-M5 E 5 221' 5 sl 0 353 mil E '3 'Pm af X -1 , I , ... - .:. -' i -, V. . , . En 3 5'-gn, ?' fn E' 5, 5'7 E ? 9-325, 91 3 39- nf Q 5 3 'rm E' E 2,511 m Q S 51- , DJ 3 m Q 'O-1' 5' ' Q , -U ua 0 - 5 -1 ' 3- . 'X X X X C . 5 IT! - - - , 511-4 ' 3 5 yn U, - -1 . gn n . X -5 X Q 3 ' 'Tl O 5-1 - - -11 . -1 . 50 Trl - yr -1 'T1 X Q Xia 52 1 - X C X X - 2- - S - X X UU - 0 . - D1 3, X X X 2 W 3, po - T1 vu ' K - 71 . 3, X X X X g X E E ' - m m -1 -n -U . X X X X M .- - X - 3 1 f X X 2- fn 4 -1 -1 1 W P 'fl A ' F1 X X X X X 5 X N X S XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSXXXXXXXXX XXX X XXX XX XXXXXX XXNXXXXQXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS S A X ,XX XXXXX XX X X X if 1+ 1+ 1+ 1+ 1+ 1+ 1+ 1 1+ 1+ 1+ if 1+ 1+ 14- 1+ 1+ 1+ wi- 11-'PX ?. m I 2 s xx 1 Z Z 1 f W ,,,,,,,,,,,M ,,m,,,,,,,,,,,,,. f. ' f t i if t- t 5. Z 1 1 mm mnffffuf fum Ir 1 I Z ' Z Z I Z ,,. .Z if ir if -4- -5- if in Z Z tZ,,,,w,,,,,,,,,,,,mffff,W,1,,wwf,,,,,m,,,,,,,,,,,,Z ,,,,,,,,,,,,,,,,,, ,,,,,,,W,,f,fm 9 Z,,,,,,,,,,,,,,,,,1fffffffffffffffwffffffffffmwffffffffff, t, Z Z 2 Z Z rxvmva RVL L Z if if Z Z Z Z Z Z Z 2 Z Z is fi' Z Z Z 2 Z Z ,kg BLODCETT, CLIFFORD A., Aviation, FALK, PI-IILLIP, U. S, N, Z Z Z BLOOR, GEO. J., Q. lvl. C. FARRELL, CARL W., U. S. N. Z Z Z Z BLONIEN, BERT A., Sergeant, lst Class, C. W. S. FEATI-IERS, LEONARD C., U, S. N. Z Z ELOUNTEJOHN Naval Aviation. FIE, A. I'IUBEIlT, Landsman, Naval Radio. Zi Z Z Z OECK, DWIN M., avy. FIEI.DS, A, B. Z Z Z BOOTH, EDNVIN R., Private lst Class, Infantry, A. E. F. FISI-I, W. I, Z Z 3 BORCELT, EDW. H., Industrial. 'FISI-ILEI1, I'IYMAN, Corp., Engineers, A. E. F. Killed Z Z Z Z BRADFORD, THEODRICK, Aviation, A. E. F. 4 In action. Z Z Z Z BRAMLETTE, M. M., Aviation. I--ITZOERALD, LLOYD E., Sergeant, A. E. F, Z Z Zywgg BRANDT, CLARENCE, Aviation, FITZGERALD, WM., F, A., A. E, F, Zfffff4Z EREIDSTERLMILFOIZD IA.,tHospitaI Corps. IIEORD, LECSETIE1 U. SIDE A C ,S gf RENNAN, EO ., n an ry. QRATER, . ., Orpora ,,.. Z5 if EROCKHAUSISIN, HEREERTSF. A., A. E. F. EREESE, HEREERT GEo,, Ycoman, U. S. N. Zg gf ROSSARD, ATTHEW I., ergeant, F. A. 'RElDEMANN, IRALPI-I F., Ensign, U. S. N. Z2 ZZ Z2 BROWN, 'ICI-IERON A., Radio, U, S. N. FROELICI-I, A. L., Sergeant, Hospital Corps. Z2 Z2 gg BUCKINCHAM, L. EVERETT, U. S. N. FULLER, I'IENRY C., Lieutenant, Infantry, A. E. F. EZ Zi ZZ 'BUCKLEY, OHN W., lst Lieutenant, Aviation, A. E. F. FULLER, WILl.ARD L., Ensi n U. S. N, Z1 ZZ 1, ,f S - ff , 1 Z3 QZ B Kldled in action Nov, 8, 1918. SABLER, EIIMER V. ZZ Z5 33 ULLIS, ESLIEJ. V AFFORD, IZUGENE J., Corporal, Machine Gun. ZZ EZ Z: :Z BUNDY E. B, Coast Artillery. 'CALVIN JOI-IN L. Private F A A E F Killed in Z5 ZZ Z: M . . , V . . . A. - A A H jf fg gf BURC, OLIVER M., U. S. N. action, Aug, Il, 1918. Z2 :Z ZZ BURKE, -IPI-IOMAS L., Signal Corps, A. E. F. GARDEN, GEO. P., Private, Aviation, A. E. F. BURLETT, KOHN S., Ensign, U. S. N, GARDINERLRALI'-H D., Aviation. Z2 gZ Zglwgg BURNER, KENNETH H., Industrial, GERMER, I-'RED M., Aviation. Zi,,,ZZ Z Z IKBURNS, ALEXANDER, Corporal, F. A., A. E, F., France. GIDDINGS, WM. W., Private, Q. M. C. 2 Z Z Z Died from wounds received in action March 8, GLENN, ROBERT R., U. S. N. Z Z Zig 1918. GOERNER, EDWIN F., Private, F. A., A, E. F. 6 Z Z Z BUTTS, STANLEY V., U. S. N. GOETZ, FRED W., Corporal, Ordnance, A. E. F. Z Z Z CALDNVELL, CHOLETT B,, lst Lieutenant, Infantry. COULD, STEVENS, Naval Aviation. 2 Z CALDWELL, THOMAS B., Naval Aviation. GRACE, J. H., U. S. N. Z Z Z CALLANDER, W. E., Government. GREGC, SCANTON H., U. S. N. Z Z CALLENDER, JOHN, Aviation. GREEN, GEO. E., Private, Machine Gun Battalion. Z Z Z CAMLIN, H. A., Elec. Engineering, U. S. N. GROSS, GEO. H., Industrial. Z Z XCARADINE, G., Corporal, Infantry, A. E, F. Killed GULLICKSON, WM., Engineers, A. E. F. Z Z Z Z In action. HALDEMAN, LENNOX, U. S. N. Z Z' Z EARPENTQI, EIYIERETT N., Hospital Corps, A. E. F. HALEYJJOHNVB,IGXrtillery. Z Z Z 4 ARSON, M. ., ergeant. ALL, OI-IN ., aval Aviation. Z Z Z, MZ CHAN-IBERLAIN, GEORGE H., British Ex. Forces. HANKS, CARLOS C., Sergeant, Q. M. C, Z Z ZZ' gg CHAPNIAN, FLOYD. HAMLIN, JOHN, 2nd Lieutenant, Artillery. ZHWZZ Z2 ZZ CHASE, ROLANDJ.. Medical Corps, A, E, F. HAIKICER, JOHN W., U. S. N. Z Za 5? CHRISTY, ROBERT HENRY, Naval Aviation. HARMAN, HUBERT F., A. E. F. Z E7 Z' ff I Z Z2 ZZ CHURCH, CARL A., Lieutenant, Aviation. HASTINGS, H. LAXVRENCE, Aviation. Z gg CLAUD, CARL A. HATLEN, H. C,, Industrial. Z Z2 ZZ CIRVES, FRANK, U. S. N. H1XNVN, GARVIN C., U. S. N. if Z5 ELARK, 'IXRIHOMAS g,aSeaman, 2nd Class, U. S. N. SOYDENQJOHS E., Clglor Serggant, Infantry. Za eZ fg 14 LARK, M. ., r nance. AYES, M. LATT, rivate, ngineers, A, E. F. Z ff CONDRON, GEO, TOLMAN, Aviation. HAESSLER, EARL A., 2nd Lieutenant Z' ZZWZZ CONGDON, CLAIRE C., Lieutenant, Engineers. HEFFERMAN, M. A., 2nd Class Seaman, U, S. N. 2 Z Z CONNOR, EDWARD H., Znd Lieutenant, Infantry. HEISKELL, A. ZHHHZ Z Z COPELAND, JOHN B., Aviation, A. E. F. HEISMAN, MILTON J., Ordnance, A. E. F. 2 Z Z CRANEFIELD, PAUL F., Infantry. HELD, ROLAND R., Aviation. Z Z Z g CRANE, CARROLL, Marines. HEISTAND, FRANCIS, Corporal. Z i. Z Zig CRARY, LAWRENCE M., Sergeant, Infantry, A, E. F. HIPKINS, J. N. JR., Industrial. Z Z Z , 5 ERANVFORDRROBERRQNQOI3 IAviation, A.IE. F. SOARD, Wen. D., Private, Marines. Z Z Z RETNEY, OEERT ., n ieutenant, nfantry. OLWAY, ORDON. 4 Z 7 Z CULLEN KENN A L' H N Ch ' Z Z f 1 , ETH ., ieutenant, oLT, ORMAN, emical. , f CULVER, W. S., U. S. N. 'HOOK, HARMON P., Aviation. Died of pneumonia, Z Zig CUMMINGS, W. B., Znd Lieutenant, Field Artillery. Dec, 15, 1918. Z Z Z CURRIE, EARL W., Sergeant, Q. M. C,, A. E. F. HOOPER, NEAL J., lst Lt., Chemical Warfare Service Z Z 2 DANE, EDWIN H., U. S. N. HORN, ARNOLD F., Industrial. 3 Z Z 5 DAHLMAN, OSCAR C. E. HORMAN, HAROLD, Y. M. C. A. Secretary, A. E. F. Z Z Z Z DAVEY, ALLAN C., Hospital Corps, A. E. F. HORNER, SPENCER. 3 Z Zyfffgg DEAN, HARRY C., Sergeant, Mach. Gun Bn,, A. E. F. HORNINO, WM. J., Aviation. - ZWWZ DENNIS, HENRY C., Medical Corps. HUE-BELL, ERNEST H., Musician, U. S, N. gg Z5 gg DICKENS, JOHN S., U. S. N. HUSTING, NATHANIEL B,, Industrial. ' 22 ZZ gg DIEHL, PHILLIP M., Sergeant, Q. M. C. HYMER, HOWARD G., Flying Corps, U. S, N. Z2 Z5 gg DIMMICK, EARLE W., Captain, Infantry, HYSLOP, VOLNEY B., Private, Aviation. gg Z' 'DOLAN, LLOYD F., Private, Q. M. C. Died at Camp HYZER, LELAND. ZZ ZZ Z5 ZZ Greene, Oct. 17, 1918. IRISH, JOSEPH. ig Z5 EOKE, I-ICB. M IVEY, EVERETT D. S 52 PZ ZZ 44 RARE HESTER . JAQUISH CASPER H, U. .N. 2nd Class Seaman. 5 if Z :Z ' - - . ,n A :Z Z: El DRAFER, HAROLD, Zncl Lieutenant, Infantry. JENNICS, DAVID HARRY, Znd Lieutenant, F. A. 15 ZZ ZZ 3Z DROLENGA, NICHOLAS C., Engineers. . JONES, RUSSELL, 2nd Lieutenant, Artillery. 25 Z ZZ DUNNE, NEWMAN, Private, F. A., A. E. F. JOHNSON, ALBERT R., U, S. N., A. E, F. ,Z Z5 ,Z EDMONDS, HOBARTJ., Naval Aviation. JOHNSON, AUSTIN, Private, Field Hospital, A. E. F. gf ZZ-,024 EDWARDS, ALLAN A,, U. S, N. OHNSON, D. B., Industrial. Zami? X 1 , Z Z Z EDWARD, LEROY E., U. S. N. JOHNSON, EDWIN M., Government. 5 Z Z Z EIDE, ARTHUR M., Infantry. JOHNSON, JAMES W., U. S. N. 2 Z Z EILER, WM. H., F. A. JOHNSON, JESSEJ., A. E. F. Z ir Z Z 4 EK, JOHN A., Sergeant-Major, Mach. Gun Bn., A. E. F. JOHNSON, LEONARD, Aviation. f Z Z Z ELLIOTT, ALVAH C. JULIAN, DALVEN, U. S. N. Z Z Z fg ERICKSON, LEONARD. KAASA, LEONARDJ., U. S. N. 5 i Z Z Z ERICKSON, WM. E., U. S. N. KACHELHOFER, F., Industrial. Z Z Z 1 I X Z tg EVANS, Jos., Ensign, Marines. KARST, WM. EDW., Sergeant. , Z i, Z Z Z EVERSON, CARL, Lieutenant, Medical Corps. KEARNS, EDWARD P., 2nd Lieutenant, Infantry. Z - Z Z Z FADIAN, PHILIP ., Znd Class Seaman, U. S. N. R. F. KIBBE, H. R., Cavalry. Z 7 f 1 Z if Z if Z Z NZ fi' Z Z Z Z Z Z Z Z Z Z ir Z V ,,,,,,,,,,,,, ,,,,,, ,,,,,,,,,,,, 2 l ,,,,,,,,,,, 5 I ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, 3 Z Page 375 5 1 A 7 S f xxx xxx xx xxx xxx xxx 1 5 ffffffff ff wwf ffffffff fffff ' f i. -Q 4 4 4, K Z ff, , ,mm fffffmfw ,ff Z ,ir t t i t t Z Z ItZW,mf,fmffmmmmffffffffffwffffffmf11111111104 ,,,,,,,,,,,,,,,,M fmffffmfffffm - Zfffffwmfff,wwffwfffmf11,ffmfm,,fm,f,fw,,,Z t Z f r y I-xvmva RVLL 1 1 2 iz ff' 4 ei. 2 Z Ike . 4 Z Z KINC, CHARLES C., 2nd Lieutenant, F. A., A. E. F. MURPHY, ROBERT JOSERH, U. S. N. Z Z KING, KENNE1-i-rJ,, U, S. N, MYERS, HOWARD K., Private. Zi Z Z 2 KITCHINCMAN, R. F., Aviation. MYRLAND, OTT0 E-1 Lieutenant: Z Z Z KLANDRUD LESTER Sergeant F. A. A. E F NEE'-EN, Be Corpofalf Hospital Corps' Z , . , , - - , Z Z IQLETZEIN, HOBART H., Znd Lieutenant, Infantry. RIiTIIFLiEQVgi2gqg'n, U. S. N- Z Z Z KNIGHT, HARRY W., Industrial. NILES, ERTQEST, F, A' E. F, Z Z RKOSS, ALFRED. Died at Camp Grant, Ill., on Oct. NORDBY, MARSHALL B., Aviation. 2 Z Z Z 13, 1918. NORTH, JOHN K., lst Lieut., Machine Gun Bn., A. E. F. Z Z Z Z KRAGH, HERBERT E., lst Lieutenant, Naval Aviation. INIUSSBAUM, HAMILTON L., Lieutenant, Aviation. 5 W Z ZZWQQ KRANN, EDNVARD P., Zncl Lieutenant. O BRIEN, HERBERT J., Royal Flying Corps, Canada. Z' ZZ ZZ KRAUSIEZ, QQJSTGVES Radio. gDELL, APIZBERT QRIXSI. CEI I I U S N Z fi Z4 KREG, . . . . . - ETJEN, ICHARD ., a io ectrician ,... 9 gf LAMFERT, FIJORENCE, Government. O'HORA, CLARENCE, Chemical Warfare Service. 2 ,Z LAMPMAN, CLIFFORD E., F. A., A. E. F. OLDS, RUSSELL B. h Z ZZ Zi 22 LARRABEE, EDWARD, Znd Lt., Royal Flying Corps. O MALLEY, EDWARD, Marines. A Z ZZ Z? Z? LATHROP, RALPH W., Radio. OLSON, JULIAN T., U. S. N., U. S. S. Minnesota. 9 ZZ if LAW, E. J., lst Captain'S Mate, U. S. N. OLSON, ARTHUR O., Znd Lt., Machine Gun Battalion. 2, ZZ Z2 22 LAW, ROBERT O., U. S. N. OLSON, LEONARD C., Aviation. 3, Z3 Z2 LAXVSON, C. P., Sergeant, MachineGun Branch, A. E. F. ORR, ROBERT C., Aviation. . ZZ Z? 5' LEHMAN, H. J., U. S. N. OSGOOD, W. PALMER, Quartermaster, Naval Aviation. gg if LEMENKUGEL, EDW. O'SHEA, STANLEY, 2nd Lieutenant, Infantry. gZ Z? if LEIMENKUGEL, J. M., Signal Corps. ONSHEA, VINCENT, Cadet, Marine Aviation. gg Z? Z4 LERDAHL, NELS C., 2nd Class Seaman, U. S. N. OSRAMP, A. M., Aviation. V - Z1 gZ Z2,,,,ZZ LEWIS, QUOI-IPL? Pcqigatce, kgedical Corps. EADDOCKHRYCHEN 11111, Zlstj ?rg3ant, Aviavxorg F Z MUFZ f 9 LEXVIS, M. ., n a io ectrician. ARKER, ERBERT ., n t., viation ,... 4 Z Z LICHTENWALNER, RAY, U. S. N. PARR, FRED, Aviation. Z Z Zig LIEBERTHAL, PAUL R., Sanitary Corps. PEARSON, RALPH J., Government. fi. Z Z ' 4 LINDEMAN, LANVRENCE O., Br. Amb. Service, italy. PELTON, HAROLD E. L., Signal Corps. 2 f Z LOGAN, CEDRICF., Radio, U. S. N. PERRIGO, BURTON, U. S. N. gi Z Z Z LUESCHER, ELMER W., Aviation, A. E. F., France. PETERSON, CARL V., 2nd Lieutenant, Infantry. Z Z Z Z LUND, ALF., Corporal, Ordnance. PETERSON, LEO W., Sergeant, Medical Corps. 3 Z Zip? LUNDBERG, GUSTAV M., Yeoman, lst Class, U. S.lN. PETRIE, HAZEN H., Private, Coast Artillery. Z Z Z 2 LYMANWSIEORGE C15 Lieutenant, Infantry. EETT, ERNSTEH., Colilpogil, Infaaitlry, IEC F. Z Z f F 4 LYONS, AYMOND . ICKHARDT, DWIN ., rivate, OSDICS Orps. g MCADAM, LINCOLN G., Sergeant, F. A. PIEH, WM. J., Marines, A. E. F. Z Z 2 MCCAFFERY, ARTHUR L., Sgt., Medical Corps, A. E. F. POND, STUART A., Signal Corps. Z Z Z Z MCCALLUM, VERNI ERNEST, U. S. N. POTTER, RUSR P., 2nd Lieutenant, F. A. g Z ZZWZZ MCEANDLESE, STAtxg.EY R., Rrivlate, If Igantry. A E F EOWERS, EDWARD U., Naval Aviation. ZZWMZ Z4 f4 Mc ARTHY, OHN ARTON, st t., n antry, . . RINCLE, DWARD. - n , gg ZZ 72 Z MCCLINTOCK, ALAN C. PRYOR, G. R., Znd Lieutenant, Aviation. 5 57 Z MCCONNELL, ANSLEY B., Pvt., Infantry, A. E. F. PUNGLE, ED O., Lieutenant, Aviation. 2 ,Z Z2 2 MCCULLOUGH, ARTHUR L. QUIMBY, JOHN A. Z, QZ ZZ Z MCDONALD, DURWALD L., lst Lt., Aviation, A. E. F. RAASCH, EWALD C., Government. Z MCDOWELL, L. J., Aviation. RAGATZ, LOWELLJ. A 25 gZ Zz 2 XMCHUGH, KENNETH Corporal, F. S. Killed on XRAMSEY, FLOYD, Sgt., Q. M. C., A. E. F. Died of Zi ,Z Oct. 25, 1918. I inHuenza, August'2l., 1918. jg Zz MCKENZIE, BASIL F., Engineers. RAND, WENDELL P., Aviation. Zimg MCPHERRIN, JOHN 2nd Lieutenant, Artillery. RAY, C. HAROLD, Znd Lieutenant, F. A. gg :Z Z 2 MCROE, WM. J., Private, Engineers. READING, CLYDE W., Aviation. 2 Z Z 6 MCNAMEE, SHIRLEY, Zncl Lt., Infantry. REDIN, ROY W., Aviation. 2 Z Zi 2 MALONEY, GERALD C., Sergeant, F. A., A. E. F. RENANDER, ARTHUR W., Ser eant, Aviation. Z Z Z 2 MANN, LOUIS R., Znd Lieut., C. A. C., A. E. F. RENNENBOHM, OSCAR, U. S. gf Z 2 MARTIN, O. W. REUTER, WM. R., U. S. N. Z Z Zi Z MATHEWS, E. W., Znd Lt., Artillery. REWEY, ROBERT L., 2nd Lt., Infantry. gi Z Z 2 MATHEWS, M. C., Industrial. RHEINGANS, WM. ., 2nd Lieutenant, H. A. Z Z Zi Z IXAAXXVELL, GERALDINE, Bacteriologist. RICHTER, HENRY ERRYFIELD, F. A., A. E. F. get Z Zvi E MAY, GEIO. Loiislliflgrirlgas. EIETBRO35, FIEEDJ., Private, Medical Corps. Z Z 1 1 AYER, RED ., . . . ITTER, M., ieutenant. 4 f Z ' 2 MEIER, PAUL. A ROBERTS, GLENN D., Q. M. C. Z Z Z MELAAS, KARL C., Lieutenant. ROBERTSON, MARTIN R., Aviation. g Z Z 2 MELCHER, BURTON, Coast Artillery. ROESSLER, LESLIE A., Private, Engineers, A. E. F. 3 Z Z 2 MELVIN, ROY E., Radio, U. S. N. ROGERS, SAMFSON, JR., Naval Aviation. Q Z ZZWQZ MERCER, DONALD WINTERS. ROMIG, PAUL W., Lieutenant, Field Artillery. g,,,,,,Z Z3 ,Z MERWIN, GILE E., Aviation. ROSE, AUSTIN T., Naval Aviation. ZZ Z, 2 MESERVEY, ARTHUR R., Aviation. RUBEL, HENRY Scorr, Radio Electrician. ,S Z5 ,g MEYER, HARVEY G., U. S. N. RUSH, J. COURTNEY, Marine Aviation. Z Z' ,Q MEYER, MARTIN EMIL, U. S. N. RYDJORD, JOHN, Mus., Gen. Hdq. Board, A. E. F. g QZ Z2 gg MEYRICR, GORDON Radio, U. S. N. RYCH, EDGAR W. Z Z2 Z MILES, BENJ. F., Private, F. A., A. E. F. SADLIER, RICHARD E., Private, Aviation. 3 gZ Z2 ig MILLER, GEO. PAUL. SANDERS, SHIPP GILLISPIE, Sanitary Corps, A. E. F. Z ZZ Z1 Z MILLER, HARRY I., Radio, U. S. N. SCHEIDENHELM, A. K., Cadet, Aviation. 3 Zg 5 MITCHELL, DONALD E., Private, Infantry, A. E. F. SCHERNECKER, EDW. GEO., 2nd Class Seaman, U. S. N Z' ZZ ,Z XMITCI-iELL,4Ji?lEJIIfI9G., Lieut., Infantry. Died in Paris ECI-IINDLER, WETER, Engineers. Z fg 25 an. , . CHLOMOVITZ, ARRY. y 2 lI:A!lOEHLMANN,FVigLL5xMSFNSegt., Q. M. C. ECHMIDT, QRNO J., 2nd Lieutegagiit, lngmngryiq ,MM ONTAGUE, . ., . . . CHMIDT, ARLTON L., Petty cer, . . . 9W 'f Z Z MORAN, LEONARD E., Government. SCHMIDT, GEO. A., Sergeant, A. E. F. Q Z Z 3 MORGAN, LLOYD, Sergeant, Medical Corps. SCHMIDT, RAY OTTO, Government. Y 2 Z Z MORONEY, OHN R. SCHOWALTER, HERBERT P., Sgt., Ordnance,-A. E.-F. Z Z 5 MORSELL, . B., Radio, U. S. N. SCHNEIDER, WALTER E., Znd Lieutenant. 5 Z Z MORTIBOY, LEE, Engineers. SCHRAGE, C. T., Elec., U. S. N. R. F. Z Z . 3 MILDOWNEY, FENTON P., 2nd Class Seaman, U. S. N. SCHROEDER, JOHN E., Naval Aviation. 2 Z Z Z MULHOLLAND, L. G., Machine Gun Bn., A. E. F. SCHUETTE, JOHN A., lst Lt., Aviation. 5 Z Z ij MULVEY, WM. HENRY, Private. 1 SCHRADER, JOHN E., Naval Aviation. gi Z Z Z MURPHY, LAWRENCE, Lieutenant, Machine Gun Bn. SCI'-IXVARTZ, MYRON E., Infantry. Q Z . ., Z . 3 5 Z Z 3 3 Z ei' Z Z i2161111Miyagi1111111111fffffffffffffffffgffffnnffffffff 1 ff 1 ff ,ff ff ff ffffgfff ffffffffrffffffff ,fffffuf,1101111011111111111011011ff,ff111,10111,fffffffgfffnfffffffffff114111 fab Z , ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, , . ,,,,,,,,,,, , I ,,,,,,,,,,,,,,,,,,,,,.,,,,,,,,,,,,,,,,,,,,,,,,,,, Z A Z F if ,.,,,,,,,,,,,.,,,,. , ,,,,,,,,,,,,,,,, , ,,,,,., ,,,,,,, ,,,,,,,,,,.,, , ,,,,,,,, , , ,,,,,, , if if F F Ik Z 1 Page 376 A ' W if xxxsxxx xxx xx , if 5 I , , , I if , , 1 , I I 'Av , I , 7 'k' E s E 1 1 4 2 1 E 1 1 s 1 1 1 S 1 S 5 7 7 1 1 5 1 7 5 1 1 1 W NX X . xxxxxxxxxxsxsxxxxxxsxxxsxx-.xxxxu xxx 4 1 , 1 4 2 Z 1 1 4 1 1 E 1 1 4 5 5 s 1 1 5 1 Zi Zi 1 Zi' f Zi' Zi: 3 6 1 5 i1 1 7 1 7111 4 2 1 5 9 1 1 111111 'A' 1 1 1 if' 1 1 1 1 1 1 1 1 1 1 5 1 7 5 1 5 -111 W g1111111111111111111111111111111111111111111111n1111111111111 A 111111 1111111111 i . Z 11111111111111111 11111111111111111111 SCOTT, IAN C., Ser eant. SCOTT, OWEN L., S. N. SCOTT, RALPI4 H., A. E. F. SCRANTON, l'lUGl-l GREOC, ENGINEER, U. S. N. SEMON, EDWARD M., Captain. SHARP, DONALD E., Government, Bureau of Standards SHERMAN, HELEN, In Training as Nurse. SILBERNACEL, EDW. G., Hospital Corps. SII.vERNESS, EMIL L. SIMPSON, ALEXANDER L., U. S. N. SILVERMAN, EDXVARD, U. S. N. SKOW, CHAS. T., Sergeant, Aviation. SMITH, ROBERT EVANS, Private, Infantry. SPOI-IN, GEO. D., U. S. A. STALKER, NORMAN D., Ensign, U. S. N. STANDER, A. E., U. S. N. STAIDL, STANLEY A.. Aviation. STEARNS, WM. Y., Hospital Corps, A. E. F. STEELE, RICHARD, 2nd Lt., Aviation, A. E. F. STELLING, LENNO A., Private, Engineers. STEWART, DUNCAN J., Private, Field Artillery. STEWART, JOHN, Ensign, U. S. N. STEINLE, VERNON, Lieutenant. STOCKUM, S. F., Corporal, Aviation. STUMPF, HARRY R., Private, Infantry. SULLIVAN, SAMUEL, A. E. F. SUNDERLAND, PAUL, Musician, U. S. N. SNVEENEY, CHAS. E., Aviation. SWIFT, JOHN D., Radio, U. S. N. SWIFT, WM. A., Znd Lieutenant, Infantry. TAYLOR, J. L., Industrial. TAYLOR, GORDON H., Heavy Artillery. TAYLOR, THOS. D., Sergeant, Engineers. TEICEN, ARTHUR H., Hospital Corps, A. E. F. THEISEN, GEO. D. THOMAS, ROBERT K., U. S. N. THREINEN, BERT A., Private, Aviation. THIELDGENS, VICTOR A., U. S. N. TTISHLER, HYMAN, Private, Engineers, A. E. F. Died ir5France from Wounds received in action Oct. I I7. TOERNE, OSCAR T. VON, Tank Corps. TONER, HAROLD J., Industrial. TOOMAN, A. R., U. S. N. 'l-OUPAL, ADOLPI-I, Field Artillerv, A. E. F. TOUSLEY TRAHTIN TRANTIN , HENRY D., Hospital Corps, U. S. N. , ERNEST, Government J.,JR Artillery. TRACHTE, CLARENCE G., Medical Corps. TRUAX, LYLE L., U. S. N. XTYHLER, H., Private, Engineer. Died Oct. IO, l9l8. 'ULMER CHARLES H., Lieutenant, Marines. Missing Since October, 1918. UPGREN, ARTHUR. VALIER, RONALD B., Aviation. VAN ARSDALE, M. W., Pilot, Aviation. VAN GENT, PAUL, Engineers, A. E. F. VAN HAGEN, GEO., Lieutenant. VAN SLYCK, LOUIS W., Radio. Voss, EDW. F., Field Artillery. WACNER, NEWTON V. D., U. S. N WALDO, DONALD, Radio, U. S. N WALLIS, HARRY G., U. S. N. WALLIS, ROBERT S., Corporal, F. A. WALTON, WESLEY WARREN, JOHN H., Medical Corps, A. E. F. WARREN, WADSWORTI4, JR., Hospital Corps. WELCH, l'lAI.BER'l' A., Private, Engineers. WESTON, FRANK LAWRENCH, Aviation. WHEELER, I-IORACE P., Private, Signal Corps. WHEELER, WARREN G., Industrial. WHELAN, ALLEN. XVHITE, ARTHUR B., U. S. N. WHITE, KENNETI-I S. WILCOX, G. B., U. S. N. WILEY, ROBERT L., lst Lieutenant, A. E. F. WILLIAMS, L. H., Corporal, Infantry. WILSON, HERBERT D., Corporal, A. E. F. WISE. SOLOMON, Aviation, A. E. F. WITTENBERG, JOHN F., JR , Industrial. WOLFE, J. CALVIN, U. S. N. WOOD, BENJ. B., Marines. WOOD, JOHN, Aviation. WRIGHT, DUEY E., Private, Aviation. YOUNG, GAVIN W., Hospital Corps. YOUNG, DUDLEIGH J., Hospital Corps. 111111111111111111 -11111111 1 1 v11111111111111111 1111111111111111111 RVLL ZANDER, HENRY G., JR., Aviation. ZEITZ, EDWIN, Private, Signal Corps. ZIECLER, ALVIN, Infantry, A. E. F. ZNNICKER, M. H.. 2nd Lieutenant, Engineers, A. E. F. 1921 ANDERSEN, CARLJ., Private, Field Artillery. AMES, IQIRK, U. S. N. ARCHER, ROLI,AND H., Hospital Corps. ARNOLD, RUPERT S., Government, Bureau of Mines. AYTON, 'IPI-IOMAS W., Lieutenant, Field Artillery, BAKER, L. J. BAMFORD, WM. L., U. S. N. BASSATT, JAMES, Hospital Corps. BATES, WILI.ARD H. BENNETT, JOI-IN, Chief Yeoman, U. S. N. BERNSTEIN, JAMES E., U. S. N. BETTENOORF, ARTHUR J., 2nd Lieutenant, Infantry. BLATTER, RUDOLPH, Lieutenant, Field Artillery. BLOODCOOD, DAVID, F. A., 32nd Division, A. E. F. BLUM, FRED G. BOHMANN, ROBQT. B., U. S. N. BONHAM, EARL E., U. S. N. BOTI-IAM, RICI-IARD G., Medical Corps. BOWER, WM. A., Aviation. BUNDY, JOHN W., American Red Cross Service. BRITTINGHAM, J. E., JR., Znd Lieutenant, Infantry. BRITTINGHAM, THOS. E., Lieutenant, Infantry. BROWN, LLOYD JOSEPI-I, Sergeant, Artillery. BROXVN, HAROLD, U. S. N. BUETTELL, ARTHUR L., Corporal, Ambulance Service. BURDON, CHAS. E., Private, Infantry, A. E. F. BURNSIDE, GEO. HARRISON, Marines. BUSHELL, ROBERT, U. S. N. CHANDLER, IRAY W., Private. CHASE, SHERMAN, U. S. N. CHAVIS, W. CLARK, LORAN S., Private, Infantry, A. E. F. CONNOR, RICHARD M., U. S. N. CONNOR, WM. D., JR., Signal Corps. COOK, HAMILTON B., Private. CRAIGI-IILL, ELEANOR R., Medic. Corps, A. E. F. CROCKER, W. C., 2nd Lieutenant. CROSXVAIT, SCOTT T., U. S. N. CROWLEY, R. J. CURRY, ROBERT J., Radio, U. S. N. CUSSON, SAMUELJ., Aviation. DAVIES, ROLANDJ., Medical Corps. DAVIS, GEO. C., U. S. N. DAY, WALTER R., Marines. DEXTER, KENDALL, U, S. N. XDOLAN, LLOYD T., Quartermaster Corps. Died at Camp Green, N. C., on Oct. I7, 1918. DOWLINC, WM. J., Coast Artillery. DUNCAN, M. G. EARLE, KENNETH S., U. S. N. EDWARDS, LEROY, Radio, U. S. N. ECAN, TIMOTHY, Hospital Corps. ELLISON, FREDERICK ., Lieutenant, Aviation. EMEL, RALPH C., U. . N. EMERY, CLYDE B., Field Artillery. ENDRES, HUCO, 2nd Lieutenant, Infantry. FAUERBACH, KARL H., Signal Corps, Aviation, A. EF. FEDDERSON, N. K. FEDERER, L. J., U. S. N. FELDMAN, JOSEPH G. FELKER, CHAS., Artillery. FOLEY, LEON F., U. S. N. FOSHION, HERBERT W., Sanitary Corps. Fox, RAYMOND WALTER, U. S. N. FRANK, JACK WILLIAM, Radio Service. GIDDINOS, W. W., Captain, Field Artillery. GILLEN, EUGENE, U. S. N. GLADDEN, ALFRED HOWARD, U. S. N. GOLDBERG, MARK, Private, Coast Artillery. GRACE, H. R. GRAHAM, RUHL, Sergeant, Aviation. GRAY, WELLSLEY D., 2nd Class Seaman, U. S. N. GREGG, ASHTON C., Coast Artillery. GRUBB, EVERETT L., Lieutenant, Field Artillery. GURNEY, BENJ. F., Radio. HATCH, WARREN F., Private, Medical Department. HAMMOND, GORDON B., Lieutenant, Infantry. HARRIS, HENRY H., Aviation. r HALLATZ, CLARENCE, U. S. N. 111 1111111 1111111 11111111 111111 11111111111111111111111111111111111111111 111111111111111111111 11111111111111 111111111111 1111111111 111111111 1111111111111111111111 11 111 11111 11 111111 11111 111 1 11111111111111111111111 Ill I - Il rl 1 l lf ll . , ,, ,,,,,,,,,,,,,, 1 ,,.,,.,,,.,,, , ,,,,,,,,.,,, ,,,.,,,.,,,,,,,..,,,.,,,,,,,,,,.,,,,,,,..,,, . . . i' f f' , , ,, , t wk in if 'A' i f H ff 1 ' if i ai f K 41111111111111111110111111111111111111111111111111A 1111111111111 411111111111111111111111111111111111111111,,1111111 I Page 377 9 I 3 ' 01fillfillllllllllllllllllfllllllllllllflllllfllllrllllllflll 111111 1 11111110 5 4251? I 5: 52 52 52 fi 5: 5: 52 52 52 52 52 52 5: 52 1 2 s 5 2 5 1 1 E 1 1 1 s s 1 5 61 1 111 3 1 1 s 51k 5 5? 5 5 gf 5 51 5 5 5 5 5, 51 5 51 if 5 71 5 5 f 5 5 gt 5 Zi f 5 gi 5 at 5 5 5 51 5 5 5 5 5 52 52 52 52 52 52 52 52 NNX get Zi f Zi 5 if gf 5 TUV 5 5 1 1 f . , 4 11111111111111111 5 5 5 'Ar if 1 1111 7 1 111 1111 1 1 11112 TNVNVR HAMMOND GORDON B., Lieutenant, Infantry. HAZARD, CHAS., Student Pilot, Naval Aviation. HEAD, G. H., Private, Infantry. HILL, CLARENCE D., Industrial. HOPE, PAUL F. HOLLATZ, CLARENCE A., Sergeant, Tank Corps. ICKES, WILMARTH, Artillery. ISAACS, HENRY G., Lieutenant, Infantry. JACOBS, LAWRENCE C., A. E. F. JACKSON, LYMAN E., Private, C. A. C. JANES, GUY E. JAQUISH, JOHN H. Band Leader, A. E. F. JOHNSON, E., lst Lieutenant, A. E. F. JOHNSON, ROY S., Hospital Corps. JORDENS, H. W., U. S. N. KANARD, LEONARD, Private, Cavalry. KAREL, JOHN READ, Private, Infantry. KEHL, EDWIN M.. Private, Hospital Corps. KLAPPROTH, W. H., Lieutenant, Heavy Artillery. KLENERT, SIDNEY F., Aviation. LAMYER, MERRIL, Private, Truck Driver, A. E. F. LARSON, O. R., Ensign, Znd Class Seaman, U. S. N. LEAN, HOWARD WM. LEINFELLER, CYRII. L., Lieutenant, Artillery. LENTZ, ROB'T. C., Motor Transport Corps. LESSLAR, MONTAGUE. LIGHTY, HAROLD K. LINDEN, JOHN F., Hospital Corps. LOBRE, HUBERT, U. S. N. MCCOLL, WM. F. MCKAY, JAMES H., U. S. N. MCNAMERA, ED. J. MARSH, FRANK H. MATCHETTE, WM. MATHIE, HAROLD O. MAURSETH, LARS H., Government. MERKEL, LEOJ., U. S. N. MILLS, FREDERIC F. MOELLER, HERBERT G., Aviation. MURPHY, ARTHUR M., Aviation. MUTH, HERBERT J., Private, Field Artillery. NASH, WM. MORGAN, 2nd Class Seaman, U. S. N. NEWTON, ORRIN I., Aviation. NORD, S. K. NORTH, LUDLOW F., Ambulance Corps. OKSANEN, OTTO W. SOSTRANDER ALBERT H. Infantry. Killed in action July 19, 1918. OWEN, ALLEN K., British Royal Flying Corps, Canada. PACE, HORLAN, U. S. N. PERSTEIN, I. ARNOLD, 2nd Lieutenant, Infantry. PHILLIPS, HARRY A., Signal Corps. PICKARD, WM., Lieutenant, Infantry. PICKARD, JOHN, Aviation. POINDEXTER, ROBERT G., Private, Marines. 11111111111111111 . POTTER, DONALD WM., Private, Hospital Corps. PURNELL, G. W., U. S. N. RADKE, ALFRED H., Private, Medical Corps, A. E. F. RAMSDELL, IRVINC MEYER, U. S. N. RILEY, MAXWELL EDW., U. S. N. RISBERG, HAROLD N. ROBERTSON, R., Private, Q. M. C. ROTHSCHILD, JOSEPH D., Private, Q. M. C. ROUNSEVILLE, WILLIS, Corporal, Hospital Corps. RUFF, CLARENCE A. RUHL, GRAHAM A. RUSSELL, CHAS. W., U. S. N. SANDERS, WILLARD, Ensign, U. S. N. SAWYER, MERRILL, Infantry. SCHAPIRO, SAUL. - SCHELL, LIONELJ., Aviation. SCHMIDT, EMIL MORRIS, Radio, U. S. N. SCHROEDER, HENRY F., Hospital-Corps. SHORNEY, GORDON, Naval Aviation. SILVERMAN, HENRY. SMITH, GALBRAITI-I M., U. S. N. SMITH, H. C., U. S. N. SOLOMONSON, CARL E., Ordnance. SPARLINC, E. W., Naval Aviation. STURTEVANT, PAUL, Sergeant, A. E. F. SWAN, GEO. DEWEY, Royal Flying Corps. TERRY, OWEN R., U. S. N. THOMPSON, EARL, U. S. N. THOMPSON, R. W. TRUMPF, FORREST, Medical Corps, A. E. F. TUCKERMAN, GUSTAVUS, U. S. N. UBBINK, JOEJ., Private, Aviation. UHL, ARTHUR, U. S. N. VASSELOR, ERNEST C. - VASSELOS, ERNEST C., Sergeant, Personnel Dept. 'WAGNER, KARL, Engineers, A. E. F. Died in France of pneumonia, April IO, 1918. WALKER, WM. E., U. S. N. WALL, ARTHUR B., Signal Corps, Aviation. WARNER, P. W., Aviation. WARREN, JOHN H., Hospital Corps. WATTERS, GEORGE H., 2nd Lieutenant, Infantry. WHITE, RICHARDJ., U. S. N. VVILDEMAN, WM. J., Red Cross Service, A. E. F. XVILLIAMS, FRANKLIN R., Landsman, U. S. N. WILLIAMS, RALEIGH, U. S. N. WILLIAMS, ROBERT F., 2nd Lieutenant, Aviation. YOUMAN, CHARLES R., Private, Ordnance. YOUNGREN, RALPH L., Field Artillery, A. E. F. 1922 LATCHFORD, ELLIS V., Znd Class Quartermaster, Naval Aviation. 1111111111111111111111111f11111111111111111111111111511111111111111111111111111111111111111111111111111 11111111111111 11 111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111 5 ' ' 1: 111111111,,11111111111,11111,1,1,1,1 111111111111 2 11111111111 111111111,1111111111111111,1111111111 111,11 2 ' - I -1 111111111111111111111111111111111111111111111111111A 111111111111 . 91111111111111111111111111111111111111111111111,1,1 l M! Page 378 lIf 5 4 Q K 1 I V 5 1 111111 1111111111 1 t ' 5 1111111111111111111 5111111111111111111111111111111111111111111111111111111111111111 QCODQTED CEIOLITWLOD S Tecorateb for Qalor Arthur HT. Zllexanoer, '14, Wellesley, mass. lieutenant, Aviation RECEIVED the Distinguished Service Cross for bravery while piloting his plane during an attack far behind t-he German lines. He was seriously wounded in the encounter, but he brought his wounded and un- conscious observer back to the starting point 20 miles behind our lines, driving and safely landing his machine between fainting spells, as his comrades reported, then secured surgical attendance for all the other wounded members of the escadrille beforeihe himself was attended to. After his recovery General Pershing selected him as one of six officers, one from each branch of the serv- ice, who had been conspicuously brave, to investigate instances of bravery and recommend awards. Lieut. Arthur H. Alexander Flfatlan Ui. Amen, '10, Clarinbar, Kiowa ' lieutenant, 16. S. IN. Ambulance' WAS awarded the Croix de Guerre in l9ll1'7 'While Commanding the 5lst 'Ambulance Unit in Alsaceg Amen. enlisted in the S. U. I,.,1A,m ,ulance unit in june l9l 7. After completing hisl training at Allentown, Pennsylvania, he was made ,Sergeanrtelwajor and sailed for France ingjanuary .l95l,8r. l'n,,I'uly and August Lieu- tenant Ameii attended nonfe5rrirn,issioned officers' school near Paris where he receiveclilris cdnimission. xlluge 380 t. Harlan 'Becotateo for Valor C3eo1'ge Carey, '17, Beloit, livis. lieutenant, 28th fllnfantry A' ROBABLY no Wisconsin man has received as - many citations as Lieutenant Carey. On August 2, l9l8, he received the Croix de Ciuerre with palm at the Barrech Nlarech al Ney near Toul. Commander General Petain of the Tenth French Army signed the order for the decoration, citing his work at Berzy le Sec in the Second Battle of the Marne, july I8-23, l9l8. Previous to Carey's award for gallantry he was cited by Major Geneial Bullard, commanding the First Ameri- can Division, for extreme bravery during the operations connected with the capture and defense of Cantigny, May 27-31, l9l8. Lieutenant Carey seemed always to be placed where the fight was hottest for he again ac- quitted himself nobly in the terrihc action at Soissons, July I8-23, l9l8. For his heroism at that time Major General Summerall, who succeeded General Bullard as commander of the First Division, cited him for the third tlme. Lieut. George Carey i Lieut. John A. Commons fllobn Commons, '18, mabiison., wis ' A Iiefutenant, 339th flnfantry A rlfitishilvllirtary Cross for bravery shown in service in the Archangel district.-' Lieutenant Commons vxgais' ongof, the first Wisconsin. ment fo go into training at Fort S'lffericlan inf l9il,.7. Sent to Camp Cus- ter, Nliichigan., he joiined thefsame regiment with a part ofvwhichfihenis now serving. 'During his Iilefiod of train- ing he became an expert the Browning machine gun, and'-many of his exploitsgifn Russia have been due to his adroitness and ezgpertness in control of this weapon. On Sept. 7, l9l8, he wen'tf't'o-.Russia and sawimmediate service. ' Slightly wounded, was sent forthe hospital but was shortly again '0I1v'lil71C?A'fI201'1t. It was during the attack on Kadish ,Lieutenant Commons Won his decoration. After almost all? this zmen had retreated under the heavy enemymlire, Lieutenant Commons with a fellow officer held his post, fighting stubbornly, and saved the day for the allied troops. . Page 381 S wecorakcb for Valor 3I'l'arrig1Q7. Craig, 'l5liClevelan6, Ohio lieutenant, Aviation RECEIVED Croix de Guerre with palm for con- spicuous bravery as an observer. While flying with the French army he flew far behind the German lines to get necessary information for artillery. During his return flight his plane flew directly over a German trench firing at the same time all his machine guns and severely crippling the German sector. One of the brav- est feats of the war, his commander says. At-this time he received the Croix de Gu'erfe'fzand yvaswcited again shortly afterward for braVeryf,g,g1Luggin'g'Manother Hight. For this he received the Creiix-de Gubrre with palm, but . . . A . 1 ' 1'-if' ' lbsthis life m the exploit. l-'Lx ,f X -, , 5 ' -1.-,,,-,1.:, . g in f Q if or or Lieut. Harry W. Craig 'fi Y' N g T - Qlrzrkk wg, If-Ns , As, , . , i ' - 355, r ,-1 ,., . f-frm - - I 1, 1 N L52 ' I Xij- ' 13.1 in . Ir 1 ,3 A 'Z ..f?-.29 ,ig , cf -Y: , rw Zvi ,aft - 1 ref. -'P , P' ef ' 'I 1 Jffarry illvblon, 1i3,.monbq,vr, ., , Y ,-,V ,dk .,.. ajax , IEUTENANT DILLON vxias .walked theiCro1iiv - in l C' awardfxvhe' wafsamenitioned in twice 'for extigaolridignaryif-Tlifaveryp-in Hqjffyas in H G??ZfrelQ1edQ5SsiNP1 dated A1JjQ 2'Ql 918 'Mfor galllanthyminaagt?ib1fi'1i fhe opera fi . . Qs- I -' ' '2-- in ,I au v w 1 Ay: .w - - C0QlneSSl'5ip,ifLEh6YAfinwl' ,attdeffoii iivheni the :Hifi Hanks j?3'iafi1y hE1 ieQup,l , ,.f A :fmt ' J 'fer' w-:ag'fPz3.F . , 'Q' 2 -,Fir 1-'U 0.1,-'2'f.', fi' lFl??t'-f'I'?10d2f'i4ii2-' i K St0rm4.and,ioccupy Mfg, Y. was i L, QM . 1. Sid af all r V e toovlgzraliliQbJAQgtygQgsg'Ess1l y e I hwy-,?an.d by his splenchd ,5?h lfigfieet1ve possible. I it which won him his 'crossi jzierforrning a difficult serv- ice, l..ieutenant'Dillon was struck and instantly killed by a p16C6 of shrapnel. , ' ' Page 382- Lieut. Harry Dillon 'Eecorateb for Valor Starr S. Eaton, '17, mabison, wis. Captain, Company 1, 231-6 Zflnfantry KECEIVED Distinguished Service Cross for brav- ery shown July l, l9l8. During the Battle of Vaux, when hard pressed by the enemy and support and reserves were kept back by enemy artillery, with a depleted company he held his section of the line for nearly twelve hours. During all this time he was a constant example ofilieiqoism to his men, sustaining them and urging- t-hern to greaqger bravery in the face of almost certain de5'th.,,,,gljleiWag liilfled in action Sept. I4, l9l8. Pi' iiii '12, 1? T7 ' Q. rw as .'-.1 .L If ,....f9a.T.x l My I , vw: tw A L Capt. Starr S. Eaton Y -.Lj-,i,.31-.,,2 MHA! A V I ff , fi ii fw75fi'i ' lil 1 jr! V y Y w I -T: 'i,v ' . ,t t . it , r 'QQ 'r-r fiillotbiiibllf F12413ZZa6ison,'iR22ispe,g, ' ' ' V ' tt -'4 if , ' WJ' 'fill 14- -',gl, 1Q' 1 iff 5 , 1 , , ,- ' , i gw fi:3if5',.g -if , gJ:1t:l:.-1 iff -mpg V V- - l pfgshed, Servicefi-jiGfoss,Nfor-Ebrav-V ' '39ff1,s,,.x33- -il .1 vgfa3t,3vg,,f,.,-GWSQQD3 - I . y , A Aw -N 3, ,fv - ,I A- ef2aepggvgisliogivzjffatiiflhagtgau Thiiemy41:1g4August,i,?:1l,Q,,lg'8. 1 .uzrfwzwn ff, , -f f.xs..'a U -A 4s ' alt wa G XJ-- . 11Ns:'? :- V A gfgflarner hfasQseemreomtinuf6us.,servrce,,'s1nceQfhte'wentlitpwtghe ' ', H i -A -- fQ'K1iaiff-'Wfwifiti-. 'gy 'wif' 1:4 r 5,MenQglnQnkio1id1exif.d,wnmng-fiheff'I Qiilrfntnoubla ,ltleiseryedtat ,f,, - H ff-1'-rilzfrer hestetiim NediliaQ51un.feered'vasflan an+b'5f1anee'rdr1vefr 1'Z-Ifztivzms'-N' Q '6::',,e.1- l ' 1, ,Q 55 j' - 5 A A , gg , . ' arigimqasgstfmff ff'g'onEi3aYnmeEgf:fwxfgteimfysglklmionthss lgarelf SGITVICCX -all fmt, w '- .M HH -1- i A ,ff f .'-.xf,1f -INF, ..' 4, -- VV-H E31 8 f a, fifi'i'i1 4 ,.,, V 'PJ fit..- 552' WS, ,. 'f W., K , A, 3 '- 1 9 ,gi fthe . l , 'EJ l . Cilvlsionifvfrs' ,'t' g :ac- V L2 wma as . r -,lm - I S 11ta1s0Hier2r 0f.y.h1Sr3aeg1mQaVfQ t f 'ffl -ff tagaiiistietbhe 'Guitar . .Wt ,g H , t ' iiii d5Yif?5li55'IT?5f1Y 72, . ' A fi ' z i aisbravery and coolness 4, 3.af? 5w ilu Yea. LL. if'tf k. - - . y displayed ,ait thatil z Ijgfggigayqarded him the g 1 'United States decoratfi Ete1thg'1,,ht2i1id Work he was . l - A . 1 , - Osenitr home in Septemberagfprjinsggrgpgqigjgatf'!2Qagmp':Lewis, t and was awaiting ordersi' overseias'-when the 'F:lI'ITl1Sf2ICC . Capt Lloyd M. Garner was Signed' Pagef383 . t. Cyrus Catton Albert .175 Cfgiliizofej fi-jirfnceton,' Xl. 3. Ttiieutenant, IC. S. Aviation 5- .- ECElVE.D'Croix cle Guenre for bravery displayed near Verdun. He was one of the ,first Wisconsin men to enter service. For six Irionthswhewserved with a French ambulance unit in and around ljelgeagured Ver- dun At one time he traversed steadily for 48 hours a shell swept road, narrowly escaping finjury. Without food or sleep during that time his of mercy con- tinued until he' was removeclyqexha-usted. 'During the course of one of his trips a field which was ' swept by enemy machine.-giliil fairid Without assist- ' ance took out several iEil1?1ffCh soldiers.: For this valiant service he . After thisgterm of service expired he aviation corps and served for some he Was killed Hear ISSOClL1I1 making a daring observation Hight bacli fof'fthe4American lines. S 'Eecorateo for Qalor Glyrus II. Gallon, '18, Bozeman, mont. Ttieutenant, American Ililot of ifscabtille, Br. 127 .EIEUTENANT GATTQN was decorated with the French War Cross August 18, l9l8. At that time he was serving with the French. His citation came as an order from Chief Commander Vuillemin. Catton is described as an excellent pilot, one who braves all hazard. Has never missed a bombing expedition since attached to the escadrille. Has on July I6 and 18, l9l8, particularly distinguished himself at the time of bomb- ing of the several passages of the lVlarne,' also on the 9th, 10th, and Ilth of August, during bombing expe- dition at very low altitude. Shortly after his exciting adventures with the French, Gatton was transferred to one of the American squadrons where his work was equally courageous. I Lieut. Albert F. Gilmore Page 384 Tecoraleo for Valor Uiicbaro Iffilorekb, '15, wheeling, W. Va. I Captain, 26' Eivision, Z3r6 Illnfanlry GAPTAIN I-IILDRETI-I, who was one of the first Wisconsin men commissioned and sent overseas, received the Distinguished Service Cross Nov. 3, I9I8. Captain Hildreth holds a rather remarkable record for rapid promotion. Two weeks after he received his commission in the infantry he sailed for France-june IZ, l9l 7, with the First Division, 28th Infantry. After a year with that division he was transferred to the Sec- ond, 23rd Infantry. After this his rise was rapid-pro- moted to First Lieutenant Sept. IZ, and, Captain, Oc- tober 24. For his bravery during the severe battles just prior to the signing of the armistice General Pershing, for the United States, pinned on his breast the Distin- guished Service Cross. Capt. Richard P. Hildreth i ' I Q 1 U A 1 if. '17, Kite lake, in , Ilgllllfildiihh Hero Squubron- I in ,isltingiiished Service Cross for: brav- X ,ery as time ef death, aSep.t. 26, I9i1l'8g Kelty was fiiS,tinguiS'h6S2l'2fS aa!-excellent .',, iiiilpt, ifor the Hun found impgssible to -er1gageisini,l5attle.g I-Ie his death While on an important aphgidigraphic missiombehindi the aiflefman, lines. ulilefyvas neaur1'f'Crepiong, when the :Wasp to brave, 'anti-aircraft'barrage to 'accomplish -his. mission! realized thatpthe success A, :of thewxArnerican fcigcpgipsgz gjiierided upon'hig?.f,iriE:ling the artillery -objectives., atterriiiting the impossible 'ai shell instantly killing his observer and that he crashed to earth and was lirrivltlie. fall. Lieut. Asher E.. Kelty Page 38:34- N 'ikcorateb for Valor Lieut. Phil H. Lasher 1, .- ,H , Y fjlbil FH. liasber, '19, Elgin, Fill. Sergeant, meoical ADQtdCbmQRt, 129th Flnfantry SERGEANT LASHER is one of those valiant spirits whose bravery consists of endangering all to help a fellow soldier out of danger. ln a fierce battle in early September, l9l8, the Americans were lighting along side of a company of English. The Tommies went over the top in spite of heavy enemy shell fire. Lasher saw one of them fall in a spot entirely unprotected from the terrific artillery fire. Observing that the fellow was not dead, Lasher left his trench and started out to help him. Gblivious of the shells which iwere falling around him faster every minute, he went but and, ministered to the wounded Britisher. Hiesyommandsf' recommended him for his decoration, particularly on account of this actiong although 'his other lservites had been equally meritorious. A ' V 7 f 3'l'f.'fEf,e3bertQ .i A ffnteljjifeter' R. LE ERT, an inseuctofiin the.Uni- versity, received the Croix, defiuerre while serv- ing as, -interpreter of prisoners- under fire. . For frnoijthsf during the worst fighting fof the Wai' Leberti served close 'to' the frolitfiflines, usually in ieontinlsial danger from enemy artillery, Hue. He is at Qiieserrqlwitli the French High5Qornrnission,,fiin1'rWashingtoi35J'3 7 V V Q ix.: ' ' N ,VW M -I . ,g 'ea V tenan ar-IIIY, 111 fhteg Dame of' Chateau, X 'D ,December fl91i8?S3fQiIih'eQ5presentation was I ff .3-2 i -' N 3. 4. Ci - J. ,a.., E,nM.i,v 7,2 y f '7r5,f- -ii .lg.iii.:1fr.-V, : . T. 8 3,211-3i,?gV..'!-If SQF1fhCaS5219i1'EaOVeH- .. - F0rr.+i1err Y f . ,wfffffsr .1 1 ., 4 .. :ww:4aL,.,1,.i w'xf4- ... - . ie-H tquous sqvices ln act10n?dlc17fiinggtlyesglgancleisaoffensivew' of Qctoberi' 31 4 iiii Llndbqgiggwifmughligiiigds, had many narrow escapes-J through his hel- ibuti not carry his 'name and number . fI 1 ' ' i ' Page 386 iilfisf ut. Gustaf H. Lind ism in St. Mihiel drive, Sept. I5, l9l8. S 'Decorateo for Qalor Casey V. Tloomis, '19, milwaukee, Wis. Corporal, machine Can Co., 6lb Keg. IC. 5. marine Corps RECEIVED Distinguished Service Cross for hero- Loomis left the University shortly after the United States en- tered the war and enlisted in the Marine Corps in April l9l 7. He trained for three months at Paris Island, was moved to Quantico, and sailed for France in October l9l7. His official citation reads: The Commamder-in- Chief in the name ofthe President has awarded the Dis- tinguished Service 'Cross to Corporal Casey Vaughn Loomis, Machine Gur1'Co., 6th Reg. U. S. Marine Corps, for extraordinary.- liergilsm in action near Thiaucort, France, SeptL'44l15,,t,l9lr8. During an enemy counter at- tack Corporal Lg6ifr'i1iai?Rrol'ifntarily left a sheltered posia, tion., and in entirgeldissregiarel for his own safety, set-.sup his gun in the ,,Q1?n,f,u-ndenia heavyderferny fire. se- curing enHladingiT'HI5fie.bn' therfadvamfingqenerny, he broke up the counrtgurgattddli within IO0 yards.-.of our line. Corp- Casey V- Loomis QgrpdE5lWLooiiii,sEig5zas.3at thef front 'i' from 'March 5 to , Noifil l, l9l8.j' Hiilfriived a slightrwound at the Ar- gonne. At that his, regiment Was decorated by the French withitlfe Legion of I-lorior. - ri! 5,1 1 ' Jg .. A M, -wh? X-,Jr.,1. 2.2,-x:.i,V .- - 2 rv 1,4 'auf . r . , Q, .. ,. as Wafmkrzxr. gmreey, r as ia .s . J - . , . ir M ,... ' f C ati Bel1eafuA 'W6od .chaise-'rrhiefry tis, wiiiela the V V ' 'if-wiliii 522 ffi-fi:f.,sf i- ' , nfl ii gf-1 r. 'illffiffrvlnfszfso d1st1ngk?15hCdrflifimsrelvf-QS'fbisfsstwrfffungQ-they ride 1 rg., .vt ' - nu .. ' wg, -,ax .... Corp. Frank A. McCoy -u 'fi -' It Jr' Aiea +L ,,, , ,ra the Cf011iyQdiCgQiiil'CffC 2 1 mrinre. owaadf 1-' ' LQ flair 'r 'T2'? A 1 - , - , 41 'rt SA 13 of, Honor. W. The? a:1??A..,,the1 only :to receive' glii'eifLegion oftljlonor. nearly every man engaged was McCoy was se- 1 ' ' d d if 'riltlwa vere y injure an ig9y,go..tQrig E,g:ea,p,. we ' 'Z Qiwgilf.. f- ,N Page U87 N Tecorateb for Jalor 1 A Lieut. Paton IVIcGilvary Ora Ui. mcmurray, '19, Evansville, wis. I 1 Ttieutenant, :Aviation RECEIVED Croix de Guerrefor bravery in flying. McMurray 'was one of the' first University of Wis- consin men to enter service, going over with the ambu- lance unit in ,Ianuary 19171. I-Ie saw 'violent and cori- tinuous service .as an ambulancedniver during his six months' service. After lhis' term of? sfervice'L.ieutenant McMurray enlisted with the American army 'as a pilot: While Hyingivviith a French' escadrille- he was sent over Withrfhis observer to spot enerny positions far back, 'of- the lines. Four Foklcers attadketif and he succeeded in driving' them all off, after-criippling two machines. On his returrihe flew immyediatelyf over an advancing' column of, 'artillery and 'enemy anti-aircraitgfire succeeded in seriously disa15li1YgQ,tliisifneW force with his machine guns. In flying slightly wou nded. The French government' him the Croix de Guerre for braverysliown oritliis and other similar oc- casions. Page 358 Ilaton mc6ilvary, '16, mabison, wis. lieutenant, 15. S. Aviation A-f'IEUTENANT IVICGILVARY is the only Wis- consin man who has been decorated by the Italian government for bravery during the war. For over a year lVIcGiIvary served with the American troops in Italy. During this time he made many flights over Austria, in bombing raids and as observer. I-Iis first decoration, in the form of the Croce de Guerra fthe Italian cross of warj, came after a successful observing Hight over enemy territory, September 20, 1918. Dur- ing one of the raids Lieutenant IVICC-ilvary accom- panied the circus of which the famous poet and aviator Gabriel D'Annunzio was a member, and had a fierce encounter with enemy planes. During the November offensive lVIcGiIvary's bravery was again conspicuous, and he was awarded the Bronze Medal for -Valor. 1 1 1 1 1 1 I Lieut. Ora R. McMurray S Tecorateb for Valor George 55. noble, '14, mabison, Wis. lieutenant, 168th Ifnfantry, 42nb fDivision HECEIVED Distinguished Service Cross for brav- ery in action July 28. During the Allied drive in which the Germans were pushed beyond the Vesle, Lieu- tenant Noble Was severely wounded. ln spite of the dangerous and painful injury he remained with his platoon in the midst of constant and severe action throughout the day until forced by loss of blood to stop. Like many, other Wisconsin heroes he wrote back, 1 did nothing at all Wonderful. But in spite of his pro- testation, his major gave him a high recommendation as one 'of the bravest men in his command. l-le was later killed in action. Lieut. George B. Nobl Capt. Paul Meyers r. 1'gig1j1'1' arfdfriflb firefl' Meyers is 'one' dl' only fflaul fill meyeers, '18, milwaukee., wis. Captain, Observer, American Tfscabrille BRECEEIVED Croix,d'eGuerre for bravery in the drive to Ap etmoungt, on .May 13, 1918. General Passaga, COIri1frIandingF'the'3Znd Army Corps, cites- Mey- fersuin his order ofthe day. Gm April 12, 11918, intrusted by the command! an' euiggent mission, he did not at 511ies'ita,t5,to ,cross the linesgatva low altitude af 300 meters, despite unfavorable aigmqgphleric conditions, and to ,exe- -cute the required reconnaissance under violent macliine or three who have received the de Guerra Lleutenanti Meyers was Q 'one 'of th'e'15Jesft,1foQ1E12iQa11llifga pains who lever Wore the Wi. ' ilrle lI.'m coming back for one more good year i 15IaitljfeffieswibxWlsconsin. We are Waiting for him. 1 g - ' e Page 389 Lieut. Gordon B. Reese TDecomte6 for Valor Gorbon 35. Reese, '18, milforb, 52. IIT. Ttieutenant, Flnfantry HECEIVED Distinguished Service Cross for actions during operations of Oct. 14, 1918. Lieutenant Reese is the only Wisconsin man to have received a decoration for bravery in Russia. During the fighting with the bolsheviki along the Vologda railroad he re- connoitered enemy positions andxbrought back more useful information which was greatly instrumental in the success of the operations on 'Qctober 14. Again in the same recommendation forwgward, the command- ing officer states that Since joiniinfi theycolilmn Lieu- tenant Reese had frequently fshoyggnayggeat' daring, loy- alty, pertinacity, and devotion, had given a fine 1 . ,, ,V A example to his troops. tk ' in ' , , fflhj, , ,j , ,nu-1 1 . , .,,' .-. -. -bgzakq . V 1 ' X 1 - 1 I i ' 1 K f.- - , at af.-f' ' V :ii Arthur jiobinson,-'17, mabisdn, R2?is.f 1 lieutenant, filnfqntrgi it V liiCiEiIvEDiii 1st1nguished Cross for 1' gal 'flantryiiand heroism displayed? under fire near'VilleE SavoyeE,,Aon',LElre riorth side of the Riverton August, 2Z,,,191i8Qf'f' kj ?'Screened ,smoketofnpiar heavy barrage. and the dGfx5C 55534. ith? lCHQ!i15611ha.Cl'Q15l!5hii45rf01W4'i4i ignifis Shine' gun to s s riQht'fif1,arik'of: CQm15any the lf0igi'r?Iif2tCdlLA.l .gud .loriifmedl ei? 1' 565121155--gil-ifikisiis' fire LL 19911 the Emtirfrffskimpany, .GB-Usillgf many Casualties. Lieutenan-tfj'i:RQfbiprQs,on.1'attaclgedi mafhiigl and 'bf members '7 crew. V-.under 1 ' 1 Hfelhe 'fUU1i9d51?H5 suh upon the, advancing and heroic action caused Casualties in breaking UD fa -,'- his C0mPaI1Y,S position..Qseriouisly-.5 ii',p. ip . Pane 390 3 1 1 , A - . , P Q 4-V 1, ss. Lieut. 'Arthur H 'Decorateb fo Hicbarb wilson Steele, '20, Oak, fflarh, Fill. liieutenant, Observer 166th Hero Squabron .QEIEUTENANT STEEL was awarded the Distin- guished Service Cross for great valor in action near Bois D'Barricourt, France, October 23, l9l8. While on a bombing raid back of the German lines, Lieutenant Steele accompanied by his pilot was attacked by six German pursuit planes, and the enemy began riddling their plane with machine gun fire. Lieutenant Steele fought them on, all sides and is credited by mem- bers of the Eleventh, Aero Squadron who were flying over him several thousand feet with having brought down one -of his opponents. He was wounded twice in the leg and wtwiceiinitiiie arm but in spite of great physi- cal agony he c5fiiibimu'ed fighting. Each time he was h-it he was knocked' down iritdg the observer's cockpit. ,,:,! last, however, Qply tail gun waslin--working condi- tion, the othetftwgoVbei'ng'fhopelessly'gdisablehdy:by ma- chine glln bulletsuiand Lieutenant1'S'fe'eleQgiik uncon- r Valor wi sciousiigtoithe'Afcgcljpitfi Steele, a iuniioif-iin'fLetters and I-ieut' Richard W- Steele Science, re-entereiiiifilie''University fin Aprilf 11919. ol r .,, ,',, 'k.f'f'.-S . ' Lieut. Edward C. Twitchell 'I' qf,.', ' 'f'-1 -1-V ,Jar fig' f -4 .1,1ir,e.:f- ,,1- , - .- ,ns are rbi'-sem ,, lieiiQfHQers' ,training-ieamp at , is iiiggcourse hee atsfcommis- Tfbwurib, -EL., Ewitcljelfl-, '13, fitliiibison, wus, ,X ii L L P i ?llieutenaiyt,'fAt,tillety it Nlarch, ' l'9l7, -l5CfQE97,fthe Qi1i.15Cd faStates Entered theiwar, Lieutenant? ,Edward'Twitchel14 enlisted 'for ,monthsf gservice,-1,fwi'tlio1it payg, ,wwitlfithei l'Nbrton- es Aiiibiilance' Ther' Qiorpsfjhsawijalmost ' con- ' Eixiuous itheijiiront drives jqf' 149311, -Woifkingftjonsjggntly under A At.,thefclosC of. his i',.- deco- rated 'asga tiiitiuitei-rto,,- his :'f yalior under 51-if1fQil,iIIi'ilQY51fYi-,ii 'tr' ' ' 'A' 2- -e'2k'+,sax 'z .?- iq, i 'Z ',,- are-It f ,, i 'F' uf1i 1feel,iHg tha1g'1higi3wantedf--to 'agamtigiver aslliffm' the fig gift i.ii t'i1':1f.i , , ,,-, M5 -- . 34,5 . r Sixth Eels is V X lVfarehff'I3 X3li9llQ?f3fh'i 'asf-sevenelS?f7gas'seds Affterwhrs -' -ffr- 1 -e-17 fy 1, - J one Of four was-from , 5 A 4 if fr an , l 'Lear si'61iedif'fSee9nd weeks later pro- 'moted to First ,assigned to the l'07th Regiment, Guards, and sent again to ttie?'Eii'5nTif itached, and later seritlto' the States.. He was stationed at Camp McClellan, Alabama, as Operations Gfficer when the armistice was signed. Page 391 f A. Mor 'ihcorateb for Valor QX. mortimet Van Cstranb, '16, mabtson, wis. lieutenant, K1 O3r6if11'ie1bifArtillery '!'LIEUTENANT VAN OSTRAND was cited for bravery in action on june 19, 19181 1 During this engagement he was severely gassed and was forced to spend several months in a hospital. Van Ostrand re- ceived his commission at Presidio, San Francisco, in 1917, went overseas in January, 1918, and saw active service continuously until he was wounded. The divi- sion commander cited him as follows: On june 19, 1918, during a heavy bombardment by the enemy on position 413, Toul sector, First Lieutenant A. M. Van Ostrand, 103rd F. A., exposed himself to this intense fire to assist two men from an ambulance which had been hit and was still under fire, becoming severely gassed himself on this occasion. The division com- mander congratulates this officer on his gallantry and self-sacrifice. Since his recovery Lieutenant Van Os- trand has acted as instructor in the Artillery School at Saumur. A Uianbolpb 11. ewaoswortb, ffl. Gbomas, My. , Captain, 3Fiftb Tielofftrtililery' 'A QAPTALN f'DUCKY .WADSWGRTI-Ig, Editor' of the 19'17'Badger, survived nineteen monthsof ac- tive fighting, overseas and came- through without ia scratch, and with both the French and Belgian Croix de Guerres as envious memenftos of the long service. Captain Wadsworth had charge of-za battery of regulars and was under fire at 'Chateau Thierry, Argonne Forest, St. Nlihieland Soissons. entered' the First Officers' Training Camp at Fort Sheridan!! iii 1917, and was se- lected for overseas service. iiiiriiediiaftely after hewas commissionedg A Page 392 Captain Randolph L. W X Tecoratcb for Valor fDonaI6 W. wlbite, '18, manitowoc, Wis. Ttieutenant, 23rb illnfantry ,'LlEUTENANT WHITE received the Distinguished Service Cross for heroism in action Nov. I I, I9I8, the same action in which he lost his life. The recom- mendation to Congress came through General Pershing based upon the favorable reports of White's command- ing officers. l-le was mentioned for extraordinary heroism in action near Landres-et-St. Georges, France, Nov. I, I9I8. When the advance of his battalion was hindered by a strong. enemy machine gun nest Lieu- tenant White led his platoon forward in an attack on the hostile position and was killed at the head of his platoon just before the last machine gun was put out of actionfy t. Donald W. White Major Lemuel A. Wil Ttemuel la. 127-ilrnot, '14, Vaincouvet, 55. C. Y major, 29th Vancouver Batt. Znb Canabian E. HF. mejor WILMOT received the' British Military . Cross for valoreshown in ,actionla-nuary 29, I'9I 6' Wilmot. is prpbably the first Wisconsin man who saw active service, ,and doubtless the only one to have risen to Such rank in the Canadian army. He enlisted in I91Ii5, abd-'soon rose to the rank of Lieutenant. I-le was in charge qff ,the .scouts at that time of Tobirfs Tigers, the famous crack Vancouver regiment. One night with two others he crawled across .No lVlan's Land ,and cut the German wires. They stayed gin this -dan- gerous position three hours., knowing well that the least sound would mean 'immediate death. They attacked the trench, silenced the semtries, and bombed the dug- out, capturing several prisoners and putting those who resisted to the bayonet.. Lieutenant Wilmot was slightly Wounded in the fracasi I-le continued in active service for over a year, after his exploit for which he re- ceived his award. l-le was then sent home as a training officer and raised to lVlajor's rank. Later he went to England and served as an important member of the Munitions Council. Page 393 'Decorated for Valor Lieut.'So1 Wise ' 1 fc? ft. Sol Wise, '17, Cincinnati, Ohio Ttieutenant, :American Cliietveiwifscabrille, no. 111 WAS awarded the Croix de Guerre on August 14. 1918, for bringing down a boche plane in the bat- tle of Picardy. On August 11, Lieutenant Wise with other American aviators engaged in battle with Von Richtenhofis famous flying circus While making a bomb- ing raid behind the German linesi Vui11emin, com- mander of bombing squadron No. 12, cited 'Wise as a calm and sure observer. He has..-taken part in some of the most difhcult missions and! has acquitted himself with intelligence, bravery and modestyf' At the time Lieutenant Wise received hisiasvgard, his Escarde re- ceived its third citation together Withia Hag bearing the Croix de Guerre with palin fqfncbfififfnicuously brave inservice In the battle in which Wise was decorated his riiachine was -stijgck four ibuliets from the Fokkersmand ti'i6 'sSROtS repaired, by -gblfack crosses to mark erieiriy hits X 3. f ti H V..-' ., 17 1 1' --a,4g,,- ,, - , 1.4. , 1 7'+1:gn,n,4'!':5! ' 1 if K N? ,Q- 11 'I X Qijgllermaiz- Ziscbhe, Hoqiqqnjgtwfisi. A 'Captain,lC'. S. Ittiivirinef gl if gf fisggsenior -Qlass' , of was decorated with tithe Croix. de Guerra, tcigerher' vggiith st irom,,Mars1gal Pqetaln, for fat 'Thieiiiry' in machine ffibrsqnal eiisregafd daiiiit-'INA gold and set ini-'4the:'1rnedaki ' '31 JA V: 'K' it Yi 1-' ' . ' ' whichvgas ,presented at the 551053 hostf11it1AQi3j3?1Qaptaint'-,5Zi5Qggg1iiik5i5ifAf2fsf '?One 'of vteni-,horioliff graduates ofa in they 1UT'Si Marine Corps hostilities inQ19l7. He was saw much active fighting '.-c, Thierry where they ,coveted r- fglory. 1 e Page 394 ' .. daring, ua- i its Captain Herman A. Zischke -L 1' 'FG J:t':.,Nn 5 653fszf'fi5f - lqffiffil 4 5 If P' 4-F' 2 L- 5 x ,..1 . f wrN,..,.v,h., , A Af ,, 2 gn I' X 'ff' k5:1'i--1173- if ' A ,f',5'Q,V.f 4 N , . 'i'4Q.3? :f9:333?SB.v' U' - 5,1 Faris if zifwga f ' X ya '. Qmffkfaf nf. :..?' W'-i31Ql5ls25'7 lf' 1 ws., -' ' ' V Q 1 : 4 nf' 1 ,WQMNNM . - ' iw-AA ,., 'L Imam. um--'f - .naw ...Q Wisconsin 's First Contribution to the War Gite Famous Badger Ambulance Unit Q i Capt. Lloyd Garner, '18, in Charge of Repair Work on French Ambulance.: for the Front One of the most interesting, but hitherto unpublished bits of Wisconsin's part in the World War, is that of her ambulance unit. In early l9l6 it became evident to people in Madison that the University should be represented in the work of mercy being done by Americans in France. Consequently Mrs. Robert Van Valzah. Mrs. A. L. P. Dennis, Mrs. Hobert S. johnson, and Miss Mary Oakley, began to raise money to send some men to France. Their Hrst move was to bring a special war movie here which served to raise the first money for the fund. Shortly afterwards these same ardent work- ers brough Maxim Gorky's son to Madison, Lieut. Zinovi Pzechkov, a member of the Foreign Legion touring the United States under French government auspices, to arouse interest in allied relief work. He gave a lecture in the Woman's Building which raised 5100. . While the volunteer committee was debating what to do next to raise funds, Miss Belle Crowe, of the Irving, in November l9I6 came forward with the munificent offer of sending two boys to France as ambulance drivers. This offer toglether witilasie money already raised served to send Healy Powell, Harry Craig, and Ray Williams to France early in anuary . An incident to show how true these first men were is that during action on March 19, Crai received orders to go into the woods just behind the French third line of trenches fthe Germans had already captured the first and secondj. The woods were full of gas shells and the lighting was less than a quarter-mile away. Craig and three other men drove ambulances into the woods and for many hours continued to carry wounded out, constantly endangering their lives. After the expiration of this gallant Badger's term of service he returned as an aviator and was later killed while driving a bombing plane. V .In the meantime Madison and University people were not idle. Mr. Barry Cerf and Mr. Eugene Byrne of the University formed a student committee of 20 men to raise enough to send a Ford ambulance and to maintain it as the University of Wisconsin contribution to the work of mercy. While the student committee was busy canvassing for funds a town and faculty committee composed of Mrs. Hobart johnson, Mrs. A. L. P. Dennis, Mr. Barry Cerf, Mrs. Robert Van Valzah, Miss Belle Crowe, and Mr. Eugene Byrne attempted to raise enough to send 20 Wisconsin men overseas. This combined with the student funds would pay to maintain a complete ambulance unit, which is composed of one ambulance and 20 men. The students succeeded in raising 5800, three Madison alumni-Carl Hobart, Morris johnson-gave SL000, and lesser sums were contributed. These funds were sufficient to send eleven men chosen from over fifty applicants, many of whom had tp partially pay their own expenses. These men were Ora McMurray of Madison, who iater received the Croix de Guerre, Albert Gilmore, later killed in action, Leslie Rowley, who received Croix de Guerre, Lloyd Garner, another recipient of the French War Cross, Stephenson P. Lewis, also died in action, Ivan Fay of Evansville, J. A. Evans and A. R. Evans of La Crosse, Richard H. Stout of Indianapolis, Tom Hefieran, who was later killed in action, from Chicago, Gilman Blake and james F. Jenkins of Grand Rapids, Michigan, who went as hospital orderly. ln the summer of 1917 three more Wisconsin men went over as heavy ammunition truck drivers, paying all their own expenses. These men were all physically unfit for regular army service or were under draft age and did not want to be left out of the big work. They were Hugh F. Brown of St. Louis, Mo., Merrill M. Benson of Sterling, lll., and Harry B. Haley of Madison. Shortly after this the Government took over all relief work as part of the American Red Cross and so closes -:A little known but interesting chapter of Wisconsin's share in making the world better. F' A FIGHTING FAMILY-judge E. B. Belden, '86 fcenterI and his two sons, Lieut. J. E.. Belden, 'I7 fleftj and Lieut. S. R. Belden. 'I 7. Judge Belden served in the Y. IVI. C. A. as secretary in various can tonmen ts for Hfteen months, while his sons were assigned to infantry cam-s as drill instructors. All three are 32nd De- gree Masons and members of Chi si. ' THE CYCLER-Lieut. I-I.Stan- ley Wanzer, '17, before the post ofhce 'A in the little village of Raubolt, just west of Chateau Thierry, where he was billeted while awaiting orders to join a new unit preparing for the great advance of last July. AT VERDUN IN 'l7- Stephenson P. Lewis, 'l7, is shown in the foreground be- fore his hospital car, ten miles from Verdun, on the day American forces joined with the Allies. I-Ie entered the French service in l9I6 and served as ambulance driver along the Marne. Later he was transferred to the Ameri- can army, commissioned, and killed at Chateau Thierry. ALL 'IS-Four of last year's graduates re-united at Great Lakes. Left to right: Thomas Hardy, Charles Ewing,-Arno I-Ioppert, and Ensign Arthur Dahlman. Wisconsin Battles the U-Boat Menace V , i ANTI-SUBMARINE DEVICE EXPERTS- One of the most important scientific contribu- tions to the winning of the war was rthe submarine detector invented and perfected by Professors Max Mason, R. Roebuck, and' E. M. Terry of the physics department of the University of Wisconsin. . After a series of preliminary experiments conducted on Lake Mendota under the direction of the university had proved the success of the invention, it was officially adopted by the War Depart- ment and the scene of experimental operation was moved to the Naval Experiment Station at New London, Connecticut, There the device. the nature of which remains a govemment secret. was perfected and upon being employed on American and English transports. revolutionized sub- marine warfare. Not one of the vessels outfitted with the detector was sunk, and in nearly every case following warning received of the approaching enemy sub-sea boat, the latter was destroyed by means of depth bombs. h All American ships were outfitted with the Wisconsin submarine detector before the close of t e war. The picture above shows a Captain and group of scientists attached to the U. S. Naval Experi- ment Station, New London, Connecicut. Three Wisconsin men are shown: Professor Roebuck, top row, sixth from left: Professor Frank Gray, top row, last man on rightg Professor Max Mason, bottom row, fifth from left. A SKY GUARD-The experi- ., A mental work on the Wisconsin sub- s marine detector was carried on from the group of buildings in the fore- . ground. The entire area of the Naval H i - Experimental Station was under - ' r K 1 .I A martial law and no one without the if-H 4 ,V In ,,.. ,lk highest credentials was permitted 41 - .. .. ,.',,,.- V - ,. ' . f .Q ,.,, ., -,.-ow.. ' fs - - - - T'-mgfi -- K- ----- r asf' X-1 anywhere in the vicinity. Observers .ilillilgaf ,, :Mc-1 - C-f, 1. ' S' ....- .1195 -N - - In balloons, llke the one Shown' kept Watch of the Sea Coast to Prevent Q-4-'fsS:rss.1f-ffifsszim,-awmf?ra-fe fs.. - ,.,v,wf,- .t - . - 1 - - tw ig: , -Q :,- f any possible andmg of spies on, the 1 5 - --.Av-. L- .... . -Q.. ' . water side. X i F . .5 - l 1 1 als i i 5 '1 S --9' 1 r' 1,1 , .ig , ji 1' 3 kv- l Q -. p -li 'iqx i ' 1- Za - - . ' ' ' ,. V -- 5.52-'3,u'55S . ' , , ,x 1135, :LLT514 ' - jr. , w -,wi 1:L4:,..H H- .,,-Ka., ..,.,,g,,..:g' ':a.1TfT'jfig-N Q- f 'I is 5325, . , ug... W. ,i '.c..:.-.. . .V , -,T ,.. nllw , f-A. . J. ...-- ui-id, ,:, Hg., . w?z 2l,1f- Z .fj . i'f--:Q--.4-it -'eicti--3.31 - - . Vi' 2' 1. kt Tjl4Ki'fi 4, 4 .. . ----1... -1- -fs -f., - -5 .- . ... -., N. .i,. , . -if S-...f .. .- .. . i?1: i'l ' '.fFiW'-ft' 11.-A-fJ-' -' 'v . . . --of-'-5-el--1.4. ,915 u.:,1..:'- y uan-. ' - A .-.'. w - ' I. ' . i Y, lf' ,, L 'g,,,'r.---'Y . -'N . M ff' V - -' -Q '. mf .- .A . l.. 2 -A ,- ' 55-31 ra' 'Q M4 ',' '. 1 , 1----M ' - giftfw. EQ- e- ima?-' I ' 1 1 .Ee .- e 1- . . ---- - ,. L -.I-il? - --iz.: -' . -. -'--X - 1 -- - --g SECRETARY DANIELS STUDIES INVENTION-just prior to the employing of the Wisconsin submarine detector on all American ships, the secretary of the navy and his staff of experts studied thefdevice at the Naval Experiment Station. They are shown in the picture land- ing from a submarine chaser Hying the flag ofthe Secretary of the Navy. Secretary Daniels. Thomas A. Edison, Lieutenant Spafford, and the Five University of Wisconsin faculty members in charge of the demonstration are in the foreground. THE U. S. S. THETIS CAMOUFLAGED-Was em- ployed as the ship on which the submarine attacks were to be made. It was the first merchant ship to be outfitted with the Wisconsin submarine detector, and in the experi- ments was used in conjunction with the submarine and submarinechaser shown in the other pictures. -- 'rs' ... --L...- -' '-1:--T-1J.-.,- ..,...-- ::.'.L. . , . Q'...,.f..w - -. QI , -f'- - :- ., 'swu kg 1-.yn-., . .. 4- , J -f,-4 -' an if ::1...,'.:.,:14:1:-'aff READY FOR AN ATTACK-The American sub- marine ul-ll used in connection with the test work on the Wisconsin submarine detector at the Naval Experiment Station, New London, Conn. This under-sea. boat 'f at- ticked'A'lJt51e, Thetis and was itself endangered by the c aser . WILLIAM H. DABNEY- Superin- tendent of the University engineering shops from l907 to l9l 7, served as general super- visor of construction and installation of the Wisconsin submarine detector at the Naval Experimental Station. He is here shown with two small American subma- rines used to f'attack t-he Thetis docked in the background. 1 1 1 If I S. C. 19. -Submarine chaser 19, shown here, was the first vessel of its kind to be outfitted with the detector. lt was used in tryouts held along the Maine coast. Sturdy boats and sturdy lads. They have to be to stand the racket. The picture to the right shows Prof. Frank Gray on hoard the U. S. S. Thetis while the latter was being ap- proached by the submarine 'Al-ll H for an attaclc. g At the time the picture was taken, the submarine was more than ten miles away, but warning of its presence had been received half an hour before. Prof. Frank Gray r . . Q I 1 i 4 , 3 W Y . r - ' 1 N' ' X 3 I WX -F VY 1 J I --- 0 . A ,. on , ! 'g f' 53 . ' 4 1 ta ' e A ' W. IKE' :f -N 4 V, Y' 4, P ..-f -Q .p r 1 ity 54' --.. ,. : . . ,. x 1 eff K J: , f Li ,lj 5,4-5 ' I lf- - .qxf -' I he -I A K . s- 1 I , ,V K iv .4 K ,. ,.,, it 1 1 I V rll' -YQ 1- 1 'f X.: - 5 G v:,r 1- ' my , K ' 11 Q r T-ii? U MUSTARD GAS, I SAY !-Capt. V. L. Bohn- A QAUSAGEH-Transferring commander son, '13, arguing with a fellow officer of the Gas from sausage balloon to S S Gloucester. Service over the fine points of awestern-front at- Lieut. Kenneth F. Whitcomb, '18, pilot. tack just being launchedlby the enerny. ' b -'x BOUND FOR BAGDAD-The front figure in this group is W. R. Boyd, '18, who spent Fifteen months in Egypt and Palestine in English army Y. M. C. A. service before America entered the war. This picture shows a' portable movie show being transported across the Mesapotamian desert. ENEMY SPOILS-A captured German l 03 rifle and musket. Abandoned by the enemy in HUSKY A. E. F.r'S-Sergt. D. L. the great retreat forty miles east of Verdun. Dietz, 'l7, Cleftj and Sergt. A. lVI.,'Dunn, Lieut. Carl Harper, 'l4, is bringing the musket '20, being entertained at the home of home with him a as souvenir. a grain merchant. Dinard, France. I 1 a 1 'I - CAPTURED BOCHES-German prisoners under French guards, Soissons, September, l9l3. Picture taken by Lieut. Harold Blommer, '15, attached to the French forces as interpreter. V A V' I gi 2 if, . l V so 2.2 rg. l 1 2-,:s:wv:Q W-.,:- '-i w-':fP',f-166,54 aw . . i I .ya Q F l i K. w W, 5. A WAY SIDE SHRINE.-Crosses such as these are found at almost every intersection of roads in France. They typify the devout spirit of the French peasant, who pauses for a moment of prayer before each. Sergt. H. A. Edmonds, 'l4, and Sergt. Floyd C. 4Roth, 'l6, are seated at the base of this shrine near Moreau. I l I . . J l i i . is - - E ' x V 4 :T Q 5' . Ca 1 ':i2zifai5e:?3 ' -5 f , '.?'5: laS:5ifff? '5-5,9 V 43314 ' 420 -L12 1' , ' ,,. 1,--,VA ..,. ,g,-35319, w Say- Q :fa x 155355 .H - -ff.: an 1 - H s -A -'Ri L . Q ,gk fasw sfr. l' . Q IL l - gf -:'1,,gf55.:g,gQQ Y 4 - r at BACK WITH A SMILE-Lieut. Edgar A. Baird, 'l4, was engaged in al- most continual fighting in the vicinity of Chateau Thierry from July to Sep- tember. l9l8. He is shown here on the day of his arrival at a rest camp. 75 miles behind the lines. Happy? Sure! Not a scratch! A GUEST OF ROYALTY- Lieut. Kenneth W. Ericksonf 14, of the Field Artillery, was in act- ive service near Chateau Thierry from July to October, 1918, after which he spent two weeks in southern France. This picture was taken in the gardens of the Prince of Monaco. who entertain- ed groups of American officers. FUSSING IN FRANCE- Lieut. Clarance F. Watson, '10, fleftj and Lieut. Edward Holmes, 'l1, spend a Sunday afternoon cycling through a Parisian park with two French teachers, grad- uates ofthe Sarbonne University. FN'-. '-,,rf'L7. ' f THE HOME OF LAFAYETTE-Lieut. Kenneth Curtis, 18, of the Military Police, was billeted on the estate of France's great republican at Cosne for nearly a year. ln peace times, thousands of visitors are received each season. Everything stands just as did during the French Revolution. ,a-' , ' THE LUCKY THIR- TEEN-A group of col- lege men with the 20th Engineers. While all have been under heavy fire, not one has been injured. Top row: Herbert Ross,' 18, A. J. Brann, '18, H. Lons- dorff, '19, Henry Mc- Adams, '19, Sidney Thompson, '17, Sergt. J. M. Hussey, '18g second row, from the University of Michigan: bottom row, from the University of Chicago. 1,1 ., . ' x , ii? V- 1. JUST A BIT OF JAZZ-Edwin R. Booth, '20, extreme right, helped to sweeten army life for the troops training in England. The other musicians are Harvard, Michigan, and North western college men. All six are now touring the country with the Victory Boys' Band. A HTAUBEH-An enemy plane brought down on the Alsace front. These small airplanes move with terrihc speed and are used in obser- vation work, but are not constructed for fighting. The pilot is unable to defend himself from attack. 9 3 1 ' a PINE ISLAND, CUBA-Louis A. Manthus, '16, of the Marine Corps, was garrisoned at a Cuban internment camp, where some hun- dreds of Teutons were kept as pris- oners after attempting to stir up popular sentiment against the allied cause. .- A DARING FEAT-Picture tal-:en by a Badger aviator of a daring Canadian pilot per- forming for the birds at an altitude of 3,000 feet. :Wi v- IQ ROOM FOR ONE. MORE !-Lieut. Clarence E. Rich, 'l7, always had an eye for the artistic, so trust ,him to pick out one of the most romantic and picturesque nooks in the Palace Garden, Ver- sailles. But he wants company, for what's a ro- mantic spot-alone? TURNING THE PROP -Pilot Bill Reid, 'l8, about to turn over the prop for a friend going togtake a joy ride among the clouds. V' UNDER ARCTIC SKIES-Lieut. Gerolcl E. Luebben, '17, receiving the U. S. home guards at Fort Liscum, Alaska. I i .1 V A COLD RECEPTION-Rollin C. Hawkes, 'l8, third from left, wears a pleasantsmile in sri-glie of the big blizzard which blew the transport on which he was bound for France 200 friilesfout ca 1 er course. ' I 4 l 1 LET HER GO!-Lieut. Kenneth M. Kelley, '17, was trained at Scott Field, Illinois. Later he served as an instructor and exhibition flyer on various American fields. He has won several prizes for both speed and stunt work. He has just completed a tour of the country with the Flying Circus in the interests of the Victory Loan campaign. A VETERAN OF CHATEAU THIERRY-Lieutenant Vemon C. Quigley, '19, of the Trench Mortar Battery, was in front line trenches for nine months, in the thick of the- fighting, but escaped w i t h o u t wounds. V A BADGER BALLOONIST- As a member of the air service, Major Alvin C. Reis, 'l3, was called upon to do observation work all along the western front from both airplanes and Hsoapbubblesu during his ten months of active overseas work. From the balloon here shown, hefclirected the artillery fire which destroyed an enemy ammunition base in the Verdun sector. X -. .Tip kg ..,.. ,l -- g . kg, V?-. YTLSYGW. 7 .cf-M, ig 1, -A , ., -,, .F,1ff--.- f ...rwvvr,,... -1 .1 f-rw I,, THE DEVIL CANUCKH-Picture by Wisconsin aviator at Taliaferro Field, showing dare- devil Canadian taking an FROM THE HEIGHTS- Bird's-eye view of a French city taken from a height of 2,000 feet. Badger bird man Ujazzing around in the fore- ground. Name withheld by request. - airing on the body of an English plane at an altitude of 7,500 feet. RACING HOME-This photo taken by a Badger airman at Taliaferro, Field. Texas, shows the birds in flying formation racing back to camp after an hour's spin in the clouds. THE POPOTEI'-A party of allied country ofhcers enjoying an outdoor dinner in the Parc d'America, Paris, in celebration of Bastile Day. Veterans of Verdun, Liege, Brussels. the Marne, and Pavia were present. Lieut. Frederick Pfister, 'l5. is seated at the end of the farther side of the table. SOME. CHICKEN, WHAT?-Mem- bers of A. E. F. were frequently billeted in small villages where few accommoda- tions could be had. Consequently, any- thing that suggested shelter was pressed into service. Lieut. Harold Wengler, '17, was quartered in this chicken house with four fellow officers for eight weeks. NICE IS NICE.-Forafellow to spend LES DEUX AMIS-Capt. James D. Basey, his furlough in, says Lieut. H. B. Heicler, 'l5, and Lieut. James D. Boucher, 'l4, at Biarritz '15, but who wants to live there? Too France, where the former was recovering from a many steep hills for one thing. serious gassing received in the Alsace-Lorraine sector seven months before. U FLYING 6,000 FEET UP-This picture shows Canadian aviators in flying formation at a high altitude and gives an excellent bird's-eye view of the beautiful Texas scenery. Many Badger aviators were trained at Texas flying fields. , a WHAT WAS VERDUN-Few cities in the war zone suffered so much devastation during the past live years as' did Verdun. ln the path of two fires, what was one of France's fairest cities, is today nothing but a mass of tumbled stone. This street, Rue joan d'Arc, was formerly lined with magnificent dwelling houses and public buildings. The battered walls, the appearance of the lawns, and the picket wire are indicative of the condition in which the whole city now stands. Major Alvin C. Reis, 'l3, is shown in the foreground. 4,,. BEACH BEAUTIES-Five Wisconsin men all lleutenants m the aviation service enjoying sun bath after a dip at Biarutz, France. Left to right J W Kunneke I7 Linton A Cox I9 I. D. Miller, '16, E. A. Arpin, '20, W. Buckley I9 Freak Crashes .7 From Flying 0 Eacperiences Of Badger Avia tors A MIRACULOUS ESCAPE.-Remains THE SMASH-UP--A disastrous crash at of a scout plane following fall of 4,000 feet in Love Field, Texas. a tail spin. The pilot, Lieutenant William Reid. 'l9, was unscathed-a miracle of the air game. 1: ,I Z, . . , : i4 um... ' ' 1 A REAL SMASH UP-All that was left of the hydroplane of Lieut. Harvery Conover, '16, of the 90th Aero Squadron, after a collison in mid-air. from which he escaped uninjured. The salvage crew is shown in the background. i ' QQ 1' A Qjlffore Crashes X. 21 '- . ..,.. . V f ima--1125-.'i' 1 .. .sr:v?f P. Mzi-1!5,f'5'-57 I , .f .,. if-2i1ifHmf'f ., .7 A, -, , 2t4'..i'5f,-1 154 farm . 65 .1 A A V .x X Ira: up J 45.3 I- N I .. If Q E' ' ' wwf- f I HL... L -' 112' fl.. V ilk 5,2 'fi - Y. -I 1.x , IJ, V - A 1 . 1,1 .:' s In ' -- . -af. ,. . , . H, '-'-www, .. ' ' ii V' , , . , , -, , X jx s Ik- ii ,I I. in . I -we ws . . , ' , H ' 4 , iff-gf.-'-if ,- . V, - . r--' fb...-i . rw- 3+-'ie-rw -4, ' ' ' , f' - i+:wf-r-x-mL5m1uiv- - . JUST DROPPED IN-Lieutenant Bill Reid, 'l9. Hies into barracks with his sky ship in an attempt to find the shortest way home. He did. NOSE OF SAME. SHIP-As seen inside of the barracks. CASUALTY - The passing of a tailspin and its results-one fatali- ty. Photo by Lieut. Bill Reid, 'l9. WRECKAGE- Picture of a fatal crash at Love Field, Texas. Taken by Lieut. S. H. Harrison, 'l3. 'N N-1. S' I ' - V . . I . 'X of Going Up and Coming Down ,,... .,, A . mf V . , , . ' six fr , B X is , S mi iid-f' -Q A W -X.. I ' any . pf ' X ' -V ,V l - - ' .se .fvhafi ' .I I fe, , - ' I . ' f. f 5 . . -:, - ' ... - ' W Qi-:rss ' ' I0 if , - -.. ' ' 1 v l If f L X, E . I g ,. ..,.. - .f-wi '- ., W-g25' :'1v y Z,.-ff ' 'KA , ,545-X ! M....,, , .iw-..:e. ,i .1 f..--.,-.-Q. 4-.35-1 -- ',- -I f.f,,,K WH- f--+5 Q jubfi - ,-25732.-Q 'L'1A43:r1'5iE my-. .et,:f,x.:'f . 1.LZ.':.f-m'-'sfffii-1.-N qw- : fA.s.':J 0 .' P: 'Af '-'..f?2:l Q. Aaffiliv'-fs13i.' 1 - 1:55 'Bidi-i'2.f1i -QS 4:1 -we A L3 z.'-.-fzf' 45,-.N.frff::mg.'S.r-wha' -e'a??'f9sS:': :f-we-fg.Q,.-f1,-.--A 2 .- 1 .1321-:ami '-Qk.,i:.1f+.x-d-:::Sa'e:, -, ..v-eg-saws-4?w..f wQ...'.f3.r-: f 1 inf' ,' . A- 'YTJ+ri'ff.. 'f?35t -'lu ' , ' -'ibffig -MAE 'I ' - ' ' '-'Q' U N 5 A' e .1 . CUTTING HER TAIL OFF-Crash at Taliaferro Field Texas. No fatalities. '1 1 3 A MIRACLE-Snap taken of a Wisconsin man's plane taken after a. forced landing sidewise in the heather. N0 casualty. ifiiefe ' .257 it . GOING UP!-Lieut. George M. Chritzman, 'I6 , at Kelley Field. After completing his training, he served as bomber near Verdun, and aided in destroying an enemy ammunition base there. He is now employed in the aerial mail service between New York and Washington. UPSIDE DOWN-Lieut. S. H. Harrison, l3, experiments with new landings. He has just landed, upside down but unhurt, and is waiting for the wrecking crew. 1 FORMATION FLYINC-v-Part ,Ti-y of the tactics at Ellington Field, 'I6 which Lieut. David Mossis claims he thoroughly enjoyed. HOBNOBBI NG WITH ROYALTY-Burdette I. Kinne, of the Romance Lan- guages Department, is an at- tache at the American Lega- tion at Berne. In off hours he spends his time making the acquaintance of exiled nobil- ity who may be straying about. He is here shown with Prince Pierre Boycoyans, grandson of the former Prime Minister of Roumania. Bur- ileite says that he likes the Stunts Above the Clouds NO TRAFFIC COPS- Lieut. Wm. H. E. Reid, '18, looping the loop at a height of8,000 feet. Lieut. Reid discharged from ser- vice. is now a senior in the Ag school. f : ' 4' K V ' :nav-11 1' V aa .- ,: , Vg. ff 45141 ,Q 5- 5 A. N 2- W. uv ,N .:3z1: .- ' 'lf .9534 ' , X I- Yam - 1' s nf QQ A -Q5-.bf Z ., g,,. 4- 513 '1'.tf V- .-'Iii T Q.,-' .gf'41 1 fn -.- .. - , , 1- ' K1 - ' 41 .. L1.yf,,A. A Z . 4. - ,V ul, ,uf .. . I dx .. f ' XV . f 0 'gms 'H , - - --- -A . 1 is Ama. -also . Q. y. x vi' -V . . 3. .. -V... . - X fi ww.-.. A p ' 7 pf -if we . 1 .9 ,I 1-pgs w. ,ah wt.-.,s, A A Q:-.V 5, ,F -f . ,'s4Ytff9-..ff1-S-N w. if 1 39- we .-at f, it - - get ,,,, .. A ', . f Tig ' H .. X- , so I 2- . as Z? V , Ve Q - af? is at - -V . iw 'Q '- . ' ' -V LOOK OUT BELOW-Truck train passing throughistl' Voe, France. Taken by a Wisconsin aviator from his plane at an alti- tude of 5,000 feet. ' ' 4 V! OH, FRENCHY, FRENCHY!-They're all fine fellows, these brother-republiclieutenants and captains, says Lieut. Frederick Pfister, 'I5 flast man, front rowD, but their lan- guage is so queer 'n all that! Still, one can have great times with them. Taken in Parc cl'America, Paris. PERSHINGS CHAFFEUR-Upon his arrival over- seas, Sergt. Sherman M. Sykes, 'l9 frightj was detailed as chaffeur to America's Commander in Chief. The four stars on the windshield signify that the car is General Pershing's. Sergt. Sykes was drum major of the University Band when attending Wisconsin. ,F . Q VTE? gfj,Eff5QQE f2.fiff. I' -1 ii- 5' ,ml f,1.v,uv,ts-ff wr. H Y 1 ii m ' t,,..',.,c.,.,, 21- - - L, , ' rf! It -,,7'7?Tf2' ' ' A' Q , . ,.,, W M233 -aw:-,g....,. .,- , . -, ,. .vm 4' I WA- 1 x.---- -.....,. .... . J if-. . ,wwf-News . , 'V jizznzij ' c..c,,..1 if , l COSMOPOLITANS-Five nationali- ties and three languages here! Still, every- one is happy. Seated on left is an Italian Y. M. C. A. directress, right, an Eng.ish captain, standing left to right, a French lieutenant, a Scotch major, and Lieut. Strand B. Gely, 'l6. Taken in the Palace Gardens, Versailles. SlCl'lTSE.ElNC-l..ieut. Arthur I. Barclay, 'l2, third from left, and two Harvard chemistry pro- fessors, officers in the Chemical Warfare Service, being shown the ruins at Verdun by a peasant whose father served under the first Na- poleon. .-,I --W.: Y . yt ',.'Y I, '11-Q.. ,- A.. 5 w .., 'r ' U wf1ff fr -age :, l , . ., YQ . 41 EJ ' .. ' i , tix' f 1 -V 4, -fg,.,gx--x.fi.gr,, .. Lf ,- W- 41 iw:-4'f-.,,,. -- - ---- - ' - X -.,,JE1.g 1 .kggygw ' , ,. a wi. N A :ww gSg,w.,,.m 552 , Vi .FN YN 'TW 5' X,Q.N.fU 'f iiitxlif xv! al w,,,ML ,, ' rn, QQ, .:.,,,.L ,, M,- . I Q v w . 1 eg, Q ,i f .ig-L. yy f gQf5,e?fEi,'1ii, . 7 i fi-iigfg 2 f , Q rw -2:1 'mb ,siitkwi-.u 1 , . ,,--97 -1 S ,f A uf F 1 f f : 5G:'my.fgi,,,..qQ wfsfsfmw.. 2 W if A ' aff fl 5. f vm, v l . 1 2... i VICTORS IN FRANCE-General Rebault of the second French army, his staff officers, and Major Howard Frocher of the American army, congratulating the winners of the athletic events of a field day staged at the American officers' training camp in the suburbs of Paris, on july 4, l9l8. Lieut. Harlan Amen, 'l0, fifth from the left, was winner of the cross country run. Six weeks later, he was awarded the Croix de Guerre for bravery at Chateau Thierry. CERTAINLY I LOOP!- Lieut. Herbert Mahler, 'l7, in- structor at Kelley Field, won an enviable record as a stunt Flyer. rm l BOUND FOR BRUSSELS -After the signing of the armis- tice, letters of congratulation were written by American officers of the first army to the authorities in the Belgian capital and dis- patched there by airplane. Maj or A. C. Reis, '13, is here shown in his machine, making prepara- w N -'asv 'f N' ,,1f-i':rY5ir?f'19w Ifgjchii '1',.iQffa:f5iEQx???f fi-.Ji M, 1... --f-f-Qi -fwfr ,af ,.-I M :aft I LW' viii. 85. ifqzq i ' ' ?2i'isf tions for such a H1 ht. ' fxlwif f- A it it :fa 2.795 I ' tl- E , 'fdnfv wwf' fi :- 1' qfig',,f4 ing' , . A ff. ,i J .,1a,?,li.,- ig X' fa, Tin W -giiicfi. ' r -. H be 1I':r:w-. , O Qi A sf . : Xt . LIZ. x -1 , ' r,'2tz':'-Lf ,' Wil 'J P ' V la 1 X eg 'ff'-:fi 'W-' .f Lew R'-fr 5 ,, ..,i i . ,.,.. - . f W M, . J ,MQ . ,, . 4, ' 5 1 f ug- ..:4 - 9'-'-' ' 5.1. V 'ply . f, VL, ,uw 1- 1' 5 K' 1' EE --Q -35 if- if ,Lff l 'il ' 'iff 3 ,.. . Q:--'Ili , fig, 'Z ,, 9 J' . . H C 'iff ,f . ns-L , it f L ?f .- 'f -212' W, 1: ' ' ew -V, r - fr ., fr' ' ':ff,.M.'- R : . f Q fj,1IQQqz'.'f- .AJ ' , ,--, . ?kf f1,.x le '31-ffl-fV ' - Er: f . ., . L Q1 2 A 7 ufli. .. 1 2:7 :.:e.1,,: ,ZA ,Men , LS, Y 1, wwf, ' .JQV ez: 4 fa' ' .. Y X , G.-cf.. iw- A - - ' H' ..i'. .'. '-.' g.Q:',.. ,S i -l 'V L X ul '-. OR: 1 elflilrs - ' ' ' . 'Hifi' - .-:i'A '3' I ,L' Maw- 12.55-'?ir,,, '1 M' -J ,-,. -- .. - ,943 2: - B . f f'-fa?-'JE-t'f?K' ' -' Q ' - f 1 f ff Z , - .4 ., wwf ,,:f - 'LMA :Z.,'Jx4i'f' ff :fav J.ae,w? 1554.144 3 I . , 1 11 was 1 ,z V., 1 , ,f V 35 - ' M. . frm gf q il WX an xi' J' H N 'Y ,., Z-: r9 Mens NOW FOR BERLIN!-L. S. Clark, 'I7, with the army of occupation in Trier, Germany, says that he is taking this Royal Prussian Artillery helmet eastward with him and that he will wear it during the triumphal march up Unter den Lin- den. ' He took the tin hat from a Boche prisoner, captured at Verdun. , i I 1 1 1 SAlVllVllE'S SISTER - M a r ge t lVluggs Rowland, ' I 3, who has been in the Red Cross Ser- vice since the spring of l9l8. She has served at Verdun and Chateau Thierry, has been in over a dozen bombing raids, and has helped rescue pati- ents from a burning hospital ten miles behind the lines. She is now in Siberia. ON ALPINE HEIGHTS-While on furlough after four months of constant lighting on the western front, Lieut. Stevenson P. Lewis, ' l 7. accomplished a feat which won for him undying fame among the hardy Swiss. Alone, and with little mountaineers' equipment, he scaled Mount Blanc, the first of many thousands of amateurs to succeed in the venture. This picture was taken in the upward journey, at a point where he left his companions. Lieutenant Lewis ,was later killed in action. l A IPAL IN THE HEAVENS-Wisconsin aviator sights a pal above the clouds, altitude 8,000 feet-the pilot's para- dise. THE RACE BEGINS-Squm dron of Devil Canucks at the start of their race through the clouds at Fort Worth, Texas. Canuck pilot in the foreground. Excerpt from a Wisconsin avia- tor's collection of photos. I I 4 BATFLE FORMATION- Remarkable photo taken by Lieut. William Reid, 'l8, show- ing battle formation of a squad- ron of .planes flying at same alti- tude over Taliaferro Field. Texas. ,,,.. N1 .r.-il:--1ig:g:,,w. .,i4.g5,.,-..i.5' 3'-Li,L23:5s12m1 wg Wray-4:s.',fda:--va: '-fp-sf ,f.fff,Wyt,.f:-f,,ff 5 f sf:-z if - W, :--v-f 'f- gm. ? V 1- 42' 1692?-'L V424 l- ,.,-:sax-gf,f5gx.,5f1fgyw ,. ,VL nb: W . zefifff-95 5'?v,.--'w:-yg.m-.:,q,,af- ....1 7 ' V f A ' t 9 :ia 'ff1.fi- - -5 Q 'x2jvJ.m3Zg- '. X ff? F '- -fl-'-H'--' A N. ,, '--- 1' ., 'Sf f . Q -. ' . ' fi .- ---eifws Y 4, f 1 W f ' - X Q :--,-W-1 .e-04+ S ff!-f:'f- .- -. w:..fmfi., ,, 1, ,..,,g:i., am.Af,x,,f,..:,. f,,, V - , 4 2,4 - 1 nr:-ff-L f' '- +9sw'?'w 'ffl V . M -- ,ss f--fs V a - Wh ' V f zgigiwriyfc, :ff z-, Neff Q , .V 9 f L2 X' Gif'-F556 vw . : V -1- .A -1..,fz:K- my . 5 W een' ,L f .2 nf 2 'm -LT' 2X,,: .h'f WW: 1:,Yfff'lfSJ 5 - -6:4'w.fa.,4s.a:-fw-A-A '- ., 5 , ' YF? ' i -. ii r .1'c'-1-:sr , 1. QTY?-F,t'?f' 'k i '?'E54 of -ici IN THE FORESTS OF ARGONNE- After three months near Chateau Thierry, where the heroic 32nd Division checked the Hun advance and turned the tide of victory in favor of the allies, Sergt. Arthur F. J. Stoffel, 'l7, who directed the ambulance dri- vers in one of the Sanitary Train units with les terriblesn was transferred to the forces stationed near the Argonne Forest and again saw the enemy in retreat. This picture was taken while a road over which Sergt. Stoffel was moving wounded men was impassable, due to German bombardment. I fb f W trial' -. x x N A PATIENT PATIENT- Lieut.igWalter C. Hornaday, 'l3, of the Rainbow Division. was seriously wounded by a shrapnel shell during his eleventh month of service at the front. l-le is here shown on the porch of Base Hospital 23, convalescent after three months spent on a cot. English Spoken says the sign. Yes! says Lieut. Hornaday, but it's a long time a person has to sit before someone that's able to comes along! TRENCH DEFENSE. -Badger avaiatorfzsnaps trenches 3,000 feet below while performing contact patrol work. These tren- ches, near Verdun, had been 'abandoned by the enemy. x V PSX, ,, .E ., -, . ,vp V ,. - ' . fr . ' -1 awe s 1 l 4 v 4 di.. ,V I , -4, fr .i ,,,. , .af P-QM ,,,. .1 . f W4 1' -X . .-V1 '1 .. N + 4:7 -N ,N u A gf . . I 1 ., , :B 45' s X EEXJH QQ, K ff mi 1 H4142 F' ., :,'2'swawg I 5 ff 1 Y 71 K, 1 .R if gm. 1: - 1' .e 4'11i',.'q.1' nl-,mai--lf. n Ya W, ,-,Q ,olivia--sf - ,asm-2 .imf ,wie ,lk 1 .,,.g. ,. A .Fm K. V M? 'Y 55 5, ,Q 4-, NXVQN il 9:T2Nli'i.,.f.,p1Qfw I ff, I -,vf- Gifts HOME, SWEET HOME-After an enemy bombardment of the village in which he was billeted. Major Alvin C. Reis, '13, of the Balloon Service, re- turned to what had been his comfort- able quarters for some weeks. That the Hun gunners seem to have felt a per- sonal antagonism toward him and aimed accordingly, is suggested by the result of their efforts. ' A l 1 r A THE VILLAGE CHAPEL-A 16th century church at Mandreaux, France, dynamited by the advancing Germans. Lieut. H. B. Heider, 'l5, of the Coast Artillery, standing in the doorway, -could not Find a single villager in what had three years before been a prosperous settlement. IN THE. WAKE IOFA THE.-' HUN-For three months, Sergt. Howard Thomas, 'l6, and Corp. joseph Kowalski, 'l4, members of the Field Artillery with the historic 32nd Division, were under constant Ere in the vacinity of Chateau Thierry. This picture taken ten miles be- hind the enemy line on August 3, 1918, during a rest period, shows the damage done by a shell which had burst only a few minutes before. Notwithstanding the possibility that another whiz bang might drop at any time, both Sergt. Thomas fleftj and Corp. Kowaski Crightltseem 1 S 15555221 if '1?5ffigf.f- . 1 to have been quite at ease. if 1 i sz. iii . - A - ,v 'yifqgi if x 4 i wi - Y -. X , 'N A --15-. ,p..w.,g,, I 'n , , ' C., 5- .. kg -' - 1 A' A lf' ..-- . ' 4-H LQ Q . -few 11. 1, A--0 1 :Q . si -.1 .lx lr , Ii .fl .A-J 11,4 ' -11 1' .ijk . - tl ' ' W., I ffl' ,,. 4' H X... KL. W -I. .' 'Qui . l' f ' ,ff 'f 1'x.f'1. , QI, '- ' ig 3'-,sg p.jLf -, ,I 'iglfigi in - 'li' V2-2 f ---X 'Q' fi , 41 1 I 1 . 1 1 . 5 , i I . .si , N , - 1 ,fp 215121 ' , i 4A,- ,. Q . Y... ,,v. . I I 'i H . , ' . - 5, . wg. w5gyfu21i7Q-,ki .. . ., ' , , 1 . - A . X. , evififfif' if -.. . is ., JF -,:.:1.5..,.,.g.,,5 -X ,. -K L., ,. l -L ...eJme..fzsm'..' .. . H K . Q ' ,. RARIN' TQ GO-Lieut. H. S. Harrison, 'l3, taking off in a De Haviland plane equipped with a Liberty motor. THE. FAMOUS 276 -Lieut. Wm. H. E. Reid, 'lB, ready to take off in 276, the plane in which Lieut. Webster made the altitude record for Hispanica motors. . K., . 3, , - af- I l WRECKAGE-Crash of Lieut. H. S. Harrison, 'l3, with another plane, which resulted in a broken arm and other minor in- juries to Harrison and death to the occupant of the other plane. One plane is partly burned. ZATTAH BOY!-l..ieut. Arlie A. Scharclt, 357, Wisconsin's famous athlete, wears three wound stripes. Of fifteen months of service overseas, twelve were spent in hospitals. ln three engagements, he was wounded by shrap- nel, twenty-eight pieces of which were re- moved from his body. One time he lay in No Man's Land for two days and a half before rescue was possible. V CHUCK TAKING OF F-Ensign Charles Car- penter, 'zog taking off in at giant 16 seaplane at Pen- sacola, Florida. More then twenty Vvisconsin men re- ceived their pilots' licenses at Pensacola. x asia-biamdsienggy -wg, 5 ., 3 l ' A s sr. Wisconsin Naval Flyers 1 2 gi tl 4 I ,'jOHNNIE RACES THE. BLIMP-Ensign Johnnie Schroder, '20, flying in his seaplane at Pensacola, Florida, challenges a Blimp,' to a race. The photograph was taken by Ensign Schroedefs observer, and shows the dirigible running neck to neck with the seaplane. SANTIAGO HARBOR-This remarkable photograph of Santiago, California. was taken laygnsign Howard Stark, '20, from a height of 4500 feet. Many Wisconsin men were trained at antiago, - X x,f'HV' r Q, if SANTIACO FROM THE. CLOUDS-QTl1isEphotograpl'i of Santiago was taken by Ensign Howard Stark, '20, from a huge l6 naval airplane. ri l w CALDWELL CRASHES Ensign Tom Caldwell, '20, forced to make a pre- mature landing, stubs his toe and his plane noses in the sea nearly a half mile V from shore. A miraculous escape for both Tom and his observer, who were rescued by a speed boat. The plane was salvaged by the wrecking crew. T I READY FOR DIE TAUBEN. View of air ships in battle forma- tion, taken by a Wisconsin aviator in a trailing plane. Note airdrome and French countryside below. I .1 Y ES -. ...GW Fm ENC!-155 ...BUD GAR F391-ATR UNF- ! C F. M0055 0 -' UHsbmM4A: .1 'WT' A550 DI ..Z',1jjj,1f,f'h1,,Lj1..1,, --fm 1,,,j -1 1.,,,'Q01 1. 1.1, 1... G 1 1. 1 1 1. '-111. 1 1.,, 111. 1 11...,,Vu I TVU5 J rn WW S... QQQQ' Y' L1 . . 0341? S53 1 ,1.'h.-11.,,, P 1, 1' 1-1. ,.... 'f111., , 1s- 1.11 'D ' AJ F 111 5 1. D. ,, , f'f--1. ...N r n1,,,,, 1-,,, I nh:- ..-- ' ' - - fd--31 . ,.37,n1E. gg, .i,,f...,'Qf,'g . , S .X , -151.771 'v .11 n '11 '.'1f' 'W 11,, .1 N ASK. Q.. f.w.w .4 W' .. N vs BW VPN Nb K5 . an XWORBQYNQ! Avy. JW ww .50 ww Wg A SW 'H X v. V :NY -.G S 5993 - Q . .... Q QQ! GLS .Bw N XY wi.--Ti. ..- f.--,,.0,,. ff.. Y -1- f'.-- . ' .--'X.-'..- X... V.- ,,.4,,..,,.. M.. lv. X Q 9 . V ..--1 ,..- ,,.f ,X.--,,..--Q.. X.. , UN. ,,..v,. S ffgp' 6YJQY1Qb4Y5 ' QB Q, Q Q.. ,,,..,.-...,,. ,. ..e 1.-'C 1 it '29, 4 XXI. Xfuvi N- ., .. ,,. . . S, 1.91.10 .. .0 . . 'Q..v',,.2'- 1 F, 1 . 4' .UP . ' .6 1- 111: fur..-.1 ,.. vw. N..-,,.,,. 1 1 ig..- .. ,- rv x .. - ... .. X .- L,u,,..s.1,,1 .9191 ' xv' ,,. ,, G. .1 M. ff... .11 .... .95 . 1 4 1. e Q,qg1Q4, e , ,.4k,.4' 3 n 11.1 , '-A .,,' ,,- , -.11 11 ' .,. X -5 - 1.1, . . . C 9 N 45 A . 1 . P . 1:- .. . , .ff I - ' ' .b. Q? Y' Q .CT - Y. Q: Q.. 1,51 - Q1 'S . Q .SYS 1 i F .---f ww cj',c'1,5 Q fc. Q1 K1' 4 5 Sk-1 .P ,. 'Prbfl , A, Ernst Wr ..- 1--11.1-...T ,. 1,4 fm, ' A,5,,,:,f,I ....... 1 1 111 . G. 1.51 .EP .N.N9'., ' 2 .1 553.99 We .Iv .41-'W .. .1 . .1..11.. -'1I.. 'f K.. ..., 1 11.-. 1.. . 111.1 .1-1 .... 1.1. 1.1. -- 1.11. 1.1. , ,.... .. ,',,-,:Hg:,g1h-1- .... ,.,., ,H 1 1 . v ..'- 1 U L ' 11 1 1. ,11.11..1.11-. J...,,,. ,,,.1'4 H 11.1 I I ' , ' 1.1. 11. 1. .1 1 . 1 1 - .... ,, Hg . ,.... ,. .11- 3 an 2.-A .-'-'X ........:fm...f 1-Q.-1.1 .... .-1 .. ,.. .. ..,....,,..-U .... .-1 It H 1. 111.11 .1.. Ei - -1--1 '-' --- 1.11 1 1 1 1 I' .1 1-....1. 1- . ' .... .. ' 1. .... .11 . xii.. -52.1 1 J 5.-1 ' , I- .. .,.,.- ...I-' ....-1 .1......,,,.,, , ..i',,,.--- -' f,...15Y1f.- ,,'.. xg.. -1,111-:Q L A .. - ...1 ,..- .-', .. . f --' ' .., fm' 5 4... ' ..- 1. .11- 1 . .1 '.- 'ffm- . wi- - Y ,fm 11.1.11 , 1..1.,.11 1. f A H I ,-,,j X. ,,.1 .qs .... .,.,.11,11,, 1- ....- .1..1.. T11-Q 11.11. 1-.. 14-1-1. 11. 11.. .. ,. xv ,. x 4 ,.'f'Q,w s , . D. ,,.., .1.... 11.11. .-H' .11 1' 1-'X-'I' 1 ,m,..z. K I1 1 vw., 11. 11.-, V Q- ' W .f'..H-11.-1.1, A-1.11 9.11.1 ... ak.---,11.1... .. we .... .-, . ,.A .... S. ,.., .6 ng... ,.. ,.. ' '11 vi-' ,.v'x..X 1.. 1. Am.. fd' .B U.. ?.,,..h,. ,Q-1,551.1- A .A . V. aww, oi, 0,4 ,Q v-1.1 ..- .. -- .1 5 .1 -1 1 3 4 X' 11.-1 Lf' .11 1.211 .111. .1 , .1 , . ,...1 ....... A,.,, .J K tw.:-.1 K W 1.1.1. ,111,11.1.1 .. K .1 ..1- 1 1 1 -.1 '- ... nv W 1-1.111.111 . 1 .:g' ,.... .,1,, 1. 11 , 1 , , ,, ' 11 . ..1.1.1.1.. 111. . if 1-1-1 .1.1....1.. ....... 'HM 1.1 1111... .1 ' 'Y' ' 1 1 1 1 ' ' ' 1 x A ' C' - .1......,. ,,,, ,, ,,, Wm Y ., 1- 1.17111 - 1., 1 ., f Sixty-six Wisconsin Men Nou 'fem 1., ,-'11 ,UA ' 'I .111 F 1 A H , ..11........1 1 . . ',,f,1- I11.-51.-5.1 ....... ..1I.1l.E:,11'Qj1ppg1-.1-1 .. ....... .1 ' .... ...1f'.'Z, ,f,1m-- 1.111,,-...'.......... 11.1 , I 1.01.11 .1....-.... 111....:'h H. -1 .1 -1..1..,..... 1,,,,,, ,,,,'y,j45g:fo1--. -.... .... .1.1...'1C1 I,Qfff ,,, .. , 1. ...,1.1... 11. .1..,,,, ,,,1, .111.... .. . .W . 1KnA-dy..-1131... 'h , - H- 111111. .. -.... 1. '. . 1 11. ....,....... T..'YJ3.'1 '1'i', ,U----1 , , H M . ,.,.1. fI!.11I .Kr-.1 111111. '. du I 1-1.111111 11.2 '1x11.111. .- 1111.. .1-..,,,. ,., ,,,, 1.1..111 11. 111. 1 . 1 ' 1. 1 1-1.11.... .111'..iC '11-11-1--1.1. .1....1.. ,.:1'j f -' 1 11.1. 1.11. 1 ,U , . Q' A A 1.115111111111111 11111s1f,1.f11111 111111 11111111115 151 Sewing in 'Yarious War Branches FDOTBALL MEN ENLIST IN AVIATION CDRPS sm,--1. w1.1-1.111111 2.1.1111-1, 1...-vu .... ,.... ... 1...-1 an 11.. .-.1-.... .11....11.. .1 .... 1.n.11.1.'.. ..1-.111 11 1.1 111. 1..1.1011.y .11 .1..-. fm. 1.9111 b. .11 ..11,.1111 .1 .... pf...-11. .sn-1. 1: 1 ww. 1.11. 11-. 111. 1..1.., -rv.. 1..11..111-. .11 ....... va., 11. 1-1-119.11 1.11 .... .wr-11... .11 H...-1:--1 .11 11.-. -....-W...-1. 1. ..........11. ...111.m.-1 or 11... .111f. 1-31.11. 1.1.1111 1 e 11 . mm. ...fm .v1..- ..11.1. mf nv..-ya f.-1.-. 11-1. 1 ....... mf ne- it s of -NM 'F C life Near Battle Ff0ntT1...:...5 k...n'111e .1 1.. 111.- .111 , ' nr..-111.1-1... 'q' 'me . up - 1.11. .1 . .... 5.1.1. ...-1:1 1.-. 1.1 1.1. .111 .,,.,,,. in 11. 11. 91.11.11 1 11,- . .11--.... 11... ' z 1h.11n.. 1 11 . - V' 1 mm ,1 ,:fJ1f::-r11111.11.1.- 11 1.1 .v :. 2 -1 . 1. .. 1 1.1.1....... ,. 1. .111 QM, ....... .-..., ..--.. 1 .., . 1..- 1.. if -1- 11. 1. wr 1-1 14. 1 1 ....-.1 .- H H, ,. .... .... ,..,,,,,, 1-11. 1 , 11 11..... 1., ,, .. 1, ,W M., 1.-11.......1. .1.1.1.1. .1111...11 .1 1....11... .... rn...-.1 1 11.1 OVER TOP WITH Former Univ ' 1 ,.111. 'ifsily Mun Desc MARINES ' .sb 1.1 . ol L...11.....ff1.. on Fa 'uS C -HS' -111 1 1'1,.1.1 111. 1.11. .,. .-.1.1. 11 .1.... 1.1.1. ...-1.11, ,..,,, :, ' -11.11.111-.... 1 . 1 .1.., 111. 11 1 . 11.111 .11 . -'-' ..1- ... 111. ,M ..1.. ........: ....11..1 1 '11 ...- 1 .1 1. -11.-..- 'r11.1. .-1 .1..1-.1 .111 1.1. 1- 11 .1.f1.11.., l' s, ..11.1... :n ....... 1-.. 11.1 .1111 .1 .11 115111. .-11.11. .111. ' 'C-1 .1.111... 1 1.. 11. 3.11. .... uf 1. 1.. 1. 11. --v11...1.-. 1, I. .... 1.. 1. ... 1.1.1, ..,,1,,L'g,1- M , 5, uk.. 1 -- M1-1 1111- 1.1111...11.,, . um... .... 1-3 . 11 .. 1.1.1, ,1 1. .... 11111-1.1 1 1...,....1 1. mu ... ..111.1.1f1..1 .11 1. 11111 .-.... 11 .,.., ,,,,, - 1... .....1...1'.1. .... 'f H-11 111 11... Jw 1.1.5 ,J-3.1 ....... ..-11.2. f.-1. 11.11. -'IH 11 1... .... .1 . 1 11.111.111.1, ... ,VU 11.111 11. 1 1.rxn...1.-.sg .1 ,. . 111.111 af. .111-1. 0' .... .1a.1-11..-.p, 11. H ' U 111111. .1..111.: A.1.1.. 1 , , 11' 11 . 13.11, 1,1 ... ,wo . wo... .... .11... .... ,, .H ,.1f......f-,,.+, Y - 1. - v ,.. fr .-...f-',. ,-1, 1' 1.1-4, , .v , ,Q .. k,...m,,: 91 J, iv... NR., 193. .1 .. .4 Q-,.x,., W.. ,.- .. ,.... 9 - Q T. -oo-. . f'.1-wi.. .... .1- 91- -H xpix W .vga U.. Q 4- I .1 ,V ,. ....-1 wi. X - . ., W ,. ,.p..,,6 Q.. .. . , ,wg 1. 1 . .Q . 1'. Tx,f7,..' 'x 9'-mi. . , -Q .. ,,.5X1 .1 .f-fl. Tt?,.LQ:1Q'..1f' J. fx X 9'-1 .K2.5f,,.1...-N'E.1' 1, '1..7i,.. 3 .. 5, 5m ..oHW . X S 2, Q, NIWWX a 0 NWS 'n A 83592865 .N...Xe. How' W... W wgon ...Nj ...'g,,. ,zo .,.. V. 1...1- W1 .--E ,. in-'Q23'-2 1 . E' -1.1- e v .10 . E' ., ...'r1,...-....-',,..-1, , S411-vc.. T2-f ' ':, ::.--11... 1.'vn,,,... P,.....1 g....v, ,5,..,: ...Q .,...g,.. 11, .mf ..- -3 1.--,.. 11' ..rnh,, ...r 21.- ' Y.,,.1 .11 ' ,.,,..: ...N ,..1 - , 1... .a ' un' ,q uw ,I rf. .U B..--,,,. - .... ' . .11 1. - L -1 .. Y' .1 .F 1. '5K.'Q.'F.5'3175-' o ,.. 'gihovgc .1 ,:,.. 1.-1' ' .WY .-HA 1 -1 - ww. W..- ... H... M, .w M ,.. ..1 H.. .... . -'RX Wg, -1 f Q. .1-vm --, ...Q L..-'U' .A - .. ' -f , ',,..f1 ...w ' ... QQ ...1u,, .1 .o ',..3 1 1 .1 ' ,.1.h,....- 1 ...I ,110 , 'xvnvf ... J'Q,,1n 1,-.wf wif ,.1.- '1',1..- D . .. 0 ,,. ...g ,1 .,.. , v-,...4 ...f ' ' ...- U.. ....',,11. .11 ,.. .,...v .... ,,..v. ,.. sv ...r -11c,,,,... .I ,,,. ' .1.:' .0 no' 1. .-QW... 1... D... .11- .,,. H'-,.... ,,..v- ' .1 . ,,,.. .LY,,,..mn1, .gum .-1 .. , ...qv-M.. I ,.... iz: Q. .1- ...gn dwg.. 1 , 1 .1.',y.,,..1:, .r N111-,..-1 . 11 .... .v.- 1 .. 1.1 1.11 1. 1. wwf . 1111 1 11... -11... 1.11111-11 ....-.1 111. 1.1 1-....... .11 -111 '......- . v, -.. . M--. . 2 4 XR.-j,,,.1 . .Q,,.Q,..X'2,1fg.'i 1fA..g,,.f'-.0 vcfaos.,-1 M ,,,, Yay A . ,,.H 5 V. 5.-0.1 ..- ,.... 9. ,Q .... 1- '..'..1 . ,. .19 .-1 nv. ... ,.-da' .ff .11 -'O-W-rn.. . . .Q , .NW ...- NYS... 1- , J.. , k xl. 10. .'- , 1- .... , '. .f . , pg.-2. ' 1- X T-........, ',:f, y'5Q,'---1. H.. v . g, ' .-.-,'.- f I M .... . . 1..11... -f .... iv .ww -1 1 . . ,, Q . .. .. ....1,, 1,,, ..' J v .1 .-1. - n.. gm 1 I' 1' 1 . 1 f .W .... .1 1' . , , 1 1 ..,, .11 , 9. e wg ...I gn ,md I Nm' Y Q AUX., 8 - 1. . X ..W 'Ef1fkf 1 .-.111. A ...MN M '. ' .sf 1 .. .... .1 . lm- Mn 1-1 1. 'X..1 .1 1 f,,.1-'TZ-1',, f ..-1. N, .. Y ,, .2 W... I. 5.1.1.1 . , ..1 . ,. .. 'f':1f-'15 f-'fm-fy ...iff ,,...,,,,, 4:11411--f .1..- 11.1.1 .1...., .1-...11 11.1 .-.... Wh 11 .... y.-11.111 -1 11. ...nh z 1 1..111... uv' . W.. .1 1.11. .... c. 1,,. ' 1 -.1 ., .1.111. 11.1..1,. nr .1 .1.11.l.'f'.-I Qi. ,f .......-S .. .:::1'1.: 1 . .3 -.. .11 Q. .1 . ., , g , 3 - ,A , wc, 1-1. .1 .625 od' .sv .-0.--Q,.1gg.. 113111 YW X 0 nf 1 .G ..'LU.1-' V.. -,. -9- 1 .-- .... ...J .X',.f , v' 1Gc..1,.. U... .W .1 'fp ..1 D .... ,,. 1 . ...J . .M . 1 .,.. hs ... f:,L,,.0:l,c.,.B, u, .inA.,... ,,,,... Q 11. 1 .1 ...- .... ' 1 .9 ,xo 111. 1.1.1.1 1 1: .. 55. 3.11-,N 3, W, 1 1--1 1.11. .... .... 1.11.1 ..1...11. .... 1. ....... ....... .1111 .111-11 :mm 1. 1.1. . x-JS. 'V' 1 .ul 1 .vt rv 0 1. 1.-.., . -1-1 1.1.1 1.-.1111 11.1.11 ..11. 111.11 1111.111 1 .1 11. .1 10.1111 1 L ,. 1 W X ,. . ..., . ,.. . 1 . 1 1' 1' .1 .,.', 1 -' , :L -- . 1 ..- .J -1 .. .- .1 ,.. , M... ,,...',.- V- K, .. ,.. ,,, ,. ,- .. ,, ...,..x..,,v i, ,, P-,,,. H ,, ,...- ,,.P',...' .:,,,. .Q,,.X,.4v.,- .1 .1,..'Q' . .. ,1 -.- . -fs. Nm' .'- N, - 1. ,.... f - .x.q, . 111- 111111. 1 41.11. . .. vm' . ..n,,,. 1, . . fx, 1 ' ,..-' ,.1 11. 31.1. .. .... 1 . . 11. 1111 hlrwqltv Nb D 4 'X . , .' .1 . ... . .1 . . 'dgvd ,.... ,.. 9, W .1--' .- l. ' 7.11, -1,31 , 1.,'11 11 'T ,UA 4 ,, M ,L 1 '.'M'f' '1 11 '11 1 -1 . ,.. .,. . , , .vu.,.g,.e-' ,,.. -,,..1',,,.. I .:x,,..- ,. . . . ,..1 .-1 - . , 1 , v , ,X . ...v,,,. 0.1 ' 'AN .. .1 B. ,M . . .- 1 Hx 1' xx! 90 rlx ,. , 1 ,.. .. ',,..-5.1-,..1 ,.-1 K-,,..f?, .tn .v .Q .1,,,..Q 9 ST Ulm QS: Q9 AY- L- . S . G - 46 ,wigs ,. l.v'g.- ' . 911. .1 ,f .- X fix F' ..-1-'L-1' .1 1 ' 11 1- ' 1-1 ' ' ' nf'-1 'JM- ?. 4 1 n ... 1 -. nk, iw 1-,...-'31, f J , I. 1. a A. 1 I-' .w ...Qs ..k,,-1 U1 11 'o '11 ,v .- - . 11, 11 -fl' .o 'r .. .. 1, 1 N... . . . 1-, A . lf. Q , .1 .1,,, .,,J1. 1 YYQQY39 ...N .., . 011-31. 14.1, 1.,,,' Q, Q ,,.,.-'.,,1. ..,1,f.,,.1, 1.,,! , Y- YB I1 f 1. f 1,615 J1,LN11,,' 1.311511-.,,hv1, If ,.... ...111,, 1 71, ' . 1- 'gy ,. 1, 1, , bw LMS-1 1,0 . , ..,, 11, '11 1 ' 1. V1 1501, . 'fa 1. 'f . 1 Q3 'ag 15 Ay' . A .. .,. 'ca 1 .- ,..- 1 1 L , ...f,'-211fn1,L'1 . 1. f.,-11 ' 1, 11,7 .f' -', ,G1,,'H1, '11 .1 -.1 '11 1- 4.1 .1 v. .. ...H .' ,..-1 01- 1, -11,11 gn. SV .3 .ur .N .rw-..1,','1. V. 11,1 . . 1.1 -mx ...gil-Y C.. -' .w W -...-3.13. ,, .L X.. ,,.. 111, H1' 11' 1. xr., - , 1.0 1 .,- .1 --1,,, .. ,,.. , 1,, , , . .1,' X1-1 -. . ., 1.-,. ., .2 . '. M' '-1 ,-11,' 1--1, - ,.... 0, .-I ,.. -5...-51 111,. .. 1 - 1.1-,,, .q ,. ,w,.- ,. , .X X. .-0 1. .. F111 .fx N, .1-J' hm' 1 11. .A ....1....1. N 'M rw- 1 .25- ..... .1111 -- ' 11 -111.1 , BS a , ,. , 1 7 -- C0 C ...Ken . '45l':':-Jl:1L.1u1 .... 1.. -- A M e 'kgs X ....... ....... 11227. ' .Nod . 'NYY 6, .... 1 -as ouch ,....- ' NW 'Sake .... 3.iJ1'2?'- an ....-Y, 1: .11 ..- ,J .--- .1-1-1 .1 .... N... K ,.. ,U 1 - -. 1- - -- lo .1 A ..-:.J1.-- 1.gy'.1..s WM 1 11... ' I M, wQ':'.x1m.. .11 .1 ,.. I 1111 ,D H, - 1.11...1.-.' 1-1...-Ti -.fT.'.'--rgg,gfg ' J' '....u1:..Y........1., iq.,- '11:.-, ' ,' , ' 1 S 1 11.11. -1-1 1......1. .. , co 11f..., .,g-5 v 10. FY IW.. 1. 1. 1 0 1. ....... 1 32' 0 0 ,I 1 -lj. 1 1, . 1 1 1 we , 1, .1 M -1, ,V vt.. .1-'..H'.1'v.f' .f',v'. 1 1 1 . 1- 11L! n 5 1.11. 1. si. 313751. s re..-1. -11.1 ....... 11. 11,1 HOLD SHE rx 5,1 SWAN or T. .'1.T,,1,,:' L P10111 U--SHOCK MIHIE 11.4.1.1 s...a , . ' and 111.31...L f3... ...1....11,. 11.1.1.1 '- H111 . ,fa wr am... H 1 . . 1:1 1-1.1.1.1 ,,,,, 'W rr..,.,, A 1111.11-.1 .-. .., Wa 1.-1.1. n 11... EL 1 1 -.:. if 53:11-f' 1 ... -X M1 ...., SY B. - -1 .. . 1 '.1 hgdl:.f hcl... -p..-1. 1' 2 .1 ,. . 5,.,1.. ,.,,..- ,,,,,,, N -1. :' ,---1 .1f..'5 T . 11-1... . ..- .A ,A 1.,., W -1111 .....1..11.d I 1f'.1'Q 2111 .... 1f1.:',,f ' 11112111-112' -1.4 mfg- .-...mg .,,,:P 'H 11..1.1, rm .'1, ':- 1111... 1... 'h' Wd : ,. Y, 1. 1.1-. SI2'2g-,.,'g-L 1h5.?fg,'-1 111.T'1f..7 ' ' I - rr: . ,gf-1 -1 11.11 .f !1Q11. .11..1n.1'Z' F' W 11. 11.2 f rm... .1.1 '1lx 111.1 15 ' 0' S., ..111.- W rw. -1.111 1. 1 1 11.1 1 M 2--1 ' MTF-.-:..1 1',.-1,-,f-.1 mmf ' -'hr nn. ....,, f --- . 1 - I-111 ,,1,,Qd Q 1-1.11.1 5.513 '7 M 1-1.1 11 111. ., ' f' fr .... - 1 -1 . W1 wr o ,1 'nf .1 .1 11.:1.1. 11.95 ,, 4, CofX , 'f I 11.1.1.2 ... -11... '1 -7-,, 4, 11. 01, 1 ....-ff I.. 1. , 2 , '91, 'A-.,, , 77 'lf . L, 11, 1,,11,,,X44, o E, c.,:1s.Rfo, 'L 'va' for ' 91,4 DN 14 11, 1. 1-1 'f1.-.-- 91. ff.. 1 ' M M. 21. . 1' '11 11, .1 I.. 111 A. 1. U. .,. Ao -V 5,11 :1, 1. ,1,,,':,,'u ,fm ' X 145. - ,,'- 1 . 11. 1. ..,,- n,, 11,, -., v 'j4 11f' h..' 11 'D 12' JH 11,,'1., 1, 1 , Mn. 1. 1 r1,,, 11,-I ,D 111,510 .f.,11 bla,-,:1,. 1,421.3 .1211 ,L . ,211 1 'G.,:.,,3 X , ?'11:5 ffl 11.2 ,' gb X .W 1. f 11, , 11 -A , -.1 a1,,J41,'i11 5 ,.,,y.-,, 77.f'11,f:'1.,,' 11,5 A5 'A A Y... Q.. - Q30 9.673 ss . v ws si ...Q ,...g'.1 ,. ....... ,mb mv .1-L ,,.-1.1 ,.-16, 2.42. .v 11- 1- .1 .1 Q .Ni s if .1 N 0 5 6 1. ' . .CQ -Q5 127- Q. j..Q1 .H un.. .1--. . .v .0 Q. G. .. .. .1. 1 v'-.v v. .11 1.s .6 . .w..,,.-j..f1,,.. . 1 . ff.. VN: ' 1-1' ' ' .1 ff 2-gff . 'J , 1. :',,,...f- wx,-1 ,,...N..K' 4' nf' 1. 11 1,, 1 ,. 1 . 11... L I K fx' .N A .e ,,, sfw. '1 Vg., vit Awuvf .wnsfw-f -f . Y A , 1 wi W ' -,,,,Q - 6 - ' If ,tg 'Q mv.:-1:1 . .Afrzvi fp V il 4, N .- L , .,,. M, 5 N .. .-,ZW .545 , 71+ ,. f w '?? Mfr:-.. 1 . eqif .fl .',. fy ,H 'Xff1 'if-1' 'i ,?2, .Q-v,f, V ie 'Pr ' i TlL,,.Lll5fL,Q'.. W 'V ':q'.'+ 1 1-'rl-,-, . ' Q X V A 'LTV A f, -VaQ'Q5:fn11Vip,,j..fl,- - kw- 1-a 'H . . 5.51 . V eff-mvqezff-V-v :- X.-P I AWS-Wwnilnww G . ,X 3. .tin 5 Q .,-Q 1 4 sc ui' , Amff , 1-2, ,5 ,Q .3 1 mg jufjg-'ts Aj R 135533, W-fl if ' ...QQ-Vff mi ' 'mill oldies?-fQ'0 f1issw'llW ., 1 , 6 Q ,A ' -W ' A' ' H exxrwigf -S. -f . 7' fm ft 1 1'H1sf7?PfV is 7i?PtC77? fi'-A wwf 'A 3 ' afiwigzfif.-.f2'f X? ?a :Q '11 MV SEV P uff HN V V. 1 h -1,.Vfx,,3V .L Egg, X r 5,3 I5 ,S my ' ,K E 1 VMS V e 4. V 3 ff. l :.- ,NA X gf re-'-fm., l, 'if fi, .fV ,,,ff' .. ...,..-..-H V .- VN' ,,,V1fiVfwe ,fu V --L -'-s-.- I ,nys -- sf. VV V '-Vtkwrf'-'.lf.h me :f wimiw - e-. - 1 A , W .W ' were ,. ..sw'- -::',. 41-V----W -Vp-.,f,,, if .7 V. ff' 1 a n 'lah viii 3' if 2219 e f . L' WC l , 19 ,5 E W , if 5-u ' fi-'f 1 ' is . - if 5 mu VbV'f'7 -f -W ' :V-s22ferV!z22ea 'IN Wlwliifff ' l' 3v'flif i'i C'kE4? WV: Qgsgiii-2f.'t'-V7 :HW-fs V,'2r l1?7? . . ' 'P' ' A I 1-V i ' 5 - ' 1 'U1'n '5f9s?3-aS Z I B ' '43 4 , Va' 'f 's'2'w - nw- W. ',.' V' . ' .-If' W' 1 ' f V 54 H 5 5, ... Li .,e.-M 2 .M M ,, X ,AMW . W4-,sl mf . A A im ... , , I W zu- V 3 .:-:lib -. ' . V I V .,, ,H ,Ar , - - 1 . ,J , V. 4 l--I 152 UV' 3 ' 3 64 ' ,Q'2f,:2SQ.qf,j:f ,, 43, , fgyeif-'Z ' ' .1 -51624 'rs i 51-2 -fer Ilftaii' Wy. Va .VV. . - -I ' T-. 'M?:lt'T'-, '7 V ., fl V' ' V? 'f1, 'f' 5g 4 .iff we-f - V V. if 2-L-:H . .ti e - 'M 'QE 1 . L ,Q-'figiizz 1 eb pay . ,v ffygfgggiifu .?., f .IL L 'Z ' wif? .... sail---f--A 'Li ,Sqn - Vw V' .- f., 5 Ti FN? r , ij 'nf ,if '1 1 ..,g'V, - tg. f f ,EV if - . .Q-,Q . 35. :1VV2V.f3:, ., --V. 'T ,o . . . ' 1 2 af f 'N ' VV . - . if A ,J . -fi ' -.ff .31 'f wx YJ . f .,-. me-gg 1' ' A .V Tit 'S X if l :Q f ,,f.sf.gf VN-31 1-fm ,.5.4f' pf Jw f 1,5 .t ' -- WL. 1-W? ,-aff,-' A- -- T gf! I' ' ,L fi- ..,..- ,i KM .I iv-Q Ili., ., 4, V Q- il- Q , KV V . . I 1, . -, V1.3 VV - , JN53., ,Qu Q, gfgjg' -. -5135, .rffj .W L 1 V v . ' - -' 5 13 , I .gjfw 1 ' ' 1 fr' F r- -V fr if M V w w' fb, OFF FOR SHERIDAN Q -AN HISTORIC PHOTOGRAPH--On May l2, l9l7, the first of Wisconsin's volunteers were given a rousing send-off by University and townspeople who turned out en masse to bid them Godspeed. Few of these men have missed the thirlls of actual combat, and several of them heroically sacrificed their lives on the field of honor. . LOYALTY DAY, I-9li1-Wisconsin's first patriotic celebration was held on March 3I, l9l 7, just prior to the break in diplomatic? relations Germany. The entire' University turned out to demonstrate its unqualified sup port in backing President Wilson during the critical point of the German-American negotiations. i 75.1. . fb fri if -zu f X. .'. 1,, , 1. if-V , fgggg-gt Q55 A w. ,. DWP gigvw, bf. . . wi V , Yi v s's,? , rfia V if l 3 .., 4 ,IW E: -'X 1 1 i I 5 --I NAVAL FLYERS-ALL BADGERS-These naval aviators in service at the U. S. Naval Air Station. Pensacola, Florida, are all Wisconsin men. They are: Top row, left to right, Ensigns K. F. Whilcomb 'l3, D. julian '20, T. B. Caldwell '20, D. P. Spurrier '19, H. B. Stark '20, V. N. jones 'l7, R. F. Tillotson 'l9: lower row, left to right, Ensign M . P. Griswold 'l9: Lieutenants L. A. Hammer 'l7, G. C. Nedry 'I2: Ensigns C. H. Carpenter 'l9, T.'W. Tuttle 'l9. BROTHERS-ALL BADGERS, ALLZSOLDIERS-Five Wisconsinfmefin, brothers, all enlisted in the service of their country. ' F 4 ., , X 1, V, . f 1 v 1 ,bi 3 ik. -M ff. 1M KCCw' P'- Wm, K 1, ,Q ,K r V --A 4 fy ' ' 4--flf?lsi1'l'.f FARMERETTES-BADGER CO-EDS DON OVERALLS-To help push the war to victory, many of Wiscon- sin's women filled men's places on farms during the summer months. Sue Oleaen I9, is pictured shocking grain in her fathefs wheat field in lowagf-Ingrid Nelson 'I9 was caught painting a silo: jean Patterson 'I9 and Jeanette Lamb ' I9 are shown at the noon hourinstheir masculine attire and Corothy Martin is hoeing her big patch of potatoes. Oh yes. behind the plow is Marion Olbrich 'l9, doing the fall work on her father's fram in Illinois. f Q, x..x-..,. HONORING OUR HEROES-Wisconsin's mammoth service flag, bearing more than 4,000 stars, was most auspiciously dedicated. ln the shadow of Lincoln's statue, on Memorial Day, l9l8, great tribute was paid to Wisconsin's volunteers. ROOSEVELT OUR GUEST-Among the memorable occasions of war-time Wisconsin was thelproud reception accorded the great Teddy fMay 28, l9l8D. The picture shows him at the station being escorted past the cadet guard of honor by the late president of the University, Charles R. Van Hise. By some odd coincidence of fate, these great men have both recently passed away. I congratulate you on your fine record in the war, and I congratulate the country evien more, were Tedcly's words to the students in his address at the stock pavillion. Wisconsin xjbse to the need in a way which will forever after make every graduate of it lift his head in pride the University's name is mentioned. i ti . fa, ' yi . 1 -Q - ...leislwfifefdr film .115 5 .nw-.W 5 ' , - 12,4-iq .'1 'fwwg J. M, ., ,,., , . .AA 3 :4 f'f'r-. ' - '- . 5. 1:33 ' -4 5 7-3 ' -A ' ':.,xt.: . Q,-T3 .gzf Y r i ' vc: 5 1. 1 J? . ,. J L F.A,.,, CO-ED WORKERS-DOING A lVlAN'S BIT-Many of Wisconsin's women answered the country's call For every Hghter a woman worker and donned the masculine overalls to work in munitions plants during the summer months. These co-eds devoted their entire vacation doing manual labor in the Gisholt Munitions plant. They are left to right: Ruth Johnson '20, Elisabeth Head 'l9, Ada Kroening '20, Ruth Martin '20. WISCONSIN RECRUITING HEAD- QUARTERS-Gov. E.. L. Philipp is shown in the center with recruiting offi- cers of all branchesoffthe service. More than 43,000 lmen ffrom the state of Wis- consin enlisted in the various branches of activefmilitary service. . 17 1 '. xi' K in l P 1 . 9 . ll! I N ...N N I x A I . .,,. ' iiiif- 5 EMF' ' . 0 wif ,f I 515 .,f - A .Q ,,. ,X .sf ,, 1 .nfl v -:1,,..i?,1 v- 1fE21kf -z '1 'A 11 . , .5 ei .ffmwl - I WISCONSIN PROFESSORS DON OVER- ALLS-Professors Carl Russell Fish, History, and F. B. McGilvary, Philosophy, who worked at the Northwestern Ordnance plants during the summer months. The picture above shows the professors at noon-time, enjoying lunch with a fellow worker. TAFI' VISITS WISCONSIN'-The ex-president is shown shaking hands with the late President Van Hise at the S. A. T. C. Review at Vilas Park. A splendid review, and much credit to you who 'stood by' said Taft when address- ing the troops on the lower campus. X -. 7 if Q 423' , X R, ,H THE S. A. T. C.-THE MEN WHO USTOOD BY -More than 3,000 men enrolled at Wis- consin and drilled intensively for several weeks. Had the war continued, these men would have played an important part in the final act. The picture shows the entire regiment in review before Ex-president Taft. who paid them high tribute in an address on the lower campus after the review. I '- BRYAN PLEDGES A. O. Pl-Not least of Wisconsin's distinguished war-time visitorslhas been Wm. Jennings Bryan, the grapefjuice authority. Bill was the guest of the A. O. Pi's for luncheon and he has their tacit assurance that when the women vote he is going to get the long angle for presidency. . 1 .,, K. .. .. t Q. .X V-'ifxgj H, AL 1, , ' ' i -1 1-1 ,rp 4 X 1 ' 1-......1 .h .zo - '1 J A .. ,. , w. . .Li ,uni-4 ,,1 ,Awami Y lr ia! 1 ,E-,1 1 1 1 ,' :a1?1 :.. f , J- P4 .' ' .V .vp 1, '1 X pr J ifqgvila ,, is E f in 151 J, 'f' .t-,..1s-' l .Q .lfli T51 ' 1:1 ,il ,KJ Mai' 2-r I 1 I I ' . A1 . 'dim 1 I 5--121, 1 '11 ryj' if ' '?'-,J 2, 12351 EK , 1 ' . sg: 1 ' Z 1, i 'x 1 is . 1 fb? ' a if 5 -2 . '11 lyii' 1 bfi J - , J i 1 , . 1 fl ' f -:la 4? Q, . 1 . Ii K 11 if 1 ' l, 1 '.1' k, .,. '1 1 1.' , . 1 5 1. 1 -5 ,,L,,.,,. 21. ,,,.iW 1.4 ...f 'S , an 1 , ' 11f 'L7 1 ' ' - ..'1'1 L., 1' .' 1 .+.1'-, ',.u1'xM 2.25--r -'I z., .Leg-J,-rf, -:-- M53 4 .1 Wisconsin Aids Fatlierfless Children ofFrance i Ruinszof a French Village The University of Wisconsin early came to the aid of the war-stricken children of France. ln the fall of l9l 7 the students of the University of Wisconsin became interested in the work for the Fatherless Children of France. Through the inspiration of the Madison Committee, plans were first laid by the Student Committee under the Student Council for the adoption of a whole village, the village of Montreuil. Helen B. Smith headed the student committee. Her work was taken over in October, l9l8 by Gladys Haskins '22. The university women under Self-Govemment Association, arranged orphan boxes in all the rooming houses, sorority houses, and both dormitories. In the First six weeks over a hundred dol- lars, mostly in pennies, came in from the boxes, and the first three children were adopted. The yearly Christmas Festival of song, given by the University Choral Union and Glee Clubs made it possible to adopt six more of the children of Montreuil. Gradually the interest spread until organization after organization, sororities, fraternities, individuals. and university departments have felt the joy of sharing in the great work for beloved, courageous France. Through such cooperation the number of adoptions reached sixty-six, the children living in Montreuil, Sevres, and Lyons, and other French towns. ln the fall of l9l8, the work was resumed with fresh impetus. During the week just before the Christmas holidays, three Christmas trees on the campus loaded with stars representing individual contributions, repre- sented over four hundred dollars for the children. With this money and seventy-five dollars more gained from a moving picture benefit, together with other dona- tions, five new children have been adopted and fifteen others readopted. The need for a continuance of' adoptions is still very great and the University of Wisconsin will continue to . participate in work of keeping and making happy the children of France. . 11 -4- t -YQ ' , 1 . A . F f1 ,mi 1 W , 1 Solange Quiot e 'S' 1, M-- ' 6 K . ' A ,Qui l ' f X 1 . . . A . l I' '1 - , l ' 1 . 1. l . 1 17 'Q f ,T .312 2 1 -f f . 1 H-: 2.1 '--1' 1.1 . ' 1- ,J .47 - L' .-'f-11' 'fkn..1,. I , , 34?i'15,35F-G '-irgs.-io .1 m If'F? 'ff1 I' ,.':: ff' -iii, i , FV KJ1 'Sgr' aw- JQQW iG1Ll-gzfif' -1 'Ali ' - W Wm' ' 'L . . '5'i2i1-.enBl1i.v??!la.: .X :FL .1 'ellis 1, EW, at .15 h ,Aff W' ,ff I N .. , ,X V, ,Now Y x - I iii 1 ww Gy 14: 7 fr rm , n .. 1: Q' 1 1 ,V .--., My Fatherless Children .f i., I r U l v E The Kappa Orphans from Montreuil Germaine Rigoulet, Montreuil, Adopted Renee. Adoptecl by University at- Large rm 1 l by Barnard Hall :i3,33?,,f2fi5rf 32,123 W' if- fvwmw. fqff rmg:gr3tQiSM0aag?g03fALff M alfalwama. , -31, WMVQLWMMLL ,,,,.m,fvZ,ofojw,afvZu. Oie-Mum.. DMA. GLC 'MDM 5 Wa :f'fwa u Pd, fgoccafsfwfuv. all ww: '4qVCQfV A 1'JMfJ J -UVL, '11fVJf04AM,L 41-01419 Lmmcmual cf! Iwi? gfggfmk, b941AAfb'f1f1,0f3 Clluew Lwvw f Em f51,o4M4wA.- DLL A Wfflwdl- Ed: 4A1oM-A woua .oowvt 'wo fG4,v5ofww ILL Ebofve Q,M1',L Ctrlc 4044 gvafml cdwa !lgJLVe. C Oqnother Letter from Renee Montreuil, France, Chere Mademoiselle: Le 20 Decembre l9l8. J e profite de mes vacances de Paques pour vous envoyer cette carte. ,Ie vais vous dire que nous avons ete bom- barcles par les Boches, moi j'ai paue des Gothas. Nous descenclons tous a la cave mais nos mamans ont du courage. Elles pensent a nos vaillants soldats qui com- battant sons la pluie cles obus. C'est si terrible supplier l A front Francais en ce moment mais cela nous clonxiefaf 1 clu courage. Mademoiselle, un bon bon baiser de votre petite amie de France. 'J Renee. V -'x Q 4 , l 39 ' bfi :U x J , 4 - 5,3-'S Q : V1 Eli Ewin- wp-,f Q L53 ,M se, wha fr 'V 4, 1, ,.lv'., l 'E ..l' , 1 X W Fri-,,..w 'S,:, A 4 'f f l 11 , , V V+-f I L .ws - Q X Wh W ' ' ' H Z ' F Z 6746 ISCOTISU7. S Q p 18 6 I k ' . ' ' 5 I bzynnzs-:nn-an uwscm ' um-mm ae Janne: num , H 3 ' - , . .. : 1 S, v - J - ,f'4...X a ,A-tg, ,. V ,. N. 5 4 -- f i e el ,. 1125 5. P - ,Q A 5 ii' il-1 N .5 : 1 Q ,Q-Lg. ' f 23' i?T?? .e11 i 1, lv li fi i .. li-: 4,-Q ggagL,,,,,!f Qt . , .mage ---sp i '- ,fikf 4555 rf 'QPU ,'5'i Lyon-Home of Ten Wisconsin Orphans am Q fe 1' , l !'5ik uf' 'q5gC.E7ql ' r ww -.iu'::'icr'x'u -nu-rm-if. zgaspfflxfzngassagueaeezs.viemti mscsseiinensiiggmm - - - '- ' e sxffw K- pm: A msg! iauanllcsqgga gi--wif 1. :gill 5' hu 4135.1 E limingliint :M 1 --ggi, if so :aagssaw we Clllig fitE3i,,,,.,,, w . fm - 1- ,ii , ,,. in wifi? w el 2 Leaf s .,.. 'fir if wma. lv -A-' .4 . Sui1LRhn:Q School at Sevres Nl ntreuil-Sous-Bois Montreuil-sous Bois, the first '3Wis- consin City is just 1 outside the city ' walls of Paris and is only a fifteen min- ute ride from the heart of the great French capitol. Sevres, the second Wisconsin City is a town of 19,000 in- habitants. situated onlthe left bank of the Seine River. and only forty-five miles from Ver- sailles. Lyon, the home of ten of Wis- consirfs orphans, is the third largest city of France and is located on the Rhone River! I 1 War Orphans 2 Lucienne Metivier, Montreuil, Adopted by University Girls. Fi it i'fAiQifJ'5 , nw, . , . M . . . , f 7 'mi' .. .,- -5 M L lf: ,ge AQ From Left to Rightg Felix Davoine. Adopledbliy I Ye Cath Inn, Albert and Almee Davioneg Adi L opted by the University-at-large. J v x 1 x 1' nb ffgw: vflilr' 5-K A ' v.ff , ' 5' .l Q J ji 'gig -wwwm. mx., - fifty .-I f? T - F H' , 1 . 4- if-'W, 14.:-1 M oAL.1'if'Ew4aaQ.,w.a1,' JH. gr-ff A, '. . l., 1-,tflf f 'Q wif J YT 25 ., Af -'ff ' -,. .. ' , -Y Mmm-.- . 1 R5-EW9' ,ywmw A L 'Af Q 1 'www ' fl 3 YW fl wil A' ' j ' V-awww X i l '3?11,f,g..f fi? flu., 'gh 2,5 jlffq I . 'ck 25,3 1 fl' lt jk if 'fl' l fl. f'?vn?ff: ! J . I l I l ' S 5 , l 5 1 .X , .w . 7 A l . 1 . -5 . l 'H' fa l 3 L24 ll - X H 1 .VH A ll .2 , v T 5 3 5 .i l l y . ,N M .6 '.'.2'UJ:'1AY-, , K ,-1. , , . J ' all 'af ffl' ,f 1, 'I Q -ai 3 5 - le 1 an fx Sl I , l , X - 17 l ' 1 l 1 g,s.I' w 1 5 4' y V E25 H 1 , l l 'ef 4'53s'f'5 Q 5 ' l VE. ? A + V- Fix - 1 ' . X L :if 4 , - Befgggvtiaxyxlsgeglg llzline elmziievfjxizzgxglltiflKg-cl-ggnsgllxvlzgl-gel'Intl-tl'lg6ggi-gcglvgqwmfxalxiglgflseglll la day of strenuous celelnratibik' J , 5 if The pxcture on the Capltgl steps washtalcen gt 3 a, m. on the mogning of Victory pay. All day long co-eds, S. A. T.?,C. ' 4 -,- Cy.: iz? .jill ' Q33 'gf' ' 1 ,. SSH. -.. .4 .1-lf . ...., Q X, . V f V., . . ,I 4 ,324 . gg I 2 1- . r ll 5 Q ' E, l '-.fi V ' his , S men, and townspeople Jomecl m stagmg an Impromptu celebratxon unparalleled in enthusxasm. VV .. Q . 4 V 5 r-Q! . , 1 Q. , gl .CTN - K l ,Fl ,La ff 'iii 14 wi ' 1 A ' ' ' ll- . l . f rf lf-4 ,H L V 415. ,, In Vi- . vw .fggfvtyl ' vii:-,lg by ' ' E ' ' , . , f U l - ' ' .le-'Xl' ' F ' L '3 ' ' ,Q ,X 1 1 -,mx f f ,,'gM:'Y5. r H L I I. Q I, . E, , . .5 Q. Q, .- .H ,, , 1 ' , ' 1 .lv ., ,gpg-, , , ,uf 4, V - f ' , '- Q.. 5,21 i '- 1, . 11 ' - 1' , Q, yi-l5'qi1f, . in Egg lmfh V . 'fy X ll -Q X- ' U . mf . 'ix 12 M- .J ,. all 1' Q V .e fx :?'5H.ifl'1 ' ' l- I i'.5'ig,5qfi. wr: . . wg . ' 91595. l , ,-.i1f.i,p.,g ,, fr ,'i7.f! rf 'F fgq.-f ' 32437 g3:i1yiw,13n'fl ?+ - .- 'g' 4 'XAti,gg'S 71J '5:,:l fvjfl H 'TM4-5116 EH? 4? f1sgfg2'.1Asl41ilEg l, A27 ' fl -My 4 ,ff f J 1 -' .Wm ...m'-4'-eq 4: 4 -xv ll -UM QWQR-'W . - n f n 'vf' V :7iLf ff1 - '1,.:. 2 - - ' ' -'V 5499' PWEQE? -J L i '- ' fi W- x 'li ,fi -, nf., L ,-Lu.: mg. 'L , ',,.5I9i,-K. , : l ww- ,- -'I J 23:- 1 ' Ayn'-.wr ,ge 21'-33 . .:f'- fefww . All-v , f '1 144551 -' 5+ ,Dyfv-4? '- uf. -.. . fi- -ff :-4 '-':. if -'-f-1'-'W:si2lvlf'-,- .Li r M-wif:-':'fi' 1 ' l . ', nffm: :QA mat - J,Tl:5'4:4'22mggv.' 1 .L f , f .L f , ,--...wml de: M1 --- - ww- ' -QW 14 -A H w e,, r . R, , I 1 .......,,K , 41. 'MM-.., 1 , XF,-M-':q.n,.,: -7' j9,,.,,,,, M Xwl , i ff-1-.,.,,,5E a.?l'z, A V mv, r3g.f'xL .Tc ,1'ilil3lf- fr V -f 2141-f.dfh?1alE ii -V il , 1 l .f'?2..-W9 if i' ml FQRYV. iam' 2 7'l'WgT'1 3 ,lx l F' 'I 'rf 1-i ny ' i 126- fl ISU ' 27' 'Cf' ' --f ww if , : ,tial , 1, 1, 2 .,,'-,Q njgwp 5 1 J w LH1. J . ' ' f Nr 9. . iilvi-rr 1 Y ,,.',evfu'f nf J f 'r ':Tf f' A ' L ' .. -1 ff ' ' f 'Ci' 1 -wr. A: f .. - r- ..,' , - -2,5 w ' w , A 3-f -- - V ,G-ja -- ' 'lim' 2 ff' XB 3li4.il-f7f 'fi . f f' F.-+ 1 -27fi'i. f I - V -,,vl-:gJr,,,M r-,uma 1 V 15 ' fl, ' ,,',,f l .. 4 , V di ,. if fl ni P1 W1 ll , . . . I. ,.. ,. -eel-i::liv'i3,1 lllefxf., . -q.,51w-L' ' ,fmpzfq ex ,, ji if X' 'ffl V' Ji , 'l ly fi lt ie. i , . 4 , ilfir' .77 qw, x ., ,- ., 2 1.1 ls, ' Hornbeck ! I i 1 Martin Westermann WI - . . . . TH Wll.SON TO EUROPE These Wisconsin rofessors accompanied the American peace delegation to Euro e as authorities in their specialized lines of work. Prof. I... Westermann, as a specialist on Turkey, is a member of the history department. Major Lawrence Martin is professor of geology, and Capt. Stanley Hornbeck is on leave of absence from the political science department until he completes his work for the government. Wisconsin has furnished more professors for this sort of war work than any other university. lr 9 l V is LIKE MY OVERALLSQ-Hazel in I Brashear ' I9 as she loolcecl when inspect- 1 5 l ,rf V6 ing 4-inch naval guns in the Naval Ord- f nance Factory, Moline, Ill. last sum- mer. fm ll 1 . - f v V , W A v I.. Q l. , r OH JQHNNIE!-Ensign john W. Blount '20, before- flight 05 the Florida Coast in naval airplane. I v - 4 ., f, N 1 xifzfzi . ,,,. ,, 1 ---- f. , ...mf l mum x ,- 4 ' il.-Vi lf 123575 flu - ' 1 ,bv ,W ,S ,R .X ,dwg fKQ4,.s . 43' v -mls. 'L I 9'-,U,..15,:3s1A we-nf 1-. fjfiiili X, 7 .. fz54,fn-154,32 r :g.v.a..-.2-.EMf...m. .5 ia- ,,,.'p1ifQ3g-V54 5'-fi- Mfr, 5 : 5 if., .' file , ., ifcgq. ' g' ' f, 'Tn , . . unify N I , Q , ,.. I. ., f , f. ,s . . , -e., tf,. gm. ,f -,, L, V ,. -. e , 'Lyn' , ' ' L Risgf ,E 'JM H-..s...e..e...-4..?Q Hpswvc,-mfif .. . J, - .. v-A . 4 .ff . 5. ze 1 'ff' ',,.mfwa,.. I N. x, 1 , Q ' 'mcg ig' .mfr li 'f kj :.5f5,fffE,rgs.jiS'ff4'3 J l1f4:'-f1f'7 aw., ..,. Av' :N 5 9151 .f j'r1 RXEQ ..,. ss.-- ..., -..,-... ..., --c.,. ! J. ' Q i The McElroy Affair 1' 'vii 625331 ,H .H . ??5s4ff 'c' 1 1 1 1 1 ' .- A -b -. .r .mem THE BEGINNING--THE LIBERTY DAY PARADE-This photograph shows the caclet corps marching through the rain to the stock pavilion where they were forced to sit in drenched clothing for hours. principally on account of the long-winded McElroy speech. Because a few of the cadets were physically unable to endure the irrelevantfoutburst. the Princeton professor on returinng East spread false charges of U. W. disloyalty through Eastern newspapers. ' LIBERTY PARADE cosrs Two L1vEs 6. Q X 1 - - Jann A. nomum as recom: vue-nu. Aero nun can or X N mzuuouu '83 SXV-riff X . Q, SY' Weis' def' 555-:.g.:::w,g4:n:1g: A mana .mm u 1 1-un or ua- um-. mmf ur ww -.ef-.ma mn -.my -nm .mm L xg.-mn --armed ...rm -me-nw, :nu N- map in-.L pn. wma H-mu-Q. mem- rr-rp. wumm mr .rm ' 5 mms nv vu 1 9 0 44' S56 GKYQQF-5' ,. S't l ' '37 222.4721 1.5.11-2. fax -1 H vu ww I.. uf-am. nm-M. in nu Ng, Q 4 695009 ,....0iy, Rau .mm by B.. .Eu R In ' Q Qs 0 is me -'M H H - Y- all 4 .Q e ee M'- Y 4 ' 1 1 - .- -. . srws.. .mann A-nm N- X 52 P1 Q' pi 4 fvtvi' ,ef I 6 .v - . , I, ,w v 0 .4 ,,.-yi. 0' if -v' ,, .- ..nl .--ummm. nn. .mr mn wmpaw .549 3. ,A-'fr-'I--, .. 141.3 Mc? 44 , v '-Wilszit a- -eift-vw-'L+ 'A-,VJ . fl . 4. 'fe' a e51,K' 9. X 4 10 3: .Lg..kr,.4 ff. r . ,.g, ei-1.5 f.. .fm .3 in - ..-. WWW Qin ..,WQ,gff . QQZFVX W - 44. '.gf'Zv,, 51' . Qhr 4f,a,,ei 3' Qi? 6954, 46143, 0421-,QSM 'av '2.,g.,f.,,:- 3. Q MQ, f ,g.,a?h4gl:,-4.735 - -ifL.,.'glg.geg3g-4gZ'Q' 416 , . - , . .. v'f':2f1:f:Q-'zfr.51.Z 4 ,B . we N+Q e.,4 lk. 3' 'L' 1 r' .GM A 'css' of ev rf vuxakf' e W 1 'v 'Y ' '- u4 '14 'fs K me iw .QQ2-:Q - fu QA xx .f5w22i ff.f2'.'f2ff4a. 4 w -904' Nifarn v- Qelir' J Q4 F': 'xxx-4' Il X '-S. - f 'f , l' iq , bww 'Q f P .-'.-,,. 1.41. ph 'Le' -Q' .-'Ss' r-'X - K 'iw 'J ,+qg'f.g4, v'+ , .'si'4,'MK J? Q +.g:,.v.,n :f.w:c: agyvdxrg vga, .-K..r:Q-NP.,-xea3.fc QS, Ya ,,j?Q-,4-j:,'g:.4:, szzsfsxfs QQ5? 0 l . P , . A . 1 ' . .-,-ZLZXQLLQ 4.5. +-fgixgggl f...f4n.W,1x,-,-1,3 X 'Qgf-gg-3igL,g4i'f3.,+Iw4w, qa53fv.,.. 0 A , Q, 4, y.,iu.,4 .,ef,, , a,.a4,'fi-45,-444 ,' QA ,Q pg, Q, Ns...-Q, og., if . .- of 1. 4- 'f.,,, fa, . ,,, Q,Q.?.,S,fs, kg' U,,n,e .wo ,Q Q04 ,nov 4. ,N .f y ,.v,,.1 ,Q .- 4 4,-. v, ,gb 4, . gig, 'X A ,+ i,.+X1 ,,of,0,f,+.-,v,o,.o , Q , M, 4-N.. 6 4,44 1? 4 16544, ' x55 x 'QS' g--4s..g..+.-2.5m-':+g..,g,1, -1,-if ,P X49 , 4o.3w.,T. 'cpl' Z 4 4 X 0 4 V X N f X, 1 've 4 Q44-6: 10+ xy .r . ,,1L,v-,. -qv Q Qs Ss 4. .. +lfl'f ew-if . 'Q-as 5 K S S -1 1: v FM' + v'ff'3'Z- fe QMFAQW' wx yi. . -wg '5g3,'e4+ PV ry' 0? xy. '53 '53 Qfssf ff g2a.f,jf'i'7 . 620 0 ug If xx si . .Q . 4 is Q ir if Af. if? amz. 411' 'x:f+13 f +7 S ,hs 5 1...-ex I ' .ll FQ.. ,. is fc-I liiffg 3 fy-v.,..',:s -'Gm f A 33 A 'QQ Q , Q Sgr fi, ling, Q , . -,5N .n3,,.-QL.-,:0. 3. .21 gg: , X4-qi, - 4? A .-:af Qgffi. :Q gg: N, ,,.-Q. 'jjj' , 0, 0 :Ny ,W ji, ,L Q? 6 Q . .,.r ...N 1 1, 9,0 8' .Q -r-I Q vc HCI: H ' . t5t'!-f QQ? 3 4- 4 5: ' : z. -, ,.- gf-, w .-'N -X. A nie ,Az-'i, oi' gp 431 55' :.s,i'1r:A5rf-25' ff .5-If f hy egm.-33 3353--,.1gQQ3::i-g,.2fg 1,Qg.lv:'-.5Q',a'Jj?Q'f-, A52 H fat .4 tn., P?-w -fs N.. rg .. . ' 1 -sr '..w1.-H+..-' N'-'l,.. v..' w'waff-1.11,-pg-5 -p ' ' 53: 54' 05?-fi Q 6' 1' 6? ' -'rw' - s x- r-W..-H 'U-'X 'X 1.f14.av,,V ' --1 ' ' ff-:Tiff-'-Fr:-s'I-13 Sl: ' 4- 'is fri? ti-K l ':i- 3'i::x '1 .- .9 2'512L3m '2- 4 is e .f s 1 .- -1. giui .is..f.,, gh :' 31,5 ,Qlrs :fn ..-Q.-j,..n .e',.v,.v , rw',n-..1o'L'5 '.v3A4 1', 5 ea N.. Q . 5, i H-,..,v N . .-,.- 3' -4-A-g4f.G - -sa :g 'f, 5 ss .-, 1 as-sqfsg ff,-f' .f-..fw,,.-xx, 4' . b fi' ' I Xe' X rl' P' 4- S'?5a3 kwin Y-' ce'E -i'44Yj4.'.:' iq.- N 'JI pf! -' ':'?.-L' ,,.'..- 'Queue 'f-U34 - Y Xxif- if iff ? xr. 1,1 gl. , X e cz in .' :lf uw. -'ici v v ., f : ' 04.5 2. fa 5? in f.4,4.. if 455-Q 9' 'W if 1-51511 .'.. f K .,... .. X .f21fimlcs1.1i :ka ts. lg? R ,AQ WH. giiglrkxl WN,-51 6 .qaf'ffm'?-fn. ,. iw me . 4 K - . .X yy. A -5. 1 , A M tl s. if . ' 1 ,J 1 L-.,. -fray? ,Q 1.. 'QI fn'-1 f ui -Mu 'fri A . i ff ' ef ' lv ? 'ILT '-:.,feJ- :gr IE '15 'VARSITY OUT-The efhgies of McElroy and the Kaiser were flaunted through the streets for hours. McElroy's efhgy was labeled McElroy, Prince of Asses, and the Kaiser's dummy was dubbed Kaiser Bill, Me und Gott Y '-s-c LAST OF McELR igtudents danced wild about the Ere which consumed the effpgies of the two characters held in mutual contempt. McElroy was forever squelched. ' , 1 T--.mm , 1 , 1, 11 , X 1 '---1-11 11.715 1 1 Qi im: 1 1. 4'f-,,:g35 ,1-rg L,...:E V' ' L N '.Z'L31f- S?15'-fig? - -1., - 1 f., 11,1 11,1 , 1wgX I -'W -fi , ii 1 .qw 1- 1 was 1,11 ' 1 'z'-1,25 nl q,j1 -' E-'L GT ij. Q - 11X 1 SLUYALTYE E. W111-11 1111131111001 T51-'RN-fy W S Nw Wm 'mmf2sa:1'2:2a3S?zJ,Hb-'- K. ' f 52' Q19 -,X T- W an 'HURoor.oFLueus, 1 W- 11 1 1,1 Unwer, 3 'X j9UE1m-rev 1-X 'AsxA 5 .5 LEADS CHEEHS Fgg S-UT-5 - wx 1 1 yxuws cvwc1sm5ixQ ax XXV Q3 gg? 7' NNW M we 1,111 ,111 1111 1Q.1Xf- 8,169 n,.f?jj?j'm-my.133 , 1 I 1 V , xf,Q 5 1. 11:.111tZ:T:'-:':1L A X1 an 1551 jst F W, 1 1 1- .11 Q1 1 rf' 1' 0 111' - ,,11fUf v' Ln' ,Tw Q 116 D 1- .11-'1.V'11 Ki 1M'.11Q -'- . w- 31- 1? .Pie W1- .1- v,.gx,,.1. K 1-' 11 -111- ,. 1-3.11-'11--X' . 1 KSN.. ,. ,, 1 N --v or 11 Uflsler Dem 1 1115-I3-3311 4 W ,,, V, R1 .611-9,1-9Q.dw5111. .1,k ents 3 Ffarin . JP' ,,-'A 1101111 X , 'Y'gfn 111121111213 1 culffllnay n '7' Siu. 10 11. r,vivh1,1-M11w 111h111111..,11, HMU11 ,man van D, U .11 ' 11 ' 1 11 1 ,Ll-l111111..1 1,1 5, S ale Affair ll- 1111.1 1 ,NG S 1 21 K ,'1f i111- 4' 1 1.11.1111 11- v 1. 11-fl sv 11 1111 XX H3559 QZSX 19.8-Q' WY- Sxyikmnx Yami-5 xgfinffvm QMS YA ,,- azsxoanrs sa 1 hm m1 1, X111w1v11n111s1 f wxsmmsxuxm owen roman P nuns uusnnc, nu ff: mu as LA ron: can cwv-rx n u-v -111 1111 1111.11 11, 1-1-111.1 1- 'rn . w 11 1.111 ms .. . . 11111 11111.-.s1.1. 11- 11 1 :Ls a. :1,-- 1111 11.11 1111.1 11111111 111 ,011 11111. .1 -1.1 ' 1.111.,11-11.111111 111-.11 11111111111 111 1.111.,11.1111 11 5111, of 11-111111111...11111:1 1 11, 1.1 w1.1-11 111 1.1 H65 TS- 1 1 1-1. 111-1,1111-1.1 11,. 11. ... 1 1111. 1.11 1111111141111 QMYY 1 -5 Y YOQXY P390 X '-:,: c1.1 X .1,,,,,, :mer-., ::::r:.,r:::: :, 511111 153, m::'.xu1':':-. .1 111,11 1.1 1114 r 1111 T'f'1kX1 110111 11 R 1s,2Vb,:,FQ,, ,,.'.,,4k 1 , G Q' Q WZX1-5 a 11- m11M -11111. -1- 11111. PA LL? W 7Rlo11c S 1.114 1111 ,7 0NGs 1, -n-11 h .1 f.,f,,j--'-1T1'N 1-Lili' --1- .M 11 n11.,,'j:--1 ,,, If-1.1. mfg 1, , X QL 1 Q, 1 -1 -1 11.1 , 111. 'fu - 1-A111 'm ,, 1--11' d'-11T, n- 11.2 --1, ii .-S 'fy-11 11.1 1 .QQ V n lf' ' 'v 1 1.4 1 sy 11.,. ,D T1. '--.,g'-11... Lf---11 1,'g---1.1Z'.2iZ ' QV ,v,, 1, g,., . Q 11, - L' 11.5 0-225,11 1, --wa? 111 -1 .2 , 11 f 1 , A 11 N -0.1 Y'-- ,1,.,, 4 G 411.4 q.v,x.1-- 114111 m K7w1. 11 1.1 , 1 1 0 , 1 1. , 1 , J- .1 N11t1..1,,,H' G-1111. 11-. 1 .1,.,1 ,f,,v.1 Cn1:1111 11.. 1.1 F U ,J 11.11lr:,, N , 1 11 A5 Amr UF BUNTEMFT41 'Z 23 4- 6- 4' 0 -2 fr- 0 '96 2, 45, Ach I fe QM, J, I: 21551,-1,V1jg.Q,25j13,,1,X 19-Q ee , 4,00 fx I J' 0 Lui-fh?:' 4Q'w -'x . N. -1- , , - V- 5' 'E aeffx .,,z'?',4f 1 9 5 0 1 '9 f 11- . 121-1111, 6 Wg e 1'1r-amz -'11 Q21-.'f11.f :WML , L 'f-1-Y-',-:xi 0'2- ' fe 'Zi' 49 11 I ,ffm 4 0 239 eff 44:15-+1 4 -v w,1f,1,1r1,f-, . 6,04 Q F S 1 9, di'9,9t4' 'iii-.L1., -414 f ve. 14-.4,-neg. 411,-1 gf ,. ,- 951 'aaa Q, 4'3?,'q, QI. . ,M . , ,,,,,' his fa-M,-, 21951315.71 -45, 'SJF11 -' - any 4, - U94 , ,-. ae--A .f 1.1, . , Z-if 1 --if 99 I , 1 ' '14 ' 5 cr- '5 If 61? 'f?,f'v'a 'hiv ' ' 51 2 I 4 Q 233211, -1 . 'b,LWCk, 'Vw av ., I kv -4 5 Q,S'4--,Tx ,2'Lf'. 2 '1 0-m1f.'1 I-b:,c,,,., . 1 1,,c 'eu' . . M5 'wad 0 fs, ..1r-451-., eo '01, 00, HW- 417 , I J ' ,-1-2.-we-1-'i- 1X '-1 off M 'f U04 341' fi-1 W 00 f 1. W. ,W11 Qyfmi-,Z,Za-,f1Qi,'1,V:tf..,5 . .1 -:1 fx 1-.1-1:-MQ1'-:f11:.,w4:'.1--1 4 ' Y1 1 1:-I3--J-.-.-1'--12 -K-I'1-1-:Q' xx . l v.,,e.,,:.4,q5:1,s,.,q ,avsgvv ,X X . ,' A .ue Q,,,o,,,eQv1L.,v, 2, .311-if. f Wa - fn?-1: 1.1-215' '-'-z2f:2:w--2-f W Q x W- 'Q G1-iif-tr? W K' mm K .1,,1.1.1. .11 1111,..1,.1.1. I H' 1 1111 1- ' ,ku 0, 11, ,L 1 N ' S -f '71 z'.',,:,,151 f 06 S 'wa X -1-:111111111111l N . .1111 11.1.1 1 9 9111919 4 1111111 1 Z m I Nw? 11.5.1 111. 1, P'-'X '. --' 2111- -1-11. .1-1.11111 1. 111 5...-ww fm., 1-6yL.111---,fx,,,,1,1- 1 11... 1111.1 11. 111. 1 W,,1.1 1-QWA1.-jg nm 11- A-911.1-A 111 11111.11 1 1 X' -1.1.1-11.111 .va --Bw 111- 1 111 111- 11111. 11111 ' uv' ,,111 ' ,,f111:1- 11 11.1.11 X ll LL In 1 1 -1111 1111 11 1111.1 111 1119 we 11.11.11 .111 111 W2 Wu' , 91156-M ,..1.., .1 111.11111 111. nd luv! s 111-1 L. lawn 1 r 21 111111.11141 11:1 W1111-111111 111. 1 5.1.1111- 111111111 11.1 1 1111 x-111111 111- --j,,..11 Q-g,,,1.1 M I 'X' ' ,.1.411 11.11 11 - ...11 1 1- .11 E121 . 11.1115 ,.--- 4, ' 11:1 11: 11 ,1 3.1.11 '.11.....1- 'QS .111 Q' ' 1 111111. . 1111-V' 111041 - .xv 1 m,,,11 A V, ,,. 111111111 ' nb 'N ne an W1-A111111 non' 1 lou! 1 A1111 11 111111 1 1 11 111.11111 1 1411 1111 1111 m 11.1 4 11,1 n 5 1 1 -11. -1111. -1111, 11. 4 -L 1 wx. '3 '. 1 111 11.11 1111 U 11.1. '1111,.Q .1111 01.1 -I 1.11 'ff 11,f ' 1 --11 111.- 11. 01 11111 1111.1 11, 111. A11 . 11111111111. 1 K 11.1 1.1. .,, .11a- ,,11w 1, 1, Q n -- .1- mn Inu-1 :haul N bonu In 1111-11111 111 ma 111111 , 1. ..w- 11114. W w wx 1 1 K M' 1 -1 ,?.1.x 11111101.. 11,111 111111. -11.1111 Jn. 11111 1-111 1 1 .11 11 1-.111 o a 1 my my-11111111 I 1- 'K Y- 111 ef xo ,V '11-'Q'3.1. .-A 321 '1..Y. 1- -3,1111 . -W 01111 .x,,,..11.u ,,.1f1 111 1.11.1 1111.-1111... 1 1, 11'-W 11' 111.11 1111. 114111. 111 -1111111111 04,'1f,f v D 11111 11-.,. -11111 -1 gm. vw wa 1 770 if Smvfl-fgtkos I I K 4 11 911-1111. 'J...,. 5-,111 R W 1 N M ' '1 111-1 ,5, .11 . U11 111.1 11 . ,fu-:m,,,,1a -11111.11 11111 1 11... .111 1. 1 N, vt .,111r-W ,,1111--H 1. 111 ,A 11 1 1... --' '11 -' 'fi T- A- 'T,1111fq 1111111111 'l' 1.1111111111 K. 111- 6 P11101- 1.1 1111- M111-n ,.,1n- ,,, 111- 1, 1 - ,1 1-- ,',.1.11w w,,.,1- 1 1 .11 11. 1, mf .1111 U. -1.1 .-sw'--H 1 , mg- ,111 1-viwxt X LN B 1 111 1 , 11- X.1-,52 ww 5.111 3, ,111 Q 1.3. ,,,,Qu5y,.,v3u11a M ,111- WW' uv ,.. -1' 1, 1- 1- 111 5,1141 'imm- n in-45 NW' of cu.-1 ..F,gnL xi Fra: :EW Y? 1 i 'Y Laws A , 311:11 f f'4', .511-1' UF fx 1 Pl Nun l' 11? 1.1! H' N 1. .....1, x 111.1111.E2. ,i,, -111 1....CL2, 1 , 1-1.1.1 NU, lg-1-:mm : .1u111, ,W ul nm my 4 -1-1111. ,. ' s1,,1,e,'LgffP1a1,e, X Q5 I W 6 ' -1 Meg, 4.11-,11 :Sm 1.5 R'-'Y To '1 odfyoijss ,Lx .1Lf'l'11111.1..+ 0, -4 K4 1 ,fo 1 ,1 A. -1..,oM.11.,,,, 'v 111 ,,. 91:9 p '1 491 93.1-15-A I 1:1 D' HI 1-1, 1 1 K n , . f-s11fc.- --1: mf- 11. ' -4 'r . , ' f f --1111.-1,11 11,11 , ... N RETMCT7 r 1- .1, 11.fY1' .11 11.g,.Tf15l1m11,., .hu ,mt M 1.0! 1111 , 1 am A 'Wil slam. 1, ,, . ! 1.1. ---111.,qf1.1., yn, , , ' , 'uhh F lmbn. Lrrmy ,I- 1 111111 , . 11111111.1- -111, ',,.,,, le11 f' ruff I -11 11 11 ..... , .. 1.11. 11,111 1.1.1 ..,, , , 1, ,, , , .... 1. -- 11L. . '1 - ---11. .f 1 .11.,11.1... . ,z--I xtv' rf 1 vw 1.1.11-Q,,.s:Q'5riv,1:m g.r,,k.n r , -I 111' f-1111-,I H1 D 1 -11, -1 1,,,1S,l.a.u rf. . H- N., -111. . ,ho 16' ,,1- ,-1 Y' ' 00' .X '4 11' 11-'111H 111 ' rw.. -mf 111 , 0' N' v w-X 41,1 -1.11, . ,,..Vv I 1111-111 11 M., 11 -1. ' m1f ' 1.11.11 . 11- 111 e-' -X . - . rf 'Y J W' YW gy-11, yMl11'1,jIf:.1-...,K--f. 3,, 11.1 IIA. KE ll n ' PH ' ' ' -1,' 11. p-11? ww .vw ,11 L W 41-X , 1.1, nu. 1 11111-1, 1.11,,,,3,,1. X, ' 1 11 ,. . 1-11.1..1.., , 1 1g . -1 -4 '--I-:1111..1. A Y -- 1-111 114 1.1. gli.. 1 ' ,, ' 111.N'h I-111, 'r. 41-1-,1 1 v ,1-21111121 gl , 11 I I 1 my k1.,,-1.1-. ., X A 1 :Tn-11 .mu W-dv-1:11 1.1. -f111.,,,t-f.1.., l7.,,,,d ml 1 . 1. K 41121 -111, 11.1,,, 'M 1'1 Nzvfgigjcwuus- 'Nw or men ,111-,111-x:,.,1.,,1N, If-.1...,n 1. ,R 1- ,11 '1-1..,, 111, 41-fu , .1 ,h .1.1.11,M1,3 KM BM: I I 1 I ' 1 ' H-Q1,, ,1-o 111 i 1 , 1-f'2.11f' x1f'z,1- 11J,,'- 1... X--3,11--,1. -U11 ,,,, fy-1... 211- '1.111'7 I .'-- - J --- 1,1110 . ,QL-1.1. W M , Wm N .ii-111 ---11.1 if1:1,1,. L 11, ,gl-111 ff., 1-1 ,A -'1 . un., 1.1. 11 -11.1 N1 1 --1. , v,1,, 1 lm., .1. .r.,, ,W 1 2-1 ,, 111, .f,f,Q---1- ....111,,,, H-1. ' -H 11-1, -X--1111111 , M--1111 n-111. 1. 111.1 P muon ' ' ' :f15sonoN 'Mr-urn. W 'H' vTmo'r5 '4 15:1-1 ' ' - 1-1 -31,1 wav.. wlwlwu .- A11 1 vnoocvznwuun ww '. 1 li, 111 , X W ,f IW 1, 1,-11, fa Q1 0 11,50 WW v'2 -., f- -11 I- X afar ' . WU 1 K h Wy' '45, N,-1 ,4- 'Rf 1-QW mf-4' ag.-as 5 f ' . 4 '41, -'ab0a:f1M fr, 1,1 ca Y, f 111 4 SWR W M. Q26 ,gh J W 11' af X 41,1 H3735 ,uf M- 5,1410 . H. , gl. , - M, wks 1 Ko x5n0V gg 'mea ki 9, Raj. ' 9 ww P4 M2120 NJ 4 1,-14' .,-1 5 ' .Q x i,,1.1,w, ,,, 11.5, ,. ' ' 1.1 --' '.1 F fy: ,Qu I M X E '- 11-1 Y-1 M u fr .73 'WW 1 1-- X'.11-- 1.1 1 .11 M a3: '-'SST-if 9 1:9 0.1 e ,1 1 , A , 11167 4- 'L .0 -110 .111-- 11 ,. .lb J 'fn-....----f. 1 .1 11 1. -f ' X311-1-13.1.1 ,,.1dA,. ,nt 11- 111-1 ,.,.+1 ' A hm '1 -1153.11 .X ' '-A'-' A x Y V 1 ffzlhflf- 'zz 111- ',.'1,,,1, - ,. 1 ,I Quo 'dr 'L1.vv:', 1 -:'v',,1114':,,,1ud, , . 1. 49+ - . ' 11-- use , .gx,y,L!.,. .ga K 6.11 - .1 1 1-.11 - f -y,1 1.--.11- 1-1 '.. 'QQ .11 11,14 1-'31 v 4:1 - 111 , . 10 1 ', S Of' Mv f c .',11 I, x - 1- , -fa A 1 ,111 011: 11 7. , 1, 1 1 41 e.. EMA fi- Z ' 1- - 1 I .1 .11 1 s 4 1Subx3 ,11v:':A,, ,,, wo, an I 1-X 11 19 N11' . Ay N W' X A9631 4' ra 1- 11-X6 X 11,0 ,111-16, X me 1- -R 1., ' --- '11-ffaiff-.2111 -1 ff' .11 -0 .. - A ,,,v'N.,,111M ,- v 1.01 pm f - a .' galmwlmnu , 13,21-v I 1 om, wg, .,. . id '- --'-1, -u'b.,-mkvef. f. 1. 1, 1,-1. wb. 'h'112 ij'-.'gy . ' l - . . 11 , A N., g, 'lgfflsfl bib' T, 2-. '- Pl nh., 551. 'u. 'ff' lr. X 110131 P, F1111 91.1. 1 ,F ... .Q.,, ,.,,gX 1 1.5- . Q-2 -11'-111, mf. 1 11 lf' 1 -11, 4-1 1.1'4 '. ln - 51 b 'wJZ::',, 5911 57 11. 1-1- .1--3 V . .1 -- ', ,.1. ,,,.1 1 yy Tues K9 M 1111ef1'l BY N W . sm Nm Z' - - ' '. snS WWW Z WE. ....fm Y ,,.111 '1 ,111 1-nn ' ,A uw 111121 111 'N ,1 1111-- ,1 I 1 1-----3: 1-Ml 1, .1 .111-111:. 1' 4111114 1 W, 11111: 1 .1 11 - -H-::.....1l1.:' 'H ': 'i:1:1. . su-Y 1 H 1 11. '11.. 1--gf, 1,1.1.1M , 111.-. ln! :N Fun 111111. 11 -11:5 1. .1 1 5 -,, K ' - H ,,.111v.-v 1. 1 , 5, 0, 1,11 1.11.1111 :mn 1, A.. 11, 1 511.11 1- X M ' X' 1211. .1 1.1.1- - '- W 111:1- .11 11 1- c.a.11 rr-- 111 vu -vi-Y'f d .1 ..... 1.1 - , .,.... 1.1 G x nov ll .1 nl K W ,, 4, , ... 11 . ..,... 11 ' ' ' .,1.1.--1 A -11-1 5 w , . 111 ..- '::.:..1,- ,L 211131111 3:c,..,1-:inn , . 1..., . UVM 111, 1 ., .U - -J ?3:fw'1g-::--'--W W - -. - -1 A .11',.1- 1e ' ' -P, 1 11... 111.11 -- V I ,,,..1.11M 1..,,1.1 11 vm-X ,,,,,,.1,.. 1. -V-' ' ...11. 1 ,,..11..., mn .111--- ' ' ,1.1, 1,111.1 -41 5. '1 17, W 71. ,1 6-. ' -.1 , 1 ff 3 Q-J? xx- f -'J , sig?- 1521. :- .f,,3:1I-- - -.. H1-1 ,ff ,.. 92114221 JL ' -'1-AM '1 -- L51 lE6.TXiZ6jg-EJIXB OIXO 1' and Clas,5f5oCie'lTez5 ' W V 1 I I III I J I I IIII Phi Beta Kappa tg ,fggyvfc f 1? 4 23405 if VBJMQ 0 ,4 fgsohwff fn v W5 firm J M '2M,3 -s EP Ag AJR! 6 if 45 'SCE , 13QZg'mf W I1 WT I. we gg' f y W Hf',,,g522' 3445? I 5 I -I 2. I My - I Regents FLORENCE GRISWOLD BUCKSTAFI2 JAMES FRANKLIN TROTTMAN GRANVILLE DUANE JONES CHARLES H. VILAS CHARLES ELMER ALLEN FLORENCE ELIZA ALLEN KATHERINE ALLEN ALBERT WILLIAM ARON F REDA MARIE BACHMANN LELIA BASCOM EDWARD ASAHEL BIRCE WILLARD GROSVENOR BLEYER MARY VAN RENSSELAER BUELL CHARLES HENRY BUNTING HORACE THOMAS BURGESS WILLIAM B. CAIRNS MARIE LOUISE CARNS RUTH WAYLAND CHASE FLORENCE MAUD COERPER GEORGE CARY COMSTOCK MARY CECELIA COMSTOCK PERCY MILLARD DAWSON ROBERT CONRAD DISQUE ROBERT ELKIN NEIL DODGE WILLIAM HENRY DUDLEY RICHARD THEODORE ELY ADOLPHINE BIANCA ERNST CARL RUSSELL FISH GEORGE CONVERSE FISKE ALEXANDER GREEN FITE ALBERT STOWELL FLINT GORDON SCOTT F ULCHER CHARLES JOSIAH GALPIN EDWARD HALL GARDNER LUCY MARIA GAY WILLIAM FREDERIC GIESE JOHN LEWIS GILLIN EUGENE ALLEN GILMORE ALFRED PAUL HAAKE HAROLD COWAN CHEETHAM MILDRED L. FRAZIER MIRIAM LOUISE FRYE THEODORE M. HAMMOND IM6mb6l'S in Faculty KATHERINE HALL WALTER WVILSON HART VIVIAN A. C. HENMON LEE M. HOLLANDER FRANK GAYLORD HUBBARD GRANT MILNOR HYDE LEONARD ROSE INCERSOLL JOSEPH J ASTROXV LOUIS KAHLENBERG WILLIAM JACOB KELLER ALEXANDER KERR JOHN LOUIS KIND EDWARD KREMERS HENRY BURROWES LATHROP CHARLES KENNETH LEITH WILLIAM ELLERY LEONARD CHESTER LLOYD JONES ARTHUR S. LOEVENHART FREDERICK A. MANCHESTER HERMAN XVILLIAM MARCH MAX MASON WALTER J. MEEK CHARLES E. MENDENHALL HARRY LLOYD MILLER BAYARD Q. MORGAN FREDERICK AUSTIN OGG JULIUS EMIL OLSON MAX CHARLES OTTO JOHN B. PARKINSON FREDERIC PAXSON XVILLIAM HAROLD PETERSON ANNIE MARIA PITMAN JAMES FRANCIS PYRE ARMAND J. QUICK FRANK OTIS REED DOROTHY E. REID Class of 1919 Elected as juniors JAMES ARTHUR GOUGH HAROLD MARTIN GROVES GERTRUDE JACOBS IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I HI?EQIIIZKEGEIYEIIPEEYIIIIIIIIIEEISYEIPEIIGHFEIEFII I Page 444 IVIARY EI REID HARRY SANGER RICHARDS FREDERICK ROE EDWIN ROEDDER LOIS K. M. ROSENBERRY HARRY L. RUSSELL FRANCES ELLIS SABIN XVILLIAM AMASA SCOTT GEORGE CLARK SELLERY ELMER LOUIS SEVRINCHAUS FRANK CHAPMAN SHARP GRANT SHOXVERMAN MOSES STEPHEN SLAUGHTER CHARLES S. SLICHTER CHARLES AUGUSTUS SMITH ELIZABETH ANITA SMITH HOWARD LESLIE SMITH HUGH ALLISON SMITH WALTER MCMYNN SMITH SUSAN A, STERLING ASA CURRIER TILTON WILLIAM TOTTINGHAM WVILLIAM TNVENHOFEL EDWARD VAN VLECK RICHARD VAUGHN GEORGE XVACNER OLIVER PATTERSON WATTS NVILLIAM WESTERNIANN FRANK ERNEST WILLIAMS WILLIAM H. WILLIAMS ALEXANDER WINCHELI. MORTON OWEN WITHEY LOUIS XVOLFENSON KARL YOUNG CASINIIR ZDANOWICZ CARL LEMM-MARUGG HELEN B. SMITH MARGARET SPERRY I I II H- ImmImIiimiiiiwimmn InnmInmiInIruiiwumnImInumInIminiIiimuIimmuinmmi mmInnwInmimvInImIIIIummnumiInImIIIIInmiIimmiwummIninmirInmiIIIImmmImIIImimiImIninInuInumInIIIIminiimmiinmiImmiInIIIIinummiumimiinuu miimiwmim IIImnIImIInmimiuiIIIImrInIII.miIiwmiiiiiiiumm IIIniIuiIIIIIIIIIIIWIIIIIIIII I1:IIIIiiwimmiimm Iiiiiiiiimuwiri I I II III. I Irivm min mn InIIInImmnInIIIIIIIIIImIIII.wI.I IwiimiuiiviimiiiuInmiimimmIumumImImInvimIiiiiimiiimniiimm mymyIiiimmmmiiiiiimmmiiiimmmm..IiimmninmiimwnmiiumiminiIumiiiiimmmnIIIIIIIIIIIIIIIIIIIIIII mumnmiInInnInIiiiiimiinnminiiiumiIiiimiiuminmiin InmmmiIInmiimmiInumuiInIInImimunimiiiiuIIIImumIinimmiInmiInvwuniimmiiiui.nw.InmmIu Immnwimwiiinw IInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ImmmiminimumIiiiiiwmimiiim Honorary Engineering Fraternity T B P ' au eta I Brenner Werba MURRAY CHARLES BEEBE EDXVARD BENNETT O1-IN GURNEY CALLAN OBERT CONRAD DISQUE PETER FRANCIS HOPKINS FRANZ AUGUST KARTAK LESLIE E. KELSO LLOYD L. CALL RAY E. BEHRENS DAVID -I. BLATTNER HERBERT GLAETTLI ERWIN C. BRENNER PAUL IWIUNZICKER Blattner Koehler Wise NVOrks Behrens Peters Warren Glaettli Schmidt Ragatz Stern Members in Faculty OTTO LOUIS KOXVALKE JESSE BENJAMIN KOMMERS NVILLIAM SPAULDING KINNE EDWARD ROSE MAURER DANIEL WEBSTER IVIEAD -JOHN ALEXANDER NEWLIN JAMES DAVID PHILLIPS Members in University Graduale 1919 Elected as juniors JAY E, NEWTON LEO J. PETERS, JR. Elected as Seniors WALTER A. KOEI-ILER EMII. F. STERN I 920 Elected as junior ROLAND A. RAOATZ ,- :Urn YU-1 i i- I x .D 4, C Joi-IN REESE PRICE HALSTEN BERFORD THORKELSON LESLIE F. VAN HAGEN CLAYTON NORMAN WARD JAMES WEBSTER WATSON WARREN WEAVER MORTON OWEN WITI-IEY ARL F. HAYDEN ETHAN W. SCHMIDT GLENN B. WARREN EDMUND M. WISE EDWARD O, WERBA LAWRENCE P. WORKS ............................................................................................................... ............... .. .... ............. .............................................................................................. .................................................................................................................................................................................................................................................................... .................................... . .. .... . I IIIHIIHHIlilllvllnlullullulwlilllirlullwlvllxlinIlllllulllilluluvlvlll M 4 'm W ' vmIIIInmiIIIIummmimmnuInuimiIIIiInIIninIIniminImmIIIIIniIIIIII.ImIIIIIIIInInmiInIInIiwimiiimiimiiIImiInIIiimiuiiiumiiiuiiInIIIIIIIIInIIIIInInIInumIIIuiInIrumiInInImuumimiiiimmiriiiiiiiInmmiiiIIInIInImInIIIIIIimimmummIIIIIIIIIIIInImInnmIIimIIniIInImIIIIInII.IIIIIIIIIIninIIimimmumiiiiiiinum 'mimi nIII..wIn mnIIIIIIIIIIIIIIIIIIIIIIIIIIIII WEEE? Page 445 a s a s 32 Honorary Agricultural Fraternity Alp ha Zeta Founded at Ohio State University, 1897 Wisconsin Chapter Babcock, 1905 Number of Chapters, Z4 Wallin Stoltenberg Caldwell Drier Clarke Reid Koehler Wilcox Smith King Anderson llflembers in Faculty HUGO WILLIAM ALBERTZ ALEXANDER SEPTIMUS ALEXANDER STEPHEN MOULTON BAE-COCK GUSTAV BOHSTEDT JOHN WIl.LIAM BRANN DONALD ALAN CALDWELL EDMOND JOSEPH DELWICHE EDWARD HOLYOKE FARRINCTON JAMES GARFIELD FULLER LAWRENCE FREDERICK GRAEER EDWIN BRET HART EDWARD GEORGE HASTINGS GEORGE CALVIN HUMPHREY JOHN AMBROSE JAMES EDWARD RICHARD JONES LEWIS RALPH JONES JAMES GARFIELD MOORE RANSOM A, MOORE! FRANK BARON MORRISON GEORGE BYRON MORTIMER GEORGE FREDERICK POTTER HAXRRY LUMAN RUSSELL l'IUGO H. SOMMER HARRY STEENBOCK HENRY CHARLES TAYLOR EMIL TRUOC RICHARD ENGLISH VAUGHAN JOHN CHARLES W ALKER HARLOW LESLIE WALSTER XVILBERT WALTER WEIR ANDREW ROBINSON WVHITSON OTTO REINHART ZEASMAN JAMES GARFIELD RAILXVARD Nlembers in University Graduate School ELMER M. NELSON ELMER R. CLARK ALLMAN V. DRIER WILLIAM H. E. REID J. ARLINGTON ANDERSON C. HOWARD KING 1919 1920 71 E A MELVIN F. XVAGNER HUGO A. STOLTENBERG FRANKLIN W. XVALLIN ARTHUR N. XVILCOX WALTER B. KOEHLER XVYMAN S. SMITH .. . .IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIM' we II..I.III.IIIIIIIIIIIIIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIII II III: II I II II I II IIIII IIIIIIIIIIIIIIilliiliiiIiilliiliiliiiiiiiiiiiiiliiiiii1Elilii1liIIIIIII I I 'M Page 446 I I I I I I I l I I s Honorary Chemical Fraternity Phi Lamba Upsilon Founded at Illinois, 1899 Wisconsin, Beta, 1902 1' I L.. , I f rf STEPHEN M, BABCOCK HAROLD C. BRADLEY EDWARD B. HART LOUIS KAHLENBERG OTTO L. KOWALKE FRANCIS KRAUSKOPI-R EDWARD KREMERS VICTOR LENHER E. DAVID FAHLEERC CARL F. HAYDEN PHILIP J. HICKEY CLINTON KLEVENGER ALFRED E. KOEI-ILER ERWIN C. BRENNER HAROLD C. CHEETHAM MINC-HENC CHO EVAN P. HELFAER FREDERIC A. HORTON 1 s I C' IS GT fjf Members of Faculty JAMES H. XVALTON, JR. Members in University Graduate 1919 C. N, HATTLEBERG 1920 ROLAND E. RAGATZ I.II..I...I.........i....iI.,I..i..I..I..II.,...i..I P a g e 4 4 7 A. S. LOEVENHART JOHN MONTGOMERY F. B. MORRISON JOHN L. SAMMIS H. A. SCHUETTE E. L. SEVRINGHAUS HARRY STEENBOCK EMIL TRUOG ELMER O. KRAEMER ELMER M. NELSON M. STARR NICHOLS ARMAND J. QUICK HUCO H. SOMMERS PRESLEY D. HOLMES CARL A. HOPPERT IRVIN W. KEEBLER ALLEN SPAFFORD WALDEMAR VELCUTI-I mmmvmwmmmlmlmmummnnmfmmnmummmmmmnummmnnmnmunmmnmmmmunmmnmummmImnvLInIu1IIInnmnnmumnmummnuqfufmmwlnllxllnvmm,nmmmmulnlmnxnggnlqlggETEHHT:nnuxIugMrgmyur!ggQfmgggwwgglwwwrmgnnnuII5553g5M5y31T.vgy3wg5g ,vg5QJQ5wMgvjygggI1ggwgggvjggg1gg2 5 E5-T '..mmmmmmT u1nnnT'lumnmm1I1nwI1.REWEIn-u 'NuI1.In .IfII.1..M',m. '.miREiEmimm..mmn.mmm,mlmmmIf,II11ml.-mmmmmmmmmmmnmmmllmmm- numu1nuIIXIIuIIuI11IIrvII1mmmmmnwmmn1II1mumm.mnn .m.mmummmmmmmmmumInmnmmnmmmmJInmm,.mmmT m..m.mmm..nn,mumumnmnm1II1I1mI1.II1II.1ImmumrumI.mmnII1mnImImlurmmIn1ml1mmmmmumlm.-run.Hung E 255 Honorary FOFCHSICS Fraternity :EE 522 E55 555 555 EEE EEZ 555 1,2 Delta Sigma Rho IW embers in Faculty ALFRED P. I-IAAKE ARNOLD BENNETT I'IALL 4: JAMES O NEILL JAMES F. A. PYRE Members in University JOSEPH B. BEACH LEROY J. BURLINGAME HAROLD GROVES FRANCIS D. HICSON JOHN C. WARNER EEE 3 gummmJ1mlmmyrmnurmKmummmmumvmH.JmymmlnuInmm..rwumm.mmmrInJ.mmU1mmm'1nm-mmummmIn1In,mmnumnnJmU.mm..m1.HW.mmJmrmm1m1InmJufmlInrmmnnm1.Hfmummm..m1mm1umm1.1InyuJH.H.ummmH.mum,HrmmH.vm1Inmm,mm,fmInmmmmum1InmmmmlmmunmlmnmumummmnmmmmmmnmummnIII1H1H1muummmn1nmummummummummmlmummmfnurlmmnEE 5 I ..,...,.....,..--,-.-,...........-........ L... ......,.. .. L.-..-..,-...........,....... ..,.. ........... .,.. -.-L .S..,.. .. ....... - .,..... . ...... -L ..... -.,.- .... ...........,. - .....-.-............-.-..,....- ,,... umm numwmwannuwvmmlmumnuuwunnnmmmmvIn1mmwInumnmummmumwmnmm.mmunmmnumm1mnumummunannu:mmm1nmmmmunmwnnruwuwnumnnunInnnnmum1ummnwnwInwununwImmulunnnmmmunumnumvuu11nuanwInummvuvmmmvuwufwnumannumnumnnwunnumnuummunmuunmII1xI11II1IInuuu1IIn1mnmmmmnmlmmnsmmnmuun1unnumumnumuunvmnummnnumnmmnunummumummnm P a g e 4 4 8 mn-mm-mwmu-.mmmm .....m.u .T .mn u n nm u mmmnmnmmmuunm m n mnmmumuml un In un ' ' l ..n....,... ..L..,,.,,.,,....,,. ........,,.. ......,,. ' ' ' ' Honorary Commerce Fraternity ' Beta Gamma Sigma Vanden Braack Cot frcdson Edwards Pease Edwards Linchan Frochllch Kellogg lvlalzahn Gardner Scott Adams Gilman Elwell l-lag den flflembers in Faculty FAYETTE HERBERT ELWELL STEPHEN XVARREN GILMAN EDWARD HALL GARDNER XVILLIAM AMASA SCOTT Meznbers in University 1919 GORDON DALE ADAMS HENRY LAWRENCE GOTFREDSON JAMES MATTHEW HAYDEN I 920 LEROY EUGENE EDWARDS RAYMOND DELOS EDWARDS RAYMOND FRANCIS LINEHAN WALTER ERNEST lVlALZAHN GAIL VANDEN BRAAK HAROLD LANFROM FROELICH FRED CONWAY l4ELLOC-G HARLOW HEATH PEASE Q A 'i 21 Q, I' T A v 'ii ff? K..W.w..v.-T..W.T.UT..m.mu-ww-NIT mum umu u mul u TnTwmTnmnmummmunTnmTuTTuunmumuuwm Page 449 mmuummIunnnIImIIumIIImIInmIuIIInImnIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII u I unz In n I n n In n n In un nu I ,........,...,.......................,...,.....n......L-..m.... ....:,i......i,?......... ...... u...... . ...H 1 1 ! l....T.... ........ L.. W u ..,.......,.,...... ....... ,. ..... ............. I In I 5gumnnnummnunnxnummmmImImnnumnIuunmmumImuImnnnnmmInIm Honorary Medical FraterniLy Sigma Sigma new xx ,Jn ggy. ,D ff, ,, L. fABWwfm .f t l5?g.,.,B1f Members in Faculty CHARLES R. BARDEEN HAROLD C. BRADLEY CHARLES H. BUNTINC- WALTER J. MEEK WILLIAM S. MILLER F. C. RINKER PAUL F. CLARK JOSEPH S. EVANS J. A, E. EYSTER O. LARSELL ARTHUR S. LOEVENHART G. H. ROBBINS W. SALANT BEN H. SCHLOMOVITZ W. D. STOVALL ROBERT VAN VALZAH Members in University 1919 KARL K. BORSACK WILLIAN1 C. LARKIN WILLARD A. CHIPMAN EDWIN F. SCHNEIDERS JAMES A. GOUGH ELMER L. SEVRINGHAUS GEORGE H. HOYER WILLARD M. SONNENBURG C. J. NVHITE 1920 CLARENCE E. BACH R. KENNETH IRVINE BEN G. BRICKBAUER HERBERT A. RAUBE ERWIN J. HABERLAND ERWIN G. SEYBOLD VERNON J. HITTNER HERBERT B. XVRIGHT A .... . .. ....... ... .... .... ........ ... ..... . . . . .'asIsisInan:zzInIssI:azsasIa:szauazszzsxazvzazszzx ... . . . IIITHFEHE... Page 450 I - .,...,...., x Honorary Electrical Engincvring Fraternity Eta Kappa Nu Founded at Hlirzois, 1905 XWisconsin, Theta, 1910 XVISC Scott Hantzsch Blattner Knoerr Lamont Scigcl MURRAY C. BEEBE EDWARD BENNETT ROBERT C. DISQUE DAVID J. BLATTNER TOWER W. KING JAY E. NEWTON RALPH E. I-IANTZSCI-I ERNEST A. KERLER NVorks Peters Members in Faculiy JAMES W. XVATSON Members in University 1919 LAWRENCE P. XVORKS 1920 ROBERT C. SEICFL .amwwwwv eg .2 X f'.f'WT S ' ,ff WIN R, Q I rgg 'T'L YM Q 5- x 9 Q- 'wp.w..A 1 N67 xxdfxw Q IIIIIIIIIIIIII IIIIIIWIIIIIIIIIIII IInIInInumm-.IIIIII.IIn.IIIInI.III.IIIWWIIIIIIIIIIIII Page 451 Kerlcr Kmg FRANZ A. IQARTAK ERNEST O. A. LANGE JOHN R. PRICE LEO. J. PETERS KENNETH L. SCOTT EDMUND M. WISE RUDOL.PH R. KNOERR DALLAS R. LAMONT IinummmmmmimiimmiimimmmImm -I.. I mmimimimimmiiiimIimmuiimii I II In II Imimnmiiiimiimm W. ----.--A-............-M-.........--.........-...........-................. -..L..,.......... .-.,,- ',,..-...........,..... l' l Honorary journalistic Society Theta Sigma Phi Founded at the University of Washington, 1908 Wisconsin Chapter, Beta, Established 1910 Tener Briggs Kleveri Pine Pettibone Vinjc Collins' Ludlum Robinson Heise Whiteside McDonald Ojfcers ' KATHERINE PAGE WHITESIDE . . . . President I-IESTER ROBINSON . . . . Vice-President ALICE V. PORTERFIELD . . Secretary LOUISE LUDLUM . . . Treasurer LOIS MCDONALD . . Historian ETHEL VINJE . ..... . Keeper of Archives Honorary Members WILLARD GROSVENOR BLEYER MRS. AUBERTINE XVOODARD MOORE EDNA FERBER ELLA WHEELER XVILCOX ZONA GALE l'lONORE WILLSIE Active Members Graduate lVA KETCI-IAM BERNICE KUNEY ' 1919 FLORENCE COLLINS HARRIET PETTIBONE MILDRED EVANS JANE PINE LOUISE LUDLLJM ALICE V. PORTERFIELD LOIS MCDONALD l'lESTER ROBINSON BERTHA OCHSNER KATHERINE PAGE WHITESIDE 1920 ADELINE BRIGGS GARNET KLEVEN FLORA l-IEISE ETHEL VINJE ESTHER VAN WACONER 3 ' 9. 1 -q W : L'm'L l 'i ' 1'l i : ' ' sf'l'i- i'iii'i ' ' ie Page 452 IIIIIII: E E v'z1:11un..... II.,19:I21:I:Il:u:2uI:!::..,.,.,..... ' I --IIIIIII 5-g.......,.. ...II II......II.I.I..II.I. I I I I I I :zIa::I::a:::I::Qgg ess E EEE E . E E : E 5 Honorary journallscnc Fratermty I . 2 Es E E55 EEE Sigma Delta Chi IIIIIIII IIIIIIIIII I S7 E D sn. N Q. Q A U N 'U In s: S CI E C. N 5 2. Z? ,SA xo Q NO III III IIIIII IIIIII IIIIIIII. Wisconsin, Iota, 1911 II Ei: . EIS EIS 52: s I I I Q.. E55 z: EEE sis 'EE Members in Faculty , E WILLARD GROSVENOR BLEYER GRANT MILNOR HYDE WILLIAM ALLISON SUMNER ' Members in University s Graduate If FREDERICK W. INACKAY , 1919 a EDWARD L. DEUSS JOSEPH R. FARRINGTON I WILLIAM E. DRIPS JOHN L. KLUG JOHN R. RAMSEY E 1 920 HAROLD A. GILL LINCOLN A. QUARBERG E BERNARD E. MEYERS OWEN L. SCOTT BERTRAM G, ZILMER 5 E 5 55 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIE 2 K EEffW1'!!E!iL......,.!T1'l!f5T3!1. 3l!T2!'.'. ...... ''!-M...,...e.....,.....L.---..,-,.,.-2..,, , .. .. .. ' M' H U ' :.nIIIIIInIIIIIIIIIIII II I II IIIIII-IIzI-QIIIIIIIIIIIIIIIIIIII II II I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I II II I IIIII I II-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 453 Honorary Economics Fraternity C34rftus Altmeyer Elsom Chu Ferger Hsieh Kiekhofer Ely ,Krueger Perlman Chapter Roll Wisconsin Harvard University of Denver Washington University of St. Louis Honorary Nlembers PROE. JOHN R. COMMONS PROE. RICHARD T. ELY PROP, WILLIAM H. IKIEKHOFER Members in Faculty ARTHUR ALTMEYER LEONARD B. IQRUECER KEATS S. CHU Active Members BERNARDO W. ELSOM XVIRTH F. FERCER HSUEH HAI HSIEH HARN'EY J. XVEISSE K i ftfl 1 k :Q K, A... .... ' L 3 .,,. . V Page 454 ELBERT W. JONES RALPH IQARCER JACOB PERLMAN HAROLD W. REED 1' ' ' ' ' ' ' ' ' ,. ' 1 ' , I II I I II I I I III II I 5 EE EI E I I E Ez I BWIARCUERITE BEATTIE FLORENCE GRAPER BETSEY MADISON . Nf1AE GROENDYIQE . ELIZABETH AMERY CORA BINZEL AGNES BOEING IVIRS. CLARA BURHOP EMMA CONLEY MAE COWLES ELSIE LEONARD MARCUERITE BEATTIE FLORENCE BEATTY RAY COOLEY LAURA FAVILLE Honorary Home Economics Society Qmicron N u , s ,A I '24 5 ,A- , I ' ..6O :LQ 551 Q 1 Eta Chapter 1915 I Ojfcers A46I7'11D6l'S in Faculty President Vice-President Secretary Treasurer JEAN IQRUEGER BETSEY MADISON HAZEL IXXIANNING .ABBY I-. IVIARLATT MRS. NELLE NICHOLS DOROTHY ROBERTS CELESTINE SCHMIT M6mb61'S in Universiziy 1 91 9 ADA VAN STEENEERG FLORENCE GRAPER MAE GROENDYIQE MARGARET HUTTON ELIZABETH SUTHERLAND E 1 IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I F1 II In I II IIII I I II II I II IIII I IIII I IIIIII III I II II IIIIIIIiiiiiiiiimiiiiiiiiiiiiiiiiiIEIIIIIEEEIIEIGIIIIEIIESIIIIIII I I III II I III M IH H Page 455 J 11111111111111111111111 111111111111111111 11111111111111111 11111111111111111111111111111g11g1!111111111111111111111115111111111111111111111 111111 11111111 1 1111111111111111111111111111111111111111111111 1 1111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111uu11111111111111111111 11 1 1111111111111111 111111111111111111111111111111111111111r11111111111111111111111u111m11111111111111111111111111111111u11v 411111111111 111 111111 1111111111111u111111111111111111111111111111111111111111111111111 111 11 111111111111111111111111111111111111111 111 11 11111111111111111111111111111111111111111 11 11111111111111111111111111111111111111111111 11111111111n1111111111111111 1111 1 11 1111111111111111111111111111111111 11111 11 11111111 11:1 1111111 :11111 1111111111111111111 ' Honorary Mechanical Engineering Fraternity Pi Tau Sigma Nelson Larson Corp Berggren Bellaclc Mueller Williams Warren Phillips Schmidt Gaubatz A. E. BERGGREN J. G. CALLAN C. l. CORP Members in Faculty 1V1ember.s in University 1919 WILLARD B. BELLACK EMMET J. IVIUELLER EZTI-IAN W. SCHMIDT 1920 ARTHUR W -GAUBATZ A f515Q1. 1 111111111111111111 1 1111111111 1 1 1 1 1 111 1 11111111111111111 11 11 11111111111111111111111111111111111111111111111111111111111111111 111 1 1111 1 111 1 1 1 1111 11111111111111 1111 1111 1 1 1111 111 11 11 1 111111111111111111111111111111111111111111111111111111111111111111111111111 Page 456 A. L. GODDARD G. L. LARSON I. D. PHILLIPS EMIL F. STERN GLENN B. WVARREN EDWARD B. WVILLIAMS DELMAR W. NELSON f iz ... 4 4-I Q livfhmfyf .Q ,.- , U 5 ' Z , 1, 1 11111 1 111111111111111111111111111111111111111 1111 11 1 111 11 1 11: 11111111111111111111111111111 1111 1 11 1 11 11111111 11 1 1111111 Stern I I I I I Honorary Athletic Society Star and Arrow I If Nlembers in Faculty THOMAS E. JONES MAURIGE A. KENT ERNEST O. LANGE GUY S. LOWMAN CARL P, BAUER CHARLES H. CARPENTER BERNARDO W. ELSOM LUGIUS W. I-IIPIQE STEVENS COULD I'IAROLD KNAPP RONALD W. RAMSEY 1919 1920 JOHN R. RICHARDS FRED E. SGHLATTER .JOSEPH C. STEINAUER GEORGE T. BRESNAHAN HAROLD C. KNAPP ROBERT IVI. SUTTON EDWARD B. WLLIIAMS KING G. WOODWARD ALLEN SPAFFORD GEORGE E. VAN HAGEN FRANK L. W ESTON ANTHONY G. ZULFER 1921 MILLARD M. BARLOW PAUL A. KAYSER RUDOLPH H. BLATTER WILLIAM H. MATCHETTE CLARENCE W. IVICINTOSH IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmIInIIIIIIIIIIIIIIIIIIIIIIII Page 457 I I I n I in I u I mu iiiuimiiiiniiiiwe uiinliiiiliilikl CO. A CO. B CO. C CO. D CO. E Co. F CO. A CO. B sas Honorary Military Fraternity Scabbard and Blade Founded at Wisconsin, 1905 llyiseonsin, Company HA Number of Companies, 17 Living Members, 2,000 Hammond Slaker Rewey Melnherrin Slichter Atkins Creenslacle Tuttle The Brigade First Regiment Wisconsin University lvlissotiri University Minnesota University Pennsylvania State College Cornell University Washington University Iowa University Michigan Agric. College Purdue University Kansas State Agrie. College Illinois University Ohio State University Second Regiment , Iowa State College 'W. Virginia University Arkansas University Maine University if CO. E XVashingtOn State College !V1embers in Faculty MAJORJOHN S. WOODS, U. S. A. VAN L. BOHNSON CAPTAIN THOMAS E. JONES, W. S. Cv. HENRY A. SCHUETTE LIEUT. WILLIAM C. ATKINS, W. S. C. Members in University 1919 MARCUS LULING BAXTER THAYER ZACHARIAH CLAYTON ' IRVINO JONES GREENSLADE TI-IOMAs W. TUTTLE I 1920 LORING THEODORE HAMMOND DON V. SLAIQER 5 JOHN W. MCPHERRIN ALFRED H. TAYLOR ROBERT LIVINGSTON REWEY H. GORDON TAYLOR f 3 .. 'K 1.151 -' JSE fi 5 EiE53iii3EE3EEEliiiiE551iiiiiiEEE?E5Ei5El5EE5i5i..,..,. I I I .I .., Page 458 gummmmlrnmlmm.mmImmImImImInImIIIIIIIIIIIWIIIIIIInIInInummInIIIIIIIIIIIIIIIIIIImunmmrv-IIIIII,mmIm-.II-.ImIm-IIIWIIIIIIIIImm-IInImIInInmm.ImImInfmInImImInnumImmfmnwmlmlr.mmmmm.Imm,ImmImmmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIW'mmmm.mmImmmm.nuIInImInImInI.IIImI-IIIIIIIIIIIIIIIWIInIImmuyInIInmIIIIImInIInnmlmumImIIIIIIIIIIIIIIIIIIIIIIwrnummy-IIIIIIIIIIIIIIIIIIIIIIIIIIIIWIIIIIIIIIIIIIII--.II-IIIIIII-Ig 5 gum..m.m.mm..IIn...mnIm.IIIm...I-I.mmmI.mImI...IIII.-II....mmImI..mmm..I.HWIIIII,IIImuIIn,IIImInIm.IIIII.I.IIImIIIII..Inm..IImmII...I...I..I.Im-.IImIm.IIIm..IImI..I.IIIm..mmI.m.mmm.ImInIIIImlmIIIImI--WMIII.IInIIIII-IIInIm.IIInII..IInInIWImummmInInI-InIIIWI..IIIInIInIInInI.IIInImI.mnmrInImI.IIInmm-IInIIm.IIInInIIm.IIInImIIIIIIIWIIIIIIIIIIIIIIImm-ImIInI..myI..ImmmuummmInImInI..ImIIIII.m..I.IIg 5 555 255 E rg 5 sz EEE E . A E as E 2 5 E E: - :aa an E as Honorary Senior Society EE E: EE :F Ez ass E52 age 'Sz E55 -W EEE E55 355 Iron Cross -n E25 EEE -3 - . 5,5 , I L E5 iii EE EEE LEROY JAMES BURLINGAME CHARLES HAND CARPENTER EDWIN LOUIS DEUSS MILTON PETIT GRISWOLD HAROLD MARTIN GROVES ess EEE P2 E :I- EEE ass ESE EEE 555 EEE E15 EE ass :ig EEE E55 EHEMIIIHI.III.W.,III..,5I5,mm...I,,......II..-..,I.-.......,I......m.......,...II.I..,..I.II..I.IIIm...I..II..,..,...E51.m,I..I..WIIII...I..I..I.......m...,...,..,...W.,....,,..I..,I...,...,,...I..I..I..,..I......I......,.m.II..I.,.....I........,.....f.m...mr..I........I...,..N..I...III.,Im..I...IIm.I....I.I...I,.,..,,..m,..,II.m...,.......I...I.I,........III.I...I.I,...,...................I....I..W.I.m.I....m.Im.,I..I.,H.,In.........,........I...,.,.I........I.....,......,.....I..,II,..,..,...,: gg EIIIIIIIIInImImIunmmmunnummmmmumInnumunInmnunnnxmmInunImunummmnuvmmrumnEiIEiRiIIIiYuImIn?mlIi?EiillmiilmliliiiGiimiiiiiihxununnnInmmInuiuInnmmminuunInImmnumInummImnmummuInmmmnnumummnumuIIIIIIIIIIIEIIIumunmnmnmnmmm:mumuInumuInnumIIIIIInIIIIummIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInumnmmunnunmmmrmnmmlmIuummmmInumnummlmmIIIInrnrnmmmlmumlmnmvms P a g e 4 5 9 vu In I Inu III III: In I In rx iuux II I Inu: nn: Senior Women's Honorary Society Qflfortar Board 3-11 if Mortar Board has a three-fold purpose: the stimulation of scholarship-the furtherance of Interest IH worthy endeavor-and the increase of College activities. The members are senior women elected on the basis of scholarship, womanliness and service. LUCY WALLRICH . MARGARET SCHULTZ ADELAIDE PAINE . MARIE l-IJERMSTAD JEAN PATTERSON VIOLA PLEUSS ALICE PORTERFIELD JULIA Posr SUSAN RAMSAY Ojicers Mein bers mimmm I.III.III..IIw-IIIIIIIIII niInIIIII-IIuiInIInInIInInIuiIuiInInIInIuimmmmuiriii Page 460 . President Vice-president . -Secretary Treasurer VELMA REID LULU SAUL MARGARET SCHULTE l-IELEN B. SMITH CLARA XVILLIAMS :sux H1 I I 1 I1 nu um vu rm umm r rum nw nu unllxmnluvr1rnl1rn1un1lnu1v1un mum: 1 nn Tn: rrw r vu In n Honorary junior Society White Spades 1919 HERBERT M. BAKER CARL P. BAUER CHARLES H. CARPENTER EDWARD L. DEUSS HAROLD M. GROVES ROBERT IVI. SUTTON 1920 JOSEPH B. BEACH J. GEORGE CROWNHART LAURENCE W. HALL H. KENNETH HARLEY CARL A. HOPPERT BERNARD E. MEYERS LINCOLN A. QUARBERG RONALD W. RAMSEY OWEN L. SCOTT WHITNEY N. SEYMOUR ALLEN SPAFFORD ARTHUR R. UPGREN BERTRAM G. ZILMER ANTHONY G. ZULFER iiGiiiiiiliiliiiiimiiliiiiiiiFiiiiiiiiiiiiiiiiiiii Page 461 Sophomore Society Skull and Crescent Chapiers Minnesota Wisconsin 1Ui l9i5 Clark Bunge Farming Bolender Manson Murdock Wakefield Kaiser Waln Wheeler Brircingham Follett Paul Harris Srolre Mmchell Royce Carver Wolf Travers Schaab Smith Pond Fagan Aclive Members 1921 JOSEPH BOLENDER THOMAS BRITTINGHAM GEORGE BUNGE HORACE CARVER BURTON CLARK ' ROBERT FAGAN LOTHROP F OLLETT JAMES HARRIS PAUL KAISER CHARLES MANSON I mlmlmm Iulmmrmmmll IIIIIIurInInInIlIIIInIInluIInInIInInIlmwrmrllrrrml Page 462 XVILLIAM MITCHELL HAROLD IVIURDOCK HAROLD PAUL THOMAS POND HENRY ROYCE KENNETH SCHAAE LEWIS SMITH HERBERT STOLTE CHARLES TRAVERS IQENT W AIQEEIELD In ,l..m..,..w.l l . gig.ml..mm.lw 1 EEE :aa 232 E55 555 225 525 iii E32 is if ggi .4 Sophomore Society Skull and Gresent Sltockey Seloage Beardsley Leaper Scott Lillieh Ivlulhenburg Holbrook Vaughn Craas McDonald Allen IVIacFadden Kinnan Chabdourn Keyser Bronson Clark Smith Purnell Stock Bryan Welles Gregg Brown Zubrocl Stevens Stavrum E Pledges 3 1922 HARRY ALLEN DONALD MARVTN - EDWARD BEARDSLEY ROBERT MCDONALD ' CARL BRONSON CHARLES MUHLENBERG 5 DEXTER BROWN WILLIAM PURNELL RICHARD BRYAN DONALD SCOTT REUBEN CHADBOURNE I-IAROLD SELVAGE JOHN GREGG FRANK SHOCKEY KENNETH GORDON FRED SMITH PAUL HOLBROOK THOMAS STAVRUM ELI.IOT KAISER GEORGE STEVENS 2 ARTHUR KINNAN DONALD STOCK 5 WESLEY LEAPER GLENN VAUGHN JOHN LILLICH I-IORACE WELLER , WILLTAM ZUBROD il? il? TE isa 55? ?lE.T!lflHlU.......l ' L............--..........-..2!5E!!ET!L ..., -,..,,.-,. .... ,.J..,.,- ,,,,v..,,JJL,,,, ...,,, ,,.,,,,,j.,L,.,, JifEHEESEHT!TEE!1T!!TE!!E!!f!!!!!!E-.,..-..-,......E....-..........-.J........-..-l-4-.lvl--A ---------A-M I Page 463 . President J v I I In I I I nr I un :nu unxum I I Sophomore Society Inner Gate Florea Fairfield Mclmosh Brindley Chamberlain Comey Grace Miller Pauly Pinkerton Gray Reps Schramm Elder Y Dorries Paddock Siebert North Goesslmg Ojicers JOHN W. BRINDLEY HOWARD R. GRACE JOSHUA G. ELDER D. VAN PINKERTON Members -sophomores JOSEPH CHAMBERLAIN FRANK A. COMEY WILLIAM B. DAYTON CHARLES W. DORRIES GORDON G. FAIRFIELD WILLIAM B. FLOREA FRANK W. GRAY W. WILLIAM GOESSLING RAYMOND F. LAMMERT LAWRENCE BARNETT JAMES R. BEMIS JAMES R. CALDWELL COLEMAN CLAGUE HUMPHREY DESMOND ARTHUR N. DONELLON WILLIAM B. ELLIS STEPHEN L. FALETTI DELOS HARRINGTON WILLIAM HIECKE DONALD M. KASTLER Freshmen 'K . 1 .RI A In I I lliiilililiEliiiiiEiiliiiliiliiiiiiiiiiiillilllliiilhl Page 464 Vice-Presidenl . Secretary Treasurer CLARENCE MCINTOSH ALLEN H. MILLER LUDLOW F. NORTH JOHN M. PADDCCK JOHN O. PAULY DONALD REPS FRANK H. SCHRAMM TAYLOR H. SEEBER CHARLES W. WINSTON ARTHUR KNOCKE DAVID J. MAHONEY BERNARD MAUTZ STERLING PETERSON ROBERT PIERCE DAVID T. ROBERTS HARRY SCHXVENKER GEORGE STOLLEY JOHN W. THOMPSON ARTHUR WATSON PAUL WRIGHT g.,.,..I......., HIAIINIAVIV INT. .H T E E EEE EYE E25 EE gfg Els EES ESS I I I s I EE :gs E I I E 15 EE si I E I E E S E 5..niiiHFFiE I I u uv war mr I I u r I III vu mum uv I I ru QfN4y5Zic Circle Nunn, .A Officers ADA KROENING . , President RUTH STORMS . Vice-President BERTHA BLAUL . . Treasurer Members 1919 LUCILE BIEBERMAN LAURETTA CONKLIN MARION BOYCE DOROTHY GRACE LILLIAN CLARK CATHERINE MUNSON MABEL SMITH 1920 JANET BUTLER MARY ELLA FERGUSON FLORENCE F INNERUD ADA KROENING 1921 BERTHA BLAUL FRANCES RYAN MAR JORY DONALDSON ,JULIA HANKS DOROTHY HOLLANDS HELEN MCCARTHY -JOSEPHINE BLISS- EDWINA DEXTER MARION DOWNING ELLEN GOULD KATHERINE SCHMEDEMAN GRETCHEN SCHWEIZER DOROTHY SEATON RUTH STORMS 1 922 MARY MCLEAN KATHERINE MYERS FLORENCE SCHROEOER ELIZABETH SNIDER ELLA HULL ALMA STRAIGHT EVELYN LEE ANNA VAN ARSDALE 'T' 1 ' I :seanaffIEfffaffffiaszaazszniaxzfififfffiifiEfiffifixansz I I 1 Page 465 fpan-Hellenic Association Pan-I-Iellenic Association was organized to maintain sorority life and inter-sorority relations on a high plane, and to be a forum for the discussion of questions interesting to the College and fraternity world. First Semester CORA MAUTZ . DOROTHY GRACE . JEANNETTE LAMB . LUCILLE EVERETT , Seniors FREDRICA ATWOOD CATHERINE MUNsoN I-IILDA KIECKHEFER ELEANOR DANA DOROTHY GRACE . JEANNETTE LAMB . RUTH BALL . . LUCILLE EVERETT . VIRGINIA TENER GENEVIEVE GOUCH CORA MAUTZ . RAY COOLEY . IRENE FOLCKEMER . NINA MANN . Officers President . . Vice President . Secretary . Treasurer . Mem bers Delta Gamma . . . Kappa Kappa Gamma Alpha Chi Omega Gamma Phi Beta . Pi Beta Phi . Alpha Phi . Chi Omega . . Delta Delta Delta Alpha Xi Delta . Alpha Gamma Delta . Kappa Alpha Theta . Achoth .... Alpha Omicron Pi Delta Zeta . . . miinmummmiInimI.III.m-immvlmmm. inIIunmmImm.m..iIninu.mmm.m.w.i. Page 466 Second Semester . DOROTHY GRACE . J EANNETTE LAMB . RUTH JOHNSON . RUTH BALL juniors ADA KROENING lVlABEL SMITH LOUISE SAMMONS HELEN I-IUBBLE I-IAZEL WRIGHT GERTRUDE KING RUTH RUGGLES RUTH JOHNSON DOROTHY JONES DOROTHY SHURTLEFF ADELIN BRIGGS VERNA TUCKER MARION MCCAEE GoLDEs KISCHEI. f l'bj-QIWXHTGS I I IIII I III I II I II II I I Inu IIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I CPM Delta Theta Founded at Miami University, 1848 Wisconsin, Wisconsin Alpha, 1857 Number of Chapters, 85 Grubb Bell Harvey Evans McIntosh Gesser Chapman Moroney Huszagh Clafiin Umbreit Donnellan Carpenter Duncan Boeing P. Wright Paddock Sweeney Webster Wakeman B. Buckmaster Maurer Deysenroch Schwencker Kucheman D. Buckmaster Geiger Moody H. Wright Pradt ARNOLD BENNETT HALL GUSTUS LUDWIG LARSON HARRISON EVANS DEAN ALBERT BUCKMASTER LAURENCE BRINKMAN CHAPMAN LOUIS JAMES HAYES EARL EUGENE CARPENTER CARL FREDERICK DEYSENROTH MYRON GEORGE DUNCAN WILLIAM GREGORY LOUIS FARNUM BELL A PAUL JOHN BOEING Members in Faculty EDWARD ROSE MAURER FLETCHER ANDREW PARKER Members in University 1919 1920 NORMAN ALBERT KUCHEMAN EDWARD LEONORD MORAN HERBERT COLE SHERMAN HERBERT BEACH WRIGHT 1921 EVERETT LORRAINE GRUBB LYLE CLIFFORD HARVEY LYMAN PEYTON HUSZAGH 1922 GEORGE GEIGER BRUCE MACNEILL BUCKMASTER JOHN GESSER PAUL CUDDEBACK CLAFLIN II IIII II I I ,I , E 5 Sw . ., es? I - 9' i 'T A4 5' Page 468 WVILLIAM DAVISON STOVALL WILLIAM LINN WESTERMAN EUGENE DICKENS MAURER CHARLES VICTOR SWEENEY HAROLD BEECHER TAYLOR ARTHUR GOODHUE WAKEMAN JOHN MUNGER PADDOCK ALAN EMMONS PRADT JAMES MILTON SCHNVENTKER CLARENCE WILLIAM MCINTO SH ARTHUR NEWMAN DONNELLAN FREDERIC ALAN MOODY GEORGE MACKENZIE UMBREIT CHARLES LORING WVEBSTER PAUL ARTHUR WVRIGHT n IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I II IIII 515 --A 552 21: -M:355335515551555tg3gg:35mygg1551gf5gg5555553153555gglmmmmlmggMymglm155My555mm55535555M5155mm!I5mrugwun3ggtyQ555:11intn:wanInm3lyqlwnufulwunvmuwInwrywuwmfumyfyInwufw11win1IHfumuuNmMvmInwuwm1u1XHwvumHInul1Inwu1vuwu1u1mnynwI.uvu1nvvuwnvumuwm1vunl1mNInulumm1n1mnuX1Hmmum1H1m1vuXH1mvmmm11InH1XnXWWWV..1mvmmlm1.fuInm1m1VHnuulumm1H11H1Wmummmvmmmuwmg g - 9wuwmwInwufwInwu1nwwmfnww-1wInfuwInmunwuwmwfmuwinwInruwmwInwuwnlWannlmuanvuvuwruwInumnruwurnuwmyfumvm1nyfunu1InInw111mwInm1nunwfuw-.1w.1wmwnwuwwwmwIn1mul1m1u1fnyn11u1anm1In1uW1u1InWnwnlwuwwHwrnnl1nnummmlmmmuwlmmmlmmfninmmumummlmHwWwIH1m1H1fuXWrmm1mwinni1nhl1XmdhwI11In1nl1.liinuni1I,INA,iiUlm1IliEin1Q51'iiHH?yiw1Ei1iiihiuGil11yi55.4HH151wlilN,ll1MF.11m1m1nluluin1inm1inm.ummuwW Q 3 E :EE 5-5 E 'IE :fi 215 :za 'W W- E55 EE sag gk, . f , as :sz ESE Ei? gf? sf: 4: EEE E22 Egg :Ez EE EE. ,.,- Ei. .., EE Zi, ,,, :ge :zz 5, .., 55 515 555 EEE E55 EEE EEE E55 2' ,,, gs gxs age :gs :ag 155 Ska W ' ss, v ,. p A- I I: :sg as fl: EE V 552 :E 5.2 SE 5'- .UmnunuInunumInvuruummrnummvuunumuwnuunnuununmummnnummmvunmmnnumunnuvmmmunnmwnunvumm:wnurnunnulunurunurmnwnnummmnuunnumumnnununmunwmmruwuwrvrwmmwnuwnummunrnwnuinummmnunnumunnnnunununuuunnumnummmwmunmunwvunumwuunwnummumnununuvumumuvumm:usunummuwuwannvwmnumvmnumvuun:mmwanuunuvmuwummummmnumunmvmwmmmmnnmuAuunmuunnmmunm Page 469 1 252 m. L I I V1 CBQIEQ Theta Pi Founded at Miami University, 1839 Wfisconsin, Alpha Pi, 1873 Number of Chapters, 80 Schwenker Loomis Meelc Brindley Beckman IVIanSOrI Salvage Blatter Mackay , Caldwell Florea Brader Harley Woodward Goerlitz Farrington McKinley Coxon Waite Stavrum ' Osborn Avery Feltzman Sutton Schaab La FOll'ette CHARLES HENRY BUNTING JOHN ENGLISH EYSTER GORDON SCOTT FULCHER WVILLIAM ELLERY LEONARD JOSEPH RIDER FARRINGTON PHILIP FOX CARL LA FOLLETTE NORMAN KIRK AVERY FREDERIC OMAR GOERLITZ RUDOLPH HANS BLATTER JOHN WVEBSTER BRINDLEY FREDERIC WILLIAM BECKMAN ERWIN WALTER BLATTER JAMES LYMAN BRADER JAMES RALSTON CALDWELL MARION EUGENE CLARK, JR. Nfembers in Faculty FREDERICK AUSTIN OGG JAMES FRANCIS AUGUSTINE PYRE J OHN RICHARDS Alembers in University 1919 WILLIAM JAMES MCCOY GEORGE BRITTON MCKINLEY 1920 HERMAN KENNETH HARLEY' 1921 WVILLIAM BOWMAN FLOREA GUNNAR GUNDERSEN 1922 THOMAS TOURMEAU COXON CARL HOWARD FELTMAN WILLIAM ALEXANDER FIELD, PORTER LANVRENCE LOOMIS , ,?S,w1e:,,:k: 1 Bon f- IIUJX InIm..II.I...II..I,..wII..I.,I...I..m,I..II.4I... ..,.,.I..II..,I.w..W.III..I,..I,.I..,.,w.I..m.I P a g e 4 7 0 ERNEST BROWN SKINNER GILBERT SMITH HOWARD LESLIE SMITH LEONARD SEWELL SMITH ROBERT IVIAGE SUTTON IQINC GRIER WVOODWARD HAROLD CLARK KNAPP RALPH SUTHERLAND MACKAH' WVILLIAM KENNETH SCHAAB PHILIP CLAWSON XVAITE LOUIS FRANK IVIEEK CHANDLER OSEORN HARRY RAPHAEL SCHXVENKER HAROLD TAYLOR SELVAGE THOMAS LOWEL STAVRUM E mmmnummnInummwmy-munnnunUmmnulmInmymummwmmmvwmvuummIn1nwwnwN1wminmummvuwulwInwnwu1mumInmwu11nwInwnwHwulumInW1In1H1mw-IwInuwInmin1Hwwuwfuwnwmmvmfuwn1ruwn1wnwInulNIHmfnmUfuuwmwufu-1mwHwrnummfn1HwruwmX-1Xvuumnwmwuuw-IwInfuufnummm1nuH11InXwmvmIn1nmmwmmuwmfunlwm11.umuInuvmumrHu-4wm1InwuuVHumm1u1muuwmunumHmulwIn1mmXmumyuwvuwInXmmnmuumnmnmi 51 EKE EEE E22 EEE E52 EE iss E32 EEE EE? Ifmmwmu1ulnnwu1inmuunInwmW.I1wInuvuwInInfmmlinwInmumuwlmInWInIn1nvmumInIn1Inrn1H4in1mmHwInpuwinwuWnl1Inmuwmm11.1InIn1uW,I1N.wHI11WwIn1I.1In1.1wU1H.mm.H1.I11.11H11H4yn1mmX-.41.1ufvmH-H-1--11mH-11.1H.W.Innv,H4W1mH.N.HH.H.Hmnumw1.1XHXmmuInIn1H1m,U1m1.NnwmH-1..1H.,H.X1.NmU.mu.M11.1vmInXH4WvmwH-1.I1H.1.Hmmwmm.w.wmm-lmmm.. .U..K..Wm1..,,M,..,K.,m,H4.H1..1,.1lmH,.HYWWW.1V..,..U..U.,...,I..IH,..,.Hy..,...,UM..H.,W.,V..,.H,..,U.H.,K.,,.UK.,,y.,,W.H...M,I.....I...N.,W,.H,.m.....5w,wm, 2.11.55GUTEEYZIFIRIKEIIIRFIEEHfbLE?EIRIIGRIEEZEYIIHEIIIIZEIQIEEERiiiHIGH?QIRIIIEEIRIJLIIHIREM:HEIEiEiiii?HIRE!FHRISREIEIMETEREIIIIGIRP31151EINIREIUQI?EMISFEKQGEIQPIKREIIiiiMIGiii?GilERIEliiiiiiiiilFIUIGEII-1umm-fmnmmHmm?EhIniumv1I.1InHmXmmmnmmwn1InmunmymInvmmmm11.1lmInH.mnnmummul1.HInwu1fu1vuN.ummummmwwu A Page 471 m..mwummwn.K 1 H um., m 1In1Inmm-mm-1.mwmfm1Inmmmmllmlmmg : . 1fl.1Innumumumwmnunumlumlvmummmm-mm mmwnumnnummmnumvmuvfuwfmmmnumunmmw:mmminnuwnwInminwnuunmwm1nunmmwmmuumuuuuvvumynmmnunuwmmul1mvmInmvu1munnfmnunuInInnl1InwnuluInmnl1mmunfInwummmmmlwwK -IIIA Mmm, -NIA A ..l.,, -,...!,,.,,,, Ahlll ,4,,.,,.. ,,,. I ,,,,,,,4 4 , I ,..4,,,. W , . . ,..,,, ,,.,,., ,..,. ,-,..,.,..-..,,.,,..,.... N ' ''H' ' 4 - 1m.H1vmI.Wmmmn.m.m.v 1 mmnnmm. H umm mn H I nunmmnnumnwmnnuv I I ur In rm u I nu n I I I In In Thi Kappa Psi Founded at Washington and jejerson College, 1852 Wisconsin, Wisconsin Alpha, 1875 Number of Chapters, 46 Lewis Hathaway Wellauer L. McCabe Bunge C. McCabe Burgess Shockey Miller Gutcnkunst Barney Canoe Holcomb Maedje May Bayer Weeks Nott Harding Smith Bussey Brandt Member's in Faculty PERCY IVIILLARD DAWSON ARTHUR SPERRY PEARSE Members in University Graduate LESTER MILLER OLIVER DOUGLAS XVEEKS 1919 CARLYLE WILLIAM BURGESS RAYMOND OSCAR HARDINC JOHN WEBB CANCE CARL WALDENIAR IVIAEDJE JOHN FRANCIS TILLEMAN 1920 LESTER FOLLETT IVICCABE CURTIS BENEDICT MORSELL HENRY CONRAD XVELLAUER 1921 TYLER DAVIS BARNEY CHARLES ALBERT CUTENKUNST GEORGE CHRISTIAN BUNGE WILLIAM LEON MAY WILLIAM LEE DOOLAN CHARLES DNVIGHT MCCABE PHILLIP WASIJBURN NVARNER 1922 I-IORACE IXAACDONALD BAYER CHARLES EDXVARD I-IOLCOMB GEORGE SEMLOW BRANDT ROBERT CREGO LEXVIS FRED NEWTON BUSSEY WALLACE COUET NOTT CHARLES THOMAS HATPIAWAY FRANKLIN PERRY SHOCKEY FRED GUND SMITH Xin., EiEEE2552EiiiiiiiiiiiiiiiiiiiEiiiifiiiiiiiiiifii I P a g e 4 7 2 gunnmmmuummummnnmumIIIvvvummnmmummmInummmummmunnunnummmnuum , ...r.nm,,......-............,..... munlnmmummunmumlnmlnnlmnumumnumnumunuvunnnunvuunrn1ummllmnvuxluuulmI M Mmm- mlm-whim --I M l'vI M KI1unnygxmrII1xnmunnmnmunuuunumunnuvnumnnmmummmummmuwvmIIn -my ummmmlmmumm.1m.mnl.m.-mlnmllmmm.-Imnmmmmmm.H.yuK1mnm.w.m-umm..ul K.. ' ' W kk.M-, WWW -,l- R .,A.--v.4.-, mu ,.A.---,N,.4, 3-whuwwf!.....1.555,,q.,.y.y.yfmulrmfmmmm..ummmWummnnmmm-mumfmmm.mmnyXInXInrwmmfH..mmlW.unrmnummm.....u.m..ummr 3 , L 1 H... ,H...W...,,,..m,........,K.,.....,..u.,.......n..,......mm...M,WK..,.....uu....,,....mm...m..H.,....u,.,...,IM......,.......M,,........,,...WH.,,..,,..,..,..,,.,H..,..,,....,,...,,..,H,...1...,..,..n...am.,Ln,mam,nnma1m::mLras:415:m559:J::59az2:mi:1:zn2:111:sn:155:::JLaz1:n:::::s::::::m11::::::z:ramm::x::::i::m:i1::amm 3 S : 5,5 ' 5 -E , Sie 2 EE ' 5:2 3 E 3 1 S E Q EE b 5 if? 5 5 323 E 512 5 SE f 5 EE I 2 gm f 5 EE 3 E25 , 5 EE X 2 :za ' 5 EE , 5 E Eg? I E55 'I 55 :i 215 E5 ss: fl E55 2: 5:5 E: ii? ii i 2 :EE ff EilgmmummmmmvwmmwmlmmnuInmmHmmmmmmuumun , I I H mn v4'vI'vlIlyvI'II mm IVIV M Vllllllli H i 1-1mIn1myInmummmInulmnumymmmm-mmwmwmmInWfmm1InInvumm-ummmmlmmm1.I1HWfnnnH.imul1Inm11.1myHu11mu1-1nl1ynmmmm..mu-mumXInmXInyu1InInH-1InrmmwHum1.mnmlmnn..mn-.ulmlxun Emuunnmununummummwnumruummmummnnumuwmmvunumununuummvmnn ' ' ' ' ' InunInlmInmw..m.mmnm n umuunwmmmumnuInmmmmuummmmmnunuynmnummmmmmmanInvuummmunmmnwmmmmrnummmmwInm1vuvmiiimuliinuimyuwElinwiiwii?wifillyuviEMNiihiiiiiFhivilliiiliiihliiiiihh511151151iFiihiHiiyin?iiFv1vMFZIIHEUIEI Page 473 ,vii,,Hsizm.ms:H,m:.m..,....W.,.W........mm,.H,.,....,.,U.,H...H.,.U.,,.HI..,,.,....H.H..,...,,..,.,....,..,.,,,................,E I I I I I I G 111 PS1 Founded at Union College, 1841 Wisconsin, Alpha lota, 1878 Number of Chapters, 19 Kayser Petersen Kinnarx Pabst Gehrand Schroeder Knocke I-Iirsheimer Scott lBrittingham Ivlayhew Lyman Thomas Higbie Ramsey Spafford Isaacs Swan Wright Mautz Goessling Philipp Comcy Ramsay Dougherty Halline Slichtcr O'Shea MURRAY CHARLES BEEBE ROBERT DRAKE FITZGERALD THOMAS BEVERLY CALDWELL EDWARD PAUL HALLINE HERMAN FRED HEEP THOMAS EVANS BRITTINGHAM EGBERT BIRD BUNDY JOSEPH ARTHUR COLEMAN FRANK AUBREY COMEY JAMES KENNETH DOUGHERTY LEANDER WOOD FERGUSON WILLIAM BRADFORD FREER ROBERT RANSOM GEHRAND ARTHUR HOUSTON KINNAN Members in Faculty EUGENE HUGH BYRNE FRANK GAYLORD HUBBARD Members in University 1919 1920 HENRY GARCIA ISAACS CYRUS LUCIUS PHILIPP RONALD WEST RAMSEY 1921 WILBUR WILLIAM GOESSLINS EARL SPENCER HIRSHEIMER PAUL ADOLPH KAYSER 1922 ARTHUR EDMORE KNOCKE BERNHARD MEYER MAUTZ ANSON BOSTWICK IVIAYHEW FREDERICK AUGUST PABST RALPH ERNST PETERSEN '- if-ev V: ,i w ,L -Sw . -49 ' EEEGIKIIIQIIFilSWIGIEFFIIIIIKEQIIEIIZEZI Page 474 CHARLES FOSTER SMITH NATHAN BRADLEY HIGBIE JOHN EDWARD SCHROEDER ALLEN SPAFFORD ROBERT IQEVIL THOMAS GEORGE CLEMENT LYMAN STANLEY DANIEL O'SHEA GEORGE DEXVEY SNVAN SAMUEL CLOUGH XVRIGHT XVALTER PUCKETT 'J WAYNE RAMSAY - DOUGLAS I-IOWES SAUNDERS DONALD JAMES SCOTT DONALD CHARLES SLICHTER I III II II II I IIIIIIIIIIIIIIIIIIIIIIII III II I IIIII-IIIIIIIIIIIIIIIIIIIIIIIIII I III II II III IIIIMEI III II III III II I IIIIIII I II III .-.,......x....l.,..,W,...,..,,..,....m..,,. .....,. ..,...,,..H.,U.W.,...,..,...,......,.,..,.., ,.... .,...,um..,...,..,...,,.,,..., ..,.. ..,..,...,.,, ,..., ,,H,,.,,.H,..u.,..........,,..,, .,L. .W ..,i ..,m,.....4 ,.... ..,..,...,..4,,.....,,., ,.... .H ..,,.1,. .W.W,mm.,.,..,,..,..........,l.,...,,,,.....,......,. ,,., ,,.,,...,..H.,.....,,. ,,., W., ,..,. ,.U..,....,...,. ,..,, , ..,.., ,.1,..,..,,,.,,......,.. .,.. , ...., .w.,,.,.,..,...,..,. .,.. ...Hw..,,..w.,.WH.,,.H.m...,.n..,,.,,,.1,..,,..,.,.,...m..,..,.W.,...,.......K...,...,.....,,...,..,,..,...,m.,.,Z 2:mam:mmnnamamamanmamnnaqnmanzzmamsxaanafzaaanmnaammnmmaaaam,...x.aW.,,.,,......,..,,..,.H,...,.,....,..,,..,..,,..,,.,...,,.,,..,...,...,.,,,.....,,.,,..,,.,Y,.,,.,,.H....,..,.H...,,.,..,,...,..,,..,...,,.,..,,.,,,..,..,...1,..U..,.,H...,..H,,...,.,,,....A.....,,..,...,...............,.................H.,A,..,......,......,,..,..,.....,,..,.W....,.,.,.,,.....,H...,,..n...,,..,,...,.,W.,.,....,...W,..,,..,K.....,......,.,..H..,:.,..,...4,...,.a.,:.:a.mains..n...aszszzmza:n:...mm::rr-4...ggg E E 2 E 5 E EEE E 2 E EE 5.1 5,5 E22 Ei? Epi 515 225 EIS as XE gig 555 E35 5 :iz 21: , E5 EF S25 : : as EEE Eze JE E-E :fs M: 222 -F ... :is - 1 2,2 E45 E25 -.: za: :ig zz: 5,5 gag EEE ESE . , -,. 522 sis 552 ESE :si as Exe ggi Ex 52 25: iss iii ia ES SEE 25 EE za E5 iii sis 2: if E? --- -1 H' 'E E . iii 5 E! E E ax za. I 55nnlummInummmmunrmmmmmumwnumummmnmmnmnu nf m n wn H mm Immumm1ulummruin1vu1uwInInulwInummmInnuInwmmwwmuwIninummufmulun1nmlmm1inwuummuuwuvulummInunluuvinnnmunuminummInnvHuy'lmupmwfgumlfMy ,Eur ' 2 I mwn1InulwuWmwmmm:wmmmmwm,mmmvmnumnumm1ummmumunmmmnmuummmmunvuwmummmmunnmuummmum ,,.,,,,.,,,.,,,,,,..,,,.,,.,.,.,.., ..,.,,.,,.,, . M ,,4,,,,,,,.,., , , , ..........,..,............. ,,.-.... ...... -M ...,.. ,........- .,.......,.... .. ....... .n......-....,,......,...........-,...... Ei.. ........... ...........,,, ..,.,, ......., .,..... ,......,.. .... -,-..............,...,. .,...n. ,. u.... ,.., ..,.. . ....... . ...... . .....,...... ,. ....,... .,..,, , ..,...,.. , .,,.... M .... ..... . ...........,.. , ..,,.,,.. . .... ,. ....,.... .M .....,......,,... .,....,,.....,.......... . .,....,..,...... I .... .,.. .I H HXmmWmmWmHmmlmmlmmH,,mm,N,HHmm,mm,,,,,,,,,4,,,,,,,,,,,,,,,,,,,,H,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, fmmmmwwmInununwuwmvumwwnwmulnmmmummmmnnwulw11wnummH'mumwnumvuumWnlmuInmnlmlwInmnlwm1I-4m1.11nuuwmwmmwInmwuXufmymmyuHnwnwfumummInmwnwmwnwIHul1inmyu1InulXfumwInulinunnw1I.wfum1mXwuuInfnyn1wHnlmmlmmlmm.1numumwmmm IInwmmmwnmmmmw Page 475 El? E-E EE EE if 5 5 E15 :iz :sg 1 age axe QE E :I II I I III: I L Sigma Chi Founded at Miami University, 1855 Wisconsin, Alpha Lambda, 1884 Number of Chapters, 74 Mlller Bronson Holbrook Desmond Logic Tuttle Barr Paul Hemsing Foumcss Harris Stuhler Bemis Jones Iviayer Pauly Members in Faculty ALEXANDER FITE CARL WEBSTER COULD CHARLES SUMNER SLICHTER Members in University 1920 WALLACE ANDREE BARR JAMES FONTLEROY HEMSING WALTER HOWARD GAUSEWITZ CHARLES HENRY JONES FREDERICK STUART STUHLER 1921 EARL EDWARD FOURNESS ALLEN HOLLIS MILLER JOHN RADEL HARRIS HAROLD HENRY PAUL JAMES IVIILNER LOGIE JOHN OTTO PAULY CHESTER JUSTIN MAYER REISS GEORGE STUHLER 1922 JAMES ROSEBOROUGH BEMIS CARL EVANS BRONSON EDWARD BROWNE HUMPHREY EARL DESMOND ,S f A , IInInInvIIIIIImImIIIIIIIIIIIIIIIIIIIIIIII I. IEliiiIiiIIIEiihuMidi!IEHFZSREEEZIEEZTI Page 476 JOSEPH CARLETON HOLBROOIQ ROBERT STEVENS HARRY SUM SWEENEY KARL ROGERS TUTTLE gmnmnmummlumummvmmmmnumumummmmummm1myummmvumnmm-wwmmmmunmmmfufuummmumnguqlwnnnmmfX'mmWmmyrmmWmummlWWInyumlwlumy-uWInWmmmlmw-mmH1H.11HlmufXInmXMun1InuvvmXIn1.Hm1mummV..M.lmfmV..ummmyWWmiH.XH.X.HmXH.X.Hrmnu.HW1nu.HvmlmH.w.HuwyuummmununnlrmummwwrwmrmnlummU11--IW11InvmW1Wmfummmmnynnfummug agglmwmmumummInfmwInummmnumWw.mm.m.Hmymm.Xmm.1.mm-.mmum..KmmmU..mumm'ummmmummmnmmm--1ummInnn1.IunnuunlmmHHyuV..Hmmu.Umml.HXH.H..numXm1mm1mXmInXV..muInnlw.Hyu.w.H.HruwW.mmwufH.XH1mlnumX-1.41.XmWV..rmInNmfmmW,IHIn1I-XvmWN1.4WH1W1.U1-..W1.4--.X1mWW4m.mmmmm..4fmW.mmlmmmmmm.vmmXummmmfynXmyInI..XinXmmlH.XH.Umumlmmf- .mu..mm3gg 555 525 555 .- FE SE ,, Egg aii :ss 555 SEE 555 ii! 512 gag U SSE E52 ees ggi egg EP? EEE 255 525 EEE iss 555 E55 S55 E55 EES gag ai: 555 5:5 fig 255 ..s -,: 355 iii :gs ... fee --- sag Ei? 555 E., .12 3,7 ... Q., Y, E: 1 5-E iii ,, E35 ,, 1 HE E 1 EEE E in as , in gs: EE E55 gs :si EEE M 5 4 1 5 : 3 5 5 5 2 5 55:3:MMREmmmlm:EwaEmlm55:umlmwlllliHMBEHnumymmmgWInInwuwmwInInvuwruwInynnnWrmyn1umwIn1mmm1rn1uvmmrmm1mInm1,UmyInmWmnuInIn1ynIHwInInmyuvfmInummnvmnumInnnnuInummmnumwunnuluIn1vu1Hnnm1VHXInInunm1mmvnlnl1mulwuf1Inmnum1Inm1vumum-mmumm.fn.11um1InmmmmmH4mfmlmmmrwnuu-mmmHmuIn1ummmnmHmynummyun-mwnmm-mmm-mm 3 .qummumnnuunnurmunnnunnuumAumumvuumu1mnuvmvummuInrnnuununnuwInruwIumummnunununwvunnnunumannuvuwuwrunuwwnunuunzuwruwnnuunwuvwuwuwmunnuvuwnumnuunwmnvwmunwanulmmunvunmyrmmmuuunumnumunwnnnnuumnurunuun1luvu1ru1nummunxmunLu1nwruumu1mummunuwnunnununumwanruunInumnuInumnnnnunnnuInunannuummmm1mnmnumluun1uuvuunrumvmmnunuumnnuumnmummmmmmaf Page 477, I I n I I I I I I II I I III: III II Delta Upsilon Founded at Williams College, 1834 Wisconsin, Wisconsin, 1885 Number of Chapters, 48 Daugherty Vanden Braak Lammcrs L. Hipke Gavcney Evans G- Hipke Nason Morris Delaney LaHin MacFadden Karas ROIQCIHUS'-l Y Balch Ryan Brossard Lintig Warren Cherry in Members in Faculty CHARLES ELMER ALLEN WILLARDEGROSVENOR BLEYER HAROLD CORNELIUS BRADLEY WILI.IAM CAIRNS WAYLAND JOHNSON CHASE GEORGE CONVERSE FISKE BENJA CHARLES GALWEY EDWARD HALL GARDNER EDWARD KREMERS FRANK OTIS REED GEORGE CLARK SELLERY WVALTER MCMYNN SMITH MIN WVARNER SNOW Nlembers in University 1919 EUGENE EDWARD BROSSARD HAROLD LAWRENCE HOLTZ XVILLIAM FRANCIS DELANEY LAWRENCE VICTOR LITTIG STANLEICH KEYES GAVENEY FRANK ADELBERT MC COY LUCIUS WARRINGTON HIPKE LELAND WILLIAM SPICKARD GAIL VANDEN BRAAK 1920 EDWARD THOMPSON EVANS GILBERT JACOB HIPKE 1921 WILMARTH ICI-IES GAYLORD ROBERTS ADRIAN LUCIUS LAMMERS WVILLOTT MARCUS WV.-XRREN 1922 HAROLD MCEARLAND BALCH JOHN MONTGOMERY LAFLIN JAMES CROWELL CHERRY ROBYN IQIMBALL IVIACFADDEN ROBERT LANCIL DAUGHERTY DALE MERRICK LELAND LEWIS KARAS CHARLES WVILLIAM MORRIS, JR. WILLIAM RICHARD IQELLETT CHARLES SEYMOUR NASON RAYMOND JOHN RYAN I , 19 A I I I I .I .I I I I I I I I I EiGiiiiiiiiiiiiiiiiliiiii?525iiiiiiiiiiiiiiiiiiiiii 'lm-'f l Page 478 . -mm..mn...mnK..,...V...H.,un..+...,...4.HK..,,........m..,.............,u...,.....m.x.mnu.11...,M..wwW...K.........,H,H.,my.HWK..,VW...K.,myml..,....,...H.,K..,WN...,.WL..,,..,..,,..,H.M..,.HWml.HH..H.....,..u..1..m.H.HyH,y..,.H...,K..,..,K..,V..,..,...H.,,.HV..,IHW.H.,H.,...,...,......W...,.HV..,,..,U.,,.,,H,K..X.HH.,1y....,,,UV..,,..,...w.H,..,...,y..,H.H...H,.HH.nm.HH,,,...W,H,K..,.HK..,U.W,,..W..,my...WH.,...mn.Hmymy...wmvmm,,..,,..v...,...,.m.....,, 2 2 s 2 EE E 1 E 2 5 5 f EEZ Es: ,Zi E! ss, -as H: 5 EE 355 252 EE EEE EE SEE iii ESE 252 E25 :gs :Eg ESE S2Emrmmum.mn-4H.ummV.,H.1imuvV.....mn.H1HXIn1.11V..,.U....1-1WV.....MmV..H.,....V.,.mmH.11.1,..,.m......mu.,,..,..,K.........v..,W,...L.,....V..,...,..,..,K..,....H1..1.H.U1...1..V..,V..1mH.,myV.,wH11.11nl1..,1.11H1V..1I.,L..1..1X.H.mmm11.11.4H.11.1N.-1K.....U..,.HH.1..,X.11..1.U,V,,WN.,U.K..11.11v..,H1..X.H,.H1H1H1H-1InH.1..11..1U1K.,NK.W,,.U,..,,U,V.,L..H.U..X.1XmV..,1.1,...,1.11.Xmy,.ww.mw..mm..yu11.1Ln.HN11.,..,...V,.1rmH.W.IHNXH...w..1...,....l.....w4........'xg iumunnumiIEiRFEGiii?EMEIFIUHYHIIFHUi1lil553555YiiiiiIREImihumunMIEIIIRISIHIEillilfiiliiiillmililH1IiiKWiiilifYiIGiEH1lilEMURIHIGHGiiliiilE5GIUEHIIHSIMIIlillEifiiGiliiiHPIiiiF5151iiilimNfl?QilIINilliii1iiiiii1iliiilWPI:1HIREiiiEIUIIIHI513IilliiiH11511IIIEIESPPIFW1EIPI1FililiilliWIEEHiiiiiii?FillfiiiiEITHERNIKEwinnnwm1n1m1n1min1nvm1rvU1umwru1mm1umnaninHIuuwnurunwuwuwwuwnwwuv1u1u1mvmm1nnwvmnxnuunmnummnmmr P a g e 4 7 9 LEONARD FREDERICK ERIKSON CHARLES MAYO LADUE ...mn.n..r.........r..................... .....m....n......um.n.......mu.. u .mu In .I u . ......................... .I I I n I nnum.. .In nn.InIummmInnmmmxu...mnmnnmnnInmunmumI..unuvmumm.urmunnuu...uumlnunuuzumxumun ...mmun........u..u.uIm: -.T..lw-............-...---................,..,..L..,,..-...,.......... .......-.,...e, ...,...,......,. ,.... ...,.................,.........-.....,.,....- .... u...................................,....,........n......,.-..., ...........................f.............................. ............................................. . ................ .. ... . ..... ......... ........ ..................................... .... ..... ..... . . . . . . .... ......................... ................................ ...... . .............................................n.....m.....-..........................................u.......... . .............. Delta Tau Delta Founded at Bethany College, 183' 9 Wiscon.Tin, Beta Gamma, 1888 Number of Chapters, 61 Krumm Adams Shepercl Stegeman Campbell Kiser Bartlett Schoeninger Mann Murdoch Teckemeyer Eril-:Son Scott Mitchell Mclver Hewett Rogers Gnagi R. LaDue Reps I-Iougen Randolph Morey Jackson Stock Pierce Faletti C. LaDue Grace Thompson -mx s E E Members in University Graduate ALFRED MOORE ROGERS 1919 EDWARD ERNEST ADAMS WILLIAMJACOE SCHOENINGER FLOYD FISHER I-IEWETT THOMAS LEROY SHEPERD RUSSELL MORSEBY LADUE ROBERT OLIVER THOMPSON, JR. 1920 JOHN FREDERICK KRUMM FRAZIER DANIEL MCIVER JOHN BINFORD RANDOLPH ' 1921 EVERETT LOWELL CAMPBELL GUSTAV BRUNO MANN WILLIAM BENDER GNAG1, JR. XVILLIAM KENNETH MITCHELL HOWARD RICHARD GRACE III DONALD JACKSON MOREY XVALTER WILLIAM HEWETT l-IARELL ALEXANDER MURDOCH FITZ MORRIS JACKSON DONALD XVILLIAM REPS ADOLPH OTTO TECKEMEYER 1922 GEORGE WILLIAM BARTLETT, JR. ' STEPHEN LAWRENCE FALETTI HORACE PERCIVAL l-IOUGEN EDXVARD THOMAS KILEEN ELLIOTT FOX IQISER ROBERT LAYNE PIERCE EDWIN IRVING SCOTT HENRY RANDALL STEGEMAN DONALD AUGUST STOCK Pi- A-J T ' . ........................................................ ....................................I.......................... Page 480 ............................. .. .... ........................... .. ..... . .. ........1......... ........ :mnumnnuummInuunmummmnvuw'mn1luummvufmwInmmnmmwnulununvuummmwInunfuummvmnufnwInmmfummmymvmmwummInruwInmwnnInummInfmnufmummuwmyvu1mm1nwummInmfrmInInwmvu1mvuInummWwmwu1ruwInruummul1m1Innnruumin1u1m1uluuwummWnumymymmumm1uwmmunulumuwmmmwummm1rwmwmrmmunummrnwunmmymumm1mvuwyumyummrmmnmuwmmnnmmwmum :mug 5EQEIEEEHEIIEEEiiEiHi5iiiEiGEMiiiGiEEiEiiliiiHiIiiiiiMIXEREIiiIIEEiiiMiiGEi??EiR?i5Ii?iii?EiTiiiIiiiiii?Wiiiiiiiiihiiiiliii5511151iii?iii1il1iiIEii?iiiEiii?iiEEIPRQNIEEiiliiiiiilFiiiiilmiiiiiEECFETEIGiiiIEIEZHHE551125IEEIHIEYFIRIIITFMIEuiiiiiiiiiliiuEIEEIIUIAIIEEIZRIIIEIIHIEFIIEIREIiiniiiliiiili1fiR?i?Eii3u?EiUimi1miiimuuuummInmumInmmmmInummmnlmuuwnummmnummmmummmvmummmummmvumyuvummummmnmmmmmg 35 EE sg S :Eg 5 5 E Egg 2 is EEE 5:5 ESE E ii EEE Egg EEE E15 EEE E12 5:5 2 sa sea 5 2: 5? s 5 5 E EE E EYE EEE E 3 2 E E 5 : 2 Es E E gs 5:2 s gg E E5 Ei E EEE EE Z 5 s gz, 5 5 E E EE EEE E2 E 552 5 se 5 5: 5 QE E55 ' QE E E E EE E ass :as EEE 5 EE E 5 5: E EE :is -E E fl- EEE EEE 5 E55..mmInunnumulnnwInmy.mmmnumunummmlumumInmwlmInnmwmmWInmyin1nmumInin1u1in1fummmwuIn.mmwInInmunnunumvuwu1Hwmwinfuul1nmlwInmvuwrnmwmwnnumnvwmlmnwulwvufninwug.:wuwQEyumwInluuuuuvvmulnlulwgmMmwffvmy!1gmMg55555555!w55wgf5m!5jmyggmfggmwMg333551553353gy5555555553555ggggyggggggggggg535355553153gggggyggggggggggggggjggfmf5133553gggggfgggggggggggggfggifl ' H 'M' ' ' ' 'M ' 'N' ' ' ' ' 0 ' 0' vm ' ' 1 1lumnlmnnvlmlNinunInwulrlnllmmnmulNul1ll1luvmln1InnlunmmmlwuwwvuInwu1LuvmxmunlmlmlxruNmlmrlmmllummrlmlnruuurllunulHnllllllmnllululnv1 iam,a.n,1.,s,s,i,,i,,anaamnK..nm..,..m.a,.,am.:Y.nunma,anmmm.i,n...izn.sz..1.m.a.i.sHz,a.a.:,Q.:..:.:.s,a.1.:.mw.11ua,.HsmK.W...Hay..,,..,.....,,..N.H...H.,W,.H.,.,...,.,1.....,...K..,,.,H.,..,,..H.NK..H.,..,,..m.,w...i..,..W,,H.lmM..,.um..,H..N,.H.,......,,H,WK.,,..,K..,..H.,..,m.,.,..m., .W P cz g e 4 8 I mmmmumIImmI :,....,.........,.,..... E 1 snwmmIIIm :,mIII.Im. Ernaazzizzazss , I I I 5 Phi Gamma Delta Founded at Washinglon and jefferson College, 1848 Wisconsin, Mu, 1893 Number of Chaplers, 61 NVallin Fisher Miller Hohlfcld Ross Lamb Anderson Seymour Lillich Parker Taylor Rul-ca Strong F. Bump NValton Schmidt Purnell Watters Grupe W. Bump Dye Bacchus Pond Lindahi Gauntlert Membe1's in Faculty AXEL EMMANUEL BERGCREN EZDNVARD XXLSNVORTH ROSS WILLIAM SPAULDING KINNE ALEXANDER NEWTON XVINCHELL OTTO LOUIS KOWALKE LAWRENCE LIVINGSTON Nlembers in University FRANKLIN WVHITTELSEY WALLIN FRANKLIN ELIZA BUMP GEORGE HENRY CHAMBERLAIN IVIYRON IVIERLE FISHER LENNOX GLEN HALDEMAN WVARNER SMITH BUMP ROBERT I'1ALDERMAN FACAN RUDOLPH LIBBERT HOHLFELD HAROLD WADSWORTH LAMB 1919 1920 1921 FRANK A LSXVORTH ROSS GEORGE PAUL MILLER RAY OTTO SCHMIDT XVHITNEY NORTH SEYMOUR JOSEPH LEVI XVALTON f THOMAS HENRY POND CARL JULIUS SEIFERT THOMAS FOSTER STRONG STANLEY EDNVIN XVELCH GEORGE HANAWALT XVATTERS 1922 GAYLORD EUGENE ANDERSON THOMAS BACCHUS WILLIAM PAUL DYE WARD JACKSON GAUNTLETT ROBERT 1'lENRY GRUPE EUGENE IVIACDON yJOHN EDWARD LILLICH GEORGE EDXVARD LINDAHL GEORGE IVIAGDONALD PARKER XVILLIAM HENRH' PURNELI, JOHN PIRIE RUKA ALD TAYLOR Z S A ,I 0 ' rl '!-'13 v W-Iy.wAH II.A..v.mIII.A,.wm IInIuInIIWIIIIIIIIIIIIIIIIIIIInIIII.IIIIIIIIIIIIIIIIIIIIYIIIII I I Page M2 Fagan as 3:5 EEE 3,mumunWInnmmm,vm1InInummmmy.mmfmm1Inm1InWI-1WWI-1w.IWWwIninnm-I1unInmmmV..Wwnfnm.HmH.WU.XfnnumXmWInInw-IXwHnuul1WIHH.Wmmnm-H.-.m,um..mmmHXLHX.NXW1.fK.WwH1H.WmXu11I.1H1wH11H1WWWWXH.WWwWvm.-vm-mmmfuV..W1.XXHXH.X.HX.Hmfm1mUHN.W1.41HXH.WWW.HW1.4H.WmmXH.XInW.HX.UX.IHHX1HWWwwW11.1V..vmV..WH.WWW.HX1.XXHW.HX.HXI-XXI.XH.u.w.mmm..mmH4InWInWWW.1WH,1Wml.1Hm11.4X.-41,.m.w.m.m,m-unE ggw..,,......,,..,...,,..,.m.m..,..U..m.,.m.,m.m..w..1W...w..,..U,m..H..wW...m.....,..,.,.,,..,..,.,.m,,..,,w..,,m.m..H..,W...,.m.,,..,....,.U..4..,.,.u......,,.4,..w...H..,..,..,,...,,.W,..H.,.,.,,..,H,,..,,.m.,...W,..U..w..,,..,,..,,,.H.4,..,.m,..,,.W..,,..,.H,,..W..,,H,,.,,...,,.,,.m.,,..,K.,,...u.,,.4...,,,.4...v..Maw.,s,m..,,.m..,.....m..,,.....,,..,..m.,,.,,,.4,.,.,,.,,.,,,.4,,..,..,U,,..W,,.,H,,,.W..,..,,.....W..,,..W,..,....,.,,...,.,m.,,.,,,.,,...,..,,..,..m.,,......, E 55 3 5 5 SEE E E E :EE 515 .ss Sis if asf 335 2 E22 iii SSE Zz, 25: 555 ggi sag sis 555 ii: 555 22WI'+wMmf ww W'wwHM- muwww-H+ HN HH+1HHHWmW1HH + H'w 'W'IW H-H'WHW HH'HHH W HH+'H 'WH'rms1 av :'::f1'z1:s::refzuezf11:1refmix:k::fz::1z11r:fr:s1:urams'1zusniffmesuefrsszuelssvzefrefers:essex:zzzuemuzzfrezueefzrzzuizsfzeznzzieuieureuufzurems::u4u:1ef1f:uee:r:us111:.1e11r.e1,eL.1::zs.:1:::::.fee:1s:,1:sf::.1z:.L.L.uf.1.,,ze.1.ffrsm1efmuseeuem...1,.azH:.,ea-.fyusz12H5352gmmwmmmmg .anamms:aunnLanaa:azzaamza1aninaanaa:meua::az:amnznsa.1as:1smaanaaxananaz1anmea.,sims:..nzzz1.11aaanasmaananH,Y..,H.,..,K.,X..,K.Y,..,..,.,.,..,..,,.W..,...,,.,W,H,.M...,..,,HY..,..,...,..,,.HK..,.1,,.Y..,,..Y,.,,..YH,...,..,....,.,..,.,.,....,..,...,.,,...X.,,...,.,....,...N.....,....,......,....,.....,,.,.,m.,.H,H.H.,.H.,H..,......,.,..X..M.,..,,,.,.H,,.,....,.,.H...1...,...,...,...,.,.,.,..,..,,....,.,..,..K..,.,,H.,...,..,.,..H...,...,.H.l.,...H...,.,,..,.,,u. , Page 483 E: iii :II I .m I Ir m Theta fDeZta Chi Q Founded at Union College, 1847 Wisconsin, Sigma Deuleron, 1895 Number of Charges, 29 Miller Petrie Breuer Bolender R. Rewey Mansfield Dickens Mitchell Bach Etter Tuttle Ballantine Griswold Schmitt Doke Royce White Dean Knoll Koch Vaughn Allen Hill Keller Members in Faculty STEPHEN MOULTON BABCOCK ROLAND ROBERT ETTER Members in University 1919 WALTER RANDOLPH MANDEL ELLIS ADOLPH STOKDYK 1920 CLARENCE EDWIN BACI-I NEAL GEORGE BALLANTINE LOUIS ALBERT CARLSON PERRY ALLEN DICKENS HENRY FARNAM GRISWOLD CLIFTON MILTON JOSEPH BRIDGE BOLENDER HERMAN MARTIN BREUER HORACE KLEFFLER DEAN LEO JOSEPH FEDERER WILLIAM WERNER GIDDINGS CLARENCE DONALD HILL DANIEL HAMILTON KELLER HARRY DANIEL ALLEN 1921 1922 BURTON HENRY KARL CHRISTENSEN MILLER HAZEN HILL PETRIE ROBERT LIVINGSTON REWEX' FRANCIS HERMAN SCHMITT ROLAND COLEMAN SPRINKMAN TUTTLE ROY PHIL IQNOLL WILLIAM FREDERICK IQOCI-IT HERBERT STANLEY MANSEIELD MALCOLM MITCHELL WILLIAM ASA NOTT OLIVER XVENDELL REWEY HENRY BURNSIDE ROYCE GLENN HENRY V AUGHN XVI-IITE R... I 1 . f 30 5 .V Kifiggfi mlm lim-Hiiwmm Page 484 num Iinminmmiiiiiiinin I-IIuI.IIIiiIinIinnlIIIIimmmiwimiwi .Eg .EE g.,...nw!wM15Emm..wwwmygmlgwmwQ2EE55LM55mww3,55wwwn.wuum!XWW.www..u!n..mn55u.5,nuny.HlmK..1mm...,.,.....!....m..KmInunnuM...m.,.m.mm..,,m..,vw,mmWnumlmH.mmm...fmWmlH.,WmfmMmvmH..H.um.mmmlm...mymm...mmmu.m1n.mmm..munm.mm..mnwn..n.w.mmWW.XXyn.Hmm..U.MmnU.,1.nuvmnm.mm..mmmummmmn.- E E-'ummnmnmmnmnuInnmmummmmummmmnmnnmumuInnnnummwmm.mmmnmummummmmmmunmnwmmmmw'mmnumulwummun1fnummmwI1wul1numu1vmwInrmmunwvuummmInummmummInummmmmmmunmmmmmmInummmwmummmmmmmmmnuunmmmumymmmnnumummnumfummmmmmmmm.fmnnwmxmwH7511mIIIIIIIHIEIIIIII5FEIiiiiiIiDEEFii?EHEiIiiIE?ii??iEEEhFiFEEFITQ-E 5 ss 5 EE 5 E E E 5 E 5 E I E E i E E 5 se E: 5 5 ss ggi , s K 5 E2 E12 SE 5 E E E 5 E 5 Q 5 E , 5 2 5 E 5 E E a 5 5 E 1 5 5 5 5 5 z E Q E 5 :fa 5: E E Z 5 E Eg: :Y sig :z E EE 3 : are E- 5 gg E . gig :- s Es is E EE 5 I gas If EEE QI 52 EE EES E 2 2: EEE if Ee E E E 5 I ' E EE 5 ' EEE I sf: .- Egg -- EEE - , 2 QE If E E E : : sea 5, :, 5 E E I ' -g- A- EEE..mmm.mm..m..m-.Uumm..m.mu.HH.mmm.,mm..m.nmmm.,ym...m,m...mmmumm.....mm....m.frm,mmmmV.-mm.,..,m..m.m.m...Hmyyn,mmInI.Y...n.,..m.,w.umm.,H...f.H.,..,..mmm..m.,.m..mm..m...,..m.,.m.mmm,Hm...,,.m.,K..,...,..,...,..m,,.,.yunm.,,....m...K..H..K..,..,......,...mm..mm.....,...um..,..,H.....1w,...m,..,mfmI..X..4..u.m.m.mm......,nm.1.m..,...........m....,........,.mmH.,.m,.,...,...1..u....mmmz 2,1nmInmm1II11IuII1nMEiERiER?EEEIEFEREEFIKEEEIIEEEEBYEQEiiIEIEiiEERiMiEi??EEEEiI?iEiEii5i5EMIEEEEIMEIIMFEFGIEEEQEIENEHEIMIEEEMFFEIIHIIEEEEliMGMiEERi3EiiEiEEGElTiiHunu:-'MununummmmEiEiMuum5KiEmummm:muummMEGMEIGIGHnmmunuwlmmiunnnEiiMRimmmmmmnmmiiihlummmui?FmunuMFi1mmmvumummiivmrwnnnmunmimvuumuDE.mmRvmm..mnmmmmimTH. Page485 E IIIIIIIIIIIIIIIIIIIIIII IIII IIIIIIIIIIIII IIIIIII II I II IIII III II II IIIIII III IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II III II II IIIIIIIIIIIIIIIIIIII IIIuIIIIIIIIIIIIIIII IIII III III II I II I III III II III IIII I II III IIIIIIISIIIIIIIIIII-IIIIII IIIIII IIIIIIIIIIIIIIIIInIIInII.III'III.IfISIIII-II2III.IIIzIIIIIIIIII.IIIIIIIIIII.IIII IIuII IIII IIIIII II III IIIII I III IIIIIIIIIIIIIIIIIIIIIII TS Founded i Upsilon at Union College, 1833 Wisconsin, Rho, 1896 Number of Chapters, 25 Members in Faculty WILLIAM STANLEY MARSHALL MAX MASON JULIUS EMIL OLSON EDWARD THOMAS OWEN 1V1ernber.s in University College of Law DUDLEY HOPKINS DAVIS MARCUS LULING BAXTER I 91 9 PAUL STEVENS KRAMER EDWARD BARNES WILLIAMS STEVENS GOULD JOHN FRANCIS HAMLIN DONALD STEWART HOWLAND FRANK FRANCIS PERCIVAL BROVVN BURTON CLARK, JR. ROBERT WILLIAM DAVIS KENNETH SOVERHILL EARLE JOHN DAVIS BARCOCK GEORGE ALEXANDER BAUMAN EDWARD DEXTER BROWN HORACE ALBERT DUBOIS STERLING DONALD EWALD KENNETH CANDEE XVILLIAM KENNETH GORDON I 1920 SAMUEL HAGAR MARSHALL EDXVARD WASHINGTON IVIATHEXVS WALTER KING MOSS LAURENCE WESTON 1921 RICHARD DONALD EVANS GORDON GRAY FAIRFIELD FRANK WVINCHESTER GRAY KENT TOWNSEND XVAKEFIELD 1922 HORACE FREDERICK HARDY WILLIAM ARTHUR HIECIQE PERRY MILLER HULL WILLIAM BRUCE MAINLAND HENRY HARNDEN NOBLE JOHN J UERGEN REINKING JOHN XVALKER THOMPSON IIIIIIHIWIIEI I I 4 is I Eli Wei N L I. ' ' W. 545 ei . X -' RST . 1 KX: ',-I . EXIF! W I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II II I I I III I I I II II IIIII II I I I IIIIIIIIIIIIIIIiiiiiiiii?EIIIIZIiii5IGEIIIIIIZIIIEIEIIIIIIIIEIIIIIII M ' N ''mM ' WMM II Page 486 I i L i WIT .,l..,...u. 1.,w.mw..,..... .... wwmy.1...,1.....E,...Iw,.I ,..,. n,...n. 2 un.n .,...,,..l...,..,,. . ...,,. I ,,.,,. . 1......,,., I . .Nm ..K. .I ..,. ,I..........,.,.,...II.I.., ,,,. II.II.1.I.,I.,1.1...,..1.....II,..,..I..I.,.III.,I.,I.,Im...I......,I..1..I... .,.,n I ,l..,...K,.,. .I ,....... 1.1.1.WI,.....n..I,.m1W..I,..1.1...I.,.....n...1..,........I...... n..,,... .,.......,...m.. n.,n I... ...Kn,,..n n...,,I....1,..1..m..I ..,K. 1 K... ,.,,,..I..,...,..n ..,ln N ..n.. I....................I.....,I..m.1. E 'gammamT.....I....,m.1m.I.I.mmImaam..IRmsaanmaamI..mmaimmaazmmmzainaan..I1.1nmmIIa:IzmmnIImnImnInm.,Inmznnaazszammanamm..11......Amanaanzmnmmmammasnm.,II..I..I.,II...IHmmmnmnnmmmmmamT.+m TnTaamImmmmsmanmasmnmmmmmmmsmrI E E E ii Sig .1 E E .- E E P ' U ' Z Z E E :E sz psz on . EYE EXE SAE , I Members In Sermce E55 I Iss-I 1897 512 EE MA-IOR GENERAL CHARLES BOARDMAN CORP. BERTRAND HERIIICK DOYON I I 901 I 902 E JOHN CFIARLESSTEVENS COL. IRVING FISH 5 1903 1906 COL. EDNVARD POWER CONWAY LT. CUDWORTH BYE I 1 907 I MAJ. ARCI-IIE LYMAN NASH LESTER BARBER STEVENS I 1909 l'lOXVARD LOMBARD BEYE CARL JEFFERSON CUNNINGHAM I 1 91 I ROBERT PINKERTON HEALD HERBERT UNDERXVOOD 1912 LT. ROBERT PACE BOARDMAN LT. MARSON WILGUS PIERCE DONALD MILLER WALL 1 LT. ROBERT LINDE BOXVEN ROBERT BAKER RICHARDS JAMES I'lENTRY WALL TOWNSEND HAY LT. XVATSON GOODRICI-I TAPPING DEXTER ROUNDY MAPLE CAPT. JULES MERRILL PARMENTIER LT. HERNIAN HELM VEERHUSEN ELMER FREDERICK WIEBOLDT 1913 CHARLES STANLEY ALLYN NEILL XVILLIAMS Fox LT. EDWARD NELSON WHITNEY ARTHUR COBB JR. LT. ROBERT DAVID HUGI-IES FREDERICK SEACORD WILCOX LT. NVILLIAM ROUNTZ FITCH LT. DOUOLAS MERRILL PARMENTIER e 1914 LT. PAUL LINDE BONVEN LT. HOWARD LESLIE HEALD LT. J. G. NELSON SMITH TROTTMAN ENS. JOHN CLEMENT EVANS ROBERT THORSEN PURCHAS I 1915 FRANK GORDON BABCOCK ENS. MILTMORE NVITHERELL BRUSH HOWARD HOLMES TOMLINSON NELSON GEORGE BRITTINOHAM LT. STRAND BYRUM GALEY LT. LOUIS HOWELL WILLIAMS DELMAR REYNOLDS HUGHES A 191 6 LT. J. G. JOHN SPRAGUE BAUMAN JOHN SANDERS HOHMAN CAPT. CARMAN BIGELOW SMITH LINCOLN OTTO GATTER ENS. RAYMOND WOOD JORDAN LT. SAMUEL CRANE VAIL LT. CHARLES SCRIVER GILBERT LT. PHILIP GOLDER SANBORN CAPT. HENRY DORR WAKEFIELD I 91 7 LT. HERBERT PULLEN ANTES LT. JACOB GRAFIUS CALVERT LT. CHARLES DELOS MORTON ENS. EDWARD GEORGE BRITTINGHAM LT. JAMES GEORGE CLARK JR. LT. FRANK EDMUND OGDEN LOUIS GEORGE BRITTINGHAM ENS. JOHN FONDA DOWNING JR. DONALD DRAPER SPERRY DOW JACKSON BEYERS LT. CLARENCE RUDOLPH MENGEL JR. LT. LEONARD CLARK WOLGOTT CAPT. JOSEPH TORBITT MENGEL 1918 LT. GILMAN DORR BLAKE JOSEPH CONWAY DODD JR, RICHARD l'IUCI-IES MARSHALL EDMUND EUGENE BEYERS LOUIS PHILIP EWALD WILLIAM I'IUGl-IES IXAARSI-IALL LT. DUDLEY HOPKINS DAVIS LT. GLENN HARMON KLEMME ENS. DON SOUTHARD PRESCOTT LT. ALLAN CHASE MCCULLOUGH ' 1919 LT. MARCUS LULING BAXTER PAUL STEVENS KRAMER FREDERICK LEWIS SPERRY EDNVIN ALFRED GALLUN CARLTON FOSTER LOPER LT. JOHN STEVENS ENS. MILTON PETIT GRISXVOLD LT. ANDREW ROBERT MAILER ENS. THOMAS WESLEY TUTTLE LT. WILLIAM J. HAY JR. MARTIN JAMES SHERIDAN JR. CAPT. XIYSE BECKWITH WHEDON , ENS. EDWARD RUSSEL KOENIGER , LT. EDNVARD BARNES WILLIAMS 1920 LT. JOHN HAROLD DRAPER LT. RUSSEL ALGER JONES LT. EDWARD WASHINGTON MATHEWS STEVENS GOULD LT. J. G. ALBERT RANDOLPH JOHNSON ENS. EDWARD WELLINGTON POWERS LT. JOHN FRANCIS HAMLIN DONALD HOWLAND RAY WINFIELD THOMPSON L' . JOHN FRANCIS HAMLIN DONALD HOWLAND RAY WINFIELD THOMPSON RICHARD PITMAN HOHMAN FRANK LAWRENCE WESTON 1921 FRANCIS PERCIVAL BROXVN IQENNETH S. EARL EDNVARD VILASPLATT LUTHER HOAR BAILEY GORDON GREY FAIRFIELD GORDON SHORNEY ROBERT DAVIS CHARLES WILLIAM FELICER KENT TONVNSEND WAKEFIEL XVILLIAM HARRISON MATCHETTE I I , IIIImmnnwIIIIIIIImIInmmIIIIImmIIIIIIIIInIIIIIAIIIInwIIIIIIInIIIIIIIIImIIIIIIIIIIImIIIIIIIIIIIIIIIIIIInmmIImIIIIIIIIIIIIIIIIIIIIIIII IIIIIImmIIIIIIIImmImIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInIIIIIIIImmIIIIIIIII-IImmImmIIIIIIIIIIImmIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIII IwwmIIInIIIIIIIwwmyI-IImInIIIII.IIIIIIIIITIIIIIIAIIInIIImmmII.MII.mm.mm111IInInIIIIIIIIIIIIIIIInIIWIIIMIIIIIIIIIIIIQMWEMMWIvynglfmgmfwwffmgf IIIIIIIIIIIIIIIIIIIII1IF111ERE?iiiiiiImIInIn'IMIIIIIIIITIM?WHEELIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIAIIIH IIITIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIFFiiRIGHEMIIIIIIIIIIIIIIInuImI-IIIIIImInI-I,mmIInIIIIInI-IIIIIIIIIIIAIIIIIIIIIIIII1IIIIIIIIIIIIIIIIIAIIIIIIIIIIIIIIIIIIIIIITIIITIII IIIIIIIII IMIHIIIIIIIIIHIII.nm IAIIIIIIIIIIIIIIIIIII IImnn.mumIIIIIIIIIIIIIIIIIIIIIIIIIII1-I-ImIImIIIIIIIIIIII-InmlyIIIIIIIIIII IIIIIIIIW Page 487 If,- I Ixunniuuuuu I1 unu I III: I u III I Im ru L Inu: In 1 -,S mm nw Kappa Sigma Founded at the University of Virginia, 1869 Wisconsin, Beta Epsilon, 1898 Number of Chapters, 86 Uhler Zarsc Risteen Frank Holtz Poppcrt Ritzenthaler Cheatham Paddack A Blattner Sobraa Gregerson Godfrey Brown Bowles Beckwith Loverud Sundt Bonesteel Members in Faculty SCOTT HOLLAND GOODNIGHT WILLIAM HENRY LIGHTY Members in University 1919 W DAVAID JONES BLATTNER HAROLD COWAN CHEETHAM PORTER HARRIS BROWN REIMAR AUGUST FRANK CLARENCE HENRY ZARSE 1920 DUDLEY JAMES GODFREY RYCHEN IVIAYHEW PADDACK 1921 WAYNE IzOR BECKWITH WILBUR EVERETT HOLTZ JOHN SHELDEN BOWLES HERBERT LYLE RISTEEN 1922 WENDELL BONESTEEL RUSSELL LINSTEAD POPPERT ORIN ARTHUR GRECERSON OTTO MARTIN RITZENTHALER EARL KENNETH LOVERUD BURNEY ARLOW SOLBRAA PETER DOMINIC MCBRIDE GUISERD MERRILL SUNDT WILLIAM THOMAS UHLER I I .. ww . .. 'Aw - 1 . 5 IU A 5559 . 12 -u, ' ,swriv- ..fiNX 1 If faf 4. I.uII.mw. I..w.m..mImI mm InIIInIninnuIuIInIuIIIInmmmumumnwn Page 488 muwnmf EEE 5: an 51- 5,5 EEE 55 :gg -,, :FS ,u..,.n...m.. ....u.. y.UMM...H,m,.Mwm,5w,M,g,25,u..,.,..,w,.N.,,.ME,YH.,...,w,1,,,HM!H..X....,,Z!My,HM,M,www.I....wwin.wi.w,5!,,M..,,...W.HK.,H....H,.,,....,.w..,.,...4 ,.,, .., ,..,l.., ,.,,. .,,. W. .,.., ,HY,.,,..u..,,..,..H.,,..,,...,.1,,H,...,..,,..H..Y..,,..YH.,..,H..W...,....H....,,..........,H,,.w.,,....,..,...,.. ,.., WM..um.,W,,.W.,Km,.,,..w,.,H.,.,.,,..,,..,,mm,..m.,...W,..n.....W 55,W..,...,....,.w......,...,...HW...AHnmH,,W...W...,...,,H,..,..,..u..,....u....,.......,.n..,U...M,..,..,..,Y..,...,.............KH.,,..,.1,...U.,W.,,H.,H,Y..,km.MNH.,,..,K.,..,,..,,..Y.,.,.....,,..,.,....H..,W,..W,...mv.,,.W..,,.,,.....W..,....,...1..W,.M,.,..........HH.,.,.N.,,.,.un.,,..,...,,..,.,.....:aam..,,.,Wsamanmmzzmnmmuamamnamsnammnznnmzsznmxzammazmamenanummam:mm,,...,..m:mm...,...,...1.......,7fa 5:2 ,B ,Q as 2:2 EEE 555 iii ' Sl EQ ESQ 33 15 55 E55 . Eff - - ri: 222 E35 . is EE EEE E3 E32 EEE EEE Sig :EE EE E55 zz: E35 EEE E25 iii Egg -E iii Egg 555 EEE zz: JE :E Es: :ga 55 Sas 55 Q: :EE 1? Q22 .if :zz 5:5 E35 ,., is: :E m EE as E35 W, :E aaa 1 ME as E35 R ' 55? :E 5,51551M5,515,355,115,1,N55,M,HMmEH5.5inupI.,H,1W.,..HE..WX.,W.1,......,..,..4W,HK..R.,.N...K..,..H..Y.1,..,,..,,..,..,.H.H,..,..,,....MH.,..,..,,,H...,..,..,,..,.,H.,....H,,..Y.H,.....,...K.,km...,.....VWm.L.,...W..,,.,Y..,,H,..Y..,Y..,.H...,..,,.,,...,..U.,..,,,..H.....,H,.H..,U.H.,,my.H..,H,,.v,.HV..,,H.H,..,,..N.,W,..,WV..U.,N.NK..H,,,m..,..,..,H.....,..,..,,.....,,.v..,...,.,,..,,H,,.,,..,I,,,..,...,.....,,..,..,....,.,,.H...,,H,..,H.U.,K.,,..,..,,,H..H.,..,.,.WH.,,..,.,..,,,,....,,,...,.w.,.f55 :..,......H,...,.H,..,K...M...,,HU.Y..,.HY...H.,K..WYmn.X..,K.,..HH.U.WK.,WH.,...W.umH..H,,HH.,.W..,H..m..,H.,..,H.,.....:a:.,,auas,..,..,.,.,..,,:.,K.....,..,...,....a:...,,.,...W...K..Y,.Y..,H........W,HH,Y.HK.....Y.HY..,.H...WK.M.,,..1..YWml..,..W...H.,WH.,..,..,,..,,WH,,K.,,.W.,...H.,,.,,....H..,K...,.,.H,U..H.,,,...,.......,..,HH.....W,.,N...W,.....,.H,.,,.....,...,...,...,..x.:.M,..U.,,.,.um:nzV..,.um,.....,1zasz..,.....,,....,.,,......,.1H,H.mmK.,,H,,.,uw.,M.H.H.,,...,...,.m.,K,..,u....n..,.1 Page 439 1 I I I I I I n I mu: I II y CPM Kappa Sigma Founded at the University of Pennsylvania, 1850 Wisconsin. Alpha Theta, 1901 Number of Chapters, Z9 Sumner Sicker: Wolfe Holmes Barlow Stark Hammond Knollin Prange Ray Kellogg RuSSell Johnson Montgomery Paul Brandt Neumeister Fugina Woodhouse lvlyers Morice Larson Nlembers in Faculty ORSON CLARK CIILLETT JOHN WARNER TAYLOR AIOHN GIVAN DAVIS MACK JAMES WEBSTER WATSON LOUIS ERHARDT REBER WARREN NVEAVER Members in University Graduate CARL FREDERICK HAYDEN 1919 PRESLEY DIXON HOLMES THAYER ZACHARIAH CLAYTON 1920 IRVING xl ONES GREENSLADE ELTON KNIGHT MORICE LORINC THEODORE HAMMOND CHARLES HAROLD RAY RAYMOND NELSON HAWRINS OTTO LEONARD SICKERT FREDERICK CONWAY IQELLOGG XVILLARD CARLYLE SUMNER JOHN CALVIN WOLFE 1921 MILLARD MERRILL BARLOW CARL LOUIS NEUMEISTER CLARENCE ALBERT BRANDT EDMUND LOUIS PAUL CLARENCE EDWARD FUCINA I-IERMAN CARL PRANGE MERRITT ALBERT GILES THEODORE EUGENE STARK STUART CROCKER IQNILANS IRVINC XVOODHOUSE 1922 ALBERT JASON IQNOLLIN RALPH ELLIOTT LARSON XVILLIAM HENRY lVlONTCOMERY CHARl.ES MYERS ELDON BABCOCIQ RUSSELL 'ii' ImInIIIII.IIIIIIIIInIInInIIITIITIIIII-IIIIIT.-III 1IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIITIIII Page 490 IITIIIIII EE ,,- E E ummmnumwinwInnum1u1ulwuwwnv.mmmwInfmwInvuwmwInm1vuwInI11ml1mmyunvmmWInfuwm1Innnyu1m1uwrnwuluu1mI11wHnnwruwmmwmruwruwanmwInwInm1fmummm-mmnuw1uwm1uwul1mywruwanwufwuwmmumwumnwfuurHnmumlmnmumwrl1ru1In1vuvuwmvuuH1wmuruanwmwInmwvmmyfuw1IninwuhmIn1uuuu1InwynVuunlw11uuIn1nvm1In1In1Hwmm:nuulummuwuummfmfmuw1u1yurmwminwInwuwu1wmwmnnuuumwummmmmmmummuw :E wnnwmmmmfnnvuunwuwulnuNHwIninwmymnnmwummmummmumuu-nmmm-mufmulwm1u11n1H41Infuwm1InwInwin1Inin1Nwwm1u1m1u1ru1n1uwwfu1vmInIn1Inin1Inuv11Inm1mfuwinwInul1m1mmwInwuwmwInwu1fuwmfuwmmmnumnuwmfu1-1vmXmm1m1min11I.wvum1nuuw1InIn1fnuW1uwmwm1Inm1m1ynm1InuIHyn1ufnuyu1fmVHuuu1uumuufwInrnwmmwmnm1mfu1mwInunvu1m1mmmmmmnmn1fnnufnwmvmnuwmmmmmummummuw gr E5 EEE -EE :E 'E is E immu1wummInwuwm1.Immwmlmmnw i 4 E I .1 mmmmmmnmnmmulwmmmmmmum nmuwrnwInnninunnlmuInmmummmyummmnlwvuruwuwnuInulwwmvu1u1u1lmInwHwInmummInm1InnlwH1mnl1InmWmnmInWnWmmruwInwwummmmnmmHwI1w1-4mwn1rnwuwInmmHInInfnin1mmmmnmmnun:wwwfmuwuwwH1mwuru1muuwfnuluvHmmVH1u11nX1.wmN.I1inuvmmmuw1.NinmWwm1mmmUminmH-15gy5355gffmfmmMMwwuwmmmwwwMywmgm m11H1InInin11.41mulwunInwuw1H1minWnwwnwm1Hw1nwIn1H1uvnumwuwwmmrn1nw1IwwIninwu11.11lilinH.wH4wInInmfmiminni.1H11.4fmK..V..MMA1nInmiInW1m.1wmm1H1fnwU1inin1H1fm-1wmwu1HwwuwInnu-Iww1wwInmMNfuwwInulmwrmn1vurumwmnwwmm1.1wmmnlmn-mmm1.1innl1H11I.W.In.H11.4rmm1.Ilm1mm1mW1.Um1.IXmX.UWU.XXI.1vu11.11u1uvm11H1In1uwwInmmU.11.HH.1H11vum11-I11.11mmm.m.wm.nw Page 491 Sigma Nu Founded at the Virginia Military Institute, 1869 Wisconsin, Gamma Lambda, 1902 Number of Chapters, 79 Osmunclsen Below Mecartncy K.Ede Fanning Mann Martens Blowney Joerndc Stolley Hopkins Shaw R. Ede Smith Conley Spies Eckert: G. Miller McDonald Dorries Brothers Naeckel Stevens Nelson Wolfe Jones Lammert Rincenburg 1V1embers in Faculty WILLIAM IQELLER NVARREN JUDSON MEAD FRANCIS CRAIG KRAUSIQOPF DAX'ID XVILLIAM SMITH HARRY FROST XVILSON Me1nbeI's in University 1919 . RICHARD I-IOYT EDE HAROLD XVILLIAM NAECKEL GEORGE ELLSWORTH MILLER lXflARK SNOVVDEN NELSON 1920 CLARENCE VENOAH JOERNDT ARMIN GERHARD lVIARTENS BERTHOLD CHARLES MANN DON LEE SHAW NEWTON VAN DERvEER XVAGNER 1921 CORNELIUS COMSTOCK BELOW RUSSELL PACE BLOWNEY WELLINGTON BROTHERS CLAUDE SWANSON CONLEY CHARLES NVETZEI. DORRIES JOSEPH FLOYD EZCKERT I4ENNETH LELAND EDE WILLIS MOORE FANNING JOSEPH JACKSON HOPKINS l'lOXVARD PALFREY JONES RAYMOND FRED LAMMERT GEORGE lX4ARTIN MALCOLM MECARTNEY RUSSELL HOWARD MILLER GERALD AUGUSTUS SPIES RICHARD BENJAMIN TERKEL RUSH IDONNVELL TOUTON FRANK TISCH XVOLFE 1922 DE LOS JAMES HARRINGTON GLEN FITCH RITTFNBURG ROBERT EDMUND MCDONALD GEORGE OLIVER STEVENS ORVILLE ALEXANDER OSMUNDSEN GEORGE BROCKXVAY STOLLEY 5 - Ifit filimy 79 3 ,R -',h'!Qf - Af1 . h , l IIIIIltllltlltlrlllllllwltIVIAIIIIVIIIIIIIIAIIIIIIIHI I ,,......,...,.........,..,......,,..,................,.. Page 492 l l !,.,l..L..,,l..i.ll' gymmmpw.,mu.HH.mmIn1InnnInHmmH.nmI..mm..ummy..U...I.1.H.nmnmmmnm..-vm...-.mm...um...rmW,f..H..N...lmlmV..V...fm...ummV..,m,.Hf..,H.,my...V...,yn...H..H.W..Xmmm.,...,myV.,,.NXUu.u..w.u.m..m,...H.XnnI..vmmfN.NV..,.MWN,.....1V..,U,H..vmW1H.V...nnK..1In1mH.1H.1.Hlm.Hmfm1H11mvm1.HH.W1H..V..vmfmWX1.1X.HH.,XWH.1mV...H.1mH..umm.Hlmrmnn1fu.Hvmm1I..,.HH.,H.rmX.HH..H.1W.Hyu.mm.mm..mmmm...m.5 55g..f..,...,....l.........U..,...,...,.M...H.N.,..........,.......,...mm...mn,..1.........MWL......,..M.....i...m..,...........,......,...,,...L..,,..........mW...,......,,...K......,H.,......,,..,...K.:5,::n5n5.:1:::1..,:n:,..Ii.H:.:,:.5515:9X..,,ni.mm,is5:1n:1Z::1::::::n:::mm:55:Jima::::Gi:n::::::::::::::::::::::::::::sz:::::::::m:n::::::::i2n::zzzzainmzz:54:11:11:zzGinn::SiamL::I:::IQ1Ii::JL1I1:1L11::IG:::::n::::nL:Ji7:i:::7::15:5211::15::z::1:I57:5nz::niiI:::7i:nn::i:nminaiziii 2 E E E - I 5 215 5 5 E5 2 5 E2 2 E5 5 2 , 2 E 1 E is 2 2 2 5 si: 2 age as: 532 Sis Eli 55: S55 E55 E35 E33 ne: EEE EEE iii 523 5:2 EE ff, 555 E55 555 .,.. EE EE 512 - , S 5 E 5 2 E 3W.1.5.3n5+,..,..m.N...mmm....Wm-V..u.,...H.w.m.u.H...mum.,,..H.....,uw...myW.....H...K..,..,...m,..,,..,,.,....m..,,.w,,..H..H.,..,U.,W..U.,...,...,.,U.,..,,..,..,,,.,,,,,..,.....,,,.H..,.,,,..L..,H.,..1K.,,..u.,,.....,,..N.,,,.....,.,H.,..w.,...,......,..,..,,,..,,.,..n..,..,,....m..um.,W,.,,..,..,,.,...,..,,..,,.W...,..,.w..,..,..,,..,...,,.,,....,,..,...,...,,.,,..,..,,.,N...,w.,wH..,..,,.,,..W.,,.,...,,.........,...,,..,.,,......,,..,..,,..,.,....,...,w,..,,.....,,...K..,,.m.,....,.q lg HumIllml1IllnllllllillllllllnlunlmuIllummIllululllInzlnlllIllullllmlnllmmluluInnlxmlulnlnnlllllnIllulumluluIlllmllmuInnlNmul1IllummIIAInululWrlullNululIllWNll1lulllnum1H1InulmxNuxruulxmul1rnulwxlwru1rnlmuwxllxuxmlmluwInulvmruwInwuwuwwll1InrnNH1nuu1ulmuuxlunuruxuwmulnuul1llxinunm1InulwllwulunluxuxnlxInxLunuunnuwyunuwnxxlurnxInul1nlVullu1In1Il1lu1vuInnuxuwxInulwuxrmmxInulwll1nl1AIAunuumrunuVIummulnunmmnllxul-i P a g e 4 9 3 gmmnmmmm...,..m..m..,.uI.I,. gggmmmnmufl. .I In I If e s I I II II I I uvm I I I I I III: :lun n I! Oezpha Delta Pm Ffoundecl at Hamilton College, 1832 Wisconsin, lWisconsin, 1902 Number of Chapters, 25 McNamee Lindsey Ellis Beardsley Kastler W. W'eller Smith Bauer Stolte Day Bryan Rowland lvloulcllng Schramm North H. XVeller Members in Faculty RICHARD THEODORE ELY FREDERICK WVILLIAN4 ROE WILLIAM AMASA SCOTT OLIVER PATTERSON XVATTS 1V1ernbers in University 1919 CARL PHILIP BAUER JOHN ROBBINS RAMSEY I - 1920 LOYAL SOUTHWICK BAKER JAMES MILTON LINDSEY FREDERICK IVIGINTYRE BICKEL SHURLY LAWRENCE MCNAMEE CHARLES HAND CARPENTER WALTER TRONVBRIDGE XVELLER FRANCIS DONALD HARPER STALHAM LEON XVILLIAMS 1921 GEORGE LEE BEARDSLEY FRANK HIGGASON SGHRAMM CHESTER KURTZ LEXVIS PETTIBONE SMITH LUDLOW FREY NORTH HERBERT ALBERT STOLTE 1922 RICHARD BRYAN QSSEPHI-WATKEIS MOULDING, JR WILLIAM BURTON ELLIS AVID AND OWLAND DONALD MONTANYE IQASTLER HORACE LOOK W ELLER GEORGE BURTON XVRIGHT L ,,,. , 'A 1553? Ifigiizsniifr -:mmm as IumInI-II-IInIInInIInIIImmmmmlmlll III-IInInIIInInInI.IIInIIIIInI.IIInIIIIIIIIINIIIIIII-mlm Page 494 gumvmnmE!!:gflmMuw535wqvwulmwinwvuyuwIn1W1u1mW1mnn1mnl1in1mwu1nuvmHwwInvuwul1mwnl1In1mruwvuwul1IHmwInwmm1Luwinwm1Hwm1nuW-IWmWm1uwmwH4wuwwuwfuwmwInwuwwnwmwuwrnwinwmwuwinwmwuvwuwrnw1nwuwpnwm1u1nlwyu1H1,I11InwH1yuw1H1InwH4wnwinwnwwnwmwInwvuwn1yuumrm1mru1H4wInnnm1uwu1mum1InwInmwruuvuwuwmuInXuwWwmwH4w.1wm1mwInmvwHwmwm1Inmwuu1ynmwwuwul1yuXmvuwfu1vum11uwmuuwumfu1nl1fu1unmumuumunuumm 3 5 gnuKmmmlin1InrmIn1.H1K.1LMH.wL-41W,H1N11H1H1W1K...yu1.H1I..vm1.H1W.ML.,,.HV..1.H1WWL..1m1W.H.m,..1Hum,1.,V..XV..,Wnu...1m1.N1..,1.-1InX..X,H1.-41.NU.1,U1.-11V..V-11H.1W,.HN.W1-.1V..1H.1.N,.-4L..1N.,.U11.11.11M..1V..1inN.HV..NV..1H41y.,H.,..XX..XX..IX.1,..,Ei.1,.l,lil1iiIiiIHS.llIIANilill?illP511151Q515211L211iiiliiiQ2111111FZZYLIGIE1iiGilGiN1illillZHPilliidIiiNIKEHIEGilIllGEGilL51GIIEIZIIEF1GIG51581511LEGEXEFIG521IGSGi?HEI?IIEl??5iKIiGiiIiwmImmwmrz5 In :EE ... :E gif E52 535 TEE? v :EE :EE 525 :zz E55 :gs 52: EEE E35 H: :za egg as SE E52 E35 E55 EE EEE iii EEE :sa S52 525 -Y' is EEE EE ig E55 iii iii iii gag is 5 almm.,ummmnupmfm.mmIn1InwmnlwInU-yu-mwmrmmvmWn11.4wmvunlmflmymummmfmmul1Inmm.W1u1In1mmw.IWummm..WuvW.1wInnumm1mmmyrmIn-.IXmmrmInH.mynmHnu.HvmInW1In1InInkmnlnnH.WlmInInU.nnmNinnumm,mmNH1N.HWNvwI.NInunvunnnnnummNynIn1InInNInmmlnumNmm1InrmInInvmNIninmmInNmmlm1Inm1InmnmummwmmlmyH.vmnm.,mm.1.Humm.muN,mmH.mmmnmnlmmw-.uuma S 5.-mmnumumnumummmummInwnwmwInanwinunvumwmamrunnmw1ununumrnmumInnumnnyuummmInmnunhInInummmmmmnynulmwuwInrmmmmnmmmmuIninnuunmInwuvnumInunfmInunwnummmwummInunumvunuummvunumwnwminwinuvunumnumfuwunmmummnlmuunmmmummlmmuInmvmwInulmummunummummmummmummmul1vfuvummmHulmmmnumwnu.mmmumnmmmunuumvmnulnnxme Page 495 U l I IAIIS Sigma Alpha Epsilon Founded at the University of Alabama, 1856 Wisconsin, Wisconsin Alpha, 1903 Number of Chapters, 86 Roberts Carroll Donaghey Omsred Pfcifer Cotfredson Klapprotl Wilson YValker Adams Fawkes Cooper Alford Moe Evans Trowbridge Bainbridge Ferrer NVarner Nelson Adembers in Faculty ROLLIN HENRY DENNISTON EDWARD GEORGE HASTINGS LINNEAUS WVAYLAND DOWLING WILLIAM OSCAR RICHTMANN WILLIAM FRED GIESE WILLIAM HENRY TNVENHOFEL 1V1embeI's in University 1919 GORDON DALE ADAMS THOMAS MASON BAINBRIDCE HENRY LAWRENCE GOTFREDSON 1920 CLARK JOSEPH CARROLL PENNELL CLARKE KELLY ' ARCHIBALD HUBERT FEE KARL RAGNAR OMSTED RUSSELL MANION FETTER HARLAND BERT WVALKER 1921 ROY CHARLES GOTFREDSON RALPH RAY MOE WALTER HENRY l'qLAPPRO'l'l-l OLIVER XVENDELL PFEIFER CHAUNCEY MACINTYRE ELLIOTT XVALFORD SPARLINC MICHAEL MASON NVARNER 1922 CHARLES ELLIOTT FAWKES ALBERT HOWELL MANN FLOYD ELMER NELSON RICHARD ALEXANDER ROBERTS ORVIN SALE FREDERICK NEWELL TROWBRIDCE FRANK EVERETTE ALFORD WALTER BEAN CHARLES THEODORE COOPER ELLIOTT MCLANE COWPLAND JAMES BERNARD DONACHEY EDWARD CHARLES EVANS LAWRENCE JOHN XVIILSON xxx z. W., IIIIIIIIIIIIIIIIInI.IIinIHIIItIIIIIIIIIIIIIIIIIIIIW IIIIIITIIIIYIIIIIIIIIIIIIIIIIIIIIIlwr-Il-mlm--II Page 496 wmmumumumummnnmnmlmmnmuummmmummInummInummummuwmmfmmmmnmuw-mmumuvvumm.mwwmlmmunmmumummmmmmumumInwInulwfummwlw-mmmmvmIn1uwlurmfumlmmmmunmulummmwuuunnmmwnummmXmmymmmwmmmumyumuInummuvuwmuuummumummummmmmmummnumIn1vuummmununmmmnmummmlmnn1runwnmmnnmmmm.mwwmnmnm Egammammmuuuuummmmnmmum1wmyummm..1lmummmummmumInummyuummInInwWwInrmXInul1mvm1.I1Innumm1myH.1yu1H.1,mmnvw1mm:mmmym1InrmmyInwInrmnnm1InunummInmKmm1ulul-w.H1I-11yu-I1ummInHurmyuru1mfImInrmm1In1.HnnnnIHinXm1inmlnum1H.NN.W1ml.H11-1M,W1vuXInunmmlummIn1ImInm1InfmHmmummmmm.fmum.I1W1Inn11mXm1H.WwmnfuInvmm1W,mmW-1--wlmmhmug 53 EEE E2 Ei EEE EEE E? EEE is E ' E E I E55 E5 5 s 2 1 E E -E 'E E E E ' 5 :i if E22 if ESE if: EE EEE EEE 21 222 is 55 EEE E' EEE 32 SEE 522 if 5 E Z iii ii' 225 5 5 5 5 E as SZ? 2,5 E si E 5 E E35 E Q 5 gii,.....m.,.........,,,,.,,..n.,,.,,,.,,..,..,...,,,.,,.,...H.,...,,,.,..,,..,...,.,,,..,..,......,,...K..1.........,,..,...,..,..,,.,,..Q,,.,..,,,.,.,,,,.,,..,..,..,,,,,,.,...,..,W.,,.,,..,,.,,..,..,,,,,..,K.,,,,.......H,,n.,..,.......,..,,.,,..,...,..,..,...,..,,..,..,,...,,,,M...,......,,.,,..,,.,......,...,,.,,,.,..,,..,..,,.,,..w,,..,......4...,..,..,..,,..,m,...,K.,,,.N..,M,...,,,..m.,.......,.,,..,,.,,,.,,..,,..,..,..,,,w.,,..,,..,,..,.,,,.,,,.,..,,,,,.,.,,,.,,..,,.,...,,.,..,....,.,,,.,,,.u..,...,,.,.,....m...,,.,.,....,,.,........,.,,,,,,.,,..u.....s E 5 Hmmummmmummmnummum-nmw.mmnnmvuum--mumnmimmdMiniinHIMwhiinivi1Riiii6ivGihi1wIEEEMZZIGEEEEZIQFEEIZHZEEEFii?.liuiiiiDilhi1K?HMFiIEMNHi?vEi1hi1Eh?-IMi-H'ivIllinimRlMhif?l1iv2rimixhhiiliwHMIwEmii1i6.iuMihi1iliwiinhihiuiliniiwiiiliwEEnihiniwiivinhhiihF-irilii-JGEKINEElhhhIENinEDElihliiiifiiiyi:IEQSIIIIMIEFIMEGMIIE151351IiiiiiilFQIIIIHHHEIHIRZWIIIEEEHIIE5IIIEEiS2IH5EIGEEEIii25EIliIY?NiEEEI75iiIiE?Mfuminf Page 497 I I I I iiiii I II II Delta Kappa Epsilon Founded at Yale University, 1844 Vfisconsin, Rho Della, 1906 Number of Chapiers, 43 Colville W. Leaper Watson Hills Flogaus Pritchard Beardslcy Collins V. Leaper Blair Wheeler Vsfaln Zul fer Murphy Coleman Pinkerton NVard Bailey Barnett Spielman I-linners Duncan Dayton Thompson Cram Membe1's in Faculty OSCAR JAMES CAMPEELL EUGENE ALLEN GILMORE Membe1's in UHiU6I'SZ'l3l Graduate CLEMENT JOHN COLEMAN 1919 CLARENCE LEROY COLVILLEE XVILLIAM ALBERT FLOGAUS CARROLL COLTY HILLS 1920 EDWIN ARGYLE BAILEY FRANCIS WILLARD DUNCAN VERN CLAYTON LEAPER W DANIEL FRANCIS MURPHY ANTHONY GEORGE ZULFER, JR. ALONZO WARD, JR. GEORGE ELY VAN I-IAGEN, JR 1 921 KENNETH BLAISDELL CRAM WILLIAM BENTON DAYTON ROBERT WOOD WALN DEWITT VAN OSTRAND PINKERTON 1 922 LAWRENCE THEODORE BARNETT WILLIAM KENNEY COLLINS FRANK CARY PRITCHARD EDWARD HUGGETT BEARDSLEY RALPH GORDON I-IINNERS HAROLD JOSEPH SPIELMANN JOHN PORTWOOD BLAIR WESLEYS TEWART LEAPER STUART EDWARD THOMPSON ARTEMUS DE LONG WATSON LYMAN EDWARD WHEELER 15 - A I auf I It . ', 'ru if ,- Z , 1 ,--W-M------- -0- -'v-.v,.-v.-,. ' ' Illlfl5!!l!!l!!!!!EElflllillfllllllllllllllllfllllllli ' ' l ' ' ' .....l..l....5lJ.''lLL.L..l!......L lWH1lllY1lE'!l1!LL'Tf!l..1 I . I .. . ,,.,,...,...,,.,,..,,.,I,.,,..,I.,...,..,...,,.,,.,,I.,, I . . ..I. I ..,. Page 498 gmmmmmmWWmmmmWmmmmmmmmmmmmmmmmmWmmmmmmmmmmmmwmmmmmmmmmmmmMmmmmmmwmmmmWmmmWmmmmmmmmmmmmmmmmmmmmmwmmmmmmmmmmWmmmmmmmmwmmmmwmmmmmmmmmmmmmmmmmWmmmmWmmmmmmmmmwmmmmmmmmmmmmmmmmwmmmmwwmmmmmwmmwmmmmmmmmmmmmmmm z, ..,..... N n....,..,...,.........,,,,,..,,,.,...,.. ,,..,,..,..,...,......,,.,,,,,,..,......,...,,......,...,..,,..,.. W ..,,.,....,,.,.,...,.,......,.. ,n.,.. ,,...,.....,,..,,..,...,..,..........x...,..,...,......,.,..,,.,......,...,,.,..,,...,........,.,,.,..,,..,......,...,,....,.,...,..,,,.,.,,,......,,.,,..,,.,,.,.,..,,,.,....,..,...,.,...,,.,,,,,,....... , .,,,,,......,...,..,...,..4...,,.,,,..,,....,,,,.,...,,.,,,,,,....,,,..,,..,...,,.,,..,...,,,.....,..,..,....,..,,.....,.,..,....,.,,..,,..,..,,..,,..,,..,,.....,..,,,,.,...,,.,,,.,,,.,,.,,,.,,..,,..,,..,,.,,.,,.,,,,.,,,...,.,,......,, E E3ymmmmmmmmmmmmmmwmmmmmmmwwmWmmmWmmmmmmmmmmmmmmmmmmmmmmmmwmmmWmmmwmmmmmmmmmmmmmmmmmmmmmwmmmmmmmmmmmmmmmmmmmmwwmmmmmmmmmmwmmmmmmWWWmmmWwmmmmmmmmmmmmmmmmmmmWmmmmmmmmwmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmgE E35 Z2 5:2 Ee EEE Ei sii -- ESE 52 333 EQ EEE E5 55: az EYE EE EES EEE 55 555 S2 a- E25 535 E35 EEE iii sae E55 E55 -1: EEE E55 YY S22 EEE EEE if gig E52 E53 SSS F5 E EmuummmmummminnmmmummInm1Inm1InmwnummummmInummmInmummmIn1InnuInummInvu:mmmyvummm.vmululwnumInruunmmvmmvmmnnInnunummmnumunvummm:unmvnmmu1uummmmnnmnnmmmmuummunumnmmmnmufmmmmmumnmmmmm1mmfmm'ummummnummmmmmmm.ummmfmmmmnmmlm-mlmmmummmmnnmmmmmmmnnmm-Amummummnuii2 munniiifiiMRi5EIEiiEEHMEEEEEGiRiiYGiEiiEiKiiliEIiiUiEii?iiEEiEii5iiliiIniG5iRFEEIIEIRiIIEIEiIEiEiiiEiMiGiEiiEiinHnnmEIGIGIKIEEEIFIIIIEFEEiiimiiiiiiiiiiHIGHumnummmunn:mmmwmmwvunumnumIvIxmuumummmunnnumnumnnummmmmmmnmmmmnummmmmuun1n1nInImlnmunmnmmuunnuInnmmmummuumuInI1IImmnmmmummmmnwmum1ummmummnmnmmmmumnnnmumwnnmmummn Page 499 SEE SEE 2.5 E52 525 fi: mmm'-W .l'..lA-- S w ...A NVVVHVINUI I I I MWLINM II I I I I I I I I I In nunIIIIIIIIIIIIIIIIIIIIIIIIII IIIII I II I I I II IIIIIII O61 ' Founded at the University of Michigan, 1904 Wisconsin, Wisconsin, 1906 Number of Chapters, 24 I Ebling White Pease Jenks Wilson Clark Axley Behrendt McNaughton Ayton Cail Borsaclc Clugston Freund Tisdale Members in Faculty ERNEST BEAN PHIL ROBERT CLUCSTON F RANK HADLEY ,111-IOMAS EDWARD JONES CHARLES KENNETH LEITH VICTOR LENHER FORD HERBERT MACCRECOR WVILLIAM SNOW MILLER CHARLES HENRY MILLS REID FRED MURRAY RAY SPRAGUE OWEN JOSEPH BERFORD THORKELSON LOWELL TOWNSEND RICHARD ENGLISH VAUOHAN WVILLIAM HARMON XVRICHT Members in University Graduate HAROLD AXLEY LESLIE MCNAUCHTON LLOYD LEONARD CALL WILLIAM BURLEICH TISDALE ' CLEVELAND JAMES WHITE 1919 KARL KASPER BORSACK ELMER RUSSELL CLARK JOSEPH ORIN XVILSON 1920 OTTO HERMAN BEHRENDT WVALTER EMERSON FREUND WILLIAM EDWARD DRIPS LAWRENCE ERASMUS MEYER HARLOW HEATH PEASE 1921 THOMAS WILLIAM AYTON NVALTER HENRY EBLING an fqfgy YI. , .y if . Zi IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIII III II I:IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIVQIILIIIQIIQIII I I IIIIIIIIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I 'T I 'I TI 'TIIIWITITIIIIII Page 500 IIIIIIIIII I. IIIIIIIIIIIIII III. IIIII III IIIIIIIIIIIIIIIIIIIIIIIIIF5 'mn mnfnmmmInmwulw-umwInummmnumwIninmlmmmmnffnmmnymmmwInqumnummwmunmwqumummnumwuwunmyumnnInmvwnnnwuwuvmn:muwnumwuwinummnnnumyuwmmmusnwInwuyuwmulmnnfwuwm1In1minwInwuXmvmIn1nwufwInnluummufun1In1uvXmmuwInuninwruuInmmuIn1uwmwruinumummumwInwuwInummnuufuInyuwummm1InnumwmummmwInwanmmfmuinunumuuvmunmunl1rmmmfummuwwmmmumumg ulmnuIn1uwwInuvwInInwInnnwnuminwnvfmIuwmumInnlwnmuuuummIwnfunmmwmmmmfuwInmnu1InwmunnuununinwmwuwanwInul1mlInwnwmwmwInfu1Inmmmuwmluufn11mfuwmwInuf1fnwul'mmumwmm1num1minuInwInunfuwInuInmwIn1Inwu1in1mwInwIn1mInuIn1Innum1numummnmnumu1yu1In1u1HrwmvmunwInvmunInwmnn1rn1ImInwuuufwInuummmmnmgE5 E 'QRIIISYEITYIREIIEIEiii?iiliiilPHIiilliiilil?EUHRiii?IIKIIIIFFLIIZiiiiiiludmmm . A 4. .. . ,,., M 5 2 r sig 5 E TY T' 522 K 7 EEE :L E E 222 T Q ESE 23: EEE I 555 : 352 EE EE EE 5 Q E E EE iii , EEE 555flunIn1Inwuwunmm1ul1Inul1inulmnInulwlmInulmyunIn1u11mannnin1InnmuUn1mmmm.1nvunIn11311.1inm1um-vinwuwminwmpn1Inmyn1wnmw5.15.41inngWw-IwvpMul1591551551315lm5:5H53W3tgMlm353155M55553ufmy5531553555lmMm1IfN:WmmV3Mynrwfm!hmnf.Q1151551yuinP51yumw1I.XInmf1HmyXInw11XInX.IMX1UXInwI.XHU..fmmXnnInunHmuummH1InWIn1InuvXWX.UH.wmnnInWInmfmXnn1flmXnumH.Nmuwmm.mmmii ' ' ' ' ' uwnvwnunmummInInwuunwnwInun1nupnunwmmnuwnvinvuvuwan1mnuvmmnmannnunmnuwmmunuvunnunnmmnnunmu11wrmInnunuwru1luunuxvnwInnunmanwmunwrnwuwmnuuuuuvinwmumnnuuumxmmuul?In?Inhi11HIIIHIE1IIIEIIEEQiii!EIIQIIIIlimi?IIYYIIYHIIGIiEHEIIUHZFIFiiiIii?IHIIIQRGHINGEH1IillIiillli1iii?ii?liiY?i?lii2IFl1?iiiFi?IIIIEFGQHHGIIHIIEIIIE smhmmmuxuuinnnwnnanun1uvmunnumnmmummmmunwfnwunmmmmmmmInulunmvInmmmmnmunmum1 P L1 g e J' 0 I I I I I I .......,,.,...,.....,, . ....v.II..-..,,....,.,.,..,..,. I' V U I Alpha Tau Gmega Founded at Virginia Military Inslitute, 1865 Wisconsin, Gamma Tau, 1907 Number of Chapters, 66 Culbertson Thompson Paul Yauman Neprucl Bryden Lewis Mclcher Faber Mueller Pryor Montague Moore Zubrod Stalao Fiedler Householder Harker I-Ioehn Frazier Members in Faculty PAUL FRANKLIN CLARK VIVIAN ALLEN I-IENMON JOSEPH SPRAGUE EVANS ARTHUR GIRDON LAIRD WALTER JOSEPH MEEK Nlembers in University 1919 JAMES ALAN BRYDEN EMMET JOHN MUELLER NILES EVIND STABO 1920 CHARLES DEWEY CULEERTSON THEODORE GILES MONTAGUE DONALD JOHN FIEDLER DAVID WESTON MOORE JOHN WILLIAM HARKER LINCOLN NEPRUD GEORGE SEEGER I-IOUSEHOLDER HERBERT HAROLD SMITH 1921 ARTHUR CHARLES FABER GEORGE PAUL HENRY GERARD HOEHN GEORGE RUSSEL PRYOR LOUIS CHESTER MELCHER JOHN NORMAN THOMPSON CHARLES YAUMAN 1922 STEVE WALLACE ANDERSON HELMAR ARIEL LEWIS LEO CHARLES KAUTZ EDWARD YOST HARRY STUCKY F RAZIER EIN ,O.,, ,,.I I - , , if S2 Q A NRS .ar - ' A I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page-502 WILLIAM BOARDMAN ZUBROD Smith II IIIIII III II IIIIIIIIIIIIIIIIIIIIIIIIII III II II IIII IIIIIIIIIIIIIIIII . n...mm.m.m............ u......m.mm.m.m.m.....L E.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................m.........9................wLW Vlrv- Alllvhh K iiuv- M MIM g 3 5........................................ .... '..........................'?................... '........................................................................................................................................................................................................................................................................................................................................................................................................ '........ ............... ........................................................................ '........ 2.E 5 ef: EE :ze E25 2 I E 5 Y 552 . Q 5 EEE EEE E52 EEE EEE 255 3 iii .,,..4.......,......h,...., N. ........................... ...... ... .,.... .... ..,. .............. ....., ........................... .,..,,. .............T................................. .... .... .,,.., ... ..., ..... .,.... ... ...,. ........... .,.... ............. ...,, .... .,.... ..... .,..,,.. ................. ,... ................ ..... . ..,., . ,,.. ......... .,..... ................ ..,,.. ..... ,...., ........ ..,K .W ..,., ..... .... ..... ..... .....m.. .... ..... ....... .... . .... ... ................................................................................................................................................................................................. '....... '................................... '......................................................... '................ ......... .......... 71 IlllllllllllllilllllllllllIIIIIIYIII!LII!ll!lllull!II!HINIIIIII1Alhllhllllllllllil E'.EEGii1ii1E7.iiREBER?EEKGEEGRRIEFGREEG...nu..n..n..........mmm.num.muvm...un.um.m.....n...un.num..................u....... Page 503 J I I I I I II IIII IIIII III II I II III I IIII I IIIIII II Sigma Phi Founded at Union College, 1827 lVisconsin, Wi.sconsin Alpha, 1908 Number of Chapters, 10 lVlcPl'Ierrin Crandall Taylor Callander Hall Chadbourn Richardson Chamberlain Follett Reed Carver Clague Robertson Gilman I-lunt Roberts lN4ul'Ilenl:erg M6mb6I'S in Faculty STEPHEN WARREN C-ILMAN GEORGE IVIGMONIES HUNT MembeI's in University 1920 GEORGE WASHINGTON CRANDALL JOHN XVEITZ MGPHERRIN LAXVRENCE WATERBURY HALL ALBERT KNAUER SCHEIDENHELM ALFRED I-IENDRIGKS TAYLOR 1921 JOHN MORGAN CALLANDER, JR. LOTHROP FRANK FOLLETT HORAGE JONES CARVER XVILLIAM JOHN PICKARD JOSEPH NOURSE CHAMBERLAIN PHILIP DUNHAM REED KING RICFIARDSON 1922 REUEEN CORNWELL CHADEOURN CHARLES HENRY MLIHLENEERG COLEMAN ELLIOT CLAGUE DAVID TRACY ROBERTS RICHARD CHAMEERLAIN ROBERTSON wx 1 II In II IIIIIIL I 2 'J' IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII III II ISM Mmmm-Wm maximal., I I I I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I II II II III II I II II II I III IIII I. Page 504 Ez ,mummnmmnmuuununmw1I11uvnlnuwInmwvuwInvuulwmXInmmW4wmuiiFFI?ii1iii?ii5ii'i 15.591511111235151wmy1Innwvmuwmmyu!rnwm1511mwmnnmWInfmfuWmfmfn1Inm1Wvmwmnmmnmmmfm1munmrmunmunwmin1W'mmwnuHwm1vmH1ufvmmwVHHHmwmn14W1mwmmXvu1fuurum1vunumun1uumlmvuwru1vuuIu1mmfmmmmmumwmm1fl1m11-4muu1fu1Inw1umrmmlmvm1yummmuummm I EgqmmnumummwmnmnwInvumumunvu1fmmnumwmmwmfmuuruumnwmwmmwmfmnnmnuXInmnunnnuwuwuU1m1Inunvmvu1mwminmmmwnnmnm I V.u..m.,..4mm.w.mm..4,..w.m.m..,mmmm..vmym..H.m.-nmW...WWWm.v..mmHW,...u.ym..w.mv..f...mm.g mH.H.XH.Y1.1...W...H.,,HWK.,,..,U.Wvw...W.1WH.W.1,,.UlmH.,WK..W.HH.,Km.HH.....WH.,WW...K..YH.,.UK..Y1.,.WN.Yml,HN.,K..,V..WH.,..,mmHH1...,..m..H...,m...H.,,H,.AVH,U.,H.,..N..,..HWH.,,mmH..y..H..,..,,.....4WW,W...,.HH.,U.1WU.,H..v.,,H.H.,H.,,..,.Hy.HH.,W...,W,1W..u..,..H..m.Eg5 E 1 5 5 1 : 54 E -E as E35 LE 555 513 552 5:5 ' EEE K :ig S22 2 S35 1 E52 5 235 E25 7 gig Z :ga EEE 215 Sis E 525 2 5 ' EE Eli -:I 225 :iz 552 Ei. iii Eff 1 2 5 eg: QE 5Q..5U..,..,K..mv.H,,,X,.,WH..H.W,.U.U,....,Uy..W...,...H.W,..,,.,1.,,,.1,H..H,L.H..,,...m,.U..,y..,W,,....,U.,,H,.......m,,.,,..H.,.y,,.H..,...U.,,y....,,W...l..,...,..,,.,...,..1..:m,...Ef25m53mm,Ezffmfm:EIf5:52gmmggmgggggggggggggggfgggggggggggggggggggggggggggfgggggggggglgggfgggzgggggggffggggfggzg:gg511:5:ug1::13155Q1Q2f35::2:2u1:z2::2r2:21:2f5::22, ' ' 'M IIuivinwininhuvuwInnnwmmwrnwmmnuannmmuwnnunmuminmmrn1mmwuwnwmwmmruwnwwInInnnnunlwmmwInwumwmvuwvunuInmwmWfummmnmmnm1HmNuXwuwmnuin'mm1u1ufmwmmwvummmwn1ummmmvu1WHwmwu1I1u1n1mlmmvmrmummmlmmm Page J'0J' U.,,.,,,..,,1,.,,,..,,.w.,W..,,..,M,,..,...,M...,..,.m.,.....1....,.....,.,..,.....,.2 I E mnumumm1uwunmmfvmumm1umwmw.I1nu1InmmmH11umfnnmmwvmmummnumn-:mai I uInIumIImIummnnunmlvrlummmmmmm II mmunmmmlmrmm num I In un II I I II L Alpha Sigma Phi Founded at Yale University, 1845 Wisconsin, Kappa, 1909 Number of Chapters, 21 Kiland Marks Scott Perrin Doege Taylor Pieh Gildermaster Pinther Spengkzr Schubert Bakken Porter Barth Hanson Velguth Bacon Melaas Hammond Hoyer Sollict Members in University 1 91 9 HAROLD EUGENE MARKS KENNETH LOYAL SCOTT PUDUTJ 'Fl T1 Om? NOC 3,275 wir iZ 'E mw'11 fro.- ZPFU Ojn-IH EUQ pmaz S52 5270? zr-Q 12,0315 15 02510 PHC? 5930: SIR ws ss OSP m Q zzm 7, Z 5 z Z 2 3 U na T' ES we E S. YN. lx: NI N tv N4 Q KT1 I O C HAROLD TESTER BAKIQEN LYLE STANLEY HANCE 'Wx f.,, U I Q A Y is Af' -wi' I. - . .II ..,....., ..,,.,,...,.. , ..II..I.I,II..III.I.II..I..II..I.II..II.II..I.III.I...I.II..II..I P a g e 5 0 6 SILAS LLEWELLYN SPENGLER PAUL FARRELL TYE IQAREL CHRISTIAN MELAAS ROY JOHN PIEH HAROLD OTTO PINTHER CLARENCE FREDERICK SCHUBERT TH IQARL GUSTAV IQILAND HUBERT LOGAN PERRIN LINCOLN AE-EOTT SOLLITT COLBY ARTHUR PORTER XVARREN ARTHUR TAYLOR wmmmmummmmu-munwwmuml1unulummmmmmmmu uwmmummnuvuumvmuumummmvmuunmmmummmfnmvmummmwmulrm1InulVfmInvmmvmmmm1HvurnwInwnuuwInvmvuwnwrnwnunumummwuwInmlfmIumuulWwlmIHwyunmummwmmm1mwmummmwwwnufuumIn1u1mwnuynnmvumwm1mnumumlmmmnmvunmuwvunuunyuwIuummvuwInvmunInummunm1Invmummummvuwummmuwnnnmumg gmmun......mmunmmummulmmmmmmvw-mmmmwmumuulumnmmuvmummmummmnuvuwInulrmmm-1.H1mnuW,mmum1.1H.mm..V..mW.....w.vmm.numW1H1...W,m1V.1rumuufvm--wmun-ummmmmyuun1.HIn1Inum1mmUI1vm.1XL,IWm1JH511lmV..HIGH,H.1linyiiii.,?ZIFJ.IEFiivQUINZZEIEIWHyhillilihX.HPi.4i5EIU,.i.EF11,EIGLummHILL11HIn1yuNfmfm.1W1IHnvX11.Wfm-1Ifmumrmnm-Hnum1fmnwmmmvw..1.E'5 5 E E E E55 E 1 5 Q: E w 555 EEE Ei' E5 ,Zz El EE -.5 Ei si? S12 fi: EE EE EKE EEE :ff E55 H: E22 5. EE sg? --- E22 SE EE S25 EEE EEE E25 E55 5:3 EEE E25 EEE Sig SEE EE EF ' Er? 5:5 I . . ,T Y .V E if E22 1 EE 1 EEE i SE si Ei age E12 5 2 -if u um mummmwwmnmmHnnnmmum-1ummmnummmmmmm:3 E E aT..n.5f.mm..mm.....mm?H.U.mnIn.WH.H.,K..1.....m..m.nu...wmv.H,V.,,.m,..wm.,mm.m.um.m.w.mmw.mmH.X.mn,mmV..X.mV..mmnuW,mm,y.XWmyV.,nuWmy.HinmmmnL..lmH..WHXH.nm.,N.mm.my.HH.X.HV..1um1WH.rmrmmmmlufH.WmH.N..Www1.X15ugfmmfguwwgM555gmgjgffgf955355333g35533353gggggggggggygggggMgggLMg3L,,gM,M xlkl M,,,,W,,, 1 : ammwmnmmummmmnn'mmnu-mmvumumnumy-mu1mwmm1mmwmmmmumlmmmummumummInmmfwInlmH1m1mmmmm-161mmmmmmum1fmmmm...mnumrmmmulXmm,InummmmmummmInmmm.1mmmwmmmnummWummmmf1Inmm,InmmmmmmlmI . ,l......m.m...HWKm...V..um.,WWH..mn..K.....,W.,.......,..m....,H....,Wmm..l.....,..,,....,m.u,.u.....m..1......,....,..i..............,..m..,..,,..1.1.,..,s P a g e 5 0 7 gn I ru ul Iv I nu In I I u Zeta Psi Founded lat New York University, 1847 Wisconsin, Lambda Psi, 1910 Number of Chapters, 24 Le Claire Peterson Riggert Fitzmaurice Mahoney Gregg Slocum Seeber Blum Marvin Jourdan Pomeroy Elder Travers Members in Faculty WVILLIAM HERBERT PACE JAMES HENRI XVALTON Members in University 1919 ' HAROLD FRANCIS VAUGHN 1920 GEORGE LOUIS BLUM, JR. GRANT ALLAN FELDMAN RALPH HORTON 1921 WILLIAM DUNCAN CONNOR, JR. ARTHUR HENRY SCHNEIDER JOSHUA GOWER ELDER TAYLOR HAYHURST SEEBER RALPH LOUIS JOURDAN CHARLES XVESLEY TRAVERS 1922 JAMES MICHAEL FITZMAURICE ARTHUR DONALD lVlARVlN JOHN WYATT GRECG STERLING DONALD PETERSON DAVID JOHN MAHONEY EDWIN XVILLIAM RIOOERT ...I we - , ' - its-WMQ I IIIIIIIIIAII.rwImI..II..II.I..III. IInIIIIIIIIInIInIIIIIIIIIulInIIIIIIIIIIIIIIIIIIIIIII Page 508 mmmnufmmmnumm.mmvmmmummummm.1In1mmnunm.mmm...mm1.HnmmumIn..mm1I.1vmmm.nuwm1InH..mmm..m..Hmwlfmlmm...fmm..-...H.-...-..H.1H..nl1U.wH.m.lnm.m..H.mH.1m1ulnnmyInmw1.11H1mvm1mH.1fu11H1mm1In1m1H1nl11.1m1mw.I+1uwm11H1m1H11n1myu.1H1m.mmy.Hun1Inuwmumumwm nmmmmm.mm.I.1Inm....wm..mmm. 1 . 1 f . .. E.. ' . ..f '! 1 ' 1 L'.. L 2 5 Tigumummnm.mn.m.Innmm..um.-..ummInwInunI....Mnlmuul.m......n.-..ummm1...ml.W.H.um.........-..HN...HU......-...In...1m..If1m...4.wK........M.........H..H...4..4.H..N...H..HH.1.H.-..H.......N.-..H..-..w1-1.m......v-...W1.11.......H.1.......1..1..........1......1.......1.........................................H..-...H..H..H.H1....-....H....A...HH...m.H.ll..limiuiii...1I11H.1...Pillni1Il?hihii.Qiiihli71.1.iiiii?EIIZIISIERIEIIJDIIIZJiiliiiif.Tii1IIi12ii3il11lJGPlGlT.2E.1-f I E 2:5 E52 EEE EE SIE iii 2:5 sus 5: 552 :ig 552 ' :F E55 1.5 515 E 2 22 255 EE if? EE -, . E gg 5 : :is , 2 ' -g -2 E: 515 25: Q53 , , Sig sg . E15 E55 E22 E53 E15 EES sn: :ss :rs sis is ' 255 ESE :iz 555 EEE 232 E55 ggi E52 EEE ,1- :ii E25 si: E22 E 5:5 2.5 : E E., 2 . 12- E25 225 555 ii? 5:5 if . . -in :Ee EEE 555 iii EEE iii -.. 35 EEE 233 :iz E22 225 5.5 sis Ei? EYE EE :ee EE ,,. sig .2 5 sie E :ss EE gag E2 2.5 :J iii EE :fs ESE E E gas 2.5 :3.......n...........m....f..........U......................................................................................u..... ,... .......... n.,.,n .. .,,... ..... ...... ............................. ............. ........................... .... .............. .... .... ....... ......................... ...... .... ...... .... . . .... ...... . ... ..... ................. ..... ......... ....... . ............. . ........... ........................ ............ .......................................... ..... .......... .... ..................... .... fu..............................m..........,is smznmminzizzzmam:iir.i..iiimini1miQuinasiiiiamsmiamiiianmmiimazasnmiinzziarmmnnizmianazszmmzimaziaznmmiszanmamnnmmmnzamaaniiniisammmmmmammaximianinmn:iGn2inimir.ii1:mnsmnminmsamnzmannzasmznnlima:smsmnmimzzzn1nmnzm. '..........m.......:.....:............................................................................................................................................., P cz g e 5 0 9 IIII IIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I IIII IIIIIIIIIIIIIIIIIIIIIIIIIIII ......i,....-,...,.,-....-...-... ...L.,M.....I,...,...I.,-...,......-.A..,. m I I IIIIIII IIII II IIIIIIIIIIIIIIIIIIIIIII III II II IIIII I II II I III Chi Phi Founded at Princeton University, 1824 Wisconsin, Kappa, 1916 Number of Chapters, Z2 7 Hawks Trumpf Deuss Emery Hutton Hodgins Taylor Johnson Moody Noer Higson Stone Wallis Coomber Rieck Aylward Upgren Millar Sharp Klann Kiekhofer Thurston Allen Bigler Baker Crownhart Heusron Hubbard Harris Matzen Burt: Dowling Conine Beach Members in Faculty ALFRED PAUL HAAKE ADAM VAUSE MILLAR F RANK CHAPMAN SHARP WILLIAM HENRY KIEKHOFER MORTON OWEN WVITHEY Members in University College of Law LEROY JAMES BURLINCAME FRANCIS DELMAR HIGSON HERBERT MILLER BAKER EDWARD LOUIS DEUSS JOSEPH BARNES BEACH JESSE GEORGE CROWNHART GERALD BURGH HODOINS JOHN ADOLPH BIGLER -' HOWARD MERTON COOMBER PHILIP HERSCHEL DOWLING HARRIS GIBBS ALLEN ARTHUR WILLIAM AYLWARD ROLAND WILLARD BURTI 1919 E ALFRED NEW.WAN HEUSTON HERBERT JAMES MATZEN 1920 ALVIN RIETBROCK IQLANN SIDNEY FREDERICK MOODY 1921 CLYDE BURTIS EMERY JENNINGS BRYAN HAMBLEN WINFRED EDWIN JOHNSON 1922 WILLIAM HINMAN CONINE EDWINC OOLEY GUYER ROBERT AUSTIN HARRIS .J I' K 3 as Q45 I V . mfg.. 'K '..:.5' 'XRS ' I ?Z.524e.+Q, IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II Im II I ' iiii1iiiliFIIWIHIZEIIEEIEEHIIREUIIEEIISIIEIIEEEIERIIIIIII 'i' Page 510 WILLIAM HENRY NEGLEY HAROLD ROLF NOER CHARLES WILLIAM MUTHER WYMAN SYDNEY SMITH ARTHUR REINHOLD UPOREN ANTHONY WILLIAM PESCH CHESTER EMIL RIECK ARTHUR CHANDLER TAYLOR RALPH ELI HAWKS ALFRED DWIGHT HOTTON WARREN SYDNEY HUBBARD I III I IIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIPIIIIIIIIIIIIIIXIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIII II II II III II III III III II III II I II I II III IIII IIIIIIIIIIIIIIIIIng , IIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIITQ I IIIIII II II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIYIIIIIE I III IIIIIIIIE IE E .ig EEE SIE Eli asa EEE .Is Eff E'E E E SIE Eli II, EEE E15 EE EEE 555 EE E55 EE SEE EE E52 SE is EIS EE SI: E55 :IE SIE Eg JI Sig EI: SDF II IIIIII IIIIIII IIIIIII IIIIIIIIIETIYE :IF SEE EEE EZ .gg I SEE EEE SE 5 E EE EIIE E E 5,2 EEE 555 SIE gmmmmnmnmmmununnnImmunummunnnnummmmmnmnmnuuummnnnmnmumummnuummnuanw:mmmummymnuunummmmwnummyummInunummmmuummufmnumnmInvu1mmummumfuulmnummmnumIummmnuInunmnm.mmmwnmmumnmm.mummummummflunlummunnmmmfummmumnmnvuummunvmmnuummmunwInuInummmmmfnumummInmunummnmnnummmunmuwu 5 gum.mmummmm-1.ummm...mmmmlmm..w.m.....m.mmmmmm--mmm-Ifmnuuw-mmInnumm.rmmumHHnuInmumInHmmm.-mmfmnulmmwfmmmnvmnummmimummInummlm.mmnu.mmK..wU.X.UH.whm-IEE.nil.:WIIFQFIIEXIEIHMEIDIEHEIEIIGTEGEEZXIEEIIHE73175511HHHREWEEiMEZEIEGIRIIIIEIKEMEHEIEIIEEEIZIEIFEIEUEIEIIIIIIMIME?EIJETGIEIEFIIQZIIw.MRElHE..m..mmm.m.mum,.,mg5 E35 5 E 5 E 235 S35 5 5 Ei! SE 555 EEE E52 555 555 Sig EE EE EEE E45 522 53- 55 E E E E E -15 5 E25 4: E35 QE E . an Elmm..n.m.nEEiEEEIEMiEEiEEEiEEEKIIIIEEIEZIIKJEEEEIRIEEJEEiMMIEKiMEIElERiiiiEIIIER?R?iRni1iRiGuIuRmiufumm:ulInwummmmmnummfnummmmunmmuumnummmrmummmmmummmulummmmllmummmmfInunmm'numnullmlnlmuunvmmunlmuInmmmmmmm,mmm,nuummmummmnI11mmnmnnmlmwummnnmmmmmmmmnmmmnmmmmmmnumumlmunmmmma Page 511 m un num I I I I n Ill I IIIIIIINI I n I4 I uw--Ulngllggmu I II I I I I I I uname Delta Thi Epsilon Founded at the Unirersity of XWisc0rIsin, 1916 Husting Lorfeld Madison Newman Ends: Quarberg R. Falstad C. Fal cad Besne Scadden Groffman Glaclclcn Reid Hoppert Scott Williams Dahlman Bjerke Keller Altschwager Zilmer Scrstad Brunner Graves Gardner Aflembers in Faculty HUGO HENRY SUMMER Nfembers in University CLARENCE HENRY FALSTAD FINLEY FURMAN MARTIN j UDSON EDWIN HENRY ALTSCHXVAGER OSCAR CONRAD DAHLMAN ARTHUR KONRAD ENDE ARTHUR OTTO GARDNER HARLAN GEORGE GROFFMAN CURTIS FRANCIS BESTE ANTHONY XVESLEY BRUNNER ALFRED HOWARD GLADDEN NATHANIEL BONDUEL HUSTING RALPH LEONARD FALSTAD 1919 .JOHN LOGAN RlENVMAN XVILLIAM HERBERT EDDY REID SPARKS WVILLIAMS 1920 CARL ARTHUR HOPPERT GERHARD XVILLIAM LORFELD LINCOLN ANDREW QUARBERC OWEN LE GRAND SCOTT BERTRAM GEORGE ZILMER 1921 OSWALD LEO IQELLER CYRIL LUCIUS LEINEELDER FREDERICK OTTO MADISON FRANCIS HAROLD SCADDEN 1922 SPENCER FRANCIS GRAVES - MILLARD JOHN SERSTAD RSF S-,, . A .I X , :EL Y I 515. , ,,,,,iI:zfSifi'e,1., If ffS.1iff:l,,:2iVek Rza A S4553 f IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII I IIIIIIIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Page 512 Q: ia . i S :ii is gQ.n......,,..w.mmvmV..my,mH.mm.,manXmU.W..mmm.,umm-.Imm.,Hfummm...U.mnU.mm.,Wmvmmvm..mm..,,mmu.mnmm..!..mm.H.-w..wH.mwm..1,.mm..mmm.m.mmmmmm..um.mm.m.mmmm..,.m.-ummXHXmX1.mm.m.m..y..1m1mV..X,1.,.HWm.m.m.mn1mmm.,yu1mmww.w.mU..,f.-uwWmX-mmumm..-ww-.Xmmm.umummwwwmmmmmmwwV..nmmvmInXInnnu.m.u.wmuw.mmmyg 5:m. ..,.,,missmmnzmnrnnznm:n:mm:amn:mnnm:z5mm:mmnmmr ,...,naman:n::::s::::::m::an::::nas:sanam::xzzzxnzas1:az:azz5::zzz:anna:san:::::::i:::as::::n::::::::,za.::..,..n.:,,..,...,,,.,...,..,,..,...,..,,..,...,,..,,.,...x..,....,..,..,,,.,.,.,,.,,..,,..,..,,..,,..,M.,,.,,.,,,,.,..,,..,,.,H.,,.H...,,..,....,.,.,.,H.,W...,,.,,..,,,.,.,.,.,..,.,,..,..,,...H.,.,.,,..N..,..,.,...,,,,.,H.N,,,..,H.,,.,...,,,,,,....H,,.,W,,...,..,...WH..W.,..,,.,,..,.,....,.......,..,,.,,,..,,.,,.....,..m..,ggg EE 522 asa EE :EE gf: -W 'S EEE E25 sag 555 E E 555 :ff -5 ' 2 EEE E s EI: E E 32 : - :I 555 :F 555 gig gig : :QE EE ' if 1- 5 E if 1 E E - 4: ,E Em Eff EE sf: 5 2 :Ss 255 E32 E55 EEE Sis EEE EE Ewa Egg E55 qs 525 EEE E55 QEE E I EE sae gs :xi 2,1 'EE -E: 1 :Eg 55 535 sg 535 ii 512 as ,gs is 215 1 q gig 1: 552 35 525 55 1 E55 W figs Q55 Eg: EE SE EE E E 5?3..y..m.,..m.,,WWww...N.5H.Uf..,WWEN.-1....f.,..mm....m...m.1..,....,.m.,m...muV.,W...vmH.im.y..vm,....,,..m....m....,...XH....mu.H,mm.l..m..,...mm...m.1.umNhmm.Hf....mm..1W.,-.nmm.m,,m...m...m..mmmm.X..mw....-fm..m.mm.m4..m.,.m..,..mm.,..H.Hmm,....,...1...u.m.m....muum.,mm,,.Hmmm,..T........mmmMW1.1VIU.m.m.m.mm..1..mu.5, 5Li,2LmMn,..,...,m E :mmnumwnunnnunmuunmnnruwunmrmmwnuunxuunum1mnununnnnnnummummuuunumxuwnumsuwvmvunu1mmxannnwm1uwvuunununvinxvixummmrnmmfxuwuwmmuwmnuInnnwanvuwannuwmvmmvuwuvwnvmruumxmnumzummvnmmuwmmunmuuunuunun1uvuwanm1luvurmnnmmmnmnnuunmunmnmmmmmummmwu1numnumum1umnnumuwmmm:unmm1rmrnun1uHInm1mumuummmuwmmvmummummummmmrx- Page 513 I I uummumm I I I I :umm 1 I.. ..I...-,mm Phi Sigma Kappa Founded at Massachusetts Agricultural College, 1873 Wisconsin, Zela Deuteron, 1917 Number of Chapters, 30 Nuzum Morrissey Kelley Smith R. Bergman Schutz Klosnerman M. Bergman Dauksys Wescphal Dohr Members in Faculty FRANK BARON MORRISON HARRY STEENBOCK HAROLD WILSON STEWART . Members in University 1919 WILLIAM ALVA NUZUM 1920 IVIILESJOSEPI-I BEROMAN LEWIS WVILLIAM MORRISSEY DONALD DOHR HARRY LEROY WESTPHAL 1921 IOSEPH DAUKSYS HAROLD JAMES KELLEY DON WHEELER SMITH 1922 ROY ANTHONY BERGMAN ADOIJPH IKLOSTERMAN GEORGE SCHUTZ I l-, ' A1 -l1 s 'ti4f3f I Q? ff elf 'Z I I I I..ITREESE555EEESEEZEEEEEEEEEEEEEEEEEEEEEESQSEEHEEEEEQEEZ.JZII 1 'W--iw m'f'ff'f2f'm'fff'L'-M-fu 2 Page 514 E. gag :P ' fs is ,E EL ' : E 1 252 522 gig 555 E E :E :se , - EEE 233 ,Ez ,W 252 5:5 E55 snEm.m..u.m..,!..1...wfgfmjww5535555EE51I51E5Igg,1m1,.5M...K..ullxllmgwgfl-f..n.nulugwwwggfX.lwwEHuy.Xufww..X1.3V..X3.1Kmmp.X.NvmmymmXmy.,mK.-wi.UXHXinX.H.mfWnu1....HX.Hmm.,umm..mlnnmmm.,mfm,H.H.,myV.....Q...,..,,.m..,K..,.w..1H.XMmm,H.,yumyfmmmyy..w....ummwn.mmmmmm..ummmm..I,mmmmyHmmmmmyummumm.lmmm.1.m..m.m.um.m..mm.fg 55gmInnn1munhmmwnlnufumyunummmvuimununmfwInulnun mnnnwnn 'nuuxlm1mwmnmlun mmmmumummnumnmfulmummmnnnum1mmwvm.mmnnInnumwInnunuH1ummInmm.1anwmnumumnmunnmyuunwInul1numm1In1nunumvuvu1InwInummnumvmmmummwInunInwnummmmmmmwmm'numummummmnmmm1funuummmmmmmnmnnmmnmmmm.ulmuInunummmmwnnwunnmmmmummgQ2 255 Ei - :gg E53 532 ' iii 'E isa gaa E : - E55 SSE 35 '35 Ei: 5:5 sis -.- 5:5 zg: -EA gif L: Sis ss: Ei? QE 4- 2,3 SEE EEE Ei? ESE 552 Ai, .V s-5 555 E 535 35: :is 555 EEE EE 5:5 ax: 2 1 : 2 Q 5 ii E 5 1 5 E52 55in-nmmummmummmInummmmmInmmmumum.mm.mmInvmU...HH.umInH.mm......M.,,.,m1...,..,1.1...U.,AyH.Hmm.,.U...um...HnuV.....M,1mlm.mmmH-nnmm.InmH-mmmfm-mmInrmummmm-.-ummInmlmmm,H.X.H...vmmmy...mm,...,......,..,,.......,,,.uummmmum....mm..m4m....,..v..m..,.m.1.H...,.....,,m...,..m.,....m..m.mw-.,....mKIfV-.mm-.mm5wmy.u13-.EMTmlflwigwlu.-1.11.f1n.......,.-1..., EE -M .....,... M, .,,.,... n.,................. .W .. ........ .... . ........ . ..,,., ,..,,. . ..,.,.. . ............................ . ..... .......... . ,..,....., ,.,..,.,......N. - .,,. ,........ ......... .....-.. ..., M ,,.,,,.,,......... ..- ....,. W..- ...... ........,...-...W.-..,,. .,nM -.---........-.-.....-.......-.,-.. , ImmunnumrmvunnmunnmmanummunummnunnmuuwununummunvunnwnumanulumInmnuwmnmuwmummmn1InmwmunmmnmnuzuwInnwwnwmmnuummuunmwununwmunuvunnuunwmummmnwmvmmumnunmnvannumwmmmnu1InmummmnunumInmunmmmmmInmnmInmmmumynmmwmnnumInnmuumnnumnuunmumumwn.mmummmmmmummmmnmmmumnmmyummmmmmmuunummuunmmlmv P ag e 5' l 5 I I I u I I P' Theta Xi Founded at Rensselaer Polytechnic Insliluie, 1864 Wisconsin, Phi, 1917 Number of Chapters, 21 Puerner Knoerr Hanson Lange Benton Turneaurc Hasenpflug Axelberg O. Terry Steele Albers Slaker E. Terry Works Golley Bellack Ivlantonya Goddard Schmidt Fratcr Brady Marshall Warren McConnell Members in Faculty CHARLES IVES CORP FREDERICK EUGENE TURNEAURE ERNEST GTTO LANGE EARLE MELVIN TERRY Members in University 1919 XVILLARD BERNHARD BELLACK OREN HERBERT MARSHALL HERMAN ADOLPH BLAU RUSSELL EDWARD PUERNER MAURICE MILLER HANSON ETHAN WARNER SCHMIDT WILLIAM GEORGE MANTONYA GLENN BARTON WARREN LAWRENCE PERRY WORKS 1920 WALTER LELAND ALBERS RUDOLPH ROBERT KNOERR WILLIS BACHELDER COMMINGS JAMES DAVID MCCONNELL GEORGE GORDON F RATER DONALD VALENTINE SLAKER JOHN LEROY HASENPFLUG WILLIAM ROBERT STEELE FREDERICK STEWART TURBIEAURE 1921 ' DWIGHT FAHRIG BENTON MERRILL BEECROFT GODDARD HARRY WILLIAM BRADY OWEN ROCKEFELLER TERRY EDWIN LEO XVIELAND 19,22 GEORGE WVILLARD AXELBERG FRANK BENJAMIN GOLLEY, jR. ERWIN EDGAR HOMSTAD DUDLEY JOHN lVlILLS NELS CORNELIUS RICHARDSON IIIWIIIIIIII m.I.IIIm.,II.IIIII.IIIII WV.-gmvlgggl IIIIIIIII.IIIIIIIIIIIIIIIIIIIIIIIIIIlrIIIIIIIII.IIIII.I.II.II.IIIIIIII I II I I I 1 Page 516 EE 225 222 wwwwwMH,9w,,l,,Qw,ww,M ....,... MwwEwwM,5myE,mf5,5,IWWM,mf1,5mm,U,,f!,1,,m,55,,:ME,iw.,H.W.,.,.N,H,.H,..,Q,Mmml,H,3NgyW1..,,..,,,..,......W.,. ..,..,......,,,., ,...W....,..,.,.ww.0..,,. ,,,.,....,.,... , ,.., ...,,..,,.v..w.,... ,,.,,, Um ,,.,.,.,1.1. ,.,.,.,m w..., ...H..,..,.,..,.., ..,,. . ,.., H ..K..,.., ,...,..v..,...HH,..,H.Y......yH.,Km,..W.HWHM..W..n..i....,.m...m gg sig Egg ag ' :gs SE E25 5 5 225 E E :gi EEE if EE' EE: ,E. ESE Eff E :SE 555 E52 E15 . E Ei? EEZ SSS E15 E132 555 E53 E22 EE :n: :gi ... zz- zqs :5: sez U: EE Ei 5 ganWW..,WN.m,.,,...K...,.H.,W...um.mm..,U.,...Y......Y.........,,,.,...,..,...,,..,..,,......H.U.....,,..,..,,..,..,.,.,mn.,,..,..,,N.HK.,...,.HH.,...,..YK.,,..H.,H.H.,K.,Y..U..,..,,um.,.mm.M,HWW.H.U.,H.um..mm.mm.H..m,,..,K.,H.,..,,,.,..,,..,...,,.,,..,...,...MW..,.HK.,,..,,.,...,...,..,,..,..H..W..M.,,.,..,,..,..,,...,..,,.,,..,..,,..,...,..,..,,,.,.,,...,..n..,...,K.,,.,,.....m.,,,..,,.,H.W..H.H.WW...V..H.,,......W.,...,...H.W.IHW.W.N..,W.,,,,,.,,,..,..,,.....53 E a,K..,...,K.,...,...W...,.H...,...um.-A..,...H.,,...K.,mm.,mH.,my.Hnumm,H..W.mm.Hl.........,...i...l.........mm,,..,um..,1HH.,...K..,..,K.,W,H,WV.....WU.,.H,..,.1WH.U..V.....N..,.N..,K..Y.HH....,K..Y,H,.MH,,V...H,InW.U1...W1W...WK..,.H,..NWW,...,...,..W...,H....,H....,,HN.u..m.M..Nnw.,.,...m.....lmN.1WWH,NHN...,2.,H,Us,..,,.mmK.....,...Kmmum..,...,...,mm1.1.,..ml,L.,H.,H,H.,..,,.mu,W,um,uw.H,1.W,IMM...,y..H.....,..,.......u.,..,...,,..,..,..:,i Page 517 m mmuwInnuImmmiiillulmnii I I I I I IM IKE?ii,IIIIIZIEETLLQIGHMIEDIEIIJ Lambda Chi Alpha Founded at Boston University, 1909 Wisconsin, Alpha Beta, 1917 Number of Zetas, 48 Roewekamp Babcock Hewent Nelson Shanks - Falk Bennett Andersen Field Hughes Bowers E. Ellingson Simpson King Bectendorf Granberg Clark Hitchcock Oldenburg A.EllIngsOn Members in Faculty 5 RODNEY WHITTEMORE BABCOCK CIUY SHIRMER COOK LEWIS PIADGET SHANKS Members in University 1919 HAROLD IVIANOEL FIELD MORRIS LEE HITCHCOCK CHARLES HOWARD KING 1920 LOREN BENNETT ROSWALL ELOF HEXVETT WILLIAM ARTHUR CLARK CHARLES LOUIS HUGHES ARVIN BELFORD ELLINGSON EDWIN LAUGHLIN FREDERICK WILLIAM OLDENBURG 1921 VICTOR SIGURD ANDERSEN ELDRED JUNIUS ELLINGSON ARTHUR BETTENDORF HENRY SILAS CIRANEERG NEWTON LYNN BOWERS GEORGE FREMONT NELSON FRED WILLIAM ROENVEICANIP 1922 BURTON CHARLES BAKER CLARENCE FALK ROMAN HENRY BRUMM NOEL ROBERT SIMPSON I..IIivliilyiimmliiimiIinmliwmiilimvillvi IInInIuImunlvimmiimliiIniuiIIIImmmilvilmmiln Page 518 I1iiI.mmImuiiuiwIm.-mm.. ,.i:..m.Hm:m:imm...... ui .....,.,.,...,,.. lnmmnmmnmnmummmummummmmummnuummmwInnunummumInwumnumnummnnwnurnwnunuInmummmmnvuwmmwnwwnnuummInnuvumvununmumInwmm1ulnuummmvuwmnnnummmuwvmnnummnmmummmu ummm M mmmmm ..4N,i,,.4, I n,,,,,,,, W N,,,,,,w,n,,,,,,.,,,,.,,,,.,,,,,,,.,,,k,nm,,,..,.,,,,,,,,,,,4,,.,,',,.-, M ,,,....,,. ulhyvlllllyrl,,Iu,n,..,l, W ,,,,ll.,..A,,.,.. M I AIII ..,IM,u,,,l,,, n W 4,Iv,.4,Kl,..'.I,IN. H y ,., ,...,. ..,,.,,,...m,..,,.W...W,..,,..,..w.1...,,..H.,,....m....,..,wl..,,..,..W...,,,.,,..,,.,,.w.u..w.,..,.,.,,,.,l..,...,um.W......,...,,,.....,,.1H.,H.,,W......,.,W.,um...,.,...m..l.........,,..,1..,,..,...,.g Effm...nm,..,u.,W...,.,.,,.,,.N.,,,...,.,,....,m..,W,,..,..n..,,.,..,,.u,......m,.,.,U.,..,H.,,..,...,..,..,...,,..,...,.,.,..u........,,......,..,,..m,..,...,,,...,......,...,..,,,.........,......,,.,,..,..,,...K...,..,...,,....,,,.,,...,..,,..,..,,......,.:,,..:,..,..,,:,z::,:,.,:..,,..z:.:::..a.:nm:a,.m..:::a.::::::x:::::::z:::::::::::::::::x:::aa:::::::n:::n::n::::::n:n:n::::::m:xu1:::mn:::n:::nn:z::zzzzzzzzzzzsaszamaazsmmsaznz::::u::z:::1:::a:z::::zaazzzanmaannaznsmz:mnmm:mz:,zr.a:u..n:mmmEg5 E E iii E 2 Sas E E sag 5 5 :sg 5 Z Ei? 5 - 5,5 E E ' ' -IE Zig E22 gi: .. V ai? :ug u 2:2 5 SIE EEE 2 s S s EE sis se EE 555 E 5 - EEZ S55 :gg SEE E12 iii 555 z sig 5 EEE 'E 2 55 552 325 are EE: EEE Q55 EEE EEE EEE Ei? :EE 525 EEE sis 515 Ei? E E EEE E E EEE E32 E25 ii? ,IS 2 E EEE .Ea :-5 EEE Q Ei? SIE EE - EEE EEE ESE E - S EEE Sei 'iz E25 gig E ff: SEE EEE EEE ESE gee EEE gxg EEE ' EEE gm an age if LE 5:5 EEE EEE .Em ff: E55 :ee 2- EEE E - EEE E25 :gs Es: EEE 252 aes EEE Egg if? EE: iii 555 535 555 EEZ Ei? EEE 55? iii az: s.: 555 EE gg EY: as EEE . : : ESE EEE K : s x 5 E E 5 E 5 5 - :E E ' E 5 5 5 5 E 5 55Smmmmumumllul-,muhmmm.mmnmm.H.mm1...V...m...,...K..u.,...1.H.v........KmV....m.m.....1.Hmm1mm,......!.wm-.u.,n.,.m.,myu....4..m..v.,.w1.1...mlH.,lw1.m.1..v.-.WK..1.HKM1vm.n...m.u.....KmM2T:5m:mEE..f..5y-mmm.,.HL...m,!mg:.,,..-K..mm.1mX.H.HV..1......,..m....,...wKm.Hnm...,H,..H..,.HV.,my..W..mm.,L..............m..,I..1-...,.,...,....,.m.,,.....,....,.,..m........-..1m.,..m..u.-A-m....,.f...,.m.n....m,.E 5 5 mm-mmmm-.Iummmmm.rm.H.Wum.,mmummH.1Km..,m...m.....,.........,.H,....m..,.HK..H..mv.Hnm.,,mm.....1W.,.mm..,...mn.H...H.,H.,.H.mmInml.H,..H.,mm......Hfu.H.mmnm.,K..K..XX.H.HK..mf.HYH.W.,mmm.,.m.,WH.,WHH.HK....m.........,H.,...K..H.,.H,I..K..XV.,H.,V.,um......IHnu,.....H.,I,......,.,......,K...um.,K..nu.UH..,.,.M...um..,.Hmm,,...,..,..,yV,H.,K...K...1.m.,...,.m....,..mw,...mm..m.u......1k.....m.,...,......,.......,...,.,.f..E. P a g e 5 I 9 QIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I I I I I II I4 I Iv II II I I II III I I IIIIIII 5 EHEIIIIIIZIIIIIIIIIIII I I 2:5 325 252 EEE :I: Tau Kappa Epsilon Founded at Illinois Wesleyan University, 1899 Wisconsin, Lambda, 1917 Number of Chapters, 11 s E s 1 a iii E55 1919 BENJAMIN GEORGE BRICKBAUER 3 s 3 1920 2: A35 egg HANS FREDERICK EMMERLING ELMORE WALTER FIEDLER -ie ESE EE 1921 I -i- RALPH OLIVER FIEDLER -5, 5 RUTHERFORD RIESEN HELD -i- sis sg, 1922 I , ROBERT AEBOT ASPINNVALL 2 RAYMOND PHILIP BETHKE EARL WILLIAM HENSEY 535 EE E x-A., I I 5 WN-::SfQ,, 5-1.6 -Q V ,E , E22 gi: -L ,II 7 I W A IIIIIInIInIIlIInIInIInIInInIIIIIIIImIIuIIIIIII Page 520 Held Herz feld Bethke Siebken Brickbauer Zellmer Schneider E NVall E. Fiedler R. Fiedler Klement Rummler Pellow Togstad Members in University CHAUNCEY JAMES PELLOW RICHARD PHILLIP HERZFELD FLOYD RUSSEL XVALL ROBERT GEORGE ZELLMER ELMORE F RED KLEMENT HERMAN PETER SIEBKEN EDGAR ROYLE RUMMLER EARL EDNVARD SCHNEIDER IQARL RAYMOND TOGSTAD Emmerling Ll5!..f!L IIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I I ' I I II II IInIIIIIIIIIIIIIIIIInuI -mmmuummmummmX,InW1rmmX.HXH.mymimy1.111.U..X.HXin,..XmyInmlmm.mlXInvmmNmymvmX1.wXInInWrmmw.IXH.imXInfuXH.WX.UIHXmX.HmmXX..XH.X1.XXm.HXH4XmrmH.XH.XHXH.XH.Xmmy.HXHXXmInXInX1.1WXwmH-X1-XX.1XWX.HWXinXmXHX1.1XK..nnWWin1U.my,1.X,HX.UwH1H.,H1,.M111,WH,WXH,,11XI..XH4X-AH.XWXV..MXH-1X..XW1.-4X.HmyH,mfXH1ulX1-11.IXU-1InXH.XH1XInIn1w11HL1.XwX.HXHXKm.HXW,In,In,1.wX1.wmmlH.X.HXvmI.XnlXH.XmXmmmmmm..m.ug,.g ii MHEFHQFIWEEIIEGREIIIQIIQVIH...1InwHKHIII11iillllwlhmmlmfm1ummmfmnulm-mu1m1In1mmmmnmIn1mmm,mymwummmnmmummmul1Inmmfmvm1lm--mmmlmumm..1.Hunmmumvurmmm.un1In1Inmm'W1I.1lmmmvu1m1.Hmmm-I1.I1rm,mmm1H.1vm.mmvu1.H1fmmmunynuuIn...WW1NLmy...lmIn1ul1umm1W1vuwfdihilFilHCIU71lllllllK5IllK-HlhllhIll1FilQdhJiiininfl:Fl1UhvlnhiilvinuinuinivlidlvimuHlhllIYillKnKHmQ 2 s 5 2 22 EE E35 .L . . EEL EE E15 . . 552 EEE E55 I A if isa EE 233 ESE EEE IQ: :fa gig EE z.: :ii EEE E23 E25 gg5-mmfnummm-.mmm-.1ummI..my.MI.,mK..mfmyInum.W..HH.mm.,.H.Hmyum.,.UV..1.HV..1.HV..mm.,.HK.....U..1...rmkm.H...V..WW1.HH.1.HIn1......V...WW.HK..nmmm.m.....4V....HK.,K..,.mm.HV.,V..H.,vm...mm,V..1mL.,...NmW.Hum....1N1.11.11.fm.myV..1-IH.,my1.,H1my1fu.HWW1...mlI.,N..Nmy.mnM.H.mm.U.mmu.,,Hmm.vmmV..NInWvm...H.,ln.W.fny..NH,Um.,H...HWmH.,H.W.fmV..N..Lm.wm,...fm,.mm.....m.m.4..wm.W. 3 ann:nuwnumnmmmmmunrmmmmumun.mnwuwInnurmmInmruvmmzuwuwfmmmnnvmummmrnanwInmunwuwmummnnanmwrn1mmnuummmnuInulmwInrnwulmummmmvuunwummunmunummmmmfunuminwwuinwmwInuuuXIninunummvumainwmrnnuinummm1uwu1minmummulmvmanm1u1m1nwmmXinmlmmmumIn1ummlXuwmmummmnunu.mmmummm1mmmmuummmm1,mmmrmnummmmnwumunnmmlma. Page 521 I I mi mnn nun II Iimmummvw .,.,.....,J..., ' ' L,....LJ,......,..a....m.... ,..,..,,,,.., s I 7 1 Trzeta C111 Founded at Norwich University, 1856 W'iscon.sin, Psi, 1918 Number of Chapters, 23 Stewart Pidcoe Bemis Luther Eklund Thieme Black -Josephson Thomas Sutliff Matrox Witte Clear Clarenbach Bartells Bowman Kerler Wegener Tasche Abrahamson L. Jenkins Malzahn G. jenkins Fuhrman Powell Cristy 1V1embeI's in Faculty GUSTAVE BOHSTEDT WVILLIAM GEORGE DORMEYER FAYETTE HERBERT ELWELL SYDNEY LINCOLN MILLER Members in University Graduate CYRLIS CHARLES THIEVIE 1919 GEORGE GORDON BEMIS LYEL NEXVTON JENKINS WALTER ERNEST IVIALZAHN 1920 ERNEST ALFRED KERLER jOI-IN DEMLITI-I STEWART 1921 ABE ABRAHAMSON RONALD CLARK IVIATTOX RALPH EMIL CLARENBACH WVESTON XVILLIAM PIDCOE EWART KELLER CLEAR W HEELAN DNVIGHT SUTLIFF OSCAR ADOLPH EKLUND LESLIE WILLIAM TASCHE GLENN LLEWELLYN JENKINS JAMES I-ILIGO WEGENER MELVIN EDDY LUTHER JOHN GRIFFITH XVITTE 1922 RAYMOND OSEORNE BARTELLS ROE ROBERT BLACK HAROLD BOWMAN CARL GUSTAVE FUI-IRMAN , i in nf' A- N S in . A. - gf. 1. ziptgga' RQ- Ag:--aw .ImII..Im--IWII..II.II.II..Im..-rI.III SELMER BEAUFORD -JOSEP HSON HECTOR MENALIUS POWELL THOMAS BERNARD THOMAS FRANKLIN ARTHUR VAN SANT IummmIIIImiIIIInInirnIIIIIIIIIIIIIIIIIIIIIII I Page 522 an - nrmnmInnnnumnnummvwm1vu1inummfumwwunnmmummmInwmmyummnuvuwnumunummfuwulwmwInfuumnufuwnuwuvnnmummInmynlwruwuwunmnvuanwInwmwuwmumm1Wvu1un1vuvuummmwrmInvmmmnanwInmwvmIn1u1yuuwumuwnnnuwInwnXmmumIn1Inwu1InwruwwwuluInwInruwnuummmwm1Inuuwulvmunumfu1nluum.umrunuwnwwInmmnanwnuwInmuInmumvuwvuruuruwmummmwruwanunwanummmunwvuwvuummInummnwumnug if r ru ur unmuwmnu vuwlmn vu mm mlm mmmmmuuvmmH r mmm mu w my Imnwmnuumumm n m A rv nm ummmuumuumnnu mn u ' Qmummnum1In1InummmwinwmnmHunun11HmmumH.wm1ulummInnu1In1InrmmwH11HXnnnumurmuv.H1mvm11-W.muv.n...HwHHmm. 1 I H., . V., .H my .4 1 I L Hu... mm.. .H 4 .mu U.,.,.m. .W . :YE EEE EEE M 3 Se gif EEE if 5 5 se' Eil 55 55? EEZ ii: EEE Zi' QQE ge' ss' gg: :i: 22' if sz: QQ sz: '5' za: gig 22. EE 31- EE :if :g: 255 fi' 5' 255 .EI 'ss 21: J: :ga 4: 'is ,5- :SE E55 EEE -E1 :EE 552 E E '25 ii? Q23 E E are 5 5 E55 al: EEE E75 :P EE EL: 3 5 Ei? 5 E 535...,W.m.,,...,.., ..... mn. .,,.. ,..........,..,..,,..............m...,....u..........,.m.n..,...K........., ...,n,, . .,.., ...w.m..., ...,..4,. ..,m,.,..,,.,,..,,.,.,,., K..,.. . .,..,..... ,....,..m.....M ..., .,.,..,.....,....m ..,. mm, ..,..,.. , ,... ......m.,...,.., ,,.. W. ...,..l..,,.,, . .,l. H ..,, ..,..,...!..w.,...1..U., ,.., ,.,nm..,,.,.W,.......,nu.. ,..,..... H... , ..,n .. ,..,,.,.,.,,.,H.,...,,..,..,......,,.,....r......K.u..,...,..... ..,,.u.. ..... ..,,.,,.u,,.... 1 ...., ., ..,4 . ..,..,, m.,,.m,..., ...... ... .1,. ,.,,m.,.......,..n.....,..,,..,....m.5 E.......,..,..,,. ...M, -..n..-.,,,,--., .... W, .n..,....,,. -.. .... m ,.,., ..,..,..,.. M .,,..,..,,,,. -M....,...,,.... ..,. ..,-.M,-,..,.,-., ..n,,.. ....u--.,.,.-,.., ....,..,..,....,. .. .,..,... . ,.....,. -.. .,.... ...-... ..,,.....,... .,- ,..,. .......,.. .... -........-h-.....n...-... .... ..,.-.-.,.---....-m-.... ..... aunmuummuumuunInnuwunanzuwumnmmnumunnumnuummumumwmmnmmmumnmwmunummnuunruwummvuwanmwuwmwummmmmunruunmamuvmmmnnunumuvnummnumwmunuwrurmmwannumrumuurmwnuunannuinunmumunwInwuwruuananunuxrmruwmammuumnnumunummnmInnmnnuummmummummmmummnmmumnmmnunnmann:wnnwmruwnnrn:mmunnmmmmmmmuummvmmnunmmmumumumi Page 523 1 .wwH11-mummmuwn.. Im1ulmwmmmwmmmmnw1,1mw-.4www.-NWIWum.Hmumin1Innumwmuullnlmu.Egg 4 1 I Awema Founded at the University of Wisconsin, 1905 Affieck Kirch er Nelson Reuter Schafer Schulz Liebert Eaton Schrank Dally Rennebohm Lindemann Hartung Schroeder Babcock Wiesner Vanderj ag: Nash Member in Faculty JOHN GLAETTLI Members in University Graduate ELMER MARTIN NELSON 1919 XVALTER ROBERT DALLY LORIN DICKELMAN 1920 FRANCIS HALL HIESTAND HERBERT EDWARD LINDEMANN PAUL KIRO1-IER ROYAL LOUIS MEYER ARTHUR EUGENE LIEBERT XVILLIAM ROBERT REUTER ELLIS LEONARD XIANDEREIAGT 1921 RICHARD HIESTAND GEORGE ANTHONY NASH l 1 -me 275' 'xg GILBERT WILLIAM SOHROEDER IRWIN PAUL SCHULZ A i: ,5 15 .fr .Ii 'f f .zT -W ummm mmnmmIIIIIIIIIIIIII um mn mm Iumr mmm IIIIIIIIIIII. mvrrmmrm Page 524 2:2 EE 15...V...myK..V...,...,H.,.HK..um...H..,..,K..H..,H,.H,,..,K..,.H,..,...,W...,,.m..K..,,..w.,fmK..,y.,...yy..N..H..X.,.,,.,W.......,mm,H.,L..,...,uw.,H.,H.,,.....4,H,K..,V.,,.H,..1W1Inw....,......1,.m..WH.Vf..,1HX.11.UX.HA..muH,,..4,..Wm....,...fnU.,,Hmm..m.m..,..H1.4H.1K..1.H1..,V..1H,1VHH..H,1U,H.1V..1VHXVHH.,y11,mXynvmlmVHmyvm1H,1.1I1HU..H.mmm..mm.m.1um.,1.MmH,W,mH.W.1mW,H,K.,X.HW,X..,y..,I..H..Wnm..NWW1.1mmu......,...m.n..,,.w...5 5?Eii7EiE7Fi5iii?iiIEii3iiiWill?EIIEEFIHGIIIZEFIJFIIHilliiiiiiGiliiii?iiJiiRliiiiiiiiiiWii??ii?iii1Ei1?iiiiiilihilimi.FillimriAui?linulnuununmymmlWIn1.Iwvu1InwInwInmrm1InwIHnlwm1uwulmninwfn1In1n1vuwInwInwuwnl1InmmmmnmmmfnwInnnu11innnuInuluu1m1inmmm'-mmm1uuvu1muuwm1n11mmwuvwmnlwmwmwInn1unumvmwmin1fu1fu1mulwm1nwnlwruwmvuwulXinwuvrmmwIn1u1nlwmvm11ummuuwmvwmfn1u1myInXIn1mmwmm,nnmyfmmmmmmwgf5 5 gi 5 3 2 E55 552 555 5,5 E55 :XE 555 sig 5,5 5.5 555 515 545 gg 125 EEE E55 sea s 5 :fs E a 5g5,v..m.4.......,..5...,.....Vyu...X..n..,...,,.,....,......H.,W...WH.,...,..,..,.......,..,......,..,...,..n......,.w..H.,...,,..,...k.,.......,..,.........,...,......,...mu.....W..Wy.,...l.....H..mm...rm.H.f.H...m..H..,..w,K...l.....,.......m...,...,.....H......,........,,,..,..,,..W,.....,......,,.,......,mu.,...,..,...,.,,,..,..,W......W!.T5.m3ME35Q93U5Wwwwwm...,..1,.wwKm...lfymTH5w3Mm,..w,,w,.,.-51,5 imnu1ummmmmnmumuwvuummliliiliiiillEiliiiIFi2?iiiIEISIGEIIEQIESQIIEIIEIRIQIQIEIIEIKIISFISEIHHUIRFHIIIEIZEIIEIEIZREiKiiiliiEiiiiliiiiiiiiiiEEEIIRIIMIGIHHEEIDEIIIIIMHIIZEilIiiiIii?ii1EiiEii?unni?iHim1wmlm-Iwumuumm:mmruunvmfnmummInwvummmmuuruummInmwnufmvuwuv:mmmuvwmmumummmummummmmummnmmnwnmnnumrunn1uummnmnnmmInummmnnm1nummun1mmmnnum11111uunummummuxnmnnurnmnmn Page 525' I.....I.I..i..I.......... 4 I . I ig ili.R.l?iiiii.ii.I.li.?i Proif:SSiOnal Lega Fraternity CPM Delta Phi Founded at the University of Michigan, 1869 Wisconsin, Harlan, 1891 Number of Chapters, 46 Torphy Thauer Conway Langer Monk I.,auS Pile Richardson Sweeney Wharfield Genrich Duncan Davis Spohn Fralres in Facultate CBenchers at the Inns of Courlj On the Woalsack STEPHEN WARREN GILMAN HARRY SANGER RICHARDS ARNOLD BENNETT HALL OLIVER SAMUEL RUNDELL WILLIAM HERBERT PACE JOHN BELL SANBORN HOWARD LESLIE SMITH Apprentices at the 1nns of Court Inner Temple, 1919 HAROLD MYRON LANGER ROYAL WALLACE THAUER ROBERT WILLIAM IVIONK THOMAS EMMETT TORPHY Middle Temple, 1920 PAUL HOFFMAN CONWAY ROMEO CURTIS LAUS RICHARD HARRINGTON CHARLES JAMES PILE CHESTER RICHARDSON Outer Temple, 1921 DUDLEY HOPKINS DAVIS ALFRED MOORE ROGERS FRANCIS WIIQLARD DUNCAN GEORGE DANIEL SPOHN FRED WILLIAM GENRICH, JR. CHARLES VICTOR SWEENEY AUBREY CHARLES WHARFIELD , k 5 -' - Q . 'Z' A f 'Y-Am' - .. . . . n . As fri .L . If 1 itz' ' 5' Q WI. .S Q , , . ,E E. EE I I I I Q I .......... ... ... . . . ..............I...In...I.......I............................... ... . . .... ............... ...I....Y.................................. I in..III................I..........InII..I.II...I......I..I.....I.... .. . .III ..I..mI....n.I.u.....I.u.Imu..mm Page 526 s nmunwunwunmuInwnwannnwIninmumin1mwnuwnwnuuwmummulunnnnuinmmmInwuwuumuuunumnmmm E gm,H.1,mH.U..,H.vmnuKmmy.H1m1.HnnmymyInW.HYH1V..1U.,H.1H.1.H,K..un1.Hvm,mmnu,.Hmm.,lm1.HWmyH.,K..rmX.H,.HquI..1.U,.M1..,H.M.1K.,X.H,..,.H,.H1.Hmym1W1V.,,.HH.,H.,H.,HXXH,,HXinmyX.11I..1.H11.1H.XH.,...11.4U.1in1.H1..,in1inXH,rmU,X.H,1.1H.1Wimin,W,WXWunW1in1..1unyn1Km..1.H,H.1In,InN.1WXWH.,H.Xmmmm.m.m.mm.W 5151..:a:n...,....:.,..,,..,,......H..,,..1,.11K...H,...,,..,,.,....,..,...,....:..,,..,,..,...,.......,,.,,..,,W,......,..,,.......,...,H.,...,...,.H...,,.....,,..,...,,..,,..,...,..1,.H.,.,,..,..,,..,,.,,..,,...,..,...,,.,,...H.,.,.,...,..,,..,,.,,y..,......,,..,...,,..,......,...,...,.,,..,,...,..,...,...,y..,..,...,,.,,..,,..,...,......,..,,,.,,..,,..,....H.,,....z,,..,...,..,,L.,...,..,,.,,,....,,,..,,.,,,.Q,,..,.zz,..,z..,,..,...,,.,v.,,..,,..,...,,.31...,..:,..,iz,,..,1L.,..:,..,...L,..1sa.,.,na,,..:V..,yi.1L.,H.,mn.:,iz,Liv.Lil:J..,.::s,:n::5n,.l..,5i:Li:1J:.,llQ-3 512 Ei? 5 2 sis Exg E55 :ia as 5 E 5 ,,,.,. ...-..... 5 3 :is f ali Epi 1 2 2 egg 1 5 5 Eli Ee: E :gi I sa W 322 222 1 ig: EEE 522 W E52 3 5 212 'F EE 24: 535 Ei: E95 fi? EEE if 252 Q.. 5.5 21: :ia W -is iii EEE ESE E55 :ie iii SEE iii E25 EE 553 3: 5,5 E55 553 E55 E55 EE S32 E52 sez is EE aaa ess ii? E35 225 552 225 ,ZZ is: E25 235 :fi 2:2 z 555 2 S22 32? ' Ei? 522 Z 2:2 22: 555 EE asa sie EE ' ' ' ' ' ' ' .H.UU.,rw.HimW..,mnNm.HH.1.H1N.H,..WWWWH.1W1.1,.HinXW...U.,U.,W1.1,.HKmU,mymyInvwuw..,W..Him.W.H.H1Km.HWK..W1H,mimH,X..,.HK..,...WHnwK.....V.HW,Wmm.,M,H.,inXnm.,,H,y..H4,..H.,NInX.,H.X,.1H.,H.,.H,um..m,..,.Hmym1.H.HI.,XK..,H,vmumm.wHHum.InH.1.HU.,.MH.NW,W.XH...myV.....,myW,..1...,...,...,.m.m.,...s..i f,nwmmmwmInnl1wmmmmumvuinnumynlulwulunnlmumummin1mm1unuwmmnmunmmnuummm Page 527 ,I III III J Professional Chemical Fraternity Clilpha Chi Sigma Founded at the University of Wisconsin, 1902 XX7isc0nsir1, Alpha, 1902 Number of Chapters, 30 Schutte Schrenk Wise Holmes Flogaus Hentzen Brenner Keebler Kraemer Himmler Stzaicll Griem Hickey Cheetham Miller NVarner Hopnert M' embers in HAROLD CORNELIUS BRADLEY RICHARD FISCHER EDWIN BRET HART OTTO LOUIS KOWALKE FRANCIS CRAIG KRAUSKOPF HENRY AUGUST LANCANI-IAN CPIARLES KENNETi-I LEITH VICTOR LENHER Faculty RICHARD STANISLAUS IVICCAEFERY WVALTER NEBEL ,JOHN HENRY SCHMIDT HENRY AUGUST SCHUETTE WVALTER THEODORE SCHRENK HARRY STEENBOCK EMIL TRUOG JAMES HENRI WVALTON, jr. MembeI's in University 99 CLINTON BENNETT CLEVENCER ERNST DAVID FAHLBERC PHILIP -JOHN HICKEY ELMER OTTO KRAEMER ELMER LOUIS SEVRINCHAUS Graduale I ' GEORGE ROBERT SHAW DANIEL LEANDER SHERK DAVID WVILLIAM SMITH HOWARD DEWVITT VALENTINE CHARLES LAVV WV.-XRNER CLARENCE RUBEN WVISE ERWIN CHARLES BRENNER HAROLD COXVAN CHEETI-IAM WILLIAM ALBERT FLOCAUS MILTON EMII, GRIEM CLARENCE NELS HATLEBERG 1919 CARL FREDERICK HAYDEN PRESLEY DIXON HOLMES CARL ARTHUR HOPPERT IRVIN WALLACE KEEBLER ARTHUR LANE ,I OSEPI-I ARNOLD STAIDL ERNVIN ALBERT HENTZEN- LOWELL WVHITMAN HIMMLER 1920 CHESTER ,JOSEPH MILLER -ALBERT GEORGE SCHUTTE 54h 6 '- P ., 'M ,. J -IREQ gf. Ry TIIITIIIIITIII mm, Ii.Ii..IrIIIIIIIwII I I IIIIIIIiiiiii?iliiiiiivimiiiiiiIIIIIII?iiiiiiiiiiiiiliiiiiiwiil I Page 528 -mmunmfummnnunwmummnnunwansnwmyuvwnumfunmmwwmyInnnwInunwnumnuwmwanwuvnmunIn1Inwnwnnnnnnnunum1vuwuwunwfuwnvnuwInvuwn1wuvmwmmnmmmmfmfuwunmnuwruwunwmmwanwIn3nnnfImpp3uwwnminwrwmmwuuwul1uunn1numrmunuInwmvuwmwqiInyywmvIn1ufmwm+I1+mwmwInInvm1anuvuinumunru1vu1mnumunwmmnumwanwmXIninwmunmwmwuwwuwnuInwInfuwvuwInruwvuuvunumvmvmnfunvmmvmwuvmnuuwmmmnmmug EEE if S52 , EE FLIQIEEIIIIIFIIHiiiEiiiQiiiEIIPEIIIIIIHIRIIREliIHSEFI!ililiiilii?IiiiIii1iii1FHIIIRFIQYiiiHSQIISPiiiiiiiiiiiiiiiliiiiiiIii?iii?HIGHS?limi?Hi?PIEEIIITIHHIRIIFFFIHIIIWIEIPIIYiii?iiiiliiiiiiiiiiiiiKillEIITEIIRH1NilEiiiEiiiiii1iiiTHREE?.IINiiiliiiri?hiwnlwulnuwuwunluwInunInunnlwm1munnumvmwInInwuwnlummuwmvnmnfuwm1lmvuinufuwunnuin1munmmnnmmnun11.wnumVuwunVuunufuXuuuinnnWunuInuvuInXu1InwIn1HXnluInvmmyynXIn1InmXmnlwm1uvnumwInInvmwInullmunmmmmg3 E E EEE 1 : E E 5 iii YE 'iii ': :L si: 2 Zi. is -.- as ,.- Si 555 ffz '- J. .: :F AF,--V' :is n n 4 nuvmnvnunu1min1mummInuvwm.mmWwminmumm1u1muHvuwmulumInmul1mmwummmnnfnwummmWmyvu1InWNWummmmfmm1mXuXmmumm1umm.1-.1KHwHwummminvmmmw-mmf2 E Z5 5eLHMEW!In1mnmInmymmwminwInwmInfmlmmm1rmnmwmmmmmumfnnlunmwInm1nunvmwuvwvuuvunwmwnummyInm1nunuuwmuwminwunnwInIn1HwmwInmm1vu1mmwInm1fuXInInuInwInInmmymuwmmummmm-uw! 1 I I I v-'-4 Alhllh 1 mm H W ,'A4' Alllrl Q .nummummmmwnmmuunwvunuuunwInnmuwnnmmnwuwnnwummmmnnInwmminmumwmmm1mm1nnmmnnwuwmmwnumw-Imnvuul1ummInmwmmm:wmmwnnnnunwwuwuwm1nvmwnvulwnuuvinwmmwnnnumunwulinvmnunnmm1unnw:mmmummmummmnmmuumm1mumuunwnnuwuwnwmwinwmulununnumanwmwnwmumvuvmnumummmmuufwrumwmnvumwInInunm1Hmf1vuInlmin1uwfufmulnummw1Inmm1Innnul1Innn-.mlmnlmmmw Page 529 ii I In nu II I In I II ni Im nl I I In In Immun uv uwvniw In u uuuum I In u mu :II In n Huw In In nnuuluuizuimuuu I uni II I II I n In Innnw I I Prolesslonal Legal Fraternity CPM Alpha Delta Founded at Norlhwesiern University, 1897 Wisconsin, Ryan, 1904 Number of Chapters, 37 Ma rsh Olson Thieme Cross Higson Wheeler Newman Schxvcichler Duff Waller Stevenson Noer ' DeWiLr Hall Warner Shannon Sharp Members in Faculty EUGENE ALLEN GILMORE HARRY GLICKSMAN Members in University ROY MARTIN DEXVITT 1919 JOHN LOGAN NEWMAN WVILLIAM HENRY STEVENSON JOSEPH POMEARD DUEF FRANCIS DELMAR HIGSON 1920 CARL JAMES MARSH LOTHAR ADOLPI-l SCHNVEICHLER FRANK JOHN SHANNON LAWRENCE WATERBURY I-IALL HAROLD ROLE NOER OSCAR ALBERT OLSON MALCOLM PITMAN SHARP 1921 , CYRUS CHARLES THIEME THEODORE ADOLPH WVALLER JOHN CLEMENT WARNER SYLVESTER LAWRENCE WV!-IEELER gl ii A-A fu R 1. .. , . -W ,. I' Aiea ' V' I-1.4mm ..IIm.,I,.IIWI..II.,I .IIInIIIIIIliillllwiimllmmInInI.IIInIIIWIWIIIIIIIIIYI Page 530 nun num II E...m.N..u....., K.1, ...rmK...,..M.....,.HH.,H,,K.,..HH.,.H.WH.....V...W,...K..,K.,,.H,..mm.,,V.,...,,.mmU.,..,H.,,..,...W,I..,,HHHW.,..,..mw...,..,,.. ,K.. , ,.n.,,..,.,. mm., ,...,, W... ,.,,..,,..,.., , .... , .,..,,. ..K..u..,,.u.., ,..1,. .mm ..w..,.. ,,..,,.w..,., wY.., ...,..m..,,.m.,, ..,,. U., ,.,,,.,,..,...,..,, .M ,...,,. H... ,..,K..,.. W., ...,. , YK.. ,Km.H,...,..,,..,,.v..w..,.,,..,...H .4,.. mm ..... ,,..m.H.. ,,,,,.. , K,., , .,Y,.,,.,,.,, , ..n.. 1y..myWWV..y...,,.,H.,Wmy,V.,V..W.,I,.,V.,my...,H,H.,m..w,,..V.m5 sg: 2-- 555 E55 E35 235 ,ig 23: 53: 55- 235 EE E55 :zz Ei? EE E25 as E52 -.. JM- sag ii? 5gannmmuf1ru1Inunmymnn1InInw.mmInIn1,mmulin1myminnu1H1mm1mfnlmmrmInmlmU.mumInIn1mmm1.mm.munnInL.11In11.1mlmin1I.1Inmw.Iw1mI.1K..U-nmm..mwm1.1.HInXI.UH1.HInH.H..1.HH.mn1.1H5M1Vfmmmmmm55myMEMWHmayMtwEmmysEMMTHEMYEInHmmmETQEuwwlmmmwwulll,mmfmmlwwmm35322352152553512332325J E e.......,..WH.zwaznazzaamazianzsmaazaazaazaaazaaanzzzmazszazaaanasaaanaaasamsasuaxan:nmzazzaamaxzszznamamaaanaazzaaszssnzamannasmmm..,nn..,..,..,..,.,.1..,,,H..,.w...W...,..,,.,,..,,.,......U.,,..,...,.H,..,,.....K,.,,,.,,...,.,,,,,.,...,,......,,..,.,H...H,H.,.,.,HI..,..,,..,..,...,..,...,..,....L..HN...W...M.,.W.,,......H.,,..H..l.....,W.,.,H..,.,...,......,...,..,......,.,.,...,,.,...,....,.,....l.m....-.m.,..n..M...,.,...m....,,..,..,,.num..M.,.W.,,..,.,,,..,.,....,...,.,.,..,,,.,...,,, ' Page 531 III In II Professional Civil Engineering Fraternity Triangle Founded at the Universily of Illinois, 1907 Wisconsin, Wisconsin, 1913 Number of Chapters, 4 Stiles Behrens Walraven Olson Walters Sherburne Chase Kirch Kurtz NViepking Thiel PlaSkett Neumann Kidder Quimby Fisbeck Hahn Claentli Members in Faculty JOHN GURNEY CALLAN WILLIAM SPAULDING IQINNE LOUIS ADOLPH KIRCH DANIEL WEBSTER MEAD LEONARD SEWELL SMITH Members ln University 1919 RAY EMIL BEHRENS HEREERT GLAETTLI FINLEY LELAND FISBECK HENRY WILI.IAM KURTZ 1920 CHARLES POMEROY KIDDER DWIGHT HAWTHORNE STILES FRANK KENDALL QUIMBY PETER WVALRAVEN LEWIS RAYMOND SHERBURNE WARREN XVEIR WALTERS CHRISTOPHER ARMIN WVIEPKINC 1921 LAURENCE HUGO l lAl-IN 1922 ' LEON EVERETT CHASE RAYMOND HANSON l'lERBERT PAUL NEUMANN WVALTER CONRAD THIEL WALTER OTTO ZERVAS f .'.... ,I ,... ? 90559 JSI,-', ,IH ,.,,. II ..,,..,... I ..,.,...,..,,..,,.,..,,,., ...I. ' I I IIII I I I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIZIIEII Page 532 IIIIIIIIII III III I IIIIII II II II IIIII IIII III gmmnuun:uwummnmnuuvwmmmmWvuwum1lminwInIn1m1mwvu1InfmvmmmmfmmummfununvuwunfuwInwnwwu1fuwuwwuwfuwnlmmwnmmwmummmununfmrn1fnpmwnufunuwI-pmvmummmnmnunmyunmW4inwrmul1Wvu1In1miwunummm.mumlunnvwW1mm11Inm1vuwInnuInnlwmwuwmn1.11mwIn1InunruwInunnlnu1InuInrmlmummmmfmmm1mXanW1XI.1InWW1mwvmmmmwmuumlmumlunwu1Wnunuwlumwmummmu 5QgmmvmuumnuunnunmuwInunnmmmmmnn-unInnu1mfuwm1lmInWmnumyfmmmmwmmmmfwwmwWwinwin1uwnl1InwInmwinwuwmwnlmmlmmmuuumm1vm1nwrminwmwInin1InwInunlmnumnmummmmuwInwu1rmm1.IwwnwInwvurmunummmuwnumlvuurnwInwuuwuurunnmuunummummmmuumvu1Ruwin1nihiXfuriwhwIn1iiiIMhhuwHmm-wmmlmiminfuuInin1--1HHU1KH1HiEhi55?Gini?-IIIIRIIIIEIILQFFillN71iii?H1212IEIIHFZFIEIFIEISZHQIEQ5 Sis 222 W 525 W E15 E ' E55 SIE ' EE E25 ' EEE ' EEE , E15 212 55 EEE 2' sg: fi : Q: , Z , sean...k..,....K.....,.mm,W......,,..4,...m,..,...,..,WyHY..,,....m.m..,..,...m.W.,.m..u.,,H,...Km.MH.,L.,Y..Y,HX.,H.,H....,.HW....HH.,,.,,......L..H.,K.,Wm.MH.H.,WK..,..,.UH.n..V..um..Y.....,Y..H.,W.,H.,W..mu.,W.....W...l..,..W.W.,.mm..,....,....,,..,H.,y.,,N.UK.w.W..,..,...,..,um.,.mmV..N535,mmf53,Mmm55135155351333,5mm55,lg15,5W1555551,11:51353555153553555541353W555gggg55155535555Mwgglmgggggffggmgm. I w nf H HmmmInunIn.Hvmmw.mmnwmmmmfuwn1nl1.1wnl1H1nHInmwmmwyum1uwVHnnXI.Xm1Inm1H1.H11-1m1m1.I1In1.I1W1.Hm1:mmmulXInVH1in1m1.m.m.mu.m.1w4 immilIIHENMEIQEEIZYIAEililillEliSHRii?IiiUIQ?HHHKill?iiiiiiiii051512IIIZIIIYIIIHiEiiiiiiiiiHiiii?iiiIiilQiiliiHIGH?iiiiiF?ii1Fil?E51iiiiiiQEIRIZZI5IIGZIGEIGIIRIliHHH?F565711RIIHIGFGFilHHHiiliiiifhiEWiii?I-1iiiEFIiliiii.Iihuiu.IRX.I1din11H1ImIn.ilnumXI.1.I11.Iwmmulmmwmm-mymwmummmu umm u 1 w Page 533 I I I I I II III II IIIIIIII III III I I I I III IIIIIIIIIIII Professional Medical Fraternity Thi CBeta fPi Founded at the University of Pittxburg, 1891 Wisconsin, Alpha Pi, 1915 Number of Chapters, 33 Irvine Snolze lnnis Green Sormenburg Ghipman Kidder Raube Overton Hoyer Weber Rogers Leach White Roberts Brickbauer Erickson McGarty Axley Engle Malone Larsell R, Jackson Borsack Dawson Richdorf Meek Schneiders Marsh . MembeI's in Faculty ARTHUR SOLOMON LOEVENI-IART WALTER JOSEPH TVIEEK WILLIAM SNOW MILLER THOMAS TORMEY HAROLD CORNELIUS BRADLEY PERCY DAWSON REGINALD JACKSON OLAF LARSELL Members in University Graduate ROBERT ADAMS XVALTER ELMER GREEN HAROLD AXLEY CHAUNCEY LEAKE KARL KASPER BORSACK EDWIN FRANK SCHNEIDERS CLEVELAND JAMES WHITE 1919 WILLARD ALONZO CHIPMAN WILLARD SONNENBURG GEORGE HENRY HOYER JOSEPH ARIEL STOLZE ROB ROY ROBERTS CLEARY NEIL SWANSON EZRA HAZELTON ROGERS CARL JOSEPH XVEBER 1920 EDWIN ALTSCHAOER BENJAMIN GEORGE BRICRBAUER THOMAS DREDOE ADOLPH ENCLE EDWARD THOMAS EVANS ARNE GORDER THEODORE HANNAN KENNETH IRVINE EARLE ELTON KIDDER ALBERT EDSAR LEACH S me megs 'ine '19 GABRIEL ERIC LINDEN GERHARD LORFELD ORRIN VAN OVERTON MICHAEL EDMUND MCGAR FRANCIS JOSEPH TVIORRIS EDWARD NOHL PETERSON LEO WILLIS PETERSON HERBERT ALBERT RAUBE IRNVIN-PAUL SCHULZ LESLIE TASOHE 'S' fQ'3EI 2:::: :S QI, , ffl. I 'if ..IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIH-II I II I I I illiiFiiiiiiliiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiiliiiiiih I I II I II Page 534 TY u:mm1vummmmummwumuinmmnuwnuumfmunnnvmmVmm,fuwwnwInrmmumunnnvmmfnlmm-1vmulwnummwmwuwfnwmwuwfnumminwinm1m1Inumuwin1vu1n1rwuvmHmmmmmmnmmfnnuIn1.Ivm1mmmummww-mmmfnMXInmHInm1InmymyvumUInWfm1uvmXynmmmmnwvummmnmnmmfmwmvuwnfumInruuInuvwvuuulWumnumwIninumummm1m1mwI.wmvwInruunwInmwmllummu-Ifmummmnummmmmnmng 111' . .. M- . . 5g1...mu..,U.M...H.W.,,.H...,,...U,,.H,..,...W...,..nm.U......UV..U.,N.....um......,,...V..,,..,......,W...,..,.......1,.NN.H..,,,H,..11,.,.U1.HH.11,.,...N..K.,,......1,..,...1y....,...1...X..X......W..N,..H.,X..,,..XI,.1..11..4X..,..,,..+..,X...,..N,UW...H,,...1...U.,N.1U...,X.HXy.,...,,..X..,,..,,..,y.,...,...,.Hv..W.,U.X..,,.,,N.U.,,..,.NXW...,,H,...,f...HW..,W.HV..,U.X...,......1...,..,,..,.H.........,...,I..,VH,......,......,,,.,.W,H,,U.......1.H...,...,..,,V.,,y.,..,U..,..,....1V.1...Hn,......,..U...,,.,,,.m.,m,.g 5 E S E E E 2 2 Q 2 5 E- ... EEE EEE si? EE E55 Ei E25 E35 SSE 532 :Si 555 525 525 EEE ESE E22 Page 535 I I I I I 4 I I In I nl I unmvul I I un un umuuux 4 I 4 I I I Professional Agricultural Fraternity Oflpha Gamma R110 Founded at Ohio State University, 1904 Wisconsila, 1ola, 1916 Number of Chapters, 12 Burr IVIcCrary Shepard Allgrecht Nelson Lamb Stranahan Stemmler Cole Walls Jackson Hatleberg Members in Faculty JOHN WILLIAM BRANN CLARENCE NELS HATLEEERG JOHN CHARLES WALKER HARLOW LESLIE XVALSTER HARLEY FROST NVILSON M6mb6l'S in University 1919 NELS THEODORE NELSON 1920 HAROLD TAYLOR ALBRECHT ALLEN RUSSEL BURR HAROLD HARRISON COLE I 921 LYMAN EDSON JACKSON MILTON GUERNSEY 1922 STEWART JAMES LAMB JOHN WESTON LEWIS I 1 Tlgclrzka-.II': '. X txumila , .M WWI. New GORDON HASTINGS SI-IEPARD RAYMOND EARL DONOHLIE JOSEPH ALFRED PFAHLER XVILLIAM STEMMLER, JR. BEN FARRAND STRANAI-IAN VVALLS WVARD RANDOLPH IVICCRARY CARSON ELLIS PEACOCK 'lffjgzr , IX? 5 1 'Ar I.....,,..,..,,,.I.,,,.,...,..,,.,,,.,I..,..,...,..,,.. liililiiiiiliiiii?Eiilliiliiliiiiiiliillimlliilliiliii P a g e 7 3 6 1 1 5: U.,H....Y..Y...,...Y.H,.,,K...W,...H.,.,......l.,W..,,,.,..,,..u..,. ..,l. ,Y,H,..W,,,.,..,..,.,,.,,...,.,,. .,,.., ,W...H..,H,K..,,.U...,.F,..,,,.,,.,u.Y...U..YH.,,P.,..H........N,H...W.,,..,.....,,,.,,.,,,.4,.W .... .m..,,.,,.,, ,.,,. H,..,..W..u.H.mmW.H.H,,H,..,H.,H,H.H..HM.,Q..W...,..,,.Nm..,H.,...H........,........K.,.WH..1.,...w.,...,..,....l ..., ..Y,.YV..Y.HH.,,..u..,,..H.H.,,H,,HW,w..,,.W.m,H,..U.N...,.,,m..,H....H.,..,.......,..H.,H.,,.,,..,...,..,m.,,..,...,.,.,HW.H..,,..,.H..,..w.! ESE is .IE EXE 'E 252 :fs .QI E 1 .f- 552 ,V gg, zg: E32 'i- 22. 225 iii :Ei 352 :iz 323 if iii :FE sa: iii 25 iff Ei? 32: is E52 si iii Ei si :Ei gi iigmggifwlmw1.mmInnumWn1my-1W1.mnununmmvu1mm1--4'mm1mmm1Innumm1mnmuwInnmflin1n.nmummu.n.mH1H1mmm1mmuf1mmW1un.IvuwInmm1In1mmru1mmw.1wnmlwmmmmmummmm1Inmmm,mm-mXrmmmnnmmWmN.mywwInnumH.X.mnwInmmwmwmmm1Xm.IvuX.HmmXH.Xmm1.Imummmm.1H1mv..umm.muWInmummummmmm..H1un.1mywInmm.mmmHuummlH.1.mmmmwmm-m.mm.aQ InumnlnnXvuiwnuml-mnw.IwInwIninWmnl1In1.IwInwumfwInnlWw.1wInw.mmmnum1mm1.H.UrmIn1mnuH.m1H.W1mL..1mH-1H.H.myL...K..LHWH.X.UK..unm1.I1.UH.um.HInwH1mmw.Hnlw.Hinnuin1u1InW1in1.mum-mmm-Hm1I-XI-muingmnv1.uminwm1Inin1.Iw.H1InminrmWXynvmm1H,1..u.u.mm..ummHmyL..1.H1H1In1HXH.1--4m1I-mumH.X.HH.1inummInummyu1mrmmumInvu1u-nuW1mInnu1u1mfmInmmm..nunumWww.-mnumwum.. Page 537 5 I I I I II I L Professional Medical Fraternity Gamma Tau CBeta Founded at the University of Wisconsin, 1916 Pledging Chapter of Gamma Chapter of Phi Rho Sigma Phi Rho Sigma, founded at Northwestern Medical School, 1890 Number of Chapters, 28 Seybold Jexvitc Bemis M. Bach E. Bach Kitowslci Shimpa Huston Sosallo Cochems Krohn Bormann W. Murphy Millard Gough Nei:-el Cole Burdick Vivian Haberland Puestow Tillernan J. Murphy Newcomb , Krembs Hictner Tierney Dahle Montgomery Driver McNaughton Trewyn Jolly McKinley Watson Johnson Nelson Teschner 1V1embers in Faculty - PAUL FRANCIS CLARK JOHN ENGLISH EYSTER Members in University Graduate LESLIE MCNAUGHTON ALLISON LOVELLE BURDICK 1919 GEORGE GORDON BEMIS ARTHUR VINCENT COLE ARTMAN HOVEY DAHLE CAMILLES OGDEN DRIVER JAMES ARTHUR GOUGH CLARENCE NELS HATLEBERG CLARENCE EDWIN BACH KENNETH COCHEMS EDWIN JOHN I-IABERLAND VERNON JAMES HITTNER MARK JOHN BACH MILTON CARLTON BORMANN EVERETT LOWELL CAMPBELL CARLYLE ARTLEY JEWITT JOHN HUSTON N ICHOLAUS STANISLAUS JOHNSON ROSCOE LEO MCINTOSH ROBERT BERNARD MONTGOMERY JAMES HENRY MURPHY 1 920 JOHN EDWARD KITOWSKI FERDINAND RICHARD KREMBS IRWIN KJELLAND KROHN JOHN FREDERICK KRUMM ROBERT DINSMORE MILLARD 1921 EARL EUGENE CARPENTER GEORGE WHELAN COON EDWIN DANIEL MGKINLEY 1922 CARL LEE JOLLY vc L5 'H' Srl' Z ' ... - 4. mg! 'f f g' 2. ' ,..v-x 3 ,I .. f X11' 'G ' HAROLD NEBEL KARX7ER LOUIS PUESTOW JOSEPH FRANK SHIMPA JOHN FRANCIS TILLEMAN ROBERT STANSMORE VIVIAN ALLEN SMITH XVATSON MARK SNOWDEN NELSON ERWIN GEORGE SEYBOLD PAUL AUGUST TESCHNER EDWARD FREDERICK TIERNEY WILLIAM JOHN MURPHY ALVAH LAI NEWCOMB BRYANT HOOPER TREWYN JOSEPH ROY SOSALLO .............. ............................ . ..... .... ...... .................... . .... .... ... . . . ......................................... --.ggi 'W' .I.................................................................... I ' I .I . .... .. ... ... . ... Page 538 numwmwmmmunnml1In.mmummWInmmumyuumInmmumwummInwInmqmnlmlwwlwflmlwInuwInffl1fnwmwInInumInm1mw--4w--1ummm11-4nl1N1unnlumInul1uWWIninwruummmwInwuwInw.I1ulHmmm1fu1mwynmHmmmmumInmwlwwmmmulwu11Huummunwuwmmu1uHXInuwInyuun1fuuInnluufmmHw-IwuwwmwuwrumHmm1u1uwfu1mmm-mnummmflwwuXuluwInmmlnuulufnfuummwuwmwynXnXanumvum1vu1mvmummmuuummmg F511myI.1vmrmvmW1.mmmlulmnmvmWmmWH4nnnuN.1H.1rmm1.MwmK..XX.I1I..M11In.myn1.11U.11.UH.XW1V..1.1,1..1H.,1.1w.H11-1H4,m1V..1M1U.11.w,.1,.U1V-11.41W1-.11.11...11.11..1.H1W1..11H,,H1.MH...Umm.1.mm....fm1H.H,vu..11V..11.1myH.XI.,H.XV..1..,,..1V..11-1N.HV..1...11.4V..11.,,H1.HX.U1..1H.1W1.HH.1H.,..m-1..H.w.mm1-1.m,.w.wm,.fu....11.1NHX.U,..1.H1.HH.11..X.HNHnu,WX..11-mm..,m...wm.41H.nnvwmmXm1mm1In1HXm1wmm.Xvu1fi.WIIHIHIENZILIRIEE 5 E15 : '-E 'S EE EE EE 5,2W5,5MM1,5mf55,M,H1,5,EM,wg,ElmyuIn,Q1,55,1lm25,5M5,31:5E51,11.3,.Z,H.,,.,,.,,..,W..,...,V.,.N...,...,..,.,.,,.,....,.,..,,,,,,.,..,,..,..,,.,,,.,,.,,..,,..,..,,.,,..,.....,...,...,.,H.,,.,,.,,...H.,,.,H.,,.,H,,,.,H,H,,..,H,,,.,K..H.,..,,..,..,,..,,..,..,..,,..,..,,.,,,.,..,,,.,..,,.,,,..,,.,,.,,.,,,..,,,,..,H,,HN.,H.H.,,..,...,..,..,,,.,.H...,..,,,,,..,..,,..,.,,,.,,..4,.,,H,,.,,,,.,,.,,.,,..,,..,..,,..,,.,,.,,,.,,..,,.....,,,.H.,,..,..,...,..,nm.,,.,,.,.,..,,.W,.,..,,.,.,..,..,..,...2 3 mm'IWWXHXWHWInXInXWInWXHXXHXXHinXWXHXInXHXmmmlXHXInNHXXHXHXXMNInXHRHNWmmmmwmuWmmmM .,,....,...,... . . .,,., .,..,,,.,,..,,..,.,,..,,.. ,,,,,.....,. . , . ,..,,.....,.. ........ . ..,. ......,..,..,,..,..,,..,,........,...,..,.,...,......,..,.....,.....,,,.,,. . ......,. . ,..,..,.,.,...,..,. .....,..,.,....,,......4...,..........4.......,..,..........,.. . . . , . , H U....XHXmWW.UX..X..X,..X,H,..,.HK.,NH..H,HW..,m,H.K.,XH,.H,.1X.H,W..U.n..u..,.w.WHUW...X..X,H,HW.HXHimXUXWH.,y.X,HH.,,1..HX..,ml.HH.Xmm,..X...X..NHv.,..m.,,.v....,..., ,.., .mf.WWV.,mumW,mm.,.m..wm.m.,..m.,...u.,,.,. ...,, . ,,.,,.. .m.mm.,,., ,..,,. .,.,u.m.,,., ,,.. .K.v..,..W.H..,.m..m.,..,w. ,....., M..U..,...,...,.u.m.,,,,..- P LY g e J 3 9 , Fraternities In the order of their establishment at the University Phi Delta Theta . . Beta Theta Pi . . Phi Kappa Psi . Chi Psi . . . Sigma Chi . .. Delta Upsilon . . Delta Tau Delta . Phi Gamma Delta . Theta Delta Chi . Psi Upsilon , Kappa Sigma . . Phi Kappa Signia , Sigma Nu . . . Alpha Delta Phi . . Sigma Alpha Epsilon , Delta Kappa Epsilon Acacia ..,.. Alpha Tau Omega . Sigma Phi . . . Alpha Sigma Phi , Zeta Psi . . . Chi Phi , . . Delta Phi Epsilon . Phi Sigma Kappa . Theta X i ,... Lambda Chi Alpha , Tau Kappa Epsil: w Theta Chi . . . Awema . . . 620 North Lake Street 622 Mendota Court 81 1 State Street 150 Iota Court, V 630 North Lake Street 644 North Frances Street 616 Mendota Court 521 North I-lenry Street 150 Langdon Street 222 Lakelawn Place 621 North Lake Street 614 Langdon Street 625 North Henry Street 640 North Henry Street 627 North Lake Street 524 North 1-lenry Street 615 North Lake Street 225 Lakelawn Place 106 Prospect Avenue 619 North Lake Street 104 Langdon Street 635 State Street 630 Langdon Street 211 Langdon Street 166 Prospect Avenue 1 15 NVest Gilman Street 619 Mendota Court 143 Vilest Gilman Street 610 'State Street fl-heofessional Fraternities Phi Delta Phi, Legal . Alpha Chi Sigma, Chemical . Phi Alpha Delta, Legal 616 North Lake Street 642 State Street 668 State Street Triangle, Civil Engineering , . 438 North Frances Street Phi Beta Pi, Medical ,,., 613 North Lake Street Alpha Gamma Rho, Agricultural 1530 University Avenue Gamma Tau Beta, Medical . . 428 North Murray Street Page 540 Orornfes I I I I I III: in III I n mmmiImmminuiiiuiiiiiiliuim iwmmiwnt Kappa Kappa Gamma Founded at Monmouth College, 1870 Wisconsin,'Eza, 1875 Number of Chapters, 40 Living Members, 6,500 Vinje Krueger Sarles McCabe Beatty MCI-Ienry J enswold Robinson Patterson Murphy Saul Bieberman Peterson Seaton Ferguson Butler Munson Allyn Parkinson Riley MacLaurin Sm ith DOROTHY HUBBARD FLORENCE ESTHER BEATTY Members in Faculty HELEN MCCLINTOCK-I. ANNIE PITMAN Members in University 1 91 9 MARION J ENSWOLD LUCILE WILHELMINA BIEBERMAN MARY SEARS MCHENRY LAURETTE BUGHER CONKLIN MARION ELIZABETH FAY JANET BUTLER HELEN MAE DICK MARY ELLA FERGUSON I... LOUISE ALLYN CATHERINE OLIVER MUNSON BRUNHILDE MURPHY 1920 DOROTHY ADELAIDE KRUEGER IRANE HALL CLARA VIOLA HOOVER MILDRED LYNE JOHNSTON 1921 MILDRED KITSELMAN RACHEL SUTHERLAND COMMONS DOROTHEA MACLAURIN MARY HAMPTON . VIRGINIA BUCHANAN JOSEPHINE BLISS RUBY BRITTS MILDRED HINNERS AGNES MARY IVERSEN MARY JULIA PARKINSON 1922 HELEN KAHN CARYL MCCOY PARKINSON MARGARET POPE ELEANOR PRAY SHELDON ' ,.1, .II..ii.ii.ilII.I...II.II.,Y..IIIi,.w..i.m.4i..ii.ii.. iiinumniinInIIIIIIiIInIIIImmmmmimiiiii Page 542 DORIS CARTER PETERSON DOROTHY JEAN PATTERSON IVIARGARET IRENE PETERSON KATHLEEN ROBINSON LULU ESTELLE SAUL CORNELIA MGCABE lVlABEL MAYHEW SMITH ETHEL VINJE ELEANOR RILEY AGNES BOWEN SARLES DOROTHY SEATON ELIZABETH SNIDER GLADYS SCHMIDT AGNES SMITH IRENE TONVNSEND JULIE XVATSON I I I I II-ii..w.mwI..w..II.I I .imimii InW.,i..ii.m.mm.II.I...ssa - ........ ,.....................,.-W.1 2 miimumz 21: Qmmmmunulwanwmvuwmwmvmwmnupuwmwm1nwwuwnuwuwm1u1wuwinwwuw1nuvuwrmIn1mmumnunumwmmumvmunrmwnummwmwvwvmnunuwIHvuwwuvruwmymmwrnwmmwvumm1mnuvmvuwunwIn1Inmnu1u1fnwIHwvuwuwmwruwvuwnwulwunwuwrmm1nnyn1w1n1wmuuuinufuuIn1uw1H1nuinwvuvu1vmm1nw1uwfnum1nfwu1rvuuvum1yuvuwunmwvuwmwu1m1mwn1muuluu1nv1uuuuuvuumwmwInwuwmwuwnuwnuwuwwuwru1mynwm1Vunuwm1uvmwuvulm41mvu1rmmmuuuuumwmwnnmrmg EQ27lhwIllmmi1In1fnwIn1n1myvu1InwIn1Inm1m1Inm1m1-I1m1In1mvmmlunul1lmInumInmmuInnu1annnunnu1mnunuIn1m1mH-mlvmvmulwm1InwInulwulnun11rnin1unnuInnmInvmnl1m1m1mvu1mummmwmlu1XInm1.411u1m1Invu1yn1mm1nl1vmumm.mmmm1mruwvu1m1-I1.111m11.41Hmul-mmmmm111H1w1Hm11Innlwi1-HulHuin1vuwInH.1mlI-Imlm11muhIn1H1ul1mm11flUi11ifGil?EIMS?711121511Eh11.1mGAIlihii5111111KIMIZQZKIIRTEIIEISE1.-g3 5 EA 2 E S : 5 2 QS Egg ' ess 532 ESE sxi ii 222 535 ii: .SI '1- EE SE fsf :gi H' E35 'E ilwvunlwnuwnuulummnlwInunInnunumul1luulwuvrnwluwunnsuwnnunnummwulwluannvwruunInAruvuruwnnulwnnuwInzumwnlwunruwnuzuwuvrnuvwInrmInulwuwInrnrmrnw:muwuwnunummwnuwmmruwnnwnwmwuvmunwanrnwanunwnnunInwuwmvuxruruxIrwvuumunvnvuuvnuunwmuunruulnnnnvunumxuwwu1nmuulxzumlmlmurmmvmurmvrxummunnumwluwuunnmunnnumuuumvxulrrvxumnnurmmnuummunnunxumnumwnunnmnrxrunuunuvummmnuuunnmmii Page 543 Ii I I I I nn4 5De1ta Gamma Founded at University of Mississippi, 1872 Wisconsin, Omega., 1880 ' Number of Chapters, 29 Radford Waterman Pabst johnson Clark S. Blaul Brown Schxvartzburg B. Blaul Fricke Storms Vaughn Kurz King Head Briggs' Wright Warner Wuerpel Ripper Alwood Bacon Sumner Kroening Gallagher Ferry Mabley Jones Schmedeman Members in Faculty , CORNELIA ANDERSON MARY COMSTOCK MRS. MARION ROSENBERRY KATHERINE ALLEN MARY FOSTER GERTRUDE SELLERY , Nfembers in University Graduate MIGNON WVYMAN 1919 FREDRICA ATWOOD ANN BRIGGS KATHYRN IQENT BROWN LILLIAN CLARI5 BLANCHE FERRY LEE FAIRCHILD BACON SOPHIE POCHLER BLAUL ETHEL FRICKE ' BERTHA BLAUL lVlARION DICKENS SARAH DEAN GALLAGHER MARYANNE COSS ANN VAN ARSDALE EDWINA DEXTER MARGARET FLLETT ALICE GALLAGHER ELLEN GOULD ELIZABETH HEAD IQATHERINE j ONES FLORENCE KING GRETCHEN KUEPPER 1920 RUTH ELLSWORTH JOHNS ADA KROENING 1921 MARJORIE l-IALL HILDA MABLEY WINIFRED MOSS. - 1922 HELEN I-IOOPER ON FRANCES SPAULDING JACIQMAN .IOCELYN WINTHROP KNIGHT MARGARET MCDOWELL 42 :A ,X A, . fl II.Ii.IIiIImInIIi.Ii.II.IinIIIIIIIWIIIIIIIIIIIIII IInIIIIriImmiiwmimiiiiiiIIIIIIIIiiIIIIIIIIIIIIIIIIIWIIII Page 544 - MARTHA KURZ RUTH MARIE RADFORD CATHERINE SUMNER MAURINE VAUGHN CORNELIA WRIGHT MARIAN NVARNER ISABELLE WATERMAN LOIS YVLIERPEL PAULINE THECKLA PABST IKATHARINE SCHMEDEMAN MILDRED SCHWARTZBURG RUTH STORMS I-IELEN I-IAYNES ROBERTS IQATHERINE EDITH ROGKWELL DOROTHY SUMNER VIOLA THOMAS MARY REA WVOODARD 3Wunnumvmmymmmn1wn1mmmurunmInru1nlfmnlwpmmwmyuwwIn1ul1yn1fnunm1mwIn1In1luinwIn1Inin1inWIn1m11.11.11WruwW1uf1In1H1u11H1H-1m1uv1-11nv1uf1-111uwm11.w1HwIn1In1Inmwm1H11-I1wH1W1u1V1.Wu-wlwmlnHW1.1Xm1U4W11Hvu1m1w.41uX1H1m1H11H1n111.1mXH11mruvm1HXvu1InNuXvu1V..W1vuul1H-mfum-wywmmmmuwmummmwmm1Hmmmlwuu-umumwmvmm1Hruwvumlmnurmfuwwn1vmwumuuumwmfnm1yunm-mm-mlww. numumruvmmrmmnu1uvNmInInwInw-Imnnmmumlmufu1Inummm1mwHw1I.wmuwInin1m1.I1w.Iwmwum-mmmHwInum--111.11H1.I1nl1InumInfuwmwHwm1inmHInm1In1-I1w.I1WulH--1W1InH.1U.m4mm.um..m.wfulmynWminXLHummIn11.4ru11HX.IXmuwIn1U1H11H1I-41.IW1ulUNm1.111.I1Ww1.4+I-umyuin1ulmymwInmuw-.1Wul1nu.I1rmInanHmmmwHwwu1ininXWuvmnmnl1inWmwmmmuumfn1H1mwWyuW.,m1H.W1H4mmmmmiwm-:EE Elm' , E25 EVE EEE :!E 525 E15 EE ' EE: I 232 E52 :gs Exl 1 Ez: if Ei? 5:7 545 :E EEE E gm33531395552TimEMM1ww..WmH5,..X3.1XV.....,.HV..,......,...U.,...W..11..,H1...V..X..X1.4H.XV..XV.1WX...W..XK.XH.Xy.X,H.H,..,.N......1U.,..,H,.H1..1N.1,..,..,1..1..,,.,WW,.,W.1,,H,...K..,..,,.1,.,,WV..,..,,..,.V,H....,1.,,.,,.HH,WH,K..,.,,...,..,V.,,.H......N..XX.X11.,,HX..1V.,1.4XmH.1.1XynX.U.HV..MXV111.HI.XXnv..XXWM..m.,m.,mnm.,.,m.,.mmW.1N.NV..1mummmm.m.m.mmmm..mm-m,....m.,m..u.mmmmm.m.m..H,Wg 5 2 ,.mwnwwInuv1Huummmlmlmm1-1Inruwwnwmmww1-wInnuH11-M-mmmmnmmfnnl1uwwuwInH.mwwmInmmm'1mU.11.1m1WH,11.XK.,1.11yuWw.111.11.Hm1..1m1m..1V..1m1.1W.HmInwin1m.11K..mwinwInwH1umywuwHwWwHwrnwu1fum11I11mfnmruwinNInm1I.11n1n1mmwH1lmm1mmum-mmmHwH1w11.m1X.1u-.1ininmm..nlfmmmmnummwumuminnn1-1unwnm.1uvmnmmmmmmnmmwunumlmummmmmmmu mmmmmmmmummlh- Page 545 IIIIIIIIIIIIII I I I II I I I I I III IIuIIII I II III III II II IIIIII I IIuI IIIIIIII II Gamma Phi 5Beta Founded at Syracuse University, 1874 Wisconsin, Gamma, 1885 Number of Chapters, Z1 Living Members, 3,630 Walton Hanks Carlock Wallrich Maher bteemland Hinkins Snmh Deakin Finnerud Lindsay Harper Boyce Haley Works Williams Hubble Nuzum Coates Yerly Heddles Coerper Turney Simonson Wang Rogers Scofield Members in Faculty HELEN MARY LANGER AGNES BOEING Members in University 1919 MARION FERN BOYCE ' ELEANOR FAIRCHILD DANA FLORENCE DEAKIN DOROTHY MAEEL CARLOCK DOROTHY COERPER BEATRICE CUMNOCK CAROL COATES INDA BELL JULIA JUDGE I-IANKS HELEN CAMPBELL HARPER LUCILE GRACE CAMPBELL JULIA COLMAN MARION DOWNING ALICE LOUISE EVANS RENA HEDDLES EVANGELINE MAHER MIRABELLE NETHERNVOOD 1920 FLORENCE FINNERUD IRENE WILSON HALEY HELEN MARY HUBELE JANET EDMONO LINDSAY 1921 MARCIA IXVELSON HINICINS HELEN MCCARTI-IY MILIJRED AOELLA ROGERS 1922 ESTHER THERESA GUERINI ELLA JESSIE HULL KATHERINE MEYER , I,. i?'2S'fII LUCY WALLRICH RUBY XVALTON CLARA BASSETT XVILLIAMS LUCILE RUTH XVORKS IVIARCUERITE FRANCES NUZUM DORIS SIMONSON LOUISE MARIE STEENSLAND FRANCES TURNEY HARRIET LOUISE SCOFIELD FRANCES EUGENIA SMITH GLADYS LORRAINE WANG LEONA ADELINE YERLY DORIS MAXINE LOVELL FLORENCE MARIE SCHROEDER LOUISE EDNA SMITH DOROTHY ROMAINE SHANER IIIIIIIIIIIIIIIIIII-IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III III I II II M -,I IIN IIMIQIIIEIINTEI -I I II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII I II Page 546 mung nu mm. I1fmmnnmnmwu1funnwInmn1mmlnnnumlnnmfuwwnlmfInwnl1nvnuwwinwu1runnwn1myInwnvnuin1nnuvmyunInununinwnlnuuv1inunmvmwanunvunnvwnvnnwnuunwummuInwInInwinwInuInunmyInwmununrmanwInwmwIn1munrnumnumunwunInunmmmnummum Q,..,i...u.....,,..,....,..,.,.,...,,..,...,i.m..,..,,..u.,,..,.,...,....,....,..,..,. .... ..,..,,...,.mmk.m.m..,..,.......,.......,K..,...,.m..H...H,,..,..,W,..,H....,,..,.,.4,......A..,...u.,...,...,..,, W... .. 5,gn...n.m.,,..,...,.......,u....,,..,...,K..,....,.,...,,.........,.,,,,.....,,.m..,..u...,..u...w,..W,I..,.........u,,,.,..,,..u..,.,,.......u.....,,..,nm.,,..,,.....,,...,..,...,,....,,......,...,,..1u..m,..........1.,...,1:,1,.,..z.,..:..,,..,:..,1::,1:,.n,a:::1.:n.z:iz:1,z11:::1:1n:11.1:1::1::1an11:z1m1:a:z:::zzz:z::n::1::s:::::asmzzz:zzz::manan:1::::::::::u::z::zaaa::zzz:nzazna:m:1:::1a:1:::::a:z:::z::::a::::n:zz::::a::nam:1::111:1:11aszzn1zazmmaszaaaaazzzaaznzzaa:1a:asa11z:1ia11a1Q1::asa1m:ax::1:a:u::1a::a:::xa:aazzs::::gg5 egg 2 Egg 235 as sfi -w ,, r, . f 11' fvf- f,-1 mf ii? Egg I AW , W- I, V ,-WK, E52 gig ,1 ',:,f,z, ff -6 1, 2'm,jft.j iff L,f'2,'Zv,. E 5 1 'W ,gm '- 1 f,,.,f1-f,. - ff.1,w,f4gfz-1 EQE EEE .,Az5lHf4vL NL ,f I ,Wil EE 1,1 72 ff ff' ff Tv Q 'Lf , IW. ESE EE 'i V fwff E32 'is ' ' ' EEE IGMOBM 'A ?f'i7esf1' ' 535 ., . . , X Q x x , - V, if EEE V . v , 1 ' ' 255 I, ' .4 ' E32 ff I '. 1 - ' f ii? E55 ii, EE EE Ei 535 Ei za. Ei mm X mumummmmmyummm.mmInmy-mmnn-ImmunInmwmmumyumm.mmnnInnnnu-nmwnmnuvmmxmmvm .... inulnlmnunmmullnumunAnnuununmlmlunumunInnumulmvluunInunInnlnumunnlnlwuvunsnnumnuInulummlunlunvuwInrn:mmunvuulmymvInInluummInulnlunulwuwulnum1lunlunAuwInInmmmnnlnumnulunum:mlnInumllunnmnmvnmmnnumnumnnuvnunnnlwmmnunumulnuumllummmmnumuunumulnmlluuuunmnnmuumununmuulmnmumluanulxnumnnmuurumannrnummllmmlmnnlulummunnunf Page 547 I In In II I II I In I I I IIIIIIIIIII IIIIIIIIIII I I I III Iuuv II IIinimnvmuinimuruII mu: II II IIIIII III I III nvu Kappa Alp 11a Theta Founded at De Pauw University, 1870 I W'isconsirI, Psi, 1890 Number of Chapters, 42 , Lowe Dennett Schaper Dwight Briggs F ishbum Hanna Sackett Brown Mautz Graham EaglesHeld Bartlett Ashby Chase Paine Buckmaster Conover Groendyke Butler Taylor Tillotson Winchell Beard Strock Gill Schilling Sperry LUGILE PRITCHARD ROGERS SARAH ASHBY ' l'lEI.,EN CONVERSE BROWNE DOROTHY DIXON DENNETT ANNETTA DONKLE MARY DORIS BEARD ADELIN SUMNER BRIGGS MARGARET RELIHEN BROWN KATHERINE BUTLER HARRIET BARTLETT SADA BUCKMASTER FRANCES DWIGHT SUSAN DE LAITE BROWN MARTHA BUELL RUTH DICICOVER DOROTHY DWIGHT KATHERINE ELY . Members in Faculty MARIE CAIRNS JULIA MERRILL Members in University 1919 MAE GROENDYKE CORA MAUTZ ADELAIDE PAINE VIOLA PLEUSS 1920 LUCILE CHASE DOROTHY JANE CLARK DAPPINE CONOVER VIRGINIA EAGLESEIELD 1921 HELEN GILL ESTHER GRAHAM ISABEL ELIZABETH LOXVE 1922 HELEN INGERSOLL ESTHER MERWYN LINDSTEN FLORENCE MAHORNEY DOROTHEA NELSON , 1 i f xg 94 S . I In ummm. miiwimiiiiim IIIIIiwwiiiiwiuiiiwIIiiIimiwiimiiiiiii. Page 548 HELEN DODGE HELEN SKINNER MARGARET SPERRY SARAH MARGARET TAYLOR MARION ALICE TURNER TQATHERINE MAURER NVITTER TQATHERINE FISHBURN FLORENCE BERNICE HANNA HELEN ELIZABETH SACKETT GLADYS SCHILLING VIRA VVYINCHELL DOROTHY SCHAPER LEAH SUTCLIFFE IVIARIORIE STROCK MARY ELIZABETH TILLOTSON KATHERINE ROSENBERRY ELIZABETH SHOLES MARJORY TODD KATPIERINE XVICKWIRE IMA NVINCHELL :Es - 51- y111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1 11111 111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 1111111 1 1 1111 1 1111 :H 1 1111 11 1 11111111111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111F111ii111111171511111111211111111F1111111111F711PE1111111111112111171UIQF111111151??1l1l711iii111111IPi1Z' :EE ' Sf? S E52 - 11111111111 111111111111111111111111.11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111111 1 1111111 1111111111111111111111111111111111111111111111111111.111111111.111111111111111111111111111111.1111111111111111111111111111111111111111111111111111111111111111111111111111n12 111111111111111111111111111111111111111111111111111111111111111111111121111111111111111I11111511111116111112Ui1111111111111111111E1111111111il111111111111111E1161111111111111E11121111111111l111i11111111F1111111l111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111F11F111111111111111111111111ii11111115111111ii11Fi11111111111111111111112111511111111111111111111111i1iil11111111121111111111211115111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111F Page 549 1 V 1 E 9 x 1 ! e 1 4 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 II I n I I II IIIIIIIIIIII I II II III IIIIIIIIIIIIIIII II I I II IIIIII IIIII II IIIIIIII 5Pi 5Beta Phi Founded at Monmouth College, 1867 Wisconsin, Alpha, 1894 , Number of Chapters, 53 Living Members, 8,162 Ramsey Bcardsley Kern Clayton Donaldson Hahn Owen Goddard Esch Kessenich Archibald Wanner Puckett Whiteside Sundell Schweizer Lathrop Tenney Trc-:dwell Chandler White Wright Bur Johnson Hollands Porter' Snavrum OLIVE MAUD BEARDSLEY MARIE MARSHALL ESCI-I DOROTHY PATTERSON GRACE HELEN MARIAN ARCHIBALD CATHERINE BUR AGATHA HELEN HAHN ELIZABETH CHANDLER HELEN CLAYTON Members in Faculty ALICE CRANE Members in Universiiy 1919 GRACE CLEMANS,GODDARD MARGARET LATHROP MILDRED VAIL PUCKETT 1920 MILDRED KATHERINE KERN HELEN JOANNE OWEN AUTENTIA MAY PORTER 1921 DOROTHY MAY HOLLANDS THELMA BERYL JOHNSON MARJORIE BROWN DONALDSON LUCILE KESSENICH MARJORIE BLAIR ELIZABETH CLARK ALICE CRARY 1922 EVELYN LILA LEE MARY MCLEAN OLIVE BERNICE PETERSON RUTH DLYNCAN SUNDELL LILLIE TREDNVELL IQATHERINE PAGE WHITESIDE HELEN RAMSEY KATHERINE E. TENNEY ESTHER JULIETTE XVANNER HAZEL EMBREE WVRIGHT IVIARIAN FRANCES PIERCE FRANCES AVELINE R1'AN GRETCHEN SCHNVEIZER ALICE ALETHA XVHITE CATHERINE SCHULTZ ALMA LAVETA STRAIGHT MARGARET THOMAS JOSEPHINE .IORGESON CAROLINE SCHWEIZER DOROTHY RHODA WARE ISABEL LUCILLE WRIGHT I IIII II III I III'l ' i IIIIIIIII IIIIIIIIII I IIIIIIII IIII III II I I I I IIIIIIIIII I IiiIPIIiiiPIIIiiiiiiIII?1IiiiiiIiiiiiiIiiIiiIFiiIiiIiiiii II I IIII I I III IIIIIII III IIIIII II II II III IIIIIIII Page 550 IIIIIIT' W I I IIIII IIII g.mwmwww5,31WM3553gmmmE553l555lwgwggggggmwEEMMQ553595,,M,,MM35,55,1myWMM5533mf4.,E,5,1,,mw.W,WK.,U.,um.,...mm.,,,.,,.,,.,,..,...,H.,.Hy..,.,.,.m..,..,,.....,,, ..,. .,.HV...,,.,.,.,..,,W,.UK.,V..,N.,.W,H.,X.,Y..Y,H,H...mmY..H..,...,.m.m.,,...H..,HY.m...,..U......wK.,H..W.K..,H.N.mU.,.......1H,H,H.,V..N.HNH.,1.,numN.HH.,.Mmm.WW...VWum...H.,..,,...m..l..,,..g 55gn...,...,,...,..,,...mm.,...,,..,,..,,..,...,,..H..,..,,..,,......K...,..,...,,..W..,,..,,.,,..,uw..H.,.,,,..,,.U,.,...,,..,H.,..,H.,.......,W..,,,.,...,H.,..,,.,,..,...,.....,,H,,,.,,..,,.,.,.,...,..,,..,.....,,,.,,..,.,,H.,,..,,.....,N.H.,H.,.,.,..,...,,.,,.,,..,...,...H..,.,.,..,,.,,,,,,.,,..,,.,,,.,,..,,..H.,,..,.,.,..,..,,.,.,...,,.,,,,H.,...,,.,,..,,..,H.,Q.,,.,,,..,,.....,,..,,..,,..:......W.,..1,..,,..,.m,..Q..,Ka.,...,...,.,.,..,4.,H.,.a,,..,.,.,4,,.an:::za.,,.L,5.1,L.,Q..,...,,..,,.,...,...H..,..,,..,,.....,,,.,...,,..,,..,..,,,.,,.,,,.,.Qgg Els ses EXE gig 555 sig Eff ::: Es: 232 iii Ei! Ei? ' Ex: -.. .z. , ,.Um.mmmunm.Hml1InInL..W.1my.HH.H.,L..mm.1.mm...mvH.11.1...1.HH.,.HK..1.HV..WL..W1..1.w.H.wm..w.1W-.Wmm,1..,nvV...VH.HU.1In,..WH.,..1..1H.1..,..11.4,1.1.H,1.1H1H.1..1WH.,H.WX1.4mm-1V-WNHX1.H.11HWV..11HmN.1W-.1X.HnvX1,NH4,HH.,..m.H-U.-11.4,HX1.4MXWmW1..WH,WmN.H1.4mymun,1.vmV..Wnfmummmm...m..Xm..mm..m.....mm.mmmyH.vmmH.,,mmummmuw..X.UM1.HV..XwmummmH1W.H,.1m4..m.mwU,.mi 5 amnnu5EuE1mniiEmi1vEhimillEEIIEIBQMulGQHIZIEIREUUIBIGiEEhMMI1HMGilliiiliiGilliiiiiiliimiiliiiKEEPERiiiEiifiiililfiilIi?Iii?FIEREITFZZIiiiiiRliiRii?lil1ii?ii1H11il?HiGiWH?ill5112.1Mill?IlQ.HwillKLM.1E1mmfwHmmfwHml1mlmn1ImInmvm.I1myInN-11InWXHXinwI-XmuIninW1yumvinmunwUHmummunmmmmfnmwH1ulvmmm.nu.mmmmmmvmm1mnwmlmmmXmmXmwInmvmuwmmmfuunm1fumumWunHmnmumInXInmXI1Xuvmumuwnuwwa Page 551 III II 5 u CH1p11cz Phi Founded at Syracuse University, 1872 Wisconsin, 1ola, 1896 Number of Chapters, 21 Anderson K.BarthoIf K. Conklin Winchester Kitchell Wilcoxon Megeath Bacon W.Bartl'1Ol1 Schulte Faville Utegaard Wensley Day King Neil Cook Hall Custer Newcomb Stevenson Jones Tormey M. Bartholf Colder Kiland Van Aken Cox Cooper Lamb Jamieson Jenison Runkel Hjermstad NVhipple Eschweiler Hamilton Kremers Beal Place McCain Kupfer Billau Members in University 1919 WINIFRED BARTHOLF LAURA ELIZABETH FAVILLE MARIE EMILY HJERMSTAD MARJORIE BARTHOLF BEATRICE ELIZABETH BEAL MARGARET ELIZABETH BILLAU KATHERINE JOHN COOK MARION ALBRICHT CROSLEY ETHEL MAE CUSTER FLORENCE ROBERTS DAY MARY ELOISE ANDERSON ISABEL LYMAN BACON KATHERINE MARY CONKLIN VIRGINIA THERESA CONKLIN DORIS EDWINA COOPER GERTRUDE PHILLIS KING HARRIET ANCELINE KUPFER JEANETTE JONES LAMB MARGARET HELEN SCHULTE- 1920 HELEN DOROTHY GOLDER DORCAS JOSEPHINE HALL PHYLLIS BRAYTON HAMILTON HELEN MAY JAMEISON VIRGINIA KITCIJELL LAURA RUTH KREMERS KATHERINE LOUISE MCCAIN 1921 DEIRDRE DOROTHY Cox ELAINE KATHERINE ESCF'lWElL PAULINE GERLING ERNESTINE J ENISON MAELE J ENNINGS JONES ER CLARICE RUTHERFORD WINCHESTER 1922 NELL BARCLAY PLACE ALICE VIOLA PORTERFIELD JANET XVHEELER RUNKEL JESSIE MEGEATH VIOLET STEVENSON lXflARION TORMEY ISABEL ELEANOR UTEGAARD MARGARET GRAY XVENSLEY MARCIA XVI-IIPPLE MARIE ELISE XVILCOXON MARY LENORE MARTINEAU CLARA NEWCOMB MARGARET EASTWOOD NEIL MARGUERITE SHEPARD JULIA LOIS VAN AKEN KATHERINE BARTHOLF ANDREA KILAND l'lILDEGARDE L. lVlAEDJE DOROTHY DREW TENNANT .4,2...: S ll. nies, IIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII I. II III.. IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII. IIII.w JILIHIIIJHI ..,, I.I.I.IEwI I II IIIII IIII I I I I I III I IIIIIIIiiiIiiiIIiiIiiIIIIIIIIIIIIIIIiIIiiiiiiIIIIIIIIEIIHIIIIIIIIIIII II II III II IIIIIIIIIIIIIIIIIIIIIIIII III I I I II IIIIIIIII 'I Page 552 ymwmumful M m.m.mmm.mfm.ff.mwwm 5 g gfmwfmuuf mumuunmmffmfumwm , ,. .. . ,. ,. ......N.,...'JLfwfr!!'fiff11:11:11:1Jff:Jf1J1J1MJu1JJUJff!'ffrJ'11!.::1ff:lfzyfllfllffrfzrlfrlfefl JJf,:JHJ:,:JJ.:JLJuJJff1ff:Jf!f:J::J2:::err::J'1,J'fJl'fuf1:f'f' Jiffy'1J!'J:::1Jl1:JfJJ:,::.JJ:rJ'fr1f::Jf1:J.:ffm JJ J:',JJ'::1 fJ Ju ''H': H' W f'W'HH'WHWIWIwwwWWwwwvwIff''fwwwwfffwlwwwwwmfwwwwffwmwlw H . ,..,.,..,,.,.mH.,,...,.,.W..,.,,..w.,.1.,,..WWU,.H.,,,..,,..,,.....,,.,,..,,.,,.....,U..,..,...WmW.,,H.,W..H,,N.mmW..,,..,,..w..,.H..,..,,.,,...,,W..4,,..,....W.,..WW,.H.,H.,,,,um,.,,.m.....w,.,..,.,,,,W,,,,,,,,..,m:,..,.V..W.,fn,,I,un,ffm:,ffm:,mfr,in5:19112rf:z1:::::',1r'f:::,zzframyme,fa,,may,fwfr,,zssazzmzzsnr,muff,f::z:::1f:a::m': ' E 1' S E S E li SEE 5 3 E 5 r 5 1 anmumfmuwwmu ummmmum1Huuvuf1uffmrfuvurwmmmnuvuvnuwmm :E 'Tri ' 555 ?f-ii 5:2 EEE ,I E55 ? 'I ! 555 555 1:5 E55 Ve? E15 ,Rf 51 'E as 5.4 E55 EE Ex? ag: E15 5 525 55: 5:5 if-5 lm....m...,.........,........,..u.,.u...u............W................u...W.n...,.......H....m.....W..,,.,..u....,..,......,.....,..,u......u..n......u.n...,...,.f.....m......,.u.....,..,...u.m.....u,.w.m.u.M512 SuuuummvmuumnurumuumummmnuvuunnmHuumumuumm:muvuumrrrrumlmunuuuuruuummmu1uunnmmuuummv1umnmunuummmumnllmurulumuuulmlmnmmmmHu1HnuHummmuummumnnmnmuuvmrummmumnnnmunununuumurmmfunnzufm:umnmuuuuu1n1nuJMInnvfniffiifhlffrufniUnffmvifffmi5fHififfmfmDIXIEmimiF5555551155175fmffmsfmffmmilullnr:nn: QW P a g e 5' J' 3 .. S MP ku .V -, ,,,. n I I I I Im If 5Delta 5Deita CDe1ta Founded at Boston University, 1888 Wigcdnsin, Mu, 1898 Number of Chapters, 68 Living Members, 6,785 Little Allen Chadwick Karlen Robinson lV1acAnanny Kircl-I Feclde Snyder Taylor Smith Forward Hubbard Converse Phillips Johnson Strong Dickson Brunkow Dodge Umbreit Hughes D. Smith Piper Everett Nfernbers in Faculty MRS. W. J. KELLER MISS FLORENCE ALLEN MISS LESLIE ROSS Members in University Graduate HELEN PETROVNA CHURCHILL MARY FRANCES LITTLE RACHEL BEAL CHADWICK NORMA CHURCHILL LUCILE EVERETT ESTHER MARTHA BRUNKOW MARY CONVERSE MARGARET MARY DICKSON ELIZABETH DODGE JULIA CHRISTIAN HAY ALLEN 1919 lfATi-IERINE ANN FEDDE RUTH ANN HUGHES HESTER DOUGLAS ROBINSON 1920 l4ATHERINE GERTRUDE FORWARD MARY LOUISE HUBBARD RUTH ANN JOHNSON 1921 MARGARET MADELINE KIRCH MARGARET STRONG 1922 DOROTHY JEANETTE LITTLE MAE LAURA SMITH 2' A0 vig 'A T Avi . SQIQQQQ' ,,1...:s nw, Ll' 0 - ' ll i ' 1 - on InInII..I..mm.Imi..IIn...I..II.I.I..I.m..mI I InInIInnuIIIIIIIIIIIIIIIIIIIIIniIInuiImnumlumivmm Page 554 DOROTHY PAUL SMITH KATHERINE TAYLOR PREDA EMMERT UMBREIT lXlARlE IVIARGARET lfARI.EN RUTH HANSCHE PIPER lN4.-XBEL GERTRUDE SMITH HELEN MARIE SNYDER DOROTHY IVIACANANNY guy nnunnnunmmnmuvm1mummnuummmmn ,...,,.....W.,nm.,W..,.u.....n...m..,,.w...H,...,...H...W,,...m,,. .,.. WH ,,,. H.,nm..W,,,..,,....1,..,..,,.M..mm.W,Vmm,,H.mu...M,,.,,,..,.,ww,,y...mw.,,.,,..,,..,,.,,.,.,.,u.H.,, ...V W,...,..m.H.,,,,,,..,.Ww .,,. ww.,H.W.,H,,,WW,W,,...,.,,..,,..m.,,..,,.YH,,H,H.,...,,,.,.HH..,...,..,..,,,,H..,..,.W.,,.,.H,w...,w.,..,,...,,., ,.., W. ,,.. ,H,H,YH.,H1H.,...W1,,..,.,.Wn..n.,.,,..,,.N.U,....,,,.m..,,w...,,.,.,g :SE EE 522 E52 sis EEE Ei? ESE ESE Ei? :VE 5.2 EEE ess EEE 535 fi? EEE if iif :13 555 ff: EEE ss: Q-5 Egg fx 5:3 545 S25 2' SEE 31 555 :ff ' :sg E52 EE ggi is if 15: E55 255 555 EE EEE E55 2 iss K S 525 2 ss: 552 K 5:2 E .,,.,,..,,.....,.,.,,,,,,.,,.,.,,.,,.,,,,...,,,..,..,.. .,..,... , . I H 1 I In 4my1.11V.11mH-Wmumm1-Nm1InVH,vu1H1W1VW.-wwmwmfn .1wvmmunmumnf1vmuumnmmmrm Infmmwmwmummm1-.m6QIv.uumm mfmW1mV..1VHmnw.mw.mmwmmmWw1.41WmXHXWHmm1H.Hyu,H1ulnwmw-w.wm H .V 11nnwmmuummuuunmu1wHwwlmuwmw InHw1fl1v11mwWruwuwulu1NIHWmm.mwmwm H . W .WmummlwH4mmlH.1W1Hmwwwmlfv m.mmmmfmmmm:mmm1JEIIIEIYIIIFiI?iiIiJi?iiGiE H wm.mmmfHV..WH.XH1WH.1mV..,..W11.1..1111XH1U.w1.1mW11.,1.1W..1W.v..u..,.w.W.m,mm1H1W.,,1I1XH.NV.NyH11.NW.V..1y.NN.11V..H!3,mmH.N.Hxjf55wg5.53IIIwmygmfmwmagg 1 mmummInmuwwmlmumummmmm-fmWWmmm-mmlumunummummummmmunmmmuwmwuvmmmmm.Hm mmH11wmmWvm1.HmvmmummmMEIIW U.,U,,,.YWH.Y,H,M,WW,..,,W..,:sin::fz1n.5 a g e J 5 J' 3111111111111111111111111111111111111111III111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I1111111111111111111111111I111I111I11111111111111111111111111111111111111111111111111111I11111111111111111111111111111111111111111111111111111111I111111I11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111III1111111111111111111II1111111111111111111IIIIIIIII11IIIII1111111111111111III1II1II11III1IIIIQQHIIIIIII1II11II11II111111111111111111111111111IIIIIIII11111II11II11IIIIIIII11III111111f AJ111111 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11111 1 11111111 1 11 1111111111111111111111 1111111111111111111111 11111 1111111 11 1 11 11 1 1 1111 1111111 1111111111111111111 1 I 11111111111111111111111111 111 1111111 11 11111111111111111111111111111111111111 Chi Omega Founded at the University of Arkansas, 1895 Wisconsin, Nu, 1902 Number of Chapters, 38 Living Members, 4,827 Bekkedal Buell Bartz Skaar Hendricks Olson jones Kowalke Van Wagoner Westerlund Pettibone Pontz Casey Hendricks Harrison 'Settle Neprud Boll Snodgrass Cottrel Collins, Ball Krouth Lewis Goodrich Clarke Fellows Bridgeman Ruggles Doherty Beach Mead I-IARRIET GOODWIN MILDRED BARBARA BARTZ KATHRYN MAE BULL RUTH BALL FLORENCE COLLINS GLADYS F ELLOWS HARRIET GOODWIN HELENE CLARK LOIS MARIE COTTRELL LELA MARY I-IENDRIcI4s MAROUERITE BEACH DARLINE BEKKEDAL DOROTHY BALLANTYNE MARY BRIDOEMAN AILEEN CASEY FRANCES DRAKE 111111111111111111111111111111111111111111111111111 1 111111111111111111111111111111111111111 11111 1 1 111111111 1 1 11 1 111 Members in Faculty GENEVIEVE NAGLER Members in University Graduate NORA NEPRUD GROssMAN I 91 9 DOROTPIY BETH HARRISON MAROUERITE EDWARDS JONES MAROUERITE KRAUTH I,ILLIAN LUCILLE LEVJIS MILDRED MARCH I 920 RUTH ELIZABETH RUGCLES ETHA CLEAVER SNODGRASS RUTI1 JOHAN SETTLE A 1921 GELIA MARY BUELL MAROUERITE DOHERTY 1922 LYDIA HENDRICKS EULALIA JONES LIELA TODD MEAD MILDRED LAWSON 51-+1 .- .. 11, f - X T T35- . ' V DOROTHY REID ESTHER NEPRUD VIRGINIA PASLEY HARRIET NIXON PETTIBONE MILDRED HELEN PORTZ NELLIE HURLBUT STEVENSON GLADYS SEVERIN RAONHILD SYNNOVE SKAAR RUBY WESTERLUND ESTHER ELLEN VAN WACONER MARION GOODXVHNI GERTRUDE KOXN'ALKE GRACE MEYERS MILDRED KAREN OLSON EDITH THOMPSON KATHRYN RUTH WHITINC 11111 1 111111111111111111111 11 11111111111111111111111111111111111 1 11 1111111 1 1111 11111 11 1111111111111111111111111111111111111111111111111111111111111 111111 11111111111111111111I1111 111111111-mm 1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111631151ill1El1I11111111111111111111111111111111111II1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111YEGI1Ri?11111111111111I111111111151FUERHGEZR131111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111I111111I1111III11111111I11I1I1111111111I1IIIrI1Im. Page 556 gmlm.HXW1mH.Xrm.Hvmunmmm..XInnnumm..X.HmlfmV..XVfl,IfnmXmX.HXWH.XK..XA..X...X.U,Mml,.HH.X.HXL..V...X.HmumH.X.U,..H-.n.m.n..wwmH.,m,.HV..,my.HX..WX..Xmy.H,.H,..,WvmX.H,.H1.1m.1..w.,,m.m..wfm...,.mHXmy,HX..,inXV....H,...X..NX..,W,...,..,I..N...,...WXH.X.H,.H,.UH.NInX.HXy.,,H,.H,H.H.,1.1N..N,.HN..XV..X.NX..XU.,V.,,...X.MW..HX.MN.,K..N.H,1.1NK..H,X.HWmH.,V.,,.HX.HK..X,HX.M,.HX.HWX1.1X.HH.w.HwN.XmHHmXmXmX1.XlmH.1...XH.w..mm.mm.fm.m E ,r ..,............,.,... ...,........W... ...,.... - .............. ., ............. .. .,........,......, W ..,................ ,..............,.......,... ..... ,... . ..,.....,....,.. . ..,............,...,..........,......,., . ......,....,..,..,.,.,,..,..,,,..,..,.. . ,,........,..,,..,...,.........,,........ ,..,......,.. ,...... , ..,,..,...,..,,.....,......,.......,...,.............,..,...........,..,...,...,..,...,,..,...,,.,M.,,..,,.....,...,.,..,...,.,,..,.,,..,,.,.,..,.......,..,.......,.,,..........,.....,.,.......,.,...,...,,..,.,,,,. . , , 5 5 g..um...uvV..nmH.,...X...Q..m.....,ymmmny.....W,y..,H,,WX..,X.Hmyy..,...,y..X......Q,..,H.,.H,......1w.H.1...1.,.,.w...,m,..,,..K..1,..H.,,,..,y.,,,.,,......,...,...,..,...,...,y..,..,...N.,,.M,..,,..,X..,...,y.,,..,,..,...,..,,..,...,...,..,...,,.U,HX,.,,..,...W,,.,,..,,H,..4,..,,,.XH.,H.,..,V..,H.X...,..,,.U,..,..,,..,,..,.H,H,H.,,..,...,...,..,...,..,,..,,..,..,,..,A,.,,..,,..,..,,,.XV..,...,..,,..,K..,y.,X..,,..,,..,.,.,..XV..,.H,...,..,V..X.UH..,y1,H.,...,...!..,,.w.,,..,1.y,V..,...ml.,U.HXH,,.HI..,...m..m.ww.gg5 255 EE QS. E55 -. 232 ii: if aa --- 2 2 z 2 3 E 5EInnunmunvvururunumwnunmunmnunununmmwanmwInvmmunwInruvmmmwununmrnmumuvmummmwnuwmmunuvnuruummruwnnunwnwunummnuummmnmuummnuunnnnunnmnmmmuvmwmnvunuwvummmmuumnnmmrnnu1uvunmnnnmummnunumurnuummmunnunnnnuuwnumunnnnuwu1nunuwynunnmunmmnuununmmm:mmmu1n1munnummrumunuununmnunnvmnmurumnum1zurmvuumuun1uunmnnumnmn-2 556353iiiHiEiiRii?illUiiiiiiliiliiiliiiEiiiiiiiii?iiiEIIEIIEIUIUIEEIIGIIEIKRiiiEIIEEUIIIIIEEiGFHEUIZIHiEiiiiiiiillEiii?i?IiiiIEIEHHIEii?EEIIEIUIGGRFilBIKESiiiGIIEIEIGiiiiiiiiilYIIEIEiiiiii?iiiiiiEIZEZGIEiiiiiiiimMilli?QIIZEGEIIiiimiiiiiiiiliiliiiiiiiiiiiiiiiiiMGH?iiiFIIIEIQIEISQEEZEISUiEZKEIEISIIQUIRIZEGiilFillSEIEIEIHHGIGZEZEGIIYEIZEEYEIRFIQIiiiiii?iiiQEHZGIIEIEiiiIIiEiiiiiIii?iii?iiGii?iiiQi?EIEIIISIIZGISiiiiii?iiGilFilEEKIZ511511E2HIRQESIQIIIEIMFIEIZIEINEEIZIEEEGHmmmiiimmml Page 557 -2- z.: C34ip11a Chi Umega Founded at De Pauw University, Greencastle, 1885 Wisconsin, Kappa, 1903 Number of Chapters, 24 N Kieckhefer Lyler Winnie Mozingo Bishop Ehrman Slininger Andes Van Gent Haring Hayden Leary Gaik H. Kieckhefer Harker Donaldson jameson Zillman Sammons Martini Young Nolan Buob McDougall Bertling Atkins Nutter Miller Ludlum Simpson Cordell Members in University IRMA ATKINS MYRA SUSAN HAREQER ANNA JAMESON I-IILDA LOUISE KIECIQHEFER ADELINE BERTLING RUTH ELIZABETH DONALDSON ELEANOR ADELHEID CAIR MARY ANATASIA JOHNSON LUCILE ADELINE NUTTER ELIZABETH MILLER CORDELL RUTH MARIE HARING LENORE ANDES .IOSEPHINE BISHOP HELEN BUOB FRANCES COCHRANE WILHILMINA EHRMAN 1919 1920 1921 1922 MARY NOLAN RQ ' ggirj 1 DIN? IIiIEIIIIIILIIIIIIIIIIQIIEIRIiiIIZIIIIIIIIIIIIIEIIIIIIIE Page 558 LOUISE LUDLUM HELEN ELIZABETH MCDOUGALL ARDIS MOZINGO RUTH ZILLMANN LOUISE SAMMONS MARJORIE DEVAL SIMPSON GLADYS SLININGER MILDRED NVINNIE FRANCIS MARGARET YOUNG FRANCES TUCKER GENEVIEXVE VAN GENT REBA HAYDEN NORMA KIECKHEFER SUSAN LEARY MARGARET MARTINI LUCIA MILLET I I gnnunumunwInfuwmwnwm1unmmum1uwnwInmwnumlmvmInmuInummmmumummmmmnvuwwwfmunmwmnuwmnumununmymwnmInnnm1nf1mm1Inunnm1InInwnlwnHInvmfn1InfnunwInnuwuvvuunwuvinwvuunwuwinuluwuuuannwmunwInwufnnmvnumrnvmwn1rmmmwruwmnmvuInmnnurmnumfuumummwunuwvunummyuvnnnuwnununwuwufwInwruwulnunuwunmnnwanumnmunyuuwuunnumunnum1uu1mmmmwuuumuumumumummmg E 5Smin1Inm1Inmummrmunmymlmml1mH.N..1I.,HHupm1rmnuminmmmnumunmy..m..m41Inmumnn1...mmummnmmumm1..1mm.myvmul1I..mlmrmM.1.HnuK..1m1InvmH.1mV..1Wmmm.1.Hyn,1.MmfK...1.1vmnuV..11.H..X.H1mx.lm-xmililvli.dll5723111LIELIEIIGIIIIIEPIZRCIIIHGIIQIliEliQIIQIIZ?iiUii7i??5317115Qi!TIii?il17iiHll7lliIZBEIIZIIGJIGilHi?JRRii??i!Yiil?7l7iii?lQ??H1ii7Gii?ii5iil1iii?lilI??i?iii?l71?il7F?iHiiiii5EIEl?PilliiiiiliiiiKiIFZIIHIZCIITZIIHIZHIGHZZEE E ZZ? ., 232 EEE EE SE 'ii sei E55 2: 525 255 sie sae E 231Um1.Tu1HWH.1uvWmH.numyIn1m1H1mnwIn.H1HmyHuininH-w-11myinm1Im.Iwu.'mmmWH1.Hnv1In.HwK.,W.ULfm...,.w.,m..nmH.H.H.,,..1K.,1..H.W1I.1mH-U.myV..X.UV..1K.1W,.HV1.,--.XI.,In1.11H11.11111In1.HIn1.Huv1H11.41.I1.H1-1,.U1H,mmNK.1N..1Inmmmmm-m-Hm.mm.wmHNI-411-vmmy1H,.H...,V.,m1.11NH,..XH.1..,1HmlV.,W1,1.,HUH1in1V..inH.1K..1H1V.,...QU..W1mm1X.11.w.mm..w..m,In1.IX1I.X1HX.Imm.,-.,m.umm1HW1.NyuN1.,N11XH.mW..u.,.m.1.:E5 imunmnnw.mmnuInvmInummInwnumInrunmmmmwmwIninulmwnuwannummunwnnummvmmumwu1shnh1minwuhunnh1will1uiiuindhvu1mfuwInm1mmnuanmwmmmwmnnminnmmInwmuw1uwnnnunwmlmmwnwmwmmwmmw1vu1uwxmXInvuwmunw1uwuwInwuwnuwmmwHwmwunnwmmwuumuminuH11H1minumnmmmmmumfumumnuWvuuummmuWmwlmmunnunumw-4wmnunfmwunvmInwnunwwuwu1yn1vmHunnllmwHufmInynmmlm.mmM.E I Page 559 -Eg -W I In I I I ri ini i IIIIII Mp ha Xi CDelta Founded at Lombard College, 1893 Wisconsin, 1904 Number of Chapters, Z8 Ekern Herreid Ferris Timlin Parsley Clppelt Bird V. Skinner 1-I, Smith R. Smith Leavitt Tener I-lelberg Frantz Loomer Coapman Haskins Miller Byers Schuecte Tierney Brown Stevens Maplesden Schaffner Waite Labudde Turner M. Skinner Stomet M. Ward A, Stoffiet jones Members in Faculty FLORENCE MAUDE COERPER HELEN GUNDERSON GLENN EVELYN MILLER Membe1's in University Graduate RUTH FRANTZ 1919 MARY ZILPHA BOHAN MARY RUTH SMITH VIDA ALYS COAPMAN SARA FAY STEVENS MARGARET FRASER FERRIS MARY KATHRYN STOFFLET EDITH MARTIN MAPLESDEN VIRGINIA SIMPSON TENER HELEN BELLE SMITH KATHERINE BIRD TIERNEY EDNA MARGARET WARD 1920 MARY REBECCA BIRD LOUISE MARY SCI-IUETTE I-IARRIET GUINOIR HELBERG VERA IQATHRYN SKINNER HAZEL RUTH LEAVITT ANNA BERYL STOFFLET GERTRUDE JOSEPHINE OPPELT VIOLET LORRAINE TIMLIN MANNIE NUTT PARSLEY RUTH MARIE TURNER 1921 RUTH ELIZABETH BYERS HENRIETTA SCHAEENER DOROTHY PERRY JONES IVIILDRED ALICE SKINNER GRETCHEN LANA LOOMER MINA KATHLEEN XVAITE 1922 ADELAIDE JULIA ANDERSON FLORENCE MARIE GEHBE FLORENCE JANETTE BROWN DOROTHY GRACE HAMMELRATH CONSUELO BURWELL GLADYS MARJORIE I-IASKINS ESTHER KATHERINE COAPMAN BORGHILD THEODORA HERREID EL.SIB ALVERNE EKERN CONSTANCE AMELIA LABUDDE VINNIE FRANCES SANBORN I I In iw Timm.-IIIIIIIIIITI...II inmmInIIIIIIIIIIIIIIIInIIiiiiiiiiiiiiiiiiiiwiiv Page 560 uuinn ru II Iuirivuiuu min n IIIIIIIIIII II Imnii Iiinim Iwi iimi In iuii Iiiuu ii -1 'r -K gm 35 if if mmlmlmInmwmmumwmuf1unmHInmwmwI1vmwnwummuvwmwpu1mmuufmwwnwwnwInwwInwn1wI41mwynummwuwwnwH+1u1inmuInwyurmuv1muwwnluumu-mmHmnmwin1InwInulwwmWIn1H1.I1w,Iwmmnw.1wnvw.Iw1-1wulwmLuwnHwnwwuw114wn1wuwmmunwwWmuynw--4mvmInin1H1w1.4uHumvmm1n11H1uwwnumulHuwuww.I1numXmumInm1vu1u1InXInmummm1mmlXuXinmuInW1H1W1WXuXinuwmIn1m1InfnwnwmvmmwuwmwmNuwmmumummmmmw. 25 1 :F -6 fi gayum.,vmInlm1mmv1Inm11.11H.1mX.111.IXuvXI.111111H1In1.1411f11-.41.14K..1ul1m1mwInnn.M1.H1.11Mllililliii1liillil1IiIHiIYI?QGQI5111liFlilGilIil1Iill511IIllJillIlilillIIllliil51IPIIIll1UZ1ll.1ill?illNilIEQQIilIEliUiIHQ?IiiIiilIIIIIiiQIIIQIZQIIQQIIRRIIQIIJIlilI51IillIli1IliIIllIlilIEYili1Jil1iiiIISIliIiilIii1lilIll?PII1III1ill?IIEIii1Ill?lil515111iiill1Q55illIiiJillIll11ll?SliMIRHHQ23Ill1iiiIQIGIIHIEiHHH?UiUi?IEEG51?illIP113IESZQIIIGil151551iiiGil151551511ill52115111lilIii?iiiIPI1lil?GilIIlGilGIIKIHEIUEGIIGIGKQE 225 ig? ESE Els gag 515 sg? sg, El: Qi? EF -- - SQ? QQ Ei: E51 :IE E15 ,g. K.: :e. E55 Ef- -f: ,Z Ei? El: EXE : 5 ii: 5.2 5, 5 E i1 5 555 S , ii i? EE: :I is :Q gf Em iii E5 Eli if EEE Ei? ii iii gi Qi EG ,33.H.,,.,,,.,,..,..,,H,.HV..H.,X..X.H...V,.,X.X,,H...X,H,..,,.,U.,,..X.H,..,V.,X..,...,,H,mm.K.,,.,,V.....,..,,..,...,,.,...,,H,.M,..,H..UXX.U.N.H,,.,,.,X..,,,.X,.H..,..,,V..X.1X.,,..X,,U,H,,.,V.XX.,,.41..,X..,,..L..,..,XK.,VH,.1W...,v.W.U1.X,..N,.,N.vNm1..,nv1..,.Wwm.w.H1,X..,V..XK.,XH,L.w..,W.m.,,..,,M.HV..XK.,.H,I.,X,.,,..,..,...,.,,,.,,.,,,H,,.,,.,,.,..H,..,,.,,.y,,..,..,,..,..,,.,.,.,,..,.........,H.,..,mm.,.H,.,,...,..,...y.....,,.,,...M.,.,H,..,,.,.W,..,,..,,.,.H,V.,,.,,..,,H,..,,.,,..,.W..m.,,.,...,,..? '? w.,..HY..Y,.,,...H.,,,,Y.U.HK..,,.,Y..Y..Y...,..,,.,YK..H..,.N.H.HYV.YY..Y.H.,H,.,,X.,,..,H,,H.,.....1,..,..,,..YY..,......,...,..,...W.1YK.,K..,K.YY.,,.H,..,..,,W.U,,.,,..Y.,,,..,X.Y,.,,..,...Y,.,Y..,U,...U..,...,.,...,,.,,..,,.,H.,,...K...H,..,,.,,H....,,.,,..,,..,,.Y.M.,mn..,,.W......,,.,,.,,..,,..,H,,..,.H......H.HWW...H.,.,,,.,,.y,..,..,...,,,,,W.,,,..,,.,,..,,..,,asainz.z..z,ia.,azxmmazmasmmmf,..nm .H,una?.H,.m.'F,.,minimmmama.-..,mymmzzFr,.,isanzzmzanizassmxmzmammf Page 561 ny mmml II I I I I I I Cl41p11a Gamma CDe1ta Founded at Syracuse, New York, 1905 V . Wisconsin, Beta, 1905 , Number of Chapters, 20 Coldwell M. Sammis Edelman E.SammiS Rosser Shepherd E. Oleson Newman J,OleSen Spensley M. Olesen Hartung Nichols ,I.SammiS Kytc Hathaway Davis Chappel Hornaday Bray Proctor Shurnleff Woodruff Cooper Childs Cook Kielchofer Kemps Lamont Nornhrup Gough Lichtfclcln Hauk Dopp Munger Members in University 1919 GRACE CATHERINE BRAY GLORIA OLIVE COOPER V. IRIS COLDWELL MEDA CHAPPEL MARY EDELMAN FRANCES FINLEY LEATHA VESTA HARTUNG MARGARET CHILDS MAEEL LOUISE COOK HELEN ADER MARY LOUISE DOROTHY DOPP RUBY HAWN JOSEPHINE HORNADAY MARGARET KIEKHOFER GENEVIEVE GOUCH PATIENCE KAMPS GLADYS KYTE RUTH ALBERTA SHEPHERD 1920 GRACE ESTHER HATHAWAY HELEN CECILIA HAUK ERNA KIEKHOFER LAURETTA HESSIN NICHOLS 1921 HAZEL IRENE KELLOGG 1922 PEARL LICHTFELDT VERA BLANCHE MUNCER ESTHER GRINNELL NORTHUP HELEN PATTEE . DORIS PHILLIPS IOSEPHINE LOUISE SAMMIS Ls,-1' -.Q ik: 1 . 4 53315 , Q, IH 1.111 I .I III. II iliiiiiiiiiiiiiiiiiIiiiiiiiiiliiiiiiiiiiiiiiiiliiiiiiiii P cz g e J' 6 2 MARION ELIZABETH LAMONT MARCUERITE SAMMIS MARTHA HELENA OLESEN ELEANOR MARIE OLESON SARAH LOUISE PROCTOR GRACE ANNETTE ROSSER DOROTHY HANCOCK SHURTLEFF MARY LOUISE NEWMAN JULIA OLESEN ELIZABETH IVIALVENA SAMMIS MILDRED SNELL ALICE SPENSLEY RUTH SXVANCUTT IDA SWANCUTT HELEN XVOODRUFF + wnumunuvwInmmmuwm1Inwvuu1nmmwu1nuunuwummInwInnu1InmumInruumanfuwmmuinwInnuwmmumruwmwuwm1nlulmuWwInn1+nummummnmwanmm:ummpnwnnwmwuwIuumIn1mnmmnnmullnmfnwwuwnwwuwfnumInunummmwInwInwuwmumm1111m1u1N.4NmmywwInnl1m1InmmwnmwumnuwwInrHulHInwmwnu1uwInummm1IninwInwmmmuunuv1unufuuumvmnv1In1n1mvuvumuwvu1mwvmummmm1H1vuuInnuumnumulwmm.ummnmnmv. ifQ1iREIFIUIIIPIISEIHIIIliiT?iliiiiFillEEElIEEIIIQIIilliiFi?iiiSIIIHQITEIIHISG?FHIFIIFEE1HiIIIIIQWIZFEEPQIFIIIFIIw1.1Mi5112151Iii?IliUiibiiP55511iiiIFIEIQIIiiHi!will??liiiR5?F7E1iHEiiiiUIIFIENEIEIM'lilFil1iiiiii1hi1ii!Filmwii:IIIHZI1lilEli!1illIIHFIIIii?lil1JilGiliii15111lilHiHilliiiGLFil1iii1511Yii1IiiFWZ?GiUIQ?FilJIMQi!GilXIII?ilIii?ill?FillIiiIii1IiiGHGIii1IIZFIIIJill1515115211EIIIIIEll1liiiiiiYiilhivihIiiiiiu1GEMM!Iii?JilUi!GuIm'lvlMill1.H1vu1Ehmlibm1im.il1li1duEilllin,iumumFu.vm...ygE E x E 5 E is .3 :za :E 51: -13 555 EE N IS' .5 ,, iii SEE :is :ze 25- 22 5 5f.,......,,.H.,,M.,,.,,...K.,...,,..,.,,...X.,WW.,,..,.W.,,W.H..,,,UKm,UK..mv,,.W,U,H.,,.,,.,..,.1,.,.,.,...,lmH.,..,,H,..,..,...H.,,m...,,.W..,L.....,..,...,,.,...,,.,,W..,W,HH,,K.,,..WW,..,......U..H.M.W,.,W..,,.H..,...,..,,.,,.,,,H,,.,,..W,K.,H.,,.,W...H..,.,,..,1,,...,..W..,....,.H..,..,,,.,,.,,.,,l.,.,,,..,,.,,H,,.,H.,H,H.,U.H.H.,,..,,..H.H.,U.,...,..H.....,,,.,W,..,,..,,.,WU.,mm..,.,,.,,,.,,.HM.,,..,l..,..,,..,.,,,.....U.,,..,,,.HH,,..,..,mm.W.,..W.,.,,....,...n.,,......sQ5 mwuwunmwrnruwvuwnwwIwwInwuwnwwnwnwmwuwwuwmnlmwmwInwnwnwwnwmvuwnwwmvu1uwwnwInm1mwuwin1flw1IninwnwwuwnwInwn1wnwanm1ruwIn1nwuwwI11m1n1H11u1min1fl1m1.Iw1u11I11mInruwu1w.1wu1rnwu1H11n1in1.111.11H41.1wH11HWInWHvuwwH1nvuiwn11nwni1I,1uE11EiIii1iiHilQiFiWilNilE51FQSRIIRYE1iiiIQSUIFiiiQi?Yii1QiGiiIIllSEIYIIRYEERiii51151Ui?1IiiIiiGi?GiJilNEVERiiIEKiliiiiliiUHEl?ilIEKIDiiliiiQFIRHHH1li?IEIIIQIUIIGIEIIEZIEIRIiiM?GilESUERGM-1mEEEEEmnmuunnlm-ami Page 563 35 :x: ass 'I I I I III I III IIIIII II I I IIIIIII II IIIIIIII IIII II u I I II I III IIIIIII II II III: III II IIIIIII I I I I IIIIII I II I II IIIIII I IIIII II III IIIIIII I IIIIIIIIIIIIIIII C34cl1O1:l1 Founded at University of Nebraska, 1910 Wisconsin, Kheth, 19-If Number of Chapters, II NVhite Mueller E. Ayers lvlcClelland Lamberson Albright Ollbrich Tucker Connell Bartholomew Krieger Lawson Luther Bemis l-l. White Martin Cooley D, Ayers Blackburn Madison Taylor Faculty M em bers BETSEY MADISON ' Members in University 1919 BERNICE ALBRIGHT DOROTHY AYERS LOIS BLACKBURN MARION GLLBRICH 1920 'BEULAI-l LAWSON WINIFRED LUMBERSON VERNA TUCKER 1921 ANN ALEXANDER ESTHER AYERS MARION BALDWIN MARGUERITE BARTHOLOMEW GRACE BEMIS SOPHIE DEHLER I MYRNA WHITE, 1922 HELEN WHITE 955 13 3 - 'P' I .gf- 3. 34 fs '43 IIIIIIIIIIIIII IIIIIIIIIIIIII I III IIIIIIII IIIIIIIII II IIIIIIIIII IIIIIIIII IIII Page 564 MRS. ELOISE VAUGHN BEULAH CONNELL RAY COOLEY BRETA LUTHER DOROTHY MARTIN JOSEPI-IINE PRICHETT VIOLET KRIEGER KATI-IRYN LEITZELL RUTH MCCLELLAND EMMA IVIUELLER MARION SPRING EVA TAYLOR IIIIIIIIIIII II II III II IIIII IIII III IIIIIII III I I III III II I I I In II IIII Wummnnmum g E-...H mm . nmnuwWruwufumin1Wnnm1mmmm1an1InwuwummmwInruWWWumIn1InInmnInuww1u11uwmwmwuvNnwmumuwmafnmwmnmmuuwHwu1NuwmvmI-4wInwIninXyuummU-1Innl1mwynummnmmmumm . L r u1WWWmm1vu1lmIn1mmm.1In111.fmin1in11-11InH.1W1W1.H1,H1.I1V..1m1IHH11W1H41ImIn1In1.11nf1W1H1nuWW1-Uyu1mf.H11.11vuW1m1WW111.nm..11I11Inun1InHHVH1nl1H111.1I..1.H1mIn1yu11.1N-NIn1...mmfm-nw-N W V umm mu 1. E25 l gg EEE 222 ' ' . V :EE 'fi,:'f:Qi'QllJ zfmlf. .' s ' f v Egg 3.5.5,g45,1f.:Zf:kifz,,-,,',Ig ' J - ' 1 Ei? '.ff?:'Y'-'X'.kfY'ff . . sig SQg3?'1:Qfi?ki'f 'N 7 , 555 9.4wyQa'y.:-,f-sw f . E55 t.1f:,imM3 A sas, Ei? EA PKHSA L gas , X v-ww., f i ' Q3 is EEE 2 EEE w. - sis 1 Eff .f 2 EE H.. P '- x EYE :fs 25? EQE EEE 555 nwu1lmmwuwwuwmwInfmwInmvmlmmmmIn1VH1In1In1u1nlXin1m1H1ummmmww. IW1ruwn11IHmwmwInwI1wmwmWnwinWmwInvmW1vu1In1Inm1inwnwinWluWfn1vuruwnuwmwruwIuulwmwruunnnInwInwnwrminwIn1vuwmmwmmum . .,. ,. , ,,.,,..,,..,...,,H.,.,H.,,..,..,,.,,,.,,.,.H..,..,,H,.H,..,H.,,H,.,.,,.,H.,.U...,,..,,.,,.,,,,.,pm...,.,,...,...,,..,..,...,,.,,.HH.,,..,H.,...,..,..,,..,H.,,..U..,X..U.,,..,X..,vm...m..,...,..,,.,,,.g rr E R We g2alummfuL..vmnl1.mninml1ulInlm1.1rmm1In1In.mmInnunf1Inrn1.Hnnm1InH.mf1.11mW.11WX1.4U.vmml1.1ulwrm.Hmml...Amin1mlI-1V..1w111.Uyulm1.41lu.H1ynV..1....lnH1H.wInXHmu.Hm1nwmwmlmHwIn1ulinvmV..rm,H1In1.HnlW1WnuInnnmyulmm.1mK..mym1I-4inU.11.1XH.mW,NmInWnm.0H.inmy1mmW,1mInm1fu1InInIn1vwmmn.mm.mm.mm..fmX1.1fnmf1w.m.ww.mm..vfmnu1.NH11.1.Hmf1Inuf1HW.11.UmyK.,X.U1H1m,.m.m.v..um..,., - : SnmmumnnwminunfnwInwnwnuwInmnuuwwuwIuinwmunnuwInwInInvmrnwmmnninwnwwuwuwwIuunmunwmwuwnnmin1ufwInmwvunufnwuwfn1nwLumnwInInnlwuwuuXmmnnnuInin1nnlmInwuumwnunummuxmmmml 1 1 . ., ,....,..-.,.....,..,,-,.... ...,...... .., ,...M..... -........-.,. ..., ,.,..,..,......,..... ....... .....,....,.......,,...,.,..-s5 nummummnwmruwnnmInmmwwuwInul1funnInwInpmmul1UwwnwInmwflWwmnfm1mwmmwHwmnv1Inn1uvmnnmmmmmmwu1mmlinwuvmwrnrmmnum1mwIn1wn1Inmy1I11H1InmynmulHHnumvuummm1uv1nwmwrm1.wm11111nfmmumuuwmmm Page 565 e House K - 5 I uuImn1mu11un1n111 II 1 1 In In ml 111111 I1 I wma 1111 1 III 111 1111111111 111 1.1111 1 111 1111 11 Iw111111I11I1m111I11111 1 1 1 1 1111111111 1 1 1111 11111111111111 1 CHlp11a Omicron Pi Founded at Barnard College, 1897 Wfisconsin, Eta, 1916 , Number of Chabters Z1 M.JOl'InSOn Fleming Babcock Martin Turner Hottel McCabe Fowler Folckemer Kleven Roth Mitchell Melaas ,Falk Jackson Sehon Cruenbeck J.JOhnsOn Teschcner Thompson Nehrlich Lacy Gooding Bassett Beveridge Gilbertson MembeI's in Faculty MARY TEHON LEO M6mb61'S in University 1919 GLADYS MAURINE BEVERIDCE JULIA AGNES JOHNSON KAREN FREDRIKKA PALK MARGARET RUTH JOHNSON MARTHA lRENE FOLCKEMER MARGARET ISAEELLE MELAAS CATHERINE LORETTA FLEMINC MARIE MITCHELL ' HELEN KATHARINE JACKSON CLARA NEHRLICH HELEN LOUISE TURNER 1920 DOROTHY JANE BASSETT MARY COLLISON FOWLER MARY GREGORY AGNES ELIZABETH HOTTEI. GARNET KLEVEN .IENNIE MARTIN MARION MCCABE MARION REGULA ROTH HERMANGE TESCHENER MARGARET XVOODRUFF - MA RY ANN LlRSCHEL 1921 MARCUERITE ANN GOODING LYDIA JOY LACEY HELEN IRENE THOMPSON 1922 ELIZABETH BABCOCK HORTENSE BASSETT AGNES GILBERTSON ESTHER JOSEPHINE GRUENEEGR ELIZABETH LEWIS SEHON ' If A, J Q. I- 1111111111111111111I111111111111111111111111111111111111 1 11111111111111111111111111111111111111111111111111111m11111I1n1u11 1 Page 566 ,l zf: Ei ,,, 22 as Sis E5 EEE EL 55 -: -e Ei gg emummummunwmmmmuvmwanummmuvmnmwnwwInwuwnuInnmu1mym1In1mwInmwmnmmmumm1u1mwInunnuvu1uvWInvmmyvuwufmwfuwu1mvyn1uwwmul1mvmfuwwnwvuwmvmwnwnlunnuwnuInunwnumru1vuwm1mm1InwmmmnunvmwInrmnumXm1munmmwunuunm1m1vunumvvummmwnum.ummmummmnumuvumnmnnwmmmummm1Innnn1ynumnn1vuuv1vuumwnum1HvuwrnwmmwInunmwumnumuvmmnummummnmmmmmmmn EEE.mmi5ISiEGEii7ZIi?iiEElEIiiEiEEIEIEIQIIIIIGPQI51111IIEIXIZIIIIQ..12.11.5In1.UEli?yuEliIHH..mvN.1.HN.1yu1m1.MU-1in,K..1In1mN-1N.11.11.I1In1Ininmuinrmmm.11InI..w.I1mvul1.Hyn1H.rmun1Inrm1.I1nl1.HmyH41...1.1ww.I1I..rm1.UuluwIn1fuXInrwIn1uI.IXm1InmmfXin,myulunvumlmumunmymm.vmlu.K.m-mmmmmmmnwmmfmKfumfImulmf1-mn1InmXmXW1...ul1H-1mm1U.11HW1-.11Inm1vuX.mu1,mmmlulummmmxuwmulmwmmi 5 Exe .. EE' EE as Ei? :X E5 3 E25 ' E! Z :E .X Ei: Ei 5 as 2 : q :nz az EE: as Q: :. fi S5 -gg :f is fi :E .. 25 55 :F ii 22 E Ei .WEEEEEEEIGIUFEQEIIEI7QIIQIIIRE51Iii?IINiiiiiiiiiimiiiEIEIIIRFEQREIKEIEERRiiiiiiGIHEGIEQLiiiillBEGINHUERRYIIPFHGIMFI?H23lilliliiilwEIRIHIIIQFERRIQIiiiNilUQ?Will?iiNildllIi?williii!555511IZQIEHIEIWilIQIHIUEEIEZGZRQIRREQRGINillil?Wil?iiIiEilGiIQ?Hi?WhHRGilFiRi?i1IiiiiiQiiiIiiiliiiil?FEIIFQIPSEIEISIIEFIBER.512551IEIIFQZIEQZIQIIFEIQIIIQIEIEIGISFIISGIGIIYEIKEIIIEEEiiIQiiiiiPEIHEZPEFIIEIISEEEISIEZREEIIGZIEZFEEUZIHQZIEEREIQREMQiilERIli?llNREFILL,?iIii?REiR171GIQSIEIIIIEIUEEIZQEEQGEIQQSUISHUGEIMIQIEIEHIEEEIEH Page 567 fs 1 I I I I I I I CDelta Zeta Founded at Miami University, 1902 Wisconsin, Tau, 1918 Number of Chapters, 20 Kischel McMeans Marquardc Conway Chichester Walker Smart Cohen R Alexander jones Mann Silbernagel Gardner F. Alexander jackson Members in University 1919 TRENT ALEXANDER NINA MANN THELMA PAY JONES GLADYS EUCENIA MARQUARDT 1920 GOLDES VILAS KISCHEL MARGARET COLLINS MCMEANS LOUISE ANNETTE WALKER 1921 RUTH ALEXANDER IRENE GLADYS GARDINER MILDRED ELIZABETH CHICHESTER FRANCES HAMILTIN LATIMER ESTHER MARIE COHEN HELEN ELIZABETH SILBERNAGEL MARY FLORENCE CONWAY DOROTHY HATHAWAY SMART 1922 VIRGINIA MARIE JACKSON jj AK x . k . 2 gg Q' 5 I gp J I 15' 1 .Q is!- 1 ll ll I illEiillIRillliEEilE?lllEiiEiilliEllGiiiiiliillll . mf ' I f'i 'I.I ri '. I I Page 568 5 wmmyunummmummmmmunnu wmmmmmmmmwWWWWWMWWWWMWWWWWWWWWWMWWMWWWWWWWMWWWMWwmmMMWWWWMWWWWWMWWWMMWWWWWMWWMWW QWWMMWWWWMMWWWMWWWWWWWWWWMWWWWWWMMMWWWWWWWmmwwmWMWWWWWWWMWWMWWWMMMWWWWWWMWWWMNWWWWMWWWE 53 E an gg EE EE E2 YW ' 'Wu fVkh 354 EE E i - E2 2 E 3 5 ek E 5 2 1 EEE EE 5 EE an w E5 EE E EE 32 f Eg 1 E35- EE E ii ai Q gg E' E EE S: ag 551 W 5? 25 EE Q EE EE if QE E2 EE as QE 235 5 3 5 A- ag gg E 2 2 E i E ig nuuvnumnnumnnnnvwummwwnnnnnuummmnvnmlmmuvunununrnxrvw1uvuvwnvmvnumwrumnmm:mummymnvmnmnrmuni S 1nwnnunluumnullummInummIlllmnv1ulunummmvmmm:ummnummlnlI1H1ummwmvmmvlllulmmnumunlllnmllmmmmllui L. mmL..im...1H.wWummm.mmmy.HmmmmmmXmmmvuvlmmmnmm...Wmmm-mm.mmum.-..mmmulNummlmmI-1wmvXwmmm.,mmmmm..1.m..m-H nnnnnmunummmmmmnulmmmnmummmmnmuvnnmnummynum1mummmnummumunmymuvuummumyinmyunummmmunnmmmnvmmmmummn m.Hunum-mnIn,..-...X.H1.m.....m.1-InnvXH1.lummm.m.+mym1InL.-1L..myummnf1In1.Hmy...HmmmlmmyH...m..mm....nm -1. mm,.mmummmmmmmmmmmmmummnmmwnmnum 5 9-1.m.num.n. ?mnmmunnmnmu ....mn..,.......,k.m.,....L.....u..H Page LRRIGERHFEREHIN-ummmnum Sororities V In order of their establishment at the University Kappa Kappa Gamma . . 425 Park Street Delta Gamma . Gamma Phi Beta . Kappa Alpha Theta Pi Beta Phi . Alpha Phi . Delta Delta Delta . Chi Omega . Alpha Chi Omega . Alpha Xi Delta Alpha Gamma Delta Achoth . . . Alpha Omicron Pi . Delta Zeta . Page 570 250 Langdon Street Y 428 Sterling Court 823 lrving Place 233 Langdon Street 819 Irving Place 28 East Gilman Street 615 North Henry Street l4O Langdon Street 434 Sterling Court 418 Frances Street 633 North Frances Street 217 North lvlurray Street 43 O Sterling Court V ' I I I ,A'- I I I I P 'A- f I - Y ' .W ' ' 2 f E I I . I I J 0 I I v Young Men S Christian Association The Cabinet Officers MILTON C. BORMANN . . . President CLYDE B. EMERY . , Vice-President Ross W. ROGERS . .... . Secretary Committees M. C. BORMANN, JOHN WATKINS . . WESLEY TRAVERS, LEE H. CRANSTON WILLARD KATES, STANLEY O'SHEA . Ross W. ROGERS ...... MAURIOE E. FIELD, WALTER SCHNEIDER EDWIN GODFREY ...... ALFRED WILLETT ..... CLYDE B. EMERY, WM. H. E. REID . W. E. WEITMANN ..... J. B. HAMBLEN ..,. SIGURD OLSON, C. B. PEREZ . MILTON POWERS, HAROLD NOER . ROY SORENSON ...... E. J. HANAFORD, JOSEPH HOPKINS , D. M. WELLER, FREDERICK E. WOLF Discussio Fellowship Meetings . . Boys' Work . . Membership nal and Bible Study . . Finance and Publicity Fr eshmen Commission Deputation 'Teams Religious Conference Sick Visitation . . . Social . Foreign Student, Volunteers, XVisconsin in China . Social Service . . Inner Circle . Sunday Evening Assembly . . Secretaries Hanaford Reid Watkins Emery Noer Wolf Borman Sorenson Powers Weicmann Godfrey Field Travers Kates Hamblen I ...,,..EiiEEEEEiEERE?Eiiliiiiiiiifiiiiiiiiii?5Ei5E2E3EiEE....... . lu Page 572 1 111111111111111 1111111111111111111111111111111 11 11111111111111 1 1 11111 111111111111111 1 11 1111 1111111111111111111 111111111 11111 1 111 1111 1111 1111 111 111111111111 111 111 11111111 1 111111111111111111111 1111111 11111111 111111111 11 35 111111111111111111111111111 1 1111 1111111 1 111111111111111111111111111111111111 1111 11111111111111111111111111111111111111111111 1 11 11 11 11 11111111111111111111111111111111 11 111111111111111111g1g E TEE 552 E32 E53 E15 fi? 51 E15 E15 sa :EE 32 E! :S EJ 'QEZIEEIEE1111111 1 11111111111 1 11111i'Ti 'ii TFii1111111 1 111 111111111111 1 1 111 1111111111111111111111111 11 1 1 1 1111111111111 11 1 1 11 1111111111111111111 1 11 1 111111 1 11111111111111111111111111111111111111111 1 1 1111 11111111111111111111111111111111111 11 1 1 111 111111111111 11111111111 11111111111111111111111111111EE : I! ' 51? I U I I -F 11 if if I' fi l 1 1 1 il ,- -ff E52 mf f l Rf: ff ji 'ff Eff 1 1 Z. 1 f I-, 1, 2- if -A ff f' 5 1, 1 .ff I I I X 'ill' T !,,-.l 1 ' 52 1 1 1 1 House Ojfcers JOHN D. WATKINS , . . President WIRTH F. FERCER , . Vice-President EARL J. HANAFORD Secretgry ALFRED E. WILLETT . , Sheiij HERBERTJ. MUTH . , Fire Chief 1 Executive Committee HAROLD R. NOER . . First Floor Ross W. ROGERS . Third Floor R. BEN BORDEN Second Floor FREDERICK GRAF Fourth Floor :A 1 1 1 .... 111111111111 ..11 111111 11m,11,,,,l.111 1 . ..11 .1.. 11 ukhhillll 1 IIII. N,1,L,.1,1,M 4,.A. 1. 1 1 1,1...1 1 1. 11 1 11 5 1. 1111 1 ..11.11.11.11111..11.1111.1..11..11.11 .111.11..11.1 11111..11..11.1..11..11.11..11111.111..1..11.11..11..11.111. ..11..111 11..1111.1.11 .1.11111..1 1 1.11.11..111 1 1 1 1 1 1.111 .1.11.1111..1111. 1 11.1..11.11.11.11..111 1 1 1 .11.11111..11.11.111.11..1..111.111 1 .11..11111..11.11.11.111 ..11..1..11..11.1...11.11.. 1.11.1..111 1 1 111.111111.. 1.111.11 111. 1 1111.11111 1 1 11 1.11111111 11 ..111.1 11 Page 573 I I I nIuIInIInIIilIInlllillununwumlilmlnlnnlx I C-Army Y. M. C. A. S. A. T. C., Camp Wisconsin Morrxs Blekking FREDERICK E. WOLF MRS. H. L. POTTER Wolf The Stal? MISS MARGARET ELLINGSON . . REV C. P. BLEKKING R G COTTRELL S B ERICKSON R W FRARY J. F. BISHOP C. R. ACLY F. A. AUST F. S. BRANDENBURG J. N. CADBY B. C. CAMPBELL V. W. DEIST E. L. EATON G. P. EXTROM J. G. FULLER S. J. FRYETTE E. H. GARDNER Secretaries Volunteer Workers JOSEPH BEARD GLEASON Big Brolhers H. L. GEISLER JOSEPH GLEASON A. L. GODDARD W. W. GORE P RANK l'lAI..L C. W. HASWELL M. H. HOVEY B. C. HUMPHREY F. O. LEISER W. N. MACKIN Program Mrs, Potter Cottrell General Secretary House Mother Ojjlice Secretary R. S. MACKAY A. Z. IVIANN G. C. MORRIS D, M. WELLER Movies, concerts, and other entertainments nightly in Music Hall. Company Bible classes in barracks. Visiting sick men and furnishing paper, books, Oranges, etc. Big brother work in companies. Hostess work for visiting relatives. F. S. BRANDENBURG J. MESSERSCHMIDT A. V. MILLARI J. G. MOORE HOXVARD D. PIPER H. L. POTTER PAUL STARK GEORGE E. TEETER E. N. XVARNER W. W. WEIR R. H. XVHITBECK BURT WILLIAMS f Mackay Weller Ellingson Mann M5wf..H.2uMLuLLLm: WEEIMEETIQIIIILM lmmmvvl L-:EglinM3125!w......InI..-TWIN.I..1I.mmwIv..i mlI..m.iIm..Im..m. ..m.,....m..m.m... ..,..,..... 'M rv I II n nn an niInInIummmmmnuImnmmlmm ummm Page 574 m.mm....I mlmmIm.I...II....r....m-mf-IIm..mImm.mm.m.mIq..mm.n.uu. n u mn I mmumnuInxmummulmmmulmlmummmnuummn I I I 3, E H F3 I f':-A IO 1 1g 9 Bllviln - N : 4 nw q.. - .1 ..-A-IiiiiimJ:,',I ' ' ' 115 Iliiiillllli wi i ' 5 M32 , .4 CC'571e Commerce Glub Ojqcers HERBERT J. IVIATZEN . . . . President WALTER E. MALZAHN . . Vice-Presidenz CLARENCE V. JOERNDT . . Secretary HAROLD R.NOER . . . . . Treasurer JAMES IVI. HAYDEN ..... Assistant Treasurer Members in Faculty PROP. P. H. ELWELL ALFRED P. HAAKE PROP. STEPHEN W. GILMAN KARL P. MCMURRY PROP. EDWARD H. GARDNER PROP. WALTER A. SCOTT Members in University I 1919 GORDON R. ADAMS JAMES M. HAYDEN HERBERT M. BAKER WALTER E. MALZAHN HENRY J. DUWE HERBERT J. MATZEN HENRY L. GOTPREDSON, HAROLD R. NOER J. CURRIE GIBSON GAIL S. VANDER BRAAK 1920 OTTO H. BEHRENDT HARLOW H. PEASE LEROY E. EDWARDS EDWIN W. SCHENCK RAYMOND D. EDWARDS SANFORD F. SMITH CLARENCE V. JOERNDT ARTHUR R. UPGREN FRED C. KELLOGG ARCHIE J. WERRBACH RAYMOND F. LINEHAN HARRY L. WESTPHAL RALPH D. STILES ' 1921 E. K. CLEAR P. G. Fox R. J. LOEWENTHAL WALTER NEISSER Noer Duwe Edwards Pease Joemdt Hayden Malzahn Elwell Scott Matzen Baker .. ... . . I.. ..............m............. .... .. ...... .............................................. .............. ... .. . ............................................................... ..... .. ... . nu Im num n I I n 'MT' M nT 'F 'F'iG Inn mm. mu mn '?II1iTInIII.TER25iiiEEiNiEiH.Eii.IiI...II..I..m.I.i?..IIIIIIREBEEIT' Ti T'I ' T ' I 'TIi .I I.ETii.EiiiME.'iHK.T1H F'iTii Im Im Page 575' I .lzbi Z ' --. The .Spanish Club The Spanish Club was founded in 1917 for the promotion Of interest in Spanish art, language and literature, at the same time Offering practical application Of academic work. During the year some interesting programs have been rendered by the students in the form Of singing, danc- ing, readings, one-act plays, and University Cvlee Club selections. A successful comedy was staged last spring. This was the first Spanish play ever given at the University Of Wisconsin. The suc- cess Of the Sociedad I-lispanica is due to the marked interest Of the faculty as Well as that Of the student body. Officers JAMES GREENBERG President MAMIE OLSON . . . .Secretary TVIADELINE GOLDMAN . Treasurer Program Committee RUSSELL FETTER . . Singing FRANCES SMITH . Dramatics ELIZABETH FISHER Music GRACE GLEERUP . . Posters LEONA PRASSER . Dancing MARJORIE SIMPSON . Publicity C. D. COOL A. Cv. FITE C. GALWEY CECILIA BARRETT MARGERY BARRY MARvEL BJORNSON ZELPHA BOHAN VIRGINIA BUCHANAN CL.ARK J. CARROLL LAURETTA B. CONKLIN FLORENCE CONWAY ROSE DURCH VIRGINIA EACLESFIELD RUSSEL FETTER ELIZABETH FISHER FIDELIA FRITZ JOSE FUCILLA ZELDA GAPEN ROSE GLASSNER Members in Faculty C. I-I. GREENLEAF l-IELEN MCCLINTOCK Members in University MADELINE GOLDMAN VIOLET COULD JAMES GREENBERG FRANCES l-IAY JULIA INGERSOLL KATHARINE JACKSON MAEEL JONES IVA KETCHAM HELEN LANCER RUTH LANZ SUSAN LEARY RAYMOND F. LINEHAN CATHERINE MAHER RUTH AGNES MARTIN MARY ELEANOR METCALE ImimiIIIInIIIIInIInIIIIInImlwumirirmm Page 576 JOAQUIN ORTEGA F. O, REED F. A. SPRACUE ANNE EVELYN MOORE ELLEN MOORE I EUNICE NELSON HELEN I. OLSON MAMIE OLSON MANNIE PARSLEY GENE PLUMB M. l-IARLAN RESH MARIAN RINGER FRANCES SMITH' MARJORIE SIMPSON lRENE TOXVNSEND ELIZABETH WACENBRETH MYRNA WHITE ANNE WILKINSON LEONA WRIGHT mlmuimlmmmlulul mn. I nmmmummunm E E! SEQ E12 ga, is EI: 53 E. I: ,S S El Ei. E3 Z LE. I I 555 EI? -5 EI. SE 35 ii ii SE JE 5: I is I I I I 1 s E I I I II .IITInImIIII.IImyIIInumIIIIIIIIIIAIIIIIIIIII IIImmmIIIIIIInInInuIIIIIIIIIIIIIIIIIIIIIIIIIIII .mmmn mm .IIImII-myII-IIIIIIIIIIIIIIIIIII IImInInIInIWIIn,mm-HINIIAIIIIIIIIIIIIIII In mn I In II IHIIIIIIIMIIIAvImIIIIInInIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIHIIIInImmmmIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIImmn IIIIIIIIIIIIIIII mlm .II IIIIWIIImwmu.IIIIIInnmInInIIIIIInInIInummyuIWIInI.IIInIIIIIIIIIIIIIIIIIIIIIIIIIIInInIIIIImuuIIIIInIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIwwIIIIIIIIIIII -YIIIIImIIInuvmInIIIIIIIImmInumInIIIIIIIInvmInIIIIIIIIInInIIIIIInIInInmnIIIIIIIIIIIIIIIIIIIIummInTIMIIIInIIIIumIIIII4IInnuIIIIIIIIIIIIIIImyIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIIIIIIIII.IIIIIIIIIWIIIIIIIIIIIIIINIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIInmfluwlmmlnmwIIIIIIIIImInvmInImInIII4IIIIInuwIIII.IIIIIII.IIIIIInInIIIIIInImIIIIIIIIIIIIIIIIIIIIIIIIITImm.. Im IIIIIIIIIIIIIIII mum ,III IIIIIIIIIIIIIIIIIIIIIMIIIII, IIIHIIIIIIIII I II IIIIIIIIIIIIIIIIWI-Ei gi Ei EI as S! E: Ei E2 S5 5? 5. 55 Ei I E! QI ii E: Senior Club fl MAVIS CHUBB PROF. J. ORTEOA CHARLOTTE PEABODY FRED G. SMITH fi IVA KETCHAM BERTHA OCHSNER WILLIAM RANEY SANFORD SMITH -y HELEN MCCLINTOCR LUTHER PFLUECER EDITI-I SI-IEA MARGARET SIJERRY gg FRANK SPRACUE EE junior Club CECIL ARPIN GLADYS GREENE MAROUERITE JONES ABBIE PARMLEE TQ ESTHER BERRY GLADYS HASKINS MARIAN IQIMBALL CATHERINE SCHULTZ :E VERA BIEREAUER BOROHILD HERREID SUSAN LEARY LOUISE SCHUETTE EE GRACE BORDELON PAULINE HOELTZEL HARRIE1' LEVERICH GENGINA SMITH THELMA CLARK HELEN HUBBLE ANET LINDSAY WINIFRED SULLIVAN ELSIE EKERN RUTH HULBERT ANDA LUZENSKA ALICE VAN HISE if IOSEPI-I FUCILLA HELEN JAMIESON ELIZABETH MARKHAM HELEN WEISS 5- LEONA WRIGHT - C1 he French House ,EI Ojfcers MISS M. GASSAWAY, Chaperone MILLE FABIN, French Instructor MISS E, CONRAD, Business Manager Members 52 MARJORIE BLACK FLOEA FI LTZER MADELAINE GOLDMANN CONSTANCE KINNE DOROTHY HAESSLER GRACE HUTCHINSON EVELYN MCFARLAND LORA PALMER JEANNE PUJOS GLADYS RICGS MIRIAM ROSENSTEIN JULIA INGERSOLL ANDRAE JULLXEN MARCARET LANDWEHR HELEN LANGER French Plays March, 1919 Pailleron's Le Baiseru 1V1RS.C:.1'1.GREENLEAF , . . . . . . FRANCES SMITH May, 1919 Molicre'S LCS Precieuses Ridiculesu MISS F. CHASE ............ LESLIE ROSS IVIARGARET TITCHENER 2 JULIA TURNBULL VESTA WOOD ,. Coach LOUISE SMITH . Coach RICHARD EVANS EDWIN GUYER BEETHA OCHSNER RODNEY WELSH JOSEPH FUCILLA RAY HOLCOMI3 ALBERT ORSCHEL VESTA WOOD MADELAINE GOLDMANN PAUL KRAMER Les Precieuses Ridiculesn ..,.I.,I..II.,...II..I..Imy.MI.,N.....Im..I.mWmy.II.,II..I..I..,H.,...,.....,I...I..I...I..I...my.III.,I...Im..IInWI..II.,I..H.,.,....II.,,.,,..,..w.,..I,..I... I .I...,..I......I.I,..,..II.,I.II.III..I.I,..I.I.,..II..N.I..I.III..II.II..I...ImI.,I.II.IIII.II.,I..,II,..I..,I..II..I.....,II.,II.I..II.,I,III..II.II....,....H.,......I..III..I.,IW.,I..,I..II,Im...I..IW!!mI3E,.,mMm..Im .I,.,,.,....Mm..I.,W.....,,...,......,...I,5:3I I.....IIW.ImIIImIm.HI..,......II..II.....I...mI,.IIIm.IMImI......I..I....I..I..mII..... I WI I IInII..I..I...InIIIIInI.UI..H.mm.,InI..I..AI.II...I..II.II..ImI..I..II.,II.I..II.I...n.ImI.....II..I..II..mII.II.II...I.II.III. I.III..I...I.II..II..II.TwI.TI.m.II ,Im,I.I..I..m.I..ImI IW II.m..II..I.II...I..II.I...IImI.II..,..,....I.,II.....m.I...,wIImmm.I..II.III.H.m.IMMIII..,...I...I....,mn.m '....Im.mI.m.I..Im..w..I..mI Page 577 E EE E5 32 I I I I I I El University Press Club I Officers ESTHER VAN XVACONER , . . President LOUISE LUDLUM . . . Vice-President OWFN SCOTT . Secretary-Treasurer Members in Faculty WILLARD G. BLEYER GRANT M. HYDE ELIZABETH BENNETT MARIAN BERCESON MARIE BODDEN ADELLA BOIES ESTHER BRUNKOW F. E. BUMP FLORENCE COLLINS EDWARD DEUSS G. HYMAN DAVIDSON LUCILLE DREWRY ALICE EDISON j. R. FARRINGTON DOROTHY GUERNSEY EDITH HADLEY Members in University LEATHA HARTUNG FLORA HEISE ETHEL HESS MILDRED HILL GERALD HODCINS FRANCIS HOLMBURG HOWARD P. JONES GARNET KLEVEN LESLIE KLUG LEONARD LUCOFF lVA MCDONALD BERNARD MEYERS HARRIET PETTIBONE JANE PINE LINCOLN QUARBERG HESTER ROBINSON LUCY ROGERS MARION ROTH ELLA SCHULZ MARCUERITE SCI-IULz FLORENCE SEDER LUCILE SELK DAVID WEISS MARCIA WHIPPL,E MARIE WILCOXON MARGARET WILSON HAZEL WVOLF BERTRAM ZILMER Marguerite Schulz I Selk Hess Bodden jones Holmburg Weiss Heisc Brunkow Robinson McDonald Wolfe Collins Quarberg Van Wagoner Scott Bennett Ludlum Drewry Seder Guernsey Edison Zilmer Bergeson Meyers Rogers E. Schulz I., HHH' ' LL,-,M ,4,,,4. guggggggggggggjgg l4ll. 'llxi I IIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIII I II I II II InIIIImIIIIIIIIIIIIIImIIIIIIIuIIwIIImIwIImnImmunnIImuIImI E E I I I I I II I I III IIIIII IIIIn:aliIixziixizaeiizimm:maxisizannznzaziasizizisaiaa W ' T '::1F'i' i'imr:a1i:mmImIITIGIIII mI IIIIIIIIIIIII ' Page 578 ,F Ei: EEE ig ,. 'L! 1 '1f!!1 . . ........, Q1 s mmm. ,5- Egg sig :SE 525 sg: E! ,sg 5: Egg E i Em: .gg E33 is 5, E 5. E., Za sis li za KE E EE E as 1 af: KE EEE 1 5 s T 2' ffqk Xa-A R 6 F X J . Z , , V Ah qllb ,ifvgx ,X X -H-- Fi by X CBadger Ski-Club G. W. MARTIN . G. G. GUNDERSON F INN AANESEN HARALD BRYN F. W. BECKMAN G. G. GUNDERSON ALF IHLEN JOE II-ILEN S. A. KNUDSEN STAN. MANSFIELD Ojicers Mem bers . . President Secrelary-Treasurer G. W. MARTIN j. C. MAUERACKER P. A. PABST CHESTER RIECK F. A. Ross T. NOREERO-SCHULTZ AKSEL TARANGER GORDON TAYLOR 5 x s s T 1 T :5mnmmmmmmmmmmmmmmmmm,.ummm-lmlmmlmmu mmmmmmmmu .. .I num..I1mmmmn.mmm.mmm.mmm... Tm ...H w....wm.mm..mn llmmnuwummI.mmm.mmm-mlummlm Imqnnw.-1...mmmmm..m .,l...Q5.nf91.51uugEuT.,...w ' 'M 'MWTIIE mummy nm 111 mm ' Tumm.ummmnmmmmmmnmmuummum mu I ufmvmwmmumnn n mnumumumummmm I ul I wmmmmm I nmv EmunumIuIlmunmmmTfmmm-mmnnmumlummmnmnnwmmmmmnuumu . .I Tu u mn 1 Page 579 l --,. . ..,V' - 1 - J. I NBER' ' lffi'-H-ffiaii I-4,-.-Qz:sw.,Z 1 . I VV A 1 5 . W. Engzneers Club Ojfcers PETER WALRAVEN . . Presldent ARTHUR W. GAUBATZ . Vice-Preszdent WILLARD A. KATES Secretary-Treasurer THOMAS W. AYTON . Censor Members HAROLD H. BROWN LEONARD L. CALL HOWARD M. COOMBER ALBERT W. COOPER FRANKLIN D. FULTON PHILIP J. FABIAN ADELBERT P. GERHARDT J. BRYAN HAMBLEN RALPH E. HANTZCH PETER HANSON ALFRED J. HAUBRICH WILLIAM J. LADWIG THEODORE LEDIN HERBERT C. LINDNER HERBERT J. IVIUTH DELMAR NELSON JAY E. NEWTON CECIL P. PARSONS MILTON A. POWERS WILLIAM J. RHEINGANS ROSS W. ROGERS ROBERT C. SIEGEL EMIL F. STERN PETER XVICHNOVITZ Ayton LadWIg Rheingans Nelson I-Iamblcn Wichnovitz Much Fulton Sxegel Katcs Coomber Walraven Hantzsch Powers Gerharclt Stem Brown Parsons Lind ner Haubrich Gaubatz Fabian mmInIIIII..I.IIIIIII.III.I.IIWIIIIIIIIIIIIIIII .IIIII.IIIIIII.IIIII..III..I.I..WI..I.I,.III..I.I P a g e 5 8 0 I I . I I I .I f' ,ff 1 . K, ff, I! .Xxx M V, . - E5, ',e-'WT ,zfl . lr ffgwfffqlu ,I- . ' . .O yn A Q X- .. Nj ', - - U '- . Ki A--: ff fl-T .. , American Society of Mechanical Engineers Ojicers A. E. BERGGREN . . . . Honorary Chairman GLENN B. WARREN . . . Chairman EMMET J. MUELLER . Vice-Chairman WILLIAM G. MANTONYA . . Secretary CLIFFORD E. IvEs . . A. E. BERGGREN C. I. CORP FRANCIS L. BAYLE WILLARD B. BELLACK JOSEPH I. DRESEN CLIFFORD E. IVES ALFRED L. IDYMAN WILLIAM G. MANTONYA ELMER W. FIEDLER ARTHUR O. GARDNER CLARENCE F. HANSON GEORGE B. KUEBI-ER ARTHUR E. LIEBERT Treasurer Members in Faculty A. L. GODDARD G. L. LARSON Members in University 1919 ONVEN H. MARSHALL ' EMMET J. MUELLER RUSSELL E. PUERNER ETI-IAN W. SCHMIDT EMIL F. STERN GLENN B. WARREN EDWARD B. WILLIAMS 1920 HERBERT E. LINDEMANN EUGENE D. MAURER DELMAR W. NELSON NORBERT J. SCHAAL GTTO L. SICKERT HAROLD D. TIMM Hanson Nelson Mueller Larson Corp Berggren Kuebler Burgess Williams Timm Schmidt Puerner Bellack Sickart Maurer Warren Haubrich Drescn Gardner Linemann Ives Stern Bayle Manronya Marshall School Fiedler Liebert Gaubatz I.,mi..,H.,I.,,I,,..,I.II.,I..,,.,,.....I.,,...,,.I,. . P a g e 5' 8 1 KM-nm IIAIIA mmliu-Ml..JMW.w.-.M----W --ll -MW-.4 I 11. 11 11 1-I 1 1 1 1 1:11 11 11 15 ff' -1 f I ff, 5 ,Miki f.. , ,f WF ' , f ' 2 I ' , f ' , , K ,.1,. - X, ff? . fy I' 11 we --.' . . C ' 'Z E ' l S ' A zvz ngmeers oclety Ofcers RAY E. BEHRENS . . . . . President FRANK KARGER . . . , Vice-President WILLIAM RI-IEINGANS . . Secretary-Treasurer Members in University Graduate LOUIS A. KIRCH h 1 91 9 E. ERNEST ADAMS FINLEY L. FISBECK RAY E. BEHRENS HERBERT GLAETTLI RUDOLPH O. BUCKHOLZ ' WILLIAM R. STEELE 1 920 PHILIP FABIAN WVILLIAM J. RHEINGANS FRANK KARGER LEWIS SHERBURNE CHARLES P. KIDDER DWIGHT I-I. STILES FRANK K. QUIMBY C. ARMIN XVEIPKING I 921 EUGENE F. BESPALOW WALTER C. JAEGER WALTER J. CONNELL ISRAEL I. ROTTER ALFRED I-I. GRUPPE CLARENCE A. WILLSON I 922 ERNEST M. BARNES LEON E. CHASE .JAMES M. FITZMAURICE ERWIN HOMSTAD HERBERT NEWMAN WALLACE E. ODEKIRK ROBERT POWELL WALTER O. ZERVAS WARREN L. ROETTIGER ANTHONY F. ROHLFING GLAF N. ROVE LEO. I-I. SHAPIRO ELMER N. SNIDER WALTER C. TI-IIEL THEODORE j. VITCENDA Weipking Willson Rheingans Stiles Thiel Vitcenda Rohlfing Zcrvas Rove Sherburne Powell Odekirk Snider Buckholz Gruppe Behrens Kirch Rotter Bespalow Karger Neel Neumann Kidder Fisbeck Quimby Glaettli l-lomstad Roettiger Shapiro Connell Fabian 1 I ' ' 'Il'IICIlIIlIIlIZIl.TIImnZZLnlL Page 582 IIIII IIIIIIIIIIIII II II u u III III I II I I I III II I , ,f'X J 'J if X P RJ l ' Z W D 1, 4 61, X lu If ' I : 7 lg se my if -Lfldf E XXX. Q Q15 ' ji I gg T 5 .Ig 'i 'l' 1 v J 1 Chemical Engzneers Soczety Officers PRESLEY D. HOLMES . . President ELTON K. MORICE . . . Vice-President ERWIN C. BRENNER Secretary and Treasurer Members GTTO W. BAUMANN DWIGHT F. BENTON ERWIN C. BRENNER ROBERT W. CRETNEY FRANK L. GRISWOLD CARL P. HAYDEN PRESLEY D. HOLMES LELAND A. KIRST WALTER A. KOEHLER PAUL M. KOENECKE CHESTER M. KURTZ BERNARD M. LARSEN ROBERT H. MANTHEY JOHN P. MERTES CHESTER J. MILLER MALCOLM MITCHELL ELTON K. MORICE CARL L. NEUMEISTER ALVIN F. PITZNER FREDERICK G. POPE ROLAND A. RAGATZ RAY G. SCHMIDT ALBERT G. SCHUTTE MILTONJ. SHOEMAKER ALLEN SPAFFORD JOSEPH A. STAIDL WALDEMAR VELCUTH ARNOLD C. VOBACH JOSEPH L. WALTON' CLARENCE H. ZARSE ROBERT J. ZAUMEYER DAVID ZUEGE Griswold Baumann Kurtz Zarse Benton Koenecke Volbach Walton Manthey Pitzner Zuege Brenner Holmes Schmidt Pope Zaumeyer Shoemaker MOVIES Velguth Mitchell Neumeister Miller Cretney Kirst Larsen Mertes Schutte IIIIIIIII I I IEliTiRii'llliHii'iEliiiiliT' i'i IIIIIIIIIIEll'EThl l i'IIilIIIIiEiiIii1ilSEliIiiRiillilEEEiElRliliiGilIII IIII II I ' E '?'iNf II Page 583 BEN WISHNEFSKY CLARA MONFRIED BERTHAV YABROFF SAMUEL GOLDMAN BEN ELLMAN FLORENCE ELLMAN AUGUSTA FELSCHER ADOLPH GEIGER JAMES GREENBERC FLETCHER COHN ROSE CILASSNER ELSIE GLUCK HARRY HANKIN SIDNEY CHARNEY HYMAN DAVIDSON IDA GOLD SAM GOLDMAN REBECCA HOLLAND DOROTHEA I,EvI OSCAR DINKVITZ HENRY CHUDACOFE LOUIS EISENBERG HANNAI-I EPSTEIN NADIA LEVITAN WINIFRED LEWIS Menorah Society Ogjicers Members 1919 BEN GOLDBERG LAZARUS HORWITZ JACOB PERLMAN SARAH SINAIKO SOHNIA SINAIKO 1920 EDITH HADLEY SAM LEPKOVSKY ETHEL LEVITAN SIMAN LUBAN 1921 CLARA IVIONFRIED ARNOLD PI'-TRSTEIN ISRAEL ROTTER MORRIS SHAPIRO SAMUEL SHAPIRO 1922 JOE IVIACHLIS HARRY MARCOLES ELIAS SCHLOMOVITZ HARRY SCHOLMOVITZ CHARLES SCHNEIDER GRACE SINAIKO President Vice-President Secretary Treasurer EMIL STERN BARNETT SURE PETER WICHNOVITZ BEN WISHNEFSKY BERTHA YABROFF FANNY IVIILLER SAMUEL POLLACK XVILLIAM STERN HERMAN SINAIKO JOSIE SINAIKO LEILA SINAIKO JACOB XVEISMAN WALTER XVOLF SAM ZADECR ISABEL SINAIKO SAMUEL SYOMAN ALFRED TI-IAL ISAAC WVEINMAN BENJAMIN ZELONKY III.I.IIIIIII..II.I..III.II..I..II..I..I..III.I..II..II. IIIIIIIIIIIIIIIIIIIIIIIIIIIII I-IIIIIIIIII IIIIIIIIIII I.II.III..,.I,II.II..I. I I I III II I IIII I I II IIIIIII!IIZIIEIIIIIiiIIIZEiliiiliiiliihiiIIILEIIIISRIIEIZZIIIIIIIII I I ' I I Page 584 tl: El: E22 Eli iii Cfhe Cabinet I ..,n..,,., ...u . . . 1 Avlllrhlun M i,.I.....,....I.I. 5 5 3 E 5 Congregational Students ' Association REV, JESSE E. CIJARLES SE if Hickey Himmler Klann Wright Mitchell if McMullen Buckmaster Ferris Hammond Falk Pieh Frazier Royce 45 Runkel Sarles Ashby Turner Sarlcs Wilson Finucane Sutherland Kimball I Nuzum Warmer ,Young Patterson Tower Esch Kyle King Winchester ADELLA BOIES JOHN BRINDLEY SADA BUCKMASTER GEORGE BUNGE HAROLD DAY MARIE ESCH ADELE FALK MARGARET FERRIS GRACE FINUCANE MILDRED FRAZIER GLEN HALIK HARRIET HAMMOND PHILIP HICKEY HOWELL HIMMLER PRESLEY HOLMES MARION KIMBALL GERTRUDE KING LELAND l'fIRST ALVIN KLANN DOROTHY KYLE HAZEL LEAVITT GLENN MCMULLEN MALCOLM MITCHELL MARGUERITE NUZUM -JEAN PATTERSON ADDIE PIEH FRANK QUIMBY HENRY ROYCE J EANNETTE RUNKEL AGNES SARLES MARJORIE SIMPSON HELEN SNYDER ELIZABETH SUTHERLAND GYRUS THIEME EARLE TOWER ALICE TURNER FREDA UMBREIT FRANKLIN WALLIN ESTHER WANNER MARGARET WILSON CLARICE WINCHESTER SAMUEL WRIGHT HERBERT WRIGHT TXAARTI-IA YOUNG The Parish House IiiiiimiiiiiiimmmIininimiiiiiiiimiiiwiii iiumiiiwIIIIniiimiiiiinIininmiliiiiiiuiiiiiliiiiiiiiim Page 585 rmuiIIIninIimiiriimiitiiiiiimIIIIiIIIIIIIIIIIIIIIIIIIIIIIUIIIIIIIIII InIninIInIIn.III.IIIIIIIIIIIIIIIIImIIIInIinIIIIIninIiiIinIniInIInmiIIImiInWIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIII IInInIInInIInIIIInIiIIIIIIIIIIniIIIIInIIIIumIIIuiIIrIInInIIIIIIIIInumIIIinIIIIIInInIniImuiiIIIniIIIIIIIImInIinumIIIIIIImIIIinIIIImiIIIIriimmiIIIIInIinIIIIIIIIIIIIIIIIIIIIIIImIIIInInIuimiIIIIIIIIIIIIIHIIIIIIIIIIInniIuiIIIIIIIInIIInInImIInInniIIIIIIIIIIIIInIInInIminiumInIIIIIIIIinIInniitmHIIIIIIIIIIIIIIII I ri I IIIIIIIII mr Im IIIIIIIIIIIIII I IIIIHIIIIII III Ir I IIIIIIIU IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIm IIIIIIIIIIIImimiIIIIIIIWIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII Inn III Im um IIIHIIIIIII I Iiiiiimmwm IIIIIIIIIIIIIIIIIIIIIInIIIIIInIIIIIIIIInIIIIIIIIIIIInIIIIInIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIII im IIIIIIIIIIIIIIIIIIIIII In IIIIIIINIIIIII Inmiumiirii In E I Methodist Episcopal Students Wesley Hall, Corner University Avenue and Charter Slreel THE REV. EDWARD W. BLAKEMAN . University Pastor PROFESOOR LOWELL L. TOWNSEND . . . . Director of Music LAURA HARKER ...... . . . . Oyice Secretary PROFESSOR MORTON O. WITHEY . . Bible School Superintendent Organizations Stewards PROF. F, A. AUST EDWIN GODFREY, '20 BETSEY MADISON. HON, A.J. MYRLAND CLINTON CLEVENOER MRS. LOUIS KAHLENBERG BERT E. MILLER ELMER SEVRINOI-IAUS LEROY EDWARDS, '20 LOUISE KELLOGG MAUD MILLER, '20 BESSIE TAYLOR, '20 MRS. FRED T. KELLY PROF. J. G. MOORE Choir HENRY W. DESEBROCK Chairman MILDRED BROOKS, '22 . . Librarian MARIE MCKITRICK, '21 Secretary' LAURA HARKER . Social Chairman Epworih League ORPHA COE, '20 ,,.....,... ....... P resident LOIS SEVRINGHAUS, '20, AND WALTER KOEHLER, '19 . . . Chairman Spiritual Department GOODWIN WATSON, '20, AND LOTTIE GRAFF, '20 . . Chairman Missionary Department LYMAN JACKSON, '21, AND ELIZABETH MILLER, '19 . Chairmen Social Service Department IRIS COLDWELL, '19 .... ,,.,. . . . Chairman Social Department CLIFFORD IVES, '19 . .,..... . ....... Treasurer Freshman Bible Class. Mr. Blalzernan, Teacher ARTHUR S. EDWARDS, '22 ..... ....... . .V President WILBUR WATTS, '22 . . Vice-President IMA WINCHELL, '22 ....., . . . . Secretary EARNEST BARNES, '22 ..,..... .... T reasurer GWYLUM PRIDEAU, '22, ELEANOR SHEARER, '22 Membership Chairmen ALICE SPENSLEY, '22 .............,. Social Secretary Sophomore Bible Class. Prof. VI. G. Moore, Teacher CALVIN WOLFE, '21 ..........,.... President PEARL Moss, '21 . Sevrffary ZELDA GAPEN '21 . Social Secretary ELMER KRAEMER . ........,. ..... T reasarer junior and Senior Bible Class. Prof, M. 0. Wiil1ey, Teacher C. L. BAOHELDER ................ Presidenl MYRTLE WI-IITE, '18 . . Secretary DELMAR NELSON, '19 . . P. F. AINSWORTH, '22 JOHN A. ANDERSON, '20 MARION BALDWIN M. CARADINE, '19 EARLE COOPER ALFRED COTTON, '22 HELEN CROSBY RAYMOND EDWARDS, '20 . . Aiembersh Unit Chairmen EDNA GAPEN JOHN GREOO, '22 LAWRENCE HALL, '20 CHRISTOPHER HENDRA, '22 BERNARD HUEBNER, '21 CLIFFORD IVES, '20 ARTHUR JONES, '22 WESLEY KING, '21 ALFRED KOEHLER, '18 ROBERT LANE, '22 HAROLD METCALF, T22 LEAL METOALF, '19 MILTON POWERS, '21 LEONA PRASSER, '19 LULA SAUL, '19 ROSALIE SHEPHERD, '20 ip Chairman WYMAN SMITH, '20 LILLIAN SODERBERG ARDIS TAYLOR WINIFRED TITUS, '20 MILDRED WINNIE, '22 1-IAZEL WOLCOTT, '19 LAVERNE WRIGHT, '22 s E -IIIIIIIIIIIIIII I I winWHIIIIIIWIINIIIIIIInI I W I w.I,..I......II.II.II Ir.Ir.m1..... ,I I I....ImI.IIII-I-WI.,IIIMIII.-.IIw..I..-IIII.-mm..,IIIIIIUIIIIIIIIIII...mmImm.II.iI.II...I...III'I nmIII-IIIIm...iwm..I1.1.-IIIm......InIv..III.iI.r...i-I.-.ImI.....i.I.mI....I..II..IrI...II..mI..I.w.m-Im....I...II.InIIIII.IIII..I..Im..m.I..mIIn.I.-Imimmmm I anInuInInImIIIIIIIImiIIIIIIIIInmiImImImIimuIInIInIInIIIIInInIIIIImiImInmiIIIIIIIIImmmInImiIIIInImyImInIIIIIIIImIIIIIIIIIIIIIIniiiiiiiiiiiiiiiiinIIEEEFIIIPEIGIIIIImmInmyInuitInIInIIImiIMGMFGQIRGIFKERFCEMREEWEIIEMREEIIMHIEGMIEMEKMGIIIIIIIIIIIEIIIIIIIIIInmimiummInrmIIIIIIIIIIIIIIIImIIniImii?iBiiKEmummrmmmiiiiiiiinrmIIIIIIIHEIITEIIIIIIIIIKmIIIIInuIIIIIIImTFMiRIIIIIImiiimuinmumimmumimm Page 586 EI El El E E EEE seg Egg 555 E E E 52: 'SEE EEE is 2:2 EE EEE :gs Ez: uma un mmm Immnnmu I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII I I I I II ' ' ' nm In In II II I 5-1fn.u-.I.I,......u..... Lutheran Student Cabinet Haker Kutenkunst Goehring CStudent Pastorl Hintgen Kundert Phillips Noetzel Christensen Albrecht Hinn Hanson Fritsch Altschwager Freymillcr Lund Hoffman GERTRUDE NOETZEL ' ANNA CHRISTENSON BRYNHILDE MURPHY SELMA ALBRECHT ' EDWIN ALTSCHWAGER ANNA CHRISTENSON DOROTHY FRITSCH ERNEST FREYMILLER MILTON HAKER ' SIGRID HANSON Officers Members IIIIIIIIIIIIII .IIIIIIIWIIIIIIIIIIIIIIIII IIInIIIIIIIIIIIIIIII.IIIIIIIIII-IIIIInIIIImIIIIIIIIIIIIIIIIIIIIIII Page 587 . President . . Vice-President Secretary- Treasurer HELEN HINN JOSEPHINE HINTGEN ELIZABETH KUNDERT ELEANORE KUTENKUNST EDNA LUND x GERTRUDE NOETZEL VERA PHILLIPS .- . ..,.-.IuMPIB1'1's I .,......,..II..,gE 525 ISE ESE E2 E22 EES 555 E EEE EL EES EEE EEE 552 F2 E55 S.. 2 E ,1 mimmuiimmiiiiiiiiinmiiimiiimiiiimmiiiiiiimini i in in iniu mimi:iiiiiiiiiiiiiwiiiiiiiiiiiiwi wiiiiiii riiiiiimii iiuiiiiiiiiiiiiiiinniiiuiiiiiiimiiiiiii min iniiininiiiiiiiiiiiiiniininimiiiiiiiiiiiimiiiiiiiiiiiiiiniiiiiimm:minmiiiiiiiiiiiiiiiiiininmumiiiiiniuiniununiniiiiiimmuiminummmimiiimiiimiiiiiwiiiiiiiimimimnminmiumiiimiiiiiviuimimiuiniiimimiummmmimnnnnmiummniimnmnimiiimiiimiimiirf iiiiiimimm.-iliiiii ii 565718 Alumni Association Alumni Your committee Cconsisting of secretaries of all the classesj on membership in the General Alumni Association asks you to read the following statements carefully. Numbers . The General Alumni Association has a membership of more than 4,000 leading men and women graduates of the University Cllo members of the faculty are members of the General Alumni Associationi. Sense and Sentiment - Absolutely regardless of any sense of gratitude to the University, you cannot afford to cut yourselfoff from Univer- sity associations when you graduate. You need the University more than the University needs you. No Accident An alumni organization always ready to serve, with a publication always full of information about the University and its alumni, IS NO ACCIDENT. lt exists because there are alumni who consider their University training a trust entailing obligation, . Organization is Necessary It is axiomatic that the alumni can work efficiently as alumni only through organization. The graduate who willingly stays out of the alumni organization not only does not contribute to the success of the organization but is a drag upon its emciency. It is a well recognized fact that one of the most important factors in promoting the welfare of a universityfparticu- larly a state universityQis the intelligent interest and support of its alumni. Every member of the General Alumni .Association is a center of intelligent interest in the University. Loyalty There is only one test of loyalty-that is service Hundreds can do more by cooperation than thousands working each by himself, and do many things which thousands could not do at all without cooperation. To make your work count, you must associate yourself with those who are doing things for the University. Inspiration The years you have spent at the University have been pleasant and prohtablep their memory will be a constant inspiration: the friendships you have made will bring you cheer and give you courage to face whatever the future may have in Store for you. Advantages of Association CU lt substitutes organized alumni loyalty for unorganized good will. C25 Ehqciency-lt makes possiltle concerted and effective action by the alumni. C32 Economy-lt insures the maximum of efficiency for every outlay of energy. C41 Opportunity-lt makes it possible for YOU to have a definite, positive and appreciable share in the work. C55 Equality-It gives your individual effort the same efhciency as that of any other alumnus. C63 For the average alumnus this Association furnishes the ONLY OPPORTUNITY to make his individual effort count in behalf of the University. ' What the Association Has Done Clj lt has brought about eHective concerted action of the alumni in behalf of the University. CZD It has fearlessly told the truth about the University. C35 It has initiated many good movements and supported all good measures for the betterment and advancement of the University. C45 lt has taken a dignihed, powerful, non-partisan attitude in all important legislative proceedings concerning University matters. CThe Legislative Committee of the Alumni Association has been received with respect and listened to with attention by all meetings of the legislature in recent yearsj. U C55 It has enabled faculty, students, administrative ofhcers, and graduates to work together in behalf of the l'xIVCI'Slty. C61 lt has kept track of graduates. CThe largest directory company in the world says that the General Alumni Association has the most nearly complete and accurate list of graduates in the United Statesi C75 lt has built up the most emcient college employment bureau for students in the United States. CThis is ac- cording to a government inspectorj. C83 It is always on the alert to help graduates. C93 lt keeps track of and in touch with the local alumni clubs, and thus places recent graduates in touch with representative alumni in more than forty important cities ofthe United States maintaining local U. NV. clubs. C101 It is the one opportunity for cooperative effort by our graduates in behalf of the University of NVisconsin. Cost The General Alumni Association offers you membership for a fraction of a cent a clay. This membership entitles you to a copy of the Alumni Magazine each month without additional charge. Though the work may continue without you, can you aH'ord to let it? The annual membership fee, including a year's subscription to the Alumni Magazine iS bill fli2.00. The life membership, including a life subscription to the Alumni Niagazine is 5550. The most efhcient alumni organizations are maintained by life memberships. Graduates are, therefore, particularly urged to take life membership if possible, The loyalty of Wisconsin graduates to their University is well known. It is our desire, and we trust your wish, that each and every class show itself l00fZ, loyal and we, therefore, ask your active cooperation in making the showing of the Alumni Association not merely a showing of individuals, but an enrollment of your class as a unit, Do your part! Join the association today. ' fWay We Not In the words of President Wilson, may we not enroll you on our list of members and receive the encouragement of your active support? Please join now. i ii. i ii.. mi., .ii i mill i lim mo in i i i i ii i ii iii ii i i ii ii lui ii in i ii i i iwi ii iiniiiimiiiiiiu iii ii i i i iliiiliiiiiiliiililliilililiiiiiiliiliiiliiliiiliiiliiii ini iiiinii in i ii in iuuiuiniiu ii i 1 i in i i i ii i i in im i i iiiiin i'i'iTf'Ui'iiiiiiiiiiT'i ii in i iii Page 588 . THE ZERO HOUR SHERIVIAN SAID-Well, never mind what Sherman said. He won,t have anything on you by the time you have gone through NO-IVIAN'S LAND. HERE you will find all the HORRORS OF WAR: Submarines, Gas Attacks, Tanks, the S. A. T. C. and Goodnight and Prussians. THE CASUALTIES are enormous, only a few escaping without a scratch. I PREPARATIONS have long been made for THIS ATTACK. G. H. has shifted about a bit, but the GENERAL STAFF has always known where to report. INTELLIGENCE concerning the ENEMY has eagerly been sought after, and in some cases much has been risked to get it Qand to use itb. NO CAIVIOUFLAGE has escaped our eagle, relentless eyes. SPIES IN OUR IVIIDST, IN TI-IE FORM OF A PERNICIOUS CENSOR- SHIP, have stolen much valuable information which was never recovered, but will never be missed, as the dope gathered since is better and UNCENSORED. A SHOOTING AT SUNRISE fI:igurativeD was secretly effected by the G. SOD OUR SPIES have been everywhere and few things have eluded them. OUR SCOUT PLANES with their observers have either spied or bared the NAKED TRUTH CIVIost effective in our type of warfareb. IVIINES HAVE BEEN LAID, and the BARRAOE IS SET! IVIOVE SLOWLY, and REIVIEIVIBER-KEEP COOL! Remember that every- body else has gone through the same thing. IF YOU GET HIT DON'T STOP! That,s what you have to expect. just wade right through 'till the fight is finished. AI-I, TI-IE BARRAOE IS LIFTING! TIIVIE'S UP! STEADY NOW, KEEP COOL! COME ON, WISCONSIN, LET'S GO! . as J 6 6 sf I 'll -4 I- mmnnnmmmwm lu.lnmmfmmnmnmnnmm.nmmu.mn.um.nm umm. n. mm...m...mm.um.... . mm mmmm.wnmnnmumuummnnnuunmn . . .. mm I u .vu mmu...nmm..m.u....u.uuu.... nm. mu .nm un .1 I. . mm.. nn nm... um. . n. mmm U. .El . .rin nn nm u uunxnuuunnnumnunmnu u .nmmmmmmmmumm..mumuummmmmumm.m..munm.mm. . . ln. m.nmmn.uu um. In I nu un vumunnumwmuumuumummmummnu..mm... fha' awed fvekf fn cfwe bdfflq of arfufl Our boy: 074 B1 Us 7776 G1 mged was 00+ cafkd fb fb 07i'c?C7 6C7' 7772 and Genera! Dowf ffflfqfe Brogon 13 fbfroduced 7L0 bflf . 75647 fm Cb! Omega Canfeeo Afafenanf and dorm? know wfnefhcyf bofda ,bm !7'0we. for 7776 Sd TC boys A G fo Jalufe or shake fzorzafx . ' Q lblv .. Ms caf27L!7c1biQff!.5,!7i5 fbe I i . q i . M ui 5 ' . way MEF? framed, 2 . . 11:f '-.. 't ' N ' 1- fr y' 4. 5 in f A,, 5, 55 A ,. - K? Wipf lq, :JN A,, ' .. . v . -V W .1-'R I ' 'A ',', . 1 -1 . ' ' 231 : 2 .. i.A ' 4, - Q ,V .- - '- ' J 'W9f3iE-Hxs..- 3 ix A I A - --'Qb. . . 1. , - 1' 1. ' ' X K f ff? , - ' . ' ,'A . u . Q. Jfgjf i ff k , , . uqul q ' J 7? I 1 Q ' A RQA. - .,,..Q .... . - . . ,,,. -Q ' 1 . X3 H . .fx , ,,.,:,. . .3522 E35 . - pk A vk., 2 ' K t X:.x-'-':,,- V Y . , X f . , ' , --M mx .f . 4 f' ' ff.-.-51:7 Ffflfdfti Fanny hhrd fn lfifafenapf Ezefffbf 56575-?177,0f7'ef Wo-Mans Lago! bfacfr-bafkng Wye Q03 7C0V0f'Jf?f7Lf7677J' Eg., A Mi wxfla 615 p! FJ60C607 df6f7 3. .,., H Hg, f '- , ,, 7? F' f',f :Q sz Mp? sf W1 21 - K+ . Q Tj 'Y 'i N X ? I .g k ,Lv .I ,,,., g t. : I . - ::i::i5iL z, V .L K 5 ... ' :. 5 .121 . W -, ' , Zx, I N A 1-' I- - A I ' wf '. . - f 5' X' W if xl , '----.., V .spy Q ' ' 5 ,.,, f f Q 5 'E fp ' 'mV. A -A-f 1 'L -' . . . N ,Q . ' - A Q '-., I 2 ' .V,.. - W . ,,,. X - - .......................... .....................-.... .................. ..... .. ................................... ................f......m..................... .................... ............................................................................... . . .... ........ . ..... . . . ............ . .......... ...... .. . .. .... Page 590 gmmmm..mm.,nmuw.lm.lmwmv.lumm..W.m.......fm....v...f...n.,.m.unm.-.-..wnmm..mmmf.....mm..mm.M.Hmv...Hmm...1mm.mymu.,,U,,uw...my,...mlV..,...WWm.mm1...,mmX.Mmv..W...,uw.N...XW,.mu1InX.umWmimn.,WXum.WWHXmy111rm1mmW..XMV...Xmy..WN.,mmX...mm..H.,,mmH.,,.muH..,mm,.Hnm.,H.,,mm11.,,.um1y..mn.,,A..,..,..H..m.mwmmum.m..W4H..,mmmlummmmm.mm..nm..m.mmm.m ig 1..mmmummm1nm..fmmm-unWmmmmmmmumfmmmmmmmmmmmmmmmnummmmmmmmmunmuummmummHmmInmm.wmnnfmmvm1In1.mmIn1munfmmm,mum.mmm1In1lmInnumW.mmmvmnu-nWvmInmyrurmlmummmmm.1In.HmlwmwmmfuX.HmXV..XmXmlm1m..m.m.mmm1.NmXHnmInXI...HWInvmmymvmmWInummmlmvmInumInummmXnumm1ummmnwmlmmmu.nnu..1nf,Wwmgig 2 i E is ig 'se - Eg, sag S15 sag iss EEE 21, 525 E32 ii? 532 EEE EEE 2.5 iii 232 555 , :is 5 EE X EE :gg Eg. i:. E25 5 Q E i H 5 Q a 2 ig 55s.mm..,.,....,..m.1.,.f..M.......Km...,....,,...,....,.............,..,...,..,...,..,..L,.........,,.n..,..m.,..,1..1..l..ummm.......m...,..,f..,..,.,.,...mm.,..,mm..,....,........,...WK.um.n..u..,....,........,,,....n.....m..,,..,..,..,....l..f..,...um.....,K.........,..,H.,W.H..,m....1..,....,.,..,,.U.m.....,..m.,..,...,..H..,.......,m.....1,..1..,1..w.1um..W.nW,.w.m.m.,..1I..11..mmmH...,f.,f.m.....,,.m.m....m......u,,M,.,...n.,...n.,.,....,....un..,......,.,.,..EgEg am..W-'n..1......m:azr,.m.m..m.u...m..m.......mmmmm.mmmmmnmmmnmmmu..f...mr..... 'f..1...f...,..mmmam.1a,m,,,..mmaa:m7.:r.rwl.u..m..,.,l.,...,..1ar ....l..,.mmz1:.m1ai.:i,'r.,,..,lr .mmsmainimmaznamvW..mr?,.,......,Immmanzmmnaaszmaazzamananislam.,..,W....,..,m...u......,W.u.1.....,....,..,...,....,...K...I......H.,.m....W.,,.1..n,...,m...,,......,.,,...,.,..m.n P a g e J' 9 l Sa E271 Ko-eds and Khaki Thrown in Three Fits , , 44 HVEHTEPQ '-UQ ! A ui 'J' em 1 ' 3-'z l nl ng: A I' ia '::: , ' 7- l 1' 4, lx ll .ij - E tv E, 5 . his -azi f ilbs .4-1 .. ff ' . ' H JE A A u 1 A T 1 C-1 lf!! . - , g at ' F QQ Spasm I-Registration fDays Ko-EDTTH: just look at the mob! My dear, we'll have to wait forever and my feet are just killing me. NVhere did all those fellows come from? Ko-EDNA: Never mind your feet. Look, theres Bob. Don't you adore him? Oo-la-la! That eyes! Them hair! 2? bk Ik BOB: , Hello Edna, how's Edith? CTO Edna, tenderly -and for the seventh time that dayj. This is the moment l've been living for all summer. NVill you go to the Studio with me Saturday night? KO-EDN.AI Sure, Bob, thanks. CTO Ko-edithj l know Tm going to have a wonderful time here this year. CShe doesn't know she was the seventh one Bob asked IJ h -A 1, T40-EDITHI Theres Kate. l4O-EDNAZ 'Lo, Kate. jew eat? KATE: No. jew? IQO-EDNAZ Uh-uh. C'mon over to Chad. KATE: My dear! The place is full of men! lt's a barrix for the S. A. T, C. KATE: Oh dear! fXVe think she said udearfj l had all my baggage sent to Chad. lf one of those fellows got into my suitcase, l'd die. T40-EDNAI So would he, probably, hed suffoeate. Cheer up! Think of the good time we'll have here with all the ohcicers. l stuek dad for three new party dresses and I wish now l'd made it four. Convulsion H-Three days later Ko-EDNA: Whassa matter? Where's the Fire? Ko-EDITH: lt aint no hre, its a seven-thirty class. You'd better get up and get there on time. The shock would kill the prof, l think, but what's a prof more or less? ' T40-EDNAI Oh Lordy! Home was never like this! is Ik Vis NOTICE: Classes meet in Wisconsin High School. Use of Laboratory given to vocational men. l4O-EDNA fwith a groanlt Five blocks further, and l'm coming to pieces now. as Ps is Ko-EDNA: Not one man in all my classes! lt's an outrage! -iimT.11itiT.mw.w.i.w..iimininT..TT-1i..ii.m.iwii..ii.ii.. in .mlm T. im. .1 Page 592 .- .G ' is 1- . ru-ru ' lllllill H t w'f1f fi'f'i 4' i Sl 'J' U Wm 'Q A 1-iibfvbf u ii ll '4' LU N 1, ' ., lxjw fw I1 mi x lil vlli -Y' 71' lg' ., ..,, ,4.Y:l, . rg. 7 gv4uL, Lea- F ' ,:.. .f - .- - - P x sit '. 'lf Q... - in 1 . H -f- iw11' ' il' I 1 4 ll-sith. 13: 1 lv w I 1 ,',-.. Kg hi' H I 'IL K - ig - -Qi? ' 1 , s ' ' Qty! ' Ii ' ls . . s, Q' I 4 A K , 3 , , 1 ml' rx U Q ' 1' P it l ' X ll ..4 f I I R lil bk ik lfO-EDITHI Theres Dick. lwish hed sec me. l-ics looking this way. Sec, seventh row, third man from the end. OFFICER: Eyes-FRONT! l4O-EDITI-ll Aw, the darned fool! CLaterJ OFFICER: Column lclt-l-IARCH! Ko-EDITH: GOODN IGI-IT! Ko-EDITH: Do the men have to sa are on K. P. duty, Dick? lute you when you Fit No. HI-Saturday evening EXTRA: All public places closed on account oi' the ilu. No dances or movies till ban is lifted. KO-EDNA2 NOW isn't that-the limit? NVell, l'll ask for the back parlor. Bob used to be good in a parlor when it came to a pinch. :Qc 23 Bi! l0:3O. 140-EDNAI XVhy doesnt he come? won't be able to make him wai lt's so late now I t. He always used to come early enough so I could make him wait a half hour, at least. lO:f1-5 . Ko-EDNA: Oh, theres the phone. Yes, this is Edna. What-Bob is on guard duty and cant come? Yes, l understand-so am I-good-bye. Iii 14 Ko-EDNA: DAMN Tl-IE KAISER! I x it .Q 55 x f --f - iff... . er., ,Q aff , 5.5: My was V. . L . jf' V Q 1, 'Q' we-ms at :z ' 'il . 'ff' .V ' rv ' X 1 : 1 -' '.t-4:3 , W ' - l,, is Af 5 Xa , 5 f fyf I 56 5 19 'I 5 X MW F I K 1' Z3 Q Jr Q' 1 ,rg 1 My X i , 35 ' ...spy Y K F.. Y w Xgofix S My , 1 3 if f- f Qu' 1 vi. qw. N5 X ,xi 2? A f 2 N PW ' M, ' '- 37 JZ ' y-,,,,.v9 -A H.. , .A .1 ,M 5 wk ,wig YA w qi 9, KY ws ' . Q W 96 V 4 ,tf 4 f u. f ,W ff 4 sl Ax, V855 -1,4 iniiiiiiiiiiiiiiiiiiiiEiiiiiiniuiiuiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii Pugu 593 jj: ' ee Us -Q .. .te ff,- . . ,I I ,i x I N f 7 X -1 115 55 x ,. fi 1 9359-4 4.... .syy . t u so d J 9'-Q, 2 V-V' 2 - I ,,4.--4 .v ' ' ei Miyagj- il ilhIlllIl...il ,. X -4 11- 3' V ' 3. I I ILL! .T ii'-.5 ink Q 6 Q f 'F fd ' ff' -I Y ii lil ji -- Qi Xu A ix. I 'img . , . 3:-. il-2--k L. ' i 2' X f ' 'n,e 6 xl'I ilzwliai' I, f 7 ,I ,J X QQ .lllil ' Lili iii N X Ili , 1 i..i'53!eg, 1 M - ,,-..f2f'fpf:5Z:a. i ' fi N I . N . H I 7- f ,A-'I r ' f - ,fee-' H i nIInInmnmnnumm:vununummnmxuummummnumummmmmnnsunxInnuxunnIIxumnuwmumuuummmg .ummm1H-mmmuwmmmmmm.mlmmmu.mQ 5 1wnnmmummmmmnmnmmmmnunmnmummmnunnmmnuunummu ,fuI..,..mmmmwummmlmn.-ummmnmmmmmummmmln mm., n.n.n mmm nu..,lnu. Mmm .n..,,u.,,.u. U ...H.,,.,,,.,.,..,..,..,..,1,..,.,,.,,,,.,n...,n.,. m..,l.., ..,,.,.. n ,n,......,..,,..,..,,., ..,,..,...,..,l.,,..., , ,,.,.K.,,.., W ..... ,.n...,, ..,.... . .,,., ,... ,,,,,,...,,,,,..,,,.,l...K......,..,...K..,,..,..,.. U ..,...,,..,.., nm .,,..,, E331.111ufrmmnunmmmmmmmlmmmmwnmmnm-mlnmmmmmmmmm.NIHIEHEEIEIIIIDEHIGIIIIHIICIIIIIERESIN.,IHHEIIEIGIKIIIIIHIIFIHHMHIIIIEIEGIIIIIIIIQIIITIIQIII2ILIIFIEIHIQQIFISIIEEIIHEIIYIRIEIZFEIETJEHIREEIIIKlllf.iIIlIEl?HER?llIlIKClmmmnmmmmn XV! Wuih censors and damrxplxools 22 Af-' N ondreckless safnre dnspensers gg 0- L' n b f rf fl 1 uk - I u,.......: on 4c.,en,ef w -' A une1rx3 or C me p ace as e fn ..- 1' -. , , 535 sacred ass of time ms1'rl'u1'acm ihe Edlfors OfT2l'X Q,row wear -JU.S'l' :SE '- , .x - ' 535 ,.,.- -- BB. ww CHAN damn 'fared No The W 012 ouffli' -'Q ass M , L. W1 5 me A sue E ESE ..,. 1AN i,n-ww: : umm x uecowmn .25 'M BDU: Le mmlxf: swfecni-,v.1H4' ... 1 'f . EE? MB. , w1ffsf3 g.T,2hl 52553. 145225 11? ' 35:11 -1 f x .., wr H' M ca-H'f',,iwo '1gj22 wN1'Q,,',0 -v?1,fw-CQ',W-,f ' 432' 1 ,HX 5 if ' .u 113 ,,,, w3f,5Ln3,w,g Q1 T1oJ,f,unQ 'ima QV wiv ,glgeh '-wygffh i , -In pi Egg , af. reflt Q We... B .nz-W gy., W 1, we im:-1 W, fmf,L,,L 1,3 .fw3I'Q -:Sify I ' , . EEE ,Q 9-1 L in--flE,f',f -F5 ,ou Aw, ,Q 0-U A www vmwn A Ln. e-- N -.,,, .,J',,:1-, Q-,.,E?, lg. Ee gig g vw Huw- wool I- :en Q ,vu 1 ., Ls ,ape -4,,o. '-. ww, I ,-ff, pqg . Beg 5 iwiwwmifmmewmgsbwd' mMM.MWmwfHygwxiy E :E 1, 1-H zv 'a Q, .' , 1 : -9 :E mug, LL wig CMD' X '-ff+f.7m'-ff-t!QfZya,,, 21165,-ig., wg ' L1 ii- ww cure 5. L. bf f.g'f,- Ha, Xkf w,,.,,, , A-,12Zg4.,,v . 'N '3-Z'li,:'5. 'T W gf ' 4? G. , L ' . w'a.'-1 -, 5 ' 'mfr' 22? - f 'b.ff.,3+, -SP1-A, 1-if JMZ'f+ f 'i:Zf1'1'-Qitf' 4.7 Qu, mg-j9r?,H.f1,, 'A47-ggfw, , ' Ijf.,b.4f 'g , Sm' .-.Q-,gd .f -Ztiwm iam, 40.15, 312 wsu,-w,,' Mbna . 1, Q f 7. s,,,gf,,h.-4, A.4h.,:1.I :vm 535 a 4,'3,.,A 'aj W. ui Haj! .., ,Im 4., '- .'1f.145,h, ' 'fm . '72 .,'LT, 52:7 -- ' H- ' . iii 'w ,Q I - wg.: 323 EEE E55 EEE E 5-SQL., ff- z?-1:32. 4 47..3'15' 1Mxa N - 44 'qw '14 'n K -.'-Q-f . av . .M -.' v R 'v U, IN I 1yEO0DNIGHT W. ew.-wwf 'Q Mm ' . 1 u,'-,. - - - A 7Z37'v 1,441 Q! . ff l iii la a fm,-'f,:.,, L. hw, gag uw ' iw-. w-. X- ' Q4 'Rr iii -I , uxxxnzx POLICE. WM- , fm., , ,, , smnmfs' mn TPLLLLBG CORPS. 1, - , -gf-.?1,,A '-4 'f. ',,:.,, vuxvzmxn or nscmsm. .550 . -,,,-.4-. ,,, 'M '-..,h' X W f, 5 0 'wa Baruch: nn nm- su-mm xml. mmm, nummu. ada.. DM. MW-., N' e, v if-vi nvquu- and nie. 'H Our. 'f 'I ',M7Hw.f -as ' bffllnq-gum 1, 44,70 bf-Af -gg f u An- gg ,HK nffy Egg 'ml' Near: End. iq 31:19 'offfbwp 555 'N -cu., S lx fi, ' EEE mu: om.. az rnmn Iuahnli- - 11 1 CM , 4' -13.11 -' 'Wfn:. lm EEE :of ne Daily cm-mn1.za1m-. ....,Q A-w.f. :, ' N- m.u., '1 - ru,..,,,, P EEE Lili' - ff' 35? svwscr: nnuanxm nr s.A.m.o. lm. NMJ7:-Af: Q.. .1 .,j EE I-fm. bi-'H' . '.l' ,...'- N-f..I ' M ,-5 -Jr --.1 - 1. na nm on 3.1.1-.c. un an xm-.by urns. ...,'1g1::?',,'11-fl-2F?.'T5 -1 -. -Q.. . as You my yum.-n .mn mem- u you .nm or menu: to ..51 'l3'-'5:'. fg,'glf-'T' STUDENT: QUQZTERS BATTAJON PS -1'Q-fl... - A Y TRAINING COR :nn mum md not am-mmm. tc Ln- ,mm or cm -M1 UNWER In OF WISCONSIN 'is H1-an 5 Govommmt of tha Dnitad Shun at this tus. -min: 'Vw ms.. V. nc. L-. A amuucxs Mlwlsord, vnsomasm 5 z. xr n any than you pnpu- puuxmu any mu- ,!g.is:.:u .'2'I amber lem L-318. 2 -ffm -1- s 1-.aug anxgm, .nun un immediately u. mm. 5,3125 ,,-E. -1 -- ' na. 'H' ., 31T.'.L,'j g:Q':5Zg,' su-om Provost um-Jnux ornfa. nu,-1 n., lu.. ' Bw 'W'-1 -..'2':'L,'1 A-?C ro. moo Badgex-Zdltor. E. S. E sr IN ,-i'f'E 3-?.'.f'-T-'QF'-A : ,, '5,n,,,, lu.. ' cf- subgocn 21-msusmn ea ,vrtnt saagur. . . Y -. '-S? -, . - -Q., ,'-,gf-w za- -133 Ymi greets:-any gl-.mm ,ummm-. rn rm. you, L. 1 understand you wmmlm arming A -mx yn re nr-. okt C1,!:t 192911. yr Q ' E J mn U you are Mvned 'C be can tho anger. L an :ha ex-nose rm-srwu here me Comms can be :me -round hero unless 1 my sa. vnu mv.-Q nn uma as for permission ra print :ms umx, rm: 1 uve nomar thc -mn-r OVQ1' und C0!lBU1tBd with LIIB WD! DCWVYUFDEDC Lind hnvc dhtldhd W0 Le: you print :nn book. Yau :mud na: do thle nnunver Hunan: my permxasxnn. . 2. im my run yaur ng-nu sau:-Q section, our na L rf' careful. ff ' ' nil! 'wg 5 fa? ' - NJ. .s.n. 1 V- 157 'A H ' lv ,t' fzlz' RX W . ml , lp 9 Q A ,I gg5 ' 'D!!12151511bl!!ll!!IEEE!!!ll!!!5I!l5!f2!Z!5!il!!lC!!!5!KIM531221251ll!II!!1511MilI!!l!!Il!!2!il!1il!flillllll2511221ll!1151IIE!!!lillllllllllll5111151I!!IE!!HEI!!!fillIII1Z!1121111II!1!!!l!!1!!i1!!lE!!!!flEflSHIIIEIIICIE1llflllllffll' Ill U '!i!'Z l ! ' ' ' I ''WI! If ' fl 'Eli!!!Eli!!!lZfil!!I!f'.!!fi!!IE5IIIHUf!'.i.'2f5IIHE.'i.. ..!HE!H1IZ!!!EH!!!iiil!.. '.lEl!'.51f5UHEiUM375!B521f? mmmmmummmmmmuummmnmummmI'mmmnummmmnmummummmmmwmmmmmummmummmummm'mmummmmmumuunummmmmIilmFu??h1IIIIQIQFFIIQIIIIIGLYIIIlllffl?FHIIIIESYIITIIIHlllllllilTil?IIQEIHIIIWillYIFCIHZILIIFGSI-lulmu'Hill'diiunmmmmuunmunmI1Iun1uunummImummmunmmmmummmnnmmmummxnmunmnmnmnumuwuuummmum P a g e J' 9 4 E mum m-umm.nmwnmInum.mm.1...mmn 3mummn.255.LmLm.m.m.nm.m-wqmuwmmm mumnm.m.n.m.mm.umm.mmmmm.mmmM...MMgmInIIfu11In.1.-1I.1m1Imlnm-mllmnvmlmmmmmnmm.mm..W...nm....m....mumm.mnmmmmmm.fu..1.Im1.,...1I1.ul1..V..-1mVV.mm.numm.m5w.m.mVmmm.,.Hm.V....m..mm..m-u.mmum.mmnnlmwunmmmgg E!! .i. als ,,. E55 iii ESE E: sis EEE 5? .1 as 3wwmmwmmmmnmmummnmmmuwnwmmfnmmfmm ummmmmnumlummmuImmmmInIml1.VIV1nVImmmmIv.ImnllmmnummumunmmmllVImmwmnnm.mm..mmnm.,umm.m.m..m.---mumumm.w.mm.mm..mmmwn.m..m.Vmmlmlmmmmmmuummmmmmmmmmlmm-.lumummmmmlwmummwuummmmmmnwwg 3 E E 2 2 2 5 F vein-1g:wgggZ3y1,,.f,m1'fv314'efiQ5:1 'g..,.V 1- V .Q ff . mf ,. V.-fl -AV' .. - 2-,gf bwff.-Vf VW:-ffg..f,'v'.z,.., 5,-...iw.gg-'wfaak4rf2?ff,31cw . . 5. J, E35 E 75341 9f f' 'T - - 'V FJ-':Z'5r1 'fu-f '4'3f N'::.'.2f' fini? 'ivzf-'?3.V-1165! iw-'.i?f'h -1,-f E-MVP'-. ,.VV:.f13'V'fl cr V. ff F ,' -4' . ,si ' V- 'fif-404. if.. -' 71V4,f-.'-.:'7f ,EE E. 7-I' .ef Zffrgff ' 1'.-f- : . . ,.:'eli'1V L11 -112 . fi 54 iV: 1ff ?z.' :111Vi ' za 5 .- .V '. .- - ' E ff :Tf?4!?',23,Q:.:?f.fff? . '.'- 'JV-4' - i'- 'J K' 'V F52 w. ,+ff.7,- -xx' f 3g.: yu I-1' - 2 Qs' N- '-.Q 1 ' .. - A ' .V M V.: fm! ,ii,a ' Tv fuk if 1i'v'V V?V'1f f' Vf2V..,.'. I . 'Y qu 5 ' 5 fV.-.- .fi :fa , -.- ,ffl 'xi PT! lv- IV ffl : ., 4' 1 ' -V .gf -af. -..-.eisifgszf ' , 1 .aw ' 1 ,. ' VV 1 V V V . - .V ,v 5 . A , 5 .-wif.-'J -' V: V-'51 1 f . ,f.:f-pS:H6LL 5 - ,gp-11':i:-1 .yi 1 ' .1 V 59 Qw- .M tif i- A , ,. . , ,, .5 ' 2 -,f ,.,.f1,.. J., Vg:-Q. 'TQFQA e- .af . Li 5514 if .2 ,QQOUVRTESV , - - - -ff 1 ,- VV 9 2, , izg V -S gf: . ' .- W V V -. wif V V V S.. ass ,Q 7,-, .. .V --1,.::-9,.,j-.5391 I way: . . 5, - IV- ,.:--,1'-ju .1 -,. .QV if V K. V .' ' 1 '41 I . I A 512 -4353. 5. -Z, X h ,H , . -V. VM . V , GV . I! f. ,'?fS,I'-ffgjmfy 3' ' , gt V .yu V ' 19:14 E' EE . V V V. .. -V ' si f,: e.Vr:Vrf .Q . .. 1'l'dyLe ,wnk:'Sia . gg .-55 1...-5:17 gf. -,rsai X.. ,4 V .Li 4 ,V .n . . A If A .. I .,., -3. :gg 5 '.-1-.V Q ',...f': . . 1-'P -Fil' .U M--.. . .V,.. , VV 5 V . . , 1. ,, . .4 . A- . , 4 ww... . ,g,. .5 ., , , , , V , 5 . 9.3 ' ' 3 'L ' ,. , -.32 'Lf -' .'f,::. ..'f.4:??,1:e1 ::-5:1 .-: ' 4. 2 '.:' 4 . 'V ' If Vfieif. V V-' f 5 i-fV. -.ea V ff if af' V. V... z V . . '. ff f ' ' x asa - I 'V V 2. 5.123 -f' ' M . .. 1:Jx 1.f1 i- -12-i':f:fe -ni.-, - H., Aff, ,L 2-W6 an-f ' -' : ff W'-. , '.'-- fs'mv-.,.'.V,'HEe41.614 - .QS-Q L- fi -1' A-ff 'jf 1' fn.: ' ' 'Q :Es . ' -' 3VV.1r.v4: - .:.fg'f-+1 :gf K .:,5,V ' ff'5.Vii.2 gf .. fy Pg. .'l.'1i-ir? ' Lf? f V. V . ' 5 K as if? F-lf I .' . V NST- . :.V l '. wifi ' . 2 24 ,3'3'3Z+Z . ' . ' .J- - ' iig V. ' V V ' E .1 1 -1 1 35 1 f V Qi . 1 'VH 4 f.V. 11'-fi 1-V fifff-2 vi -ff f' r if ia.-:few . 141+ is ' , 'V ,gg . -gf'Vm45gag:V.'.-fa-' 2 ag. V . f' V V . ,V ' . . A Qi' gli 'ff ' 'V ' Ffy ff' , , glggfgfg .A , , . . ,Y , -5, , , , gf lk' , .'2 ' , J, ' ' uf- ,' 'Q V if V f 415,51 ,.-,z 953-gf 'K , - V L- A . ,. , ,. . 1 V. , S . .N .zzz .V fi-2:99 . -V-'- . V iff :'S'Tfi7r1i'fQS-.135-5 L' , f 55:51 ' - ' - W 9 .' .f ' 1 12 F: 3:55 r ' 'T V 55: ' ' 1451 fJ'f.'WFQ17 - - 4' 1' 'V' V ' . VV V .fs.a..:7?i?322-'-ffff .f f E gf .sys Q -H ff fiF'.fAta2'.f.e.f. . ,Qi - - , , -,-- ...f if ,fx V V 1' :cg 9 s!l55ff?-.mf :af gg V. , . .,- . V ...Q -5 M. :. A - :L 513.-I,-Y . 4 ,, ., Ffa: QV ' xP1?,ggff3 J f ' '-,al an ?QEF ?:zV.af .4 --415-:v2V.-Vf fiat., 1' ' V-f, k, .ei ' ' Q :ig ,gf :ir A :xr :g- - ig, 6:-,cf ,VJ mfeif x . ' . s - ah- ' V41 -34-Q1-.5-'1'-2' Wi.:-L1 -Q ' ' fx ' Cx ' dv f -, -'fgw' Qu V ' 19 ' wig' A' . 1 ruff' - J 'Vi P 1.12 .'.V V .'.i.:. 555 fi-Q -f m. J.: ..-' ,z - aNvQj,1:,.E q:zJdg:g.g 5645, Vw ' M ,V 11:21 f v1fwV2'f.'f' 1a,'If K .- aw' V11 1.1314-' f'.1'5i . .' ' Vy-X .gays :ff-f.':11:1.., avr-vfmsa , ?1'f-.i-'hz' qafjsk? J 'V . , 1 . -vnv . .V:-L. -1 w w ff .V, - ,fx V V V - f+-rw. V .V V. -2 mme agwizeiib . iii-. - 1:51 X' - f I .1 - K 15?435Qf3af.... FV . i LV, A . '. f'5:: I?f5 , 5 V. V ' V: f 1 f 9.15.4 ' N x 1' fl VV-.Vfl-H332 5325524 W-.Q...,,i.S. . ,,-.g,4:s5,.-. nw., W.-.zg5pQ.y f X .V ,,. Q. e 'q i . A . sq J . 325' ' . 7' 4 - - ' ' ', QJVEZ ' v 3? , I gygd' Q.1','Q'jQ' 'rw 5. 3 .952 ,S-War -411' -.2 . V'4pigQ,fi:5.'5?w:' W V V1 X rfaisff-PfSYe'3 S L-N-1. , EE -SG . .. -09 3 51 ,V- 5 . V -4 ' .-, ,-I- .f 'f ' . 552 ' - , y- . 'B -' A2wg.,4fw 2:25511vfgfiuz-b21?VfVViar'f'hi-2 ?5wf5f4,G6Mf5ff5LfQ2'Z-P+-82? fa. -9'f,f:a .E in Vw - V . H FV 1.,.f.4Q. Vw-zrwswV--V1?,V:vm6 .www v '- .xv '. .5 ' . V4 -' - -ff:-big yi'-1 rf P117 24 V -fV edfyfszfwf-f 'fe-mf Va u'? .1z5,.:rNh19.?, 'x131?i:.f3'L f V VV:-4 25 114'-152 - V Y V -V ,: ,sf -ma . vfb . 1 - V - Vfgfizffffff.:.z k , r V- - . 'V' - -' 'V ' '.. Q --of.-.1 'V mflr'--lffh 'f 2',-zzmsf-ff'ri-G '71wiiv,i. L , ef ,wg ' s w f? . . . V , , f -R., A52 , .VV V Q L, ggi 'Viv' ,M . Vw , xg, ... f'f.- ,5gg5.,g2?y.,?y g,.5 '.,.Q,q-fi 'fm 4 f' V. gf 4 V V , .MV . 1 . V. t:ff.wfa:'.VxVz? : 4' 5,57-g . A- 3 gm VNV .. 1. Jw. Xg.g.:4.g'V4'::.- . V, .1 .A-ei-a 5 . K 1 --- f. A .. iw nf ', . vffpx-'Qf,?If 1:1 - :Q ' A 54. -a g, Ag: , '- I . isa, , - Vw-4, f .fgfgwi P ' .fm . P-V q5.V3'g1E+:,Z'gN ' We ,sv . .V J 2 ' My . il ' 3 1 : V' ' . w ' .f ,, L i:2i,f' . V. f . . V . 5 'i Q ala' F' 'H 1 1 V! -- 1- V ,www-5,2 V X . -2.223 ., ' f, .3 s-ft 'l 4'1'y-'51wFw,4.'m' -:lmffM,V5f:Vf4::PC2hif.'mf ' P.-. ' . 2-' iw --.1 - , 14 me Egnfaif V-V.3V'1f 119 :if :ffl V V- - E V: F2 1 fn.- ,:V iw' ' V 'uw ss 'Le -3' +V, rw-.'V4zGfm. ' 't hi-9 V: Vi:1yff'W'2f,7..W. W K H 2 . 1' Y fp ' ,221g,7A2:fV ff ?J5'.5,V'x V VL ,fzggq-.1 :V ,V ,az .fr . 3 xx -1:1-f ff? - fw.p,.1,f, rm-ff. .f--. 5Rx,:.:44f - x 1-0-Ag2rz,Eg'Z' Q , - V V r'w:.L - ' .- ' z,o:l1w5g5,y1VpV:A:VV,.4. Q ,fig ,J2,1e3'4.f.wu?:4- .zngwh .X ...wi me Jw., . i f' , -:Mysx:,,,,g2Vz.f.f2.'J2fa qf,- V .. :-.. Q -.A ,. V,wf.f.m-.qf-lm , .-.,-Vfmfffv V, ffsfvfw--ffwVwign..,. 'im 1.3 .. ,V5,1.Vmf Va : ,. rw V f yew Q V f. ., 43 1 ' ,. , Z ' .. 4 ' -- .. 4 ess .- ws 5 . .,'4,.,w.1'V 5:1 ff- m15gCv1HW,Z+'f-Tiff.-.arf -' V- . 1,311 2- fxV'Ywewi-'N .1 4- 2--f . WW- -P'f'f'2 424' ia, .mga..mifV,..f,.. Hz .- .. ., ..m...1....M,.,..,.. .... .....,....-,A....,... SS: ass S2E,mmm...mm..mnlmmm.m.mm.mmm.-Mmm-mmmmmmmmmmfmmmm.m.,..mmmmmmmmmmmmmm-umm.m.m.mmm...wmmnmmmmm.m.mnmHmmmmm...mmmmmm.1m.m..mnmmm.u.mmmmmm.m um-mmm 'gg m..m....,......m,.......,m...,.,........... ...... ,m.m..m..,......,..,..,.,,,.,.,,,...i sa.1....,...............m.,.................W........................ ...W...,.W...Wmm....Wm..m.mm..m.m...mm,mm..M..M Page 595 Koneessloew os oulz Ko -E175 Qnsasveev :LQ new B.esaTeEv 29.012621 Crexm euoco 'ree Fuss oe 5.6.0 5Ox20mTv sn-:Tam nm serum 5wnzL as TOLD nv 'rc-mem V VV Ar XX OWN HRNUWRXTING' - . 'N X Qgqk . M igggafdf' X a ' QC W Y iw P41 Wilkf . Mffbqj. 2 . fibff 2221! , wxg4,A.,,,24 w ,GX M406 Sxvi Www ww hw wwf 'vm-W ' .,,pCf4 aXx-w Q fr'3L'1,-a ,f W 'LK 2701.- WXLQM GJ' My 2 44214 Jew M f ' ff' RGw1'?ff,VwFs.eiWJW ,XQjwm5 X?pifwifgZQ 5 A :Sw-TP,L 'Q' ' N ' - QA f fi, WWL7 - I ' , - cf 1 Z I , ff! 1-LQ' 3 in k m14 :JJf-g,.s- Nw. ,, A I ' r fiffonffqqrld -WRDB. T '-Xyfavswjgfjl , gd iff ' - A. 1 Gofwwnewiqllnit' 7,1 max A -. if QQ C,5:1g2fP wMx wwf 0 , 0,-a., I . MM Sywiwwl- Q?'M lY1mr T -Qfi'w. ,0V'f7L,J3' X ,.v,,f'lf,f args- M - 726V-lMP,1iLf5 ff wf ,vcd A li-W4 . Bw 6 . wf'f'32,,n.v 1464 -98335 P4' WWE ' X x I X, wx' V i 7 p ' 2 vJ,4:K'd'q , FQ? QW 7? R- 4? lfffeoifx ff 'QV -P' ami K1- 'w' QE' QLQFLN! Q, wii?4aw,s1f ' - 14.52 f A Q lg f- fiffgfibiiw lf? ww 21 HZ 6f2!3f W Nong! Q3 -165.4 5 WU WJ 'V N Q if Scfvwyi 3,695 SM W' I Q Z tx X301 H3 wo mussoc V . Q29 I Wx MNX ww' ?,l rfLgf, uf 't- KQW Y Q wifi'-13 . , V-2 -. M Hg 'z 7 V -31' K I I 1Wmnm.H1..1V..1.11V.,N.1V.1WWN1.H..umm.m.-mwmm 11iiWii1Hifill1Fi1FQ?iii?Eli1iiNilHIEGENE?GiIii?RPZRQIIEEEIIEIRFZQIEIEE Page 596 F E unmmnmmummnmumm H Etqnunnummnmmum s E Tillllllllmllmllululn A Langdon River Anthology EING a running stream of personalities, a flowing aceount, as it were, of the foihles of the great and the near-great Cnot heerj together with a few nuts that the squirrels missed. The rest of this page is intended to drive into your ivory domes Where we get the Langdon River stuff, and the following pages indicate the obvious enough for you to see why We call it an Anthology. LAN GDON RIVER Oh, Langdon River, You make my liver Its plainesl duties shirkg You make my tummy Behave so rummy I cannot do my work. Before you flowed Down Langdon road My innards all worked fne, They use me now ' So had, I vow, 1'd hardly know ihey're mine. Oh, Langdon River, I burn and shiver, Wiih feverxand ague I shake Because you get My tootsies wet And cause my head to ache. L'EN V01 Oh, Prince, I ask, what good's my bread and butter When health is gone because of some damned guiier? - Please try, Oh Prince, to keep the sewers clean Thai we who siudy may noi wax foo lean! m.mmm..m ..i...mmmmmm 1 1. .1..WmH.,.Him.U...K...im....Him...W....i..,,.m.mu P a g e 5 9 7 a in g.,,.W,..,....1..,..,...,ww,..nH.ww....U.mm...f....U....mu.,........M..,..r.,.,....1..i,..W.,r..,..fQ....W.qEM M-M Wm-MW, V W .,. K. .,.. n.nn.m...mi..n.m...,.., ,,......1......mm.,.A.,...,...I..,...m..m,...i...,.n...,,.,.., ..,i..i.....m.n..m, egm..m..u...,n.m..,..m....rm...H .Wm.Wmmmm..mwmmmm..m,.wm.w.,m....m...'rm. M' . ,.n.......,.m..,.n..u......,1 ....,...,..m.i.um.......L....nm..,H... ..1.....mna.T.1:mnm.1:aamansammr..mg55 The graves gave up their dead that we might have the truth ''anfairpwllgwyngyllgogerychwyrndrobwllllantisiliogogogoch' ' N the interests of humanity and scandal-mongers a few relentless and determined gore hunters set out to learn the truth about some of those who adorned our campus during the past year, bluffing everybody into thinking that they were farther removed from the apes than the rest of us. Most of them had been dead from their necks up since the hour ffl. V95 5 2 i'f,?:'f 3 ' 'I L. eww' 3 ' ' is V f i' gt -4 . 1 C 15, .f . 2.- 'fi'fI'fFI.i:Iw: W.- f2'fa Qh ,:, - 41, V fy 3 7, 5- vp! sz .. I. 4151. ' 'e V - v w ' - -' f ' T, wx gig s,-,J 71- , Z 'xref'-:fha , ' - . f wp- , a , ,H g-' V r Husfsa, ' ' fi, ,. gylgiifgs, 3, 5.51115 time -K, ,i nf , , ,,.. , VVx,,. , M ',,Al S ,VV ,A X i, . ,. L -s t ..- is-, 'M' .r fi--aa: 5 V --- lr- V fp-as fa e5:.,W.,m,...,..mw. . ,,,,, mmm Illlllihl Wi---.......ei....-w....,..,e.-,..-...-.....,,-... ..... ...,.....,..,. mm. of their birth. And what Nature had started, Hazzie's Skyrockets and the Students Life and Goodnight's Interests Committee had fin- ished. In other words, they were now dead from the neck both ways. But the graves on The Hill gave up their dead that we might have the truth, which same is tastefully pre- sented to you herewith, together with appr0pri- ate illustrations, The picture shown above was taken just after robbing the grave which held Larry Hall. We knew it was Larry because the minute we got the lid off the ccfhn its cccupant sat up andstarted to talk-about himself, of course. If that had'nt been enough, there was a Sigma Phi pin stuck on one side of his ribs like a Croix de Cuerre. Larry always was a Sigma Phi to his very bones, you know-as well as a lawyer. The stiff lab also furnished us with lots of gore. Page 598 unniiwmu 1umummumlmn minluInmmmmmuuunmnummmuumnmmnmmmummmmmmmnn .4m1vunumvummmmmInuuummnmnmm u m mnmu m wummumlmummnmlmm nmunwmumm s a s a s 5 as a 5 s 1 sis Ewa EE sa: :fs mummmmmmi gg .m.mm..m s. I umm Immmmnmilmmmmwunnm I 7 in u u I in uummmmmumnm mimummnnnnuwuunium nnunummmwnmmmg mi mmmmm ummmmm I ivnm.mmmmmummu 1 ,J ss: y , J e' ,. -Q 9445. f ,Aff Qfff 7 gl P.- ifj,,l5f5,,X :-- ,X ' ': J ' H5 , A futile,gfffgtfepffvelstfzfpffve on mf ,WLL The Hill C WHERE are Helen B., Scotty Goodnight, and Kink, Al Haake, and Whitney, The co-ed's conscience, the students' Nemesis, the red-haired, the barb, the child-wonder? All, all, are sleeping, sleeping on The Hill. 1 ff, X N r X x aj I ai B5 ' ' S 9 ' 1? 4 .lt Mm g --1 - 3 ' . N 5 Q- 1 jx 23,1 ' , , 1 -',. .'Ef' . - - A ' -.iw Y, -- gs.-5 1--,, ...gpg -- - .s,,-- .::..4w,?:!g.-...., fyfyfiy DIED THUS LQ' One got lost in the stiff lab at midnight, One was killed in a Chi Phi quarrel, One died when his heart stopped beating, One was bit by a circus leopard, One was beaten to death by an ion- All, all are sleeping, sleeping on The Hill WXXUX N - - fl 367 D' Where LS One died young in a hurry, One got the flu in a dance hall, One died in the D. G. bath-tub, One as good as died-he got married, One fell over his feet and broke his neck- All, all, are sleeping, sleeping, sleeping on The Hill. Where are Editors Millie and Eddie-and Jessie, and Louie. The Bolshevik, the owl-eyed, the singer, the lover of dogs, the exhorter?- All, all, are sleeping, sleeping on The Hill. six, vs ,,,, f es l A , ' ' Vf ff - s Wfgfw ofvf ofeoffv me eb. Bfyffffvzi Where is Hazzie, Delta Upsilon Beta, To whom eight-oiclocks were a myth, And studies a hoary legendg Whose College Career was dependent On keeping his grades from his father? Lol he blats in the Slcyroslcet Column Of the doings of long ago When better men than he ran the Col lwvithout fear of the Delts and the censor. His futile attempts to be funny Are mainly the cause and the reason Vfhy all, all are sleeping, sleeping on The Hill. 1minin1uimiiniv11iniinwmumnmiu-ml nm Iimininin1in1H1ii1iI-1ni1u1iniinwmmuimimm Page 599 Es EE 525 E55 E gg is Ee EE EE Ez E ei ee is EEE -fe ' '!...,......,,.........,.......,2!'... mn n im mmmm I nn wmnmi ls is EE FE EE se EE E E E v n 1 u CARL MAEDJE My life wasn't worth the living, 5. X I l f T Q ., , 2: 1'.'. ' : 1.'s tP r., -f. 'Mm .Wf X f 9 X fx 0 Sf N 1 I :' '. A f 4.QQ 'v1 ,wiv yi vi- Wm f,-fr ALICE PORTERFIELD l was small But my ideals were towering. .t , What would the Cardinal To raise its lowered standards? What would Alpha Phi he now Without me to spread its What matter my life ende The champion Tom Thumb of my time. And death wasn't worth The effort it took. l-low often l threatened l'd end my life of sorrows, Of troubles and of woes, And seek a briny graveyard ln the surging, sighing deep. My threats were empty ones- Mere schemes to win the ladies' interest It seems strange fate should pick me To die of worn old age ln the one success of my career- and awe. A German professorship. You who come to follow my example, Take this from me: Put not your faith in dancing or Phi Psi. For neither are found down here. Xllj, have clone without me fame broadcast? d in a circus. . H No matter how high you may have carred your head -A , I z. Your feet were always on WT' IWW '34 fi, I' f + l it - -.cgi-T' L a level with mine. DAVE WEISS My parents had high hopes for me When l came here to college, But l turned Socialist And spoiled it all. l got so far as to write editorials For the Cardinal, But they canned me because 'Z l wanted ten dollars For one night's work Setting ads. The trouble with raising the red flag ls that you get chased by a bullf' mm-mlmw-lm nm-mm.u.mw I1m1ummm.mmmmfmniin11mmummmlmln Page 600 a A n ri m JERRY OCHSNER Some one told me in my youth That l had brains and should develop them. l spent all my time in school trying To live up to my reputation+and the effort left me -v '144 -.:. .r I4 gl ,a . . A' ?7' weary. l ran the Lit., Red Domino, Theta Sig.-when l could. j I tried to convert the world to democracy, msgs ' But when l got out into the real world ,I l realized all my folly, Forgot the advice of my youth, Forgot my brains and developed my l died-a frivolous ballet dancer. And the world has gone on as well without my re- forms. C310 nr l..f Lib , 1 lgil Q9 , a AL ROGERS Five years l spent at an education, And a thorough one it was. The Law School saw my smiling face After all the rest grew tired of it. l've known all the girls, The Thetasf, the Kappasl, Gamma P Have known my soulful eyes. llve been the dashing villain, Broken up true love-almost, C5hades of Fran and Ken, you haunt I had ambition, though, None of you considered. l surprised you in the end When l burst into real fame- A scientific farmer, And raised onions For a living. E. pluribus unum! feet. 1 'uf-x , Q fir an :Hi ' uv- E lf, Z f' 'G I W ' f ff H W lik l X ED DEUSS l lived my life for Chi Phi And the honors l.could get. l always wished there were That by dividing my work H two of me Between myselves, l could do all l planned. The Lord was unkind When he gave me a mind, Athletic build and good nat Because l worked all three ure besides, And educated none. N Now here l lie beneath the sod, No rest has come to me yetg l plan my plans And scheme reforms, But the world goes on as well without them And better-l'll admit. hi's-all me stillj ummwwmwm uwwwmw w mwwmmmmu mmmwww 1 Page 601 IIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ummm:IIIIIIIIImIIIIIIIIIIIIIIIIIIIIIIII1IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIInIIIIrIuInIIIIIIIIIIIIn IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III I IIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIII mmf II I I I I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II II III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II I I I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIII IIIII I IIIII IIII IIIIIIIIIIIIIIIIIIIIII II I fgr LARRY HALL if e W .. . . . Xyffjf Specialized fussmg was my only art, i For years I followed it, then lost the knack. -'T I specialized in many, never realized the truth E i1 fQOf 'Many may come but few-should be-:hosenf ' f. Too late I changed my tactics, 4,, Was forced to resort to Politics W, laffirfsf' To cheer my sinking soul. - My military career I count as a success ' For the work I've done for my government W ,II Was splendid, admirable-I think. I Military Police, a useless affair in the opinions of men. SQ' Can be made most effective, if one is an M. P. himself. 'L r- My life was a trivial thing at best, L My death, nothing better: MV I died of a broken heart- , A careless woman's whim. DEAN NARDIN' From the sunny clime of Missouri at ' : I came to the women of Wisconsin, L' VVIV As an advisor of ladies, W H A soother of babies, I I' F. A prodder of slow ones, Q 'A 1 . Q' A restrainer of fast ones, 1' lb' ll A friend to the friendless, fl ' ff ,EQ A help to the helpless, Q .' I x fri IL An interpreter of love letters, f , '- -I A lover of suffragettes, Yi' 'I f X A keeper of secrets, ff ff' f 1701 I R Neither a misanthrope nor a misogynist, ff 3 ,pf ' X In short-their humble servant: flf' f f ff i X X N But Ah! I was from Missouri. ' 4 f I X HERB BAKER QI! .. I've been a. moneyed man all my life- f Not money of my own, but other people's. I financed plays and stunts by the score, The Cardinal and Senior class V ff With other people s money-not my own. Business was my hobby and my aim. I looked at life thru horn-rimmed glasses ph-opifgg As thru a dollar mark. , I died-of worn-out thumbs ..f W0 0 l ji'. I L17 ' M - elif: .5 4 From counting paper money, Other people's money, not my own. fi-T'- IIIIII IIIIIIIIIIIIIIIIIIIIIIIII5 E IIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIII IIIIIIIIIIIIIIIIIIIIIIII I I IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIQEE Page 602 II III mini ?E ii? EE ii s '- .,,.,,.. IJWWHT-1'-Ji---li--M-ill-A ' -L-1--WM WML---u ' ' ' f ig .,.,,.....,,..,...,.,..,..,.,.,,.,,.,,...,.,,, JOHN MCPHERRIN gs I ve tried my hand at many arts, L,jf5. ,h 3 I've been a versatile man, I-fzviigj, Started my career on a newspaper 1, f 'Ml In a corn-fed Iowa town. 'ff' rf is . . dug, If M.-,1'. I passed thru successive stages of prominence, 4 my I-.TWH A lieutenant, a politician, an actor, too. in I lived iii the sig Phi domicile ' flirw On the secluded, exclusive heightsg 5 But at heart I'm a bum, a wandering bum, 1' -I ff ll With only the soul of a hobo. . I H S - u Xu. ,ll Q .LE X' -.. x ' PX Eg X ti' ,il 355 E55 :E - FLORENCE KING f, C E55 - .. . Ei fa ggiff ffl The saddest of all things, ng, gif? Qi ll, An unsuccessful politician, Lf' ' ' X 55 I turned my ambitions to Delta Gamma and 1- Q ' ' K., rollerskating. g ' C A I was an ardent member of Y. W. C. A., ' Ls' Women have always been my specialty. They say men like red hairy I I But I've come to doubt that- As I have the men. A' ' ff- Q -1 Here beneath the sod is --is I've had ample time to reflect- ,L l , Would that I'd looked upon life Q-915 ' -- With the coolness I find here. gi: E PROF. LOUIS KAI-ILENBERG , ,A ...exif E If I have caused' one thinking being I E To remember a single chemical formulag 'I E O death, where is thy sting! Y If EE If I have saved one Frosh 5 EE From the vile weed, wild women, Wisconsin wineg ' O life, I am not stung! I But O ye men of Wisconsin,' ' Y V ' From my sleep here on The I-Iill, Y J E, My soul cries out in anguish, ' I E Cease ye to sing that vicious sang, Us f L 0 U1 S , 'Glorious'. ' '1 H In 1 XE Page 603 75211- KEN HARLEY Did you ever have an ambition- An absorbing. inspiring theme? The kind of thing you plan for- Hope for-pray for-- Then have it snatched from your gra For nearly two months I lived Prom- Dreamed it-ate it-thought it- sp? A Then lost it-I-Ioly Cow! ., x - ,hx EN I 'll ' I ,E 'ln ,A ' fill' ' I f ff I N V 'P A 'III 'I 'I ZW f if , X e' ',., wwf, uw I '14-4 I 'FQ y, I 'cf ff5L 15P , f -Q SZ:-,fi r ll V 9.a'i I I6:,34lIW' .fb A9 lf N .4,,g,. ft If 4 'T Ilgflllrjwlf h J f I ' WHITNEY SEYMOUR I missed my calling. I should have been a girl: Instead, I've only played at being a man. I gave my opinion Whether it was wanted or not And valued it highly- Myself. I profited by the freedom of the press In Cardinal editorials. I controlled The board that controlled the editorials- V Thus covering my tracks and covering myself With glory. The fa.culty's pride and reliable standby In my youth, I choked on a Hsh-bone and lost my voice Before I was thirty, Developed writer's cramp within the year Do you blame me if I fought for it And stood my ground against the powers that b I got the Prom. The knowledge that I had, Thrills me even yet. What were Beta, Edwin Booth Or the honors of art-editorship to me? I made the Prom,- The only thing I ever did, But, by gad, I did it! And died from the inability to express myself. f CIOL1, on Herz- Ohfleff - Of7HEfFf1, please '- be f7 ll7EJ sy, Z 1 your fem' -your fqqf. , sf U ,'f9Uf fedfures are ' .1 wVll'lC'f VN -' MKII! X' ' r :VM 1. , 7 I XX i e? Q ,J mt I 7 M7 BHBY EEDS A NEW PM S AL HAAKE Hell-I-Iell-I-Ielen! My pride and joy-the subject of my thoughts. I quoted you in class-rooms, Used you as the example of my discussions. I cannot refrain from singing your praises now. I argued for you as I argued for Free Beer Before you came into my life, I argued for you as I argued for Chi Phi Before you became my wife. Now, with ample time for reflection. I can believe Of the punster before our wedding: I got I-Iell-'n Rice. U 1 vu m ul nmmummmlwl mmI.IIII.mmmmmllmvplInlIIn1nnumlmnmmlmm Pug e 604 E x RUTH DONALDSON 'I started my life with speed-and ambitions, And ended it- An onlooker to the dash and ambitions of others. I came into college life, determined upon a reputa- , ' . :'Zff,-: tion, -1,-I NX And as a preliminary step, I went Alpha Chi. l9llf!'!l! T5gif'!W7 'N Men cheered and applauded me, and encouraged my 1 ' -. III'le.N '14-if fi ' Then began my career of conquest! , 1 -:fqXQ'l fv2,4g5+- ' , X Full man a lust Greek ' ' I '51-:E x if , gg Bn! Y Y I-las pinned his emblem on my bosomg But, like the sponge, I pick them up Only to squeeze them. As John Runkel says, 'Next'. X 1 ,- ,QW Y I 1 -L-N X X X I7 in X x , f sg X , !l!ff'H'1l5 ff . .Tv - , , fit.: -I Inu 'f - 4 A -- ,gqs .Ji ,-:! -A X -'sc ,-1f-- fu -im - Aly. ':i 5 - .. .. up I ....-.. if IIll ' unlllmlllnln 'IIII N V.. -j5,i.-q:5L,L'.4:i-- -f- , ?'g,x: T ' ' ?5?T7'T ' MARIE WILCOXON 'I pride myself on having been an individualist. As far as dress goes-at least I was 'differentf You smiled at my cap, wool stockings and gym shoes You-fools that you were- Didn't realize the value of publicity. Cutting holes in the ice to go swimming Isn't pleasant, but it's startling To the world and yourself as well. I believe in a thorough educationg so I got my train ing Below my neck as well as aboveg But I died alone and unknown, A victim of over-activity Trying to make a name for myself. DEAN GOODNIGI-IT Why was I born a clean? To be one day acclaimed of men, And lifted to the seventh heav'n of bliss, XX , And on the next to be relegated A rift! r To the seventh depth of hell, y .f Q, X, Because I repeated that simple verse, XM 'Let there be no prom'g But to a still lower depth was I consigned, When, with a burning heart, I said, 'Let there be no Badgerf . The moon and the stars shone on- w The Prom was held! The Badger was published! And hell! The students gloried in it all- fi? It set me back 26 years- I lived long enough to come back- Long enough to see seventeen new Prexys- But I remained Dean of Men. figs LSR VXA NN' -2- r,J'A -- ie -ff M X I . ., oo.: R ,swg.'-v .ff Q I' iii , c. df -4- .miie ,,,g!,,,.2.e.:f ,.-. Z 'iffL'lS.-N-1,4 -L5 6000- AIIAGATYTT - NUw..,m11..my.Hivm.,.nlm.u..mmmnym..,..m.....u.m V.. H . .mm ,my..1.H,um.IU,V..W,.H.,m.,..,...1 -,..,,..H..,..l...,,.., vmH.11.m.m.H....m..v.. ...,..H..,...,.,m nwnuwimummuumminummummmmxunnummmu Am Page 605 mmmmI1IInI1lmnmmmunIn1nInmmmnmmmmmmmuxmmmmunm muInmmmummunmnumnnnummmlmmmnm IIIuInIInnnnmIuInunmmummmmumumnnmumumummumummumummn11nnx1n1InnxInunnnIvvInrunm1nmnnummmnnummummnumnmmnnnnummnmmmnnmnumnmn ummlmm mmmmmmmlmumm ij , . I In JH Y. 1 wmummlmn-muummmu I I nwmmmmmu I nu I nu I n mm n.mmnmnnmmlmmmumumumw mu I n unumunnuunmnmmnmmu.I urmmwmmmmmmunmunnlmlumnmmumnm-mmm. HELEN B. SMITH I've been an authority in my day, A believer in rules and regulations As the antidote for all ills. They called me the back-bone of the S. G. A., Or sometimes the Dea.n's better half. I really was both-and a lot more besides, For I taught the dear girls just how they should act, Left nothing at all for them to decide, And left them none the better for my efforts. Why, I even praised Dean Goodnight When the rest of the students opposed him: Though I did that for Goodnightfs sake, And not because I believed he was entitled to it. For now I know that the minds of both of us were turned. I took life austerely, Died when I felt it my duty to die-some said - M 1 1 V , fwf- 1 if In L With a frown on my face. Fools that laugh on earth Must weep in hell, you know. I'm taking my laughter now. ,4 PROF. WILLIAM ELLERY LEONARD ffl!! In and out I go among my kind. V, They know me not. -l'. I hold communion with the gods, lx -15' I' fi For did I not write, X ' 'Sunshine flashing on a re:l-white-and-blue feather' ? Who says my verse is melancholy? .1 I Does not 'sunshine flashing' dispel the gloom ? 7 4 Does not 'red-white-and-blue' arouse your soul, , And H11 you full of joy? Does not 'feather' suggest a chicken? I, r - ' ' I As I said to 'l..ottie,' 'I'm a genius'. lj' 'Emil-h-if X MARGARET PETERSON I X Al and I rose to fame together. 71 W X Al, he was handsome-a dancer Of fame- And I, I was the same. Q L g X - Y. -1 -ind 2 r l?- Z3 f I -L15 Z7543' X I Q::Ii,fl 'N ' . I , 'U I' X Kappa needed me to help her to renown And I needed her for the same. Seventeen dates for one chapter party Was the record I made: But that was in my youth. lVIany years have passed since then, My life, before I reached this quiet place 'Af Beneath the sod, I 2 Q Was barren of men, dances, and beauty, for l I many a year. - I I found to my disgust 'I-Ie who laughs last, laughs best' And all my youth was laughter. mmmmuwlnmu mmmnummml I mn In ning.nuummmnmnmmunnmumnmmlmmmmmmmmnmmnmmnummmmmn III1H1-I.muummImInInmlmIvuIHIum-mmmmmm I I -I ml.. Hn. 'num I mmmmimmminnnmmmmmmumnmumlmummnnm Page 606 K- V xx X , 7 -4 -Q 4 T fly, . llll fm' ilfil 'X .N m I X MARGARET CRAIGHILL I've been a politician and a student In my day. The kind of student phi-betes are made of, The kind of politician women always make: . I-Iigh as to ideals, but doubtful As to ways and means for carrying them out. One thing I count a victory, a success, I made the Badger-what it is- Nlade it the 'poor man's book'- 'A price to fit every purse,' Two dollars Was the price And I held to it But it cost me 53.00 When I paid for mine- I dicln't live long enough To learn what others paid for theirs. fi i f fl EZEKIEL SOLOMONAEPSTEIN Ezekiel is my pet prophet, Solomon is my king! Out of the night that covered me In Podunk Center, I came to Wisconsin, With gold bar, authority, Hebrew The gold bar brought me salutes: Some with hand above right eye, Some with hand to nose. Even Solomon in all his glory as Was not arrayed in such authority as I But my Hebrew wit! Why, that made me what I am today. Long live the king! U y if Wy NN f I PROP. A. C. COOL Many a time and oft in the rotunda, I have been pointed out As a man of parts, With the exception of my face. Wisconsin will never be reconciled to that. But give me my Scotch lassie, A package of desert horses, A sack of Spanish Snappy Stories: Throw in a Congregational Church. 'That will be glory for me.' ? if 1 ,f .X X u id I1 ' 17 fri wit. E' WI 3-'41 :V K? 1 Us-'31 'Y um llllllllllllml Y .mu .1mmm,.m..v..m..,..m.....m...1... mmm. im . . 1.w.mw.wm.m. .m..,..wmmmm mv.m.w.mw.m,m W M ' IIIuwrumImumnmmanmninwwnwininuwwnnunmmu Page 607 1 I nx ng' ' - f wr gg: -473' dm, III! 6 lf' 'X x ,Fw- gfl agigh -1 r sg? 1a we 4 - x I 1' Ll,-' 5,- 5 iq, fijjb. L 1 A Vw 4 1 X a X. X jESSIE IVIEGEATI-I I startled you all With my leopard-skin coat. Can a leopard change his spots? Mine never did. But people get used to all things. Even leopard-skin coats. So I had to resort to A Ukrainian flea-hound To keep my name in the Col. It worked. So did I- Making sweaters for the beast. If you see Prof. Mortimer, Give him my regards. Ah, There Addy! .. . - ..... ' ' .......s.......!.!,.l!.. I BILL DELANEY They've called me 'inveterate fusser,' With my ready eye out for style: I pressed my trousers each morning And used Pompeian cream by the ton. I went in for dancing, Picked out girls that showed class. Only two things kept me back . And hindered my career: My nose spoiled my profile, My name spoiled my chance. But considering my drawbacks I've made quite a stir, Though I broke co-eds hearts by the score I fooled them all in the end. I went back ,to Milwaukee And married the school teacher I was engaged to all the while. N pp nf . I, fills it i ' 7 . .h 1.03 ug.. 31.12-ni L, ,Xp I In ll, A J -er-'tem ...aus If we had ever had a picture like this taken when we were a kid, it would be the last thing we would want to see in print. But since it is a picture of one Adrian Lammers, whom we are told thought he had lived it down, we take great delight in presenting it herewith. Isn't he just too cunning for anything? Notice those curls. That's where Mary Pickford got the idea. And that smile. I-Ie has his father's mouth. His father let him take it to play with. We're not kidding you, we're just showing you a good time. I.1I,H1.wmm...v..m., vwm.mm.m.u wwrnwllmwlwlmml inIinIHIWIu1inI.I1inIininIinIH1NwIummummmwlul Pagz 608 c Ea Ig etrhluzil Owned and Miss-managed by Alice7'Porterfield-the Board of Control Concurring. VOL. xxix No. 119 MADISON, wis., SATURDAY, APRIL 26, 1919 NO SENSE GOODNIGHT FINDS PREXY lNELlGlBLE Fires Birge from Officeg Student Body Is . Aroused Dean Scott H. Goodnight has hurled another poison gas bomb into the midst of student and uni- versity arhirs! Again the Bean of Men brought down the wrath of thc entire Hill upon his head. Late last night, after a wild and jolly meeting, the High Life and Disinterest-ed committee unanimous- ly voted to put the President of the University, Dr. Ethan Allen Allen Birgo, out nf omce, the com- mittee preferring five distinct charg- es of in-eligibility against him. The charges are being withheld pending the preparation oi a detailed state- ment by Bean Goodnight. and a study of the reaction of the student body and faculty. Wald Denies that he is President ' Rumors were current on the campus this morning that Good- night had offered the position of FISH CABLES PROTEST London England. April 24, 1919. Cardinal, Madison, Wis. ' Heard of Prexy's firing with surprise and disgust--please register my vehement disap- proval-man with such elegant taste in neckties is not to be denied-longer letter following ZYESCFVE SDZICC. Carl Russell Fish , president to Gtto E. Wald, janitor of South hall, in recognition of past services. it is understood that the Dean recommended Wald because he thought that Wald had often been in the president's office, and was well-fitted to. hold the position. Wald, in a short but snappy inter- view, stated that he had no inten- tions of holding such a position. and that if the Dean wished to hand him a present he wished it would be a vacation. , . ., Why Birge has been on proba- tion forffi months, stated the Bean. I let him go until now, but hc should have told me about it. I might have fixed it for him. V: .Birge would say nothing when interviewed by a representative of the Cardinal. He was just about to start across the lake on a ne- search expedition, and his chief concern at that moment was the weather. Students incensed The student body, as a whole, is stirred to the fighting point by the most recent edict of the Bean of Men, Notes are pouring into the HARLEY SNAPPED AFTER PROM RIOT IRENE HALEY ELOPES WITH LORENZ llllllSEL' DURING PROM SIDELIGHTS ON ELOPEMENT R.0.T.C.iT0f BE i RE-EQQBLISHED Veterans of ,War Will Serve as - ' . 1 1. Privatesg Sherr Assist- L ant ,f'Comn1y Plans for r-e-establishing the R. O. T. C. at Wisconsin are now well under way. P The varsity cadets will all rc- ceive pay for their service, declares Major Wood, the new commandant. This will be breakfast money at Lawrenoz's and uniforms and equip- men cast off bythe heroes at Camp Grant. ' ' The men who have been in the service in the training camps oi the country .will be rewarded with the non-commissioned offices, befit- ting the part they played in the great struggle for the freedom of democracy. i Shen' Replaces Atkins Major Joe R. Sh-err, because of his wonderful work at the univer- sity and at the great cantonments, will aid Major Wood in reorganiz- ing the R .0. T. C., and will replace Tommy Atkins as assistant com- mandant. The Chi Psis and Sigma Phis, will be awarded the distinc- tion of holding the general and staff offices. l'All students now enrolled in school, and' those who come here- after will be drafted into the corps. declared Major Sherr. Democracy, Essence of Plan Tho men who have seen active fCont.inued on page 5.3 VESPERS NOTICE! Vespers will he held Sunday af- ternoon in the gymnasium. Mar- garet Kirch will lead. Dorcas C'Winkie J Hall will render spec- ial musical numbers. 4- HEI EN B, SMITH Harley ,Vows Vengeance or Suicide When interviewed at an early hour this morning, Harlcy's only comment. fit for publication, was lhis:.' If I catch Maisel I'll kill him-X'll get him-cla1ndiiidoul- Maisel dies or I die. D. G.'s Salvage Cuspidor ,,When the bottom of the golden guhoon flew off, il was snatched up hy Ada Kruenig, who Saw in il the possibilities for more glory and more shoes forthe D. G.'s and their babies. Gunderson salvaged the remainder of thc cuspidor and presented it to Elizabeth Head as a souvenir of the cataslroplic. Putting both togeth- cr, the D. G.'s plan another bazaar. proceeds for the Belgian babies. Madison Copless After reaching Middleton, Harley attempted lo induce the Madison po- lice deparlment to issue nn order for the arrest of the fugitives at the next station. but the force had seen the glimmer of light in Frank's window and could not be induced to leave the :van .. This morning Madison is cop- ess. . Peeper Invents New Bill Assemblyman Pecper declared he would introduce a bill at the next meeting of the assomhly, providing for an all-state masquerade party to mis.:--funds for repairing the capitol. Middleton Bus Line Defunct The proprietor of thc Madison- Middleton Bus Line was unahlc to say when service would he re-con tinucd. In the meantime the var- sity beer-hounds have taken up hik- ing as an outdoor sport. Pussyfoot Burns on Job Pete Burns' Detective Agency will handle the mystery shrouding Prof. Hyde's car. . Pele was discovered by a Cardinal news hound in four different disguises during the night. That Professor Hyde was also zu vic- tim of the Prom melee is popularly believed. -1-Hs, :se Shattered Romance? The only evidence of a shattered romance was the autographed photo of Harley left in the Prom Queen's room at 'the Gamma Phi house. Both Harley's and Maisel's photos were given equal prominence on the dresser before the elnpcmcnt, ac- cording to Florence Finncrud, Miss Haley's roommate. . Now the photo of Maisel has disappeared and Ken- neth's photo was found on the floor, trampled, said Miss Finnerud he- tween sohs, displaying the photo. On it Harley had inscribed: To my Irene. my Prom Queen. my Dream- Il' we can't take the R out ol' Harley, may we put the R in Haley-Devob ,Many Injurcdi and Much State Property,Destro3:ed in Excitement HARLEY VOWS REVENGE The Victory Prom last night ended in a wild melee. The interior of the Wisconsin State Capitol is laden with the debris of cracked marble and broken furniture, the Madison police force has not reported for duty, the Middleton bus is up- side down in a ditch, Harley is on the verge of suicide and the S. A. E.'s and the Beta's are converting their kennels into armed forts. And the czause of the whole affair is the union of two loving hearts who are now speeding westward on the ob- servation platform of the the St. Paul train. Pecper Snoops Trouble The first warning of the com- ing encounter was given by As- semblyman Carl Peeper, who left the whirling crowd for a few minutes to imbibe enough stimulant on the cool terrace to brace him for another plunge into the wild orgy. On 1'e-en- tering the building he rushed up to Dean Gee See Sellery, who was complacentlylsmoking a six IillCh stogie on the top balcony, and demanded in the name of Podunk County, why a myster- iously closed taxicab, accom- panied by two masked and arm- ed men, was standing at the west entrance of the building. Before the two could investigate the, strange proceeding, Chair- man Kenneth Haley rushed up anxiously waving his arms and tearing his hair in wild confu- sion. 1 K'My Prom Queen has clQDed, --i11---.-- . 4 g 1 , - 1Continued on page 5.3 Co-ed's Consciencemdly-Your Ken. 4Continuecl on page 54 If you can shiver,I can teaqhiyou to Shimmy I have taught such men as Dave Weiss, Whitney Seymour, and Owen Scott A to dance like Vernon Castle., SEELME! SAR! FIELDS Page 609 Page2 THE DAILY CARDINAL April26,.1919 ' - COMMUNICATION. yoilfni Simple. - t tl d I Af ..- EFF.-L-- Tr ' -'S4-' -'- To the Managing Editor:- U el' m eng mg five op' , ' -.Y ' 'Ie' s , . . , ments come to my desk I will cou- irl 1 4 ll 1 Y Q 'i In View of last nights scanfial sider it an honor to inform you of I4 ' . I , I ' lrgflw and elopement at the Prom, I think lthem. I liz' 'Jill , 1-- 3-H 'Hilti l.'l'fj 4 it my duty, in order to safeguard FRANCES LOUISE NARDIN, 'llljrlpiv ' If I I' , ' lifsiiffjff ' -' women's interests in the university, Bean of W0mE l- ,. ' x 'i' .g, ' ' ' 5, , to sift the whole matter down, and. ii' itff . . . -In 'A-'g 1721 to render a final fair decision. Blue Bgttle will Iholgg its amiual E S-- 1:16557 ':'-?Lii1 f1+-'sif1e-e-- -FT ' ' It is not to be denied that Mr. mafmee me m 8 'UP Pa' nfs Tl 2- gk , - - ---fr ? -- --'T' ' ., . . t ft . Th . ed Harley had-the first claim on the vggiogglzoathirnlllglef of ihgnz-ie: young ladyts attentions. He was 'ing Africans. GOSH, folks, things is comin' in on us so darned fast we don't know what ya want firsat. it ! AND Fin sure said sumpn when she said, Oh, dear, we hate to lose Reeney, but my love, wasn't it just the most romantic thing you ever dreamed toil 'K WITH romance in the air, and everyone all stirred up, it is said that some wondering waiting cou- ples around the Hill have decided to call it a game, and hitch up pronto. George E. Wallis and Betty Hoop- er were seen hitting it toward the depot with the o. f. carpet bag and lunch-box. t t K THEY tell us that even Ed Deuss is considering taking the plunge, and has hired Al Haake, the w. k. expert, to coach him up on a few Two can live as cheaply as one speeches. But who wants -to live as cheap as Ed dtoesg ' Ken asked Irene if she would wed. She cooly answered, Nopo! He'd get married in a church, While Maisel, HE'D slope!! a - WE knew that some day Good- night'd do it! Sequence of events, sure. First Prom, then Badger, and finally dear old Prexy. Well,.if this keeps up, even we'll 'be outi of a job before long. GRANT M. HYDE . IN Aw WREGK Journalism Professor Has Nar- row Escape in Clash on Middleton Road Late last night, a badly battered car drove down State street into one of the garages. Stopping with a clashing and grinding of gears, a human form tottered out of the car, 'and fell in a faint on the floor of the garage. His clothes were torn, and his face was scratched and bloodstained. One arm hung useless by his side, and his breath came in short, convulsive.gasps. Finally he grew conscious, and al- though he was still dazed, he soon made his identity clear. Pm Grant M. Hyde, from the university,. .,.journalism,. . . .driving near Middleton .... narrow road... another car with glaring headlights, ....guess I couldn t see,. . . .never could drive with one hand,. . . .m-m- had sort of a smashup,..they went on, .,.. m-m-my head. . .hurts,. . . . and he lapsed into sleep again. When he -regained consciousness in hour later he told the story. I started out for a little drive alone last night, and was driving towards Middleton. The road is quite narrow, and when another car came along I was blinded by the bright lights. Then I was pitched through the windshield. Yes, I was alone. W'hen I came to, I started home. This happened about ten ofclock and it took two hours to drive home. Well, fix up the car. ' And the professor went home. Police authorities believe that Harley's pursuit car did the dam- age. However. no legal action will be taken by Mr. Hyde. Cyrus Philipp, the governor's father, will lead the post-Prom dance at the Chi Psi lodge tonight. His partner will be Miss Lucile Biebermann. Miss'Lauretta Conklin left Madi- son this morning for a week-end visit. Her destination is unknown. READ CARDINAL ADS l HOWEVER, this little marriage affair is going to cost everyone a little. The bloated Chi Psi's have started the contest by sending Mrs. Haley-Maisel a hammered silver nut-set. if 101 ! WE just bet that the Beta's send sumpn like a cut-glass bathing suit. ll li l HEAVlN'G4S! Wot next? Just now they come in and tell me that the entire body of Will Katy Guess has run off with our very good friends of the lovely smokes, Dick- enzadont! My Lohd! where will our Col. deteriiorate to? BUT if everyone else should wed, we'd still have Grant M. Hyde with us. Still, Where was Grant when the Prom camenofii' ' AND Al Porterneld will never de- sert us. Not l2er.fault, tho. THE zoo 'I THIS my young friend, is the Car- dinal Zoo. IN this cage you see the BOARD of Control. - THERE, swinging on their perches are two paraqueets, TALKING loudly. GUESS who they are. WHAT did you ask? WHERE is the business staiff MY child, this ,is the zoo, not the AQUARIUTM. MYSTERY SHROUDS UNUSIEE MISHAP Milkman Finds Lucy 1 Rogers Unconscious on Middleton Highway The early morning milk-man out of Middleton was startled early this morning by the tottering form of a young girl coming down the road waving wildly for him to stop. Won dering, the weary vender of the lactal Huid pulled up his -plodding steeds and rushed to the aid of the strange young lady. Just reached her, she fell faint 3l'l'nS. The amazed'man quickly a bottle of milk, and threw her face. Since it was 99 . per cent pure water she quickly came to. ' My name is Lucy Rogers, and I work at the university in the journalism department. Last night one of my young friends asked me to go motoring with him. We came towards Middleton, and my friend was driving very slowly. I-Ie only uses one hand. Suddenly another car came. towards us, at great speed with great shining headlights and lots of racket. I couldn't see very well, because my hair was in my leyes. Then I was tightly squeezed and went unconscious. When I awoke I was alone. Then you found me. as he in his opened it into 44-100 giving. her the highest honor pos- sible. Yet, if the young lady later regretted her hasty decision, ren- dered perhaps under pressure from her sorority sisters, she did the 'right thing in not going through with her part of the bargain, and by giv- ing herself up wholly to the man she loved. Mr. Maisel is a man who will treat her well, and since the drastic step has been taken, Mr. Harley would show greatness of character by sending a message of Godspeed and congratulation to the Assistant Prom Chairman Leon- ard F. Erikson, supported by Mar- ion Pierce, will lead the grand march at the Delta Tau Delta house dance tonight. Theta Nu Epsilon held a pre-Prom banquet at Frank Hoover's Wednes- day night. A post-Prom banquet will be held at I-Ioover's Monday night. Silver steins and golden gob- bons will decorate the table. - T - 3 PR OM PIC TURE5.fg 'THE ELOPEMEN7? We have .secured several graphlc pictures of the Prom .melt-ze, Winch We-are d1SpOS1I1g of at exception- ally low pr1ces. The Pfzoioarf S Wm. Meuer, Mgr. Q o eds' Co eds' Go eds' 0NE HALF PRICE I Will dispose of all my Prom gowns and brassieres at half price Due to the postponement of Prom and the Flu ban, I am overstocked the remainder of my wardrobe will be offered to Univer sity women at a scandalous sacnfice . S T A R W O R S T PETE BURNS, Prop. D 1 u' 9 w u 5' vvvvvvvvvvvvvvvvvvvvvvvvv vvvvvvvvvvQvvvv ':9Z9I'I9:9:9.9.'.'3.9.9.',.9.3.9.0,.9.9.9.3.9.4.9af.9.'.'.'.'.919A9.9.0.'.9.9.9.9.'.'.'..'.O.O,0I0:9IOI9g - 1 - c I I I . ! At this juncture the young wom- an started to weep and begged to be taken home. This was done, and since then she has refused to see anyone. She did not divulge tne Identity of her escort. It is thought by the police au- thorities that Harley's vengeance car was responsible for the acci- dent. Miss Rogers graduated from the Course in Journalism in 1918, andx has since been engaged as private secretary to Prof. Grant M. Hyde. Theta Xi will not give its dance tonight as planned. J. Leroy Haas enpflug fell from the box at Union Vodvil while applauding the Pi Phi act. ,He is still unconscious and the brothers are'calling off the post- Prom affairs in 'nespect to his mem- ory. The Beta Formal set for tonight, .has been indefinitely postponed. ' a For Sale. 2 pairs of bones. 3 sets of poker chips. 2 packs of Congress Cards. Dad Wolf Page 610 Anril26,1919 THE DAIL'Y CARDINAL page POPULAR MEN AT THE THEATRES ..x212i..E'3:rfQ'2.s::a.z.iti2:: ' From Faculty 5:5ff..5u:Si::.dz::r.si. RESIGN FR0lYl F RATERNITIES Greek Clubs Undemocratic Say Latest Campus Bolsheviki Predicting a general Bolshev- ik upheaval and revolution in the Latin quarter, twenty-four prominent university men re- signed last night from their respective fraternities, The men in resigning issued a state- ment, declaring thwt they be- lieved fraternities to be undem- ocratic. and that they will soon completely disappear from American universities. Each fraternity sacrificed one man in the interests of dem- ocracy and accepted the resign- ations bravely. , I The scheme has the endorse- ment ol' Deans S. H. Goodnight and Louise F. Narclin. , Hehlfeld Leads . The mcn who walked out last night are: Karl Hohlfc-ld, Al Rogers. Bill Delaney. Al Spaf- ford, Kenneth Harley, Herb Wright. Carl Meadje, Owen Scott, Bob Rewey. Red Weston, Porter Brown, Si Spengler, Herb Baker, Stanley McCand- less, Sunny Ray. Jimmie Lind- sey, Hank' Getfredson, Tony Zulfer, Harlow Pease. Chuck Culbertson, Brud Taylor, Harry Westpfal, Josh Elder, Walt Mal- zahn. They also maintain that they are bigger than their fraterni- ties. and that nothing more can be gained by remaining faith- ful lo their oaths. It is under- stood that they have handed themselves together and will immediately commence rushing and spread propaganda in ord- er lhat promising freshmen may be saved from the fraternity menace. They are confident that their action will bring the speedy extinction of all frater- nities at Wisconsin. Frat Men Gloomy After the action of the men had been made public, Cardinal reporters interviewed leading fraternity men affected by the walk-out. Most of the Greek letter men were pessimistic, and predicted the doom of fraterni- ties at Wisconsin, if the men did not return. The Dells are concerned over the withdrawal of Rogers. as he was recognized to be a man of great capacity. Bob Thompson and Rus La Due will remain. however, and it is expected that this fraternity will survive the crisis. The withdrawal of Karl Hohl- feld seemed to give great relief to the Phi Gems. as they have been expecting such an occur- ance for some time. Paul Mill- er resigned also, the remaining fraternities agreeing that both men made the equivalent of one ordinary man. The Phi Psis believe that the loss of Carl Mnedje will mean an immediate boost tothe schol- astic standing of the chapter. and the S. A. E.'s expressed a similar hope over the loss of Henry Gotfredson. D. U.'s Lose Delaney The Betas think that the loss of Harley will mean a great lowering' of the social standing of the chapter. Now they will return lo athletics as their ma- jor activity. It is an overpow- ering blow, coming as it did, just -when they were celebrating the acquisition of their first Prom chairmanship. The Delia Phi Epsilons he- lievc that the loss of Scott will sever their last diplomatic con- nection with Dean Goodnight. The Alpha Sigs are plunged into despair over the loss of their only political hope, and the Chi l'his declare they have lost the only thread nf control of the Cardinal with the resigna- FULLER Although somewhnt overshadowed by the Prom and its subsequent events, Union Vodvil on Friday night went off with a zest and u finish hitherto unknown in the amateur theatrical enterprises of the univer- sity. Every act was an example of the lighter histrionic art. OI special mention was the won- derful act given by the Pi Beta Phi sorority. This act had been adver- tised for weeks in advance and the entire front row of the Fuller had been leased to the Chi Phi fraternity for two months in advance. How- ever, the Chi Phi men were doomed to disappointment as the original act had been severely censored by the university authorities and several important features summarily cut out by Dean Louise Nardin. The girls, contrary to current rumor, wore stockings. The musical num- bers were exceptionully well rend- ered nnd the dancing act was par excellent. Ray Holcombe and his actors were pulled off by the stage hands, the old Fuller Hook coming into use fin' the first time in six years, when it jerked East Lynne. George Mar- tin, in an unusual contortionist uct, brought down the house. His very lust trick was put to a fine climax by Marie Wilcoxon shrieking fright. -fully: Look out, Georgie! Peg Kirch and Kube Fedde put on a very usual song and dance skit, which took like the measles. Both girls were. showered with flowers of all kinds, including caulis. Many contributions came from the boxes, where the Theta Xi's vied with the Chi Plxis, who by this time, felt that their money had not been spent in Vain. - ticn of Baker. The Kappa Sigs hope to do some studying with the elim- ination of Brown, their noisiest jazz hound, and the D. U.'s are mourning the loss of their so- cial prestige with the withdraw- al of Delaney. i The Chi Psis hope to make up their loss of prestige by calling on the alumni to Enanee 3 5500,- 000 addition to their lake side castle, which will contain a danc- ing pavillion and a soft drink bar run by Fred Pabst, the brewer's son. It is understood lhat with the loss of their class treasurer the Phi Delts have given up all hope of re- gaining their prominence of years ago. WANT ADS AS l am graduating this year, I desire to sell one good. spotless reputation to a high minded young lady who will care for it faith- fully.-Helen B. Smith. WILL dispose of six assorted photo- graphs of Alpha Chi women. Cheap.- Moose Hanson. FOR RENT-My standing with a Mahoney vampire. A good girl with all modern conveniences.- Al. Rogers. L. ' '- ' LOST-A T. N. E. fraternity pin. Finder please call Teddy Deak- in, Fairchild 156. iWlLL pay big reward for the re- turn ef a T. N. E. fraternity pin which has been lost. No ques- tions asked.- Ernie Adams, Badger 2991. Sororities LET US SERENADE YOUR CHAPTER and Students S. G. A. compulsory meeting for freshmen. women will be held in the Engineering auditorium next Friday afternoon at 4:30. Tea and wafers will be served from Dean Turneaune's oflice., ll I F 'Ilhere will be a meeting of the entire Cardinal staff in the ollice Saturday morning at 11. Every member must be present. Whitney Seymour will speak on Skyrock- t . G S ALICE PORTERFIELD, CALL Us . 4' W President. BETWEEN GLEE CLUB SERENADE 6:30 AND 8:00 The members of the Men's Glee club will serennde Langdon street tonight, stopping at the D. G. house, the Pi Phi's, and the Tri-Delt's. Contributions thankfully received. Gamma Phi Beta announces a mis. celluneous shower for the recent Mrs. Haley-Maisel, next Friday. ANY NICE NIGHT Sigma N iRidef to Middleton in the'D. G. Bathtub , Our machine is fully equippedfand Waterproof throughout. fExtra tubs have been placed at the students disposal pending reparation of the Middleton-Madison Bus Line. The cars will leave Main Hall after each and every class. After-6 p. m. trips will be made regularly every half hour from the D. G. house until all, are served. . A I 75c-Round Trip-75c Proceeds, as always, for the Belgian Babies V Shimmy to Qur jazz ,Phi .Gam Orchestra ,gf ' RAY 0T'ro SCHMIDT, conductor we play until' your shimmy shivers i I Our Specialty. Open' House Entertainment Reduced Prices if Refreshments are Served l Y. Louise Dunlop CC-EDS I find Angel Bloom Complexion Cream the best for my skin. . It is unexcelled. I am glad to recom- mend it to my friends. Louise Dunlop. I am Sole Madison Agem' for Angel Bloom Preparaiions. See Me! David Weiss Phone Fairchild 123 Page 611 Page4 THE DAILY CARDINAL April ze, 1919 e Dall Cardinal Th Q Q -.iX....-.E Student owed and uncontrolled' University Daily, unfounded 1492, and confined with the Wisconsin Naily Dues, establi 1912. Published every week day during thc college year. Entered as about fourth class matter at the Madison Pustoffice. Idiotorial Offices 39 ft. South of the Hall phone when operator can spare the lime, and at the good Times office, phone 7 come Il. Busy-ness office, room once. in the building just across the campus from the Engineering Building. We are just sixteen years olrl. Have you paid your fee? News Staff Cor crulchl. Managing editor: Mildred Evans, News editor: Bertha Ochsncr First assistant: Elsie Glucll. Dessicated editor: Sylva Beyer Meyer. Editorials: David Weiss. Skyrockets: Janet Durrie. Reporters: William Ellcry Leon- ard, Grant M. Hyde. Omcial censor: Warner Taylor Business Stall' tot' lifej. Business manager: Karl I-Iohlfold. Advertising manager: Adolph Geiger. Associated Adv. manager: Jessie lllegeath. Business assistant: J. Leroy Has- enpflug. Ass't. Bus. Man.: Robin Hood. Circulating manager: Willard G. Bleyer, Board of Control Call woorllr Alice Porterfielld, ditto, ditlnt ditto, ditto, ditto, ditto. CLast ditto is Whitney Seyniour.D Saturday, April 26. 1919. - Our New Reconstruction Policy 1. More Women on the Staff-- Gardual Elimination of the Men. 2. Reinstatement of Doctor Blrge. 3. A Married Couple to Lead the Next Prom. l 4. Removal of the Cemetery in front of Main Hall. V 5. More Power to S. G. A. UP T0 S. G. A. HE controversy over the in- eligibility of Prexy Birge is closed. The committee has made evident its resolution to stand firm on its original deci- sion. Professor Fish's appeal has been ignored, the faculty and students have no further YECOUYSE. The committee acted in the face of overwhelming opposi- tion. The ineligibility of for- mer Presiclent Birge is general- ly conceded, but since the pres- ident, ineligible since last fall, has been allowed to continue in his position until a climax in his work has been reached and un- til his services are indispensible to the University, it is almost unanimously held that a special dispensation is warranted. But final decision rests with the committee and there is no use crying over milk that is spilt. The decision leaves the university in a critical situation. The way out of the situation is uncertain. But one thing is sure. And that is. that it is up to S. G. A. to decide what it will do and decide quickly. There is nothing to be gained by an extension of the debate between the committee and the students. S. G. A. should get together im- mediately and weight the propo- sition from all its angles. It has a grave responsibility to the whole school and to the alumni, There is nothing to be gained by further delay HAROLD M. GROVES. CAVE MAN STUFF I-IE sensational events of last evening serve to em- phasize the need for proper chaperonage of the social af- fairs of the university. It is deplorable that a man who has asked a girl to be his guest at such a function should have her stolen away almost while he was dancing with her. Such a L o c h lI'lV2'l.'1'I3l'l perforrnanc e might do very well for a ballad, but it is hardly what one ex- pects in polite society in this day and age. Let us have no more elopments from Prom! THE SAFER SIDE. lEDI'1'OR'S NOTE-The follow- ing editorial from the prolihc pen- cil of Whitney Seymour, treasurer of the Board of Control, is reprinted verbatim from the Cardinal of March 8. as peculiarly applicable to the events of last evening. The Voca- ticnnl Conference should be hcheld ilnmediately.l I-IIRTY-NINE out of every hundred university women get married. Sixty-one do something else. What are you going to do. Cer- tainly not live on your parents. Your education has opened many nelcls for your abilities. Now is a splendid time to de- cide on which one you will choose, before you wake up some morning to find yourself with a B. A. and no place to go. The Vocational Conference is here tc help you if you are one of the sixty-one. lt is 'giving instruction which cannot help but inspire you to new endeavor for it opens up to women ways in which they can be of real service to their country. You feel that all it takes is a little effort and the will to do and you will be a real woman. Even if you think you are one of the thirty-nine, you owe Wit to yourself and your future connections to have some means of support. Some day you may have to tell a daughter what to do, this is a chance to start thinking about it. Women today have as many opportunities as men without for a minute losing their high place. Find out about it at the conference. It is a challenge to your seriousness of purpose. Communications To the Managing! Editor' ls it possible that the immense teaching stall of the university is to sit by, helpless. while one man, well esteemed as he might have been, literally pushes its leader from his throne? Can it he fact that we, who represent the highest thinking people of this state are to let such an outrage pass without a murmur? No, I say, and again NO! It is not to be thought of. Whatever charges of ineligibility have been brought against Ethan Allen Birge by the whilom Bean of Men, whatever faults there might have been in his theories, certainly it is not to be denied that the action i I l is ent rely too summary. tfo need- lessly sudden. Time and thought. as well 'is consideration of us, should have been the guiding principles of the High Life committees actions They say that the great charge against President las l will ever call hlml Birge is that he was nw yet old enough to vote.-hence ln- ellgfible to hold office What of that. as Skyrockets would say' Men who were not yet old enough to vote were still deemed old enough to die in the services of their coun- try Is that not alone sufhcient proof that a lnan under the legal age is old enough to die in the serv- ices of his school? O temporal O inores! Or more freely,-What tha doose are we comin' to?-to agzrn quote the inimitable Rockets. lt is indeed time for us to rise in our holy horror and demand that the right be wronged. and the tower clock rearljusted. Rise up, ye sons and daughters of Minerva, cast about ye and slay the brute. Yours impasslonedly, A. B. HALL. Professor Politcal Science, COMMUNICATION To the Editor of The Cardinal. For the honor of the university and in fairness to all students here, persons not qualifying should not be allowed to represent the univer- sity in its activities. As college men and women we should be broad enough to consider the principle ln- volvell in a situation and be strong enough to live up to that principle regardless oi the individual conse- quences. We would not want to see men below the required standard represent Wisconsin in an intercol- legiate athletic contest, and why should such men or women be lead- ers in other University affairs? The matter of eligibility is clear- ly not one for self-determination, It hands of the faculty eoninnttee, and inelr decision should be respected. We expect them to uphold students' decrslons in matters cozliillg under our lui-asdictlon. and we sh:-:ld be equally as willing tc hack the coni- mlttee in a case of this l-rind, The onli' point in which the E, G. A. is here In'-olved is ln lmrnerliately ar- ranging for a new selection. This l , . could be carried our with such promptne-ss that the work of the presidency need not be materially retarded. The university can hardly be cali- ed a une-man job when the many deans are considered, each of whom has almost entire jurisdiction over his particular section. It would seem that by this time the universi- ty must be so well organized that it can be successfully carried on by the competent assistants which the president has secured. They have had ample opportunity to learn his ideas If not, there is occasion for criticism of the administration. Let us. therefore. consider this question from more than one angle and not pass a too hasty judgment without enquiring into all sides or the situation. MARGARET D. CRAIGHILL. Wilbur W. Goessling left for Chi- cago this morning for an extended visit. ff e X Laurence W, Hall, varsity lawyer with Miss Lillian Stevenson will 1 aa the Kappa Gamma inforfr.. shim- my dance at Norwestern tonight, Mr. Hall is a menluer of Sigma Phi, rational college fraternity is 1 if Owen Scott, varsity news hound, left Madison this morning for a week end recupei-ation trip to La . 'a K TR 'XC5 has been specirically left in the Crosse THE FUNNY MAN at unn Ray Supported by BOB BRADFORD In the Roaring' Slapstick Comedy Hit My Wife Got Her Taste for Booze from Kissing Me Goodnight Mary Elsie Ferguson In the Kappa's Vampiest Vehicle si 4 ' ' as GV irtuous Wives Supported by an all-star cast including lil MARGARET PETERSON 5, AGNES SARLES El DINTY MOORE lgl DAVE WEISS el ELEANOR RILEY One Performance Only-Sunday, April 27 3 Page 612 IH: 1. Gal IE? itil Fil itil Sl iii lrxl ha litl liz: rl :fig fzd lil Es if! ll H, lf. :ll li, iz. 1. rl hi! 'El til X il 1. ,f A AlJril26-1919 THE DAILY CARDINAL Page 5 PROM QUEEN RUNS OFF WITH MAISEL CContinuved from page lj he shouted. It seems that while Haley ceased his dance with Miss Irene Harley for a moment in order to reprimand Larry Hall for indulging too freely in the Shimmy, Lorenz Maisel, all- conference beauty star, had seized Miss Harley by the hand md dragged her unceremonious- ly down the stairs. Violence Follows Shrieking madly, Harley rushed down the stairs in the direction taken by the Heeing pair, followed by the entire assemblage. At the entrance, he found his way blocked by Henry Gotfredson, Dave Weiss, Russel Fetter, Pat Donaghey and a host of other S. A. E's, who were drawn up in a solid phalanx before the door. .Backed by the Gunderson Frater- mty, and a score of Prom guests, Harley charged the barrier. In the ensuing battle, a number of the warriors were rendered almost des- titute of clothing and several co- eds lost consciousness. A shower of cracked marble was brought down by the sharp contact of Len Erlckson's head with the wall, and Harley was struck with one of the state's S500 golden gob- boons, knocking out the bottom ol the cuspidor and forcing it over his head so tightly that it required the services of a tinner and a black- smith to remove it four hours later. Harley and Police In Pursuit When the defenders of the door had been trampled underfoot and the pursuexs had commandeered the remaining cars, tlie tail light of the Seeing taxi was disappearing in the fastness of the other end of State street. By this time the entire po- lice force had arrived, and it fol- lowed the chase, mounted on a mo- torcycle. X The chase led out along the Mid- dleton road, the cars plunging through the dark at breakneck speed. When about two miles this side of the wet metropolis, the taxi was forced to slow down to allow the Middleton bus to pass, reducing the distance between fugitives ana pursuers to a few yards. With reck- less abandon, Harley's car stuck to the middle of the road and struck the bus a smashing blow, hux-1ing,lt into the mudqy ditch. Three pronil- nent students, whose names are withheld on request, were seen to crawl from the bus and disappear into the darkness. Throughout the chase, Kenenth Harley could be seen leaning halt out of the car, brandishing an um- brella as he heroically led the pur- suit. The cuspldor added the tina! regal touch to his hrow. , Irene Weds Maisel? i' The Saint Paul train was pulling away from the platform when Maisel with Miss Haley rusheu across the platform and leaped upon the steps. Harley was just in time to seize the coat-tails of Maisel's full dress suit. The coat parrecr with a resounding snap, throwing Harley back upon the platform. It appears that the plans of the conspirators had included a minis- ter on the train, for the ouuvlttea pursuers claim they could see the eternal knot being tied under the light of the observation platform of the vanishing coach. Bye, bye, 'Ken' dear, yelled the eloping Prom Queen as the train pulled out of the Middleton sta- tion. ' Bah, bah, mocked the , Prom hero. Harley Tries Suicide In an impassioned addresslat the Beta indignation mass meeting an hour later, Harley swore eternal vengeance. When told it was his duty for Irene's sake to leave her to whatever fate her true lover, Maisel, might lead her to, HHYISY rushed to the edge of the Beta pier and plunged into the lake, deter- mined to end it all. I ,Gunnar Gunderson, .Tack Br1nd'1ey and Phil La Follette dove afteg' him and forced him to change his inten- tions, for the time being, at Twit- Harley is temporarily derangefil physicians pronounced early thxs morning, and his face is disfigured beyond recognition. Gotfredson Arrested That Henry Gotfredson, varsity tennis player and S. A. E. member, hurled the state cuspidor which ringed the Prom chairman's neck, was the deduction of Pete Burns, detective. On the strength of Charles But- ty, chief university janitor unu stool pigeon for Gyoodnight, Got- fredson was placed under arrest. Request for release on bail was dc- nied. . That other prominent S. A. E. members aided in the elopement is charged also by the Betas, whose case will be handled by Senator Rob- ert M. Ln Folletbe. Warrants for the arrest of ai. least a dozen of the members have been issued, but they cannot be served until the return of the Madl- son police -force, which from latest reports was stranded in Middleton. Sherr Mobilizes His Truops However, the S. A. E.'s have for- tified their shack on the lukeshore, and are prepared to resist all at- tempts at arrest. The Betns have taken up the fight where Harley left it, after his fu- tile attempt to commit suicide, and the Latin quarter bids fair to be- come the theatre for a sanguinary battle scene. It is rumored that Major Joe R. Sherr will call out the University Cadet corps to quell the rioting be- tween the two Greek brotherhoods Lieut. Tommy Atkins was seen cleaning the muzzle of his firing- piece, and Major Sherr had his boots shined at Prouty's at 6 o'clock this morning. Alpha Phi will entertain the var- 'sity wrestling team at an informal 'shimmy dance on the chapter mat tonight. READ CARDINAL ADS R. 0. T. C. T0 BE ' RE-ESTABLISHED CContinued from page 1.7 service in France and Russia and other foreign fields will be admit- ted to the ranks as privates, pro- viding they can show wound and service stripes enough. D. S. C's and Croix de Guerre's will not he worn, nor will the owners be given and special privileges. The idea of the R. O. T. C. is democracy. An effort will be made to have the Four 'Lakes Naval Training sta- tion put in operation again so that the Gob members of the Khaki and Blue club may regain their formcx prestige with the sorority women. The good ship Rock and Rye is still in operation, but it needs more co- operation on the pm-t of the mem- bers, and for this reason along with many others, Major Sherr declares there is need of reestablishing the Naval Preserve. However, I will have nothing tn do with the Navy, said Majm' Sherr. Tommy Atkins will prob- ably be relegated to the task of re- organizing the gobs. ' VIOBS CHEER FLEEING COUPLE AT WAUPUN ASSOCIATED SQUEEZE. Special to the Daily Cardinal. WAUPUN, Wis., April 26, 1919 01:30 u. m,7.-A special train, bear- ing the happy couple who staged a sensational clopement at the uni- versity's Victtry Prom last night, sped through Waupun early this morning. While going through the town the train slowed down to 60 miles an hour. Maisel and the Prom Queen with arms inter-locked, stood on the observation platform of the rear chair ear, and waved handkerchiefs at the cheering mobs of people who lined the station platform. -. BIRGE FIRED FROM OFFICE BY SCUTTY iContinued from page ij Cardinal omce from the most rep- resentative sororities and fraterni- ties congratulating the paper on the stand it has taken. Petitions are circulating the campus and it is estimated that there have been more than 2,000 signers. Student opinion has again been trampled on and indignation rules supreme. Very dire results are sure to occurr if Prexy is not at once re-instated, is the opinion of the entire faculty and teaching staff. Goodnight in Defense Tonight Wisconsin is tense anl quiet und-er the strain of having no leader. The tower clock is not strik- ml: regularly, and it is reported that strange presences are to he seen around the stiff lah in the Science building. The end of this suspension will not come until next October when the regents meet. Dean Goodnight denied that he offered the position to Wald, declar- ing that he merely mentioned him 'as a prospective .candidate for the job. It is up to the Regents fo appoint a successor, said Good- night. I Reg:-nfs to Decide Theodore M. Hammond, Milwau- kee, president of the Board of Rfe- gents was called to the phone late last night and expressed great su:- prise at the action of the commit- tee. Who will be Birge's succes- sor? was asked. I know of no one but Goodnight who will take the job for the re- mainder of the current academic year, said Hammond. However, th-ere are only six weeks of school remaining and it is not necessary to have a regular president appointed now. Goodnight is the man for the emergency if Wald will not accept The Original Prom Cuspidor Is now ready for paironage ai the A A A Givua Damma Sorority BenenfBc1gfansBabfeS Relief fund to i The cost is low, A lit a'Spit 1 I Page 613 Page 6 THE DAILY' CARDINAL ADril29,1919 1ioosElHANsoN CHARGED WITH KISS BQGLARY Will be Tried by S. G. A. Mondayg Asylum or Pen Maurice M. Hanson. varsity ath- lete, charged with stealing a kiss froin Miss Liela F. Mead '22, last Monday night, will be tried by S. G. A. in the S. G. A, room at Lathrop parlors Monday night. Miss Mead, who resides at Mrs, Grady's 710 Langdon street, is pre- ferring the charges. Her lawyers will be Margaret Craighill and Alice Porterfield. The case for the de- fense will be handled by Attorneys Lawrence Hall and Mahlon Caradine. Helen B. Smith, will judge the trial, and hand down the decision, Kiss Deliberate, Prosecution Miss Mead's attorneys contend that Hanson deliberately compro- mised the young lady on Grady's front porch by forcefully smacking her innocent lips. The crime was premeditated, and the girl's inno- cence taken 'advantage of, declare the prosecution, and they will push the case to the limit to convict Han- son. Miss Mead is not yet 16. They have subpoenaed as witnesses Vic- tor Moses, Mary Nolan. Frank Gol- ley, Mary Jane Lucas, James Walsh and Katherine K. Whiting. Misses Nolan, Lucas and Whiting all reside at Grady's. Kiss Impulsive, Defense The defense, declares Laurence Hall, will admit that Miss Mead was kissed by Hanson, but will con- tend that the kiss was not premedi- tated, that it was tendered in a FACULTY ASSUMES CONTROL OF DANCING S. G. A. Rules are Adoptedg Kehl and Sari Fields in Charge The good old days of jazz and the Shimmy at Wisconsin are over. Terpsichorean activity at Wisconsin will be faculty controlled. This decision was rendered yes- terday afler a short and quiet joint session of S. G. A., Y, W. C. A., Y. M. C. A. and Deans Goodnight and Nardin. Faculty sanction was se- cured. All dancing will be done in strict accordance with a stringent set of rules which S. G. A, recommended to the Student Life and. Uninteresta ing committee, and which was in turn recommended by that commit- tee to the faculty, who adopted the system at a special meeting yester- day afternoon. Professors F. W. Kelil and Miss Sari Fields will be placed in supreme control of the new dancing system, No student who has not learned his steps from either of these dancing authofties will be permitted on any Madison dance floor, under penalty of expulsion. All university dancing will be held in the gymnasium. There will be two dances a week, on Friday and Saturday nights. There will be no shimmying permitted, and the waltz, two-step, and old fashioned quadrille will comprise the major part of the dancing program. Bach couple who attends the dance will be properly chaperoned by a member of the fac. ulty This faculty member must be the scholastic advisor of either the man or the woman. Saxophone and trombone music will be taboo, the committee agreeing that the strains of these instruments aroused the barbaric passions of the dancers. Each fraternity and sorority will be allowed one dance a semester. these dances to be governed by the new rules and regulations, and to be conducted personally by Profes- sor Kehl and Sari Fields Thompson's orchestras will be no more. and jazz strains will be su- perseded by the old-time orchestras. with their cornets, bass viols, and accordians. F13l1iR'19RIi?xE UP Ill WHO'S WHo A T WIS. spasm of intoxicated revelry, that I-Ianson's action was merely impulf sive and that he was subconsciously irresponsible, inasmuch as he was encouraged to the high emotional point by the girl herself. The de- fense will endeavar to place an equal share of the blame for the scandal on Miss Mead. The trial bids fair to attract more attention than any of the student se f government cases tried at the university for years. Hanson Faces Pen ur Asylum The fundamental principle in- volved, declared Dean Louise F. Nardin, means that this case will create a precedent in the annals of student self government. I only hope that all of the evidence in the case will be uncovered and that Misses Craighill and Porterfielcl will have abundant evident to con- vict Hanson on more than one count. Plea of Insanity? It was rumored that if Hanson lost the trial, his attorneys would curry it to the Student Court, and that the defense in that colurt would be based on the insanity plea. They will never put Hanson in the pen, declared Attorney Cara- dine. We will land him at Mendo- ta before we will permit them to put him over the road. Once in Mendo- ta, we can trust to his athletic prowess to get him out of the asy- lum. MAISEL-HALEY NOT WEDDED ON TRAIN Waukegan Dispatch Gives Wed- ding Accountg Irene Happy ASSOCIATED SQUEEZE. CSpecial to the Daily Cardinalj WAUKEGAN. Ill., April zs, 1919 CG n. m.J-Another happy and sen- sational romance lmas culminated at Waukegan. Lorenz Jacob Maisel, 17, and Irene Willneverwed Harley, 24, were 'inenserl and married by the Rev, I Will Hitchem, early this morning. They arr'ved on ii special train. The union of this happy pair was the culmination of a .romance start- erl nearly two years ago when Miss Harley first entered the-University. Maisel, considered the handsomest basketball forward in the confer- ence, had courted the fair bride con- sistently since. Maisel, however, was not selected by his class to lead the annual Jun- ior Promenade, but the honor went to his subsequent rival, Kenneth Haley. Haley chose Miss Harley as his partner 'to lead the grand shimmy carnival in the state capi- tol, and though Mrs Maisel had of- ten professed great Iove for the so- cial leader, her heart had been sworn to the handsome basketball star, and the elopement, they say, was inevitable. Pm so happy, said the pretty bride, as she lovingly clasped the arm of her handsome husband Their future plans will be kept dark until the excitement of the elopement in university circles sub- sides. Inside Dope for All By LOWELLQ RAGATZ Milton Keats Casey, the popular garbage collector at Lathrop Comi mens has been on the payroll of the University of Wisconsin -for 43 years. Since his arrival on the ox- :art express from Boston in 1866, ie has served in var ous adminis- :rative and executive departments of :his institution, rising during that :ime from a professorship 'to his present position of eminence. , N , 5 , I i h l t H l L Y Milton was born in Moose Jaw Iaine, on February 31 1848. His ather, Patrick 'Casey was pastor of he local Presbyterian church while is mother was at one time a lead- ng burlesque player on the frontier own circuit. He was educated at arvard, receiving his B. A. in Phi- osophy at the age of 12, and a inas- er's degree in Science the following GBT. Upon the outbreak of the Civil War, he enlisted as a drummer boy, and although twice wounded in the back, he served until he was dis- charged, He was cited for bravery as the result of having taken a rebel Hag unaided from a dead Confeder- ate colour bearer the day after Bull Mountain. Returning home, he heeded Horace Greeley's advice, and with 813.23 in his pants, left for the Indian infested West. His money ran out just before arriving at Mad- ison, and he went no farther, On the strength of his sheepskin, he secured a job as instructor in I-hilosophy at the university, then a struggling academy consisting of HSNAPPY SATIRE ON CAMPUS SOON Warner Taylor 'lo Publish Notorious Scandal Magazine Snappy Satire a scream of salu- brious scandal, is the latest of pub- lications that will grace the campus periodically from now on. The new organ will be published by Prof. Warner Taylor, university censor of undergraduate publica- Lions, supported by a staff composed of Deans S. H. Goodnight and Louise F. Nurdin, and all members of the Wisconsin Literary 'Maga- zine, which will discontinue publica- tion with the appearance of the new booklet. Snappy Satire will be patterned aft- cr Jim .Iam Jams, but will be pro- North and South Halls, 243 acres of woodland, 5 Indian mounds, and a hill. Here his versatility showed it- self. In 1870, he was made assist- ant professor of Chineseg in 1879, associate professor of eugenicsg in 1888, professor of criminology and baboonologismg in 1899, Dean of the College of Theology. In 1909 he was promoted to his present position. Dr. Casey is a member of Phi Beta Kappa, Chi Psi, T. N. E., Whibe Bones, Screaming Skull, the Middle- ton Club, and some seventy societies of literari and scientists. Last year, he was American delegate to the In- ternational Convention of Garbage Men of the World, held in the Royal Palace at Versailles. He is the author of five feet of books on Marriage Customs in Tim- bictoo, Was Shalgespeace Bacon? Expurgations in Boccacio, Topo- graphical Anatomy, Booze from Corncobs, A Uniform Accounting System for Garbage Collectors, The Digestibility of Limburger Cheese, Simple Algebraic Invariants, Di- seases of Roses, Food Waste in Baluchistan, and kindred subjects. His works have all been translated into 19 languages, including the Yiddish. NOTE-This is the 13th of a series of articles by Lowell J. Rag- ate on the prominent men of the university.. The next, relating the way in which Prof. Benjamin W. Snow invented and perfected his world famous perpetual motion ma- chine, will appear in Sunday. fusely illustrated throughout, thus having an additional appeal to sub- scribers who revel in the sensa- tional. Snappy Satire will be made up en- tirely of material censored from the 1919 and 1920 Badger satire sec- tion besides bits excluded from Skyrockets. Editor Taylor prom- ises students and faculty 'twith the greatest conglomeration of scandal, gore and sensationalism ever gath- ered for presentation to the reading public. For two years I have conducted a thorough search for the choicest scandal in the university, declared .Editor Taylor, and I believe I have it. The first issue will be an expose of under co-educational life at Wis- consin, and besides the spicy reade ing matter will contain over one hundred of the choicest scandal pic- tures I have ever analyzed. Booze Hounds! Throw Your Parties At The Bachelor Apartments The Dew Drop Inn Near Lake Mendota-Throw Empties Out Of Window SHOWER BATI-IS We Have Accommodated T. N. E. And The Liberty Badger I I Detective Rudy Blatter Sign With Me l Page 614 Whaf the F1-Osh Are Told fDelta Tau Delta AL ROGERS- What a pleasure this is going to be for good old Delta Tau Delta: The boys wanted me to come up here and talk to you about joining us. To come down to facts, we have a swell bunch of fellows here. Every one of them has great capacity and great ability. just look at the cups on the mantel which we have won. You realize that it takes wonderful men to win things like that, don't you? Some of them are bowling cups and some are basket-ball cups, and some are just plain cups which we use for secret purposes, but they all signify ability of some kind, We think that you are the kind of a man who has ability and capacity, and want you to wear this pledge of ours. It is one of the biggest things in school, and as soon as you put it on, you see how popular you will become. Everybody on the street will speak to you. Did you notice how everyone called me Al when we walked down the street a minute ago? Thats because I'm a Delt. Its the same way with Chick and Russ and I-Iowie and Bill, and all the boys over here. A splendid bunch of boys and the most popular on the hill. You should be flattered to have an offer like this, so heres the pin. qlelta Upsilon BILL DELANEY- Well, old man, wait a second until I shine my shoes and we'll have a good little chat in my room. You have been here about ten minutes now, and have had a good look at our men, so I am going to ask you to wear this pledge pin. By the way, how do you like this new shirt that I have on? Doesn't it go well with my tie? But to get back to the Fraternity, I don't believe you can find 'a better bunch of men than we have here in D. U. Look at I-Iipke for instance,-a big man on the hill, and an athlete, and was a naval aviator in the War. Was a real flyer, did stunts 'n everything. Then we have Stan Gaveney, a remarkable boy, and some billiard player. Stan and I both have that pool-table crease in our trousers, and also, old timer, if you join our club, you'll get in with some of the best girls in school, the Tri Delts, a wonderful collection of girls. When you join a fraternity don't forget the girl side of it. We practically have a lien on all the good girls in school, and you ought to break your neck grabbing this pretty pin I have here for you. CDelta Kappa Epsilon TONY ZULFER- Some place, isn't it? How would you like to call this home while you are in Madison? All you have to do is to wear this pledge pin which I have here for you, and which I know you will do, but just as a matter of policy I'll tell you a few things about the Dekes. You have probably heard how strong we are in the East, but why not look at us right here. Why just look at Fannie Ward, easily the social leader of the university, Fannie has the enviable record of having been out with nearly every girl in school. And Fannie also has a wonderful capacity for a little fellow. Thats why we call him the Liquid Deke . I-le takes care of the social side of this fraternity. As for athletics, I'm not boasting, but look at the facts. I'm captain of the basketball team, and we won three games this year. Also look at Tuts Cram. Tuts would have won at least five if he wasn't ineligible all the time. Turning to scholastics, we haven't many Phi Betes, but brains abound in good old Deke. Roosevelt was a Deke, and Bill F logaus is a Deke. Bill is holding down one of the biggest jobs in school this year-managing inter-fraternity basketball, hes a piano player, and an all-around man fall around Ellaj. Now that I have gone over the chapter and let you into the workings of the fraternity, heres the pin I was talking about, and which you will be crazy to wear. Phi Gamma Delta WHITNEY SEYMOUR- Pardon me, old man, but thats my foot you are stepping on. Won't you have a chair? Well, you've had about ten minutes to look us over, what do you say to wearing our little pledge pin? You won't find a better bunch in school-look at me, for ex- ample! And say, boy, when it comes to grades, join our bunch and you won't have to study. We control the faculty. We control the Kappas, too, but of course thats between me and you. Or, if you don't care about the Kappas, play in the jazz band. We play at all the open houses and get away big, like my feet. Politics, too. The fellows don't all take an interest in school politics, but I can put you across for anything you want, unless I want it myself. Guess we can get along. I-Ieres the pin. Put it on, and come on down and shake hands with some of the fel- lows. IIinmyum-1IininmrinmiuwiiinImmimmmii--rim I I ii-imiiiimiii Hi.. , . 1 I .1 ii.i.....w.........mm,mm ,.....1ii-r......i-Wi. .mri..,..imi.,i.,I..Imi.,...W,.,....i.,...,W... P cz g e 6 I 6 fgheta Delta Chi BOB REWEY- Well, you see it's just this way. You've seen about all there is to see now and we want to slip you the old pledge pin. just take a good look at it. You'll never get a chance like this again. As far as that goes, you don't have to look the bunch over-look at me. l always get away big where noise counts, and what would I have been without old Theta Delt. Listen to me, boy-if you want to get into 'Skull and Crescent' our little pledge pin is a sure pass. Of course all the boys don't part their hair in the middle, and bat high with the Pi Phis as I do, but don't hold that against us. You might visit every fraternity in school, and you'd come back eventually to old Theta Delt anyway, so let's put on the little old button and make you one of the boys. Phi Kappa Sigma HSONNYU RAY- Wasn't that funny tho? But getting serious again-you know I am just naturally funny. just kind of naturally fits in with my looks, I guess. As I was saying: Oh, boy, if you want to be a R. O. T. C. ofhcer, all you have to do is say the word and we will make you one. Don't take the house too serious, we are going to build before it busts. Wasn't that funny? I always keep them laughing. Let me think. What did I ask you up here for? Oh, yes, that reminds me of another funny one I want to tell you while l have something in my head. You see, joke and cap is too much to have on the brain at one time. Now I have it: I want to put this pledge pin on you, and then I will tell you the joke. S. A. E. I-IANK COTFREDSON- fWith the aid of the rest of the chapter in the act of rushing the poor frosh off his feetj- We are mighty glad ,old man, to be able to make you an S, A. E. and we are going to put this little pin on your lapel so that you can show the world that you are pledged to the best there is. Of course you want to know a little about about us and we may be able to tell you a lot of things that haven't come to your attention yet, although by this time we know that you have heard a good deal about us. We go in for everything and generally manage to win a place in all the interfraternity contests somehow or other. You ought to see our bowling and basketball and baseball teams. Then too, the biggest thing in school is the standings you send home to the folks, and you need have no worry about them if you are taking commerce because we get all our commerce men into Beta Gamma Sigma. And socially-well, you should see our parties-we have some humdingers when the faculty will let us. There you are: now don't take it off, because you'll always regret it if you do.'i Sigma Nu DICK EDE- just wait a second until I tell the bunch to quit pounding the piano. You see, everyone is a musician here and since you say you can play, we want you to join. Of course when it comes to real jazz, they all take off their hats to Sigma Nu. Thompson gets all his best men here,'and if you want to improve yourself to perfection, leave it to us. Look at me-l couldn't play at all before I joined Sigma Nu, but being naturally musical I just picked up the old jazz idea around the house, and now l don't have to play second fiddle to any of them. I-Iere's the pin. just wear it under your coat, or carry it around in your pocket for a few days. We want you to try it for a little while to see how you like it. That's the way we get them. Some scheme too. We are quite a loud bunch here. We're always heard on I-Ienry Street. But our noise don't interfere with our studying-we let our neighbors worry about that. Thi Delta Theta I-IERB RICI-IT- Our social committee has announced a dance for next Friday night and we'd like to have you come. Of course to make you one of the crowd we'd like to have you put our little button on and then you would be almost one of us. You know of course that we are the oldest fraternity in school, and-well you have met our fellows and they are O. K. plus. Any- thing you want to do-they'll do it. We can stage a party at Middleton or at the Park with equal success. And the girls all have such a wonderful time at our parties. They get so happy -its the punch in the punch-oh you should see them go home with their hair down their backs. Socially-well what we can't do can't be done. Come over to dinner Sunday night-sure bring her along. And did you ever notice how well our gang is always dressed? Well you see its like this-we don't wear our clothes except when we go to classes and the rest ofthe time we run around in our bath robes. You surely have seen the fellows playing ball out in the street in their robes haven't you? It's a great life and you had better join the gang. innimm-inmwmi mmmjmiummmiu 1I.iiI-1IinimMi.w.4...jI.IIin...iiniI.I..,ii.IIm.mwmmmm Page 617 mmnmmmmumimnmmmmmnummmummnmnvmgmnmnmnungumnummni nmummummmmuummummn u m I lmmummmml um: u nmuumuumnmuu I I n mumnnmmnnummn uunnunuununumimmnmnmuu immm-mm..ummmummmmiummmmmmmmmmimimmimumiuiui--mu n ni-mi. ..r.mm.m.m.m......mi.. i..m.m.m.mm .1 I ' ....mm.........i......mm.,nmmimnmmmmm I .1 I H in 1. in HEMI u I. I I Chi Psi BRAD I-IIGBIE- Some home we have here-what say you? Of course you know it's the best in Madison. And we are known the campus over as the 400 of the fraternities. Our mansion and the superb furnishings and all, and how they do help us socially. Of course you know all about the drag we have with the D. Gfs-on the Q. T. the Psi U's think they have the drag, but they d0n't know us. We'd be awfully glad to take you over and introduce you to the chapter after we put this little pledge button on you. We have sucha good stand in over there that this little pin is all that will be necessary for an introduction. And aside from the purely social end look at what we have done otherwise. 'Al' Spafford and 'Mike' Ramsey are shining lights on the campus and l'm not egotistical in saying that I am known myself, as well as some of the other brothers. Better come and live in the castle with us. But whatever you do, don't pledge Psi U. Psi Upsilon SAM MARSI-IALL- How do you think this would look on your left lapel? Pretty swell, eh? Stand off and let me see how it looks. Ah, you'll do us credit, my boy. What? Now listen here! You can't do any better than make this your home while you are in the University. We need you and you need us. We've gota fine place here and with your ability and talent we can make you one of the leading men in school. just look at our men, compare them with men in other fra- ternities. They may accuse us of snobbishness, but it's only jealousy. We're different than any of the other fraternities around here and we cater to different men. But we don't have to cooper- ate with any other fratemities around school-probably a little with the Sigma Phis and Dekes, and a couple of Alpha Delts-the rest are immaterial to us. Our men are so good that we just push ahead on our own merits. But whatever you do, don't pledge Chi Psi. Kappa Sigma PORTER BROWN- I-Iey! bring in a pledge button for this man 3 I forgot to bring one. We are taking it for granted that you will want to wear it and become one of Scotty Goodnights right hand men. You know Scotty is a Kappa Sig and we just get away with murder around this school. We can do anything we want and while the other fraternities would have their social privileges taken away from them we get by without a murmur. We've got the best athletes in the Frosh class too and they nearly won the basketball tournament for us. And we rival the Betas too for Norwegians with Sundt and Solbra. We take good care of our Frosh and never let anyone run over them. I generally go out with them nights and protect them against unruly upperclassmen or town bums. You should have seen me protect a bunch of them on State street the-other night. And I run freshmen politics in school too. I-low would a class office sound to you? just slip on this little pledge pin and the office is yours. Sigma Phi LARRY HALL- Well, old man, don't you think we are a wonderful bunch? We like you too, and that brings me right to the point. Always go direct to the point in what you have to say, and then say it. All lawyers do. But what I started to say was that the boys have looked you over and you looked pretty good to us, and we want you to put on this little decoration and be one of us. lt isn't becoming in me to say so, but you're mighty lucky to get the chance. It means something to go Sigma Phi. We see to it that every man in the chapter becomes promi- nent, no matter how poor he is. Look what we did for johnny lVIcPherrin, and look what the boys did for me. And that isn't all. We have the strongest drag with the co-eds-but we only fuss the Kappas, and occasionally a Theta or Gamma Phi. Exclusiveness has always been our cardinal principle, so to speak. We always aim to be different. If you come with us you'll be known as an individual, not as one of the mob. We live out in the country to be different. and we always have our Badger picture taken out here with our legs crossed for the same reason. Better let me pin it on, and your future in the University will be assured. m...i.........m.. in in I -r.i.,.ii.m...m. I.. ...Wm Immmmmimwm-nmI-fiinmmm-iimmnimi inmmmmummmummmumI I. mmmmummmii .i..,...,..........E 1...-4 E E E55 E 5532 ENE is 55 E gg EE gf EE Ei. E as EE E E E Es I E E E 2 E Ei EEE as Ei Ei ii E E li is EEE EE Ee ESS EEE EE ga 2 EE ,EE EE EE nu mm E.: n mu nmmmunnunnuz EE .i,..i.......i..,i..mif...mi.........i...,mi..i..ii..ii..i in mi., .. .. ...i..i...i..i.......i.i.i..,... .fi ... .I .. .H I in . P a g e 6 I 8 , ,,.f-1'r 'f-- M, lmii...ii.i in iiilim nur ii iiiI-iiiimmutuiuliii.iiiiiii..imi will i ilu i lim lim iiiwmiiiii iii i i wiiiwiii will iiiiiiiiiiii i .lim il i i ii Huw ii .iii in iliimiiiiiiiiiiiiiiwiiiiwiiiii in in limiwilliniiiiiiiiiwiiiiwiiiwiiii will ii ii ii i i Lf' 5imW..., ..,, Hmmm? .., -W ,... ,....,., '. X. f '. f 1 f , ' C I If ,ff X X l 1 5. -egrep. X A50 X N I , J 1 H 4. I-fa. h X b Ss? T x 4l:U: . l -Z , I ..-f 5 N - 'K'-ii zil.,i :Nfl ff .1 f5'rf'i' ,l , l ,x . , ' 4, i WMI. ,, 5 Zflxll I ,FV 'f'-'v.,f1.4f',i6l,I '- ill IV' ,.'i,g'l',1 ' 4 ' , I ,,i,i.',,,L.,,f',4, ' -- . 'Mi' If, iq , ' 5 f ff ' .if . , '. ,, :z! : fif' i f ,' , . i 4 , ' f f 5 gf- .1-1-. ,. fff:sZT'.4f:41ifig:3'.'xif .'-ja.-, -..' ,ff I 6 , , .i N .,, MIM U. E , , . . Y. H, ,-Aff-w .. , - 'f-,L .. , , . -5 , - ' , ff1.1:f..l' ' . if -9 ' ' i i 73.'i'-'f'.,'f7f '5'1.Emi .K M W- ' fr i 3?Cf ' i :':'f - 1 J. P ' . V Q 5. 2 Q i w 4WZ2+W, ' V ,V - . . V ,I ,,,. . L V, ,. J.v,?,3, I V nl sem-House 2-Wil Mvsusffrefe W7 N 0 R WH y, ' The Way the Betas Do It TIME-Present. PLACE-Christiania, Norway. The Beta hunting ground. Enter King Vlloodward with telephone directory in his hand, and large following ol' Betas. King so named because of his job as Rushing Chairman. l'qING .WCll, boys, there are only about six hundred AGundersons' listed here, but we'll do the best we can. I want each of you to take a telephone directory and call up all the families whose names end in 'son' or 'sen' and ask lor rusheesg then, report tome at the 'Melting pot' within two years. Exit King. Curtain. TIME-One year later, PLACE-BCE3 I-louse. Exterior. Single line of men dressed in skiis and sardine-skin coats. Line beginning at the door of King Woodward's room and ending at Lake and State Streets, Enter King Woodward, rubbing his hands together in Hendish glee, and grinning the grin ol' the conqueror. KING- Bring them up to the den, one at a time. Scene changes to Interior of Woodward's room, King seated in large one-armed chair, twirling an imaginary mustache Millions ol Betas spread hither and yon around him. First ol the line standing meekly before him. KING'.lWh3C'S your name, lad? RUSHEE- l-Ijalmar Skyensonf' KING1'x.YOUF pedigree? RUSHEE-.LAY cam lroom the great familyee ol' Skyensons who first med de skafety match. KING'.'HOXV long will it take you to learn the English languagef' Rusi-ies- About far months, skir KING-'tG0Od, Put on this button, and move your luggage in room 368' RUSHEE A.YBS skir. Ay vill do him. KING Qto followingj- Bring in the next man, They do so, KING-i'What's your name? Rus!-IEE- Olaf Larson. KINCLLDYOUF pedigree? , Rus!-IEE- Ay cam froom das familyee ui' Larsons who var das Furst to catch skardines fur her Royal Highness. de Qveen uf Norway. KING-.-HOW do you like America. , Rusx-:ee- Ay tank him van grand place' KING-AAWCZF this button, and move in room 3139 And so on until the Beta chapter reaches its pre-war strength of9C1 actives and the 400 rooms are fi'le:l King and his Norske Ccurt l. .. M.. ..i,... ,,... i i. 1 , M .,,.. ,,,..,,.,.. ,,.,..,,...... ,,.., l , .,,, , , ,....,. ..,,.,,....,,,,l,,.,.u,l,,.,,. m ..,,. H , . ,.,,,,.,..,,,,,,.,,,,,. ,,,,... , ,.,.. . mn...m:an'::ma::'mr...ll .in .im. mw ai:iirn'm,,li.i.i...i.w....,..,..l,.ii .ill ..l.i..i,iii.i..,i.,..,.li. i .. .ll ...i..i,.,i..l.,i..l.,,..,...i...iiiw..i...i.....l..,i...i.iiw., .. ii , ..ii..,.,...i,....,i. .,.. .Wm ,.l,..,., H W.. H... i. .. . . Page 619 N 1 How the Sororities Do It The following are the official rushing rules of Pan-1-lell, and that's what they sound like: No rushing shall take place previous to the receipt of a l-ligh School diploma. Rushing may take place Monday, 1:09 to 6:02 P. M., Tuesday, 8:41 A. M. to Thursday, 9:68 and any day subsequent to the Day of Rest. There shall be no rushing after 9:68 . . Each sorority shall be limited to one function an hour which shall be filed before September Morn, with the Dean of Women and the President of Pan-l-lell. On the first day the function shall consist of open house. The refreshments shall be limited to a glass of water, rye bread and a pickle. Written bid system shall be used. The bid shall 'be written on pink linen paper in a clear legible hand and only on one side. Invitations may be sent out after 8:01 P. M., june 25th. No chapter members shall be present at these formal occasions as they may influence the rushees for their sorority. After 9:02 P. M. on every day of rushing the sorority is open to guests. Guests will present a permit and references. There shall be no rushing done in public buildings, cloak rooms, Black l-lawk Cave, Maple Bluff, or the bottom of the lake. The observatory may be used, but the big telescope is taboo. No freshman or upper-classman shall be told how to write his name, what day of the month it is, or in any way be helped to register by anyone having the slightest connection with a sorority. No Freshman shall stop all night with any person afflicted with a sorority. To do so may result in their becoming acquainted, which these rules aim to prevent. junior advisors may call on freshmen if they do not wear any insignia and do not reveal the fact that they belong to any sorority. lt will be better in fact if they will try to persuade their prospective pledge not to join any sorority at all. lf a new girl has been traveling for 49 hours, is unaccompanied, and is a total stranger, she may be met at the train if a special permit can be secured from the Dean of Women. Rushees may be called for and taken home. Every precaution must be taken to avoid their knowing where they have been or what they heard or saw. lt is permissible to use taxicabs in going to and from the station. A rushee may have her luggage transported by an auto truck, but they must not be driven by any member of the sorority. These rules shall be binding on all members, both dead and alive. NT - V - I I Q I 'lm ig , I 'lllfyfh . I ge: 'f ll' ' - i , 4 1' F . 6 09 ' 5- Q Ge A 1 ' 5.G.A Rutmes LZ Nm.-- a -sfegn Tl '- A. ' -f e. mmi.BREEZEiiiimiiiiiiiiiii6IRIKiiiiiiiiFiiiiiBiEi ' ' -ini Ti n m m my 'Ei' m m mmm I Page 620 immmmmmim1mimmimmmmmmum.m. m . 1 . mm .m m m m 1 I m ii mmmmlmmmmmmmm-mm .1 mmmmmmmm mmmm S. G. A. QSour Grapes Associalionl War is Hell and so is S. G. A. Here you have our a1tist's conception of it, inspired hy having to hand his girl over to the tender mercies of the landlady at I0 o'clock, just about when she was ready to lay her head on his shoulder and to admit that he was the nicest fel- low on earth. And thus is it always forever taking the joy out of life and hanging crepe wherever Helen B. can drive a nail. No skating after 7:30, no auto riding after 9:00, no telephoning after l0:00, heavy woolen blouses at dances,-what a host of pleasant memories S. G. A. will leave with every co-ed! Pan Hell Rushing Rules and S. G. A. Fussing Rules-all a co-ed needs is a govemess to make her existence ideal. More power to S. G. A.! Barnum was right. Censored! CEditor's Note-These pictures properly belonged in the war section, but they were tabooed by the military censor. 'lhey show ,the Wisconsin spirit from a different angle, and demonstrate the successful application of co-education in military life. Wisconsin Answers the Call to Arms-Sergeant Fred W. Broclda, 'l'5, back from the French front on brief rest leave, demon- strates the affectionate qualities of the French girl, but Lieut. l'lobe Bondi, 'l9, stationed at Camp Zachary Taylor, Louisville, Ky., writes, Why go to France when they outnumber us 2 to I in the good old U. S. A.? OVGI' There Qvgr Here l seeing st. Louis! welll wsu! Wen! Of all the small town stuff! To think these guys would fall for it. Y' see, that girl ain't really with 'em. And theyain't really goin' anywhere. lt'sjustone of those six for a nickel photograph shops, and she gets paid by the hour to have her picture taken with rubes that want to show the folks what they do in the city, b'gosh. Notice the ex- pression on her face. One gets bored when one does it ten hours a day, but the boys are having a good time. They're putting something over on the folks, y'see, and their Chi Psi brethern too. O, did we forget to tell you who they were? Well, that fellow that couldn't find room for his feet is Hank lsaacs, and the one with the grave- yard expression is Bill Goessling. lt's a shame to give you away like this fellows, but you know how it is. We got to 611 up the book. s 111112221!T12!E22!!!L,E2!!22l!!!!1l232' W I ,!l1ElElEI!lI!fI' IIEIKHIIZIEIIQIZII JI!!E21!!5?J!'2iETfT'lTI'......... .2!g'......... Ef!'i 5E V I if .....w.+,..W.-M .,..m..,,.H..w, I 1 P a g e 6 2 2 9 .,.,,,..,,.,,,..,,,.,,..,,,,Y.,Y,,.,,..,Y..YY.,,,.,...,,..,,,,.,.,,.,,,...,.,....,..,..,,,,,,,.,.,.,,....,. nm. .,n. ...mu n.n,., ,.,, n,,..,,,,. ,..,.K. , ,.., , ..Y.,,.,,,i, , ,..1,.,,...,K.,.,.,,,.,,,.,,..,...,..,, , , E W ..,,,...i., ,HMT,Y,,,5515,,gl,,mf3535,555Z,my3,UM351m,,M,f!.H.,l ,..,.. , ,,.,,..,,..,.,,..,,,.,,..,,,,,L..,,.,,..,,,. , ,.1,,.,,,.,,.,,,,,..,,.,,..,,,.,,,,,,.,,...,,,.,,..,,.,.,.,..,...,,,.,,,,,,..,.,,,.,,......,,.,,,.. , ..,..,..,,.,.,...,,,,,..,,.,... W, ,,,,,,,,.,,,.,,,,,,.,,.,,,.,,K,,,..,,..,,,,,...,..,,,,.,..,..... EEE E55 552 22: E55 2,5 ,V EEE EEE E12 SEE sis 1 ESE Badger Emergency Board-Flrst. Last and Only Sesslon EEE - za: :sz sis EE EEE Ei: 5, 535 aes . W , Another Badger Board in Action EE E 55? gEsm.,...........ml.HH.,W.u..,...,...,..,,f.,K..H.,X..Y......H.,...mm,WN.,WW..W.W...,.,..mm.,..,,.m.HW,m..u.m.vmf.,K..U.,Y.,,...mH.Wum.,.mmY..,..H...MWm....mw....,,W.,WW.Ym,H,.,,,HKmW,.,WKm...K..W.um..,..,.,,,.w.,.uH.HW.,um.,.H,..,..,H.,.Hum.,,mm...my,..W.,.....H..,..m.,...,.w.w..,N.HH.,WH,W.N.,W.W,.,,,.,,.w.H.WWmu.,,.....,,.,U.,H....,,.,...,...H.,,..,..,..,W,l.....w..,....,,,,.,...,u..1..wQ5 5,.H...f..,....K..,,HN..um.Y,K.YK.,vm,.m.m.w,w.,..HHYW,H...,,..N.,,..H.M.Vnm.,.,.....,..,H.H.,....H,..,,.,H.H..HnH,...,,Hvmm.,...m,.YH....M..V..W...WY.WWU.H.,in,..W..,,...Y.,,1,,,N1.,un.Amm,K.,W..,WV..Y1.,WHWV.,V..V..W,Y......WH.,,...H.NK..,.1...mm,U.......my.HN..K..,y.,V.,,lm.,,,H,.1,.UK..M.,.H......I.N.UK..U.W,..,K..U.,,.,,...L.,...,,..,.MW..U..,.,......,U.,..4.mm.H,.HUm.,,W...M,..,.....,,,,..,...n..m....,u.,,..,HTum.mu,..n....T 'f..,,.4...,,...f.,..,...mf Page 623 11111111111111111111111111 1111111 11 1 1 11 1 11111111 111 1 11 111 11 1 1111 1 11 111111111 11111 11111111111 1 1 1 1111111111111111 1111111111111 1 111111 1 111111111111111111111111 1111111111111111111111111111111111111111111111111111111111111111111111 1 111111111111111111M1g1j11g11M11l111111111111111111111 11111 11 11 11111111111111111 11111111111 -'EEEMIEZEIGE 1i'E1 1T n'T'E'1 11 11111111'Gii'7M1iEEii1i1RE111111111111111111111111111111111111 1111111 1 111 111 1111 11111111111111 11 1111111111111111111111111111111111111111111 111 11 1111111111 1111 1 1 11 11111111 1 11 11111111111111111 1 1 1 11111111 1111 1 111 1 1 1 I 0 11 ,,,,.mM?lb 6 1 7 5 ' ' 1 ? ? ' ' K - nv ,312 X f. fl . mg! fi' X. mf 1-.ff 1,' . 1 111100 - 11.119, , . 1 ' fl R1 3 '1 'I I lb Dllilllllntulm wil ' 2 1 Q f , n I A LX? - 1 lillllllmlmi 'I , 1 1:-,-V 1' ,,,1mlI Uun ' u1111111I ' -H 1, X -'1 1-21 1 42. 1' II' 111' Alg f f' i f xx p1tl1 'uUlIl'l m lllllllllllllllmml I' XY ' 'fy ! Illllllllllliulllmm ' - IF' ., ,vii . .1 A E4 1 H' 11nH u X 1 -. A. fy . V Ill - uu11nml 1 fee' -f-' qnl 5 11-A 1, 'mglll 11111 1 X 1 wu,,,.11111 'f :rag K0 lb-,'7f'..'+y' ' 1 190 Nw If '21 as 1,111-11111111r1n111l ,,,,111n1111111 1 J- nluwungll ' 'nl'uH,,1I11l1 V -t ,YLW Q ,L n1.m1ul , .'?:ii '??5J' Sf'h - ' .-1-1115 1-1 1-gg 1 ' ' - i 5, 7. , .3 ff : 4 - ,Z F, ,Y --Y.. , -. .. ., . Eff l ,. Nm 5901 .1 ,MM xamg, 4 il, 1: L I : ,N-N x., g x.f K 5T6'li ,Xfi 'Defy'-,l: .,f1., 1 'Deng Wow: -DBDWOIF T gym 0 Iyncxgq gbeuq I o,11,1.,., 15.112 P111 1 -1 I 1111111111 :A X K N X ii Q , ,f 15' Fi H . . 11 ' L N1 if? .g f- ,131 1 - f NJ 'fm vim xv- as fl ' 11' 3511. fi 1' ' 0112 H 'Y 1 131. IIMQX I 1 X1 H6112-LKT5 In W X lf! 11 '11 fafumms 1211! - ' 15f1'11f ':'f 1fi-O2-QQ-1 17 2151 ' , W 1,-1 5, W EH' ,Q- 1111 '1 I 1111111 Q fail' , 1 ffief 1 muligl C7 4111111 7 H 1 1 1 llgilfl IIT? l 1j,1,- 1 1 11 1 1 1,17 . 1 111 I 1111 'HI LM, 1 M MM V1 f EKXMQUX1 l 1' 1 1 1111! ' ' '5 puxugbnmxown 11 1,11 9 ' , , 4 PUCDH f . I I 1 ,N new 9 qmew, 1 -.1 ' I - 5, ' uhmevuoug Ohm' I ml 'li-1 '1,!,i1,!'.L - ,111 Y Ji-:1'3 1.1. 'W V A xx 1 V 5 1: Bob Thompson's Contribution to the Badger 11 111111111111 1 1111111111111 11 11 111 1111111111111111111111 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111ii?ii?1111Iii111111111111111i11ii11i11ii11iNii11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111111111111 111111111111111111111111111111111111 11 11111111111111 111 111111111111111111111111 Page 624 1111111111111111111111111 111111111111111111111111 1111111111111111111111 111 1111111111111 1111111111111111111E Q f Q UNSW Inhad in plowing the the Qrient High Seas Exploits Qflnhad, or the Sailor Letters o an Ag School Goh On board the University Censorship vuvivixvv llluhllvyii I I mvyul illxi liillillll A With furrowed brow he Printed for the first tells of his drag with land last, time the Captain OUR HERO DEER HELEN: I bought a fount an pen often a Jew in our gun crew an I wanted to see if it was any good. That's why I'm writin to you. I didn't think I was goin to like a sai1or's life. I got kind of sick of it the second day out. But it aint so had now that I clon't need a valve in my throat to keep stuff down anymore when I get it swallowed. If the govermunt could only send everybody to sea for three or four days they could save enuf food to win the war. Somethin funny hapened the other day. A fellow wuz talkin about the automobeles an things what would be waitin for him when he got back an he asked me what I had to look forwercl to. I couldnt think of anything but you as we aint got our car yet and so I sez Helen I-Iighwateru. I-Ie looked at me kind of funny and walked This is me in a Harumu ,..,i.,, ..,..1i..,,..,. . ..,. . ,,..,..,,..,..,., ., ,,,....,,.,,,, .. .,,.,.,,.,. I .,,.. ,. . ., ,,.,,..,,.. U .,... .I..II...H...IH.I.HI.,I..I.HI..I.HIHNinW,..,,..i..W..1i.,, P a g e 6 Z 6 mmm 11111111 11111 1 11 111111111111 ML-115.11111111111111 11 1 1 1 1 11 1111 111 1 1 1 1 1 11 1111 11 1111111 111 1 111111111 11 1 1 1 1 3' Home Was Never Like This away. Jelous I guess. Though he aint got no reason to be. I aint sayin that you aint alrite, of course. You kno what I meen. We are in the Orient now Helen. I ast a fellow why they caII it the Orient. I thot maybe it had somethin to do with orioles or somethin. But he said where we come from is the Occidunt an this wuz the Orient. If where we come from is the Occidunt this place here ought to be called the Accidunt. Mabe they didnt name this country after a bird, but there sure are sum birds here. I am sendin you a pictur of one I went to see the other night. Home wuz never like this. You neednt get jelous or nothin cause shes only a I-Iindoo an I wouldnt marry her not bein my equal. The other pictur is me in a Harum. The king of Siam came on board the ship an he gave me a pass to visit his I-Iarum. Thats me with a dishcloth around my head. I had to put on sum kind of She'd Make A Fine Present for the Deltsn I've Seen Lots of Them in Frank's Restaurant if W' I' ' ' H 'J I 'I ' '.lffLf..,..lL.l ' ' ,...........1.......lf1,l.1I,l...III,2fffflfffffff...,.,. E1fff.'ffff...1f.. U ''ff1f2f.f.ffff.fII.,fL.ff.1fffJlff'II fIf.,fJ. nnmnmnnnn 1 I 1 1 111mm rm 11 u1un1m1mmm1mnuuum1u1u n1umum1mnnu mun unnu1m1nl1n 111111 m1mnn1111 nun 1111 lm rw 11 iv 11111111 mmmnmvnmmmvwuumurnunnmmmumnu1 u1nmu1n1n uni u A 1 1 mu 11m1u1n1n1nuu umm 1 :Tn I x n 1 I1 11 1 11 r' Page 627 1111111111111111111111111 11 11111 1111 1 1 111 11 111 11 111111 1111 1111111111111111111111111111111111111111111111111 11111111 111 111111111111111111111111111111 1 11111111111 1 1 1111111111111111111111111 11 111 1 1 11111 11 111111 1 111111111111111111111111 1111 11 1 1111111 1 1111111111111111111111111111111111111111111111111111111111111111111111111111111 111111111111111111 11111 Qg111111FElFii?iW11111111111TTTT3 'T 1? '1i I11111111 111111111EHMIEIGEI11111111111111111111111111111111111111111111111111111111111111111111111 11111111111111111111111111111111111111111111111111111111 1111111111111111111111111111111111111111111111 111111111111111'7HIiiIEiiI '1iT'71111111111111111111111 11 11 1111111111111111111111111111111111111111111111111 111111 1 11111111 111111 1111 111 11111111111111111111111111111F: They call themselves the Kappahs, and are all devvotees of Omar style. I knoo the fellow wuz a king the minit I seen him so I sez to him Aint you the king? an he sez Yes Siam . Well I guess Ill close, the pen seems to be alrite. With kind regards I remain as always, E INBAD. DEER HELEN! I got leave from the Captin an went on shore yesturday. The Captins awful good to me. I'Ie gives me leave to go to more places than I ask for. The last time I asked him for leave he said Take it an go to Hell but I wouldnt take advantage of him that way. It wouldnt be polite for me to go ahead of my superior ofhcer. I visited sum freeks when I wuz on shore. Of corse a freek aint 51 ,, . . . Another thing I went to see wuz a fortune teller 5 1111111.11111 11 111.11111111111111 1 11 11111 11.11 1 1 11 1111 111111111 11. 1 11 111.11111111111111 1 11 111 111 11111.1.111.1.1 11 11111111 11.111111111111111 M111 .11111111111111111111111111111 1111111111111 1111111.1111..111.1111 11111111111 11.1 111111111111 1111 .111 .1 1111111.. 1 1 11. .11 1111. 11.111111111111111 11 111111.11111 1111111 11.11111.11.111.1111.....1111w.11.1.11...1m111age UIIIIIIII ll IIIIIIIHI I4 I II llllll I I IIII H IKIIIIIIK Illl Illl IIII IIIIII llll Ill I I I III I Illllllllllllll Illll I l III IIIII II II III II I Il I I IIlllllllIIIHIIIIIKIIIIIIIIIIIIIIIIIIIHIIIIIIIIIIIIIIIIKIIIIIIIIIII I IVIIIII III II Ill III III I IIII II ll III IVIII III II I llllllllll IIIHIII Il I Illllllllll IIIIIDII Kllllllllll II IIIIIIIIAIIIIIIIIIIIIIIIIIIII IIIIIIIIIIIIIlllIllllllllllIIIIIIIIIIIIIIKIIIIIIIIIIIIIIIIIIIIIIIIIlg: Page 628 -111 1 i i l 1 2 i 5 1 l S i 1 1 1 2 s e s 311111131 1 1 111111111 11 1 1 111111111111111111111 111111111 1 15g11111111u1111111111111111u 11111 11111 11 11111111 111 111 11111u11111111111111111111111111 1 11111111 111111 1 11111 1111 1111 1 11111111 111 1 111111111 1 11 1 111111 1111111111111111111111111111111 11 11111 111 111 1 1 11111 111 111111111111111111111111 1111111111111 111 1 1 11 1 11111 111111111 111111 11111111111111 1 1 1 1111 11111111111111111 1111111111111111111111 11111111111 1111111 1111 1 1 1, 1 , 1 1 H 1 I l ran into Moose Hanson the other day. He wuz up to his old tricks agen nothin noo to me, I ust to see lots of them on the hill back at Wisconsin. Most of them wuz takin law. They aint got no lawyers in the navy, the army took them all to send up in there observashion baloons. If the gas gives out they just start em to argooing. One of these freeks wuz a sword swalower but Id seen lots of them in Franks restrant. The other wuz a snake-charmer. l thot sum of buyin her to bring back to school, She'cl make a fine present for the Delts. l got another pictur of a strange religus sekt, They call themselves the Kappahs. They are all of them devvotees of Omar. He wuz a Persian filosofer before he wuz a cigaret. Though sum of the Kappahs believe in Egyptian deities. Another thing l went to see wuz a fortune teller. She wuz one, alrite. It cost a fortune to see her an then you had to tell her everything she told you. That wuz a pretty deep one. just lil-Le the ocean. l ran into Moose Hanson the other day. He wuz up to his old tricks agen. That boy will come to greef sum day. He'll find a wooman that will fali for him sumtime and the shock will kill him. I see the Frosh have got to put on there green caps agen. Thats a good thing. lmagin a fellow speekin to one of them on the hill lust as tho he wuz speekin to an equal and then findin out he wuz a Frosh. l I seen Chuck Carpenter in Holland. He wuz in Dutch 551111 1 11 11111111111111111111111111111111111111111111111 1 11111111111111111111111 1111111111 1111111111111 1 1111 111111 1 1 1 1111111111111111111111111111111111111111111111111111111111111 1 11 11 1 1111111111111111111111 1111 11111 111111111111111111111111111111111111111 1 1 1111111EMGTliEf2RiG1111111 11111111111111111111111iREiFl7Ei1i111 1111MUlE11111111111111iiHlT TE1 1111111111111 11111M1iiiillT iTT'1TiI1Ti5GR1i1U'1Gili 'FTMif1511111115IMEGEIEI11111111EM11111111iEMiiETi11111 111M5717'7MlWi1RiMG111iiTiH1Tf1T T T 1'TiTTlTEF'E3fTT'E17i3i 111 1 111511111 111 F Page 629 This here Orient is a. grate Place I didnt mind the fall tho. It wuz landing that hurt. One of the fellows ast me if it wuz a soft wood floor. The next day I hit him on the head with a piece of ice. When he got soar I told him to never mind, it wuz soft water, but he got soar anyway. Some fellows are awful unresnable. Yours till the dog-watch barks, INBAD. DEER HELEN: This here Orient is a grate place. When you get oriented. Thats another naughty cal term. I dont expect you to understand it. Idont understand it myself, so how could I expect you too? I seen all kinds of strange sites lately. Im sendin you pic- Well I got to quit now, its four bells. You tell the time on board a ship by bells. When they sounded the call to get up the other morning I herd one of the fellows say somethin about Hells Bells. But I dont think he knos much about geografy. Did I tell you I seen Chuck Carpenter in Holland? He wuz in Dutch. Well I cant go on writin forever. I got somethin better to do. Sleep. They got a sayin on board the ship that if a fellow joins the navy he'll have to swing for it. I didnt kno what they ment till I found out wher I had to sleep. The first night I swang cleer out of the hammok. The Hloor wuz only ate feet below so it didnt take me long to get there. Bain here makes me feel like one of the Arabian Knightsuj I seen all kinds of strange sites lately' want to buy our uniforms frum us and wed have to obey orders: Its agenst the law to sell your uniform. So we kept out of his way. Well, I got to stop. I'll probibly wright to you agen. If I dont forget. l'm awful forgetful. I forgot to say sir when I ast for leave the last time, and the Captin forgot to give me any leave. That wuz the time I got left insted of gettin leave. Are you goin with any other fellos? Tell me if you are INBAD. turs of sum of em. Bein here makes me feel like one of the Arabian Knights. You probibly red about them in history. I aint got much time to rite today. Got an important duty to perform. Got to help swab down the decks. That dont meen playin cards. It meens doin janitor work. I guess the janitors on this ship are all on a strike. But I dont like the idea of bein a strike-breaker. But I been doin valet work for this ship ever since I got on it. We didn't do nothin like that in the S. A. T. C. All we had to do there was keep out of Epsteins way. We wuz afraid hed 1.1H.H.mn--1V..1.1ImiininiH11..1.ww......,.w..i I.miumminniIinmi.ninImmyvmmlwmww Page 630 Are you goin with any other fellows? Ooh la Ia! as the Frenchees say DEER HELEN: This navy aint like the S. A. T. C. The only mast-head we ever seen there wuz the mast-head on the Regimental Eagle. They got a place on board ship they call the crow's nest. It's stuck way up on a telegraf pole an the Captin sends you up there to look for other ships. It aint really a crow's nest, Helen. Thats just a naughty-cal term. We'er havin sum auful hot weather here lately. Im begin.-lin to think the fellow knoo somethin about geografy after all. Yesterday I climbed up into the crow's nest an found two hard boyled eggs. I ast the C. P. O. how they got there. I-Ie sed the ship laid too in the nite. I couldnt figer out eggsactly what he ment but I guess it wuz alrite. I got leave from the Captin to go ashor agen last nite. Me an too other fellows. The Captin gets our leaves from the hall-tree just outside his door. Thats a joke, Helen. If you dont get it I'lI explane next time I rite. I visited a diferent Hindoo last nite. Oo la la, as the Frenchees say. I wore the same dish towel. On my head I mean. An I tied a cuple of curten rings to my ears. A fellow has to be stylish if he wants to get away with the wimin. Besides I needed a hair cut. I'm goin agen tonite if I can get off. But I'm goin to see a diferent one tonite. Variety. - Thats what I like. I get away big with the wimin. Just like Eddie Wise. Its my looks I guess. The C. P. O. sed it must be my looks cause I didnt have any brains. Thats like Eddie Wise two. Well I cant waist any more time writin to you. I got to go see this girl. You aint soar or nothin are you? Yours till the sharks get, INBAD- I cant waist any more time writin to you. I got to go see this girl ..................................................... ... .... ........ .. ...... . ....... ........... .. ... ...... .......... ........ ... .. ... .......... ....................................... ......................................................... .. .. , . . .. . P a g e 6 3 I nwru 1 inn: nu v n nun: nu mum DEER HELEN: I The last time I ast the Captin for leave he tried to , get funny. That made me homesik for the skyroket colem. You know this guy I-Iazzie that rites em? If you dont your probably just as well off. Anyway, the Cap- tain ses Dont you kno that Fall is comin? An I ses what did he mean? an he ses The leaves will soon be gonen. An I ses Yes, but l'm looking forward to Spring . An he ses Yes, but there's goin to be a hard winter in between. I hired a fellow to seranade the last girl I wuz to see. I-Ie played a guitar an I sang for her. But she sed she didnt care much for vocal musik. She sed she heard a Thomas orkestra just outside her window every nite and she liked that much better. I didnt kno there wuz any Thomas orkestra anymore but maybe she didnt mean the Chicago one. I visited another Harum again two. I'm glad l'm sin- gle. If I wuz married just think how hard it would be for my wife to keep me interusted after I got back. An I seen some more freeks two. A tall woman an a short one. I wisht youd show these picturs to Alice Porter- field an Emil Mueller. These might be sum relashion of theres for all I know. I seen a toorist the other day two. You see lots of things when you travel, Helen. Its to bad you have to stay home an remain ignerunt because you dont lern much at school. I kno I didnt, an I went to the Ag school. Except the navy experiunce I got there. That gave me an advantage over these other gobs. The Captin sed so. He sed I belonged to a class by myself. I'd like to rite more, Helen, but if Ido the postage will cost me extree. Not that l'm tite or anything but in these days we ought to cut down any unessary expenses. I hired a fellow to seranade the last girl I wuz to see Cheer up, I-Ielen, the farther apart we are the more I want to see you, INBAD. I visited another Harum-I'm glad I'm single 1 1 1 5 1 s x a x 4 s ll I UllvllrlmllVIImmlvllllllrnHIHIMIIHIHIIALIINVIVLIAII U1 rm mlmlmmnmnlv I'-I : Page 632 .mme 55 5 1 5: E Show this to Emil Mueller emmalummumuwmunnlmmmmmnummmmnmnummmumInumuvuwmmmmmnmm.ummmInwmnlnmwlmmwgwgwwmygygymqmnE555Inumuunnggwunuuu-L53mmuvwggmwwwwgmwgmynnlfu.mm1mmnmummummm1InummunrmmmmllmmlufwInummmvmnumwmwnnu1unmwmwmm.vmmnmuunwInunummI.mumummXmmuuumuumununruwmmmnmumufnmy -ullmlmiilnmm-AHEIEENHHIEMIHnmmmmmuEIiEunmmmmmummmummnmmmmwmmm.1mm.mful1mm,lmInmlmummmrmmummInulumInlnummmnuunmruwmmmmmvunuInvuwIHmvmwnwmlmruwInlmunrmummIHmmf1mm1vmInnl1ul1H.lmunmvm1mm11.41InH.mummmmnm.fmvmluH.1uluInNInlnnmummuuumfnwInnumv-.1myulXH1'minim1.if1.EGENESEE1QDEIIGIMZFMIEH1uwEEElEMEIMYEFugf E E 555 . 15 E E g. fs 52 S nf- ae E -: 5, it X, A -ww . W V SEE 512 is E Es '5 .52 ,Eg E I5 E E ,E- :Eg Show this to Alice PorterHelcl 35 545 E5 Z5 fs is E EE EE is 5- is -E E5 EE 52 sa MHWEEEFEEIEIEEE' E I seen a toorist the other day two E iii 5 515 5 as E Eli :gg sm.,...MNW..lH.,.H.........u,..lW..,...U.,..,...,H.,..U.,H.,..,,Hl..,.,.,..,.,.,..lm...,,..nm.,mf..,...W...W.N,..H.W,..YK..,..m.My.,Y..,,.....,l...,.,.,.,..,,HH.,H.,.H..,l...,...m.....,,.,NK.,U.mu..l..,H.,m,.........K...l.....,....Wlm...,..f..,...,l.,....l.....W,.,.m,mU,fmf..,.H....M..,..,uw.,W.,H.,W......H...,....H...H,W.,...H.,mH.,,..,,.....,l.nW...,H.....u,..,,.,..K..,ml...,..U.,,..u.....,,..,.,..,,...H.,,...,-,,..,.,.,K..,...m.,.....U..W.,..,,,.,...,.,,,.,,.,,,..u5 MillliiiiiliiiiiiiiiGIGIEIEIGIGFIQGIIHIGISSIIJEHHIZIIEEIIZII513711F23iiiiiiliiiiiililEIIZIIGIEIEEii2iiRil?ii1iiliiininiiiEIKIIJIRIISIEEIIRIZJIISiiiiillilliiiliiiiililIliiiiEIIGIQGIIliiiiliIIFZIREIIiEGi1IiliEFSEFITIIGFIZIIIQFQZIISJI11uGiliiIiiiI1IIJIEIiiiiiEI7IHIHIIIISIEEIIIEIHIIIIIIGIIIIIQEEiiiiiiH5111EIZIWISEIIHISIISIIIIIIZEESRIIIEiimfmlli,limmlliiiiliiikiillliiiiiulimi.mlmInNlmWmmmmmmmmmmmmmum.m..n.mmmm.mmmnm.m..u..m.m..um.m.mm....mS Page 633 1 I un I+ in 111Inn:ruxlxulluuxxvimuvluxrmxu if 1 ru ii n mmm: I mmm ' DEER HELEN: l I got your letter. I could read most of it myself. The rest of it I took to a Chineze cook to translait. I-Ie couldn't understand it eether. So I'm savin it till I get home. I hope it wasn't anything very im- portunt, like a wedding announsmunt, or anything. I wuz in China the other day. It wuzn't like I ex- pexted. I didn't see any Iawndrys. Thats all I thaught they did in China. But it aint. I'm sendin you a picture of a Chineze queen. One of the fellos that went ashore with me interdooced her to me. I-Ie said she was Chineze, but I think she was just a regular Alpha Chi in her pajahmas. I didn't have much to say to her, though. Not that she wuznlt allrite. I just cant speek Chineze. I needed an in- terperter cause I didn't kno how to interpert her Thats whut I get for not joinin the Internashunal club when they ast me to. Did I ever tell you about that? One of em saw me wun day when I needed a shave and thaught I was a Bawlsheveek. So he ast me to join rite away. But I told him no, my girl would make me shave, and he wouldn't want me when he saw me with my whiskers off. I dont kno whut made him laff. Thats wun thing I aint seen in my travels. A Bawlsheveek, I meen. I guess this must be a pritty good part of the world. You heer things about the Chineze and there wimin's feet. That Chineze that Ishowed your letter to can talk a little American but he aint never been there. I showed him a pic- tur of Jerry Ochsner in her goulashes. I-Ie sed we aught to be ashamed to treat our wimin that way. I told him we didn't treet em that way, we treeted em at the studio. And I sed we got robbed every time we did it. He ast me if we didn't have no poleeceg You cant make a Chineze understand anything. There like sum wimin I kno. Dont get soar. I didn't say I ment you. I'm sendin you a. picture of a Chineze queen I'm cumin home soon. I ast the Captin if I could be releesed to go back to skool. I-Ie ast me whut skool an I sed Wisconsin, So he sed they wuzn't anything he'd like better than to send me back to Wisconsin. I-Ie went too years to Minnesota and too years to Chicago himself. So you see he appresheates a colledge man, So I'll' he with you soon. Always remember that if you iiaven't got anything else, you have got me, INBAD. A friend of mine met me at the dock .m.m..m. ..w..,i..i...u.... .1....m..,...,...,N....nm...m.....,............., H.. . ....m.... ' 1 in r I I IininummminImhh:IRISIriihiiiiiiiihiiiiiiniiiiiiiiiiihi in M ' in I u I I Page 634 1.111 1mk1I 111111111 1 :ig :ii sg, Els -L i 1 x Ei: 5::.1111111111n11111111111 111 1 .11 M111111111111111111111 1111 1 1 1 I WWW-H 1111 111 1 1111 1 111 111 1111111111 11111111111 1 1111111111111111 1 1 11 1 1 11 11111 1111 11 1111111111 1 1 111 11111111 5 3:3 5 5 E A Els :Ig :is 552 525 E55 5 5 gig .....,. 2 A 1 1 1 gi? SE EE iii 553 EEE E2 ala E25 11111111111111111111111111111111111111111111 111111111111111111111111111111111111111111111 11111 111111111111 11111111111111111 E55 EEE EE EE EE L EE E23 These are pictures of parties we had on the boteu :ag EE 555 51 21 1 DEER HELEN: Q Hooray! l'm in New York. A frend of mine met me at the dock. l'm sendin you his pictur' E The Statchoo of Liberty hadn't changed a bit since I felt. I thaught she had moved to Yoorup. But she l'1adn't. These other pictures are parties we had on the bote. You ncedn't wurry about em. There all men. Except the wimin. But there alrite. They belonged to some soroarity or sumthin. l took in a roof gardin last nite. Or it took me in. l dont kno which. They called it the Alfalfa ESE a s 1 a z 1 1 s 1 a .1, 1 525 There all men. Excent the wiminn 535 Eli E52 EE EE E55 E15 1 1 . .1 1.1111111111 11 11....1.1..1..11.11...11.1 . .. 1 . .. 11 1.1.1..11111..111...u.1..........1..........1..........1...:115 11 1 111111 11 1i'f'i '1 1 11111111 'P iI'I7TG1111111 1 1111111111111111111111111111111111111111111111111111111111111111111111 1 1 11 1 1111 1 1 1 11 1111 1 1111111111111111111111111111111111111111111mm Page 635 335 gunnxnmxu mvnunum uummmmmuumm iv mi umm mmun wummmxmnnmmmnmnumm mmmum wnuin1nuwanruwanumvmmmvnnnu u u ummm w my uwmmmnmmm:ummuumuwummmuunmmm1ruumInnnwinwnmmuwmmnmnmm I1unulwInnuInununwluulummllmmmlllummllmnllmunwllmlumllnmuumllxl u mmummmmmuumurmummnumumml mmmm 1 u uuummummue E2 EE QE EE Er E 52 E E E El E. gl E E 5 E S E E E E E E 2 E E E 5 Ei? if if 5 E : pmm nlrl lllvvlvfvlfvnnrn m llfrlfrvlfillyflf I ylvnflnnvlwlllvlll I iliilllilggg 5 523 if :-- xg 55: I took in a roof garclin last nite Flea Stock Co. But they wuzn't any fleas on them. They feeturecl Stars and Strips. Its funny whear I got all these picturs, aint it? Youd think it wuz funny if you seen whear I got em. I expect to have sum deckorashuns when I hit town. That is, if I can stop off in Milwaukee long :I h A t P 3 I M b I'll th Th t ll th Z i 'enoug on my way. re you goin o rom. am. ay e see you ere. ey e me ey wont sell you a ticket unless you got the Hoo. But if thats the case its goodnight Prom. E5 EE Ei Elf Yours undeseweclly. INBAD. Eli E-E 2:5 5: s E 2: fi E . 2 5 1 , SEQ ss? E sl: 5 . 5 2 is 3 s. E E 3' : in E E ii f is fig sig 'E E E The Statchoo of Liberty hadn't changed a bit since I left Q E 5 5 5 E 555 ..r...... .....,...........,....,............r...-.....................,............. ........,...................................E . num I I u vu nl in u 1 un vmwmmmmmun1 uw uv in mmmmmumw Lummmmuumnuuum ummnuuunuuunw m nw mmm u3waninwmwvuuwwinwInwuwanmmuihimummummu ui w mm1nnmmm1mmnmnnnmmwummumm u 1numnnmnunuInnnimmmmmmmmuunmunnummnn u :nn1umumumummmmmmnmmm Page 636 fyx f? Andi Bits of Shrapnel From No-Man's Land T , .., ,r,-, ..- ., . Ti Mf'7lI1:, - 5 N i ff K 2 W tw ' fi ' Y N' 2 H Qtigqs E 'Q W 'H-X m i., E, X , , ', '1 E X W .f Q' f ggi ' i v. ' 1 f fv 'gi I' , . - Un ' as . ! Y, IU A - . r , ' 9 xx. , if X . Q , E. s ' e B 2 a a rm uwsraumewr or Quarnrv J.. B is CLEAR Ae' A exam. w Q 3 . . HETHER you prefer Puccim or a . . . Irving Berlin, Chopin or Sousa, 8 hiffhbrovv s m honies or lowbrow ra s, ' D Y P 8 , B the Sonora Cvvhich Won highest score for i 9 tone quality at the Panama -Pacific if . si Expositionj will play for you more clearly, Q 9 more expressively and more beautifully 5 than any other phonograph. 5 1 1: B When you hear the Sonora you'11 be H I convinced. . R Prices: 1 ' .850 to 31000 it E Yahr or Lange Drug Co. ggi, i Sonora Distributors ' ii For Wisconsin and Upper Michigon li The Hi hest Class Talking Machine in the World J i Nei' G5 g ii' 'i ' T TGELQFTE 9 .L 'igiilif 5 ,fi 5-vB+B1'-aria 4+ i Q:-f o ' e 'K 1Qf w- N' -'JJ' 1- r Page 638 7500 SHOWERS WITI-I NIED CKEN MIXER MADE ON ORDER OF U. S. War Department FOR Our Boys Over There s J 5 C ll 'V-.ef-f2s?w.'. - ., Mr, '95 0 'Vs A K Z I. 13 - 5 v. 0. , rpg in S Q.. QQ. 'I ZX 55' J. A f. ' 7 ' if I I SQA I We I W 112 125' , Lis' , ,,, ,, , ,vi l l -f f i, V, af 4. , fi. I... A.,. 7 ,:f17! 'L .7 ' ' ' wwf' - X v si! Hoffmann 81 Billings Mfg. Co. Milwaukee, Wis. U. S. A. IFTS for all occasions. The latest novelties for Gifts and House Decorations. Beautiful Pottery, . Hand Wrought Jewelery, Lamps, China, An- tique Furniture at 5 'J O P Sumner Si ramtnn Drugs and Photo Supplies Special department for developing, printing and enlarging Postal Station No. 9 636 State Street MADISON, WIS. Gilexander Kornliauser Madison, Wisconsin The FRENCH SHOP Mns. L. F. I-IADERER, Prop. We make Suits, Gowns, Laces and Stamped and Ready Needle Art Work and Hemstitching 107 W. Milflin St. : Phone Fairchild 543 : Madison, Wis. Ou! of lown Trade solicited. A. D. 8: il. V. Frederickson, General Contractors Pine, Hemlock and Hardwood Lumber Manufaciurcrs of Builders Malerial Madison, Wisconsin HENRY LEWIS Druggist' . 507 State, cor. Gilman N MADISON Keep 51 cool head and warm feet and use Lewis' Vegetable Throat Gargle The Only Thing f271e Store I Cor. State Ahead Sgoblzr 2187.25 anci Dayton YOI.I CAN4 DO BETTER AT HILL'S Coats Suits Dresses Waists Skirts Millinery Lingere, etc. ---- at fpoliular fprfces MADISON PACKING CO. Wholesale and Retail Meats Clubs, Fraternities, Sociclics, Hotels Phone Badger 4920 307 W. johnson St. O. NUSVIG, Gen. Mgr. Page 639 CDiarnoncls, Watches, Sterling Silver, jewelry, Fine Stationery Funde cf- Upmeyer 00. .Jewelers -Mlwaukee Where Qui? ls As Represented Corner Grand Ave. 8: W. Water St. Plankinton Arcade Building ESTABLISHED IBIS af CQQwrtiiaGE3 Qntlenlmfri Qiitrnizrhiirg Quan, MADISON AVENUE COR. FORTV-FOURTH STREET NEW YORK Telephone .Murray Hill 8800 This is a complete Establishment operated continuously for more than One Hundred Years under the same name and still in the control of the Direct Descendants of the Founders We specialize in the Outfitting of Men and Boys from Head to Foot with Garments and Accessories for Every Requirement of Day or Evening Wear Dress, Business, Travel or Sport Illustrated Catalogue on Reguert Uniforms and Personal Equipment for Oflicers in the Service of the United States SOSTON SALES ' OFFICES NEWPORT SALES OFF cis T E svonSvn::1 220 Ecu. A SHOP AT 'U EQIQWQCQPWED o DMDLSUNS BIGGESTAND BUSIESTSYURB' Where your dollar does full Duty, you will find all that is best in WOMENS MISSES and CI-IILDREN'S APPAREL FABRICS and ACCESSORIES Also the largest and most complete assortment of CRETONNES, RUGS and DRAPERI ES IIitIinIin:nmmmmmum Prices are notably moderate M I LLINERY CORSETS General Alumni Association Life Membership Organized alumni work to be of permanent value must be assured of continued adequate support. There is but one way in which this can be assured and that is through endowment. Fifty Dollars Pays life membership in the General Alumni Associa- tion of the University of Wisconsin, without further annual dues and entitles the member to the Alumni Magazine without further payment for life. A Check If you can afford such a membership fmost graduates canj, will you please send a check or a draft or a money order or an express order for that amount payable to the General Alumni Association, care Chas. N. Brown, Treasurer, Alumni Headquarters, room IIS, Historical Library, Madison, Wisconsin. A Note Graduates who prefer to make partial or deferred pay- ments may send a note for S50.00, with interest at cur- rent rates of interest. Payments of 55.00 or more per year and interest can then be made on these notes. Be- come a life member. You will never regret it. Page 640 -1 's figiumgi rm-ga -ga mr f 'f4'uBlEu I lm I. if Ex im' 'E Wa 'se' ' ' 'rin ,lg , A V .4 i 1 ' T E J -- ,Ly Q. - 1, ,flying jg Burdick fi? Murray Co. 17 to 19 .Ma1'n St. Madison's Smartest Shopping Place for WOMENS. MISSES and CHILDRENS WEARING APPAREL DRESS ACCESSORIES STAPLE and FANCY DRY GOODS numnunmwmnmwmu .Newest -Styies De1SencZaZnle Qzafities MOTOR AND DYNAMO REPAIR WORK OUR SPECIALTY ENGINE AND MILL WORK Wisconsin Foundry SZ Machine CO. MADISON, WISCONSIN DYNAMOS AND MOTORS Manufacturers of MINING MACHINERY and EQUIPMENT Ojice and Shops 613-623 EAST MAIN STREET LONG DISTANCE PHONE 64l Foundry 614 628 RAILROAD STREET Park HIHICSOH 622 State Street BILLIARDS, SMOKES. LUNCH, COLD DRINKS fBetter than tlzose you thought tire best ELVE ICE CREAM IFS All Cream Kennedy Dairy Co. 8 641 ACTS are laid before you without the slightest tinge of prejudice, political or otherwise, in The Milwaukee Journal. The editorials are untainted dis- cussions of current events. The Milwaukee Journal is designed to provide you with an accurate account of each day's events rather than to expound the theo- ries of any particular faction. THE MILWAUKEE JOURNAL -- Write-we'll send it to you. + Bean of Men., Stripped For Action-Well, well, well. Dignity varnoose! What see we here? A different man? Child at play? Nope-- just a grown up rnan in one of his lighter and less harmful roles. Does it change your ideas about him? Think as you like, but to us, regardless of what he may wear, or not wear, he is the same char- acter it has been our circumstance to thoroly learn. Scott Holland Goodnight Pg 642 Banking Qlnmfnrt Our completely equipped banking rooms, our Well organized deparments, and the aim of officers and staff to give every de- positor efficient attention- -all these make for your comfort when you bank here. We Want you as a depositor. mank nf 1EIEli5rnn5in First State Bank in the U. S. to join the Federal Reserve System imlahiaun misrnnsin Thirty Years of Leadership! ,.m..rrm.HiffI1.I1.II.1IH1WH-it.HurH.WI..it.Nw.1r.n..H.m.,fm-,I...IMI,.II.II,.II.II.1IK.II.,r..H,H.H.HI.,IV.,,VI,.IIvu..,r..INII.II..H,,mrI.,IH,.1IHII..IHIK.II.1I..I..II.,WWH.H.UVHI.4I.4II.II.IInrWinIIIIHI1-IIHImW.v.mwwwMWrW.HK.,r.11rHu.i.m.mW..u.,,f.l,.,m.W.,,,mm,I1.iH.HV.,.H..,m,,.,I..,.1I..,,.iI,.II..I..I.,HNV.,yr,iHI..II,.I,.II..,HIWinH.H1.11.-i,..mwww. II1,IinurinII1.I..IinIriII.4I.HWinIK..I.1IWI-1inIK.IIHI1HU.IHIIitI1-IinI.1I.1III.I1.I1,IinI..II.II.1I,YIW,..I1.1IitIV.rI1.1itIV.I,1I,.1IK.IH.inII1IIin..iV..IUII.IU,I..I..IH.inI..I.HIUIinIHII..IHIHIH.I1IIHI1.IHII.IIHIuiUII..II.HUII.1inI..Ir.IinIm,.r...W-,r..H-HHI.w.Nw.H.H..r.-HH.I,IK..I.1,..,I,,IV.,...r.,,.yII1.rI.rrVrr.1II.,,.4,1I11.II.,IinI.1,r.rI11rUII.yI1.r.1I,..I1,,I.U.1II..II1Ir1,I...r.m.w.,..W.-in HE Creamery Package Mfg. Company were pioneers in the manufacture and distribution of milk handling machinery and supplies and from a humble beginning thirty years ago have grown until several great manufacturing plants are now re- quired to satisfy the demand for the CP-Master-Built line of ma- chinery for crearneries, cheese factories, ice cream plants and dairies. .I..II.IIHIV.II.1IWI-II1-IHIIrrIHII1.IHIinIK-IIHIV.ImIUIinI.II1.II1.II.1IHI.111.I1..IinIHIV.11-I1niI..I1.11.41Urr11rV.W.-ir.ii..Wv.i,. IV..,..,,m.H..1r.w.m.r..r 1.II..I.w.w.m..u.H.,r II..H..r.w.m.mw.r The Creamery Package Mfg. Company SALES BRANCH OFFICES !Write to nearest onej CHICAGO, 61-67 West Kinzie Street OMAI-IA, 113 South Tenth Street KANSAS CITY, 931 W. Eighth Street PHILADELPHIA, 1907 Market Street MINNEAPOLIS, 318-320 Third Street, N. SAN FRANCISCO, 699 Battery Street NEW YORK, 47 West 34th Street TOLEDO, OHIO, 119 St. fClair Street NVATERLOO, IOWA, 406 Sycamore Street Page 643 Our No. Nineteen X ,Z .L,. VQ' ,f-Af .? 3 li C Machinists, Mill and Railroad 5 3 ..t T - Supplies, and Brass, Copper and Bronze in Sheets, Rods, Wire and Tubes, is used for reference in the Leading bug from CHICAGO B SLY T Engineering Colleges and Institutes of America. Copy on Request CHARLES H. BESLY 82 CO. l 18-120-122-124 North Clinton Street Chicago, Ill., U. S. A. The Stoughton Low Lift All Steel Spreader One Lever for all operations 4 l lllmgifbhsninii Lnvi 'LIFT Shnianben' ' ll K 2 ill- N J . 1,4 . F -.Tu 4 WH e lIlllIll.KI iElTllllll1liTlIllTllll:IITIllIllllll if gg' ' ' ' 4 - -ii,3,1,1,gg-.gl r L ' Cl , .L STRONG SIMPLE EEEICIENT Features:-Steel Frame and Galvanized Steel Sides. A Low Lift Spreader with High Driving Wheels. The Stoughton Roller Apron Feed and large High Speed Beater results in much more even and efficient work than any other Spreader, and with less Horse Power required for doing this work. Write for Descriptive Matter to STGUGHTGN WAGON CG. Stoughton, Wis. Page 644 FIRST SUCCESSFUL PHOTO OF STATE CAPITOL FROM AN AIRPLANE ., .. .,,... . ,,,, .gm I r .,. ,, I L I I 1 7' 'H - 'I 'I . J ,, f, I If 'fx me lr, xj, - is 'fe r ,V 'S , Z. , , L, W, .-L. . . ! K , .I I , I -I - ,H ,F KODAK FINISHING ENLARGING AND COPYING COLOR PHOTOGRAPHY PARTY 82 DANCE PICTURES LARGE AND SMALL GROUPS PORTRAITS IN YOUR HOME I lt IS in the Photographic Lme We do the Best vw f Fw w I F HT I I I I I ei I I I L I3 I J I vi Madison's Premier Photographers PHONE BADGER 7016 THE BEST EQUIPPED PHOTOGRAPHIC PLANT IN WISCQNSIN it G Q Q3 029 Gb GI Q2 Gi' C9 C9 O G1 C C 6 li Page 645 fAdvertisement-Deauthorized and unpaid for by Theta Nu Epsilon, national honorary prohibition societyj f571e Rhyme of the Ancient Drinlcabeer I By Krusophalax Nulopfzsgn, T. N. E. It is an ancient Drinkabeer, And he stoppeth one of three. By the bleary eye and whiskey breath, Now wherefore stopeth thou me? My study desk is open wide, I have lots of work to dog A theme to write and Math, to get. Let go, you dirty stew. I-Ie holds him with his quaking hand, I'm a T. N. quoth he. I-Iold off and haul your drunken freight. Eftsoons his hand dropt he. I-Ie holds him with his bleary stare- The Lonesome Stude stood sti'l, And listens like a Cvamma Phi: The Drinkabeer hath his will. The Lonesome Stude sat on a chair: I-Ie cannot choose but hear, And thus spake on that T. N, E., The pickled Drinkabeer: Were quite a gang around this place, Merely do we drink, Of soda-high and sloe-gin phiz, And stuff that looks like ink. We meet at places west of here Where the beer and whiskeys flow. But when and how we get out there, None but ourselves can know. The reason why we are so shy And keep our actions hidden, Is because, to join our cheerful throng, Is by the Profs, forbidden. The Stude thinks of his study desk, A Phi Bete pledge is heg I-Iis books are calling long and loud, And he sighs regretfully. Before the town was voted dry, For us, this place was heaven, Vv'e used to drink all afternoon And start again at seven. Them were the happy days, my boy, Oh, would that they were here, We never had to go out west In search of Lager Beer. Since this town has gone bone dry, It makes it quite unhandy, To take a bus and go out west For just one drink of brandy. In spite of all the things they do To chase us out of school, We still exist and always will. Sub-rosa is our Rule. And therefore, since the things we do Are always kept well hidden, 'Tis hard to tell if a man belongs. To admit it is forbidden. Full many a big man in this school Is a loyal T. N. E. We've got control of politics, why We run this 'Varsity. You'd be surprised if I should name The men who now do carry That Skull and Crossed Keys pin of ours. On that point let us tarry. But, before I start to name a few, You must before me swear To tell no one that I told you. Now do not tear your hair. Now, first of all, there's Bathhouse Cene, A politician, heg I-Ie can drink his weight in Pilsener, I-Ie swears by T. N. E. The next man who to my mind now comes Is a Phi Delt man named john. I-Ie is rather stout and slow of foot, Many a pound has he put on. And in that same fraternity Is Charlie from the South, I-Ie has found our way the easiest- To live from hand to mouth. A Delta Tau by the name of Bob, Well-known to all who drink. I-Ie wears our pin and drinks our beer. I-Ie must sleep in the sink. And Clarence is a Kappa Sig, ' Was voted in last fall. I-Ie's a husky boy, he can hold a lot, But he tries to drink it all. And well could I thus name a score, Indeed, we're quite a bunch. But, 'twould take all night, I havent time. Moreover, here's a hunch. You can never tell just who is who, So take a tip from Dad: Keep a still tongue in that head of yours, If you don't, you'll wish you had. The Drinkabeer, whose eye is dim, Who has a thirst for more, Is goneg and now the Lonesome Stude Turns toward his study door. He went like one that hath been stewed And is of senses shorn, A sadder and a wiser man. I-Ie rose the morrow morn. Page 646 Not So Bad this Month Now, that's better! It's the nrst time the figures haven't given me a horrid feeling. lf I'd only known sooner about Jell-O and some ofthe other money savers, Fm sure l'd have more dollars now and fewer wrinkles. 'QNOTE-JuSt see the wrinklesj There are a good many young women and older ones too who are wasting money and time making desserts and salads of materials that cost more, require more time and effort than Iell-O does, and then are not half so good. Iell-O is made in six pure fruit flavors: Strawberry, Rasp- berry, Lemon, Orange, Cherry, Chocolate, and sold by all gro- cers at two packages for 25 cents. THE GENESEE PURE Eooo COMPANY, Le Roy, N. Y., and Bridgeburg, Ont. Pg 647 ill' . Q 0 . , . 49 .lv Q , O lllllll fl A Ummm W l. l Q Q O O ly H ,l I6 ll 115 I wr mm!! H l : i ,k,jlhj, v num at A l ,Jyllo I Q is m!r.!Ll, WJllll, f all H lU,U ll.1lfl, Ml..-UHl',',.iV:i,f! ,J l . 21 C u 35551 'dll llfl md, Hmm lm ldlwll , A , 2 E5fi?.e fc l ll, ,,fllll lllgg ql'ml ' l:'l1,lf,rrsllllilm F1'fl'lll 1l'fll l ll'lrI1flfl rpg ++++' M to l:f::iig,llI'?llll?ll illllsfill ll ll pmt lr All lwllllllrllw, lwle lffs5irr'2 Q llll llff-Elllll llllPllillE5:::::1P:' A 1 ll ' list l ,wil A:M I . -:Jr vA ' ,.4 ' A . ,, , A : - 1 A . , lu4wf'fl lg fe A .'l-!iQwllQ l W ,,. 5mif,E,I!gIg':4 llll,,!2QZl,, ..,.,, .lo W ll H r I r lgfsmr!r!!lwtf Afl l Illfl ll lm, H .illlllllililiiffi lf ll ll' fllmluullrllllllllllllllllllll l llll lil ,Q ll ll ' , ll l ll llllfr '-,.,w.- ,N - l -ML ----1-f'- VXNX f' ,, X ll Illllllll 3 255522522522 :::::::::::: lllllllll ll ,N .. IPM !,,A llll Il, -'21, ll 4lllll!,:I,.u 'nil' X IW' WI, -A--'------H ' ,,,,,,,,..,.MJ!j II: t I j L, , H, um!! AMW A K V H,-M., Iuwdwl GraJQ7rf mrlq !Qr'A-J-YcjUoz f1ffez f f Commerclal Ari Service Co., Inc. ' 364'367 Palace Theatre Blcl ' f h 'NILWAUKELWISCONSIN' Paradise Farm Food Products -tj and garden to your table, flavored with all the blended goodness of rain brlng nature s best g1ftS of the orchard l and soil and sunshine. VEGETABLES FRUITS PRESERVES COFFEE TEA CHOCOLATE In Convenient Packages az' Your Grocers Gould, Wells 8a Blackburn Company HAPPINESS and achievement, resting upon a foundation of right living conditions, sum up the finest result of the community development at Kohler, Wisconsin. l-le who toils here hath set his mark. The Kohler spirit of achievement is simply another term for leadership, whether expressed in the form of a modern town or a modern plumbing fixture. Kitchen sink or bath tub, laundry tray or lavatory, a Kohler installation helps to sanitary living and gives life-long satisfaction. KOHLER CO. f KCI-ILER, WIS. Shipping Point: Sheboygan, Wis. AND TWELVE AMERICAN BRANCI-IES llllllllllllllllllllllllllllllllll Illl I l a The F Eirsz' National Bank of Madison, WISCODSIH g No. 144 Ojtcers and E is a United States Depository and a designated Djpecforg depository for postal savings. A. E. PROUDFIT, i Its resources are over four and a half million P'eSldf f 2 dollars, which represents a successful banking FRANIlfiEll1l?r1Z32gll E business of over half a century. FRANIi.W.'HQY1', Q Besides caring for checking accounts, this bank V'Ce-Pfmdenf 2 pays 392, interest on savings accounts and MZ, M- C- CLAH15E,1, g on certificates of deposit which remain a year. as 'M' E It issues drafts and travelers, cheques and offers, M'fE3if,2ZF22,ShiU g in its 'spacious vaults, hre and burglar-proof safe E. BI STEENSLAND g deposit oxes at a nornina renta . I-I. L. MOSELEY 2 It offers you the best of banking facilities which J- B' RAMSAY any of its ofiicers or directors will gladly explain to you. IllllllllllllllllllllllllllllllllllllllllllIIIllllllllIlllllllllllllllllllllllll Page 649 START LIFE RICI-IT The man who makes S5000 and spends 56000 is a failure. The man who earns SIZOO a year and saves 3575 is making a success. Your Future is in your hands. Gur Monthly Saving Plan will give you a cor- rect start on the right road to success. Come in and talk it over CENTRAL WISCQNSIN TRUST C0 iv1Ao1soN af- Wiscoisisiisi Wh Should An one 3oo,ooo 9 , I-Iigh Grade Men Placed With the best concerns in the country. W'e maintain AN INSTITUTION employing a staff of nearly 100 people placing high grade OFFICE, SALES, TECH- NICAL and CLERICAL MEN AND WOIVIEN. Let us market your services LO the best advantage. lt costs nothing to investigate. Tell us what you want and when you want it. Every year we place thousands of graduates and are especially interested in graduates of engineering courses and business admini- stration. Fifteen years at it! Mention the UBADGERH in your reply. Business Menis Clearing House 1408 Republic Building ,IAIVIES O. CRAIG, Pres. :Z State ESI Adams Sts. Burden HIS Frzends with the care of his estate and also expose it to the risks of individual trusteeship, when he can name a responsible Trust Company an unfailing executor and trustee? This Company has wide investing experience, a permanent or- ganization, ample capital, and highly specialized facilities for many sided service. No in- dividual is in a position to af- ford as extensive protection. The Savings Loan EQ Trust Company Ci-iicf-too, itt. C,,,..f,,,, ,,,.,, Surplus .s3o0,0oo Steensland Bldg FELLOWS, We offer for your approval the best obtainable Clothing and Haberdashery ThaL's why we feature FASHION PARK SUITS and OVERCOATS BORSALINO HATS FOWNES GLOVES ARROW SHIRTS and COLLARS INTERWOVEN HOSIERY and COOPERIS UNDERWEAR We're always az' your service Mies 222 State Sf. University Women Have linked The Name of Andelson Bros. with fashionable attire for years, and justly so. Months previous to each season, our buyers comb the eastern markets for just that merchandise which has in its make up those extra hne points which make Andelson Bros. garments recog- nizable at a glance-Fashions latest touches so desired by university women who know correct attire. inummininnnnumminmiimmimmmmumu O4ndelson Bros. The House of Courtesy 19 W. MAIN ST. lVlADlSQNr '-rr'r1--r-Hi'-4'--r--r-' H --4-- n --4'MA1'r--4K--A- M --rii if-xNEsv1LLE We Best place to Buy .. il.,,. ...ml .... W lii,i..m..l..li...i.il., m... .....,. iii.i.mni .... ., N .,,..., . ,i,i,,.,..l. l Capital City Market C. T Courtney, Mgr. 421 State Street - Phone Badger 2905 MADISON, WISCONSIN 17 W Main St. Phone Badger 267 Sulney Thomas plzotograflter MADISON WISCONSIN BOB BRADFORD The Bevo Bum mg to dnve an ambulance in France. Joe wasn t t only one that was foolecl. But this picture shows he r real occupation. Beholcl, Bob Bradford: the original Bevo Bum. age 651 She came here to go to school. She tried the Uni- versity first. She dicln't like that, so she switched to 4C. After that? Rumors, nothing but rumors. joe Sherr said in the Milwaukee Sentinel that she was glo- e The Wisconsin State ournal Madison Printing CQ, Wisconsin vggpsnm STATE JOURNAL BUILDING, ' Corner Carroll and Doty Streets MADISON, WISCONSIN Founded 1839 Paicl Circulation February 1919-14186 Daily .Subscription Rates by Mail Post Paid Daily and Sunday Daily Only 6 . . . . 2.25 6 . . . 2.00 I2 Months ..... 34.50 ! I2 Months ..... 54.00 3 I 25 3 I 00 Delivered by Carrier in City Daily and Sunday I2 cents per Week P I 2 The Wisconsin State Journal, Foremost Progressive Paper in Wisconsin HE. Wisconsin State Journal was founded in l839. It was first known as The Madison Express and issued weekly. It took its present name and was issued daily in l852. It is the second oldest newspaper in the state of Wisconsin. It was the great battle-for-freedom paper in l860 and through the Civil War it was the foremost progressive paper in Wisconsin, fighting then as now for the rights and liberties of humanity. , The Wisconsin State Journal is a thoroughly independent newspaper, devoted to the protection and advancement of broad human interests. It is the leading pro- gressive paper in the state. It is fearless on all issues. lts View point is optimistic, sunny and hopeful. It will not compromise and it can fight. It stood uncompromisingly for this government in the war with Germany as an American newspaper should. It was true to its rich traditions as the American paper for a great American state. It has fearlessly fought for a united American spirit, a united American people, deploring every tendency on the part of citizens to attempt to group themselves together on lines of foreign land affiliations and antecedents, forgetting the common Americanism they professed to cherish when they swore allegiance to our flag which protects them. The Wisconsin State Journal not only publishes the foreign news and the national news which comes into our office over our own leased wire but it attempts to fully report and interpret the state's work centered in the state's capitol, thoroly covering the work of the legislature, the executive and judicial branches of the state's govern- ment as well as the activities of the statels commissions and departments and the great commanding constructive work which our great university is constantly doing. ln addition to all this and to the news of the city, it attempts to review the work in the educational, agricultural and industrial world. And beyond this, it reports the news of all the towns and cities that lie within the wide radius of Madison,s marketing territory. Ninety percent of the foreign advertising that comes into the city of Madison uses the columns of The State journal for the same reason that it is the great advertising medium of Madison merchants,-it is the substantial newspaper of the people, the paper that reaches the peopleg it is the great home newspaper of populous southern Wisconsin. y A newspaper iliai is true is a greater treasure to the people than uncouniecl millions of gold. It is the endless book, the history of ilie world day by clay, the sclzoolmaster of the common people. It is our national glory. - HENRY WARD BEECHER. Page 653 WMM, iwfyy , mlfeiff ,VM , 721 pw! flu JL 'X L ,ff fe Rigger 44 wjfjj 14 4-'LiZ2!Z 1 fat! 7 'fl lui-ij 'duff .iq WZ MQ? 4 -was 35 Jjffliwl Q-t 'Q' 4--1,41 JZMZXW life' ff .,-s f 14042 1-S4 fd a! jd! JAMA 171054 545 XQ M4 fiffw K A if H flL,.,-- Wujvh- ZwfI. fclw l' 1 VM 117-fn Lf fee ff L ff 4 cfs L , Q W M1 is I li WLM VAMJ itz I W fa? ilu ,ff In I ' M A J' f W ILT. -Z ff gem. y 1 2542 - -t 1 -.cc Sq A M .i of A420 7 .W h fe- , 1 . ,7 ' ,gnu 'ZW 11. ,rf l A V71--1744 f' WA! A A ff A 61 .uf-Ll :QAM N K ll GY.: ' ' WT! j f 5Ben Wishnefsky's Romance You'd never suspect our Ben of having a romance, but the Badger isn't the only thing that Ben thinks about. The Spring weather gets him just like it does the rest of us, then Ben has dreams of a home all his own. Forthwith he journeys to Milwaukee and ah, what does he find there? No, were not thinking of those little loads he carries on his hip when he comes back, But of that other load he carries on his lap when he's there. I-lowever, we'll let you-judge for yourself. The evidence is all here. Yours, Ben 'til Ivory Sinks and Ice Freezes in Hell -Margie Page 654 For your p7'C7'I.7.C parties JONES DAIRY FARM Saus age--tender little links or Crisps patties Bacon-broilecl or panned to justthe right turn Ham--fragrant and appetizing' from the green hickory boughs that smoked it Any of these three cooked over a faggot fire uncler the open sky and served on a bread and butter sandwich with a cup of steaming coffee will make your picnic an unequauecl success. MSL Your GTOCG7' f0T JONES DAIRY FARM S ausa ge, Hams, il? acon and Lani ale make our own Ice Cream and Candies Note the Quality We also make frappes and punches to order for parties and banquets BOYD and FICHTEN MADISON, Wls. 426 State St. I9 N. Pinckney St. P 655 Rigid adherence to the Policy of manufacturing only the finest Drawing Materiais Drafting CRoom Equipment SIide RuIes Surveying Instruments and Measuring Tapes Has made our products the Standard of the Engineering World. KEUFFEL 8: ESSER CO. of N. Y. 520 s. Dearborn sf. CHICAGO, ILL. H. G. NETHERWOOD PRINTING CO STATIONERY, OFFICE SUPPLIES JOB PRINTING, COPPER PLATE PRINTING AND ENGRAVING 24 N. CARROL ST. MADISON, WIS P 6 AND AFTER ALL the sparkle and glitter ofthe so called good tinnew is a passing thing, certainly not to be compared to that solid sense of deep and and lasting satisfaction which goes with the knowledge that all is well in spite of any capers of tickle fortune. The ones who are living up to their last eent are skating on 'thin ice. The WISCONSIN NATIONAL BANK MILWAUKEE, WISCONSIN Capital ----- --------- 2,000,000.00 Surplus and Undivided Prolils - - 1,847,I36.82 Deposits ClWarc'h fi, 19191 ----- - fLO,8G5,058.08 OFFICERS A' L. J. PETIT, President I-IERMAN F. WOLF, Vice-Pres. WILLIAM K. ADAMS, Asst. Cashier WALTER KASTEN, Vice-Pres. F. K. MePI-IERSON, Asst. Cashier J. M. I-IAYS, Cashier A. V. D. CLARKSON, Asst. Cashier FRANZ SIEMENS, Asst. Cashier FRED R. SIDLER, Asst. Cashier HERMAN VV. ESKUCHE, Manager Saving Department A. D. K. E.. at Work Heavy Artillery Page 657 Page 658 HWY , : s : 5 :Z :1 - -k-L'-Xmxxxxxxitlxhlx Hrtxsta Photo ngrahers esi es being t e argest organlzatxon IH t e country specxa 1Zll1g in Qlza 1ty 0 ege Ivustrahons andllng over 300 annua s every year inc u mg a arge num er 0 engravings an co or p ates in t IS one We are general artists and engravers Our Large Art Departments create designs and distinctive illustrations, make accurate mechanical wash drawings and turdseye views, retouclx photographs, and speciallze on advertising and catalog iuustrations. Our photographic department is unusauy expert on outside Work and on machinery, Jewelery and general merchandise. We reproduce all kinds of copy in Halftone. Zinc Etching, Ben Day and Three or Four Color Process: in fact, make every kind of original printing plate: also Electrotypes and Nickeltypes by wax' or lead mold process. At your servz'ce-Any t1'me-Anywhere-For Anything in Art, Photography and ..,-1 , ..... ,.... ..,..... mm . ..,.. 3, .. .... -,-:a... Y 3 g Z AA if Q A + ' g B .J . 11 1 . . . h . 1. . . 7. C21 ' ,L ' 1 , ' 14' 1 Is 1 f ' 1 1 1 ' 11' . ' Photoengraving. JAHN Sf QLLIER ENGRAVING Cb. 554 WEST ADAMS STRE ET- CHICAGO Page 659 Hg-'tie Hate? of ttze Hourll epuhlican ouse M11Wauk66 ., W. iSCOI1S1I1 Headquarters for University Students Modern in all of its equipment Cafeteria and A La Carte Service WE SOLICIT YOUR PATRONAGE Alvin anal Herman Kletzsch Milwaukee Drug Company Wholesale Druggists Drugs, Chemical, Patent Medicines, Foreign and Domestic Sundries, Es- sential Oils, Wines and Liquors: : : : : llflichigan and iwilwaulfee pr-o1Srfetors Jeyerson Sis. Wisconsin Gorham Sf- Clayton W. Haswell. Pres. Edwin G. Farness. Secy. on BIDS CO Haswell Furniture Non Incorporated O In P ar n Y WHOLESALE oRocERiEs-PRoDUcE 7716 Home of GOO! Fufnifufe Madison, Wisconsin PHONE BADGER 952 117-119 State Street -:- Madison, Wisconsin Runkel Barber 0 0 9 Drawing Inks, Eternal 1 Writing Ink, Engross- ing Ink, Taurine Mu- cilage, Photo Mounter Paste, Drawing Board Paste, Liquid Pasie. 'fl Ofica Paste, Vegetable Glue, etc. are the finest and best goods of their kind. lll li Emancipate yourself from the use lmllfflflilfilw of corrosive and ill-smelling inks and ' adhesives and adopt the Higgins Inks sx4lllill!Qilrf'!W, and' Adhesives. They will be a reva- 'We lation to you, they are so sweet, clean, .bfi well put up, and withall so e5icient. U ' Al Dealers Generally. ' to fglf'fJj?flf'iMl7'1?',., CHAS. M. HIGGINS Bi CO., Mfrs. U 5l'L'qlM' Branches: Chicago, London 271 Ninth Street Brooklyn, N. Y. Page 660 fCq311e 1919 and 1920 Cgadger Kowide Covers were created by 515112 5Dczvid Molloy Compangf 633 Plymouth Couwt CMCCIQO if algiliiii at 150125 fiisfin Safpg minfis The Personal Writing Machme HIS sturdy six pound typewriter is truly versatile. It adapts itself to your work or social correspondence, and when notin use folds in a desk' drawer or its carrying case. Figure what a timesaver Corona would be for you, in your Work or per- sonalaffairs. Then come in and let us give you the Whole story. Ojqce Specialty Sales Co. 442 E. Wafer Slrcel Milwaukee, Wisconsin The University Co-Operm iive Company LOCAL AGENTS 506 Slate Slrccl Madison, W Va ve Value -50 years ago and today Jenkins Valves have proved themselves every day since they were Iirst made and installed over tifty years ago-their dependability is established. The steady year in and year out service of Jenkins Valves is the result of heavier construction-stronger valves of superior metal. Viuglppky Jenkins Valves are made of Brass, Iron or Cast Steel- zhsr in types and sizes to meet all requirements. ff V' J ' A The Jenkins Diamond Marlin on the body distin- .fii Qfx guishes genuine Jenkins Valves from imitations. Look if X-A, for it-demand it. This Jenkins NO. 20 Catalog Sent on Request ' A It is a 256-page handy catalog of useful information, I descriptive of our comprehensive line. f ss's, Also manufacturers of Mechanical Rubber Goods, in- ' i'--'. gf, i r'iit,.i cluding Jenkins '96 and Jenarco Sheet Packing and Gaskets, Pump Valves and Valve Discs. sg , iifs JENKINS BROS. J -R519 so Wh te sr New York 133 No Seventh st Phiie , ,,.. . .M ---, . 4 - -I . 1 . .... . . ,V . .QA -aff 2- 524 Atlantic Ave.. . .Boston 300 W. Lake St.. . . Chicago .rts JENKINS BROS., Limited Montreal - - - London Danse cle La Orient X S t a n at 1' cl F u 1' 0 m p a n Y Furr1ers 110-112 King St.. at the Square Formerly of 220 E. Main St. ' MADISONQ WISCONSIN FUR COATS ' CAPES -- 'MUFFS We also clo .kemoclefing anal Re15a1'r1'ng ' Turn the page, fellows, you've looked at this long enough Page 663 A word and a valuable suggestion to you regarding The Lost Purple Trostan Calf This Wonderful color, rediscovered by us, and so evident in offi- cers' shoes, boots, puttees and leggings, was during the War emer- gency regulations officially adopted by the Authorities and was the only color tanners were permitted to produce in shoe leathers. lVlan- ufacturers of high grade ladies' and gentlemen's footwear are using Trostan Calf in the Lost Purple Color enabling you to obtain such shoes in nearly every first class retail store. Be Sure to Demand Trostan Calf in Your Shoes To further add to the popularity of this leather and prove its posi- tion as the beauty shade in colored leathers, justified and substan- tiated by its use in the finest shoes, purses, etc., We have made arrangements with the leading manufacturers of high grade leather goods, enabling us to supply you with gentlemen's billfolds or ladies' purses at wholesale prices, as outlined on certificate at bottom of page and will be pleased to have you take advantage of this purchasing privilege. Albert Trostel 81 Sons Company Tanners MILWAUKEE, WISCONSIN I1 M 'Yi E EW EE E' ' E W ,I V Certificate N l ALBERT TROSTEL 8: SONS COMPANY, I MILWAUKEE, WISCONSIN. ' I X Gentlemen:-Enclosed please find S .,...i.... for which please send me l l Gentlemen's unlined billfold de Luxe i Gentlemen's fully lined billfold de Luxe I il Ladies' backstrap hand purse l made from Trostan Calf in the Lost Purple color. ' N H' I ' 62.00 and this certificate entitle you to the unlined billfoldj I C3100 and this certificate entitle you to either the fully lined billfold or the ladies' hand purse,D I I Please mark article desired. I, l I l , L il' Page 66-1 lllllllllllllll llllllllllllllVlllIlllIllllllIllIllllllH1lIlllIIllllllllIlllIllllllVIllllllllIlllllllllllllVllllllllllllllllllllllll llllllllllllll IlllllllllllllIIllIIllIllllllIllllllVlllIlllllllllIllllllllllll!llllllllllllllllllllllll l i C' E ROCK ISLAN D, ILL. ?fYLB'5f?'H fr'XR'E'Zf'Ni cfs' lillIlllllllllillllllllllIlllllllIllIlllllll!llIlllllIllllllIllllllllllIlllllllllllllllllllllll lllllllllllIllllllIllVIHllllIlllllllllIlllIlllllllllIllIllllllilllllUIllllllllPIllIllllllIlH1llIllIllllllIIllllll!llllllllllllllllllllll I l Il Ill Illl l llll l lllll lllllllllllllll Il lll I llllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllll Une of the Largest and Best Known Department Stores in the lVliddle lWest Established in 1870 Specializing Particularly in Misses, Apparel Dress Accessories Dress Fabrics Menfs Hciberdashery llliilllllHIlIIlllllIllillllllIlUIllIllllllIllIlllIlll1llIlllllIlll.lllllHllIllllllIll:IlllllIlllIllH4lIllllllllllllllllllllllllllllllllll illlllill illlllLlllHllI1UIUHlIlllIllllllllllllllllllllIllllllllllllllllllllllilIUIlllIUIlllIllllJIl Illlllllllllllllllllllllllllllllll lIlllllllllllllIllllllllllllllllllllllllllll llllillllllllllHUllllllRilllllIlllIlNlllULllllllflllllllllllllllllllllll. El3FlClE NT siiavica BY MAIL I II At discovery that benefits mankind Two discoveries have added greatly to human welfare. In 1835 Newton originated the vacuum process for con- densing milk with cane sugar to a semi-liquid form. In 1883 I-Iorlick at Racine, Wis., discovered -how to re- duce milk to a dry powder form with extract of rnalted grains, without cane sugar. , This product HORLICK named Malted Milk. CNarne since copied by othersj. Its nutritive value, digestibility and ease of preparation fby simply stirring in Waterj and the fact that it keeps in any clirnate, has proved of much value to mankind as an ideal food-drink from infancy to old age. ' Ask for HORLICK'S-Avoid Imitations. FRA K'S RESTAURAN Phone Badger 887 821 University Ave. i .,i.,,.,,I.,,..,..,.li..,.,..I.....,,r.iKi.i,,,,,,,.,.., N. Open Day anal N1'glzt MX -Q . , 1 X Q Xi , P , , I X A - ,. 5 .fi ' X . Puppy Love? X I , Q' iff 'I ii How the Fresh Species Are Nurtured at Wiscon Page 666 Q 4 I I i nl-f 1 N . L, ,,,,x .,1. .,.. , , IA... ,- pf . , , ,.,..., 3 , ., .,,,. .I -0. .V-f Q 1 x Q52 M444 ,.,, .I. ,I .,.. .f fra ,Ana 3... 4 W X l. A5,,1f.y, qv A mf, f .A-I ,J 4 -'f IKM ' I 9--ww AGM-5 r-if-IA. N Nj-fe W-1 JM-97' + .5 . - 455,19 .aww 4-dh -. az Liv Q.. ff-AHQUQ' ' M- ' J 'A W if-1 .. .L I. 2 ri. 91. 5-I .f,j, '-31.1f2ie- Y' iz' xx... I-'HrI.?'S'i f' G I . -iw a,.. ...N .,! , -I-II-1 he-K i - 1 -. qv .,,, H, .. XL . i ' +I... MH., .rl ., , V..-Im. .Iw,,,, I -J..-.. 1 ,H . ,.I ..- , --.-, .-,-...., - , -. .- ., -. ,- .-. , ., -.13,.,-,f- ,Q I, ,g,I.f, ,ww U M 1 -I-V ' U 'Jm'1u' lT.'15' ,.1Z:,- -'-2: -Z4-I'I'f FTF' I-If '.l-!.'f'.l' -1, R 'ffv-'L-I -I '-...ff-.4,-i.':---lf-a'. -',I'I -'..Iza I- -, Iv jf:-' 5-'5fI.--fr I--'Fl 'K7?i i 'N ' M..I,3.-4-,N-qxyluu, Q. . .I- ---'III .- 5 -'Q 'IQ CLF. '-5 r. fox xx-M--N : :H ef . Q-.,F,. Eg.. .- . .iv 3 -w:'.,5,.,.. 5.:f1.,gZ'aff5Q- M' XI -.iz-' .713 .g.y.Ia:: -L - I-'3 Y 5'ii -lf 3 :- -g,j::: . ,:: ,- If K '-1 '2- ., 11,5 was S.L,'. ., 11'- 'f . v5 .fif ,jf.j.3ig2Qgi'i5 A fi - n - if 2 1 -fi .2- ' 1: 'f-fl.. IN' -I1 .- ' ' I I--' . .-.H fr- '.:,' L' -5 ' ig T' I , . 1, :- 5-Iv., ' -' 'I f I' ' I ' ia M3-A ,-A I -1.-q43j.g1f,j55'Q-15 3 . gig, .I'ffzfQfjfg-2-1jIf'3i.QQ ,4?rQg?i f,.--fg-Q7ifgf'-ff1gfZ'?Qf'.-i-Q55 +,, A' ' Is I ful , , ... , , . . ., .,,, . CH- -, K .Lv--A .LQ .A Q.. -. I, ,, 4-,I:.,,' Hy., X. . hull., , A --vw ,xv ,,,.,,IM,v, V..,M:,,.H..,-,,..V,! 'X l' V ' ., -I ' EA .I 1 X , 4 4 L. .1 'YI' 'I .. If 2 .- N .1 rl. I 4: , .I.-.,,g .,n.I I' -, s..'I-AJ 'vi 1.4. 6 I .-l ...,.,',-. mx -I :fb .L-L' , 1 .. --- ,IE-, . . , . 1 . f ,, ,A M., - -.Q-I, ,Q-,, up -ir 11: ,,--. ,ps +131 - - .41 ,. ,I . ,. I A ,,. ,gv kj, ,, vu, . 1- A ' ., EX. , .,,-I, If 4' I 'I-I. K ---,,1g.Q..,f,,,fIf,f--- 3?-.,I-.-I-..,,IF,,.3I-,,A,-.III.,-IIN-.,gl., V-- T-Ig..i-f W- 31 II g -'s'I9.- ..f,3 .I-H .M I K-I:-., II:-iw.,-. I 4 :'y-- -.-'11 I 1 :mf II.Y:',1c.. 1, 14. 5- - --A ,JU 1,'!1f '1,5-.I -gg-I H .,I- 'l. ' -A - -f.I.1f'I.f-'1-.---Wi --I -F L-51? ful -T ' 2 -kr, -,'.I.-,gig G- . --.--.1,.m.,-,-Iv . ., MI... ..1.. .. ,. -.H+ ,If.....I ., . ..,,..,.,1,.- ,,...f W',,f'1f-i-'1-'- --PID 1--gi?Ili'- ,','II'-EI. :I,'-f':'1aI1 '.pHIV Iff-f3? '. -'ff'-',- 'fQ':g,If-I:,- iffg-'-I-1.1.-'f 5 -iff 'M'- .'3.'L IQLQII-1,1.,-'-,lug-Lf-',,--IQ,-, I' '.I-M1-' 5'f N ?-MII' Z'-RT'fY'f'-1+ 'i-'g'?,:j?'-'r.- '11-i,W'I,g fi,5L..,n,-F 35's-'wr-im-+'f 1Y -I'-f:fIfrf-f. .- -.I-fsw.-'I:.'-I-I:-4'w'I I If.,-if-sf-...W-. -'-If--f-If-IT'--,',I1:,Ii--3 -2--.ff '.-I--L mi.. '- I'-' wi . 1, 'bf .v 1-. '.I,-. Q! QR ,qv is L'-zI',1x.a5-.' -I. -I---.-.WI Ie..-. :.I. rays- II . I- '. Ja- I, - -N' - I. .-4. . I , U--.frm - wI- .-I. -1.--57-..f '-If-. --'-sn:--I ,--I,-I.'-11,3 I'-..'12-,ff-'--Q Q, .Huh 'I I-in ..- E?Tf'w?5.iW9'.'iI.,, 5.I,4.i-1-'1,. 1-,S-fiiififf--'12 4-1' -l:ifyI'f,-I.- 9 :Ni-f fIf'I'2'51,f1'Uf2'-' 15 C- 3-'Z i'If' ':.I K. 'ff ni 'fif-'lil' VL: ff I '-'12-MI. Hdx?,'2-7 '.. 1 -,.q,fQ1-- Wifi if-f-, f'j?5.,3,fjgI..: ,Lugz-,+-.tk 3.55.-fx-75-'4 .4 .- iq.-1: -I.--ny---I1fs.Q,-' -nl,-12-f.-.-.e III.-,I j,II'f.g1. .-9-gy I- -I,-.-gj',--'f'1'I-.- -,, I. gag -f,IfI-.,3f- I ,- ,, :'- -,'I4f..5:.'I ,- 'JI ,-'ra T' I -I:P.r'I,,'.-' , '.-'-1'gI '-3I--f'f,-:-'f---'.-.Pr-I-N' -I '. ,ff T'--.I I- -. 1. I .1--. - -W I-.-1'-e f.' . - 55,iE?kEK1'f leif.7-its--i'-IfL-sf1'::'-5'J'I.nf :wif-- :'-lrfifi .Q ff 1' WN 7: 'Ir fi'-65+- .'2'K -'fI'. IF,'.i v' ai'..,'QI, .-'SJ-5.'T'I? F I'.L--'IIZQI-ML' . .532'I'?. .ff--Illff. Q-JH? ' f'PI '.?f? :I 47 I'lII.'.'A h'-5' 19,- YV F1-'frfifffy 47 '-f'I? -'IW' f--- ...'-...rw 1-IW-Q--ff-x.I.'Il f. -ffm .'r-'hw I+- I-f f -1'-q..-ff-I -.O,:Iy.-'1f..'--11--, -.N-5' -'I-V .M--,-.'-rd: ng. F55 -'cam-. Eff''iii-''NIw.I:lf:-wif'-'L'IHWT-5J1.3'41'? f'5FL'I.L -Mffir fp.::,-2 'ff-'f Q TL 'f '2-L-- 'I WWI V '. ,Q I--- I--'NI' F'x1I-'I , 'T1k' I1I'-- -t'--'Al-I', -- '--'I 'JJf' Im ',-i'. -- -3 -,Za I K 'II - I7 UI . . -.-.fu 1I 'f Ir .- f- F I'-wr 'fi J... -H' -' .- 'I45i.QIg.l.- IIJII'-. 'yi QI f'.'1:, '-- .' L - -.--'I-..'f.'II:--.14-g If--JH--I - Q',I...',f.', -I-':',---If-1-I .1-f5II?.-Rf: - ,--'J--:-rf,-I,..I - .Q71I-R5 '- Wkf' H- -I -. 2-V .yn '. .f '-'----,,i--'MIL I-'-:'1.'-3. 'C-I -'L-1----1 II -g:'Lf'I5--'.V',HI'a.--N1-.qi I- ',z-.'I.-Q-r,Tf 'fl . ' Y-xt -:....-- ',:',.L,,..I-I. --XLHIW-I Ig:-.-.vi ,Y.I-,75-1. jQ I ,.-,,I'I.I5. ',.Q..- -'I'-ixgf..-.1 x H -'F EJ, I.1-,,'3..v.,u4IA I.I .I V., jf.. 3,1 -Qc-,p I-Q: Quiz: lp- -1 J-I-...N ggi... 5, Tay..-a,IJ :,,g4:,.. -5-r-.,.g,,!,.' '. 5.f,'.' '-I. I ,I --,, ,- :IQ 1 I' '- 1 ,5 I I- -3 - .w?3-,,,..--I,,f,-,,'I.,,-5,.5,:.,f .- . -3: ...M A4,,,.5,..5 1-IQ5.f-U ,w ,,.,.N.:-g,,I..-- -pg. .N 7 Q.-,--,. -.inI-.',,x.-'.,,,,I,.-A., .,I-.., 6,-, y,f5,--.-,,.c.,M.,.g.,, IH, ,.- - M' 1 mg 4 I jf ' Us--,I .q----XLQ.-.W ,-In '-,-.IV-.. :PQ-. '.-- 'f-'I X..3'I.--.H .1 1 1.5.x --.-.ff -I .I:I- R.--, .Q..5,,. :'IJ..I-, Vw -I --I :-'- T.. -- --'-- M1 M.5'..?Mv,.:-:I,,,Ig ,q , I , 1, I' ,MII 5 1, NS... ,, Af' Q f. I- -I ', ..4. .,.. M... ,. ,, ' .', ,M F .,,f , .5 ,. If, , , , v-12'-Q,-'-. .,-.. - J' Y II' A. , rv : ,DX-f-'TIQ I'- I Jr:j::. ICT, 7.5.1 -.Mg 2NiI',lh1 1 -'iv Lf l.3,5, A:'2Ig'II,,i. YIi'IgI'f 'IU-:gf-Ii-5. x3:5I-JI,':,. - Lf 'J-',:-5Q IfH---,f', '-'fin' 1.4 'g 7-IE?FpIIQ.fQ', I' - - ' - 4 ,f . 1 .H 4 N- . 1 . .1... , I 1: .., .MIA ,IJ Q-.H .,., .I wi . .x-, ,I..,. IV- .fI -f..1.... , HI. 4- -,,,, -1 , --r...IgI-Q. .- i' . A f .1 3 -1 v 1 3 fy' IU, -4.1 'aQw,'R'S3 ' A ?gSf?jL'-was - 4-.1.?g:vI',,4l -QW M .4-.-,x 7-J 've P Pr- F qw' If Q1 7 um-A Nw K. .Mm .. 3, - ,V J' 1+ M' ' J . f x - 11.,,, I ..1 - -I ' I if-,igrsj - 3-Y lb ,h b I, .:- :mf I A. A . .5-H.. NI.: g..7,l:,,.m :ily-1,IA,.b,if - 'Im . 2. - ,q , I... '1,1...m -. ,IZ T3-. 7 gi W in rg 4 I -. x 1 'lt Y If., , . 1 A .- fvxf' R e m: X .T Q Y. rx , tw' .f W A I I 5 . AN NA I ,MI -.. , --H 51 ,I .- . Q . 'f , Lf x X AN 1 .Q N. I I 1- 0 ,guy 1, R11 ,L Mx- 1 -1 wb .1 Irv Lwf ' . I' . wm gh IM. 'xl ' 'If X I N 5 vb, 4' JXIYL. ILWR.-' Q' -j. I 45-a 1 nf Y N w S. ' C ,x ' ' 1' A N W B V . +5 'J J r I' . ml -. X . 'KUUQ1 .v ..,. . .- 1. f ., Ii I .,l . Y 4 . 1 ax, -.K . Ei -1, N- , 5, I',. .- ' ,f ., I f PI 1. .1 A 1 . A 1 ff' Q' xx- IMD I5 I '?' 'I' ' V Q V 1-91 lu. I ' Q n I . . I ,, -Q II, A , y' X :Q J -I X , J ' 1. Q. . -nr 9.13-5 -M Iq!1fxI,,,, -K X xl ,W , . , V. 1.-' - ' L .. A-. I -,I .M-X ,l , I: , W if , ag Ig..-'LI' MI...-. 0 I.-T , -,.-,vii ,..ii:n.lvIy ' 'I ,. - -I ,- ', A -, --H--, ' 'f,.-'tv-.LQ 'f. i -I 3.- Eff, :II,-:QTY 'J' , ' iff ff fl' -E 2 'f J1. '.1 . -. 1 1 ..., iff 7 .ifxzhxb . ., 2 .- su f ln 14 1 w Alf -Wi . ... ...'f'-ff '3'3X:.-,.'i' , , V. ,,My..x',:5, - - '21 u .Q,',-.,-i.'1I-:X-.,IaI1 L f- .H , 2 .-.I.I.::1. e-' I 11.,.J..Ib.--I1..-P- If I Qin., .':-'..I-x,--.iI.:- ff bit I I. .. I .. ' x 4 . .N-.'I - IQ--ff u, .I1 -IH.-,..I. ,-.I . -A TL., Ir-II-,vi 'f2ff,.5.r . I1 - , .- x.I ,--.f.'..I ,,- - . . 1 , . , I , , .f I 1 , ,I I -I,-Ie,.TI --.1-wx--I. . x . I . . w I . I A . . NI I. r., , .-.R-,,...,.. :, , W HWS f 1 - . W. - , I 5' ' N fy f ,Jn I II L' A 15' T ,NL f 4 ,. 'L 'gg-'-H. ,-II..-.,,,..v--,xfme . .x x , ,ft A K Iv , .I ,, 1 Ji.. . l , , 72 K I X, f 1 1 , 9- Y 41. f J H ww- , I-.A sy., -, .M Iv--.-,,,v,9!k, L' If . I 'I . ' X J f f I 0 Y ' w ' ! ' 1 K P I ' Y , ff-if 5'y.L?f'f12 'i'.-1276 N25 cn I N. x f X If A . . f J ' A 1 K.: - Q I I- 1 . 4 - 4-X -,ig 3,--g., yi-.f-.-g-,-QvgffQ.,I,,Il5,--.-A. ' ' , - , - I' .. -' - . ,, . .- I -I. . ' - -- 'I, I1 I 3.I:f1fQ:1 I11'f..z.fM- X X A -11 f v X . .t 1, A xl ,Jn f t I, J A qx U My Ju, 4, X , ,H I ju'-H: si.. N, , Y gU.'g,, 15.3 . , , . . . , . 15-,g :,I , .qw ,P . 1. ' - N H 'j ' 1 ' -A 'H I - I. ' lg v' I .1 . T' .1-,..-M, EIA--,,.ff!4',f--.ages-11-rf x. 1 1 1+ J' A, . N J , 4 I l. Y , , , I ,H .. . .XJ W., . ,-,, mn, ,..k-,,f 3 ' JI' ' 1 ' 'a' N9 N ' . 1 , 4 ' - I T . . ,' . 1 ' A -a N. .. . , ' I.,. x W.. 4. D- Ig'-I--A J mg. '--.1 'QV . A . - II I I- 1 , . I A, Hu., . - R - Y v I 57. ,. . ,, U , .. :,...9-5 . gi- -f,.,. ,Lg--, 1'--13 -1-,.., -i-M , ., 6 - I '- -- A, I- . -----X -- I -. - I- I'1-- - '- ' -I '- qv. -. z.-.f-'-. F, I 'Jf fu---N -f ff --'Ir:f- 'ff-I-' -Is- I. L - - ---- ---. :iI- 1 -3, - X . - ,- .1-'.f.,I ' - .' 4- .-1 -,-:---: c.a- Yi --.nf II-af N-,ILM-.-I III: 1 , F-. iq... ., .J---Y . .. s ,,x. .. v. , ,., ,. wwf - .JI ., .. 1.-X I . ,-,M K AI, ggq5,I-fy,,-.,.,,,I-.4Ag.,.!-.A,'.A af, .I -. 1 . I ' I V ,I ,..-, - -NIA- ' , 1, .Q I A c , f f ll A Y, I .,7- f . V ,,VfV12::,AP,: I. fjflhclbvtg,-1: ' ' ' I- I. A , .W . .V - ..-,, H , .IM , fr., X ...i-M,..I,,I, ..-,II-. I,--, , 32?--Ig.pf:I nc'.+i3.IT' AVI-'.'T 'L - -.au-I-IIgs fx -I .-.fmzf I-: I .5 1 ,, A ., U- .,-,- .If 4. .. ,I If .,I.'1, .-my 'q.1K-.gr -I .,-,,, ,-, -kg fy. .9 ,. v. K. 1. . . 51 ., -I. .I.. , I ,-.I.-- -I . ,,.f . .,. I I' r x. .4 .f..I.. - I ,I , ,. II ., -I .,, ,-,, .-. .. ,--fp...- . X . I , f - I1 ' I '- I 1- . ' ' '- - -.ff 2 - .ia :I Q-:-.im-. ' ,K . -FI J -4, I -'- - 1 fl V - Y . w . ..I- I,, 1 ,J . .M . .-gg, NJN -,dir-,VJK1 W, ,. - . N , Q.. M , . . N . . I A , - N I .,. -I., ,gk .5 Ig, ..--V,-4 , , fs-msn ,g, L -V x I ' ' 4... ., f . - . , .. 4 '- 'I -- --5--:'--inf.--If-1-Ig , . I--.,-P f--'ing' .I A-.rv - . N H A J .- ' ' Iv I' -1,5--f-I: I 3 - ' . . ,I L.- . -, ..: , . .- I.: I-I In Y , .-, I, Y - - j.I.-- ,V ,. :I I, Ig- .Ig-W -, x' V, 5 X Y ,J ' J '. Q' ' I .Fw E' ' -J -.-1 ,'-I' ,-Lb' .-'H-'. ':,.'l3ZQI.-..T, 'I gFtI, 3 '?'1,J.'y '?l?, :'.fy.,-''1'1.'. . . x.,.f+ . ..!, ., X I- , , ' Q1 .- I 5-x - 1- --.X ' - , , ,I . 4- , ,, .II-,fy V -1'--jg .,3ig.3IIj',.,1, rg15?-jf-Q.,-,,'.jAg-.-gfg,.i1,M54 . . 0. 1 ' 1 . Y ., . N I . . If f . ' I . 1 .rj 'I ,, I ff. 2-Q -.113 , X vw ,, X I-I fb- ' ' , I'. . . 3- .--1.- 3-5 4 I I,--RI J-I ,.'. ' I.. -', , I , -' .QQ I 1 L - Q v ,, .1 , , If-I if hw 1-Qglw 6,I-19.112-'g., I gi? 427 w . I I I, f , .-l , if-.::.z2.' - :..f. I 1 ' ' I .. U: - 'IL' 32 -- :if L.. if Y . , , Y In 5 A , .11 ' . R ' I 1 g f I i , ' ' ' L ' ' 1 f...!1,I--. .5 ,QM :I .I3fF,I.I ,.i-- 3-, ..::2v.'L,lw ' , A ' A ',, Q 1 - N .' , . . 4 , M, I I, fx ,RI IQ I, X , ,, 7 j 'jQ A-f-:xi Q I-A I f -2 '- 'J'.! ,, ,iw--I R ,N . ji--gf I.-.g,',r ' 'I. . nn M .I . ,, . -f.'-in -Q., ,I ..I,4.-'..j--I -..-wyf, --,EW I I. ith Q-tv I-5 gw- - -nl, N M F '- ' ' ' 'f ' ' f ' , ' I Q' c firm. .4 Ive, ,L I g W' YJ ' . + . 1 'f 1 -I 1' ,'-.4-1-.,. I.Iw.-.ff-'.,., ,- -. . . . , , , 3, ,. .,I,,-- -,x , - , . -I . x x if . N W I H , .fr 3. -, -,.,f'S.-f, 'I . , --5, -,,I1,:: . , A . Q , K f -5. -V NI ,x - I l, w L . . I .A 'Z-l, :X '..,.A, ,M-L,,'3l, ,313-'E-L55-u:HI!F Y 7 I 4 - ' ' H U . ' . N X' x X 7 'IR K - - -T573-2 x' 1I.?,3f 'Gf -3g?'f.Ti4:i YW,-'+'i','-- .CS A , , f -1 . .1 f A , If-5 . .II 7 ' 4:-. 1,5 I,-fy, 1 L, .,- M-I-,j..Q1?.f , H 2 I .I I ' ' I I ' I ' ' . 1 . f I . - 1 :Y g . , . . . .Ir ---uw ., - . Im.. 'i,'I.Iq-1..zf--'--I-.1II-. . 1 ,, . . H . . . Ig , ..1-4 . L - L H I ' , 'L , , f f' 1-a-I - 'f If ..-2 ' Q . '-fN: .'-ug!-I-.-, I I , , . ,Q , , I ' I - 1 - ,I A- 1- I- .Pg . H., ,H-, .- y:-.,,.g....v7,' . f f ,I I' 'W I 1 ' I1' I 'V' . A 'v I 1 3 ,- I7,1-1,155.b-'jfeiyX-f,pfv,.u .5 , L H x al Xa nu 4 me You , av ff 1 1 un ,I I --1-dx .--V - Iugfj,-..gI,,9.-.I,gq fi...uF,x5u . . I . 4 1, 4 1 I I I., ,, .-.:',f-, -- I.,..,I.:,QJ-'.1,Z.'-2-. f.,-.':-N' ,- K . R I I I x , 4 X ' J , X I . 5 ch - - 5:51-,,, ,3'a-,fr Iv:--Ir IIx.-1-,.-ge.--.. I W L I P 'NI '1'-- - If I 1 ' -'T '7 r -G'-'1'3'H.'1'. v - 4 1. . , A ' W . , , I .' N df, -,'.' .Y ,' ,ik w f . I I . . A ., I- , ,w H1g.,I,y.k-I: -fy .,..-5 J.,5.3,,.-Iga.-.,,--,I.,, B x I I , 3 .. - . .1 - . . ' . . Q -JM 5515: ,TI I 7411.5-1. R . 3 f -TI 'qi-nf, ,I?,,-1-.FINQ rf ,, I 1 ' . , ' I 11 I K I' Ing . Ng-f.g'Q4'q,-.,:7 4.3 54234-- ' Q n f ' .1 I 4 X ' I I f . -11? .'-XI? 'If ' VM I--N -,.-aff? I 1 L I 4 L 1 ' I , zfII,'-,X5'.l4-Ik W --LM. 'j--3 15 . , I 4 ' . . I Y F ' ,Q -J If ' -'I . :--. ',l-IF.ifI-fl3j,-'71'Jf'I,Ii15J.,.'f'- . 1 . . ' J 4. 1 I C.:-:I :IT-3-' :,:-us 4 ' N ' 9 5' N 'I f- W. 51-'ag '- I IJ. -I ', J . I .. - , , . ' ' . ' A ' - J., ' '-' N f I if A -- Q-'Gif M R 'T . f ' 'L ,A L r N ' ag N, X K ' Q ,.gif152-15 ,',. y, , I ,x, - , , I x - ' ' , I I, ' f , ' , ' -1, , I-I1j'I.. ,.f7.,!?F'f'If iy?Il:'7fTFfLf'-X: 3.18 up f .V .fy . , , II x , ga A14 , 4 I . x I 1 I, ' ' -4 , I. 5-r I ,,..3-,-1gq.gF1.'51I.I1-5914.-, f- 'f x K I ' X A x ' .Y , 3 I 1 . 11 f Wi. ' ':.L'.'--YQZIIITIJIQH'.7577 I f 'L .. I . K 5' 1 '1 I 4 ' I R' , 1 14 ,, Z.-j:f3EiT'Z,-56' ' -I 4 x- 1 .5' , 1' Q I J , N ' 4 .ll I f- w W ul fs 1 4 U , V I' 4 -Sh-3 52.5-i'.f---.2 ,' , x 'J ' U . ' I -K . ' ' .I 4 , 1 X I ' Vw . 4 A I I- S f S f If I 1 5 X1 . Xu- 1 'Mx J L , . Q - . f 1 .. , 1 , 4 r w r 1 r . g 1 4 . 4 f x I A W I , A ,. ' V-w .,. I I . Q -M . ,v 1. -, . - .' , , W x-f-I J- ' , ' f ,- I f -' - I - . J -...f.. sf1I, I 5---'I -. ..,,,. I,. f I .., ' , - ---4 -. '. v..-.. . r1g....r , 1. .- TK-. I ' .I- f.. .1 .' -I M- I -1- - ,fx 'A' X .- - -'I ' 1 I 4 . .1 . . , G I. - . M 1r,gy,fI'L..w..,q.-,-3-.. -xl -1 -'gg I Q5-Af- - - ,Q 1 .. 'iff -, , Ir 1 Q, '21-J: ', 71.1, :jI-,,- -L I I1 ,Ln 47,1-'x-1 gh. -'-'-If Q IA ' , 'f y-','. jf 34-y.,f5:fI'- 4 ylijl, , -. -Q, -TQ ' - 'ig ., IQ T5 -r' ' 3 11 -I ,I 'I ' yr ' ' Q 'B :II . yriflgf' ,- - I. . -A-N-FI -Z IT ---1,.o-- I 0.1. IRAQ -I . . - . I . I -- - I I- I -gr -3., ' -' -F-1 7,'CI...'1F:' . ,II' ,111 ', t:I,-N , .,,g,'.1:.-I I '--'.i:,-E-5, -Q --,if if .-if QM' I. 4- j J .'1'f:'I ' -'-' .I-pf ' '.1 2 - 11, .? If L, - .11 3g,Q,iivQg.:e ?5lf?L. 5 . F: 7,,3i1.,- 'El,?:::-gfvulysi ?-,,Ty.',. lI..'l.- i,.3., Ei, :Xi .,. ., .T4:l ,.t:3,.. -. .J .:L........1 , It :xl F II, h I, -L 'V ., Z.. .5 Q. 11, -QL :I -bi.. :TIE -WEFIZ-l.:U.,:5:.Y Ii-'N!fi4y-22:--EM -' Q : -I--, I - 4'-I'-JI' ' - ,WIFI 1.1 f- . , WF -, I- -I ,- ,. LH?-.'.I'-',-f--' 45. S,.'--54. gxyfgju.-'7'3ZZI!ij I . fi, S2:5j11lQL.42I'1--QW-5-L-ig?-'1..--f:3'...: 1 ff-15 -if 'Q-'A:'21.:I J 34'-Mg 'lfgl 'Q 1' ff- ' -if H- wp -Y I 5 L.:-fb, '-'ff --3 , :i,.gI' ,7S':.fJ'?f-5 . Firiil-'GgLITCa'iQvis-f5Il-5'3,I:342f'-ff-T j:7I'Il ,Iik'Ie-'-ig, -I'-lm-I-.-' ,':,.-r.--1,1 5. ' -f X107 ,': , .- -x .bw ,xi -qf, : .5-54 -wqjcfrli A J-:a '!Ll1 I,-I..15,,-,j, g?'i,f,if 61?-MSA:Ig-f2:'f.-'..-JE'I '.-, .- ,g .,,..I .. mi., -1 I, ..: -2.-yr, Z,.,,,.,,-1 I, H Q- ,-Ig-T',-.Mn-II.,-.a' :i3??,-gjg , ',v,'l52-l2'5Qff,jii!'1-,VFX-f1l wi,-if -lf'--Eif. .' if-'3, 'ff 5IIf5':fiQLf-EI V -ff -'IT-'I' -Wi-V-F-- 5 ' 'Ai-I LI' '.-- 3-5',-1 --.f---ffMf,'4f '- Y ', ' I ---. 'f'f Q'-r--' M' - Iui-T fir 1',?-'Wil-J-fl- f'5f3f7'3.Z 'J-3 '575IQ jffTf'75'igfigf fiii'- 3 -- . -. . :J , 1'f-1,QXg,-,-,wg-.3 ,. -- fir:-rf'-:VI-:N,?, w gr2.IW-P-3gIf,:l73Ig1?'J-,iI2g -,I'-i'.v--fi'.fs'-1','ii-.',-'If-1:-, -ff W.-'.293-'g.-'f'.5 f:f' C-Hi. -Zim-f'I'-'I,3Ia -Ig. '1--, ,I'.'.F,--.I' 'If I J11'If'.'1t - .r':'I?-f' f1..'-'I-LI'-INI -QI'.Iff- XI-T-191337' 3 ffifti-Fifi Q-EH- I'.J.'QEf?f 2w1' 'f5'H.-ii' L-?1f.i':'i T,I'5-:Tl, 'fi lsi' ij Q U 'FF 1: L?- 5 1 - II T 7 TL -I 'rg 4- Q ILT- Tk, ,-T41-Wg?-5 5'- nf'V'QflI'i T1 A -JQEQ,-Qjffgj5:ff-GLX'Iff7'iT?.1'.3fp-2 ff'- 'f:. Q 'ggi I df- Wt'-'5'fl2.5-.T.'Yf.'i-'zjf?-.QI QQ.. I'-SQ -I1 '31 T S'f' If,-' ' 1 'QQ ig NJ, Q 5:-FQ-.' , Q 5 - .. 1 I QQ. 1 I.1.ggQ1' X- 'IIfbi---f.:Q5gi.'J--4:.rl.f, 1- f-K.-:If:,,4.T?,'f'-'Y'.'.-II-L---Im yi-5.-i 'Q-?.'w rw If gffiwi-Q-f--'.i,i-.11-sp:-I f..-111.2-I5- -Qi .I 'll x :flf.if+g f '-f , -I 1- 2:5-4--2 fm. -fffr. mf-fl'iE'f-SIIFEI-41I'ff-1iQ.f:5!i 1f1i4-'I4-29 1'g'L'Iz.f --iff: --T :-f1'- ff -- -2 f--I L., .swf ' Ti- 5 - J' -f - - I '-.IT - ,:? .' I-. If ' '41, 9 liz -1:-- .fm 415: - e..:,--49, gal-5,-.:.,, .,If -,,weIf:55fgm'-'ifizl' .- 'iy',fIf,R:1-1' 'ij ' ff. 4. F -II I Nj-fry, ,I In. I- 1. .' ,IK fy 'ii if: Ig' .I-3:-,Lg V- . 4. iw' JT' gi -PK 5 ,'2f5,f' Aj,-c, 31,- -SLIy-.-..j.I1-411,fir?-,.-g,, -v3..,'-xvQI--.- .wifi-g s.IgAI.-.C-, ma y ,pg-g.f 1'.I,.d.,Af-.,-'I--3.- 5. 1-. ---I. - -- . .,.I.,:1af- '- -.-MIA-I I- ..,I:..:r,:. -1.-.Jr-.1 I.----M.. ,I -5 '11-.-,,f-..I.i--.Iw 3-IH-v,.I-affe- 5-5.jgHVI-..A.v,. .,, ., ,,,, 5.551 .5-,,1:-M,q'.U.!5fw,.,I.,,-,g- .-5-55,1 5,-,pi-.-,, --,-,i,-.1-.Q--Q.. 7,-, 1--J, Ia- ,Ag -Mfg:-.-,W . -.-K 3 .,1I!I- T, .Iv ,Qu 5.-,I .1-L I., .1--.ku ,Q nm.. ,IRL-',j:11:'ff'5, f5I55Y-9,3 Ib- .'?HY,,. -,.5,,,-,q,vgI,5g:-.',I:yt1-,IJW. rv In ,'-p:gg.'?IgMs-- -if 4- .Ia ,j1bfI'-'q- A 9' ,jililyff-ik-I-V1 53, .1I,,'?, .QI .4--,L 1 J,zf:.-1.4: ,Qj??mII'.I. A... ,I'fI:. . .Ip ,'IIj.,gQ1. 1.-il' - if---4.-X' ,Q.-:Ig , .-,I.iI,II 'KI .-11522-3423-:I. ' ,I'i,,-':'?75!ff 'T -1 ..:.'.!L,'-fi:-'QIf4'1'-an'af-,212-,f-g7,'53i.Zj I --'MII'-I.G'I ' Im- --,-.A-w,-.-4-:fix 41-ali-'31-1 :':IP'f'-1.-e-aff-I-',.f---I.-.MII' .1-Q-7--.xr 'wr --.'-If-I5-1-I-L-.fI,1'f'-L'-I-''Igiwf I. m - '-I-,-if-I ' -1 1-'wf , If:-. -' - x--I. .I I - - ' ' 91+ ' f ' L-- ': .- .-I Ig. ' , ,-2 -I I . ,. -. 13- I.,L-:- IM- ' my-ig' ',-ag :- Lvri'-- -if-Q.f1'f-.' 1 -1 f'-.3 A-f?-3'.-1' a-f3f'I-' f -'Q'I.su ' 1 21 I gIf-'QA-S,g,-,'.fIIz 4E'f,'S's,5.QS'-,s2--Inxc.-avi J, I-'-e.xu:F- i '7,:3'I ::,,--I-KI.:-wg'z--Qs-, we--.'1 I,. 1 3- 'f 3 :If7x,::--,, fv.'-II:.Z.f-,, I, '- - - L 1.1:-1--U, -I YI J ,' .. qw '. ,, --I . -ALI-1-wx 'J-' ,, .I '.-2, 4 3 14 H . 4 .T--f,,,','A. 'I fa- sf .vI5.g'v -'--IIE NE--I-Q I-9 ...-fm...--.S,I4Ufv, jr W. XA. -, .,.. 4,-.-, ..,. ,, MM. . - , f- . -,--,.I,.. ,., ,,. .I,I,,,. .,.I.,I-,-1-.I-, .- HA, .. ,I., AI, ,, ,I 5., .4 gf ,, gl.,-,,.., .XI M, W,,,,.y,., .,, -,,,,,,, wI'I f:I'g: W-III'--1- ''-I-I-'-if-r-vi' PI--ffm'--1-'-1-I'IIpf-- -'---f - - '53,--s': - 'Y--sir -fe H +--e'T'.--W g 1' Wwfff- -I5-P.1595'I-asf .---:JI fa?-'iii-,M 1- -51-I .,.-'...p- tif. If 4' -.I-'I'--.Wifi-T-.-. In--gli . df -Q ' : -bg..-,I: -2:1 'ep .-5,5-g22vg:.f':'?3Ij E .LI I 2qe'12..1 ' f'f4gg-'g-pgii,.'+.Iy,: 'I :fn lux- ,I,q'e-'ff .4 xg'-'gffa'-'Q-1----5-.,g-inQI:If--,'f-V -'Ivg-W-' 'W qv'-. 1j1' -1'-1' --'Lf f -I' '- -fx, .-'- 4- 3 W.-S' ' -5' ' '-:'.-4-'-1 Iff.:,I-.'4-':-795 'JH-I.:5 .12'g::e1--5'-nib -J. :I':II1:--:-- '- . i. V'5-I'-ul. Ia ' p .If A - we .2 1. I ' 'LBJ '- F . - - -IL '21 7 ' .,.- 2- Y -.'-1 . ' ' i.':f '-,E--II'1SLI-'f-1,-5 xl HI- 'I fm-'f1,:a12:5e - ' Q -:rm.-Irfgieffa.-,:.1 -9.04-I.I,,I-.-'fi..zZI if-..':-,-3fpf1. ,-II.-12IIIf4?I?-,-,.1f..r-.- 1--I9.46-::, 91.-1--'I-III?-.g'-fWFT- .sf-.-11.--:fi--rg ,Q-. .'.'ggf.71,'1.-9'5 -I 1-f et L-.I-,ffzf -H yQ:.-LE fI43L?fi:I-iff' -yi-----,'n1 lr fy!--I-. p,S--.': N '-'-'I -ff',',i.MI--,M-'Rt ' A--X':7f'f'. 'f wry -1,55-'I-5'--2-.3-7 '--QFII-' F-.P '- V i--J--'Z' -I--i-iawff 'M'--I . rr' ', WY- 5-101212 L'--I, .5Q., Nr' w.-wr I- I.,-..,- f- :-. -,.---.:1.,.,.,. .,II ., .,f , ,gy . E ., eg , .. ,,-. -- ,-1 J ,. I -. --1. -:. -L - Q., ,. I-. Ig ,fI IW II ,Is--J , - .gm -qxfgq-..I.,-5 -,.,. . , .,,,.X-.dj :Wy--...I 111-Z.wgg:iE,-,,n-':-J.. , ' .5--i'5'Q'f'Tc1.3If.1.gd FL -7j.glIgi:1,I' I- w a.-I 'Q- 1:fI,Iv,6:I' -- 535152-gpg-4-IKfI11f.'r5-E'5daQq--'-41541,..- 3 l,I'.g's.I1-P-IW 5..,iQiI.W-H16--f -- XI I.:-,b+Le-.-'SW '1 4 -ESQQQ'-,:1..,Z'.Y', I- 4-244--,I . ..El-N,-,-.-,.,.5. aa. ,I..-,f7., Q..-g.. ,,.,-,.-:I. V-1.15, ,5.., 3 .Q--5'.I.:I'IF-.W I w I..,.3-, AMI - .,f,Y'.--I1--u:,',,.L,.-I. ki--5.1-.,I ' r, mm - mx- I- ,jx 1.2! -'--f-f.'qE'4-I-'2' I'1 'I, -'Si' 4' - - I-'hri-II .':- W -2 ,I,n . , , ,,-., ,. ,,, - .,.. -. , ,. .--- -. Q-,.-I . -,.,.-.. -f. I- -. ., - --- ...Q--H. -, I---,II -..- f .,1..-X -I -5-f-.I- ,-..I. ..1.., ,1.-- -I -.W mf I 1 -I-.r-6 I--.JII---. -r--II--I ..-.-1!,,.7'.,.I '7 . I RL 4 .I Q. I- I,,I1----- T-.Iv JI' -.. cf I IJ'-, ,. -.l,. .1 4 1.s.I. . , .. -. -,,.--4 ,,... -K.-If ...JI .Q -.-5. -. -,-,F -.-a,1.-I.- -A-, .. ..,,I-- av I-W.. ,-..- w .., y., . .,,.,.., V- 1 ., -, ,- ..,I f. .- I,.,.,gI IIJ, -I, I ,I I,-- h. w Ig K .l ,, ,-, yt- -.pb -X 6- . X Q, . .- ,II-Mm ,,f.:-.Wx - ,.,-, ,... I ,. 1. -.Q If .Q ....,,..-....gI.II1 1-,-----5-5-5,--,L I. .J-.Ira. .f3M..-287-gf -. -- -I. -..-, - 1a-iw 'wp --', ., I -.,e .I 'MI-.I -yy ax A If- -f I. .a-- -,-,-'., 1: A-z I- -q.I-N 7: -.Q 'I . f----f. : .. 41 -..-,I .Q .U ,.,i..,.,,H 55, -I, .:.....1Lnfx JM. ,ygz --F Z ,Wy .,. y, . ,.r,- ,M L-7, .5 H' - I' 'I v- QU..-. A HI M yi ... I. N43 ,.. 5 -wx ., Q... ,lj H... . -I M,VmI,,.,-, ,,AI.,3..,.,.q5 ,- '1 JwI,.XN:,f,t-:-A .v P 3'-fjkfza. Y:-f.'IX..,,2?-4:-. 'L'.?,.E,' A '-.f1cUI- .1 , I., I-:YI -1- -1. ....f-., .-I., .I 1:.f.- 2 1----'--Z., .JC .CI 1-..:'Y .-II.. -6-53 -rf. 2 .-BI .-I--3 I2H:-I,i'-'k'xz'-,X'- QF1-11-ff... ,W-5? '-mi'f'I-'. 11-- i',p'?.g-I-1-eI,':4pgFs 341-f1 -.4-,.ff'-.I-y-fifl--1, -.5,-4-:5gQpQg,a .--sl-fe:-X1g,1.I3+3,-'.I!..--ff,iz:-X1g'c-gKg.,Z?-T'f-1- --3, ..-:,:g+.-5'-,-5,5151.1l.i..,.-.1: S'gf:5-4.1.34-.31-7 1. :-gmkk ,,g.i3I:.-1 .g.-,gf-.3y.-4 -.-5,519 ff- M-1 -L..j-x-,.L,--n,f.fg5,'- :N- ' .1-F5 5 .II'f..w,.'..-111523 -4, .L.5gz,IIg5,i.-4nr3.f-53'9.31.ijJ ,-.-if :Q - f --. 51 mfmy 1 . 1551- 5,1- Q L I- g IV N' Ig I. .gy ff- -5 ,I-1.-. gg .1-, Q q-zgf.-5-,gif -fp,g3-.IW-,zfgb ,-L..3q,'-.-:--:'..-,Y . .r.. uf.. gwyjgzf--IT.plb. f'--,g,,i.x Xi. I ,x . IL-.I . T U. A I' Q.. .A,.'-:.1f- L-fi'1'I- -' , -. ' .-- f 'fi' S- x.I - -fm I. ,I'.' i -:'1- N. . 1- HJ: -J.,.f--- Uk. , i-i1I.-,.-.-..'e-- -.fsf wi: - ':'v'--.-- ' .--I 'J :Y-H I' , 1 ' ff ..-.,f'f.- .,,f , - HM' f,g-1-'-?f,,III .:g- 15 . I.,. A N-5-,559-- .II .'--H .I -I .A ---'., -- a. I-ww-Q .-r --QL - l-- I .wzsl 'W'Vi-'f?.'V'19-'4'1i3Y-5 'I''L'-2---T-ff-3-i1.f.1iIH I'fS1ff.?Pim1'--'ZW-'F'..- Q-95-ff' LI. -II.-5-I--W W.--'sw'1--75---5.-.:-F4'5.g'5,-.WI5. r'-.ff-5,.bffff-1:1-.'2'Q'2.'I.rS---if '3M'1iIx g-.Is1QL?M117.4157-'!'i!'f3't 11,-5.1.9 fag,141-.gQ'.4Ll'.Bagg-5.-im-. QW., -vm ,Sk-r 551-1, f:j'n:'-fp,-:I -12,5 5gQ..IHsi.'-2 'Ar .:.1:,x1341-vs:-:nx5y7g,J,II', 1-,LI -eg K1 K- I' Q,-Q Q.:-3 5.1, .3 -.. -,Q gn 4, i- :k 511, L,-7 U --gy,- 'r,'--i f'X,j?,J fig..-Q4 -Is, fm. 1-.QL , NI: ..-t5..f,mlz,p,Q.gI...,-1,,5,, if K.-1 ,.--3,-y.l,v1r-L,-, --V-I 9- ig,,I:.gI-7--:.,. -35 '. I ',4L-h-. .ra e::'.q,n,.- 1- -M' .:, , .1 , I--.1 . -. M 5-I.-in Q, Igxv- fl, .gy . J- 5- -.3.,, ., wg, -.. , f.,. 1 M...-7 1,-5-gr, .,.. -.L-,, ,, , . .-,,I.-,,-.LII 1-9 V.,----1,-.-,-,5-,, ----Q-I.---.uf--M a I?r1I,I,-W...--..,f .1-NIV-1 .mn 1- II 1- .I J, ., Ii I. I. .- - f- wg, : --,-'Iv- -IN --. -I-.III---If- I-.I,I,.,1---I-.m -I1 I , I-- :,-- ---I '--1.-..'-:M :g,g-II3.-ay--,f.17,w 5 g f-I+. ,gl .fl-gg--.,..-.,..W, 'Q--:.,.I :.-.545 . Ig-I-.E-g..S25I-.4,' 2-.Q --5 ,pf 2,-.2 45-4.-1121 -3, vI1.,:'-,r.--g.'gg-:.' f,' g,Ilg'1,ISg,f 13'-.4 -fr,---:,,q ---..:!5.-1.ggr- 'egg.,'Ia,4g--,? I-rf..-I -' . ' JI- Ing.-.--' I Ju FW-1-:2?iI'e'-I ,.FR?.f'91:f2fg.NrfgJ-.MQz-SxiIg---I-2:gif-' jf- ff31.5552--f-if-.f-Q-'-7--.if 'hifi-inf. -5122-Ir,'Ili'-iv-'--ig:1.3-WPSLQI-'ysn-'mi-gk-I7f,,rfS'1+2''A 'if--LW - Q I,-Ig:-fsnifif:-we-MSFI.-5? zz, ,mil-fI,-1-.'I.f5I.-,ff-.S1'rf.ii-L, 'k,.-, ,?..1.J'vI,l4--- 4' .f.+ -my. ., -I J-E,--3 .xggjgiki 75 ' 3+ f .-. A. 3 -gpg 'QI'-.fr '- ,. .I 'Q-. Q' 2,771 bw, ,-57,51-PI-ig.. .2 ....,I'Fv .MIL 1, Ii. ' v'7I:.'g--3.1 ' ' 4,3-I 3:4 17:7 N , IQ.--97 :,'I.-I-' III. gf --Q. Ir-A-I-,-Ii..-'SPH:Ig-.-' - -15-,j..,.f. Wg.,---rf '1 1-IQ'-,,..-5 pg1'I1.,- ,Q sw:-gzf fm: -.f7:'f- If-.4 .I-IV --.,-I 1. 2-avr'--J -I 4- - ,-- 13' I zz -.SV .'mg--A- r',1 -- 2' I-'e' - .-H':.,:,4 .my Q., - 1!Iu.4b1.f- '?1-? Liz- -,'I'f- -, 'I 2 ,Mm-'Ik-I-, g- ,,.---V' I H rf.. , -. r J ' .I IIY53u?7E-54'--:.f'..-.fm Zsfiffx-3-5f.?Jifj?ea.3Q,9-1?-3'WP-if' S.1'sf-1514-WeI1-ff-2--f--PM-- '.??if:.1'--IW-2 H--W 'T-.I39- IQ-ffWi375I2-'31zif? 5541-5:-4'yr-r,?I'.gI.eIi'f-'gfgg-iw.Igim-Q5.5,-.ff-sm :gs ff1 I v,fEtL-fkf',ff ','::Q K, f -I. - ,if'3-235u1f.- .af-2' 1fs'-fLff'3'.!I.,F15j-'f :.-',, ,fir ,. -, r., Q-.1 -1+ f-. , '. , 1'I:..'5- ,Q uni. 1---1, , M- . . 1 .ig -1-'f-P -e sh gI'E.:-lgiar. J ?11:,j,.--?I'fg-,uf .wsu--+.a:p.g.:F-2135-52,mi-I.. .wwf-5 II.-ef--,pfIg.,-In-jp--EIx,,fd-z,I-'.,1I-5--1.-.efa-IAFEW-sis.gay.. i..f?.gs- .1-51:-.vi-f. 9,1-Q.,-H'-..,f 'Y gIIy:,f12-.qfv -: 4 .5-wr' :LI. I- - -41? -'1 --'Ki I, ITM-IE---1.''ff-1-Ir.I'fTf '--.,I .'. -,-1:'.',, - -' I-vw -J-I-'g1-,'q-24.34A'-4g f----,U-.1.I':g'gf-,I --1:-1: :f , , - Wm -1- ,:, f'-Af, S.'i'QveiIQ1x.b?iii-- Im.: If-II-Qi,iiafiai-rV.1,f.g:ms15 gr- gf g.5.5j3q!iQ1IA-if f 'ggI-jQ1.ge5-J-T.:,f13a-cw--ff,.,-.,g::4.I2:f-I-E.-gy'ug .f'a.-fiwxinfiggf?-7-'im'95.:-ji'-fig'I--'Z-::-'aiig--.5I'Q:rf'g-nf? :-::'11-Tsis.qf7ff-Ig-751 1' -' r,-f.-a'.I ffl, -Engijm'-' 1-Z2 VM 1' , .w'.'-.Ty -. ,I--5.1, -..:.f:'-,LIP I-rII.II-g'i-, 1' 'ul 'f 4.I 45.23. -n '- - ga--I1 ' VI.-.ru I-'--I, EI 4 'QI' .IL-.. J -.'-.3--9.14 ,I .3--,-, vii'-Il '-1T.-,if'Q-Qz-',,L2'fs.- ,:11'fIgI '. ' I!-..-,j : '.' I .- . I11..,! .- 'I' ,32giI,,,-Q ,--a .1Q.3.34.5-EEIE1.--gggplgizzf -,gt 5'.QF1 ,HL-' gg-5-.f,.-Xi-'I .,I-,.I-I---..,.1.,5 . M71- . 9 5.1-1I.-Q..-,,.I -Q33-.,.Q.,.1g-MII .g,1'Pz.f,.-'w J.z:f.,.s-fNi,---.-if-M-1.91,-,5-f,-9.',,,3,,.,I-,413-.,..IK 1 .,L,9-HQVI.--I5H-3,.,-47.5.1 f. SE1Qw?22-If-ggfz'-- '-. W.-gf?-3,54-14,..f3'g-Z5?1rg.i gk- - . .Q 3- g . ,, , - , . 5 I 11-2: Em 3. ,V , , . ,,g. - ,z I - . h I 3.31.1-: Q-I.1,.:ggq,wf 131, 1-4 5-f-QI.--a,'.II.f---a4,I,.l',-',-I,',:h ,ag 1...-., 1-.2g 'Zdf::'?II1 -I ' -I I .. -. JI- - , f -' . - .- . xi- 1- .1 ' '- 1 1-' . 1 I f '. , -. - QI .Qi-'Q-'QL'.11-4- I-I lv-4-f I-,' .',-I,-Iyff' ----avr:-. -.TJ 1 . --wg.-Eg-6.-QI-.1-f-I-.P-A. . L - , - I - ' I Q I - '. - I '-.Q I I- -f ,IJ--uv .I-xr-. ,,--, ,I4g1,.:..Iw! - I ,,.,,,II-. -- .-.- -y.----I -, ,I ., ,, I-L , .., - ag- - .,, , - .. , QI- ,A qu -I , I, : I .- qv: .- '57, ,KJV-.x-' - 4-1 A.,rg--541-jfaw UU -Q ,gn-.MII--: . ,-I:h.g,! 4-:A -,nr-A. ..--1.3. 2.1. ' W -mf-L: .yms-N If 414. 55. - 11.-5 ' L----ff-3, ,,-,e..: 'H--.35-,f 11-,Y-I--I-5.5 ,-vII,: 3 .4-qs:-., in' IN. '211 'L1..2- -2:1 :JPQ 9-' 95 'QI V,-,','1g', ., -. 1-.WI-,: .vfL-:- -I Mr' .-f'v -Mrs! -1'-'-.-.--UC I-IA..-. ,- , I-4. L -,QNX-.-'4-Je.:5'-5.I..-'e-y-r,:6.cq.f:- -.I--4 4-'I-1.f----Iwi-I-II-In w--fn-If ,-I-'W' .-.-a'Iw..u-II-.-Ipw-Ff:'..'.-'n..-- WI 1--1-'3:z.----PILiI.:,I1--1'--. I X - Lv.:--. 2-I wfi - . 1 - KI r' . 'I '- I- -- '.-.-I..--1 I I iw.1-if-+.193rI': -if K- FIX V. ',,'+-LW.,-i i?i1U lk- ' J.-1.HIWLSE-224'-.f,1,-,MI-'gtt'If?y-fpi.-' L-11-Ig.11:,f,.,:kl: I,,-'QW TE'-ix 4,-.1-WK. - 1 uh-4- '. H--119.1 ' 'EF-gff,IJ, ?'21JI?'11'!x-.I-I--g' 25-fi ,- J'2-Ju'--1:...fu-f.. '.f..I-.fl IQLIZ If .F---5 -- 1' I R'-HX'.'7IF t ' q:I'.I'- .V-'PR-'1If'f'? fe.-1:'.-f?b95-iI3fw'.JT-v'5'9'3ff13 1 4514 fl F15 fnE.?f1 ' Cf'--.V 'lifvif 'IfS2-- -1-'..j'w1f-.Sf-6'.'ff:-' 1 ' :Z -f .4,-:N li-Y ww- 1- bis ,aw YF! WJ il .-.i': P, E. , - HE VX' 52-'I. '1' ,T , -, , ,, J- ,I ., ,A ., ,W . ...A-x,,,,,,,x,, .V ,,..,,5.,..-.,.., !,,.,,,,,Lm,,,,.,,.-.z,,.1 . n H., Nw, H, , -, ju. ., ,W .wg A F -I' '-,',-Fw I- +w.Sf ' -,V .F Q!-fish 'L-'ZIV ,T 5.15:-ERI -': -JL 'If- cl,- -8:5-3'?'f'flE 'I.1' .-e-5.'E1'-2+ '.-f ' , 1-w ',1'-M 'A'-I ,QI-.-,I f'!I we -vig-Q'-I--.1-,S ,Q Ig.-11. 4- -1' Nl :1 :'I.:I:'fI.',r' 15-.L f.,-.lf 'Wg' ' j'II.L,:.-,- - -1 ,- ..- -5- .I.r,-I .-' ,- 5 - -,g,M'.!i.3:.:E,..., We V? -f15:.S.1??JM:iYY5l AJE?.7t15.fm-L2f::Z.1j M.,LlQ1I,m5,WQ?:Eg:Ng:.:!k:y-.gig 1.5. Iifi,.m-FEi-3L55Tf.W,I:.:V..,.V,IVu,g?.:.y'.-3.5,,P-.FLY-K.-A-.--T fy' ,, f1.uU45L,:i5i1- - Q- -,Fl V- .W31 -,ii 2--2. Q: 1.-af-vw.-fr.I,1-five .rl .a.'1s.'--'As-'-21'I'aI -NW '-s-s-..'1.Q-w- f.'ff 11:,r-?' --., I-I-rf '-f L- 211-2 'nz-If. fri I4-.Ira -'pu 'wa 2 ..u.:2'2'f'f,fc.:I-f ,,'w3fg?f-'fnfI1k.Qgr 5742- -' UE'?'Q.a'L'.f'.'2:.,.:-', -,wing-Z-,I, ,ckyyr-.,g ., -by 14X-gtg.,-'!.5:.1g5,-IN--'!,..TQ.I'-.5-,6531,Q-.gg3ff3..Qa:f1, 21- -3-Q--2...-675. m,4IIl.'Q, L--. I, 3-119 3, If -v,.?,,yq'x..I ,M .J -.A .+I 'Iqr aj- I .Y NJ , jg 1.- I 4-f-. -4:-ug'--III -.. -:I-H, -I,-'-,t'..-1:a.- Itg-gf 'Q 'Vg-Q'H.172?y1fl? -1. :iI,z:.3-'.. 'avi' -.-,-1,.: '-fb.. .5-wg. , 'Q ',.:L-- -.-:1:.- I-Iiflf' 1-4, f. .'y'I'.w.f.',.:.:.,I-,I -If,-va-.-xg - ,,3.:.- 1 - -. 'I -.-.I .,'-2'I-'- 1-,,'-:- -Q ifijltip-L , ,..zj ...ff-.. if-QV:a41, Q?i1fff,-if-ILSHQ Q kTg7f?Q4WQ7F11',J1'fT-' -QW?55.21-311f1f',Qy,Q.P 'E'Tf:i'fX3Q,jx,!i'-Wigv-EFgju-Q-ff11I f-',,--'ffyf'3SvI1fI' .'rfQ5fYf':ih'3' 112-yzfw YJ,--'-ASIS '-I-'. ,. Ji. 1-41112i :cf.','f'4Id,'1.i' . . H 4.: if y.- ,151 'i??.'.-,L I NJIQQYQ1 3-,f-.fm-,rm-,agI!1II.H3.isI-,.-,7, ----P-Q52-:If-W:j'g2:g1I1,'y-4-fsff.22-4.4 -gf-':'Igfq4 ,k' -:.I:-fifghg--wQ.:'i4frI.-nm-Llt.e:Q3I,nigiy-I '--up.,-:ei-I,--.,r.-'.--mt. -1 z.,,f-g fr: ua-.IC.fff',I. if QE, '11-1-I A -..'I-.I- -.-I..-' M Q 3' -.!.ig:,.'.' i:-'..'f--rIu v -.DM---s, , I5 ' 1.12 -'-...IV- MR-.2 '- L ' x -Sf'-:T-F X f-'.I '. - gr,-. !,.'1 ' '-1-1, -QI-X. - ' - ,I ':':.- - QM W .- ' - 1 '- ..:kg.'i i-I,1f- gy-,-xv: -Q 13 if '. II ' :I ,L fII '35i3v. b'f7'I'v ff 351-1 Jf'x'Li'f'-Ci2'?'-Sf -N.iiX'5If:Q ft--ifitfIiffifIfifif'-?vfIf:IS':5T3S7EIfZZ -f1 7Q'-1 '54 .'-QfZ'.-:'55.f g -14224 Yff, 'GW 'I'5si-'3f5:f5 Ip'-1'-P,1'wTf??-if ' IIz 31f- 5 Q ff II22:7.' ' 'P' Hg. 1- '. '-fi--by-:.-4.151 V. I-fa :-f-1'-LM.-:lmtfl-1-,.:J1I1'sXi'1''I'-I5'51iu1 .sa3af1Iei-ii..Sw .-f-aff.E-k'I.ff1?XE3fg-41-gy,gig-...5.-I-21J-I:.f-:-aah'ff---fm-i-L-z.-5.1, v...: ...v-1:-I.II 1--'2' --2. -I '. -'.--I ---- A -1-nf--4 I f ' ' ' ' I ' . ' ,. -, A .. , ,. ,I .r 'r1-, H., .. ..--.n. ,V ., --. .f qu.. .-. -.Ivs,- .w,,:-,,..,, , be-1 M. ,V ,A ,.. .,....M,,,, , , ., X N .f.,,. ,MII .I,.,-... -- 1 ,, I.,.I, -1- I, -, 4.. . .- , , ,-- M, .-uf., . M, -, ,.I .,,., - -,, I -,A ,-I., N , ,,,.--,.-mv.: -.II I- . ,. 1- -.-,IJ , I . - I I... -.. - .--'--.-I4 I -f-I-L -...f-,U ,.-.IJ---1,--I-H P---.,-,... --I wmv: '- II-,-P- .-1 ' F4 ' 'I' .' - I-L ' -I fa. . -- ' -' -Hg . 1 . , I' .-.. '- ' u'v..I. 1'-f,f I'-+-Q'-'I',wxsg f,g-'z'I-vv'j-1.3 -',-:Ip-1I'. 1l,.,.,-,ff,'. Rffii- I.1'-ffifig fi:--M1wf 'EU'? 'q- 5.379 ,. ,. , ' I a dm. 5. I , , 74 5S+1' E4-vi . :fa .:I.'J..?,---'Ii'g-FM I, In. Q,-351-.,'rEj.-5-.-xi e-4--5-,1554:-.'2-.'.g'1 iIqi2-f2vfI1Q'QI-Jil'av'1354 ji 5z'F--gm' ,-EQZI?-1-,3':fI' -fy:fig,-52-'.'-' FQYTW 'LL-if -ri.-11-.I--,'.g2?:-V292-.gif ,I-fin-L, 2-I-.955-':,.i'. 4.1 I fl, ., ff' ff:-''l'21'I----,I--.W-- 1-'Wifi-- .k-.-gig:P '..'..,-IfI.:-CA-A-1--x, 5Diff'+4--:U-?F?5.EI 3f1:-,i41f-.Hg-213'-4.II .1-'Ti-15'--'-b:?fVi'1-' F54-332'-'f-is-iJ:T'I..-fm-fI.L 'Ib --If-if ---If ': ' 1 1 - fd 71. K -,vu Ii'-hw. WI-A1--fy.-f,f :I ug --.2-.I-a-I-11 -A2 c-.1.a-.--.-:.-,- ,,:-,,-...qw ..--:in IMI'-sm---UI' -W.-I-X11z- x-'------I:---,I---Im-. I -fx.-w vw- ., 1.1 .11-. -I-el-I.--.I . II- ' -1 -.5s.I,.' I .',.,-Q:..I-.N-.,w ,. --fs,.fq.1I-.-..,,,-M.-,..I,I .-I-J-.ww -. --f Ima- .I. -,-. -4.--. f.. ., .,..:-.I.-L--- --K,-,I .IQ ,. II ,.-Im -. I, .-, - K- ,- .,, -.-..,,u, -Y I . -Yr .,QI5'j-2,-,Ly :I,5y9el11.x:,I'.r,-k-LQ:--f-Lg' Y.iz:I'qqe-ff.-'A-.g.'.,,Q-qzirfgt-IILQ TEM , ,I-,-bf'-:.-iffifij,--'s'-.4-,I'f1'L94-f-:,f5 '.Iq'5 .I '-'1x-,,,- -:,Q,':'.:.,'-,Q .I If: 1-9,4 -',g.Qg.- ,Q nf .-55,2-.I-.-'. --, 5, ,I -, - . -1.-.r I --,' .I N541 fx: I,1I .' 1..-re I.',- -I J. Ing. 1.-F-I--sI4Ig1.' -,f ':':I'I1 I' - --xii'-' --.I I- 1 - ' +I: . 1 - 1- --II.. I-I .- . UI. ,mr-w,!I5,4-wg.-y,V,,KyvK xxx KQIWI f5.,mF,I 33.1. A H.I7.,1:1'..!-,. L.y.-,f?....!, .IMLEhj'.v,.It,5MI.:l4 R: -J 4:...Q.5?j .N-3 -,-:.5-K... ,I VI. y,J,l-hx ., -.1,,QX.:V, - If.:V.,.:!,:z,1v .Il Mi.-Id - 1 ,F ,lv 41 Ay, MK , . k YI, I. . , -M, '-fr, JI, X - U . -'JV-'f9711i .-'.I,'--iw.1-1.31. 'II'1...-,.I-1..-21-iI'-f-iH--rw'k-u q: I.'II-H-9-ifL..'.fa-'..r5I'4v7e,I I-'IX--y,'-A MI, -,,21-'1II,,,- -fn..-' ---121, I-,I--NI-,.I., I . ' --.-3,5 I-L: 'I ,g- 1 rg -fw a-.gI.- ,-I I 1 4 qv -Y-.I.--W.-.4 ',' .uf ' w.-I? - , 'I-I+,-f 'flu ---1--fm -1-JI .fm--.I ..I.4-gd'-. w-.-I-1 I-WJIS. .'. Ia ,ff .- 1 --. --My -,u --'I -I - --.3 , 5, pus- .-I -A .,-.--.1,' If. - 1- 1 I .,f2,'vf-gig-I 71-fsgffif -Q-.-gffgql 4,111.45-2-:,Q-1wg1.,xgJ','- ,i,'I ,fi 4- 'Q'.3-fgQIr1,g,,.g.fIegg VAL Y-f',,--:I'1f-gi.. Q'-5, IJ-GQ,-' -1... . M5515 fj-IR'.,g,':j.,f1,,.f.- pf'---ff Egg: I V 19' 2- Q--c ff-'I T-Q-5--3 'I I - Ig .-R - -if -'31-IFJ- Lf- 1 gi-'F---9'5f'5w -S.-fl-T'-I,'.5. '.5f-fI'-FE?-'--. I1 Jgbif 513: 4'-5310-I'- l.i1'-. I':'I' 3 ag. ' '1l'1f 5 -'Il.i15- I1 : .- 'fl'-'ij' -.2-' --WJ 2 TJQI--'-'w' --.YW '-5 - , . 'Q ' '-li. -, .-' Q ' :GNT -- 1.5-'X :-- if. 'Z 2 1' .3 ff: f lr 1- - I7-- '-1-,- X ,- 'In gq .,-5.-lu -,,,1I-.:3.Ih::,:, .',-'jg Q.-1- If-Lg A, fyj- J.: .gig-..., fy I-5 - 5 5 .- ,I . , .,. --,c,I. -:I ,- '. 1, , ' .4Qk'iil'1I.-'BTW4-.I.2.5-W?-r-NVIT11-'Q.'T-.gggfr- '-.'-.-my-.I-4-'1a'f.f.-ff-lf.i.'.3Z1 f1--if-1-Q' 5411-I'-,-VII.-.---,:r.- .'fap4'.-:g'e'r'.' fi'F.1:-rvz,'.'f'51 'I-I.-...ff5y.,- I7I':'1fI-'l'I--Q .:'-1:1-:Eg -. . jfgaxr ' ' . -,Q .I:--.-- I '- II'---'f'.- I, -I--g,.,::r .Q ,::.:-'-':,-' ww v: .1-.:-.L...,:--s I -fp - I,---n f .. 1 , W' Q, I-41. -,.',1-1- - -.J--'-,df my--1, - - ,. -4: - 1' .I.'I - . 1 - :-'.'fh.f,'a:s-F qTI. QfI-Ig?---. I- ,-?':..1w: I,','-.a- ry..:full-Tmvff2I,fQ--g1Iva,If-4,1-,XI'-i-,gm-fff-.. -175-.-fix' Fw 3,- T.,..L fr-HI,g.'4,. rg.: ..ff::,- --ns f , .f Av- ,Q prff .'. y .+ ,- I , 9 Iggyf2-Sffg':.f.f5IUf,-I-Z'If-lgdKYQQQ.,Ui?FRITZ...-'n1 'f-gil,:'?-'gf-1,gigEfgjf 32,5-j4ei+.',f,'i-iiyiy'515--I1I'rr?-wr-,., -..'-'Ia-'I QI I.I..-1,45-.iw '1-1. S545--51.f'.,g4a.l-f'.'ifg,-. L--Iv.-f,gI'1 2,1-fr. -V. .I'- ,I5 -I -1-' j-ff. 5- .,f, .Q I if 1 .f-P3-,-. -5.-HupMzzf'-I-,-QI-:,'--5-.I,g9:.I1f-,--2.fly' Q- ,-M1J. .:21--.-1 .I.--wg Ig,gig.-..:.,f-,4-'-,-g.g..':.-,I,5-.,-3 I --fy. . - . Q5 -Ir- f 'I42'--W fe-71,3-..:-g-g.,3.g---.z,:1,IfIf 6'1-K 52-954,v,.--.E-QW'-III iff'5Z:IqI'-fa-.-.I:kf,:-ly ' 16-IIIL,-.9g..--4.f,Q.'-2111-'zxpI.-1:1-'H-'Q' mf . I-g.II,I' - -l-.J -if-. - - I.. .II -- ,Ii . I: . n This is the Home of Ziliseh Pure Milk Co. ., f s - W . w Nhlk 0365 . lee Cream Cream O9 'Butter X- a df ee e 629 West Washington Avenue Telephone Badger o7o Madison, Wis. Z6 W. Mimin Cphone 2407 Carl CZ Wiomas Photographer 6 Q f Cjxfaclison Wisconsin JZ A1541 gi faq Qfami Q52 az f M vi , 'ff min M Q f The only daily newspaper in Madison receiving the full leased wire service of The Associated Press. The Capital Times has made a marvelous growth. In one year's time it has attained a circulation of over 10,000. If you want to get the real news, read The Capital Times VVILLIAM T. EVJUE, EDITOR P 669 MOSER sHoRTHANo coruioia The Secretarial Courses of the Moser Shorthand College are complete and thorough. The Moser Shortha1frgZ,Ce'hL 'ce1firolls only high school graduates. I t is the only srfhoolffff Xgxsuch a high entrance requirement. . I llu' lhll ILLZI For palrticurakkx -xrarlal Courses Write, telephone or call on PAUL R7iosER, J. D., Ph. B. t Proprietor IZTI-I FLOOR LAKE VIEW, BUILDING, llo SO. MICHIGAN AVENUE A COpposite A t Institutej Telephone Central 5158 Cl-IICAGO, 'ILLINOIS For ELECTRICAL SATISFACTION HARLOFELOPRICH ELECTRIC CO4 Corner State and Frances Streets .igg or M MAo1soN,W1s, Conlracziing Ellibrzcczl Supplies P 670 . N. E, After' July First . 1 f' X . f f'-022. -.lf-.V ie? J X X N v f. gf ...f CThis photograph was taken by a Badger Staff photographer in the basementlof the Bachelor Apartments. T. N. E. will live on. Here is the proof. And all bec .:w1-,Q e of the honorary brethern, x ,LJ has invented the wetless, but not n entertaining concoction which has all thE'a van- tages of real liquor and none of the isa vantages. The V' +' 55' sin Chapter of T. N. E, has been lauded by its Hlial chapters in other colleges and is prouder than ever of its achievements. The photograph shows the Professor and Bathhouse Gene, T. N. E. president, serving their brethern in an experimental drink fest in the basement of the Bachelor Apartments where the new and strange scientific beverage will be brewed and served. Other chapters of T. N. E. will be supplied from the same source, 'tis rumored. Page 671 2' Q A , 1 I ' i- fr . Ill! ' ' V A igg, f III 1 iss ff 'W l l l l :: f 1 A ill, .ll + H 11, ' X I W v I ::- pu In all 'fi ' ' ' f 'll Wil! II- A 1 r nl ng: 1 i gg' M - sae i r Q , l :III ' Y v L ee: lr ll P 3 ,4 ' ,s c ij, , I ,lf f-7-'llQe,'-. .miie Cl' It S. A, T, C. BLUNDER No. 269787 Theta Delt pounds on chapter house d d Il lllrleixiglvlrlgeriglill agiisan the fciiowslii- Sh ll I ll ofthe girlsmlor QSUT' g C an plpcb. A. Maasai, jlr. L A D I E S TAILLEUR ZZI State St. mahisun, 1HHi5. 3113.551 58552 D Largest Exclusive Grocery in Wisconsin Phoncsi Madison, VVis. Sport Cloths, Cricket and Tennis F lannels in Abundance ,, cw ' f,, g aa, V Depenctainility As to the length of life and resil- iency of the fabrics, and as to the construction of your clothes- ls What Counts Thats Why we put all our knowl- eclge into buying the Right Sort of Fabrics- Fahrics of the fnest textures and of the latest weaves- That's why We devote our ut- most skill in tailoring- so as to express gracefully the lines of your figure- so that the clothes will retain that Air of Distinction which is soon lost in less perfect clothes. THESE are the qualities that make JERREMS' clothes so clesiralnlefeso ciepenalable. Prices: 540, 545, 550 and Upward iw Gailor for young men 7 North La Salle St. 3 Stores: 314 S. lVlichiganAve. 71 East Monroe St. E 672 Ihr Bailg Qlarhimrl Has been an important factor in the development of the famous Wisconsin Spirit. lt is the- one University publication which is truly representative of the University. It is something that all students, lawyers, medics, commerce, engineers and agrics have in common. You Need Gllw Eailg Cltarinnal A lVlan is ludgecl by the Company he Keeps An Advertiser by the Publi- cations Which he Fatronizes Architect Conover, Allan D., 36 Tenney Bldg., B. 4438. Auto Service Auto Service Co., Butler and E.. Washing- ton Ave., B. 5163. Madison Battery Service, 227-229 N. Henry St. B. 6714. Madison Tire 8: Rubber Co., 1 18 S. Pinck- ney St. B. 7200. Bakery Kreb's Bakery, 406 State St. B. 5640. Beauty Parlors Huffalcer, IVI., 642 State. B. 3770. Marinello Shop, 223 State. F. 79. Varsity Beauty Shop, 415 N. Park. B. 429. Barber Shop Singer, Herman, 620 State. B. 4989. Cafe Cop's Cafe, 13 W. Main. B. 2364. Cafeteria Irving Cafeteria, 419 Sterling Pl. B. 271 1. Contractors Fritz, C. B. 8a A. K., 138 North Frances. B. 712. Dancing Academy Kehl, F. W., 309-311 W. Johnson. B. 1770. Dentists Gillette, W. I... Pioneer Blk. B. 1228. Rodolf, C. F., Z9 W. Main. B. 3119. Baker, B. 81 E. E., 313-316 Washington Bldg. B. 470. Woodford, C. B., 710 Gay Bldg. B. 3636. Bancroft, A., 901 University Avenue. B. 3682. Barsness, P. S., 307-308 C-ay Bldg. F. 313. Drews, E. I-I., 317-318 Washington Bldg. B. 2120. Drug Store Tiedemann's Pharmacy, 702 University Ave. B. 4858. Dry Goods State Street Leader, State and Gilman. B. 2135. Thuringer-Cuarbutt Co., 430 State. B. 3577 New York Store, 5 W. lVIain. B. 611. ' Five and Ten Cent Store Woolworth, F. W. Co., 15 E. Main. B. 1332. Furniture Olson, Berger, 9 S. Webster, F. 821. H. F. Sharratt, 317 E.. Wilson. B. 1974. Grocers Hersch, 301 W. lVIifflin. B. 4425. Jacobsen, O. R., 201 E.. Main. B. 640. Diederich, IVI., 817 University Ave. B. 162. Ehrman, C. 302 State. B. 1591. I Feldman, J., 1401 University Avenue. B. 4916. Hardware Wolff, Kubly 8x I-Iirsig, 401 West C-ilrnan. B. 1349. Ice Cream Co. American Ice Cream Co., 525 University Ave. B. 1821. Insurance Co. Wisconsin Accident 81 Health Insurance Co. R. 19 Fairchild Blk. B. 1710. Jeweler Buckmaster, A., 30 N. Carroll. B. 1274. Anderson, C. W., 124 State. B. 3378. Lamboley, A. E., 220 State. B. 1 102. H. H. Ratcliffe Co., 29 S. Pinckney. B. 984. Reliable Jewelry Co., 422 State. O. lVI. Nelson ik Son, 1 12 East Main. B. 1376. Nlaurseth, V., 521 State. B. 7468. Law W. T. Kelsey, 203-4 Washington Blk. B. 1050. Laundry Yek, Sam, 313 State. Sing Lee, 810 University Ave. Pu ge 674 Lighting Rooming and Boarding Houses Anderson Light 8: Sales Co., 205 King. Mahoney, S., 515 N. Lake. B. 1453. B- 6250- Bradford, Mrs. C. A., 613 North Frances. Merchandise, General Sinaiko Bros., 1958 Railroad. B. 1961. Meat Market U. W. Meat Market, 728 University Ave. Millinery Williams, Mrs. W. E., 304 East Wilson. B. 4229. Coyne l-lat Shop, I0 S. Carroll. B. 1785. Duffy, M. A., 324 State. B. 2377. News Agency Bloom's News Agency, 120 King. B. 1121. Optician Klitsnei. Osteopath Lyman, Dr. E. J., 213 North Hamilton. B. 3100. Paper and Office Supplies ' Grimm Book Bindery, 326 West Gorham. F. 469. Printers Taynten 8l Dean, 201 E.. Main. Madison Blue Print Co., R. IO Steensland Bldg. B. 6800. Blied Printing Co., 114 East Washington. F. 375. Real Estate Ramsay Land Co., 128 S. Pinckney. B. 400. Legler, C-eo. E., 115 W. Main. B. 121 1. Ellis, Chas. T., R. 360 Washington Bldg. B. 2999. Cochrane, Mrs. E. K., 602 North Frances. B. 4771 . Kidder, Mrs. F. E., 701 Langdon. B. 5415. Storage Madison Fire Proof Storage, 825-827 E.. Washington Ave. B. 742. Shoe Stores Ripp's Shoe Store, 224 State. B. 6491. Walk-Over Boot Shop, I5 West Main. F. 340. Blind 8C Sanders, 217 State. B. 3295. Shine Parlors ' Jafferis, 228 King. Madison Shoe Shining Parlor, 128 State. Capitol Shine Parlor, 235 State. Taxis Paul Kingston Co., 22 S. Carroll. B. 146-r1 . Star Taxi Service, 138 N. Lake. B. 1366. Tailor Oscar C. Olson, 228 State. F. 294. Trunks Wehrman 8a Son, 108 S. Webster. Transfer Verges Transfer Line, 140 South Blair. B. 805. Sharratt, l'l. F., Furniture Storage and Transfer, 313 E.. Wilson B. 1974. Jefferson Transfer Co., 7 S. Bedford. B. 7. Woman's Exchange B. 3787. Woman's Exchange, 1 I3 State. B. 1215. ! I I I I Women s Edztorzals--Fired and Relnred V '-f ., ' ' ' 1- - - -. 'f wf .Q Y WT 7 A' ff 7 I A . -5315, as ,Q I wisconsin . UAILFXSM-:lf U ' 956 Ez' ' ' ff .. S2252 ' CARD' ' 'V if . ,Me 4 . ' ffm-.'1f..-is'.qww:..'- I. . 3' .V 11+ - ' ' . ' ' ff sai s, f N 1 V. -- E f 4' . 5 Q54-We sw. .. tiff..-a.14?' . if 1- Se.. -S . 4 ,M-V .Ga - -2 ,MT f- .4 N.g4.,G...4! . q Ng, ,, , .h l., . .1-qS5!?,f,4 f If ' 1 i 'asf 1 IX We . 'ro. if . ' 4 1 Abffkm K! .--' 1 1 221 82 -1 ' 1 .. 99' J '- X 1 ' ma 1 2' 'f Yiff- 551 .3 -' ',,. W H DE . X I., - . - 'ara' .1 . - .OM 1 Qi.:-g. ,AJ 4 ,--,,,,,. -Ms -N . ,K- -1 ,1eggg,.y.', 3 N . pq.. . ,L V--1, - -,Y Q. ' -- 3 i S 1 Q in 1' Q., 1- ' 1 -' .X ' 2 Ousted from the Cardinal they found a welcome birth on the editorial pages of the Wisconsin Fit Page 675 525 STATE STREET DE LONGE BUILDING I EUNQE Qkgfwfo Nursery Posing Room Reception Room PATRONS NVE MAKE PRESIDENTS PORTRAITS IN COVERNORS-STATE OFFICIALS OIL SEPIA PASTEL CRAYON ARMY AND AND XVATER COLOR NAVY OFFICERS MINIATURES IN IVORY UNIVERSITY AND PRESIDENTS AND FACULTY WATER COLORED PHOTOGRAPHS CITY OFFICIALS ALSO OTHER CELEBRITIES PORTRAITS IN YOUR HOME Page 676 PERSONNEL GE TI-IE BADGER EMERGENCY BOARD larrangcd alphalueticallyji Harold Groves, Lincoln Quarherg, Doris Simonson, Allen Spafford, Ben Wishnelsky and DEAN SCOTT HOLLAND GOODNIGHT, DETECTIVE fthe last named was self-appointedl CN. B.: The above names were printed solely because of the tenacious insistence of Dean Goodnight, and because in order to pacify his rantings we promised it would he done, and not because the regular memlners of the hoard desired to see their names in print. Vwfe hope we have discharged our obligation to the Dean in this respect. Vile claim honesty in keeping all ol' our promises. XVhy lvlr, Goodnight was so insistent that the names be printed is not hard to fathom. XVe hope he is satisfied, and we simultaneously express our regrets that we could not see our way clear to satisfying him still further and placing the names on the copyright page as he hrst insisted we should do. The Boards picture will he found on page 623. NVe, the Editor, respectfully apologize to the mcmhers--we have tried to acuuiesce in their wishes that their names be withheld from the pages of the Badger in connection with the Emergency Board. We are sorry if we have disgraced them-but we all must cooperate and make sacrihces in the interests of the General Cause: the speedy production of the Book. ' A A is E, llll ' 3 Uri' E - all :'. ,Q E Hg EF' ,Q Illia . Q1 S E f .!.!!lll 'lii' Chad girl who rooms at E 2 ' Sigma Nu House during S. A. E E r All ll T. C. era is the recipient of ir: J: 1 quite a thrill when she pulls L, 554 ' ' I -llll A - D- -.lllllllllll Illllll I Q open theclresserclrawer. This gil IAl.....' l, l is what she said: My God, J lr-r--' - JI:--gag' girls, the Sigma Nus must I' f have clrankli' QAwful, isn't it EE ,t-' W '1 , Helen B. s. c.. Avy IH! ' imumiminm i Ill I i 2 Vg ig . , . , li lllllllllllllllll . fx- I fi 3 5 - :Wim livin E . ' P':gl!llllll.l . il 'IAQ X V il Li I sir: - Page 677 N 1 'K I If .- I QX- A - .Le H' Y X I fb K ii voui 5EEVi'ct IN THE Biiisuops Over the Cfea Cups When the topic turns to clothes -we like to be mentioned as loe- ing Tl-IE men's store in Madison for giving VALUE. Style, you can see in a window. Workmanship can loe judged from the style, but unless the VALUE, goes with both- there's not much glory in either. Our strong feeling at this point of the road brings you these all wool 'flvliehael-Stern Value Firstl' Suits this Spring at S30 to S50 and the same goes for our fur- nishing goods. IW 'Wie Specialists in Apparel for Men 8 Boys MADISON, WISCONSIN - 'ls Successor to Greig Furniture Co. EURNITURE l I3 King Street l 19 S. Pinckney St- MADISON, WISCONSIN ESTABLISHED 1854 Conklin E? Sons Company Coal, Wood and Mendota Lake Ice Cement, Slucco, White Lime, Hair G? Sewer Pipe lvlain Office: 24 E. lvliffllin St. MADISON, WIS. ,' 5 g J J S20 a Day or Better Big money for you this vacation. Student agents wanted in XVisconsin, The Strausky Full Vaporizer for Fords. Sells for 554.00 under absolute guarantee to give ZSCZ, to 50'Z7 more power, 2592, to 5095, more speed, to save 252 to SOCK, of fuel. One man saved 7OfZ,, another in Norwalk saved buying a 534.00 carburetor. Take out two bolts, slip in the vaporizer, replace the bolts and it's on. L is t e n Every vaporizer you buy or sell is sold with positive guarantee to refund the money after Hfteen days trial if not satisfactory. Not one per cent return. Get one in your vest pocket and get busy. No re- striction of territory in XVisconsin. H. A. CRONK, NORWALK, WIS. State Agent and Distributor Page 678 'UUH 4l'H 1l ll lI H'lU'l 1U'l N'Ul YI l 1'F'll'fl ll llUl'UlFll'UFllllFlill?lFlU! FlUUllFlllUFVWFUFlFUUUF!!UUPWFUFFFlFlUUllill?FlFlNWFP?WWF OCCIDENT BAKING CQMPANY Ii Quality Supreme wccibent JBreab MADISON, WIS. liiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiifiiiiiiiliiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiimi TWIST lAORSEif W DRILLS Have been on the f Market for over lilpffjl ' qw Fifty Five Years ABSOLUTELY if R E L 1 A B L E TJ qsfmd for Cataiogp Morse Twist Drill E? Machine Company NEW BEDFORD, MASS., U. S. A. Banquets Luncheons Parties A Dinners fgiie State Capital Cafe - Under the Dome' ' IinmnnnmnururuTrmnvaninummmmnmuu fG7ze Dining Room Beautiful The most modern equipment in the state I Operated entirely by electricity Management of W. A. RYDE From Our Private Studio We Vote for Jessie-She wins our own Badger Beauty Contest. We have the original, and we're jealous of it to Turn over now. You've looked long enough. Page 679 f-Q15 'QM' f ' -L f A fg sig- ur- if, 2, L -. . -A ft. 14, 1 -Qilil gg i ilpl?-'?g,:j' 95, xc us we Ag fuffl 1 f!ff,i? s .-, 4, i-?,3.g?4fq -1, ,pg rely .fi g5Q,g5:a,,,,? ,vi ff . M132 E -, ,E Omen S f, ' ' ,P- 1 -. ' S 5 1 ' al 5 QYQ 1 ' ' S an n X fx 'Q Q K 2 iii' Q C T L ew T , 1 AUA f 1 ' to CZ , V,., ' T 'A'b ' it A A'-V 1 T ,.,V Q' 1 -f 23:3-:ff will ,, , :,- .-.,,-nxf-'1-, f.-1:-pg V 41 l,l'i ff 1i1 ff' 11 ' utfltters -2,2--.l:i'-lv-4'fg -1 u . -:w.r:'s.ffw ,- :az-1,5,.:,g,Qf3-5,f,:-3,f,5. - X-ft,-4,414 A. :,.' ---,,.,5,:-,AM -fm, - we we 9539:-gg'-.gig-.Qg4,' , I , 1 H . 1 . ,,.,-. Q A. m.-,' +sg3.g51- ll S X, ,' A -V . 5 QQJM'-1,. r ,. -,X 1: M. H-.,,.., :fx km . ,,,',a:f,, 'Q ,,,, , ' ,,-,: -rv Q - - '- , 1 , - , ,g A' ' 1 f.-5 K. . . t, bf? A ', 4:7 , ke? - ,Msg rf.. -.-. ,,L..-..,4.p,, ,MQ . ., .,. - ,, . ,g- nw., 1, I 5 35' W -'--- -M H M Imgmmmmmumm,vm..mm...mmm,..mmmmmmmmmlmmmlmmm. Observatory Hill-4Looking North from Main Han - ' '- ' ' mm I H I I mmummnmnumlmmH n 1 1 I mmmmmmmmmm ' O-Her Your Friends K E E L E Y ' S Old Fashioned Chocolate Creams. 'I They may think you extravagant when you taste them, but while there are no liner chocolates made the cost is only Fifty Cenzs per Pound Box. They are a revelation. Buy a box today. Made only in Madison by KEELEYS PALACE OF SWEETS 20 N. Carroll St. Madison, Wis. MADE IN ' MADISON SE RV l CE I-IAS BEEN OUR WATCH- WORD WITI-l FACULTY and STUDENTS C H 0 C 0 L A T E ll ll llllll e Lawrence Lunch Badger Pharrnacy ThePIaceloEal On the Square STUDENT SUPPLIES and Off the Square University Avenue and Warren Street 662 STATE 11 E. NIAIN Page 680 Page 681 X mi - ,, X iliac 5 H r -Q ya kg Ds..!,7ly , T, . BZ5'YKe7yTX'-XXL ' T If ' , Mc I fl, A' La uggclg , ! A ,TH lrf ww law if N'9?4 f'B L1 Jld liihgl af-,fe n ' ff fl! T 'ig X New W '- M M F 'i fl'1 Q, is f la is X Female Grads of '82 pass Chadbourne during the S. A. T. C. regime: My-what wild and noisy girls Chadbourne is harboring these Clays. Ain't it abominable? -i V -Sf'v'5 .1:QgZif-1 .. ., Lj,Q5g.'1': - V-4' .,.. 3:1922-sizf wi Ea Nw- Y Y jf . 1 ,I gf h I: V iiigiigi ,445 i ' i T 1e ' if A- f ., Q I-Bv frs-0: -I .gsm , A : lf -VVV flfxwl Z.: ,' Q 'i-33 - Signs of Spring .THE ATHLETIC DEPARTMENT . lThN sl-lud'F'endD This picture of the Lake Drive was taken C e ew 0 H S rl H on March Zl, l9l9, which proves that this Which picks the teams, awards the W's. pruning pair was the first to rush in the handles the correspondence and incidentally romantic season-Springtime will tell us all about it. Page 682 1rl!WI1Nll11lv1llWWIlWbl1H1WllN1HUI4NIlHlHIlulHlINr WMD MEUER9 for I I IIHIHIIHIWVI!VIHIIUHVIINIHNI1ll!NKHVI!NIINNI1NIlNIINNI1HHIIHI!HIUIHlUIIM N i Kodak Finishing Novelties i A Greeting Cards The Kamera Kraft Shop Pg sw llilllllllllllllllH!lllllllIIlIIIlIlllllllllVIIllllllllIllHlllllrlllll!lillIIllllHllllllllllI4llllilllllI1lIllllllllIIlIIllllllPIIlIIlHlIllIllIIlllllllIlllIllllllIllIlllllllllllllIllllllIlllllIlllllII4llllIlllIIllllHllIIlII4lllllllllllIIlllllIIllIIllllIllllllIlllIllilllIlIlllIIlIlllIllIlllllllllIIllIlIllllllllllllIIlllllillll!lilllIllIlllllllllIIlllllIIllllIIllIllIlllIIlllllIIllllIIlllllllNlIIllIlllllllllllIIlll!lllHIllllIll!llIlllIllIIlIlllIlllIl 13REvooRT HOTEL L Madison St. East of La Salle f FIREPROOF EUROPEAN PLAN : 350 ROOMS Two blocks from State and Madison Streets- the busiest corner in the world Pre-eminent among all the hotels in Chicago for quality of service at moderate cost. - A distinguishing characteristic of this busy, modern, up-to-the-minute hotel is the quaint charm of its genuine hospitality. Restaurant service of marked superiority at prices that are not excessive. RATES PER DAY Room, Detached Bath - - - sz.oo to 32.50 E Two Perso - - ss3.5o to 54.00 E Room, Private B h - - 32.50 to 54.00 Two P - - 54.00 to 37.00 5 m Laurence R. Adams, Pres. E. N. Mathews, Sealy and Treas. i lIIllllllllll lllPIIIlllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllIlllllllllllllllllllllllllllllllllllllllllrlllllllllllllimllllillllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll!!llllllllllllllllllillllIllllIlliIllil L College Refectory Headquarters for good home cooking, Every- thing clean and wholesome. Students will save money by buying coupon books. , LJ ,tm 31.10 for 51.00 352.20 for 32.00 XZ l 85.50 for S-5.00 K N .As ilk' Try It-You will be more than satisfied ess STATE STREET . lk We 2 ll fl-ax . 4' 'J ' f.4.. 'in' elgiafl i .L ,mmm-M, 'mm Eat at the . .iieisiziiiiis -555555555555 Ein 'iiiiiiiiiii 'in l Eiiiiiiiiiiil H M 1 TWO A I Cafeterias -T if H l News lter1:xfiEnYgEll1jdrIZiiaSfE.in3ayTiNe?e h ld h ilqlwo Good places to Eatn Chi Psi Lodge. CTwill never happen again, eitherj. I Pg 684 CBeautiful Wisconsin Scenes F Who are they? Lt. Joslin and Polly of the Infirmary. Now clon't crowcl the infirmary fellows. The war's over and it takes a uniform to get away like this. Moonlight on Mendota-also: a Canoe. CPretty, isnlt it?D Which proves that hazing at Wisconsin still survives. Page 685 PORTRAITS BY PHCDTOGRAPHY from the Studio of C. .Phone Badger 634 19 WEST MAIN STREET nz 1 MADISON, WISCONSIN fWlll'llllll llillll . i lllillilm.,i-ii ll-Wil f 'il rI,.L'iii'iurH1Q'Efliwllilwlilllllli lg W I ll lliliii'lllll li lyglllllllml l N 3 fl lily ll A ii' MALTEDl lm y ,J MILK ll , ,A Sr TQU I bt! I, m ,N ,ii i.,N ,ln N iqwylix ' ww is ,i ll - ai -shall ..l : i llill i-All ,l I V: I! V , Yglllllrlw My r - 1' 3 ll 'g1i'liiil'l:,lil'ii li uw. If Q f -Yi W' Wi lf ' lf ,g f -i 3ilv1Qiuir1iQ.li iiliillll ll l ll, i Q I lf l -+1 l yi 'ly N . i H fl l W lilllllllill llll:llilMlli'l l W fl n 'V iylly will 7 f' li lil M ll li li 'M W1 lllllll lfllll 'lll X C 2: BES MAL Llvll W Jlqlljg , 'lllll lllli l xi ll' E of 'll illliwi e E ll l I i ,, Ei 4- X .W-3 wif. XT- - ff .IL MMHJLH ,Ig Lunch Time-Bee, Time-Any Time For the quick lunch-the mid-afternoon snack-the bed time drink-try Borden's lvlafted Milk. lt's better than a heavy lunch at noon time-doesnt slow you up the rest of the afternoon. After exercise it's just the thing to brace you up and give you some- thing to go on till dinner. Taken hot before going to bed its a sleep inducer, quiets the nerves. All good fountains can give you Bordens. Remember the name-it has stood for the purest and best of milk products for over sixty-one years. BORDENS CGNDENSED MILK COMPANY Established 1857 Borden Building New York v Q a TMIZMLTED MI ll LK P KS Are You a Member lVlorgan's Student Club C? Membership: Composed of all the Regular Fellows Dues: Payable in Malted Milk Meetings.' Held Every Morning, Afternoon 8C Night Molt0.' What Care We If the Town is Dry? You are Welcome - Come In and See Us 534 STATE STREET e Bernards Boat Line D? 0 Q ON LAKE MENDOTA if ll' f if Q II i Scheclulecl Public Launches ll r +Charter Launches ry ............. Telephone 373 Oakwood 40-R3 l l ll ' fi FURNlTURE novelty pieces unexoelled in Candy exceuencei price and The Chocolate Shop, 528 State. B 684 V61'SiEy of d6SigY1, Shoe Shining Parlors Gordon Shoe Shining Parlor, l-lat Press g Varsity Shoe Shining Parlor, 3l9 State. 9' P EELEAEANY Rl' IIIIE 'i THE life insurance business offers college men a start in a permanent remunerative business. The Wisconsin Life has several posi- tions that will interest ambitious college men. If interested Write fgiie Wisconsin Life Insurance Co. D 30 W. lVllFFl..lN ST., MADISON, WIS. Wayside lnn 240 West Gilman Street Enjoy a Good lVleal in a Good Clean Place Home Cooking Cafeteria Plan MEAL TICKETS: -55.50 for 55.00-33.30 for 53.00 UNIVERSITY Pl-IOTG SHOP 807 University Ave. Photography in all its Branches Expert Amatuer Photo Finishing Supplies offlll Descriptions iiiisifaso S isst T UD 1 o fG71e Photographer On the Square Also On the Square with the Students DANCE DE LA SPRING CWith apologies to Miss Selk's painting in the Women's Athletic Sectionj. What is it? Frencli Club at play? - Co-ed dancers on a tear? Honest, the picture lsyreal, and our own photographer took it, Lucky, WBSD t he? Page 689 J Forty-eight l1ours before they get their Badger lllllllllllllllllllllllllIlllllllllllllIllIllllllllllllllllllllllllllIllllllIlllllllllllllllllllllllllllllllllIlllllllllllllllllllIlllllllIUllElllllllFlllllllllllllllllllllllllllllllllllllllllllllilllllllllllllllllll Perlman 82 Kaplan The Only Classy Haberdashery for COLLEGE MEN GN UNIVERSITY AVE. Call on us and look at our Style Plus Service Clothes ' l3-L7 University Ave. Badger 1027 This is as dangerous as S. A. T. C. ever became- I lllllllllllllllllllllllilllllllllllllIllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllillllllllllllllllllllllllllllllIllllllllllllllllllllllll Page 690 XVIS MAK15 A SP1iC1lAL'l'Y of supplying Frzilernity, Sorority and Boarding Houses Wilh Bread and Oll1e1'Bnke1'i1 PI'0FlLIl'fS lbhomi B. 1109 IIIZILMANN BAKING Co. Exclusive jewelers and Silversmiths Established 1891 C-AMM JEWELRY CO. 9 W. lVlain St. 9 ensen s Boot Shop LQgah'ty Footwearii 614 State St. :: Madison,XX7is. Merry Sunshine Shining Parlor Separate parlors lor Ladies th Gentlemen - First Class Shoe Repairing --- II E. Main SI. Boslir'k45'c Ballina Open 10 a. m. to 1 a. m. - Real Chinese Almasphere KING JOY LO T352 may new Gbop Sue? Restaurant 114 KingSl.. Madison, XYis., Phone B. -1,191 The Rosemary Beauty Shop The shop where your needs are quickly and efhci- cntly attended by our expert operators shampooing, waxing, manicuring, scalp treatments, eyebrows shaped, Full line ol' Toilet articles and hair goods, switches made from combings. 523 S-1-A-I-E ST .Steah and Oyster House BEN STITGEN, P1-OPI Tel. Fairchild 922 fha 'iEasy Shoppingii Stores There you can find the things you that want and where you can feel entirely at home. We MENGES PHARMACIES M FRANK BROS. WVHOLESALE, RETAIL GROCERIICS. FRUITS 6115613 Univ, A1112 Cnr. Slalz' ck Johnson Sl. Phones B, 2689-5335 Pham' B. 868 The NVarnCrSystem will put your fraternity on a sound and safe business basis Why not investigate? PAUL S. WARNER, 642 State Street Fairchild 27 -:- Teleblionrs -:- Badger 3399 BUY YOUR TICKETS TI-IE PANTORIUM COMPANY Emlzrofdery Qhxftfng Hemstitch1'ng Buttons Cover-ei Miss Hetty Minch Quality Cleaners gowns 538 State STFCCE lVl2CliSOl'l, Wisconsin Phone Badger 3029 226 State Street Madison. Vlfis. Cleaning, Pressing and Alteration L' E- HADERER- 125 STATE STREET Ladies anal Cenfs Garments . , Open from 6 a. m. to 1 a. m. 815 University Ave. Chili Can Cm-ne - - - Steak, Chops Ask Finch for Fresh Cor n, Cones and Peanuts Phone Badger 3522 Corner University Avenue and Park Street HOOK BROS. You can absolutely rely on whatever comes from Hook Bros. Piano Co. Cor. -State anal glfvfqfn Page 69 MACHINERY and SUPPLIES - For Every Kind of Contractors, Mines, Railroads, Water-Power Development, Machine Shops and Factories H.Channon Gompany Chicago i lX!lADlSON'5 Pl-IOTOPLAY THEATRE DE LUXE i ONLY THE BEST IN THE I h FIELD OF SILENT DRAMA Cl'19I'1g6 of Matinggg ee LDQily I Every -Sunday and Thursday C1719 Cudahy Meat Market R. E. 202 E. Main 111 W. Mifflin Dealer ffl Hyou Order Quajftyv STAPLE and FANCY GROCERIES when YOU buy Meats from 001' markets Phone Badger 1019 1337 University Ave. Try our choice Peacock Brand Hams and Bacon GOODS DELIVERED PROMPTLY There is an Old Man 7 6 I Coming to Your l-lome gn 5' - You will then have reached the age at which authorities agree a man should he pensioned. Maybe your employer will pension you, or maybe you can retire and live on your savings, but- Only ten men are self-supporting at 65 out of every hundred who were healthy and vigorous in mind and body at 25, The Northwestern Mutual Life Insurance Co. has just prepared a new contract that will enable you to assure your pension in advance for a small annual deposit. For detailed information call Sl-IAKSHESKY, MCMILLEN SZ FRENCH General Agents 4Tl-l FLOOR COMMERCIAL NATIONAL BANK BUILDING Phone Badger 885-884 Page 692 Clie C Q R O N A Writing Personal - . Machine Do you realize what a personal writing machine could do for you? You Write letters which you want to look business like. You probably also write manuscripts, plans, -pro- posals or reports. Eventually you have them typed-why not in the First place? University Cooperative Co. EIS. GRADY, Mgr. 5oo-5o8 State St. 11: Madison, Wis. WHAT INBAD MISSED lvladison Tent 82 Awning Co. Phone Badger 663 Nlanufaclurers of Awnings, tents, sails, Flags 82 pennants uiniiuiuiiuiin1inuumwmwmnnu 1 Tents to ren! Ebompsonk Orchestra maoison Res. Phone Office Phone lThis pihlhotgu taken frorI?l?en :fs private ciilscijon ex- ' C ' U a 1 Riifnfhfy ffeefoflfieis, lluvzatlmeifsgrgeyfivjriq Jil cfflfifr Badger 2020 Falfchlld 27 ncl they are part of the Orient that Inbad never saw. Pg 613 1V.,tHt,.tt..tH,,fT1V.11.11H1H,,.1,..1..,,,111..V.,,V.1,.41..,1.mw.m.H.H..H.4,HTT.1,.1TUTT.,,..,T,,,,4,,.,,U,,.,..,,,.,,.,,,N.,,.,,..4,f,,..,,m.w,...,,..,,..,,.,,,,,.,,,.4,,.,,.,,U.,..,..,,.1T,.,,..,,.4T,A,..,,..,,.TT1.,H,,,TTU,y.TT..,,.,T.,T,.TT,,T..TT1.T.1TT..,,.,,.1,,.T,..T..,,.,T.1,T.T,..1K.,1.,,..,,.m.,,.w.,T .,,,. ,f,,,,U,.,,.H.w.H,.,..,..11..1,.,,Q,1,,,,.,W,,,,..t..4,,.,,., MoKi11op 82 Ruud Photographers S27 STATE .STRE ET The Portrait Shop Portraits by Photography UTHNITTUWTVIHHTTIUUTVHHTWTTTTVUTITHITVIHIlTI!VITTiHV1THTTITTHTTITH!THHITTETNiNHVIN1iHHNHHHNIUN1NNUNINHHNTNHINN1VINNVIUIUIWUUHIHVHNEHSWHHNJN 1HlU'H1N'wN oto STATE STREET 1 p 1 W, L. M Klttop E G HAINLIN N B RUUD H H HoNE 4 'P-1. ,, 5, :Sw RN I? 1, 'A ' N EN m- l 2 H4 w g gl ., v . Q . . j Hfpofuiarly Jemanclecl tfzzrougizqut the nation DESIGNERS PRINT ERS ENGRAVERS The PRINT SHOP Cor. SBr0om and Gorham Sts. Des1'gners anal Engravers of the Baclger Schneiderjs Studio CD4'Ptist-Photographer N 20 East Mimin St. Pos Offi BZ lc ' CDress Suits for rentj A l l l First Photo of University of Wisconsin from Airplane Many a student will long remember I A A f pp the service of this store. X 0 x Rafe ft We take pride in serving first quality I l' lt xy is R Merchandise and Values as well CTR MInL'N9iK J All the new things, all the time l-lart, Sohaffner 51 Marx Clothes The popular Co-ed Store special- Leave a lasting impression - - - d f - M hattan Shirts 1Z11'1g ln resses or a OCCHSIOHS. EIU . Known as the best-the best known Wraps In all the newest effects' Stetgon 82 Borgalino Hats Leather and Utility Coats of all in . . Unquestionable qualities, styles as you like descrlptlons' 'C C171 Fine Dress Suits, Silk l-lats -l and Accessories Your Inspection is Inviteal Visit Our Custom Tailoring Department Znd floor, where the jinest of tailoring reigns supreme 018011 CO- Woldenherg's Page 697 Quia Creed We believe in a liberal serv- ice and the Widest field of interpretationg always striv- ing to be consistent, courte- ous and moderate, to gain such a record that We may sloare with our friends the benefits from it ..... DEMQCRAT l3RlNTlNG CQ. Personal Service Prinlers MADISGN WISCGNSIN Portraits jd distinctive qualityj Clgraclley Studio LeslieE.Co7Sf' Proprietor Capital City Bank Bldg. ' 21 East Main Sheet Telephone Badger 7904 When you are interested in Portraits and want something that is entirely diferent, step in ancl let us show you our latest procluction, Mono-Chrome. We have installecl the most moclern equipment, which with our ability enables us to give you the best in Portraits that are clifferentn. - Service? 5C'5here will be no charge for portraits thae are not ready for delivery when promised. ' Pg 699 E IPM,-1ir1, 3f ,talk-, .fl ,r a l Clie Last Shot-A Valley Qf Gratitude From the Editor's Last Trench of Defence HE Liberty Badger-the culmination of an ldea-has been realized. We have okayed the last proof, the last of over 700 printed pages will E, ,N be shipped to. the bindery tomorrow, and in another ten days we hope to see 3500 Liberty Badgers in the hands of satisfied subscribers. X We are glad our job is finished, but nevertheless we shall always 15 cherish the few lively months spent in engineering the Hldeaf' The X Q persistent opposition we have encountered, real and superficial, has roughened the progress through the tunnel at times, and darkened the way frequently. But with true faith in our loyal and efficient staff, and the thousands of students and alumni who have supported and boosted us with their subscriptions and generous words of encourage- ment, we have seen the way clear to publication-and here it is: THE LIBERTY BADGER. There was a time when we first launched our plans for the publi- cation of Wisconsin's war history, that it looked as though there would be no l920 Badger. War circumstances were not encouraging to the production of a college annual: financial prospects were dim, and it first appeared that there might be a serious shortage of good staff material. The battle began. With verbal ammunition we fought with a faculty committee for permis- sionrto attempt the undertaking, and then proceeded to muster together what is without question the finest and most loyal staff of workers that ever assembled a college annual. To them belongs the real credit, after all is said and done. They all conceived from the outset that this was the logical year for the Badger of Badgers, and imbued with that spirit they entered whole-heartedly into the work. Nothing, not even faculty committee decisions, could shake that belief. Encum- bered with handicaps they have achieved the seemingly impossible, and it will always by a feeling of pride to recall our associations with them and their work. It was not mere circumstance, either, that enabled us to see the job through. Last fall, when we did our work between drill hours and a military mapping class, and blew out the candle at IO bells, we never hoped nor desired to be here when the job was completed. We planned on receiving our copy of the Liberty Badger in France, and looked forward to that day overseas with no little zest. And when the fighting stopped over there, we began to get plenty of it right here, and it is only because we insisted upon our own ideas of the liberty of the college press that we areable to give you the kind of a Badgerwe hoped for and fought for. ln more than one sense, then, this Badger is a liberty Badger. For the Liberty Badger, what it is, was not assisted by faculty counsel or intervention. The apparent consistency of an obtrusive faculty committee to discourage the launching of the book and later the fulfillment of the undertaking was no small hindrance. From the outset we were hindered and hampered by their intervention-we fought for the privilege of publishing the book, we fought to continue, and if we have to Fight to deliver them, it wrlr be one helluva scrap. In the construction of this volume, one Idea has been paramount: to preserve and consecrate to the greatest degree possible, Wisconsin's proud record in the Great War. That record, now history, stands as the greatest chapter in Wisconsin annals. Those who made it so should always be remembered and honored. To the men and women who made the Liberty Badger a rearity-the staff-to them belongs the real credit for success, however great or small that may be. We are indeed grateful to Mr. M. H. Baumgartner of the Cantwell Printing Company for his consistent cooperation and invalu- able suggestions. His keen personal interest and supervision of the printing of the book has accomplished enviable results. Also to Mr. Erwin Koch, of the Print Shop, who gave us the best of cuts and finest of art and engraving service, we place on record our sincere appreciation. We feel not only grateful. but fortunate as well, over the striking results achieved by the members of the business staff. Headed by Ben Wishnefsky, and working under abnormal condi- tions, they have accomplished what no other college annual staff has done before. They have attained a record circulation and a record amount of advertising. They have made it possible for the editorial staff to do bigger things. Lack of space forbids mention of all of those on the editorial staff who deserve special recogni- tion. All of them deserve great credit for their faithful and efficient work. Maurice Hanson's results with the'S. A. T. C. and fraternity sections, his hard and faithful work, will always be appreciated. Miss Doris Simonson, women's editor, did splendid and eflicient work, and we feel fortunate indeed that we had an editor of h- r high calibre to handle the women's end of the book. Miss Margaret Lewis' faithful and efficient work in handling the Died for Dmocracy section will not be forgotten. The hard work put into the athletic section, and the results accomplished are all to the credit of Harold Gill, who handled that portion of the book. We feel grateful to many more, especially to Miss Marion McCabe, Miss Esther Warner, Miss Irene Haley, Miss Margaret Melaas, Mr. Lowell Ragatz, Miss Adelin Briggs, Mr. Whitney Seymour, Miss Elizabeth Hooper and Mr. Kenneth Scott for the able administration of their respective sections. We feel greatly indebted also to Kenneth Harley and Gunnar Gunderson, art editors, for the valuable drawings they have contributed, and to the other members of the alrt itaffkwho have labored hours in the working out of ideas and drawings for the enhancement of t e oo . To the entire staff we feel obligated. They have made the Liberty Badger a reality-may it serve the purpose for which it is intended: the interpretation and preservation of Wisconsin's great war record, abroad and at home. I V Q I.rin...rurin1.rrinmi-W-rrrru.ummum .m...'m.m mwmmm ' mummm. ,V.,i....Hr.....r...,..,...Hum...,..,...,..W.,.. P cz g e 7 0 0 ? 5 1 i i or -3 2 3 5 I .s S -2 i sl 22 it Ei Juni f :Immun Ei Ei S Alumni Magazine . Anderson, O. L. . Andelson Bros. . Badger Pharmacy . Bank of Wisconsin . Bell, Geo. C. . . . Bernard, Wm. P. . . Besley Co. .... ' . Boyd 82 F ichten ..,, Borden's Condensed Milk Co. Bradley Studio .... Bostwick, Hugh .... Branch Bank of Wisconsin . Brevoort Hotel Co. . . Q Brooks Brothers . . . Bunde 82 Upmeyer Co. . Burdick and Murray Co. , Buser, R. F.. ,... . Business Mens Clearing House Cantwell Printing Co. . . Capital City Meat Market . Chili Lunch ,.... Commercial Art Service Co. Corona Writing Machine. . University Co-operative Co.. Conklin 82 Sons .... Creamery Packing Co. . Cronk, H. A. 2 . . College Refectory . . Capital Times Co., The . . Central Wisconsin Trust Co. Channon Co., H. . . . . Cudahy Bros. Co.. . . Crescent Clothing Co. . Daily Cardinal . . . De Longe ..... Democrat Printing Co. . First National Bank . . Frautschi, C 82 Sons . . Finch's Pop Corn Stano . Frank Bros ,.... F ranks Lunch Room. . Frederickson, A. D. j. . French Shop . . . Gamm jewelry Co ..,. Genesee Pure Food Co., . . Gould, Wells 82 Blackburn Co. Greig Furniture .... Harloff-Loprich Electric Co.. Haswell Furniture Co. . . Heilman Bakery . . . Hills ....... Hinkson, Park E. . . . Hoffman 82 Billings Mfg. Co. Hook Bros. Piano Co. . . 1-Ior1ick's Malted Milk . . Higgins, Chas. M., 82 Co. . .Iahn 82 Ollier .... jenkins Bros. . . . . Jensen Boot Shop . -lerren's Tailors . . jones' Dairy Farm . . Kamera Kraft Shop . . Keeley-82 Neckerman Co. . Keeley, M. W .... Cbicivertisers' Index . . . 640 . 691 . 651 . 680 . 643 686 688 644 . 655 . . 687 . 699 . 691 680 . 684 . 640 . 640 . 641 . . 692 . . 65 0 . . 666 . 65 1 . 691 . 648 . 662 . 697 678 Q 643 . ws 684 669 . 65 0 . 692 . 692 . 678 673 . 676 . 698 . 649 . 688 , 691 . 691 . 666 . 639 . 639 . 691 . , 647 . . 648 . 67 8 . 670 . 660 . 691 . 639 . 641 . . 639 . 691 . 666 . 660 659 . 663 . 691 , 672 . 655 . 683 . 640 . 680 Kennedy Dairy Co. . . Keuffel 82 Bsser Co. . . . Kohler Co. . . Kornhauser, .Alexander Co. . Lawrcnch Lunch. . . Lewis, Henry. . . lVIcCabe, L. S. 82 Co. . . McKillop Art Co. . . . . Madison Packing Co .... Madison Tent and Awning Co. Marquette University . . . Massal, A. Jr. . . . . Menges Pharmacy ., Milwaukee Drug Co. . Milwaukee journal, The . Minch, Hctty .... Molloy, Dj. Co. . . . . Morgan Bros. ...., , Morse Twist Drill 82 Mach. Co. Moser, Paul ...... Moy, The .... . . Netherwood, H. C. Ptg, Co. . Northwestern Mutual Life lns. Occident Baking Co. . . . , Olson and Veerhusen Co. . Orpheum and Strand . Pantorium Co. . . Perlman 82 Kaplan . Photoart House . Portrait Shop . . Print Shop . Piper Bros. . . Reierson, C. R. . . Republican House . . Rosemary Beauty Shop . . Ruud and lrion ..,. Runkel, john F. . . . . Savings Loan and Trust Co. Schneider, G. W. . . . Simon Bros ..... Simpsons . . Speths ..... Standard Fur Co. . State Capitol Cafe . . State journal Prtg. Co. . Stoughton Wagon Co. . Stitgen, Ben S .... Sumner 82 Cramton . Teckemeyer Candy Co. . Thomas, Carl , . . Thomas, Sidney E .,.. Thompson, A1 .... Trostel, Albert 82 Sons Co. . University Photo Shop . . Unique Shop .... Warner, Paul S. .... . Wayside lnn ...... Wisconsin Foundry 82 Mach. Co. . . Wisconsin Life lns. Co., The . Wisconsin National Bank . . Woldenberg, G. A .... Yahr and Lange . . . Y. M. C. A. Cafeteria . Zeigler, George Co. . Zilisch Pure Milk Co. Page 701 641 656 649 639 680 639 665 694 639 693 641 67 2 691 660 642 691 661 688 679 67 0 691 65 6 692 67 9 697 692 691 689 683 694 695 67 2 689 660 691 645 660 650 696 660 680 65 1 663 679 652-653 644 691 639 680 668 65 1 693 664 689 639 69 1 689 64 1 689 6 5 7 697 63 8 684 658 667 270 261 A. C. A. . Acacia . . Achoth . . . Activities Section . Advertising Section . . . Administration Section . . Administration, Women's , Administrative Officers . . Agriculture and the War . Agriculture, College of . . Agricultural Literary Society Alpha Alpha Alpha Alpha Alpha Alpha Alpha Alpha Alpha Alpha Chi Omega . . , Chi Sigma . . . Delta Phi . . Gamma Delta . Gamma Rho , Omicron Pi . Phi . . Sigma Phi . Tau Omega . Xi Delta . . 251 . 199 Alpha Zeta . . . Alumni Association . Alumni Magazine . Archery . . . A. S, M. E. . . Army . . Artus ...... Athenae ..... Athletics .,,,.. Athletics After the War . Athletics, Womens . , , Athletic Association. Women s Athletic Board ..,. Awema ...... Badger Emergency Board . Badger ln the Trenches . Badger Staff .... Band, R. O, T. C. . . Band, S. A. T. C. . Barnard Hall ...,. Baseball ...... Baseball, Women's lndoor . Baseball, Women's Outdoor Basketball . - .... Basketball, lnterfraternity . Basketball, Women's . . Beta Gamma Sigma . . Beta Theta Pi . . . Birge, President E. A. . Blue Dragon . . . Blue Dra on Cottage . Board of'Begents, . . Board of Visitors . , Bowling, lnterfraternity . Bradford's ...,. Carry On ..... Castalia ...... Chadbourne Hall . . . Chemical Warfare Service . Chicago Meet .... Chi Omega .... Chi Phi ..... Chi Psi ..... Civil Engineers' Society Class Rush .,,. Classes .... Clef Club . Clx bs . . Cociirane's . . . Co-eds ..... College of Agriculture . College of Engineering . . College of Law .... College of Letters and Science College of Medicine . . . Commencement Exercises . Commerce After the War . Commerce Club. . , . . Commerce Club, Womens , Commerce Magazine . Company A .... Company B . . . Company C . CBoolc Index . 349 . 500 . 564 . 265 . 637 . 47 . 84 . 54 . 66 . 65 . 303 . 558 . 528 . 494 . 562 536 566 . 552 . 506 . 502 . 560 . 446 . 588 . 277 , 259 , 581 . 155 . 454 . 294 . 195 . 195 . 249 . 250 197 . 524 . 623 . 278 . 266 , 287 . 175 . 336 . 234 . 255 . 257 . 211 . 243 . 256 . -l--49 , 470 50 318 . 349 52 . 53 . 236 . 342 . 6 . 302 . 334 . 178 . 227 . 556 , 510 . 474 . 582 . 000 . 85 . 328 . 571 . 347 . 317 . 65 . 69 . 73 . 55 . 77 . 85 . 62 . 575 . 325 , 275 . 161 . 162 . 163 Company D . Company E . Company F , Company G . . Company H . . . Company I, Army . Company I, Navy . Company K, Army . Company K, Navy . Company L, Army . Company L, Navy . Company M, Army . . Company M, Navy . . Conference Track Meet . Consumers' League . , Congregational Students' A Contents Page . . . Copyrgght . . ., . Cross ount ry . Daily Cardinal . , Dance de la Fontaine . Danci Decor ng .... ated for Valor . Dedication .... Dedication of Muir Knoll Delta Delta Delta Delta Delta Delta Delta Delta De W Delta Delta . . Gamma . . . Kappa Epsilon . Phi Epsilon . Sigma Rho . Tau Delta . . Upsilon . Zeta . . . ark's .... Died for Democracy . Doings of the Devil Dogs Edwin Booth .... Ellsworth's .,.. Emblem Wearers . . Engineers' Club, U. of XV. Engineers' Club, Chemical Engineers' Society, Civil Engineering After the War Engin eering, College of . Equal Suffrage League . Eta Kappa Nu . . . Euthenics Club . . . Exten Final Footb sion Division . . Binblem Wearers . a ..... Football, Review of Season Forensic Board . . . Forensic Season, Review of Foreword .,... Fraternities .... Frawley's . . . French Club ,... Freshmen Ofhcers . , Frosh-Varsity Gym Meet Gamma Phi Beta . . Gamma Tau Beta . Girls' Glee Club . Glee Club . . . Grady's . . . Green Button . Gymnastic Team . Haresfoot ..., Headquarters Company Hesperia .,.., Hockey, Womens . . Holloway, Majorj. D. . Home Again .... Honor Roll . , . Honor Societies . lce Carnival .... Illinois Meet ,,., lnbad in the Orient . . Indoor Conference Meet lndoor Track Team , , ln Memoriam . . . Inner Gate . . Page 702 ssociation 164 165 166 167 168 169 190 169 191 171 192 172 193 225 324 585 7 2 215 260 379 5 316 554 544 498 512 448 480 478 568 344 11 188 281 348 251 580 583 582 70 69 326 451 327 82 202 304 290 9 467 348 577 153 241 546 538 329 288 351 321 240 280 174 297 254 156 21 353 443 256 228 625 232 231 29 364 Intercollegiate Conference Medal lnterfraternity Basketball . . lnterfraternity Bowling . . . lnterfraternity Track Meet . lnterscholastic Track Meet . Iron Cross ..... - 496 Joint Debate . . Junior junior Kappa Kappa Kappa Keysto Officers . Prom . , Alpha Theta . . Kappa Gamma . Sigma . . . ne .... Ko-ed Kapers Lake in Summer . Lake in Winter . . . Lambda Chi Alpha . . . Langdon River Anthology . Last Shot . .' . . , . Law After the War .... Law, Colleffe of 73 .,.. Letters and! Science, College of Letters and Science After the War Library School .,... Literary Magazine .... Lutheran Student Cabinet . Mahoney's . . . . Marines ..... Medicine After the War . Medicine, College of . Menorah Society ' . Methodist Students . . Minnesota Track Meet . . Minor Sports .... Mortar Board. . . M. P. Company . . Muir Knoll .... Multer, Lieut. W. W. . Music, School of . Mystic Circle . . Navy ...... Navy Prom ..... No Man's Land .... Notre Dame Track Meet . Officers, S. A. T. C. . ' . Omicron Nu . . . Organizations . Outing Club . Over T here . Over Here .... Owen's Pan-I-lellenic Association . Personnel Company . . . Phi Alpha Delta . . . Phi Bela Kappa . Phi Beta Pi . . Phi Delta Phi . Phi Delta Theta . . Phi Camma Delta . Phi Ka Phi Ka ppa Sigma . ppa Psi . . . Phi Lambda Upsilon . Phi Sig ma Kappa . Pi Beta Phi . . . Pi Tau Sigma . Psi Upsilon . . Philomathia . . . Physical Education . Platform, The . . Press Club . . Press, The . Prom . . Pythia . . Radio Company . Red Domino . . Red Cauntlet . Red Mill , . . Regimental Eagle . iBook Index . 198 243 . 236 . 248 . 229 . 459 292 . 143 . 312 . 548 . 542 488 . 317 . 349 . 246 247 518 . 597 . 700 . 74 . 73 55 . 56 . 83 273 . 586 . ass , iss . zs . 77 . 584 . 587 . 226 . 237 . 460 177 . 316 . 186 . O00 . 465 . 189 . 194 . 589 . 233 157 455 . 443 . 253 . 395 427 I 346 . 466 . 176 . 530 . 444 . 534 . 526 . 468 . 482 . 490 . 472 . 447 . 514 . 550 . 456 . 486 . 298 . 81 . 289 . 578 . 265 . 312 . 300 . 173 . 282 . 320 341 1 276 Continued 1lOyCC'S . , . S. A. T. C. . . S. A. T. C. Frolic . Scabbarcl and Blade . . Schneicler's . . . School of Music , Senior Oficers . Seniors ..., S. C. A ...... S. C. A. Ocean ofjoy . Sham Battle .... Siggelkrfs . . . Sigma Sigma Sigma Sigma Sigma Sigma gllgha Epsilon- . Delta Chi . Nu... Phi . Sigma . . SkiiClub. . . Skull and Crescent . Soldier Specialists Sophomore Officers Sororities . . Spanish Club . . Special Occasions Spirit of Sacrifice Stage, The . Star and Arrow . Student Council . . . Student Court . . , . Student Self Government . Student Senate .... Summer Sports . . Swimming Team ,... Swimming Meet, Conference Tau Kappa Epsilon . . Tau B Theta Theta Theta Theta Theta eta Pi . . . Chi . . Delta Chi Nu Epsilon Sigma Phi Xi . . . Title Page . . Track Track, Women's . Triangle . . . Turkey Race . Twelfth Night , Union Union Board .... Vodvil .... Useless Steamship Cardinal Van I-lise, Charles Richard Victory Prom .... W. A. A. . . . W. A. A. Activities , Ward's . . . White's . . . White Spades ..,. Winter Sports .... Wisconsin After the War . Wisconsin Athletes in the War Wisconsin At Sheridan . . Wisconsin in the War , . Wisconsin Engineer . . Vfearers, Women . Women's Administration . Women's Athletics . . . Women's Commerce Club . Wrestling Team .... . 262, Ye Ca thlnn. . . Yellow Tassel . . . Y. M. Y. M. Y. M. Y. W. Y. W. C. A. Cabinet . C. A. Dormitory . C A., Army . . C. A. . . . . C. A. Activities . Zeta Psi . . . Page 703 350 155 286 458 351 76 87 93 309 621 181 345 476 453 492 504 450 579 462 179 149 541 576 311 30 279 457 308 307 305 306 238 238 239 520 445 522 484 624 452 516 3 221 258 532 214 283 310 284 194 10, 47 312 250 264 347 343 461 332 51 200 182 352 274 251 84 249 325 242 340 319 572 573 574 322 323 508 WW r wmm KOX IIYXNW Mnmsaw wus A -I Vx gimxnxq in - X l H A ff + ' A X 4. .1 N 1 ' V' ' . I 'Z ' , -,g'.' L .Z 'q'. I l ' I .I .g 'tl . in 1 f '. , 5 3' X . - .., yf w'- ii , .. '.n ' , uf - r . ., 1,-,, .1-,mn Q ,,. .' , H Q .J Km' . . 5 ' Ii al 'gc A '-.nu FM 5 S ,gf I 1 Q39 :'2'h,g X. X -ff-n., !. ff '... .. v Q - ' . Ls- A, . 4- , 955. ,'a..' ' Q
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.