E-Yearbook Home  Quick Search  Advanced Search  Quick Browse

Stanford University - Quad Yearbook (Palo Alto, CA)

 - Class of 1928

Page 1 of 498

 

Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1928 Edition, Cover
Cover
Page 6, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collectionPage 7, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collection
Pages 6 - 7

Page 10, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collectionPage 11, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collection
Pages 10 - 11

Page 14, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collectionPage 15, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collection
Pages 14 - 15
Page 8, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collectionPage 9, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collection
Pages 8 - 9		Page 12, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collectionPage 13, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collection
Pages 12 - 13		Page 16, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collectionPage 17, 1928 Edition, Stanford University - Quad Yearbook (Palo Alto, CA) online collection
Pages 16 - 17

Text from Pages 1 - 498 of the 1928 volume:

“

EL ' ,ff 494' Xi, M55 F052 f iQ?- ' 21353 ' s Z JJ COPYRIGHT 1928 BY HERBERT REYNOLDS AND F, MACIBOYLIE I.EWIS ' PRINTED IN SAN FRANCISCO BY THIS SUNSET PRESS ENGRAVED IN SAN FRANCISCO BY THE STERLING ISNGRAVING COMPANY UNDER THE SU PERVISION OF HUBERT j. LANGTON A Y GNW7 fa 1 T ,Zip A, Y 1 ,W , ,, , , A ,, ,W , , ,,,. ,mi 24, , 4-..,. , :'-' 1 7- - - X 1 1 1 '1 1 1 X 1 1 1 1 11 1 1 111 1 1 1:1 11 1111 11 11 1 3 1 111 1 111 1i1 I1 ' ' 111 1 1 11 1 11 1' 1 1 1 1 1,1 . 1 1 V1 1, 111 11 11 1 1' 11 1 11 11 11 1 1 1 1 1 1 1 '1 1 1 1 111 1 1 '1 I1 1 E1 11 ' 11 1 1 11 1 1 11 1111 1 ,1 1 ' 1- 1 1 1 1: 11 1 1 111 11 1'f 111 11 11' 1 1 1 1 , 1 1 11 1 1 11 1 ' 1 1 11 1 11 111 111 1 11 11 1 1 11 11'1 1 1-1 1 11' 1 1 111 11' 1 1 12 1111 11 111 1 1 1 11 ' 1 1'1 1 ! 5 1 i1 1 1, I W 1 '1 : 11 11 1 1 1 11 1 1 11 11 4 :'I1 E.'5.'1' 1 n 1 I 1 , x 1 ' ' I .x 1 1 .i n w lu L, 1 4 I I 1 . , 11 I 1 , , ra -,J 1' .1 .lf Zifs T NWI Z' 1 , 1 . E, . VL . NJ., , 1:1 , . 1' iw r! i, f-.- ,,. .W... .,' M m,.L: .. ,,.,,.. . 'ai' V- L-if, ,.-1113: .'fx 1.42, rf EZTE1 ,.,,.i.. V 'Q 'fs-Q Y ' YL .X A, .l xif1f1', '11--'LJ1 VOLUME IOCXV PUBLISHED JUNE NINETEEN TWENTY EIGHT BY THE ASSOCIATED STUDENTS OF STANFORD UNIVERSITY PILEFPLCE TANBORD UNIVERSITY is too old to be collegiate, but too young to be venerable. The graduate school is challenging the supremacy of the undergraduateg the traditional friyolity of campus life is reluctantly making way for the machine of modern educationg therefore, the presentfday University is something ofa paradox. llfThis Quad contents itself with recording the thirty' eighth year of colorful undergraduate life, and offers a silent toast to the Lower Division. '63 565' 673' i 3 ri:'-' 5 i Q'-,L 3-V ' 'J -. 11,f1f1E1:11v f 1--'1'L:.f ,xl', 1.1L:'g rj-Jj ,t,ug.32,-,1,.jF 3 - ' VY -' 'T - A ff- 3 f 4' t- - -..-'F' L- --'i -'fw' 'l':.-. U,,'er.g'.'a,, .:L,- ,pf 9. wi,-sr? ..5..,.:u.1,'I..,1g,,, , - .- -- ' : - ,4 ' -' 4. -, . ,-,,:,,.,.,,- .-- 4..--W4-f --, .f-.. -,C ,.T...,, DEDICATED TO HERBERT CLARK HOOVER '95 E who were with Hoover at Stanford saw him sacrihce the accumulation of extra marks that he might serve the organif zation of student life. From Commencement, We watched him with the keen eyes of friendship, followed his rapid rise and saw him early forego extra wealth that he might serve humanity. GfSince then, We have looked on with the rest of an appreciative world, feeling that we of Stanford especially can understand the spirit of Hoover. CHARLES K. FIELD, '95 o u' o f'x i CONTENTS INTRODUCTORY PRELUDE CHAP TER I Administration rf CHAPTER II Classes ff CHA PTER III Athletics r r CHAPTER IV The Seasons f 1 CHAPTER V Activities CHAPTER VI Living Groups 1 f CHAPTER VII Societies 1 r CHAPTER VIII The Bawlout Rf .az ww, -L-1-L---1 1-1-:rss 1-N1rL':'.a-',1.g.' 7-1 'L- -5' 1. ' . L . ,- 57 , '-1.3 : ,--., .fr If mv: - M -Eur, 11: 'Erf4f.Emsw -1-..1.n.'-V Emp'-I.: -, R- - an FACULTY CEPHAE D. ALLIN CHARLES HENRY GlLBER'F SARIUEL MINTER UNDERGRA DANIEL NEWELL BENTON . . '29 DON.4LD PORTER JAcOEs . , '18 SIDNEY ARNIAND MERCIER ....... '30 GARTI-I DOUGLAS WINSLOW . A L U M ALDEN H.-XROLD ABBOTT . . . 'OS SIDNEY IRVING AGKERRIAN . . 'O3 HENRY K. AXTON . . . . '3O CIIARLEs FULLER BAI-:ER . , '03 DR. WOOD CARSON BAKER . . 'O3 JEAN BART BALOORIE . . . 'OI PAUL JAY BATKIN . . . . 'Io GILBERT THEREON BENSON . . '21 THOr.4As FRANKLIN BERRY . . . '97 ROGER ELLSSVORTH BLACKEURN . . 'zz CONRAD KAUEERIAN BONTZ , . 'I9 HOWARD SELDON BROwN . . '13 ALBERT EDWARD BUTTERFIELD . , '27 HENRY GUY CARLETON . . . 'O8 EDWARD GUILFORD CARY . 'I4 CHARLES LESTER CLARK , . 'O3 XVILLIAM RUSSELL COLE . , . . 'og CHARLES WILLARD CONVERSE . . . , '25 ELMER ELLSWORTI-I FARMER CREIGI-ITON . '95 LEwIs ATKINSON DOUGYKERTY . . . 'O3 RAEEURN MILLER DOUGHTY . . , '23 ARTPILIR GRDEVENOR DUNEOMEE . . '26 ROY PIERCE EDWARDS . . . . 'I6 LEWIS PLIRIPTON FALES . . '31 CI-IARLE SCOTT FRANKLIN . . . '15 PROFESSOR THOMAS BRUOE FREAS ..... '96 RICHARD FRIEDLANDER . . ...... '16 IVLRS. D. E. GALLATIN KBERNICE L. STILGEEOUERJ , '19 DR. FREDERICK AUGUsTUs GRAEER . ..., '89 DR. MARION OWEN GRINSTEAD . . . '13 DR. WILLIAM JAMES HANNA . . . . '89 CHARLES VINTON HART, .... PH. D. '17 ANSTRUTHER ABERCROMBIE LAwsON LIONEL RERIOND LENOX PARKER DUATES GEORGE CHARLES RIEGE . RICHARD F. SANDWICK . VICTOR EARL WVALKER . . . . . . . '28 NI VANCE HICXIN ..... MRE. RICHARD HIscOx CLUOY WOODBRIDGE MEANS, RULIEE STEPHEN HOLWAY , . HARKEY WALTER HUSKEY , . ALICE WINDSOR KILIEALL . . MRs. EDWARD LAYPORT fLAURA ADELL.k TRUMEOJ MARIONLESEEY , . . . . MRS. RAYMOND W. LONG KMARIE LOUISE REESEJ . WILLIAM DOUG:-IERTY MGCANN CHARLES FREDERICK MCCORLIACK SAMUEL HARDIN MENDENHALL . EIDE HINRICX! MEYER .... SEYMOUR THOMAS NLONTGOMERY FREDERICK CHARLES NELLE5 . . WASliINGTON HENRY OCHSNER . ALFRED FRANK PERRAULT . . JOHN RANRIN ROGERS . ISAAC RUssnLL .... THOMAS SANBORN . . . LACLAIR DAVIDSON SCHULEE . EWART GLADSTONE SINCLAIR HENRY EDGAR SOUTI-IwORTI-I THORI,-Is RICHARD SEALDINO , JOHN HANIILTON SQUIRB . . DR. CHARLES ELNIER STAGNER . RALI-I-I HEWITT XVARDALL . MRs. WEQITON S. XVILSON fGERALDINE M. CLUFFJ . . ROISERT STRONG WORTHINGTON . ARTHUR ELIAS YODER . . . MRS. HOWARD K. ZIRIEIEREIAN fANNA LAURA BENTON, . MRs. LEWIS T. HAYES KELIZABETH MAY GILLMOREJ 'cg Q19 127 :29 a 09 ,ls ,O3 'OG T04 'os ,Os In ,Qi 17 ,24 1 I 21 O4 'H 4 : ,Oo os 1 s 19 O4 '12 a I : : I I 1 I 1 17 11 OO I1 26 Ia. OS IS I2 27 I6 V PRELUDE A r o K . OG, dripping from the thin green fingers of the eucaf lyptus . . . The hills bef hind the campus, crouching to drink from the lake, their furred haunches black against the early morning sky . . . Thin white Veils drifting across the bosom of the Water .... Chaotic little murmurf ings of alarm clocks and awakenf ing students .... High heels tapping to. eight o'clocks .... HE day clawclles through the ebb tides of ten o'clocks . . . gaining time on the evening. Reclftilecl roofs, trees with surprising foliage. . . . . . . challenge the blue of the sky. Smoke goes up in frail wreaths above somnolent groups on the green before the library .... In the Catacombs, portentous words drop . . . heavy with the Weight of learning .... Noon, with crowds of hungry hom' ing students .... 'T Low afternoon . . . time rests luxuriantly in the still sunshine . . . the Wind walks softly. Corridors of arches stretch tranquilly, their dignity unbroken by the irreverence of activity. Light falls with ainazf ing whiteness across the face of buildings . . . golden Helds ruffle like a petticoat around the quads . . . silhouetted trees against the sun . . . faint footpaths in the arhoretum, only wide e n o u g h f o r one . . . V 1 VENING, and the greenness of the sky changes with the alchemy of moonlight to black .... Trees supplicate the rising moon, their music the sounding stillness of the night. . . . Live shadows cower beneath the grasses .... Clouds, passing across the horizon .... Silverld leaves, blown tremulously by small Winds . . . the flippant noise of cars . . . The deep en' chantment of warm winds . . . I J N J , W RCADE on arcade, each with a nimbus of light . . . that pauses before it pursues shadows down the vistas . . . lost itself, with the ghosts of darkness, in the long corridors of arches. The familiar colors of inner court fade to one silver, obscured by the dignity of moonlight. Qver all is flung carelessly the coat of night, tapestried with stars . . . F 1 N W w 4 1 l r w Y Y w MONG the carven branches of the old whispering oaks are caught the wraiths of ancient moons . . . stardust mosaics the paths . . . distance lengthens with the darkness, filtered through the plurnage of the trees . . . The haze deepens, and in the gathering of shadows, lurk susf picioned shapes .... A glowing cigarette, tossed carelessly away, shatters the magic with the asterisks of flying sparks . . . I 0 4 w 1 l I X I . N the temple of the eucaf lyptus, the hours are heavy with dead memories, are clad in the thick dark robes of mystery .... In this sanctuary of night . . . the eucalyptus, slim vestals of romance, store the forf gotten dreams of whole races of students . . . guarded by old fences, grown weary and cynical with the years . . . Only quiet ref mains . . . - v 1 Q 1 i IV1 I., ,1 I: , , 4 M ll Jw l,l g '. I ,I -.- ., . V k -. . W Y ' ' ..., ,IM fx I 1 ! I I is I I I I II I I Is II I I II II II, I II E! I, I. II I i. I ,Z ,, I Ii I II I I II 1 I I I I I I II Il I I 3 II I1 I I I W 6' -fgififi I Q 'T :Lili b V .gf ,A Q44-5,5 --H A 7,7 I 2 -W- 'i I gi-up 1 -L4 - JF' i'f1,, 14- I, I , I' I ,1 if v, fl ,,-,,,, ,- ,, f-if--W -Y -l- .-. X. ,, ,WIT iii- ,. V .- P g -A ' g, ' - v4 -if -1- :g. 'V'--4 - -Ie-if - -' ,- M LIZ- -'29 '+ ---,, ,,' f- i...' - L, 7-f ?'N ' - li-29 .W 5 'ifrf'-.1- - E: f 1 f sv ' 111i gr I lv L- gba I 37 I f I r- F Aff W-far-'eivg Y-, .YW , -, , ,., 1 .,. ' iwiz---'fe- 'T' .- l g - -' ,Y , Y -f- P,- -,.W, jj V ,..4:f.:'1-g4I-E- .Q ..- Ig 'MJL I , Q. , ta, , -ni r,-?,...Q:-P 4'-fir 'K' - 'T -'- '- L., .gi---,mf- - ' YH ' xx V.:-1- Y- . 1. I I I I I I I I I I II 'ife suis ce qui a Ete, Ce qui est, et ce qui sem, Et nu! mortal n'a encore leur? Le voile qui 'me couv're.n O Veiled Omnipotence! Dread Mystery! It is not meet that mortals comprehend The dark and devious Ways of Deity. Let it suffice that no one shall offend With Bacchanalian revelries that Vex, Or seek in paying tribute to placate Thee with a sinful offering of checks Without sufficient funds. Thou hast our fate Within thy grasp. If thou but look askance Upon our deeds of evil, we despair! Think we to stay in college? Not a chance. In vain We moan or lift our hands in prayer: Our dearest alibi shall naught avail. Relentless One! Inscrutable! All hail! H.S T -24. ww :kr 1 c 7? up ui .U FAN :Y -. 3, ' .5 -5- at?-5 Rhea 'Tr- zvgfwfgg ' H5 ga-W f-an W 'kwa xi- Q 4 .- J 1 1 , sw -.,,1 Af NZ, WW .fa ,3- Jlghx 1 Irvin- r 1 rl M 'S -' r' I- an 7 'xx -,Fw 43111 4 - -X -f-Sabah W W J vm .fvf 3 11 'e w- 5 -zz-f m F 1 ' n f 11. UA 5 v N vw .si 5 44 -f-'-A 1 F Ev :Jaffa Aagggngvgsawgxwch yE-EQIQEBKQA-2 . me x , Q, A, jp. - --f -,FW Nhfyw' Mfig-vfi'-w-Ui: X 'B-N , ex'- J KY ,'f -f 1 I 1 L 1 K- N . YQ: rgx Qiafev x x X4 ,r My if .- 3 -5-if .Y S -.fa 4 41 , N Theft? Wx hw- 11.2 ijbdc 1' x rf' 1 .3-f Lynn, 57533 -dx? if 1 -Q M x -rag fc W , li? 4 Q 4 UE, Mi .- '11 ,--. x di? x--M, 'ww -34 ' -.fx elif :QQ-..c 2-54 Q' 11.41. 4 a A 'S rf , X. ,WK 4 Q. K ig, s JS' 1-:hd ' if 4,1- , .. -Nr 'ix-.G V cm? F fu-gag? 'ww-AW , , li:- - if xr' flip 1 'FEP no we ,- -as fx ,ki--V1--I x 'Q -L 1 .1 e r 1 -mn A ma-F17 -. Qtr' 'K 1 pk 1- an-,L 476 61, 4 wa 'V ..: , -G1 , -Y . .. Rf x .u Q-rg, .Jr-J , la ,,.. N fb 247, 533, 1 1 ,A 44 'W Q. r N 145 if? E- 45-, 'ff'-3,- if fr- -1- brag .,-Y iw M.. M 1 c X4 , I W W' 3 355 ff K' W5- PIJK -,za 1, ,N r-r 4 r As? 2, . X 1 59' -ffr - 1 ff fi 3' fzcgj 1355 M, Q, rv if, 1' t K? , eg fx r H R9-5 lift: iii:-s L K 5:15541 'fri J - faqs? -Q.-'W-5 K-f Y JJ A f if J, L EP? lu'-bf EX. 1 li 1 1 V+ - vu -Ku S. Tl 4 H ,feeiv ,N U wa'.J n N 435. F 3 swf?-' 13 Y-L 1 3. 4 ffl re 1 1 , -1 m-,ar g4f? -f,r 13-Er 42'- -va'f V '2- M' 41, 5-165-241 .t U H-2-73 -mt' x f 1 f -w- .1 ur -. 1. 'fu- '-e,x C' 1 u.- .f .- 11, ? , X my aw 1, A .-oz-Cf f5.- .Mgr-p-. Ig? ,, -L , J, Li-mg Eljgxggg? J 6 -xg?-Sigh, 'S ff 5129, 'r S P if 'fig V-v in 'E 23 -3 igiigwzm 1 - 4'-V2 T gm 5 5' :LJ awk, MV' -mfr! L' vazv T' x v 2 ,a fx E 15 K, -5 'E Jufgf I T-aw 1' 3 s '73 4' ,xc -,ix JM if-rf wi' 1 - W ' sf we-A .- 3 1 1 3 4 Hu- ' :Inf we-fb, W3 'x '94 . 2. E fin, W 7Ylt 'D .r,-gpg, H-GJ 'f Y'-1,4 ,, -, x- ,fl M-.M A. -3 .,,.- If 1.5 5, 'Lv H, 'iv J.. d?ri 'o- I-'4f3,,i, , , , f' 11' ,. yi : ' 4 If XA, fe, '1-1 4 - .J w 11-'J 1 , 233 ,Q 4- if , H A 'EI 5 ku! - si, ,M - l ,wg E2 im ' if A 9-.3 ng' 544-an A 1 Q. 'f 5' -., 3433 4-19 in fi N5 Agggtfizx UM, 11 ia! T I L ,wx T1' fn ALE, f-K.-L ras' .--Qu. wx sxng W5 -we Q3- ,sl AQ is J QMS- 'eiiifahx 513'- - . -ff'-1-2 5?,1..,5:f-'- ' -.-. hkiaffaifmkx 1 ,s ' Er 7393 -'Arr-'11-uwq.y -m-rw-www W We L' - -Q -- - t A 55 3523.--E.. ,- -fb , 1-we -jb- 1 -za -J 'W 'I -fR?1 'p'ii.'5's'f'E51 'V 'H 'YM ' 1 -, 55 1 - , dvr A A an xl f W. M 21 -.544-U M ' fi rm 41,0 5 fr 93:4 W -me Q, -, up : ,,,. wap ,M R '2' ag.:-TL-7 , 'Ll ll- J O-F N t 'F -. - +as..-1'-'ri--w--l'5 -,1 .uf W' -..,,, 'I - 2 BM as-.x 1. -SE 'G-54 lf-, - -1' - .. MM- ..,,----5 X - L an--f , .-, f -f 5 -L-I f f' 'hw v. 1 'L A-, Q- -rm i-'br 03-J :Sf x 5491- ' wwf: .. '13 ,aw- -yf' -'Liv vu -J-v.-Lv -q-gg-.-f -1- f- w-luv JI? j 'A ,e 'v.f. '1'r:' ' 'AAP' A-1:1 vw 4442 V il 21-103- U. - xg Q E mg A 4. 2-1 new '-rwrr '3-rgif 'V-f-ti vv 1 an J- gi 2-5, rx K may Nfvgx pq 0 ', ,-.-2. -T f-,ze . , - .1--Q51 -:,...'-':f,--fm--,'g.,:.z. ,.-, ,,-- . .J Hr.-Ni'-. ' ' -'17 '. ::1f,-I. ' I-I' - '. '-2 A-1 y- ::g,,:g'.Fq, -.. :-- 'f:1.-iv.g---- ff- .. .. Q ' -Pc :-,Z L .:z1 fx. ,-.:..'---...:-.-2,.Y-1,--11,-:-. -.1 .- A .sv -f - - - - - - :- -51-J r,.,, ., -ng-5 .:,i3?3:-1:,:,45.a2- 0 t, . , - .,., , M , V in Y: s. I .. .i X -, , L. . 1. I , X .F G., f--:c:t'I' '53155 -3..:-:gi Y... ,A X 6 I I. ,Y .Q 4, Q . X 1 -5 Y I , 1 A 1. : I, 2 s 5 k Q 4 -3 5 fi. --42..?d-Q-L-Q-..:. fa -1 -'::- sw-.-f .s 1 ' 3- 1 , - J 'Q .4 '- . -- 1- , ' 1- -' - - .4 e .. -:IHS - - .rf ' i Y - 1-, ' ,Q-1 fe, ea 'fha zz. + P... 5- L, -V -- V 1 li fi ww -'- -of --:.S:' 'K.:4Q.-.- . ., ' ,. , -.- , , ..-5, E ,,,., . -.- .. ,,,,.- .. .. - ., -...-..',,...L.-.-.-. ..----,--I.,--,,.,...:--.,--.f--mpg-qw'-:-'Q .-f,--:g----.51-:.E1- -151--:WDia--1--f5LrA-'1- 1rIr',S:'E',3 , .- - . .--f.---f--.-gr, f. --fu -- .--+.-- - - - -2: -r - - -. - - . , , r 11-f- .-aw .mn fr,-.I--f-, -. af-.-1:21--5-f -mg:-,---, ' .u a f - . H-' 54--:,f1z'--.M .e1...::1 Q -:ax-Z 52: I-Ly .. . V -'fa-: '15,--' - .U lv- - 4 -1 1--'uf ::a.mf', . ,J -' ,,- -- , , - - sf 5 'fp-'-H-wg'-,,-L .5 1'+' ,- f-- . . ,.- .31- - .a f-xl:-1 MET? ' f'- - -L.. 'F' , is-'5- . '4 'e. u ' Q -:M -' - ,X-H W, a-M-1:2 vei1air'-i1: 1 '9f 5ffv' Q- 5 -I:-.1 Q -1 ,,.,. -35.7, 3, -,g ---'-sg-44,3 rp' 1 121:15-11' I - .- 2 -4 - -fp -,Z-' - ,1 ,- - 14'-.7 --1 My ,N 51 -fin -,i -.3-2-15 '.1f1:1-5,2 - .-if-as . f x 552 .-- Y-J' ' f-:-72Em5ga-1ff- .f .-:-'ci '-J -:gr .:-:,. ,ew-. . 1 411-,1.-f-few -..51,:n,s:11ef':5iL--:bk sq,1'a,-4 .17 ..,-L if - 5 ..'-:S-new. 2 Lair' -1 . -w s' .- ,.-1'.1.--:if-i: ?f'-?'if' -: 'sir :----:WA .- L- Z- fe, i-:I'i:m?f'.-'- - :si --'fs-f am - ' ,....::1::::-1:11: 11-,, X 'T1..::-5-ff -Ei: 52:23 P1 - . xv' - '4::fz::3-.'g+?.1q-f-::-5-.:-F7----'15--1-1. ,.-gre : 1 ,- 3 z : 5 - ,-' s 1 rw.:-.. .r,-1Nairn14,1L-,N-,nfs-.-5,--pg-:fg Q4 .54 .-,, K -wi-4:1-, ,- 'i .Y -5-.-,52,j QQ -' .955 3 5 55.-f',-51.0, ' .- fi:--., - . ' F? 1 'ki 15.5 -f f:5i?'r.- 3:43 Mil: f'-I HH - ' 5 .- . if 1 -pig-g,f Ag,a-1--1 5' ' 22:35-15.-,.2' A --. EH-if,:1.zfe:-1g:1-'sw Q ,wise 'L 1,-YZ? -'gi-.,. -: .1 1 ff ---' . ---- A- 25:5-is 'f.- -Q 1- W- -- 2 - -:fi .. 1' '-Ein 'F'-1-'Z-I-Qzf:-in ...... I - ' J-' .4 I.. 4 ? 5 :-H ' -.-,.--f, 1,5--1,-. --1 - A4-.U 1 ,:--,,- .74 ' fzyzz- 1 nip- -:- '- 11. 2. -.2-z 2-: - -' .: 7--.- z . f. f .. .- 5 4 -. iffffiff ii'-gal an '-rw I ii' :Q- -. -. ..1.,'- -- :gf 45:1 -','Q.4i' 1i:-4F.'f575'2t1S',':- 55.3-3 5' ' .WS--' 35a:1iL -5 :-fz'.,ve:?. ', .r- -:Ng -1+v:H '- fi' ,S 4-.. --'aft-5:-'-.f-'1-prf--ef-.eg :gf .-fee-.Q-es--1r-1-2- -'-1f-.':1-- ,Qi .- xgg, fi. L J 'aw F5-25 1' -' -fcai---1, ,Q ' 5,:, 34-,311-fi ,-M9--12.15-. -1129-41-gf3:-.'i--fj12:2-- -'-- .gg fi-'fi ' 35 9555.-3 . ' fr' '-M ' ', F -f i wii 1. f7:E55'S ,JL EEI Fi' -T ,fiff-1551 'f-i'E'ff52'2:f.-1f7fff1:2- -, TQ 43:1 . HN 1 - - -:fi af---........:1---1--Q. sqft rs -aan . 'ir-2:'a-Zgffff-frf-a-:fi,zi-1-'---.'---'1 f' I -' .--. --- bf -' , --Ui 1--1 . 'e -. ,f, , .sz --. - ' QL- 5' f' ' :g.- 'E :-:-Ef:'-,Q:2s- ---:--:.--..-A-,-119+,-g-1a'f--'---1-:::.1'..' 1- --.2 - -f - .- 'Sf-f -2. f , -2: ,:, -,-- ' f f- -1--1 .... 1 .::. ,mv. - ,--f f him :,-1.--.-ff---H -1--'- ,--: -I' z--if -- 1' .-5-VET -U' -1 -.-. , ,- -, 1- , . -f.. . .1 ..-, , , ., .,,- ,, ,,,,. , .,, Q A, ,, .- ...,-,.., -y --2 ,-. - -gf 5,r- 5.-f-1'-,Q---5-5:2-1.1-2455:-P 1-re - , .a--if 1g ff-3.-g,gt4ff1?3 -3 jr' :1. fff ' ---:1 -Fifi 2' . :S ak fel?-1:--. -'15-'rin'-:Y-if-'i - 55:5?- - 2 :5 41f4II:::53'Z:Gii1i1fs?i Q-'fi 'T' ii ' 1- vi' . uv- . ,g.gf1 'L -- 3 -5- --,-e:,-:,:-.1-,-1--, .c f-5,-,rfr-fy.-,f 22-- ey. 1 y ag- - .-1.1511-'--5,-.-,-. ,.:gL3-,..- , ,-- : 5 -- V. 4 -.-- - -I -v 9---f -- , .-A-,-,. -J-,--. .... ,--rwzsf,-35 ,--.aw .E--1 , -, -gv..1-,:-f...g.:- - -1-ww - : A---,, -: f, .- ---, ,,-f 1-.-, 1- :,.-g -2.5 - -: -, -2:-'-Q:-1-eff fag' if:-2ag s'1 niffrrffa-1 -El--fx 1'--, -fffe '-221:--f--1:'!a12:f:1::M ' . -1 .Y -t-42.i.CZ:':'f--7+ 1?- -S'-1--wth. 5- ,-. --.5-.4-.-r -.. -.... f -.T ., .. .,.. - -- ,J - --1-2 Q..-J.-,., 4. ,K - , 123, m .-vc-Q --, - . .- -- ,.- -ga -:Pw--.::f 1. -, .. '3:.:' ,:g..af'1E--fir' 1 -A .f-2--nf-. 015731 -- .,f'f-w-L1-22'--iw.13---N-.- 4-.1-a-1---D-.wg -ra,-rzf---... '11-,-, -?a:-1-1:--:f::Jl1f,-aw',5is.'-g,1:::'x,'2' :Y . .,2f ay., 1.1121 3 fffagknltw' ,,-- f-::g, , 1- 2- - 55-2312? 4- ig-ug, v1gf,gQ4.':5J,'3g,3z35 .41 115, -1, ' 31, -,-'z-1-:--Q,gi-1:,- 'L -..gy ',,Qf5I-i.Q:,t- 11.45 F 52 .-5, 1' -51 ,,,,g '.--, . 1 21152: ,... ,Q-LE .., - 1, - :-.'.' 3-,:-.,1zi5'-'.z-fe---.x.XL'-. 1341-10:1- win .. ----3-.-',3:'1.1-:-.- '-. 1-gain '-f., - Hg' 3 . - 5 1 , .-1. - ,K , w-,L Q.-1 'Q -1 H gh- ',- .- 5 - -' .f 555- W '.. ,,-5j5.,5:-,.,:,-a:.--,- 57:2-5,A.,gg-:,-gf, Q,-'--1unify,-::L..-gn '- -15- 5-aw. A , , , ,, ,Q ,X .:' .z- af W fi :ffffg j.12.5jf-fgjfi.,'GWpc'-Fi-E-13:L2?.1-2' 1-f, ' ,A 5--1 1 1e1' 7,Eax'q1'fa:-.1ff,'.-, .twig :-',---1' mf :'-:2.'-fj5a-I:- -.j'-fs F . .4131-' ' RF: ' ,,,. z , .- if r1'.'::ifi. :K AN.:---'..-f'.-12-, ---XV-., ', - . .2-:ffm,-:L-311'Q-P-ii'.,1'-v:?f9-WL -1, '-42:1-1' 'i :T-- '--:.':-'rn --1.1 -- v-fgf'a.- za:-1-5:59-n -.-.2-'Q'--5' LZ- 'J--'f lr-' me .-: y--'E-1 yf-1 -1 S5-:Q-EfA::::::5IQ::ii..-::2Q-r-s.- if if H2525 NW ff: -5:--.Z'.-'F' .,.-'- ',':'- 2. -viii.,-2 V.:-'E-E-iigg -'N'-1 u 5, ,ff A -U 1- 2:7 -'ii?':-FL:'?-17' 2711115 '351. - f- --u 172:11--- .... 3. F :5L5f?r 3511-,hr - :'f -1 - -'fzliff -W5 f , v--- f-'?1.-- ' - , 22-svifzwGf:,v.5'12'i:':Fff'ffm' 51' hw'---k.1: - A-ff --1'-pf. :-f-.':1 ' 1--r tif, ,HZ -.n-!1+:!L-- f- .'2' :. - 1.x rf -: .' 1 1' .- r -1 .- fa L' --f .af-'-' :.',--A--.-m . Q . -2-.-.--.4 -- '--F'-. .-X N If .-1-.-2-1. A- wa- 1-. -: ' -- 2: K 1. ,. '. -eg.z',--u:'!1I ' - -Lf., '1-:fir-. '-A.-' .I -2f' ,t7'qJ:f,. . -1 1: mf: -aria-1,, ::'31F'E-:1f'2L: . ff' f Q - ' 2 ' ' 1 2 21: 2- :Lau - . -3 -' -'-.-. mfma -. - ug-gg-.gf.f2' fJ , air: .P-fi - -.-- -, - 1,qi11g.-LJ? ,-3 1, 391 1-Regex 1, , Lia ig, L -'g,.-.1-,.f1 -:Y :-.-: 1.5: , -- ff ' -- -W I 1 ,- T9 :Lzz13q.gi,15I Mist.: - ttyl 1,31 '-'-:I-ffg-:LE-gajlg-Q ,kj-. I 3-1' g lg , '-fE2-if-?':?,q1a'i5:g'.'.:..--':n:'i 'f-zi5..'4 -,-'-1 ': E' -.e T-,1. f 1 2:'y5'?:.3 3125,-:. - - 11:---11: . -151, ff '11-115.-. l -- gl af 'e-61-31:19-j1 -.'.:I::- f:f'f'l2' .-,L-5-v -1- '. - f - , , , --if-zirrgggrgsws guy -',:p qv- ' -'Q-Inf. J -- - -2-f - 14 .- i .2 :N 4- r,-:seas-12.f:G.-::fa1 -1'--m - . .,.,,.ff' W, Yi ,..g -ir, f F -af 511 , '7 V . -Aga. Mizz.:-f' 751- 'iff w- 2 Q :wi,ij1Q--QQ - ,,' Z 2 ' i :T '. .-LIE-18:25-rf' --.-e r -ig : -A 312 -11-efa-Zaie-,QA 15+-vi: iz- -'--1152, ww, - .- , f'1 -Qab14.::y':-'e-., e-:i ff 1,-5: '1:sr-.pm3-'- yLg-.- . -, ,,- ..-1 ' ,- -,.-:-we-2-1 ' .na-1 ,Lf ' -a iQf - -1 11.13-:.1--R,:'-an - . .. .y --. '- - '- --'ui .. -3 ig!--fi:-.-4-n-,235--1:ns:yas -. -,e - 3 -q-z,::,:-gr.,,J..:- . . 1. . , -:- 1 -9-:J-Q-.M 'IU':fi'.2'5:: .:','6' .f - -F L 7 'f:.-,li-:i-5'.-9,4jf-fi-. ., 'ZIV , gf- il -I-f' 4-E-. K KFTQ'-Lx'-K5 . Hi-591. ,-ij. 3.15 'X , .L '-'I-nf:'ff-'5-Qfv:-'-2,' ,'.' '1 -,-' .1 P .1 4,1-I ., ,J-., ..,. .. .-. F 1 :. 5, - ,fu .. X . .,, . ,T ,. . - n,.,-,,.,,,,.,- ., ,H .W , .-. ..,,, 4- 1- .- 2-:szfwg--5-f,-.ef -ar .--em :in - . f, x ww' - .. 115' WW- 1:11--1-1 :gi- '---1512--new -'-1-if-1-:sag 1 1-r ,2- .. , N 4. , ,gg .,. . .,,. ,M,,..,, .., . x , . K., ,, , ,- , . . ,. ,- .f , , . ,,.,,.,, .1 - .,..,,,,,,,,.. , ,f , 'S ,, . , , .. D...- , -a.iqa1 ,, f-.a---z.-a -. r if g:: ,sf.-:v:.Q,m:- ', - f 1,1 if A-41-.gig wa-1 .9-1 fwf- - :um . ,, -47 ,ff -1- ----gr'--Q,V --.ff-...gi-rr,-:af .f. - M ., ,. . , 'A 43 S- A 1 :L . 'v2rf:'- ,if ..-, --5 gg- .,:- t'?-5-e1:?:1:-f w?-L --',-1'--Sflvf-.isia-. 3a1-fif-,ir1f'4-,-i- 25 -tn .if ns.-2-' 215 -1,' 1'--: i'-..441u1-cs - -' -1- 1:!g.'1.,, 1' tw 1 - E v 1 1'-9 -yi -A --.1 Qu., tart- 19.35, fl. 55:11 -11:2-E.'. ' 'egg 5-1 P--PS-Es-1 - 13 ,L- 1-1?-I-e,: ' vs- :-' :4:', 'Z -1, -.4-5 312-g.:e'L21:. ,A ,jg -1.-. --yr ':, ,- F V -+ A :r-.55--'P if-'f-.' -:-1-Q Esvi -51, 1:f5'f' E5v2f:f3 Y- 112 -1 1 - f 1 ..'.--'Q r-H-ff' 1-2:1-2.71m -,--ai:-:E-ag, . 5-I-41.5-f:1mg'w f -5- 5 ' - ':'E'-E.f'x- -'F: F1f-21152-2-i-ij' ,f41a1:aaC-11' V 1 -1. --Zz,-' -Ei' --i 45 .- -2-iz:-. ,M-,-.' .x .-4, -A 5 1g.1':E.Z-f:-:L ' :.'-'- Ta- -.JL 4' ga,-r-: '-CJ,-5'a14a'. Fw: - '-I -1-1 1- 'X H f1'f-M' ' : - C- 1' M- ff- -55--' gl 1 Q- r 74- ,-55 Q.-,-A3 if 34.1-frfa-gixg ' , ,.f,?-TR '--gf-A .1--1,-L,:.--.3 . 5325412111715-,if 55 ,Q -:fJ:,p,,:5:-rg-5.-'.: gg:-:-sa?-2:4 .- -- A..:-ig--p ,,f.. , Ep . 4- , f --H 1 Af- -4 sg a,.,-was-1:-.fa , Y -..---,ev 5'4'1f 'f7 ,' f-:-:fr-.gr--M 2- a- -5 -. -, ' r - :. 1 -1 -. ,h 1- e1.f.--..--- 4- 3. - .- :.. -f--sv.: . .. Nh.-:H , 1 -: e ff. .ku .1-.-As 4 .-- - -11--e,,.g.-, . - '- 1-N v ,rp -- ff ' 1' - 'iv '-sm fTfe'3:g:1'.'2a-z '-f'i'i5l- 'iff-f 'f' 1151? i lk f'-M 11 '--i iif.-. -- Q N 5323 '35 ,F :iii i'ff?'1-:5E1i','1'l'Q' ' y .W f C. - ':-1-2--, ' 4 -':. ' LZ , - -1- .- -' 1 -' '-:-.R . . '1f15r,g.,::a.' 15:51--a -'f-'f 2. .'q.'E1 A'::-,- ac 9 -5- -iifa.-f , ' eg ,,- 3 fd l f,2:aa:.-'1 a5j -s:,1?' ---..-.ti-z :A 'Y '7 . 5 52- 2 - Q-: J 315- -1 -1 .-, 455 ri' -' 1'-'fiiiit' 3'4?igf:51':L3, -'-:ggi -41-. ' -2' :f ix-5 Eng T?-Mai- -PD-' ae' -if if :.:-1: 5:1-:-.-.gan-53: -azivfzi'-'-13: 51 fi 5:-54 : -' 2,15 -, .gyp- 'i:'- 'J - --gr 4.1, '- .qgqgyz -E:,:.,2.'i'4gv'-'1 . : ap- '5 1' 'lagfgz-,Q .5221 -5-- 1- , I 5137:-. Qbgw ifie.-ff': ' ' 12' :'- ' 15 3 , '-5 gf 51 .4'.1:,1, -pg: 2331- 'g7.?.a,-s ci? ,, 9, .fi:'zaa'f':'?ii i-Qfzff p 'figvffg-1: f-2-.i315 3'3g'-- P1- igeg-131,112-:Z 'Q 1 'fff .-5.1579 1 ,- '-1- -3-, - .?,'y1:f-' f' 5' Z, .51 - 1,-.Q-'-z 'f: ' -, ,1 150 -2- 1 26-53:--,. 1:-12. ' WJ!! I jr' 1-- 'Rx '- ' JL- -a?:5i?:,' 55:5 5,2 ' -2 qz- :Ace Li vii- ' 135-1:- i-my-'F Q -Yyrf if A '-iff .2 322 1 ,iii-.Eff 'I-1 -L.:H-:-vi fa, ' fr- .' Xu 1-ft---si 1- 115 , -rf'--5 . ici ,if-1-1. .1-':- ii-.ffpi-:Q exif- ,. W ana-5 ifsesgg -J-1'-J: 3- :,-1 3:-. 4-va-ggspre Ffh ' L- 5+ . . .Y -' - z-- ' J- -via-1 rf'-2-9 ,.Q1.'1'fr-.-Q ' ,-H - -5 -- if L .Zin-sf, : .. ' lie- . ' A 3- ' ' ' . ' -. 1 iff- . . if 'fi 42-1 -: 3 P '-.- QL ,a1:. es' 52v ,jf2'-5 rv 3: is -' 3, ..,' I , .zg .Z-- :.' .-5543,-, . f-:J -1 H113-gggifjg'-cj:,1fg,..3,5 1.1:-:J , - '-1'5'F2Ei1?i?1Q,,2:'zf V :-.r -. , ,5 -. ,, .v:: 23: ..2Q,::g A' ..3- 'Q -1' .-I, fini?-: A:::.':111- aff 'irc' -'fi f. '-- li -4-f-'31 Z1 ' fi '-1:5 2--42-:Sq-,212-:----If .1-:Za :-6:1 .- -. -4,9 zf?:: 1-1- .1S512.fT' ' 51 'A ' iv?-Lf '- nc- u f-..-1. f 'i.e.' - if -' 'f1 'A-'wi '-I 12:11. 1-1 1- - -an 'ziv---295551-uifv 'Q Q - -- - -- .- :.-ef Sm:-If 246 Q- -- Hy: ' -:- .----,.,, L f---r--3-f-Mg:-.- , 'K ya- . :agyfs gx ---Q -:,.f- f aq: .-ap- --4, ,-irq:-1 --'-.2 -' I, 55, . Ar? 2' 3 -gf' -f.:':-f ., - , .f5.'.l'-:,Tr,1.'1f :Q . 1,:a ':,, ,Q-n.,, 1 isfqm'-:---f ,x, ::,' -,--3: ff I-e-. 15 :31-' , -3325, . -- f. -. ',: . -- ' -: ' 14- - 2--:str ,.g'a:.3::w.r-,'. 3,5 ' A -f:-:fin-5-gf -1 , 8 .1 -.-- . : -2-1 1. -L, ' ,g-- .-1,1 :4-- .,.fsg -' f.-' -. -.A,,q -Q., ',! -5-, ..- - ,L--1, -1? ' ' -1: .3?1:::'.f-- --1-1. 4 -1w:,.Af' -.,N,p -- -- -' gn -. .-:- ,:q . .M-, -Gia:- ,Ez-'t-2-f .-::'- :- il ., : 'ga-ki? ef- '- --IL-'Y .C ,..., 2 . 1 . 1,,.. vig- gihra' -'E' , . I' , L :-I.-.r :i ff ZA!- 13:- -is. .545 -::-3Y:: 'ij.1gg1g:' s3'k 'i1?-E:-'P 'Q-' 1' ,-: 'jf 'I' .1 Q .Q-Q7'g.'- -.3 :JJ .,-5 ?:S 2f3-gg i-.gf, 13-1 ,gg Q . ji. 4 .:a , .-, g. y y -:-5 , 1 5353 ' - mb,-, I. 3: I f- X- 5 -6- -2 . .. ',. ,- AQ- -. -5. . - :mm yt, 31,-E.,-, ,,.-V .:,i, ,-5.L3- 'nm -5 1: .31-j,,--, -f' Lf - - --' H -. :I 'r H1f -, , .L . --1:L-'.- '-1f1 1'5.g, . an., v 1: :.' -1:1'- '.-' 911 112 ' f-MF 'JEYS'-. SE-f,'5'?'f' YZF -z' i f ifff?H551-55P'Jf-91-5-W-'5i fi L : --41----5.-'Q' . ,I 3.41: Jium :I-: ffif- '-2-I gwf pazy -- -,-5, LW- . -. D ,-gh., .:m-- 53:-5,,',-,-1,g,:- A, M 4-5-wa- f 5.-3-119 1, f , - ---, '- ,g ar--fy 7:---..: gy!-9 , - 2.1.iMcv'1-.-:SQP-'L Af, xg, Ip ' -4 ., 'f ' ug!! ff H ' Fa -1 924: ' ' .3-1'-':-'ff wr -1- ki. .4-f-. - ,f .f 1 -' S-1 e--as . -. ' za - - tl - ' 'f- I-af' --:'- 'e 3223? if .ma .'.-.l- :ei-1'-,A--f 5-im .G-:ff '- ' Q2 fffm22af'fii2-- -39' 1' ',,,1 ' - 1' U J - 14 .' .' i', 'fir -2- if-9-15 vii- I :',-:' pq--:E 2 - ,952 -- xv , -' -J -7, Q1 5 .--'-1-'f2 ':-'-' 1-f-3 1: ,,g -11.rx:z2g-nr' i,-'.:-:wr 1---fr---.-me-.---wp-.-. 1 1 . 'IfvP':z-:-:r-s:'1a',et-'va' fs-152 fa, ff- 9 fl-:I---1 -u -' g f:-:-1-. 'E1 '.-Q fu--fl --. g .r..',r-1 : : -- -,Fw r ,-,g-1,- 3-1 ' , , r ,.,, . A ,,.,,, ,,,..,J,.,, ,, , ,.....,,,, ., ,. W.-,.,,,...,m P ,. ,,,.-... ,, . . , ,....,, .-- ,. , 1' ,-: -,Elm 1931 .-,fel .5--Fjgj g,f,5g:gg3,Q2-'--',,'g'1:1 ..1 .1-mag: ,'.'-.',-.-.-1- 5,15 gf.-.5 gi.,-rlgjgqg -1,-Q-'J--5, 'I .Lx:,,,,' -gig--,izifgrygqib i.,j 55-fg35 ..::.5:vg5f1' 321 1 ggi.. ', '!f1,s,t1 Q --:'w31g:.:j: ':, ,1.--7 g - - if -rjgrs -. -. ':, ' .f ' 4 -E' az' ,1'v11Et,'f'- QT ' Q-I--33:15 Q- SIN --'Q-.f,ii. - ', 111:-1E'. :-1-- '- 1.,- ' . 1. ' ' fx -Q ', -,Z-'.:.. . ' Q ', Lrg 3- ' I ' . 21 'mm A--:':g' .'-w , f - uewf-xg, f ., f' gi- -flux:-.1w '-,ff-'ii2K':-.pva-3.2311 2 - W-5' A -5. 1:4-24'.f-. -1-'1-'-- -- P 7: 't12::'-- f-gf:--wp F' -: f - - '-?.:-1-' - -'-:::: -:,--HH,.- 1 -- -F'1 'f - ' '1 - aw ' ' .- -fm'-.-Z-I -- - I-. .- 5'fff':s: -:El--A' - -- -' 12'j ,.'a' fif- , ,- .:. .1 gg-fx-1--.5-M ' :fi--'--ffwf .mffv-. .:f!'.. A' ., 1.-I .- 11 1.-,-12:11 .Q -- -H ' . .., -- tg..'z-55 2- - I'-:.. '- . '::- -pw, 'J--. 1-lg-. ,- 5 '.- 1-11, -1-I' ' . 5' .g'4.'.f- a.-.3.q--:,.5'-f--.--s,-:A :g.,-:-vi ., - 2. ,1 ,l V., Q-. .,.,.r1-' ' '15-,3--33.3,-gif,-1,g-, r-- I - -11, E3 .-1.111 3 ,mp 1:13 .3-f.-gg. -2-5, juz'-' 'IM q.Q..f-- bg- ---'- '-:r,-z,.f'g125r,g.zgy.,2-::a5xafw':z 4.41,-fa '-1-':-159.13 xs5gq'f-:-- 1-: -2:-.f. - --1:1 .-5,-3 ,Q-1. 'za-:Q-T:-n' -- 1- ffsv ---1-'5 ' -wx.:-H-1- :sez ' -:-,.-.:a' -.f:.f::u'5:1 1--:Jyy-:.,-24,41-,'ggP:''bra' 125-4:7 ,.,-, .i3v:3y,Wf?,5:-f:: V' 5.y.f - 1'-3',g513y,.5::,-:gi -1 :. ?- , f' U' .1 L' -' ig, 5 1 '.,i'-f E ff , - - 'Q -: gf 5 '1' s ,jp g :sf,'f ?., 'f Pi: -1 .- -1 , . .ie xi'? Pf - '-p f? 'W ' nf QL. -2. .-:H 'xf f. .-f--if A-fn:-1.-ii.. Q'--.-A-:4f,:fj.' 5.1, we '-if I.f-ig, I .y- . . Yr 5 :E 251 : in 4 12., .S -7,-1 Q is -4 .- - -Hp, 143, v f. ' nz -'39--:cv -- f --sf: 4 Q ,1 fa.-. Nw 1.-- pf .135 r-:Pm -wb - If - -- -- :..-Eh, gf- sw. , Q- .J i.-Q 5 ,sf -.:: f! ff-r..,-? ,J,'5j:,, -5.-,D Estee- ., z fifwr 'Z :- -szsfzar -:ff -r .,-.-f,, - 1, A e J- : -2r1.':-:-.-?Z-:,---wif -Z-1 -'ff-'91,-2'-2-f .:. c.-Fri. 1 -ff,-.. ff-If -2-f, .-if '---'-S1-.-w -f-1-'2'E1:-.ws-.11 -rg:-11-'-':g , --I -i 1 '-212-. ' 3. ,-Q.. --'5-'xn1,11?m.f- , 1:'rTf'..-:- -5.1. :f -:'. q-zzg.-2 -'1 f?'iC -5 .741-:ry JW, -,-114, .Hifi-w:9:'-',,--,,..-.,.-5g.,1-,wfgfzf-gf.-135,5 ' f--:aw '-3-11.11-f?pb.2ff-Q :f1:rif-1:'f,.4-1fiQ.-- 222122.-' -52'-fl--ff -- Y ,- -w ' .f'f?g',V' is-r -1 n-4 -. ,J-.7 5 bi N 7' .ff no r an - x aa-Q THE ADMINISTRATIGN By M wrgafrer Wood VERY year means progress at Stanford. New conditions are constantly arising, necesf sitating changes in each department of the University. The spirit of advance has become one of Stanford's most prominent characteristics, it has lifted the University to the eminent position it now holds. There are some who maintain that this conf stant growth is due to the fact that Stanford is still young, and has not yet reached maf turityg there are others who believe that Stanford will never be old, because its unceasing spirit of progress is the sign of perpetual youth. Now that admission to the University is being determined more and more by sheer competition, there is a continuous improvement in student ability. Each year finds the entrance requirements more stringent, each year a larger number of applicants must be turned away, because of the growing number of accredited men and women who desire to enter Stanford. Those who are so fortunate as to be admitted are therefore all well' fitted to do college work. This means, naturally, that there are few disqualifications, and an unusually large percent of each class returns after the first year. I Particularly significant is the recent growth in the number enrolled in the Upper Divif sion. From all over the world come advanced students to Stanford-juniors, seniors, graduates. They wish to specialize in some particular department, and often do research work. Yet many of them, no matter how much they may deserve to be admitted, must be rejected, simply because there is no room for them. To meet the needs of these advanced students who come to Stanford because of its superior advantages, the question of the elimination of the Lower Division which emphasizes a routine elementary curriculum, has been raised. So it is that the chief problem before the Administration this year has been the plan for reducing the number of Lower Division entrants during the next few years. There can be no sudden change, but each year will see fewer freshmen and sophomores registering here. When there are so many junior colleges in California as well as in other states, that are perf fectly capable of handling the first two years, it is deplorable that a university of Stan' ford's rating should spend its endowment funds on elementary college education. Palo Alto has already instituted the first year of junior college work, and will soon add the second year. On the other side of the University, a private junior college is to be built, which will make the University of the future almost entirely selffsufiicient. Naturally there has been considerable opposition to this plan, especially among the alumni. The main objection is that campus life and college activities will suffer, and that the University will become exclusively a place of research. However, the Administration feels that there is no such danger. The graduate students who come under the new plan will probably remain here a longer time, on the average, than the present undergraduates. Since the different departments are requiring several years of graduate work in preparation for a profession, students coming as juniors will remain here from three to six years. A more integral college group will result. The problem of breaking in the freshmen, who now come to Stanford with no conception of college life, will be eliminated. Activities will not suffer, for by slightly altering the rules of eligibility, athletics, fraternities, dramatics, and all the other activities can go on substantially the same. Under this new system, says President Wilbur, 'gthree or four years at Stanford will give the man who wants a cultural education the opportunity really to get it, rather than to cover the ordinary college course which has been so blamed for its evident inadequacy. Fortunately, Stanford is not hampered by either state law or tradition from making this change. The other leading American universities will doubtless follow in the future. With the increasing number who feel the need of at least two years of college education, the higher institutions find it imperative to take this step. It is Stanford's privilege once again to be among the first to lay the plans for another great progressive move in higher education. DEPARTMENTAL CHANGES THE most significant departmental changes during the last year have been made in the Schools of Education and Law. In 1927, the former Department of Education was merged into the School of Education, by act of the Board of Trustees. With the formation of the School and its division into four distinct parts-graphic art, education proper, edu' cational psychology, and teacher training-a dehnite organization has been built which forms a separate unit in the University. Stanford has long been noted for its Education Department, and it is believed that the change in organization will bring still greater credit to this branch of the University. In the spring of 1927, the Trustees provided for extending the law course to three years of graduate work in the Law School. The new legislation provides that the degree of juris Doctor shall be conferred on students who have received the degree of Bachelor of Laws at Stanford or a first degree in law from another university of recognized standing in which the work for the degree covers a period of not less than six years of combined academic and law study under the direction of the faculty of the School of Law. This tendency to inf crease the number of years of required graduate work can be traced through all the def partments of the University. It makes possible a more general education before graduation and a more detailed and thorough study of one's major field in the graduate years. ENDOWMENTS AND GIFTS THIS year Stanford has been most fortunate in the number of gifts received from men and women who are vitally interested in the progress of the University. Thirteen new scholarships have also been added. Particularly noteworthy is the Laura Spelman Rockef feller Memorial, which has made a grant of SI70,000 over a period of five years, for ref search in the social sciences. There is a possibility of an additional S8o,ooo from the same source if equal funds are obtained elsewhere. This fund is being divided among a number of faculty members who are carrying on a series of studies in their respective departments. Extremely important are the new Daniel Guggenheim Experimental Laboratory and the Jacques Loeb Laboratory at the Hopkins Marine Station, described elsewhere in the book. The Library has had its collection enriched by five exhibition cases and 210 volumes of finely printed books, which were donated by Mr. Albert M. Bender of San Francisco, and a group of his friends. The increasing amount of financial support that is being given the University proves that its friends and alumni have great conhdence in the future of Stanf ford. Without their substantial funds and endowments, much of the extensive research that is being carried on in all departments would be impossible. Six years ago, members of the alumni pledged S'700,000 toward the First Million for the Stanford Endowment, with the understanding that the Rockefeller General Education Board would contribute an additional S53,oo,ooo if the alumni fund was raised. For the last six years that goal of the L'First Million has been a beautiful dream, and a dream it still remains. Since some of the alumni have not fulfilled their pledges, the 57oo,ooo fund has not yet been fully paid. The Glass of 1927, with the aid of the Endowment Secretary, formed an endowment plan that should prove very successful. Each student is allowed to pledge a fixed sum to be paid annually after graduation to the Alumni University Fund. The Glass of 1928 has made the same provision, and it is hoped that each class in the future will pledge its share to the growing endowment. The obligation is purely a moral one. The senior signs a pledge to contribute a certain amount each year. The Glass of 1927 fixed a minimum of Eve dollars annually. The Class of 1928 has made the amount of the pledge optional. The principal advantage of this plan is that the University will be able to count on a definite amount each year and will be largely relieved of the burden of soliciting alumni contributions. Other advantages are that the gifts will have no strings tied to them by the donors, and each graduate will feel himself, through his pledged annual gift, a contributor to the welfare of Stanford University. THE PRESIDENT HIRTY'SEVEN years is a fragment in the life of a university. Stanford, from its very promising beginning as an institution set down in a wheatffield by a rich man and led by a young scientist of power, has gone rapidly through the growth which has resulted in the University of today. All of the extensions of the early efforts of the pioneers have been progressive. Every new department, school, or institute has been on a higher plane than the one from which it was derived. It has been necessary to keep on top of the educational system if a university of high degree was to be maintained. The development of the Schools on the basis of the old Departments has given a breadth to the work of the University that has attracted many professors and students. The out' standing development in Stanford's growth as a university has been a qualitative selection of faculty and students and of the Helds of education in which they could do work of a high grade. ' Although we now have schools of Biology, Business Administration, Education, Enf gineering, Law, Letters, Medicine, Physical Sciences, and Social Sciences, the Food Ref search Institute, The Hoover War Library, The Harris J. Ryan Laboratory, The Daniel Guggenheim Aeronautics Laboratory, and large research funds in social sciences and psyf cholo8Y, We have only begun. We hope to see our University develop Schools of Art and Architecture, Music, and Religion, and to organize Schools of Institutes in various fields of research. Stanford's elementary work is diminishing, and her advanced work is increasf ing. The University is unfolding and leaving the college behind. With our great campus, our residence facilities, our scientihc opportunities, our most favorable location, and the advancing civilization about us, we can look forward to Stanf ford as a future world university. RAY LYMAN WILBUR. l , THE CHANCELLOR EMERITUS OR over fifty years, since 1884 in fact, it has been my privilege and pleasure to say to University people a word to remember-short, of course, but let us hope, also true. This is my message today. In every college class at Stanford there is someone who will def mand the attention of the world, and justly so. It is not easy to pick a winner in education. Examinations and their marks will not disclose it. As Dr. J. P. Lesley used to say, You may flourish your college diploma, but the world cares little for a baby badge. No standardized education will serve. Education which is standardized is essentially commonplace, and no leader matches the common pattern. To pick out the best of you at twenty is not always a simple process. Not every light burns brightly when it is first kindled. But there are certain marks upon which you can depend. Four of these are sin' cerity, intelligence, initiative, and altruism. Without sincerity nothing can last. Intelligence may develop slowly, but there is no substitute for it. Initiative involves first the ability to form one's own judgment. One must learn to stand on his own feet, whatever the pressure of the crowd. A man who does this counts as a unit in the community, and no community, democratic or otherwise, can boast of units enough to serve its best purposes. With all this, a great soul has a kindly feeling to his fellow mortals, and is never too great to help where help is needed. Other virtues there may be, and serve good purposes each in its own way, but at the great roundfup in the middle of the twentieth century, you will find sincerity, intelligence, initiative, and altruism in the front rank of human influence. The rest will fill in, each for itself. DAVID STARR JORDAN. V ..,, , Deering, Grant, Gregory, Newhall, Wilbur, Anderson, Cutler, Nourse, Sloss l THE BOARD CF TRUSTEES LTIMATE responsibility for the management of the great Stanford endowment and U the operation of the University's manifold activities rests with the Board of Trustees of the University. This Board is composed of fifteen members who, with the exception of two life members, hold office for ten years and elect their own succesf sors. Mr. Timothy Hopkins and Mr. Joseph D. Grant were named life members by the founders. The duties and powers of the Board include the appointment or removal of the President of the University, the levying of fees, and the establishing of salaries sufficiently high to enable the University to obtain, as professors, men of the highest rank and ability. The Trustees also hold the power of deciding upon any vital change in the policy of the Unif versity, and are at present concerned mainly with the proposed abolition of the Lower Division. MEMBERS W. Mayo Newhall, President Wallace M. Alexander President, Alexander ff? Baldwin, Limited Frank B. Anderson . Chairman of the Board of Directors of the Bank of California Harry Chandler Publisher of the Los Angeles Times Leland Cutler Director of the San Francisco Chamber of Commerce Frank P. Deering Attorneyfatflaw joseph D. Grant President of the Grant Company T. T. C. Gregory Attorneyfatflaw Herbert C. Hoover Secretary of Commerce, United States of America Timothy Hopkins President, Southern Pacific Milling Company Ira S. Lillick Attorneyfatflaw C. O. G. Miller President Key System Transit Company john T. Nourse Associate Justice, District Court of Ap' peals, Division No. 2. Paul Shoup Executive VicefPresident, Southern Pacific Company M. C. Sloss Attorneyfatflaw THE STANFORD NATIONAL BOARD NDER the revised plan of district organization, there are twenty alumni members on the Stanford Board, seven representing parts of California, which contains by far the greatest proportion of Stanford graduates, and the remainder coming from dis' tricts throughout the United States, including the Hawaiian and Philippine Islands. These alumni members, many of whom were prominent in student activities in their college days, are all successful business and professional men who play important parts in the affairs of the nation. ' In addition to them, there are ten membersfatflarge on the Board who are not alumni, but who are keenly interested in the educational advancement of the University. All of the members have been chosen because their 'unusual ability and experience make them exe tremely wellfiitted to help guide the policy of the University. Although they live in widely separated localities, they are kept continually in touch with the program and needs of Stanford. The very fact that they do represent every part of the country makes their varied viewpoints valuable to the Board. ' On April 15, 1927, the fourth annual meeting of the National Board was held at the President's House. This was, as usual, a joint meeting with the Board of Trustees. At this time, President Wilbur presented the proposed plans for the gradual elimination of the Lower Division-the announcement which has elicited such a storm of criticism from students and alumni. At the same meeting, William L. Valentine, a prominent Los Angeles business man, was appointed by the Board of Trustees to fill the vacancy left by the death of Frederick Forrest Peabody of Santa Barbara. The purpose of the Stanford National Board is rather vague, for it is a loosely organized body whose members act in an advisory capacity. It was organized because of the cosmof politan nature of Stanford University. The authorities felt that as Stanford drew its stu' dents from all parts of the world, it should maintain some sort of organization other than the various alumni bodies, the members of which could serve in an advisory capacity to the Trustees and the President of the University. The Board described above is the result of this plan, and its practical value has proved to be considerable. It is impossible, of course, to expect all of the widelyfseparated meme bers of the Board to be present at its meetings, but any or all of them may be called upon in writing for information and advice, and in this fact lies the chief value of the National Board. MEMBERS Richard W. Barrett, San Francisco Charles R. Brown, New Haven, Conn. Nathaniel A. Carle, Newark, New jersey john T. Cooper, Los Angeles A Charles M. Cram, Boston, Massachusetts Perry O. Crawford, Medford, Oregon William H. Crocker, San Francisco Walter F. Dillingham, Honolulu Paul M. Downing, San Francisco Milton Esberg, San Francisco Charles K. Field, New York City Frank P. Flint, Los Angeles William Fowler, San Francisco Walter R. Hamilton, Tulsa, Oklahoma William Koerner, Superior, Arizona Harold P. Kuhn, Kansas City, Missouri Edgar A. Luce, San Diego Kenneth Mackintosh, Olympia, Wash. oi George T. Marye, San Francisco Frederick W. Nolobs, Crass Valley William M. Parkin, Pittsburgh, Pa. Henry M. Robinson, Los Angeles Charles Shurtlejf, Menlo Park Lester D. Summerjeld, Reno, Nevada Clyde A. Swigart, Bakersfield Charles C. Teague, Santa Paula Merle Thorpe, Washington, D. C. William L. Valentine, Los Angeles. George H. Herrold, St. Paul, Minnesota T- T .U ' f -'y jr' - ' -A . , i' . X- --,I Y 5-V, .4 ,E -..N ,.. 6. I. --...,. . klvflb AEN l'.,ii,J,. , 1--.M .T I 4.-4.-v --, 4 w -' -'. 4--1 A-l ' I -' I I f-.V ., 'TJ --,..-.Ll -,V , V - J , 1..,J .. ., -V Mary 'Yost George Bliss Culver THE DEAN OF WOMEN HE office of the Dean of Women is a clearing house for the various interests and activf ities of the women. Before they enter Stanford, they come with their parents to dis' cuss their chances of admission. As Lower Division students, they talk over their study programs and often as juniors and seniors, they bring for advice and criticism plans for their vocations or professions. 'The women's organizations-Associated Women Stu' dents, Panhellenic, Roble Club and the Sponsors-through their officers, consult reguf larly with the oflice on whatever questions of policy and procedure arise, and any of the five hundred who wish bring their personal problems, sure at least of interested attenf tion and the desire to be helpful. The general interests of the women, the Dean of Women endeavors to forward through her work on the University Administrative Committees and through her cooperation with the Comptroller's department in the running of Roble Hall. Altogether, it is a busy ofiice and its best description was probably given by the Dean's Secretary when she remarked, What do we do? Well, all I can say is, we don't do today what we did yesterday. - Mary 'Yost THE DEAN OE MEN N the early days Stanford students were pioneers-adventurous spirits drawn from everywhere, unsophisticated in many respects but filled with a great determination to secure an education. They had not been attracted to Stanford by social or athletic possif bilities or because parents or friends had attended Stanford. Many came in spite of the misgivings and admonitions of those whoamistrusted an institution which taught evoluf tion-a university founded by a politician who also had a stable of race horses. In those times it took some courage to overcome such arguments. Many students enroll nowadays because it is the fashionable thing to do. There are, however, enough men of the old Stanford type here to keep most of us happy in the realizaf tion that the original purposes of the University are being fulfilled. Not all the men of pioneer days at Stanford wore whiskers or long mustaches as their pictures indicate. There were many who fell easy victims to the same sort of social temptations that beset the men of today. In my estimation students have not changed nearly so much as has the general scheme and method of university instruction. ' George Bliss Culver ... . . I .......4-.-.. .-. . ,- , E N -- . 'vp' -v-'W V - - .- Y- i 'S--in J-'Ffh-Z'-'-Pg' 1'-'W . ,. A ' , . , 1' . ,,.. -4.1.....,- -i . - V ,1 ' -:ILT -H.. 5- 1' ' ll' i I . - -.H a. aj' -AI , , J john Pearce Mitchell Almon E. Roth THE REGISTRAR HE outstanding observations of the year are that more students come, they stay longer, but they do not do things on time! The most unpleasant duty of this oflice is the col' lection of a variety of lines for not doing things on time. They are almost all avoidable, and are merely a necessary device for getting things done at last that should have been done promptly and without expense. They are disliked by the collector as well as the victim, and the one request of this oflice is, Please do it on time! Over 2700 qualified men and women applied for admission last year-many more than could be accepted, and with the increase in the number of applicants, the task of selectf ing those most desirable as students becomes correspondingly more difficult. The proporf tion of those from outside our state and from other universities has increased. These are indications that should please us, as they mean that Stanford is gaining in development and recognition. Once admitted, students are staying longer. Increasing numbers of freshmen come back to graduate, and more graduates are returning for advanced work. This is gratifying, except in the case of the women, in whose case it operates to decrease the number of vacancies and is very disheartening to those seeking admission. john Pearce Mitchell. THE COMPTROLLER HE following facts relative to the present status of the Stanford endowment and the current financial operations of the University may prove of interest to the students. This year for the first time in its history, the total assets of the University passed the forty million mark. 'This places Stanford University sixth among the privately endowed univerf sities of the United States, from the standpoint of its total endowment. The total annual gross expenditures for all purposes, including hospitals, dining halls, etc., as well as salaries of the teaching staff amounted to nearly S4,000,000. Of this amount the sum of approximately 32,650,000 covers the cost of administration, faculty salaries, departmental equipment, and the maintenance of the educational plant, and represents the annual cost of education at Stanford University. The students contribute about thirtyf three per cent of this amount, the balance coming from income on the trust funds, and gifts from various sources. The average return on all investments for the year was substantially greater than in 1917, the gain in the ten year period amounting to 867075. This noteworthy increase in the average yield on University investments has been accomplished very largely through a program of careful reinvestment by the Investment Committee of the Board of Trustees. Almon E. Roth. THE ALUMNI SECRETARY TANFORD's Alumni Association, a loosely organized body, exists fundamentally for the purpose of stimulating alumni interest and responsibility in the educational aims of the University. By means of a business organiiation, efforts of the individual alumnus in behalf of Stan' ford may be made more effective, and he is also enabled to keep a closer contact with the University and with former college friends and associates. Uur duty is to find the best possible means of bringing the alumnus into his most useful relationship with the University, and the first and most important step is to arouse the undergraduate-to transform the undergraduate college spirit into the more mature and helpful ualumni spirit -thereby arousing among undergraduates an alumni interest and responsibility that will be an influence for- good in later years. The Alumni Office is primarily a- Service Bureau for the various university groups, trustees, faculty, alumni and studentsl -f Nearly 22,000 individuals are now enrolledin the alumni files, and five distinct sets of records, or a total of 110,000 names are required in order to render quick and accurate service. 2 - In recent months the Alumni Association has secured ,contributions of nearly 520,000 for the First Million Endowment Eundland has established an Alumni University Fund. The entire fund will be devoted to University purposes, to help the University where it is most needed. ' p I ' john Ezra McDowell DIRECTOR' OF SUMMER QUARTER UMMBR Quarter courses were offered' at Stanford for the Hrst time ten years ago. Begin' ning with only a little more than three hundred students and a small faculty including a bare halffdozen visitors, the attendance had increased to nearly 1400 in 1927. Next summer over forty members of the teaching staff will come to Stanford from other universif ties of America and from Europe. In addition to the visitors who are here for the entire Quarter, there is an opportunity in summer to secure distinguished lecturers in many fields who take advantage of vacation time to visit the Pacific Coast. Public lectures are of almost daily occurrence and cover many subjects. This affords an opportunity to explore new fields and develop new interests. ' . Stanford undergraduates have a large representation in the Summer Quarter, and a par' ticular effort has been made to meetg as far as possible the requirements of undergraduates who remain, as well as of 'students coming for specialized and advanced work. , Y i - - - , John Armstrong Sellards L . rt , 7 john Ezra McDowell john Armstrong Sellards Back Row: Leach, Kulchar, Walker, Blumenthal, Steele, Nelson, Hill, Barmore, Van Zandt. Second Row: Schmidt, Kramar, Wardrip Roberts, Brumbaugh, MacKinnon, Gafford. PHI RHO SIGMA NATIONAL MEDICAL FRATERNITY Founded at Northwestern University, 1890 Alpha Zeta Chapter Established, I923 John Adolph Bacher, M. D. William Hulbert Barrow, M. D. Arthur Leonard Bloomfield, M. D. Floyd DeEds, Ph. D. President . . VicefPresident . Secretary . . Treasurer . Class of IQ25 James Gordon Henderson, M. D. Charles Victor Barley Walter Harold Farr Edward 'Merchant Butt Earl Haskins Gray Merrill Gorr Barmore Albert Richard Behnke, Jr. Emil Leland Blumenthal Donald Harmon Brumhaugh Charles Leach Faculty M embers Ernest Charles Dickson, M. D. Victor Ernest Hall, A. M. Paul John Hanzlik, M. D. James Rollin Slonaker, Ph. D. Ofhcers University Members Class of 1927 Alden Hay Alexander , M Dell Theodore Lundquist, Class of 1928 Victor Ernest Hall Lowell Graft Kramar Philip joseph Miller Class of 1929 Clarence Henry Nelson Archie Marvin Roberts Class of 1930 Lowell Reed Hill Class of 1931 James Albert Gafford, jr. Class of 1932 Ralph Lewis David Schmidt . D. M. D. Maurice L. Tainter, M. D. Harry John Templeton, M. D Edward Bancroft Towne, M. D Stuart C. Way, M. D. Archie Marvin Roberts . Merrill Gorr Barmore . . . George Kulchar . John Madden Wright Class of 1926 Leland G. Hunnicutt, M. D. Melvin Ralph Somers Samuel J. Walker Harold L. Weaver john Madden Wright George Kulchar Buford Haven Wardrip Rodney Benton Hartman Donald Stuart MacKinnon John Ward Back Row: Van Deventer, Quinn, Bullock, Sharp, Barnett, Howard, Railsback, Deakers, Newman, Soderstrom, Price, Billi Front Row: Exelby, Downing, Van Druten, Francis, Andrews, Brinkerhoff, Ogden. George D. Brown, M. D. Bernard A. Cody, M. D. Thomas R. Haig, M. D. Nelson I. Howard, M. D. J. Walter Jones, M. D. Ray Scott Clarence I. Barnett Chester Lynn Cooley Perry Arthur Bonar David Emillius Brinkerhoif Herbert Arthur Cilley Lewis Thomas Bullock William Winston Burbank Carroll B. Andrews H. Ellsworth Billig PHI CHI Professional Medical Fraternity Founded at University of Vermont, 1889 Sigma Upsilon Chapter Established, 1912 Faculty Members John Kent Lewis, M. D. Donald D. Lum, M. D. Roger B.'McKenzie, M. D. jean R. Oliver, M. D. Robert A. Ostroif, M. D. University Members Class of 1926 Class of 1927 Oscar C. Railsback Class of 1928 Curtis Byron Gorham Class of 1929 Francis Harold Downing Class of 1930 Luther Glynne Price John Chester Sharp Class of 1931 Paul A. Exelby Edwin M. Soderstrom Class of IQ32 Roderick Paul Deakers Cyril H. C. Francis Stirling G. Pillsbury, M. D. D Aubrey G. Rawlins, M. Lloyd R. Reynolds, M. D. Edward F. Stadtherr, M. D. Henry A. Stephenson, M. Lawrence Gleason William Lyon Thomson Jack Beals Moore Roderick Alan Ogden Arthur A. Van Druten William Van Deventer Charles Francis Sweigert Henry Webb Thompson Robert Wilson Newman Edward Morgan Quinn D. S Back Row: Mason, Dr, Stockton, Dr. Gardner, Borley, Jones, Loe, Zieber, Gibson, Hicks, Waters, Sumner, McDermott, Dr. D. Robertson, Martins. Second Row: Lusignan, Husband, Bramkamp, Godett, Crum, Bennetts, H. Rixford, Cox, Gibbons, Bigler, E. Rixford, Skilling, Chope, Marshall. Front Row: Miller, Hoffman, Dr. Merchant, Johnson, Smith, Read, Davis, A. Reich, Dr. W. Reich, Wood, Atkinson, Northway, Gaspar. OMEGA UPSILON PHI PROFESSIONAL MEDICAL FRATBRNITY Founded at University of Buffalo, 1894 Iota Chapter Established, IQOI Faculty M embers Norbert J. Gottbrath, M. D. Ernest Mosiah Hall, M. D. Thomas George Inman, M. D. Frederick Walter Kroll, M. D. HarvardYoungMcNaught,M.D. ' Harry A. Wyckoff, M. D. Wilfred H. Manwaring, M. D. Philip Hale Pierson, M. D. Rufus Lee Rigdon, M. D. Emmet Rixford, M. D. Clarence Sappington, M. D. Julian Mast Wolfsohn, M. D. Thomas Addis, M. D. Frank Ellsworth Blaisdell, M. D. Charles Haskell Danforth, Ph. D. James Root Dillon, M. D. Hans von Geldern, M. D. Philip Kingsnorth Gilman, M. D. Alfred J. Zobel, M. D. University M embers Senior Intemes William George Burkhard, M. D. Lucas Wistar Empey James Robert Enright Albert Samuel Arkush Frederick Alford Bennetts Paul Edward Hoffman Richard David Husband Harold Delos Chope Louis A. R. Gaspar Harris Davis Loe Ray Cook Atkinson Alexander Bowman Bigler Robert G. Bramkamp Alvin Joseph Cox, Jr. Abbott Crum Kenneth Drake Gardner, M. D. Junior Internes Mervyn Julius Fuendeling Class of IQ25 Albert Paul Krueger Harry Richard Lusignan Donald Carlyon Marshall Class of 1926 William Herrick Northway, Jr Emmet Lane Rixford Henry Covington Rixford Leonard Eugene Skilling Class of 1927 Henry Gibbons Avery Morley Hicks Malcolm Nixon Jones John Carson McDermott Rexford Wm. McBride, M.D. Donald Logan Robertson Andrew Benton Stockton Samuel Marion Martins Marshall Irwin Mason John Johnston Miller Jr. Roscoe Lee Zieber William Artell Sumner Max Archie Waters David Alvra Wood James B. McNaught Robert C. McNaught Jesse W. Read Charles E. Smith Thomas B. Wiper Faculty Members . n gi., .J, . v. ,,. Back Row: Dunn, Boyes, Hines, Hamilton, Roberts, Shumaker, Wright. Front Row: O'Hara, Schomaker, Polland, Carson, Stephens, Bruml NU SIGMA NU Professional Medical Fraternity Founded at University of Michigan, 1882 Upsilon Chapter Established, rgoo Harry E. Alderson, M. D. Rea Ernest Ashley, M. D. Hans Barkan, M. D. Walter W. Boardman, M. Garnett Chene M D D. y, . . William R. P. Clark, M. D. John Francis Cowan, M. D. Lloyd B. Dickey, M. D. William Dock, M. D. Harold Kniest Faber, M. D. C. Frederic Fluhmann, M. Jack Richard Jimerson John Edward McGuinness James Gilmore Carson Ralph Denny Howe Eric G. Liliencrantz Joseph Harold Boyes Leonard Foote Bruml DeWitt K. Burnham Robert D. Dunn Thomas Frank Conroy, Jr. William Delphey John Albert Bullis William H. Collis D. Henry Walter Gibbons, M. D. Morton Raymond Gibbons, M. D. Frank Robert Girard, M. D. Harold Phillips Hill, M. D. Emile Frederic Holman, M. D. Russell Van Arsdale Lee, M. D. Arthur C. McKenney, Jr., M. D. Arthur William Meyer, M. D. William Ophiils, M. D. Albert Victor Pettit, M. D. Merton James Price, M. D. Jay Marion Read M. D. Members in Interrie Francis Paul O'Hara Robert Hale Rathbone Fourth Tear Medical Arthur Ashley Marlow Joseph Jerome O'Hara Third Tear Medical Luke Munro Hamilton Don Carlos Hines Norman B. Leet Gilbert Jay Roberts Second 'Year Medical Cranston Holman Reginald Rood First 'Year Medical Jack Kuehn Moore James Ownby, Jr. William Lister Rogers, M. D. Walter Frank Schaller, M. D. Karl Ludwig Schaupp, M. D. Edward Cecil Sewall, M. D. Dwight E. Shepardson, M. D. Alfred Baker Spalding, M. D. William Emerson Stevens, M. D. Stanley Stillman, M. D. Wilber Frank Swett, M. D. Chester Howard Woolsey, M. D Henry H. Yerington, M. D. Artemas Jacob Strong Phillips Thygeson Walter Scott Polland Theodore Paul Schornaker John Stewart Stephens John Philip Sampson Phil William Shumaker Donald Richard Threlfall Ralph Wesley Wright Bruce Stephens Forrest Young James Sapero Kenneth Strong i' -.1 ...ui ii. , Its.-1. 4, ,I -. rf. -i ' .il 'l -' .'e 5 I--Il. -.kfva L -- L- r r ,. l -W I l l Back Row: Ross, Stephens, Carr. Third Row: Morse, Mills, Martin, Franklin. Second Row: Cowan, Frank, Cordry, Knocky, Hoy Front row: Dr. Blanks, Noland, Krausi, Catanich. MASONIC CLUB OF STANFORD UNIVERSITY Established an Samford University, 1920 Honorary Members Byron Blois Leroy Collins V Newton Glaeser James O. Griffin Josiah H. Kirk John Whicher Faculty Members Warren D. Allen Captain Frank J. Atwood, B. S. Anthony Faulkner Blanks, A. M. George Bliss Culver, LL. B. Harold McDonald Davis, B. S. James B. Liggett J. E. McDowell James Mansfield Edwin Schultz Harry Vandervoort James Macdonald Hyde, A. B. George Carpenter Ingelow, A. B. John Ezra McDowell, A. B. Chester Garfield Vernier, J. D. Glenn Scobey Warner, LL. B. Ojicers President . . . . . . Ambrose Martin VicefPresident . . . Vivian Morley Secretaryffreasurer . . Joseph G. Catanich 1 - ' . ' l ll Back Row: Evans, Barnes, vonEstorff, Linton, Tickell, Brooker, Dr. Rogers. 'Third Row: Kleinpell, Wankowski, Dr. Smith, jam Broomell, Dietrich, Dr. Blackwelder, Dr. Morse. Second Row: Wright, Reinhart, Wilson, Lytel, Paine, Irving, Minner, Briggs, Ba Tolman, Crook. Front Row: Muller, Wilt, Donnay, A. R. Cannon, R. P. Cannon, Huff, Shepard, Maraduclin, Butler, Lovelace. GECLCGICAL AND MINING SCCIETY OF AMERICAN UNIVERSITIES Loran A. Creglovv, A. B Eliot Blackwelder, Ph. D. A Welton joseph Crook, Waldemar Fenn Dietric President . . . VicefPresiderzt . Secretary . . Treasurer . Class of IQI5 Ulysses S. Grant, IV Thomas R. Barnes Charles Willers Briggs W. Hervey Butler h, A. B. Robert Proctor Cannon Edgar Brooker Benjamin Cole Craft David LeCount Evans Overton Barnes Banks George A. Broomell .B. HONORARY ENGINEERING SOCIETY Founded at Stanford University, 1892 Faculty Members Theodore jesse Hoover, A. B. Victor J. Minner, A. B. Austin Flint Rogers, Ph. D. Hubert G. Schenck, Ph. D. Ojllcers University Members Class of 1921 William Erlin Huff Class of 1925 Harvey Maxwell Lytel Maiiuel E. Souza Class of 1926 Donald Rielc Irving Robert Minssen Kleinpell Manuel Burr Lovelace Class of 1927 Douglas C. Hausch Donald Crouch Linton Siemon W. Muller Class of 1928 Albert Richard Cannon Fritz Eghard vonEstorff eson, nks, James Perrin Smith, LL. D. Frederick G. Tickell, B. S. Cyrus Fisher Tolman, B. S. Bailey Willis, Ph. D. . . Roy Eddy Paine . Harvey Maxwell Lytel . Benjamin Cole Craft Alexei Peter Maradudin Class of 1924 O. Cutler Shepard Robert Rogers Wilson Alexei Peter Maradudiil Thornton Seron Scribner Victor O. Wankowski Roy Eddy Paine Philip Wingate Reinhart Phillip Edwards Wright Moroni Jameson James W. Wilt Honorary Members -ies' . 1' - '1 . h ' n-v 4 lx ,as l Q , V l. . 1 2 - 1 , '. 1, , A ,f ' ' , g I , Q- I' .-.1 . X: ,g J 4 V-.al :High gf in iw 'E Il ,- . Q lsuifgv- 9 - 55 . llllfs ' Back Row: Hume, Ricklefs, Keeler, Sears. Second Row: Willard, Coolidge, Klein, Johnson, J. Shoup, Smith. Front Row: Olsen Keating, Farr, Gray, Shoemaker, Wood, L. Shoup, Stanford, Frick. ENGLISH CLUB Honorary Literary Society Founded at Stanford University, 1901 John Breck George Bliss Culver Mrs. Orrin Leslie Elliot Charles K. Field Melville B. Anderson, LL. D. Margery Bailey, Ph. D. Lee Emerson Bassett, A. B. William Dinsmore Briggs, Ph. D. Harold Chapman Brown, Ph. D. Class of 1924 Harford Holmes Hays John McClelland Herman Salinger Marian Farr Madeline Frick John M. Hiatt Hallie Joyce Keating Leonarde Keeler Coit Coolidge Andrews Carroll French Dorothy Sewell Gray Robert Samuel Cathcart David Charles Gardner Will H. Irwin David Starr Jordan Faculty Members Elisabeth Lee Buckingham, A. M. Gordon Arthur Davis, A. B. William Hawley Davis, A. M. Henry Rushton Fairclough, Ph. D. Henry David Gray, Litt. D. Albert L. Guerard, A. B. University Members Class of 1922 Marion Byrns Owens Class of 1928 Sallie Kinsman Herbert Klein Margaret Olsen Herbert Reynolds Jack Wilsoii Shoup Marshall Somerville Class of 1929 Ruth Edwina Hembroff Robert Arthur Hume Class of 1930 Fred Dean Johnston Francis N. Marshall Mrs. David Starr Jordan John Ezra McDowell Henry Lanz Mrs. Henry Lanz Howard Judson Hall, A. M. Arthur Garfield Kennedy, Ph.D. Edith Ronald Mirrielees, A. B. Frances Theresa Russell, Ph.D. Samuel Swayze Seward, Jr. ,A.M Class of 1926 Edgar Preston Owens Edward Anderson Smith Helen Winslow Stanford James B. Tucker Walker M. Wells Oliver M. Willard Margaret L. Wood Clarence L. Ricklefs Robert Richardson Sears Louise Shoup Rosemary Shoemaker Back Row: Schaafsma, Haydock, Dienstein, Gordon, Williams, Makle, Scott, Hutchins, Cooke, Blum, Northway, Schwartz Front Row: Karmel, Kilgore, Holmes, Bowen, Aldwell, Fingado, Spalding, Mott, Schreiman, Vice, Recknagel, Webster, Mendenhall President . . Vice-President Secretary . . Treasurer . Sergeant . Marvin Adams Jack Fingado Arthur Holmes Walter Manniiig William Aldwell Howard Beeman Frederick Cooke Jean Blum William Dienstein Robert Gordon Wesley Haydock DE MOLAY Masonic Fraternity Founded at Kansas City, Missouri Established at Stanford, 1928 Officers t University Members A Class of 1928 Robert Bower McConnell Hutchins, Jr. Class of 1929 Ferdinand Meiideiihall George Mott, Jr. Class of IQ3O Hal Dickson Wayne Hunter Robert Levin Albert Makle Class of 193 I Burress Karmel Leonard Kullmann, Jr. Carl Recknagel Joseph Schick , . . Jack Fingado . Howard Spalding . William Aldwell . Robert Bower . George Mott, Jr. Martin Kilgore Raymond Schreiman Robert Scott Edward Soares Fred Northway William Schaafsma Irving Schwartz Howard Spalding Leslie Vice Glenn Virgne James Webster nv Q - .1 - -- -. - , 0. Q.--s. ax. ,- n l I Back Row: Rathbun, Hamlyn, Karr, Matthay, Bilz, Driscoll, Cecil, Kramer, Scully, Flory. Second -Row: Rankin, McCartney, Dickenson, Thomson, Pepys, Sullivan, Pringle, Harkleroad, Hiatt, Wittenberg. Front Row: Zitkowski, Brenner, Lyon, Bassett, Glen, Miller, King, Call, Simon, Chapman.- DELTA THETA PHI Professional Law Fraternity Founded Cleveland Law School, 1900 Root Senate Chapter Established, October 13, 1922 Faculty Member James E. Brenner, J. D. University Members 1927 juris Doctor Class Harry L. Noland 1928 juris Doctor Class ' August Michael Bilz Frank Randolph Karr Douglas L. King E Charles W. Dickenson William A. Glen William A. Bassett, Jr. Harry W. Call Robert E. Cecil Robert O. Boyd Roval Alvro Chapman John Herschel Lyon Fred H. Miller 1929 juris Doctor Class F. Lowell Matthay James S. McCartney Maurice L, Nielsen 1930 juris Doctor Class John W. Flory John J. Hamlyn, Jr. John M. Hiatt 1930 LL. B. Class Alfred Hamilton Driscoll Dudley H. Harkleroad William B. Pringle, Jr. Frederick C. Pepys Charles J. Simon Ralph K. Wittenberg Harry J. Rathbun Lloyd L. Sullivan Joseph A. Lysle Ansil R. Rankin Frederick A. Zitkowski William S. Scully Robert B. Thomson Baker Brown Cameron Davidson Huneke Huntington Shedd Shepard CAP AND GCWN Mrs Mrs Mrs Mrs Mrs. Mrs . John C. Branner . Clifford G. Allen Edwin A. Cottrell Ellwood P. Cubberley George B. Culver David C. Gardner President . . . VicefPresident . Secretaryffreasurer Florence A. Adams Lucille Alison Margery Bailey Elisabeth L. Buckingham Barbara A. Calley Alice Dodds Marian Dwight Lisette Fast Roxana Ferris Gertrude Baker Aileen Brown Meribeth Cameron Eleanor Davidson Anna Fitzhugh Senior Women's Honorary Society Founded at Stanford University, 1906 Charter Faculty Members Honorary and Faculty Members Mrs. Mrs. May Mrs. Mrs. Herbert C. Hoover David Starr Jordan ' Isabel McCracken Theresa Russell John M. Stillman Ojfcers Resident Alumni Members Elsie B. Fowler Mabel Harrison Elizabeth C. Hey Mary Hull Maybelle C. Johnston Emma H. Kalenborn Alice Kimball Margaret Lothrop University Members Lilian Force Anne Hartwell Helen Huneke Winifred Huntington Helen Kirkland Charlotte Lovekin Force Hartwell Thomas Thorpe Mrs. Harris J. Ryan Clara S. Stoltenberg Mrs. Edwin J. Thomas Mrs. Ray Lyman Wilbur Mrs. Bailey Willis Mary Yost , Aileen Brown . Helen Huneke . Elizabeth Hey Edith R. Mirrielees Helen D. Niebel Dorothy M. Ormsby Mildred H. Roth Dorothy M. Sherwood Catherine W. Templeton Jessie M. Treat Lucille O. Wheeler Margaret White Barbara Perkins Louise Shedd Carolyn Shepard Aimee Belle Thomas Allene Thorpe Back Row: Balcornb, Horton, Higgins, Dawson, Ross, Parker, McAllister, Swickard, Robinson, Cook, Dulin, Born. Front Row Davies, Stephens, Post, Green, Croft, Dornonoske, Marx, Cutter, Jacobsen, Ray. AMERICAN SOCIETY OE MECHANICAL ENGINEERS Huber Ogilvie Croft, M. S. Charles Norman Cross, M. E. Lawrence Edminster Cutter, A. B. Arthur Boquer Domonoske, M. S. Class of IQ26 Frank Atkinson, Jr. Robert Castle Davies Arthur H. Greisser Robert Lee Stephens Albert Lyle Cook Albert Payer Hahn John T. Higgins John Thomas Mahl Jean Balcomb Maynard Born Harry Dulin HONORARY ENGINEERING SOCIETY Formdcd in New 'York City, 1880 Stanford Student Branch Established, IQO6 Honorary Chairman Guido Hugo Marx, M. E. Faculty Members William Durand, LL. D. Boynton Morris Green, M. E. Lydik Jacobsen A. B. Everett Parker Lesley, M. M. E. University Members Class of IQ25 Bernard F. Langer Class of 1928 Walter T. Mills Seraphim Post Charles R. Ray Warren D. Reed Kenneth F. Ridley Class of 1929 Carrol Horton Truman Parker Arthur Quarnstrom Alfred Niles, B. S. Ulysses Patchett, M. S Elliott Reid, M. S. Horatio Stebbins, B. S. Class of 1927 Cecil Louis Freedman Charles McAllister George McCullough John Van Amringe Russell Robinson Howard Delos Ross Andrew E. Swickard joseph W. Vanier Cyril Tronslin Edmond Wagner john Wheatley Back Row: Dr. Terman, T. H. Morgan, N. R. Morgan, Kindy, Taylor, McLean, Duncan, Hoover, Ropes, Frey, Fisher, Sn Dysart, Schoolheld, Murata, Hongo. Second Row: Carroll, King, Koch, Googin, Dr. Ryan, Compton, Lenzen, Warrington. Front Willis, Taylor, Robinson, Farwell, Clark, Murray, Armheld, Chambers. AMERICAN INSTITUTE OF ELECTRICAL ENGINEERS Joseph Snyder Carroll, B. S. ' W. Bryan Duncan, E. E. Ward B. Kindy, B. E. E. Chairman. . Secretary . . Class of IQ25 James G. Sharp Dudley Elson Chambers Robert W. Clark Frank Andrew Compton Birney Dysart Fred William Ames John Shirley Armiield George I. Clover Foster B. Detrick Harry T. Hongo HONORARY ENGINEERING SOCIETY Founded in New 'fork City, 1884- Stanford University Branch Established, 1907 Faculty M embers Officers University M embers Class of 1927 Thomas M. Googin G. Garner Green Guy Russell King Class of IQ28 William G. Hoover Carl Robert Koch Charles T. McGavin Nathaniel R. Morgan Donald Angus Murray Class of 1929 Richard Clark Frey Theodore H. Morgan, A. B Harris Joseph Ryan, LL. D. Frederick E. Terman, Sc. D. Dudley Elson Chambers Theodore Louis Lenzen Class of 1926 Partab Singh Gill Peirce E. Warrington Theodore L. Lenzen Tomio Murata Bruce M. Richardson Edwin Paul Taylor Russell G. Robinson Richard Walter Ropes W. Gilman Snyder Albert Ray Taylor Peyton Tyler Willis yder Row Back Row: Yu, Potts, Fairbairn, Rose, McKenna, Flint, Norwood, Thayer, Hull, Payton, Roberts, Cunningham Second Row Shattuck, Wood, Ferguson, McMurray, Macy, Hotchkiss, Green, Morley, Everett, Travers, Theuer, Silvestri. Front Row Jones Reynolds, Moser, Hoskins, Wing, Fish, Wegner, Moreno, Tuttle. AMERICAN SOCIETY OF CIVIL ENGINEERS HONORARY ENG1NB1zR1NG SOCIETY Founded in New 'York City, 1852 Stanford Student Chapter Established, 1920 Faculty Members John C. Fish, C. E. Charles Moser, A. B. Earl C. Thomas, A B Charles David Marx, LL. D. Leon B. Reynolds, A. B. Walter W. Wegner A B Halcott C. Moreno, Ph. D. Charles B. Wing, C E Officers First Term Second Term President ....... Lawrence Tuttle President ...... Frederick Macy VicefPresident . . I .... Fred Cunningham VicefPresident . . . Donald McMurray Corresponding Secretary . . Frederick Macy Corresponding Secretary . . Edwin Fairbairn Recording Secretary . Carl E. Green Recording Secretary .... Lyle Everett Treasurer .... Raymond Bovet Donald Carlson Allen Christensen Fred Cunningham Lyle Everett Edwin Fairbairn Beverly Ferguson Morton Flint Carl Green Ardin Hotchkiss Richard Hull George Potts Treasurer .... . George Potts University Members Herbert Jones Lloyd Macabee Seth McKenna Alex McKinnon Donald McMurray Frederick Macy Vivian Morley Irving Norwood Curtis Payton George Potts john Roberts Ralph Rose John Shattuck Joseph Silvestri Wellman Thayer Arthur Theuer William Travers Lawrence Tuttle James Whyte James Wickersham Lucian Wood Lih Chi Yu Back Row: Weymouth, Wagner, Thornton, McGonigle, Leicester, Bradley, Benedict, Van Doren, Wood, Harmon, DuBois Hansen, Daniels, Dutton, Swain, Todd, Benton, Goodyear, Thompson, Strowger, Griihth, Gaw, Fulton. Front Row: Bollinger, Burks Dr. Franklin, Dr. Swain, Johnson, Brooker, Smith. I ALPHA CHI SIGMA PROFESSIONAL CHEMISTRY FRATERNITY Founded at University of Wisconsin, 1902 Alpha Alpha Chapter Established, 1916i 4 Faculty Members James Stuart Blair, Ph. D. ' Charles Henry Harrington, A. M. George Sutton Parks, Ph. D. Dana Burks, jr., A. M. James William McBain, Ph. D. Robert Eckles Swain, Ph. D Edward Curtis Franklin, Ph. D. john Pearce Mitchell, Ph. D. Stewart Woodford Young, B. S . Ojicers President . . .... . . Carlyle Harmon VicefPresident . . . . . Arthur Johnson Secretary . . . Robert DuBois Treasurer . . . Harold Gaw Reporter . , . ,. Wade Strowger Historian . . . .... . . Carl Hansen Master of Ceremonies . Robert DuBois Ellsworth Goodyear Robert Fulton Edgar Brooker Harold Gaw Carl Hansen Charles Benedict Newell Benton Everard Bierer Loren Bollinger Lincoln Clark Albert Daniels University Members Graduate Members John Hughes Grifiith Fred Norman Jones Class of 1927 Carlyle Harmon Arthur Johnson Henry Leicester Class of IQ28 William Bradley Herbert M. Holmes Lawrence McGonig1e Class of 1929 Gayle Roberds Dutton Rowland Ward Edmonds . . Newell Benton Royal Fred Sessions George E. P. Smith, Jr. Glenn Van Doren Samuel Benson Thomas Samuel Spaulding Todd Dennistoun Wood, jr. Wade Strowger Robert C. Swain Charles Wagner Lawrence Weymouth Wesley M. Nagle Lee Thornton 7 The Library ' HONOR SOCIETIES ONOR societies in Stanford University, as in any other university, are selected groups to which students are elected in recognition of achievement in their chosen fields. The natural tendency of college students to band together into cliques and to admit to these cliques only those who have similar interests results in a large number of organizations with polyglot names which contain, among themselves, practically everyone in the University. Many of the societies are societies only in name, and hold meetings so rarely that their members are unaware of their membership until the periodic appeals for dues are made. During last autumn quarter an attempt was made to question the right of existence of every honor society on the campus. The plan was not carried out because of the opposition it aroused, but it brought to light the fact that there are a few societies on the campus which are little more than dead timber. However, for a University of its size, Stanford is remarkably free from such encumbrances. The average large high school has as many clubs and organizations of various kinds. The number decreases from year to year, and at the present time, there are few duplications in honor societies. Each of them serves its purpose without hindrance, and there are enough for all. Honor societies are for the most part purely social bodies, in the sense that they en' courage the fellowship of men with the same interests. They also serve a commendable educational purpose by bringing into their meetings distinguished visitors and lecturers, who impart to student members of the organizations a wealth of practical knowledge and vicarious experience that they can obtain from no other source as well. The medical fraternities exist as a group somewhat apart from the other honor societies of Stanford. They are composed of medical students who have entered the Lane Hospital for their advanced medical study, and are situated in San Francisco. All the other honor societies draw their members from the campus and hold their meetings there. U The undergraduate honor societies which are included in the dramatics and publications sections of this book are somewhat different from the engineering, medical, legal and other scholastic organizations. Their membership is limited to those who have attained a certain prominence in some campus activity, and though their purposes are primarily social, they handle a great many important projects, such as the production of plays and the publication of periodicals. 1:2913331132373132233333J233J'i3JJ'5J'J1J3J'JDJIDJJDIJDBJDJDDIYJJ Ygj B CCCCCCCCCCCCCCCCCCCCCCCLCCCCCCCCCCCCCCCCCCCCCCCCCCCCCQCCCCCCLCQQU cEccccccccccWd'ccCCCmC caccccccccccccccccq in Q 'YW 'A QQ f Q4 W E e7 I ? N um XZ mx cgccccfcccccccc cccccccccccc ff? M nl Jllfx 2? lljllwlw y f W W 51 In In ' 'aede 494, Wal' iyh I c c ccccccccacccccccciigic Eccccccccccccccccccci CCCCCCCCCCCCCCCCCVCCCCCCCCCCCCCCC CCIKCCCC Qi? W ,- ff ,Q ff ew ,fs V 2 X Q Glo' X! f E N, QQ i SA 4 X 5 l-'P 1 A ' ff '7f Q '?f5f M' f IQ Jdigyg W I lfgg :A LCCCCC !MiM-:W W ,r ,QS 7 . j A' pq qiseiugy W Cilccccclfdggfc E G ff-fo V W 5 '3 5Qf K is in 6 fig W M D ffL.QQJ1QQQlfffiffllf.Q1fl1Q1'.lI1ZIffIIIf1f1ffLQf,ff,IQffjQfffflf111'l1ff1f1Zff.QffQff.QfflfIflff1QffIffff.ffIfffQff..Tf1lf111Qffffffff'IIIflIfiiiffffTff1ffffQffff'lffLf2fffQ ,.... I ff2515555i6i5Q!QQQSiiA3.i1322215f'ff'lffffIQff1f,fQ'fmIffliflllllfifffflffffffll...f'1...lf..flXfflfllffflfffIIff1QQfIf.lf2fI,.LTIIffflIf,,Qlfllffffliflffllil.QlfffiffQf1Iffff1l1fIf1...Q..11f111fIfIQf.....,fffQl?'Ei jim A . f X X 2? -X AA A A A . ' f 'N lug! - -3 2 S0 ' A 5- J I f I Qifltgi' X .asa - A 'A ' f' QW . ,, I 'f' .. fx K., Q , ,..? ,si - 'fy M W- --if -JJ? ' . 5 ' ESL I a ffff' I A 'N L, 7 k I :2 'Tf6y' 4 ' il , r' 2 ' . '. A Q , 4 ' I N ,L H' ww f- 'Nz EEE i.Alf T.fi:Jf'132ll Qg?:3+?Qffg NF! A 5.5211 . 5 A Q 5' 4' .1 , V V h .A ..-.QV 'Ei ff.- E-5 1:2s?N WW Nr' 512552 1 ' . . .ff X - WIN -- if I I 'Rf 1 Q kixxz-bi? 1iil'3N? S Exfffffv, f X H rx i.ss?g:2.. 1 -f ., ir n .F ' , 1 gf 5 xv, Mx? 2 h ' wi -,Z-.I ' gif- YBH lnImi!gg,p. FW , ' ,' , 3 ,+A 4 ,.:iff'Q: 4l X- AA I MIL!-xwlg it W Q' 'W' , 2 fx ' A ,if 5 ur No A :K-fix X N, v K-, N X - ' ' f ' -5 kr -1, '4' 'aaxf N 1- X Nm-:A , an T A V ,,,g VIR. ,MQW ,, J - ' 'I 43, .,!-,gf X xxxm qw Af 1' E: A 'Q . N f,? !'l.-.2-'f ,-gag. f fffsha., ' vislfgk M Q X - ' f'4Q --5' xx - ,' lf 5 'A wil-jfpLfS,'ix3xS' I 915: : fg Ls I -igi R in!! , l N-E f-,,.,xf-X I ,. G, f? 5 -5, fXiw'g, QR .C X N N 5. Q ' 2 agf- - X X! ' ,X -an pplmga, - ' Q 1 . 'Wx' X--N X -Nfl .,,, L L- 1 X . Fx fi-553' Q, - ff! xg XSSRKQQ wg, V Q :Q 4. ,. V 9 if .814 X --X - ,' X' 5 N 'S X X X - 'C N 5 A-Riff L12 '-ii-EEL-HK X Y 9 ' ' 3 f': Qf 1:11. A 2 ff' .X x.:'-QZQQSQ ' xf r ' -I rgif. ' 0 ' , 'X X Y.. 'Y ,fi 3 453156511 1 '- . i f - A f'9S5x 311551 'gi , N - - f 'F l if 5- 'twig 1 x 7- - . ' - R5 x 0 W 1 S F, s AX A ' Aw.,,,,7 'JM ' - 'F -' 'fifxis 'ullll bei J 'I x ' : Z'S 74 haf FXQ ' I - A-Z f ,wks-' q. , .1 .:. f A K- V -Ng X A . - V X r, - - : ,, . -'-- .: ,f im 'n ' ' w- 33 1 , Jef' . i:5f fr-:ccmccc Ji? ,Q X -Q -N-A f N- wg K A f ,, an 'yi , - :agp -S , X251 x , Q .Ja V' ' V X923 um' A 1 742 I 1 'lin 1' L -ff' 1 , 'W WN, , mf 5- -ww f H :1. Qifl+Qesmv 'lu A iq, XJ f 'gyda I llllllllnb., .ff P .. ' xl 'XV-:fd X K Fx! 4 .5,j:ifj'.f'-S- 5 xf gg rj, -NX xr x I h , jdgh,-5 4,2 ' I f xx . x-,. N ,ff 1 P'-N .nf'l ' X-X - A - mill ff , ,-1 Fw 5 NA W il s ,sa , --I L 1 4 A :.,9 --1, xx . A ?, -q'vm' i 1 ? i W , , ..,.A 4. .. , . 1,...,. .A , .1 , .. . . ,. , ,14M ,- uf? A 1 if . ' PJ ' ' ,...... 1l..l.,.l...I....f .... 1 ,QL,f..fl'QfQ'.,,1,fI.QfQ,fQI1 ., , I QQI..I,.f?f2R3?Qii 2'2E5fQlQQZ1IC1fQII.ff..'.f.fllffI,.lI.II,if,.I..IfflZffI..,IfQ.'.J.Iiffll.TIICIIIfTILTIf1f'ff,Zl',ff.1f1f,1fffIffff11..C,..l.fffiffflfil21212Il11III111111If'.'fIf.'.'LIIIZf,1ClICfL'ffQZ'.'f.2IT'QILfII1'IfI'lT.1I1iITflIIl2IfIIIIITISISffffLiILiIifL11fI,'125,22 Ne. Ko, M Wvmf X 9 1 Q A X wi ','ffsw.., WX Qfp f anniia ,I 1 4 I Q 5 6- Cx mv x X N N S X E-.. F X Q xxx XX 'N X NK fix S N X N m anaaian fff f f no I N 1 f Lf g i fs- - 52 2Y '! 1 3 f anno:-:ma::m:'5:annn: nnaa iff:nnaazaaauannaanioaanauaJa I I f 5 Ag ff ff f 1341 15' S A ' ' vwjff if V ' ix .nr I f 1 35. L xg, if - Q .-. 4 'GP RW ' ,'2 ' Q , Q N Q I If 1 j X W I I X 'VW ffwlgj g, ' 1 J 1' , A, Mf yyff M , fm We-M Q osranazoaaaaananaa :ann J'5jfQfQ5'5'53'5aaYlJaaa5aifJJ,?: nf' f 2,9 6'7 -xi 51 JJ x 'N SW ww SV 'N 1? X-as Mfgifgdtgtgn. 'fri f rl -5 X wkigigmiw 1 VMI, A vim an W K gg? F s BYRON Deism.-v EU: 205 QU: EU3 505 au: sua aus Qu? aus EU? EU5 EUS av: :Us EUS zu: 445 225 2 BAE . 1 ini' 405 iff 225 ins SR? M33 E05 am mg 5iGf'4's . HI have a soul above buttonsf The vision that you glimpse upon the right Is that with which our fevered fancies teem- The pose in which we see ourselves in dream. Behold the noble and inspiring sight: Ripfsnorting Pegasus takes upward flight, Lashed by the quirt of classmates' dear esteem To realms resplendent with Apollo's beam, The cloudy glory of Clympian height- While freshmen gaze with adulation's eyes Upon our fabled progress thru the air, And simple folk upon the earth below Train eager telescopes to scan the skies, Regarding with an openfmouthed stare Ascents that they themselves can never know HS 5, Q FC sv E 2 e fi Ai bi er Q 5 .Q ? .A P: F1 42 1 3 F2 ,, 1- in 1' 2: f 1. -, xg A . lm. T x A,,Q-jr, 1 fi 1 1 M Q' I f Fx 'Gil . s if A if R . A f' , . , ' 55 .J q ' rxfjx x t E 1 E Aw -3 f- 1 E ' - A. 'H A. , . . Q, 1 'G X' TQS 1.+'? mf 'N A A- A A 1 Q wg. . 1 . QE, gg -.,f+.1Lo , QA . K 4 N' 1 A 5. . .' V A A A f. 1'A3, -'K+ 8 ' A ' ' , .,, A Q-.mv ff A q if A 'S ' 'X 5i':Pi?w'im'5Ytx5 -STG' 5 A--1- '--Aff ' A 15 'f7wi'7QH'5f ' fb ' A- NX as ,gf wurgf- A 2 3 A .r , L1 P: A 2 A. Ae P' I ,LIE-'ff F M -S-2.15: ' ' E 1 -. vkygt Fiiifll' fu il .7 .'..2.H A E Y .' A . .-.g . 1. -. . . 5 A ,QA 1- N .. '-5.1 : :v,.3i! 2. I ., 1 H. V A - . - 1 2 -A rw ' 2 3, 1 gi S ,I -5 o.--- J,:.435 E 2 4 aa, 2 A A A H .A -.ZIV ' xwh- ff ,.. ya . - EE 1-X 3. - . , . . Vu, 0 K wg Ng, J ' lfl A:l'q g1,'f ' C 1- ' Q ',.r W si :H Q .. , ' TNVICJ- , 'L i ' T1 Y :iff , 3 Q - .. .. A A A f 5 is T 2 l High? A.fff4 Yn':'-fAAfYEsff?fs'? :AWA A if fish I . A i i f ff C HAP T E R VII 1 2 s o c 1 E 'r 1 E s MS?Bf,kEiSilE?ggg5v13iXRKBrK1t?S'!-8-94?HnYik'?6N-fL'fc'zib4SsY?9'JN'S!99?'?i-i1!!lW:'Hh1:bOC'P'!.9!'HWViA'l ? Fs?Efn'!0P.5B.'h'XW'4 jx'92,iPjQ w K , i 5. lf I ,A 1 -..-.- -ilaz ,:--wwfl .VI 5: 2- '-. gqi'v13f'i'I'. -Q A A . 'V l v fl' ' ' -DA-g--Ap-IT.- - ,Ll -i.-- ,--Y X' 1, -if 1- - L - 4+ Mi ?:l,:',,3'VL ,,f -4' -'1-e ' li-r,','+-.1kl,u W fx jean Spaulding Kathryn 'Teach Helene Turner Irene Way Margaret Willis Frances Worthington Elizabeth Stall Marjorie Thompson jean Utt Paula Weinstein Dorothy Wirteberg Dorothea Wyatt Muriel Stearns julie: Thorner Mary Walton Elizabeth West Bertha Wise Helen Teomans Elizabeth Stuart Rose Tajf Katherine Thorpe Dorothy Troy Phebe Ward Mary Louise Watson Lois White Sue Willard , Margaret Wood Kathleen Woodward Pauline Teon Dorothy Zitkowski f .51-'.::-,l '.r ., Zona Owen Agnes Plate Katharine Rich Verdele Russ Ruth Settle Nanelia Siegfried jeanette Owens Thelma Patton Elizabeth Pillsbury Beth Pinkston Phoebe Plate Maryfjane Pollock Alice Putnam Mary Raney Mary Richmond Lucy Ritter Alice Rose Ruth Roseberry Marcella Saier Elizabeth Sawe Lillian Schuck Caroline Selden Carolyn Shepard Dariel Shively Rosemary Shoemaker Maxine Shoenhair Adele Smith Elsie Snyder jeannette Snyder Katherine Sobey -1 AV T--Sf: A 4 E1 Twaifrfl L . .'lY I fi' ' if F fr. 'f'5FQ,1' 1- i- Le' ' if if 3.-.2 'Jer :V-:J -'ix .. ' .x ,. ,,. .- ,-u, -1'1','..H'- T.. F In 1 1 .,, ,M ., li-1 . -. 1 I 1 ..- ,.el ,Y ... ., f, L pl arf- 4 l' I-'L ' Elisabeth Larsh Phyllis Linscott Ida Lundquist Martha Mannon Frances Mills Benita Nobs 4...- - .. ,- Gretchen Larson Elizabeth van Liihen Sels Tsidora McFadden Katherine Miles Anne Mudge joan Nourse Helen Lease Ruth Loclqett Barbara McGinn Dorothy Miller Elizabeth Neall Louise Oestreich , , .l ,-. Dorothy Lewis Frances Lomax Claire MacGregor Miriam Miller Caroline Neilson Florence Lee Ogier ,, 51'2.. . 2 gi :'i':j. I ' -,u I ,:,.,l,' N- a' .V Q 1.1 .' 1' Rhoda Lewis ' Charlotte jeanne Long Roseanna McE'2,ue.sten Sally Miller Eleanor Nichols Margaret Olsen . -- ,L - -In n- ys-' CH'-'A' L- .- -is ,-... .vH' 'hd 1 'I ' ' .,i Sarah Grant Helen Halderman Helen Hawkins Mary Huff Meta fury Geraldine Kinne Nelle Greene Frances Hallman Judith Hedges Beatrice Iago Billie Kahn Marion Kloclgsen Elaine Grey May Hardy Louise Hewlett Judith johnson Hallie Keating Elsa Krotozyner . :is if 1 Mary Griffiths janet Harris Marion Holley Helen jones Katherine Keho Gertrude Laidlaw Ruth Grove Charlotte Hatch Foresta Holly Mary Edith jones Margaret Kempenich Wilma Lambert Anne Coleman Sue Curtis Louise Dohrmann Elvira Erickson Betty Ford Anne Friclg Melba Colrn Maxine Cushing Helen Downing Peggy Farmer Dorothy Fordyce jearmetta Gatch wk . -. .-- . f ww ,,, fl f . 1-r-V Elizabeth Cooper- Eleanor Davidson Sue Betty Dunlap Marian Farr Florence Fouch Harriet Geary 7.-....n V V, - MaryfVirginia Cooper Violet Crosbie Harriet Day H arriet Eclgart Doris Fee Wynette Fowler Frances Gijfen f-fr, ,!. -iq ,W A, V. 3, 1 .l L-1 , .A 1 1 ' 'T fag ,.sA,..,,4l-Lrwu. ... r. U 4 . 'Q W .I . 1'-'i --- 1 .-A rl.. , Y,, Bormye Deal Mary Edwards Jessie Fleming Dorothy French Gladys Gillig ,, -Lc...D T May Abbott Dorothy Abrams California Andrews Louise Artz Lucy Bancroft Muriel Bartlett Alice Behner Lydia Bowen janet Briggs Marcella Brown Helen Carpenter Dorothy Chilcott Helen Adams Elizabeth Balgewell Marjorie Bates Lillian Boyce Margaret Bullard Elizabeth Allerton Elizabeth Ahnefeldt Elizabeth Alden MaryfCatherine Baldwin Mary Margaret Ball Aural Bauer Dorothy Beckwith Margaret Braytorn Clara Rose Brecher Lucile Burk Harriet Burroughs Clark Elizabeth Mar Clarke Ruth Clawson - .. h 1- 'N' 47 lx. . . 5 I ,, I Ui ROBLE CLUB Anne Hartwell jean Stewart Ojicers First Term Second Term President-Anne Hartwell President-Jean Stewart VicefPresident-Helen Carpenter VicefPresident-Margaret Mudgett Secretary-Jessie Fleming Secretary-Lucy Ritter Treasurer-Frances Sanford Treasurer-Mary Huff LL women entering Roble Hall automatically become members of Roble Club, until they form other campus affiliations. Executive, social, and legislative activities perf taining to the group are carried on by the Club through its oflicers and committees. Each year a number of senior Women are chosen from the living groups to act as sponsors. They reside at Roble during the autumn quarter, and help the freshman Women to become acquainted with the traditions and geography of the campus. Roble Sponsors Gertrude Baker Lilian Force Harriet Ford Anne Hartwell Helen Hunelge Winifred Huntington Margaret Kalenborn Edith Mattson Laura Miller Louise Shedd jean Stewart Aimee Bell Thomas Editl-ia Wright -Q - . ,-l .P -.-we -f time at m r A 1 mah 31 5, - 1113-J 1 W . ,. . .x ,, .. . I 1 v I 1. .V r li'-,'..1', - vs?-,2:'.'E...-F.:iQ':.?'7'WMTB1iP- '..r'L i V TLQ' J 'T 'f .4.T.'.. ' .. ' ' ' ' ' ' V 4 if ROBLE HALL OBLE HALL is the delightfully modern dormitory where all Stanford women spend some of their time and some Stanford women spend all of their time. Situated close enough to Lagunita for early morning dips or canoeing, equipped with a comfort' able library, spacious sun porch, little kitchenettes where the girls may prepare and devour midnight feasts, and attractive sunny rooms in which phonographs are to be found, it is in many respects an ideal women's dormitory. Two large dining rooms provide eating facilif ties, and large lobbies provide ample space for dances and entertainments. The Roble women, about ISO in number, are organized into a club which carries on a diversified social program throughout the year. Formal and informal dances, teas, and birth' day parties are given in great numbers. Upperclass sponsors, chosen from Roble and from the various sororities, cofoperate to welcome freshman women and to make their intro' duction to Stanford as agreeableas possible. The House Committee and the Committee of Five handle all transactions pertaining to the Club, establish lockout hours, and make reguf lations governing the conduct of Roble women. They also punish minor infractions of these regulations. In all their activities, Roble women are advised and aided by Mrs. Stearns, the social director and hostess of the Hall. l Mrs. Mary H. Stearns Social Director First Term Frances Sanford Alice Putnam Helen Carpenter Sally Miller Anne Frick First Term Editha Wright Helena Maxwell Anne Hartwell Jean Stewart Margaret Mudgett House Committee Second Term Jean Stewart Maxine Cushing Lucy Bancroft Alice Putnam Margaret Mudgett Committee of Five Second Term Editha Wright Dorothea Wyatt Ruth Lansburgh jean Stewart Anne Hartwell I Y , I ..,v,.., -.-.,... , -,iv Y ,. -Q-1-.s... . .,.,,..., 's ' i 14'----1 Pl V igimii Vaqgf ' ha...L'h',,A - - 4 7, I -'. -- y .' - , .FA ,Y ,.,-- Foimded at Colby College, 1874 PI CHAPTER Established july, 1915 Lotus Odeal Hargreaves Margaret Grace Adams Alexandra Leslie Hill Martha Jean Blackvvelder Nancy Elizabeth Dorn Janet Briggs ' x SIGMA KAPPA Faculty Member Helen Marburg, A. B. University Members ' Class of 1927 Class of IQ28 Robina Henry Larsen Lucile Lyon Class of 1929 Evelyn Bernice Linderholm Class of 1930 Helen Elizabeth Bailey Class of IQ3I l 'v rl' ,I . We 4 'I ll-.1 519 -li iii ,U Una Stafford Evelyn Hamilton Snyder Mary Acelia Van Horn Joyce Cowling Lyon Roberta Richards Helen Idelle Hawkins Adams Bailey Blackwelder Dorn Hargreaves Hill Larsen Linderhclm J. Lyon L. Lyon Richards Snyder Stafford Van Horn I I , , ,,. . ee ls -3 Lucie Freeman Bentley Lorna Brem Lucia Bell Champlin Page Bradshaw Dorothy Chilcott Florence Cooper Frances Marian Leachman Florence Lee Ogier Mary Margaret Ball Lillian Elizabeth Boyce CHI OMEGA Faculty M embev Elisabeth Lee Buckingham, A.'B. University Members Class of 1925 Frances Foster Class of 1927 Edith Matilda johnson Class of 1928 Aileen Leighton Hicks Sallie Kinsman Class of 1929 Elizabeth Cramer Mary Emma Crane Class of 1930 Victoria Schuck Class of 1931 Mary Edith jones Alice Neff Founded at UniUe1sity,ofArlqa11sas, 1.895 NUALPHA CHA P11111 Established March, 191 5 Elizabeth Fluhrer McCall Lida Ritrler Virginia Grace Voorheis Helen Ruth Cunning Janet Giles Post Edna Ellen Woerner Betty Theresa Shively Helen Agatha Smith Lillian Schuck Elizabeth Dearing West Bentley Bradshaw Brem Champlin Cooper Cramer Crane Cunning Glenn Hicks johnson Kinsman Leachman McCall Post Rittler Schuck Shively Smith Vaughn Voorheis Woerner l '. ' f ' . .'ff.l'1l ..-,, i-gf f -V - x ' : --4 ff-J .' . el l' Liligr- lj-I Founded at Barnard College, 1397 LAMBDA CHAPTER Established November, 1910 Aileen Brown Helen Delatour Dorothea Cavitt Hawkins Doris Joyce Holston Janette Durfey Dorothy Emilee Kimherlin Dorothy Bogen Adele Gilman Gist Gladys Louise Crofoot ......--.7 4 1 y I ' I x 'f . . t-- . I - I I V, r l ' ,l I A V, 1 ff nu .L -' w1gt ,mlI,5' tru. it , A L , : l ff .KF U45 t- '-f : 3 f ,S ...I bi . A -E it A 4 tififssflxi .4 Lille-51.1112 wx.-.....-.su , ,, . .,,. ,. ,-,,.-.. Y All ALPHA OMICRON PI University Members Class of 1927 Class of IQ28 Marion Mack Frances Evelyn McNelly Dorothy Margaret Quinn Class of 1929 Ruth Gifford Leiter Clair MacGregor Class of 1930 Alliscn Loefller Ruth Anita Patterson Class of 1931 Harriet Ring Day 'K if , 1. L .' ' yi' .6 AQH' It in L Q J J s me 229 wrt ' ga , , img., is - as Lilian Force Alice Sohlinger Elinore Van Fossen Doris Welch Jeanette Campbell Owens Frances Lyman Worthington Claire Pierce Antoinette Schulte Beth Tollan Pinkston Bogen 9 Brown Delatour Force Gist Hawkins ' U Holston Kimberlin Leiter Loeffler Mack McNelly Patterson I Pierce Quinn Schulte Sohlinger Van Fossen Welch .,- -,,...,,.....I . I -. f-- 1 1 1 '11 .1 ..,' Y 4,15 lr J- - L A- 1 1 f- s.,-,pf JA. I --.an-R f .i..a- s.yT?n-, 1 -'T'-zsfffijff 2. A E L, -h y e T . W mr- .1-.rvf . -f, fQ s1?' HV LfT1fH lfffli IUW-.0-,f3F'5'f-:Af,U1'fi?1f4'?,1ff-it , H' Cffi Eff 5 e A , '-ii',M-rf -init?-lf.'Lw5IJl4Lllifl1 f-'iw ' v' '-1 ' Class of IQ25 Meribeth Elliot Cameron Evalyn Laetitia Brown Carolyn Maude Converse Winifred Huntington Esther Elizabeth Fair Dorothy Jacqueline Lewis Lily Laura Chloupek Florence Colberg Ruth Emeline Clawson Nelle Doris Greene DELTA DELTA DELTA University Members Class of 1928 Lois Irving Carol Lasater Class of 1929 Phyllis Linscott Dorothy Mallet Class of IQ3O Theodora Edith Deirup Clarice Hughes Class of 1931 Charlotte Jeanne Long Founded at Boston University, 1888 OMEGA CHAPTER Established january, 1909 Class of 1926 Allene Warden Thorpe Helen Elizabeth Mosher Adelaide Marie Pottenger Florence Thompson Adelaide Dingley Palmer Frances Marie Wyman Catherin Rossarini Elizabeth Harding Scattergood Ethel May Palmateer Dorothy Alma Ulrici Brown Chloupek Converse Deirup Fair . Hughes Huntington Irving Lasater Mosher Palmer Pottenger Scattergood Thompson Thorpe Wyman ' is L:.,gsL .e..'2..7fl-f 1 '-- -2 ,f CEI -w e .1 1 e e s..g . F --ifiliif all-'Q-:sw-: Jeff'- .W - , , , f W A J. ...J f,,,Y.r I: i I ,,',1g,' K 1 ,Q Li?-5 ,,lL'1ff .. .if - .--A-, -- - ,-5 - r , .,, ,i J.. ,' , ,r ..i,ii',, iL.f' ,, Founded at Syracuse University, 1874 Mu CHAPTER Established january, IQOS Alice Hawley Peck Margaret Lee Virginia Bunnell Frances Ema Demand Nancy Chloe Farmer Babette Frances Bailey Blanch Ellen Barnett Helen Rose Bullard Jeanne Virginia Kurtz Beatrice Aclelma Elkins Peggy Farmer 1 , f GAMMA PHI BETA University Members Class of 1926 Class of 1927 Class of 1928 Irene Henrietta Fox Dorothy Vivian Garnier Virginia Marion Greene Class of 1929 Mary Morris Cox Grace Humphrey Helen Esther North Thelma Patton Class of 1930 Class of 1931 Margaret Kernpenich ' l T is-X, X ' U sbr!:1.,1' f ' , Marian Wood Marian Adele White Margaret Kalenborn julia Miriam North Margaret Waite Lorraine Caroline Reeder Juanita Emilie White Hollis May Yerington Mary Trowbridge McCleave Elizabeth Marie Pillsbury Mary Lee Richmond Barnett Bullard Bunnell Cox Demond Farmer Fox Garnier Greene Humphrey Kalenborn Kurtz McCleave H. North J. North Reeder Waite White Wood Yerington ,ty-.:! . 'i,1,',.', f II. -, rr -. -. ,.,4, H, 7, 9 VY K '... Lxs !A I ,, . .. i A 5. 1 ,.',' .-.'!.,, ..,.-, .45 ivy! -1 .Q 'Y ' Baldy if-' If V-in l LA.. ,,, lv., ' V.-, 'lg'-1, i' X: Elf ll - -J 'fl pl ' ll- 'f I-elim if H, ls,i'E5f.w,T. ,',j' f if ,, - ,-sv ' H+1,.i. 2 !--.f,yes,,,,t-q..f--- ,JY 1 , Margaret Chandler Alice Bingham Copeland Ailsa Livingston Dunn Jean Marie Armes Frances Elizabeth Boone Elizabeth Hayes Bonn Catherine Tull Coman Harriet Agnes Geary ALPHA PHI University M embers Class of 1928 Edna Mae johnson Katherine Kamm Mary Lee Nelty Delmas Lefranc Class of 1929 Elizabeth Louise Bradshaw Kathleen Fitz Marjorie Aldrich Landon Class of 1930 Ruth Elizabeth Hill Edith Jayne Class of 1931 Founded at Syracuse University, 1872 KAPPA CHAP'ra1v. Established May, 1899 Margaret Meyer Laura Minty Miller jean Williams Barbara Lee Helen Louise Moore Alice McCreery Sidney Williams Maryfjane Pollock Armes Bonn Boone Bradshaw Betts Burger Chandler Cornan Copeland Dunn Fitz Hill Jayne johnson Kamm B. Lee M. Lee Lefranc McCreery Meyer Miller Moore Williams -aw Y he as - - if , -A - T- rn --W I, .+',- - wird., .,IAx,l'? 4.21. 4,-.Ni-, -1.1. '14 ., ,-i++- - - L-a---1 ,., .:.1' 'fun J' 'Y : . r'iPA1F,1 '-' A Y U:- e-1,',, uf ju.-.-4 slim.-.fvw-1:3 ,H : ,.' , .,,. 'au 'A - Q-' - 'I 1- 7- .I,. ., , ,-.. l',.4 .-aj . .5 ., Y, .. 1 5 ., I .,,-rx' air Founded at University of Mississippi, 1872 UPSILON CHAHER Established March, 1397 Mary Carson Denny Fay Dunn Hamilton Margaret Cummings Alice Louise Ingraham Louise Alice Artz Muriel deFontenay Battle tt DELTA GAMMA University Members Class of IQ27 Aimee Belle Thomas Class of 1928 Mary Louise Hulmex Marion Thais Lozano Zelda Mendenhall Class of 1929 Jane Graham McCabe Marie McLaren Class of 1930 Hildur Richardson Dorothea Woehlke Class of IQ3I Elizabeth Mar Clarke Geraldine Schaefer Kinne Rowena Ruth Lockett 551 F I lL .. I A ' s -ADX, A y ,ft .' I Q., F' Parnie Hamilton Storey Ruth Elizabeth Tuthill Marjorie Eastman Rice Frances Wade Yeazell Adele Katherine Smith Elizabeth Stuart Cummings Denny Hamilton Hulme Ingraham Lozano McCabe McLaren Mendenhall Rice Richardson Storey Thomas Tuthill Woehlke Yeazell is - yjw, ,- 'll' err f' TA W , ---J-.2-ff. 1-qy gms SlTANFlfJllU QUAD V re . 1 .1 . I Ruth Rosalind Coverley Edyth Winifred Allen Doris Rozella Bonner Louise Buxton Nancy Belle Campbell Elsie Leslie Chase Mariana Evans Mary Eleanor Griffiths Anne Challen Coleman PI BETA PHI Faculty Membefr Georgina Burk University Members Class of 1927 Class of 1928 Sara Margaret Burns Class of 1929 Virginia Helen Drury Alexia Helen McCarty Barbara Seale Class of IQ3O Dora Katherine Matield Marian Christian Strong Harriet Edith Sutton Class of 1931 Helen Harriet Halderman Fouizcled at Monmouth, College,Q 1567 i CALIFORNIA ALPHA ' CHAPTER ' Established September I 93 Elizabeth Howlett Marjorie Hunter Robinson Grace Marion Williams Caroline McCreary Selden Cecilia Frances Sudden Helene Roberta Turner Helen Anne Thompson Helen Thornton Ward Margaret Willis Allen Bonner Burns Buxton Campbell Chase Coverley Drury Evans Howlett Kerley McCarty Matield Robinson Strong Sudden Sutton Thompson Ward Williams lr 2,?-...T ' , ' , ,.:,L are ,V-:.qg 1-.. 1 .L U A -. - 7 Y Y ef - or fm Sie 'feoieo sf--ef 4 lvr Founded at Monmouth College, 1870 BETA ETA CHAPTER Established func, 1892 Maude Landis, A B. Charlotte Hall Brown Dorothy Downing Miriam Marble Marietta Fry Beulah Gibbons Mary Rhodes Barstow Dorothy Baily Brown Katharine More Crane Alice May Edwards Deborah Fessenden Bent Rosamond Clarke Louise Dohrmann Helen Downing Sue Betty Dunlap KAPPA KAPPA GAMMA Faculty Members Dorothy Putman, A. B. University M embers Class of 1926 Class of 1927 Class of 1928 Class of 1929 Catherine Harroun Virginia Moulton jane Wheldon Plumb Class of IQ3O Helena Lansing Davidson Martha Clift McDowell Class of 1931 Harriet Louise Eckart Gladys Gillig Meta Jury Katherine Keho Frances T. Russell, Ph. D. Josephine Rand Rogers Bernice Elizabeth Miller Marion Irene Nicholas Helen Winslow Stanford Edith Alden Thornton Louise Shoup Chesterlyn Thomas Sylva Titian Weaver Marion Russell Woehnert Benetta Delight Merner Frances Elizabeth Shoup joan Nourse Mary Louise Watson Pauline Yeon Barstow Bent Brown Clark Crane Davidson Edwards Ford Fry Gibbons Harroun McDowell Marble Merner Miller Moultcn Plumb F. Shoup L Shoup Stanford Thomas Woehnert 5. 1.-I ,n.- X. qf:-2 16.TI ' wi-.E 5 1 ,u 5 if Margaret Lothrop, A. B. Charlotte Lovekin Anne Bancroft Ruth Bowen Helen Elizabeth Bell Helen Lucretia Clark Edwina Ewing Barbara Frick Doris Elizabeth Conner Mona Dutton Sarah Lucia Eells Mary Betts Fisher Elizabeth Stuart Cooper Anne Dudley Frick KAPPA ALPHA THETA Faculty Members Clelia D. Mosher, M. D. University Members Class of 1926 Barbara Marx Barbara Merrihew Perkins Class of 1928 Dorothy Hilyard Cone Madeline Frick Class of 1929 Carol Ross Gray Ruth Edwina Hembrofx' Ruth Mason A Margaret Owen Eleanor Patten Class of 1930 Elizabeth Ann Lynch Marylyn Powers Patricia Rhodes Class of 1931 Gertrude Laidlaw Caroline McDougal Neilson Katharine Wiley Rich Founded at DePauw University, 1870 PHI CHAPTER Established january, 1 892 Mary Yost, Ph. D. Vera Alberta Williamson Marian McCardle Catherine Newell Wilson Barbara Denny Poole Katharine Louise Powell Ruth Elizabeth Silliman Ruth Elizabeth Tinsley Maxine Mabel Shoenhair Ruth Thatcher Margaret Van Norden Elizabeth Woodyatt Jean Elizabeth Utr Dorothy Verges Zitkowski Bancroft Bell Clark Cone Conner Davidson Ewing Fisher B. Frick M. Frick Gray Hembroif Lovekin Lynch McCardle Mason Merritt Owen E. Patten Poole Powell Powers Rhodes Sillirnan Thatcher Tinsley Van Norden E. Williams R. Williams Williamson Wilson Woodyatt w qjggivi-r i .W g A il' lv lp, II r 3. al l' All l'i1 I 'l lf llfl l l l. l !f l ll l l 'I I l lil, D15 lj gn il V il E? 4, F lv ml lv Ile ri 'N 1l'l l 1 - 1 ,,,g-fb., lf W .inf if , ' , ' ' ' ti -'Tl rp V 'iQ,,,. ,.,-Ag.-a .A-pl. r,..'- .X ll ,A ,r v, ff, 4'g.E ',5 vi, -T T T. I... 1- Ai, I I ,. X Y. 1 .. x -.1 H. 4-,,. ,, , M. ar- -W saw. 'I QU l I al' Mil,-1 '4'.',j l,Q',',.J -.5 1h!'r-vvmnw'-'.,Q t -..-'- f'. 'vi:f1a , '- 'F' l I -Q i 5- . - V., wg -- 4 4 l' I l President . . VicefPresiclent . Secretary . . Treasurer . . Alpha Omicrorz Pi Lilian Force Dorothy Bogen Alpha Phi Katherine Karnm Kathleen Fitz Chi Omega Sallie Kinsman Ellen Woerner Delta Delta Delta Adelaide Palmer Theodora Deirup Delta Gamma Marion Lozano Jane McCabe - ui- 'ry I re' '.: '-v tt,-.Y . -tD.....f ' ,..'i.. ...I --J ...na ,.'5 , ' , .. ,. Z..-.'1r 1 , -L - .. . , ' PANHELLENIC Faculty Member Mary Yost, Ph. D. Officers ' Q3-ith rTfe,',r vJ'11i.47-jj L ......g,, v fr --' ff- -' M - , Lilian Force . Sallie Kinsman . Nancy Dorn . Dorothy Cone Gamma Phi Beta Nancy Farmer Mary McCleave Kappa Alpha Theta Dorothy Cone Helen Bell Kappa Kappa Gamma Marietta Fry Jane Plumb Pi Beta Phi Rosalind Coverley Elsie Chase Sigma Kappa Nancy Dorn Robina Larsen Back Row: Bell, Cone, Bogen, McCleave, Farmer, Larsen, Dorn. Front Row: Fitz, Chase, Robinson, Force, Kinsman, Palmer, Deirup ,,,,, V,, ,.., ,-....1..,.-::.',1 ,,- . ,.Y,-,, 'J L. -' 'H--,v - u'1g,,'. 1 .-5 Q.- , ,., , , ' 1 1 -.fn-V .....,,a ...',t.. ,- , v V , ,ll I , ll .1 '. -. V . ' ' VH' 1 -2., 7- . .-,. V ,, , ., ,K Xu, - ,---.-i,-f . ,-1 ,- p--...M .-. , , , 'J Aa.. Y, F. QF'-'NA si n RZ' r ' Il 'TQ .VT ' , T lf , ,I 'li i, 1 Lflft, ' ' LJ- ilq -. '. .,l . . .- . .'.a. -P,-f -4- H 1 -A f - l 1..i'f.J f-'iw . The Womenls Steps SORORITIES ooK1NG back over the past year, two important things stand out as milestones in the history of the sororities. For the first time rushing was conducted in the winter quarter, and a committee was organized to manage the interfrelations between Roble and the Row. The rushing system is regulated by Panhellenic, which is composed of two representatives from each sorority on the campus. The system now in vogue is practically perfect in operation, after years of experiment and transition. Coming as it does in the middle of the year, rushing allows the freshmen to become oriented to their new surroundings, and permits their friendships to crystallize into groups. The longer period of pledgedom is of distinct advantage to the sororities, and it does not seem to be interf fering with the unity of the freshman class and its spirit in Roble Hall. The technique of rushing has been designed to eliminate as much as possible unnecesf sary labor and expense. To this end there are many stringent restrictions governing wo' men's rushing, but it is noteworthy that the annual attempts to introduce something more elaborate have always met with decided opposition. The most important factor' in the success of rushing this year is the spirit in which it has been accepted by everybody. There is a distinct attitude of cofoperation on the part of all concerned, This is evident not only in the work of the PanhellenicfRoble committee, whose' duty it is to arrange all the technical difficulties arising from forcing the pledges to remain in the hall, but also in the helpful spirit of cofoperation shown by the sponsors. The petty rivalries and misunderstandings which are liable to arise between those who went Row and those who did not have been largely eliminated. Like the fraternities, the sororities are facing the problem of eventually living in campus dormitories, and the possible elimination of the Lower Division. Both of these events will have an important effect on the sorority problem. What the result will be when such an issue deinitely arises cannot yet be determined. It is improbable, however, that either question will have to be decided in the immediate future. Every year the number of girls pledged by sororities decreases a little. The number of graduate and upper division women is increasing steadily. This year only 60 girls were pledged as against 79 last year. The average number living in a group at Stanford is much smaller than at most other universities, but this has a favorable result in that the Stanford sororities are very closely knit together. ' ,il :Wg 1 J- ' all W .t ' 'f 1441 l. 1 , j. I, ,1 Hr j President . . VicefPresident Secretary . . House Manager Dugald L. Blue Milton D. Burns William S. Best Milton D. Burns Robert B. Filley Ulrich Graff ENCINA CLUB Oficers-Second Term . . . . . . . . . . Robert E. Baumgarten . Frederick T. Scripps . . . . . . . Frank P. Adams . . . . . . , . . . Swanton D. Dalton House Committee Chairman-Tom M. Watt Vincent W. Jardine John S. Marks Franz R. Sachse Thomas L. Melgaard Dance Committee Chairman-Nelsoii Mills Richard M. Oddie Maynor B. Shove Ward H. Tanzer Smoker Committee Chairman-Albert G. Miller Thad M. McNamara Clarence Smith Franz R. Sachse Carl Wittenau ENCINA SPONSORS-Back 'rows Patchett, Saunders, Sanders, Richman, Travers, Fellows, Philippi. Front row: Cavalero, Van Amrmge Cypher, Draper, L. Vincenti, Aldahl. ENCINA CLUB Officers-First 'Term President . . ..... I . . . . Thomas P. Pike VicefPresident . . . . . . . Robert B. Filley Secretary . . , . . Orrin K. Earl, Jr. House Manager . ....,. . Swanton D. Dalton House Committee Chairman-Frederick H. Hawkins Robert E. Baumgarten George T. Harper Ward H. Tanzer Maynor B. Shove Smoker Committee Chairman-Charles C. Weesner Robert B. Filley Marvin T. LaHue Frederick T. Scripps Richard M. Oddie Dance Committee Frederick T. Scripps Frederick B. Carter Thomas R. Decker John R. May Thomas L. Melgaard Richard M. Oddie Franz R. Sachse Thomas P. Pike Robert E. Baumgarten President, First Term President, Second Term r. - .T K-.-2, . QL- -Uv Ak A ' ' Q Qi ' ' i' i ,fd-.. T., N... If ...W .-3. 'M-1-V. ,, ff of ,U I ,V 4 .3 -., 1 , --.- X 4 '.-,'--'.'--' -titt- . . I ft A .. . .,. l Y , ,, l lf 5. ,,.. ' ' ,r 1 - 1, . , - , V '.- A-s . 'V V . - , , 1 . - f YW V l .- 211' 'V ' 1. , + .V .. , H, N . .l 1 - l . ..- . ... .A .AI A-, ,., 0. V ll , -.- , ,L 5 ,. HEQJTW., . . A . 4 -- - -Q -I 1 . ' ' '- 4 - , . .. z----' Hwlf. SEQUOIA CLUB Officers-Second Term President . . . . .... . . Russell S. Waite VicefP'resident . . . . Kenneth F. Mundt Secretcvry . . . Niel F. Meadowcroft Treasurer . . . . , . Carl V. Hansen House Committee Chairman-Russell S. Waite Josiah A. Bridges Edmund H. Jones Donald E. Ruppe Beverly C. Gibson Philip P. Smith Social Committee Chairman-Yale C. Maxon Rex W. Kramer John C. O'Sullivan H. Pitts Malek Donald E. Ruppe Athletic Committee' Cliairmcm-Vern E. King Dallas W. Ayres Henry E. Hill Russell S. Waite President, Second Term -. .717-.5 Y., , , ... Y , ' H r -1 ' -...7...-.- -V 7. Y . - 5, I . --' 1 , '.' - 1 ..-. ,gh u ,m.,.5-ur !. YY- T A -1-1.-X-xrv l l 1 -- - --A - --Y fv -.V , Wvfirure-ea is I 1-iw ,W .- - 7 , L v- - 1, . A .- All .A - -v .. 1 LLC -- fix?2-r41Q,l.L'fL'H''Emi 14 Q 'E 'E 51 ir.. fr 1 .4 1 C fir.. i - -I '.fq.g, 'i,i- -Wiz'-7'i W7 1-, , I-:gh -1' i' .ffflff-i ,ff e A ig3-19--it-i'21-rlJ.ff'J'.f.-r V l li It 4 J l l l il ll l , . ' L . I l w 1 rl , SEQUOIA CLUB Officers-First Term rl President . . ........ . Francis K. Morgan my VicefPresident . ...... Donald A. Murray i lil Secretary . . . . John H How I Treasurer . . Chester F. Luther l ill House Committee all Chairman-Francis K. Morgan l ii l Dallas W. Ayers Moroni Jameson John C. O'Sullivan 1 y Henry E. Hill Howard C. Platt J Q Ng I Hi ll fl JH ' W ' 'D 'f flfffl Social Committee l y , Chairman-Stanley O. Swain N' y fl Robert L. Harkness Donald E. Ruppe in M! V Vern E. King Russell S. Waite ,N yuh! wi l i fy ' il Athletic Committee l I Chairman-Irving L. Johnson I l Morton M. Flint Vern E. King I w ' l A l 1 l ll I ll l ll H I li lx JN ' y ' Francis K. Morgan l il President, First Term . I1 l i-'1,l-i----- :'fffYw,-4 1L w 'p?vffrf-fejf. Lr,,gipz...:-qi- -f ,r.- .-, - 3 y r gm- ' or 133 Zffififf. Ilif-:1T?P'3i1ir?:.Q1 fffy'f 1.12 W'- ' ff A-or more I BRANNER CLUB Officers-Second Term President . . ......... . . Paul W. Forker VicefP1esident . . Wareham C. Seaman Secretary . . . . . John A. Clark Treasurer . ...... . Adelbert N. Culling Executive Committee Chairman-Paul W. Forker john A. Clark David A. Rytand Wesly P. Cox Wareham C. Seaman Adelbert N. Culling James M. Springer House Committee I Chairman-Wareham C. Seaman Laurence F..- Heiges, Jr. Douglas H. McCormack , Wesley M. Nagle Herbert A. Smith , s Harold F. Way. , , Laurence M. Weinberg Frederick S. Wing. . 1 , .Social Committee A ' John A. Clark Wesly P. Cox Douglas H. McCormack Frederick S. Carl Meyer Wareham C. Seaman Chauncey Thompson Wing Paul W. Forker President, Second Term BRANNER CLUB Officers-First 'Term President . . ....... . William H. Levit VicefPreside'nt . . . ..,. . . Harold F. Way Secretary . . . Wareham C. Seaman Treasurer . . . . . . Robert Y. Mann Executive Committee Chairman-William H. Levit John A. Clark Wareham C. Seaman Paul W. Forker James M. Springer Robert Y. Mann Harold F. Way l House Committee Chairman-Harold F. Way Daniel N. Benton Richard Guggenhime ' Andrew M. Cole Leon H. Levi Stanley J. Cook August Reich Edward Crane Chauncey Thompson Martiri Weil Social Committee John A. Clark Sidney L. Lipsitch Paul W. Forker Robert Y. Mann Laurence E. Heiges David A. Rytand Wareham C. Seaman William H. Levit President, First Term P -so fffefmfsrw -. ,Q-4 .r . .. . ff I y Isl M-A + ' i1,I'Tl+,:7fl,f, . '-P. 'W'- l Ui .,l.3:3Pft1lf'. f of-1 ll ll' H ll W A 1, K, El ll? ll' Ill All I l E ' a ' I v ' ! L . A ' l fll rl I l . . . ll lll ' l U. TOYON CLUB 4 I 'Hi Ojicers-Second Term l President . . ......., . . Alexander T. Ross I U ll VicefPresident . . . Richard F. Holt I l l Manager . . . . Edward B. Krough ll Nl Secretary . ......, . Eugene C. McKnight l l i 1 l 3' House Committee 1 l. l Roswell G. Bishop Frederick E. Hines Edward P. Naumes ' Lynn A. Bramkamp Richard F. Holt Alexander T. Ross l Eppes W. Browne David S. Jacobson Carl A. Valentine . 1 I' John D. Byrne Edward B. Krough Ernest D. Wagner . sl fl l John I. Hamlyn, Jr. Eugene C. McKnight Charles H. Woolf l I I :T i Dance Committee 5 U xl l Chairman-Stanford E. Steinbeck l ll l Wagner d'Allessio Kenneth C. McRae 'l l Floyd Willis Clouse Lawrence S. Tuttle i , W Smoker Committee . Chairman-Leslie William Garner ll I Reginald Bell Sumner H. McAllister . j Walter Heinecke Edward P. Naurnes Il l Musical Committee l Chairman-Frederick E. Hines f Merrill L. Carlsmith George R. Warfield y Herbert A. Klein Irwin C. Warner i . '1 'l 1l Alexander T. Ross f i President, Second Term il , -:T-ai . J., W Y 9 'iii' fr nj'f '-'ffl il. - f ' ' . ' 'E' ' 'LQTF' ' .' ,'5'?? 'l 1 of ,gr lg .'.fwT,'fE'.-lzffituf gl-'jp -,ive E VJ, 'U ,, -u. ii -s ' 1 rf' ' 'fr' ' ' C' P - ...I C .6-fs-. ri f-fa.-fffviuif e?rf:f'f . .A - A.-x '21-?'7,3' if is - .if'Zf:w-r1.i..-..f'-.rf-E,y...?ifff. mf 6-1ifr'1rsi.2fre.ri l.lU:'!.l3 -. -e-are-7w.fFTHf-an-D... .1 II JI W Wil , I I l'l II 'Il I II II I I I E I I I I I I' President . I Manager . I Secretary . I Librarian . I I John D. Byrne John J. Hamlyn, Jr. Frederick E. Hines I I A I Iv J . I I ,I II .I . I I I I I I I TOYON CLUB Ojlcers-First Term . Richard Worden . Edward B. Krough . . Richard F. Holt . William B. Johnston Toyon Cabinet Richard F. Holt David S. Jacobson Edward B. Krough Eugene C. McKnight Richard C. Worden Dance Committee Chairman-Herbert M. Holmes Alexis L. Ehrman, Jr. Marshall F. Somerville Harvey A. Swickard ' Stanford E. Steinbeck ' Smoker Committee Chairman-Alexander T. Ross Stephen M. Dietrich Leslie W. Garner Walter M. Wood Eugene C. McKnight Club Equipment Committee Chairman-John D. Byrne Hughes Brewster Walter Heinecke John J. Hamlyn, Jr. Eugene S. Sheffield, Jr. Campus Relations Committee I I Chairman-Walter H. odemf J Donald L. Cherry Marshall F. Somerville Musical Committee Chairman-Ernest D. Wagner Richard C. Worden Glenn D. Feely David S. Jacobson 1 I President, First Term Frederick E. Hines Frederick A. Zitkowskl fi' ' ff 'r'T55f2I rmeigrhnzf -141:11 '?i'+...r5'7T'?? i 3? ,V L --A - I m W -ir-.s-n 5f-1 f+f1f.grZ-.-f.p1.iaCIiv?-. - .. , . C ' - QW1lEQff'l' ' IQ. 3 Sequoia Hall Encina Hall is primarily a repository for freshmen. Five hundred and fifty of them serve to keep the senior sponsors thoroughly occupied maintaining order. This plan of massing the freshmen together permits them to become acquainted with each other during their Brst year in the University, and all men registered as freshmen at Stanford are required by the Administration to spend their first year in Encina. Although these 1175 hall men and the 650 fraternity men all live on the campus, there are over 850 men who are forced, because of inadequate conditions, to live in Palo Alto or to commute from more distant points. Lack of adequate dormitory space is one of Stanford's most acute problems at the present time. Social life in the dormitories consists largely of dances and smokers. Toyon presents a dance each quarter, and a special one Spring Quarter called the Coed Dance, from which imports are expressly barred. Sequoia and Branner each hold one dance each quarter, though they make no provision against imports, Smokers are given by each hall quarterly. Toyon has, in addition to the regular smoker, special ones in the Spring and Autumn Quarters for the purpose of bringing upperclassmen and freshmen together and of introducing the Hrstfyear men to the dormitory system. The freshmen in Encina also conduct dances and smokers, in order that the inhabitants of this strange building may be more closely knit into a class. A Encina Hall S Toyon Hall THE DORMITORY SYSTEM TANFORD is fortunate in having two of the most modern men's dormitories of any university in the country. Toyon and Branner Halls have been built Within the last seven years and provide excellent living conditions for 340 men. Sequoia was one of the original buildings on the campus, and like Encina survived the earthquake. Although it is in rather poor condition, it provides accommodations of a sort for 160 men. ' The Stanford Union, a relatively modern building, provides quarters for 19,5 men. These four halls are assigned only to the upperclassmen, the Union being reserved for seniors and graduate students. Toyon, Branner, and Sequoia Halls have formed an Inter' Hall Council this year, an innovation which will undoubtedly be continued. The Council is composed of the president and a memberfatflarge from each of the halls, and meets reguf larly to discuss cofoperation between the halls, and to apportion dance dates in such a manner that no conflict will occur. Since the hall accommodations are not suflicient to provide for all men who Wish to live on the campus, the Dean of Men is compelled to keep a waiting list from which are chosen the men who are admitted each year to the dormitories they specify. Toyon Hall, being the most beautifully appointed, is coveted most. Branner is a close second. ' ' 'f ' ' . , . fi'3 -'SY'-L2'1'??? ljw 6 Tl ., .. E fl ,4 1 . lei Ti ll A T'ElllllTF EVE Bvanner Hall ..,.i ,. I .ia-. -,........- V..--..- - .- -Y W -A-..-.1-.-Q.. ,...- -. . ,.,r.--. . 1 . Q-.. 71, . A .V '..- g -, .-rTw-l 'avr K-v'-haf' 'f -f H I g - - Yi 4 fb- - p I ' I V Y f f, ffl'-ui 'gf 44'1i F 'J' x fl- -'.,?,i.,1f-ii 1 f Q vi. 7 at 1.1 15 L' I .' ' 5 L3 ' '3 I-lzf',iq1i'Eh:'l'gL:LgfFi:.:J l 'I il' 4 l' 'i 4,4 ,, '. ,-1 ,. - .. ...If . .. , 4 4,1 -nf. - K . in 'J ILC? If '- 'AJ '-Tu ' ' L-i'v'l-f ',.if '1vil 'Q-JMD. 1 Paul Harold Kocher Webster Bailey Otis Donald Hitt Alden Robert Lewis Beardslee Hughes Brewster Baylor Brooks John Winston Flory A-- S..- ,Y.Y . --, LOS ARCOS Reestablished 1922 Faculty Member Robert M. C. Littler, A. M. University Members Class of 1925 John M. Willits Class of 1926 Samuel Keao Poepoe Class of 1927 Carlton Earley Byrne Andrew Stanton Halley Harry A. Martin Class of 1928 William B. Johnston Henry E. Keyes Frank Arthur Lundy Frederick Edwards Hines William W. Buckwalter Louis Creveling john H. Dawson Robert D. Edgren Ben W. James I Class of 1929 John Hempstead Gratiot A. Stevens Halsted, Jr. Walter H. Heineman Robert A. Hume Class of 1930 Sloan P. McCormick 'fur -l r: . .. , . fn : - - J , l I u.v l, ,A : '11A'!'r+ Q-rl' . 1. 9-f Walter john Short Stanley A. Weigel Wilbur D. Russell William M. Story Donald F. Merris Arthur Capps Miller Dan Throop Smith James W. Wilt Frederick T. Kline Sidney C. Madden Lloyd M. Smith Carl A. Valentine L. Hal Rowe Terwilliger Back Row: McNaughton, Brewster, Merris, Russell, Martin, Beardslee, Wilt, Thomas, Halley, Dawson, Story, Brooks, Weigel. Third Row: Lundy, Hume, Johnson, Terwilliger, D. Smith, Valentine, Otis, Creveling. Second Row: Flory, Hudson, Edgren, Hines, Littler, Short, Halsted, Keyes, Kline, Gratiot. Front Row: Buekwalter, Kosher, James, Willits, L. Smith, Allison, Madden. v .. -L, ..: -i YY ,,, if-.W-. - .. . i.. , ,,4..-Y,- .-. . - - L -..- - ' 1.-...' 'Y - 7-fl 2 u--- 'I' fl'-Q1-'.f--W--'fT.3 H '- 4'--1:3 'il' 7' Q' ii FWF 7 - - ' F 'll k iq-.',?.....,,'.'.lLy1 ..,-.gi .413 thx i -. ' All , , - if, 1 1-'.'..1' -'4.l'l-1..i,,, - - A - - HM AAAA A if. :vim V'5.-l'.+1,'.-YiI:s1E,.'-l?--- l- A 13.115 W A, Fl 3, 'W'-,i' ,: s..sl'Els'A... '1'i-u-.'-347.14 .-T iam 63 1 arg v n E ,fl ,M I' i J .1-8 Y 5+ - pl 1 V, ' 5131 i'g:3 - . 'L . A ,. ,pi - 44-M , . ' . 5.4! 445+ --'ifw-..- '! ir.,-.giQ -Lira Q ,nn 'Z -1415+593 Harmon Clifford Brown Thomas R. Barnes Robert W. Clark Philip Cavalero' ' Wesly Philip Cox Albert C. Daniels Fritz Eghard vonEstorff George Kvelve Anderson, William Belcher Ballis Max Wilfred Barton Donald Merritt Brown John Marshall Campbell Wellman Albert Clark Merven John Garibotto EL TIGRE f 1 Established 1922 University M embers Class of .1925 , Peter R. Hurley Class of 1926 - Class 0161927 1 ThomasiM. Googin Adin Douglas Henderson Charles H. Hunter Class of IQB8 1 , Thomas Meade Goodloe, Jr. Howard Greenhalgh Harold Preston Hill Frank Charles Lerrigo James Edward Prisinzano Class of 1929 Milton M. Cohen, Jr. Douglas R. Fuller Raymond D. Keeley Fred Gibson LaMarsna John A. McDougall Class of IQ 30 Elmer L. Stockbridge Class of 1931 Joseph Dykes Johnson Peirce E. Warrington Philip Wingate Reinhart Bruce M. Richardson Chauncey O. Thompson Lawrence B. Weymouth George V. White James Thomas Youd Eugene C. McKnight Rolland F. Mahoney James Wilkinson Mead Roy Fred Mitchell Gandolph Prisinzano Carrol M. Sanborn George Richard Warfield Back Row: Mead, Weymouth, D. Brown, Barton, Warrington, Keeley, W. Clark, McKnight, Hurley, LaMarsna, Mahoney Campbell, Lerrigo. Second Row: Daniels, Cohen, Fuller, Johnson, McDougall, Hamilton, Barnes, vonlistorff, Googin, Anderson Garibotto, Richardson, H. Brown, Mitchell. Front Row: Reinhart, McAllister, Stockbridge, Cavalero, Sanborn, Thompson, R. Clark White, Cox, Warfield, Youd L :za 1 Q 1 uw EL CAPITAN Established IQZI University Members Class of 1923 Fred Harding Miller Class of 1927 Rollin R. Sanders Warren Raymond Evans Edson L. Foulke, Jr. Class of 1928 Forrest Macaulay Hill David S. Jacobson Robert Lawrence Harkness Class of IQZQ Ronald Stone Anderson Donald Edward Carlson Edward Peter Naumes Class of 1930 Anthony Mulvey Thorwald Pedersen Orray Taft, jr. Fred H. Zieber Thomas Malcolm MacQuiddy Eugene S. Russell Russell Scott Waite David Arnold Williamson Ralph Chester Wallace Back Row: Wallac Williamson, Miller. e, Taft, Naumes, Pederson, MacQuiddy, English, Cavitt, Mulvey. Front Row: Russell, Evans, Waite, Carlson, John Drennan Byrne Thomas F. Conroy, Jr. Russell Gideon Robinson Floyd Willis Clouse Lyndon Farwell James Adam Barr, Jr. William Chatham, Jr. Ambrose Sevier Churchill John Bailey Isaacs EL CUADRO Established 1920 University Mem bers Class of 1927 Robert McKibben Fraser G. Garner Green George Burns McCullough Class of 1928 Eugene S. Sheffield Charles Christian Wagner Class of 1929 Kenneth Boucher Funk Melbourne Derge Marsh Class of 1930 Vernon Cordry S. Fletcher Dutton Class of 1931 Hilton O. Johnson Hammel D'Roche McKay Richard William Moore jack Kuehn Moore Irving Levere Smith Jack Norman Westsmith George Stetson Paddleford John B. Robertson Charles William Mahin Robert Ulric Ricklefs Richard Allen Westsrnith Robert W. Wiper Back Row: McKay, Wiper, Isaacs, Ricklefs, Westsmith, McCullough, Barr, Farwell, Mahin. Front Row: Byrne, Robinson, Moore Funk, Green, Fraser, Wagner, Marsh. THHSTAHEQRDQUQ sa l wafa'AmeQ1s1il1' s Clyde H, Britten Iohn Matthew Chaffee 1 Edward Gerald Anderson Donald Langer Cherry Wallis Edgar Gallagher Edwin Alton Gardner Herbert M. Holmes George L. Evans, Jr. Robert Allen Hardison Henry Harris, Jr. Edward Beverly Krough , EL. CAMPO Q Established. 1913 University M embers Class of IQ24 Charles Francis 'Sweigert Class of IQ26 Class of 1927 Joseph Rainey Hancock 'Class 'of 1928 Harold Hunt Hyde Claude E. Leach Frederick O. Macy Thomas J. Peterson Class of 1929 Templeton Peck Frank Rene Sauliere Arthur joseph Schilder Class of 1930 Edwin Arthur Snow Fred Norman Jones 'T Ellsworth Harry Jackson 'Henry Wise.Newfman Alexander Treloar Ross Freid Lynn Smith William J. Travers, Jr. Lawrence S. Tuttle Charles Harold Woolf Wareham Clark Seaman Ray Elmer Tandy John W. Way Stewart Way Back Row: Holt, Gardner, Gallagher, Hancock, Chaffee, Meyer, Hyde, Cherry, Travers, Ross, Peterson, Anderson, Woolf Thrrd Row: Zitkowski, Leach, S. Way, Krough, Blackburn. Second Row: Mynard, Peck, Sauliere, Evans, J. Way. F10-nt Row: Seaman McRae, Snow, Smith, Schilder, Jackson, Tuttle, Macy, Hardison. 4 .I Q' IT' -f 5Ti j, :!'Jhr i'T 'J f2f'1.,-, pf in 1111.35-frlgll P 'll rr --'Nl' 'fa , .el- J I, ,I -. +2.'-1I..,,,-Y 4 .. .-- , 5- -as-n .-.'-.-. , ., Clifford Russell Hayden Paul M. Baldwin Burt W. Busch Harry Maxwell Conron Ellis Brotton Armstrong Daniel Newell Benton Bert Elmer Brown George Inness Ellsworth Wagner d'Alessio Leon Alanson Carley Edward Franklin Carlson John Alfred Clark William Milton Adler --- - TA .. -. ,-Q, -f. ,- , .-.f r ' -1.1 fa---7 ' .-.,.....,.., 1 , ,al .1 ja-,L ,A L- 'S F.Tf'1:lF'.,'lf',,g,,l f5lH,- 42, ','li'f'f5r1f- il 1'-'5'1,gr1,.1,ga 1 ' rpg ez .wwf -'+ ' EL TORO Established 1902 University M embers Class of 1925 Harry Leslie Noland Class of 1926 Frank Randolph Karr Ralph Leo Myers Class of 1927 Norman Winfield Cotton Glenn Dixon Feely Class of 1928 Chris Freeman John J. Hamlyn, Jr. Clarence Heald Langstaff Eugene Scherb Merrill Class of 1929 Oliver Byrd Crandall Alexis Lawrence Ehrman, Jr. Leslie William Garner Theodore Harder Class of IQ 30 Adelbert Nevin Culling Class of 1931 George T. Harper wx- .-. -M..-an V Walter Henry Odemar Wesley Michael Nagle George Maxwell Sayre john Francis Vander Kamp Vivian Albert Morley John Snively Reasoner W, ,lim Roberts Donald Albert Robesky Laurence E. Heiges, jr. Robert Edwin Krause Edmond M. Wagner Arthur Lynn Wessels Donald Bennet Galbraith Back Row: Karr, Harder, Ellsworth, Clark, Garner, Crandall, Merrill, Northcote, Hayden, Culling. Third Row: Galbraith, Reason er Carley, Harper, Langstaff, Robesky, Armstrong, Heiges, Wagner, Krause, d'Alessio, Ehrman, Wong. Second Row: Cotton, Feely Vander Kamp, Adler, Sayre, Hamlyn, Nagle, Morley, Busch, Noland, Benton. Front Row: Freeman, Myers, Brown, Wessels, Odemar .....-M... T--V.- M ..' ,, ,,-' 2 L..--w G.. -1. -...w ' . .-- ,L L MMS' ...t,...,.,,,,M - ,. . - .-H.- 7., .. 3- .1 - .- - V ..-. .,. mug, 441-2 g,11,gjg: 1, ' 1, ,jj 1 ,L ,V .'3l'l,I f.'v,c 1. all' ...2 L -,-,-q,'E.,1'f,'.Z',,L4'Z fire i, ',.5L. '5 4, ' - 'rr'-' 4.5 1- fa- -, K-42 .-2.1 'W 'tu Vg- 'Q l Waldemar Penn Dietrich, A. B. Donald E. Liebendorfer, A. B. Leon Bernard Brown Carl Wendell Carlsmith Harry Lewis Dulin Frank Andrew Compton, Jr. James Stephen McCartney Lewis Elmer Bronson James Elmer Busch Merrill L. Carlsmith Stanley James Cook , George William Ebey Walter Gordon French Robert Burton Gooden, Jr. Stephen Mann Dietrich Eric C. W. Krenz Harris Dixon Bogue BREAKERS Established IQII, 4 Faculty lMembers A Alfred R. Masters, A. B. Howard L. Mitchell, A. B. University M embers Cl0SSlOf,IQ26 H ' Horace L. Edmondson Donald R. Irving . Clciss of 1927 James Webster McDougall Class of 1928 George Palmer Dobson Wesley D. Doe E. Murray Draper Clyde Stewart McDonald Class of 1929 Jack Ormond Hodges Sidney Julien Olson Class of 1930 Julius May Class of IQ3I Almon E. Roth, J. D. Robert Lyman Templeton, Chester Erwin Ross John D. Van Amringe Victor O. Wankowski Julius Caesar Trombetta Fred Austen Wool Clarence Sypher Lewis Rudolph Vincenti Ernest Dean Wagner Richard Carl Wordeii Robert William Poole Leland Earl Thiel A. Lee Thornton John Blair Morrison John Cornelius Murphy Leslie Irvin Hables, Jr. A.B Back Row: Draper, Stock, Compton, Thornton, Coe. Third Row: Olson, McDougall, Perrin, Busch, Wood, McCartney, P. Vin' centi, Irvine, Wankowski, Wool, Dulin, Worden, Trombetta, Ebey, Van Amringe, Second Row: L. Vincenti, Dobson, Sypher, Poole, M. Carlsmith, Brown, Morrison, Doe, Ross, Cook. Front Row: Bogue, Krenz, Hodges, Taylor, C. Carlsmith, Heinecke, Dietrich, Bell. L .egg-Yi, ,.. ' 567- :,, . l ' Ai. mlllllin ,Au Encina Dining Hall THE EATING CLUBS TANFORD,S seven eating clubs, in addition to their paramount function of dispensing edibles, have as their aim the gratification of the student who demands the advantages of membership in a campus social group but insists upon retaining most of his per' sonal independence. Those who belong to eating clubs have the social contact to be found in eating three meals a day with the same group of congenial men, and at the same time they are not restricted by the rules and regulations of a fraternity. The fortunate degree to which this difhcult aim is achieved is indicated by the annual increase in membership and influence which most of the eating clubs are able to show. This year the combined membership of the clubs is nearly zoo, the large majority of the men being residents of Toyon and Branner Halls. Since their inception many years ago, they have served as important units in the activities of the halls. Socially, they take the place of the local fraternities which are found at many other universities, but not at Stanford. The clubs organize teams for the intramural athletic events, and usually one of them finishes at or near the top. Politically, the eating clubs are very important, as most of the student body oihcers are recruited from their ranks. Los Arcos, El Cuadro, El Capitan, and El Tigre are members of Encina Commons and confer with Miss Handy to maintain an acceptable food policy. El Campo, E1 Toro, and Breakers each own separate buildings consisting of a dining room and kitchen, and are entirely selffsuiiicient. These buildings are part of the group of rnen's dormitories and are situated just north of Toyon Hall. All the clubs are run on a strictly cofoperative basis. An effort was made this year to inaugurate a policy of kinship among the clubs. This policy aims to prevent a feeling of rivalry and competition from growing up among the seven groups, and with this end in view, a number of exchange dinners were held, which permitted clubmen to eat with organizations other than their own. Although the clubs are meant for hall men, it is a happy commentary on the democracy of Stanford that fraternity men have always been frequent and welcome visitors to their tables. The individualistic and partisan tendencies that have so long characterized relations between the halls and the row are steadily on the wane, and it is even possible that in the near future a student body president may be elected from the row. The men in Sequoia Hall, situated at some distance from the other eating groups, ref cently organized an eating club, but as it is nothing more than a branch of their dining hall, it falls into a separate class. Encina Hall has its dining facilities divided into units, but they are not organized in any way. +.,,+E+ as as fx-v JAPANESE STUDENT ASSOCIATION F oundcd 1902 VQKETD TWQTWW QW? Thomas N. Fukushima George Taro Akamatsu Arthur Yagoro Kinoshita Thomas T. Akama 1 Takazumi Taki Asakura Harry Tatsuo Hongo Tadashi Shizuoka-Ken Kawaguchi Niroku Kusumoto Louis Shoichi Aoki University Members Class of 1926 Kazuo Kawai Class of 1927 Mitsuharu Shigeta Class of 1928 Masaru Michael Horii Walter Keisuke Iriki Yoshio Okumoto l Yoshio Ouchi Class of 1929 Stewart Kazuichi Nakano Keizo Nishihashi Class of 1930 Class of IQ3I Takazo Domoto Thomas Tomio Murata Masao M. Suma Lee Mitsuyoshi Watanabe john Hiroshi Sano 'Tanenori Tashiro Tadao Yasuda Shigeaki Nishimoto Joseph Tsukamoto Tokio Ishikawa Back Row: Aoki, Kusumoto, Kawaguchi, Nishihashi, Ishikawa. Third Row: Nishimoto, S. Nakano, K. Nakano, Tsukamoto, Murata, Asakura. Second Row: Akamatsu, Fukushima, Kawai, Yasuda, Tashiro, Ouchi, Okumoto. Front Row: Akama, Horii, Iriki, Dr. jordan, Dr. Ichihashi, Hongo, Suma. ,.,.-Y - - - - Y , , - - L-. . . L A- ,f,,1..1' ,- I.. T,,.,H,, ,,,,,-,Y -': i 4 'H il. . ...fl I1 Q. vis.: ' ,ew-111:-stir.. 1. 'll . , ' I , ll.. T, XP' ei ..t ry I . T. .X 47?-.,TT':,.f:zlI,1 '. 1,1 -X,-,' . 3 L l- Q. .+f f' rr'-1.1. 1 ,- l -- 1 L -L --- -:-11-..,+'.':-'r' I I ' L- --' , , . ,..i H Lx.. en- 1.- Ying Yuan Cheng Henry Docfoo Cheu Siegen K. Chou Faw Yap Chuck Collin H. Dong Perry Yewton Ho Wen Ping Hsieh George Chan Pao Hong Chang Yuan Teh Chen Ch'u Chai Edward W. Fong Tsu I. Ho Pardee Lowe CHINESE STUDENTS' CLUB Founded 1910 University M embers Graduate Students Yung Ying Hsu I. Huang Ira Condit Lee Quong L. Lee Quon Sein Leong Chien P'ei Huang Shih Tienkai L. Tan Class of 1928 Yu Hui Chia Tze An Chow Shih Chun Huang Tim On Kwaan Class of 1929 Fa Huan Li Tao Hsuan Li Class of 1930 Class of 1931 Ming Yan Wong Hsu Chuan Tuan Feng Gang Wang Hung Chau Wong Cheng Hwa Wu Chin Chuan Wu WafYat Yeung Lih Chi Yu Tso Shih Tsung Wu Chi Kuang Yen Hsing Chin Liu Wen Ching Lo Hua Kuo Pao Wai. Hon Tam Back Row: Wang, Yen, P'ei, Liu, Tuan, Tam, Yeung. Second Row: Kwaan, Shih, Pao, Yu, T. H. Li, Hsu, Huang Wu Front Row Chai, Fong, Lo, F. H. Li, Ho, Cheng, Howe, V ' 7 ,A L Vs-.-v. -- i..1,.' . ' .' ev'-'vs 'lg ' W- , f , 1 f-1-L - . gvuL:.'3h':yi1!i5 AE !:l4'.!LI-'J-LP 1.-gif i ILT' . V., V ,wi Y ,Y-4, ,Jig '...A --1-.,' -KI., 1 .n Y Founded at Massachusetts Agricultural College 1873 NU DEUTBRON CHAPTER Established 192 3 PHI SIGMA KAPPA Merrill Kelley Bennett, Ph. D. Harvard Young McNaught,lM, D., C. M. Richard David Husband William Archie Baker Albert Evans Cressey Donald Porter Jacobs Dana Gerald Bing Don Kay Butterbaugh Wayne Ronald Byrne Jim Gordon Bardin William joseph Bardin Faculty Members Percy Alvin Martin, Ph. D. University M embers Class of 1926 Harold Medsker Newlin Class of 1927 William Winston Burbank Class of 1928 William Clifford McDowell Francis Nathan Marshall John Broderick Peck Class of 1929 Claude Rowan Cummins Edward Mansfield Flohr Maurice Houser McCampbell Ferdinand Walter Mendenhall Class of 1930 Sanford joseph Butler William Sumner Greene , ffriflbv ri I If lit:- ' .. Q John Otterbein Snyder, A. M. Edward Kellogg Strong, Jr., Darrell Russell Parker Howard Delos Ross Wellman Perry Thayer john Cornell Wilson Ream Victor Miller Richard Nahum Nason, jr. John Madison Scott Arthur William Pigott Phillip Bannister Smith Ph. D. Back Row: Greene, W. Bardin, Peck, Cressey, Ross, Marshall, Butterbaugh, Parker, Newlin, Thayer, Pigott, McDowell. Front Row: Flohr, Mendenhall, Miller, Nason, J. Bardin, Bing, Wilson, Smith. '56 f i f 1: 'Sf , i...l.s...s-- P4 Ill-IPI 1 A 5- 1 i l le 2 A 'sei' Y A I-Q i'v, H ---SJ:-.'. 7. . 1 .',A 'q.fj,,Q.gL lf?-5C:2,1'.q1'1zf :SL Alvin Joseph Cox, Jr. Frederick James Cooke Carlton W. Dawson Morden Grant Brown Reimers Doran Koepke Richard Gerichs Lean Allen Bosley Lemmon ALPHA KAPPA LAMBDA Faculty Member Lee Emerson Bassett, A. B. University Members Class of 1926 Fred A. Miller Class of 1927 Class of 1928 LeRoy L. Hinckley Howard Beecher Lathrop Class of 1929 Oliver Cecil Hiatt Frank Howlett, jr. Class of 1930 Cedric Merit Madison Ernest Winslow Page Founded at University of California 1914 BETA CHAPTER Established October 1920 David John Stollery, jr. james Verne Mansfield Leonard Fisk Wilbur Ralph J. Walker Grove Allen Rawlins Robert Preston Watkins jack Harry Whitesel V. L L -v Back Row: Cooke, Howlett, Walker, Mansfield, Miller. Second Row: Stollery, Hiatt, Hinckley, Brown, Wilbur, Lathrop From Row: Lean, Madison, Koepke, Rawlins, Whitesel, Lemmon, Page. ae .. .-11 as-.q,... 4- ,V ll 1,12 -..-. 1. if 9 ...wax -33.19 Lgjs-Ifj:,'I1li .11 -- .g H 1' Mm . ff, 23. .2,l.::l.f1 Founded at Norwich University 1 856 ALPHA EPSILON CHAPTER Established May 1920 james Bennett Liggett Class of 1925 Carl William Anderson James Ross Riley, Jr. Overton Barnes Banks Albert Cummins Beeson Robert Lee Fredricl-:son Philip Graham Caldwell Donald Brooks Carr Paul Stanton Barnes John M. Fowle William B. Freeman L . .1-a - ,T+:,Yi ,ral ,3,.M..F-- V B t-- v - - f - 's S . ,,k.?s!', Wi THETA CHI Faculty Members Harold Shepherd, J. D. Cyrus Fisher Tolman, jr., B. S. University M embers Class of 1927 Douglas C. Hausch Frederick lngleby Richman Maynard joseph Sears Charles Edward Smith Class of 1928 Robert L. Harbison Leslie Earl Harris Rae F. Helmke Class of 1929 john Parker Duncan David Howard Morey james Kedzie Penlield Class of IQJO Everett Glenn Harris Guy Martin Helrnke James Hollowell Dean Morrison ,Y 1- ,., ,--mf L , J M . , .-.-.- ,L.-A..-:fx par, ,J lk .. M. ' 1 .f J, . -.. ,1 N, ,. 2.1:-. Ili-'NIIJV-l,'E.ig.l'l I - fr .5 sqm. ,,- 1, ',,.. rv 416, .Y ' of 0 li. 0' w, i ,. -- . 1, N xffs a ii Murray Shipley Wildma Class of 1926 john Martin Adams Bert M. Green Fred Platt Preston George Meredith Uhl Norman Edward Walsh Charles Lew Reasor Roy Wilmer Wood Alonzo Young Olsen Wesley Visel William Ward V' , t n, Ph. D. Back Row: Hausch, Reasor, R. Helmke, Richman, Visel, Olsen. Third Row: Sears, Beeson, L. Harris, Riley, G. Helmke. Second Row: Fowle, Green, Preston, Carr, Harbison. Front Row: E. Harris, Morrison, Freeman, Penheld, Barnes, Morey. M-. -..,..,,,-- E..-.4 - V . . --.,--nf fr I' .af 2 ,' .. r A' , - ,. li -., . P : .1 ' 1, ', 1 ' . w -if A --.. v -11-- i-.-, 4' fr Lia V JI .., .v. 1 .wr l,- .s qi ..,,,L,,...,. 'Fi' ,img- S-5. lali W. ,V l ss: - . ,-dl' 4...t,f.TllE,-STAHFQRQ 039.599 I. , . r 9 EY., -ai-tfzfzhk .,4xw,,g4 ,xig L Buford Otis Brown, B. J. g Lawrence Hobbs Acres William H. Horine Frank Baker jack D. Blair Kirk Clagstone Edward Harold Conroy Walter john Dill, jr. James Lamb Brainerd Philip Leiter Coats ALPHA SIGMA PHI Faculty Members John Bennet Canning, Ph. B. University Members Class of IQ25 Kenneth L. Ferguson Class of 1926 Irvin A. Frasse Frank Brewster Frye Class of 1927 Class of 1928 George Bradley Winston Norman George H. Potts Class of 1929 Harold Duncan Chesley Gould Ferguson john O. Harnan Donald Fletcher Muller Class of 1930 Thomas Richardson Cooper Bernhard Gramatky john Hackney Hamlin Founded at 'Yale University 1345 TAU CHAPTER Established Decembef IQI7 George William Dowrie, Ph. Kenneth Mitchell Johnson Harold K. Hotchkiss Dwight Howe Trowbridge Francis Edwin West Richard joseph O'Brien Reginald Rumwell Clarence Thomason Arthur Curtis Hurt, Jr. W. Redmon Stout D Back Row: Horine, Potts, Cooper, Norman. Fourth Row: Trowbridge, Baker, Frasse, Rumwell. Third Row: Dill, Bardley, C Per guson, Conroy, Johnson. Second Row: Frye, Muller, Clagstone, K. Ferguson, O'Brien. Front Row: Hurt, Stout, Haman, Hamlin Duncan, Coats, Brainerd. ffltaw lr VYfY?Flr 7-Y- xe -n V - 'W YY' Q Q 1. rj . n Founded at Hamilton College 183 2 STANFORD Cimvriza Established 191 6 Gordon Arthur Davis, A. B. Leonard Wheeler Ely, M. D. Charles Keep Benedict David L. Evans Harold Leslie Duckett, Jr. Frank McAllister Dunn Walter Andrew Johnson Marshall Lloyd Carter John Banwell Keith john Barker Lauritzen Nelson Ira Carter E. Perry Churchill Edwin J. Crebs John Berry Gray Douglas Clark Gregg ALPHA DELTA PHI Faculty Members Henry Rushton Fairclough, Ph. D. University Members Class of 1926 Class of 1927 Cranston W. Holman Neil Albert Miller Class of 1928 Robert Denison Keerl Edward Francis Kengel J. Vernon McCutchan Dean Brown McNealy Class of 1929 Ernst Carl Ophiils Foster Bowd Rhodes Class of 1930 Louis Charles Lieber, Jr. C. Ralph Lyman james G. Maxwell George Eugene Moore J. Stanley Mullin . , .am RL, 4w 'v, , :i 15... 1 9 00 f 9 i E, 18525 5 , Clarence G. Osborn, A. B. Payson Jackson Treat, Ph. D Edward Warren Lloyd Gregory Williamson Clifton Hayes Moore Colin Hubbard Smith Moye Wicks Stephens, jr. William Alexander Sparling John MacLeod Stine William W. Valentine Richard R. Stewart james Greer Thompson Edward Robinson Valentine Palmer Wheaton Stanwood Ivers Williams , . Back Row: Gray, Keerl, Smith, Sparling, C. Moore, Kengel, Miller, W. Valentine, Dunn, Benedict, Lauritzen, Maxwell. Second Row: johnson, M. Carter, Rhodes, Ophiils, Duckett, Stephens, Keith, Williamson, McNealy, Stine. Front Row: Stewart, Thompson, Gregg, Wheaton, E. Valentine, Mullin, N. Carter, G. Moore, Lieber, Churchill. 1254, ' 5 iS2.A.' 5f 'S5fsv': '15, Q3 5 John Thomas DeFrees William Treat Dinsmore George Alloysius Connolly William Harwood Danford Thomas Chauncey Flaherty Trerice Vivian Adams Joseph Bitterlin Lincoln Clark William Henry Collins John Linden Deahl, jr. Christian Lawrence Ecklcn PHI KAPPA SIGMA Faculty Member Everett Parker Lesley, M. M. E. University M embers Class of 1926 George Frederick Wasson, Ir. Class of 1927 William Augustus Evans William Hinckle Class of 1928 Robert Mackelcan Gunn William Henry Hubbard, Jr. David Burroughs MacClyment John Brunker Meal-rin Class of 1929 Morris MacKnight Doyle Samuel Joseph Dunkley Rowland Ward Edmonds Walter james Fell Robert Smith Green Class of 1930 Tindall Evans, Jr. Henry Michaels Founded at University of Pennsylvania I85O ALPHA TAU C1-mrren Established 1915 james Edward McCormack Bruce Miller Stephens Gustave Adolf Mueller James Ewing Rae William Sanders Donald William Hamblin George Pulsifer Kimball Dean Alfred Sweeney Robert Sutton Sweeney William Simon Philip Templeton Smith L-.-1 'a...E ::v .1 . 1 .L . f-3 fl Y, W- . '. ..., Y -5 ., . ..: Back Row: Hinckle, Collins, Connolly. Fifth Row: Wasson, Lesley, Doyle, Dinsmore. Fourth Row: Green, Sanders, McCormack Danford, Mueller, MacClyment. Third Row: Gunn, Flaherty, Rae, Meakin, Kimball. Second Row: W. Evans, R. Sweeney, Edmonds Dunkley, Hamblin, Adams, D. Sweeney. Front Row: Bitterlin, Fell, Michaels, Simon, T. Evans, Deahl, Ecklon. .fr -Rafi ,f-'r -.cvf .FLAfav.d5- -' Y Air 'A'll -,f',,z.,f.'--. .-Leia. - ., -.f.ifo,fi..f v- -... . L.- . -I ,I w4.:..-.rv-., Founded at Rensselaer Polytechnic lnstitute - 1864 - TAU CHAPTER Established Febfrua-ry 1914 Welton Joseph Crook, A. B. William E. A. Best Albert Loutrel Anderson Alfred Richard Cannon Norman William Fain Harry DeGray Birch Herkimer Ernest Adams Joseph R. Allendorf Edmund Chapman Babson Clay Hathaway Beattie Hadley R. Bramel Jacob Henry Fetzer 2 f 1. --1 :Inf--gear via r ,1 -i , v K-Luv ., I A, Fi v X' I A' ,. ' iN Q , 1, L1 r.A,, Qi ll TI-IETA XI Faculty Members Ward B. Kindy, B. E. E. University M embers Class of 1926 Clifford Anderson Class of 1927 W. Hervey Butler Barry Casad Class of 1928 Otto H. Hieb Robert W. Lindsay Class of 1929 Philip M. Shaw Class of 1930 john Cary Gilman Philip Kingsnorth Gilman Edward Lauderdale Kennedy J. Alfred Leonhardt William Terrell Lewis ,A-.5 - ,Mi-rs - :fm . i , J.FI1fJr t. 1 -f.-'..,. '.. f ' ' 'si-k..v l'f 1 E -55 I '4 ff, iz if 9 512.212, HI , .. S, 1 P ' .4 H1-. E.. ft ,afgfi-. ff ,-H.t.,.,4?nlff' ... . ' - 'yy ...Rv H f-, iffql. -rl lf 1.14-'J,f' qi --f..a '- L- Frederick Emmons Terman, Sc. D john Joseph Daly, III Clyde James Smith, Jr. George Edwin Thayer Evan Hadley Wild Edwin Harvey Smith Stanley Arthur Milne john Royden Morris John H. Nutt John Harold Revell Melvin John Rowe, jr. John Franklin Work , . ...aan ,.,..,...,-.-.- - I . . 1 , l I faJ351?5: K 1 xl.. l Back Row: Anderson, Leonhardt, Fain, C. Smith, A. Anderson. Fourth Row: Work, Morris, Schofield, Lindsay, Fetzer 'Third Row: P. Gilman, Revell, Butler, E. Smith, Birch, Nutt, Rowe. Second Row: Shaw, Kennedy, Adams, Bramel, J. Gilman, Beattie Crook. Front Row: Milne, Hieb, Cannon, Babson, Lewis, Casad, Clark, Thayer. '-.E al A sq'- y S l vi-'pl I sf AL N you lv X I .ir--.'-Kin, 1. ','n.'. A 1 l l ' ' ' 'WTGIY .Q 5 5. , fl 1, Joseph Walter Bingham, J. D. ' r Arthur Martin Cathca Frank W. Atkinson, Jr. Kenneth Neal Chantry Louis James Brandt Richard Armitage Albert Biaggini Albert M. Bly Byron W. Hay Joe Shannon Carroll Allison Johnson Gibbs Don H. Goodcell William Atwal Allen William Clough t, A. B. DELTA CHI Faculty Members Harford Holmes Hays, A. B. Marion Rice Kirkwood, LL. D. University M embers Class of 1926 Clark Cypher Class of 1927 Class of 1928 Thomas Joaquin William Quinn McAdoo Fred Hayes Newcomb Class of 1929 Ross Adams Goodcell William Barto Green Lawrence Belknap Hall Class of 1930 Finley Johnson Gibbs John Paul Jennings Glen Earnest Logan 4 . v Founded at Cornell University 1890 STANFORD CHAPTER Established May IQOS Ralph Haswell Lutz, Ph. D. William Brownlee Owens Jack Wagner Hardy Malcolm Little, Jr. Norman Arthur Springer Roger McKinley Paxton Byrl Richard Salsman Joseph Odell Smith Jack Lowell Springer Jackson Hoagland Wayne Echard Jeffers Paul Eugene Lloyd Edwin Gardner Robinson Andrew Yeomans ,LL Back Row: Paxton, Atkinson, Joaquin, Smith, Hay. Third Row: Springer, Armitage, McAdoo, Newcomb, Salsman. Second Row Brandt, Jeffers, Carroll, Hall, A. Gibbs, Goodcell, Bly, Biaggini. Front Row:F. Gibbs, Robinson, Yeomans, Jennings, Logan, Green . .li l Founded at Union College 1847 ETA DEUTERON CHAPTER Established April 1903 Clifford Gilmore Allen, A Winston Black John Payson Adams Robert Edgar Cecil Herbert George Christ Raymond George Drake Lloyd Wilson Dow Robert Samuel Cathcart Alrich William Dahl Daniel Carlo Dilullo .M. THETA DELTA CHI Faculty Members University Members Class of 1926 Class of 1927 Class of 1928 Frederick Orton David Staples Painter, jr. Ernest Lynn Patchett Class of 1929 George Hartley, jr. Class of 1930 William Alexander jones, jr. Leo Paul Kibby I if air' for l 1 4.1 to v 5' 1 3, l' ' 1' fl 955334. QQY5 f f 'E' .. X Charles David Marx, L Edward Downer, jr. Charles Wilson, jr. Herbert K. Reynolds Sheldon Riveroll Douglas White Lucian Woocl Hugh Hamilton Leland Henry Clay Miller, jr. Donald Anthony Pryor L.D Back Row: Orton, E. Patchett, Wood, Black, Reynolds, Adams, Drake, Cecil, Christ, H. Patchett, Hartley. Front Row: Leland Pryor, Miller, Kibby, Dilullo, Dahl, Cathcart, Dow. Class of IQ3O ,..... L Driscoll, Hollingsworth, .1 angie, V. - l . .4-v 1 is . I, l . 1.7 f l 0' Q' 'k ' ffl' 1 ' xx , I, . 'ff' James Lyman Adams Edward W. Anderson Cyril Chappellet Ray J. Coleman William Hollingsworth john Frederick Kenaston john Lawrason Driscoll Thomas Albert Driscoll Jack Meux Barbour Tito Bianchi Edward Thomas Dillon I I'v .- .., I I i'.4 , - -'- - H11- - .- '.?f? -X-Sv 1. V v A N' 'Y' 4 M fl G N hp Founded at 'IQ --+...,9N g - 4 n , Tale University 1 ' -- -xx . r f - Y 8 7' :big ts l - 'E' .5 - L.. 4- I 44 1 V -,:- :l ' D i T- ' '.f' i A SIGMA RHO ' ? ' ' CH.-ufrrm A Q- I ls Established February I. f .,,, ,,,,i4 ...I 1902 DELTA KAPPA EPSILON Faculty Member Frank Mace McFarland, Ph. D. University Members Class of 1927 Paul Hyson Hebb Alan Archer McCray Maurice McCray Drummond Frank Wilde James Windham Class of 1928 Michael Mark Murphy William Winston Ogden Mernon Richards Robert Floyd Sims john West Thompson Leigh Gray Thornton Class of 1929 Ray Jessie Hulen john Bole McCandlcss john Iviillard Rogers Frederick Walker Albert Edward Doerr Ralph Lud Frentrup Arthur Herbert Henry Francis Lawshe john Clarke McPherson George Watkins Story Back Row: Rogers, Wilde, Adams, Chappellet, Thompson, Coleman, Sims, Kenaston. Second Row: Anderson, Richards Murphy Thornton, Dillon. Front Row: Story, Doerr, Frentrup, Barbour, McPherson, Lawshe, Bianchi Herbert Founded at 4- Uriiversity of Virginia 1867 BETA ZETA CHAPTER Established I8QQ Edward Masliii Hulme, A. Royal Alvro Chapman Benjamin Cole Craft David Snell Adams Waldo Ashby Martin Flaherty Bancroft Peter james Crosby Herbert Wesley DeCou John Anthony Dungan Eminel Potter Halsted Charles Baskerville Harold William Mann 5 9 'ii ' I , IV -1 Q. 1 L s ' ,Ja 'i-1224 - '--ff l: 'iii-524 ii e an KAPPA SIGMA Faculty Members University Members Class of 1926 Charles H. McAllister Class of 1927 Donald Arthur Flickinger Arthur Newton Mann Class of 1928 Fenton Avery Barrett Cyrus P. Farewell Class of 1929 Warren Daniel Hopkins Fredrick Faber Hubler Allan Richard Kenward Albert Hubbard Moffitt, Jr. Gordon Wright Monfort Truman Alfred Parker Class of 1930 Kenneth M. Milligan 7' L : Q - '-so-:.o 1 .' 0 '-ja 4 'Lnxg 9 , ,, 'l' V I , Ralph Haswell Lutz, Ph Charles V. Morton James Ownby, jr. Donald L. Forster Willis C. Wolf Anson McElree Reeder Ralph Rhind Paul Alexander Sexson Thomas F. Thompson Frank S. Wilton, Jr. George Fredric Olsen Donald Justin Stevick Back Row: Farewell, Bancroft, McAllister, A. Mann, Morton, Flickinger, Wolf, Thompson, Antonell, Barrett, Wilton, Chap' man. Second Row: H. Mann, Hopkins, Sexson, Hubler, Crosby, Ownby, Forster, DeCou, Ashby. Front Row: Moflitt, Rhind, Adams, Parker, Reeder, Baskerville, Halsted, Dungan. gin' 4 1' Y . ,. . 1 ' G Walter G. Beach, A. M. William D. Briggs, Ph. D. Arthur M. Cathcart, A. B. Arthur B. Clark, M. Ar. William A. Cooper, Litt. D. Class of 1926 Richard F. Hyland George Wesley Tackabury john Hilty Abramson Joyce E. Aldahl Hubert Hayward Berner William I. Gilbert, jr. Robert Edward Burns Paul Lochry Harwood Walter Charles Hulsman Charles Edward Greenfield iii sl 5 L gn ll ,Wig 1,b9us7 'Y'fnl6:1 5.8, 'Ng ,4, U ' . vs- 5 ll f--AL 1 , U ,i K . V ,. - 5, rxxg I .5 Il 1 ' .. ,Q . X--ua . g 1 E . .,... J.. 1-,U -'-- ' .,..5..,..rf:2't:es-' h l '-'- qu '.,,, .. Y u . 1 ,'wg.f 5 :,.,g.. 1 .,. 1 rg, '-, . . in , rm tw. l fa .N f' x if M- . 1-q ' ' 1: .-,. A- , V.-.47--71. -1 A, I -4 I -A fl:-Lzfttega . .V .ii-.il Hiiwl' ,' ,g Faculty M embers George B. Culver, LL. B. Benjamin O. Foster, Ph. D. Philip K. Gilman, M. D. Henry D. Gray, Litt. D. James O. Griiiin, LL. D. University Members Class of 1928 Thomas Russell Harriman Robert A. Hefner Donald Kinman Hill Harry Lee Maltby Class of 1929 Alexander Michael McKinno Harwood Loomis MacRae john Bruce Magee Morgan Robin Nickell Class of 1930 Michael McGrath Harold Templeman U Founded at Williams College ' 1834 SrANroRD CHAPTER Established March I8Q6 David Starr jordan, LL. D. Marion R. Kirkwood, LL. D Harry L. Langnecker, M. D. Guido H. Marx, M. E. john P. Mitchell, Ph. D. Class of 1927 Charles Erskine Coverley Franz Osthaus Wilko Mentz, Jr. George Donville Robertson Robert H. Vermilya William Worthington William Robert Patrick Dowell Spencer Richards Robert Beverly Taylor joseph Odell Wright Back Row: McKinnon, Tackabury, Osthaus, Aldahl, Coverley, Nickell, Vermilya, Hill. Second Row: Abramson, Hefner, Harwood Harriman, Gilbert, Hulsman, Burns. Front Row: Worthington, Greenfield, Maltby, Richards, McGrath. Founded at Washington and Lee 1865 ALPHA P1 CHAPTER Established October 1895 Class of 192 3 Harry Hollis Chalmers Horace Hodge Davidson Sheldon Pearne Hartwell Kenneth Ansel Brown Henry john Brunnier, jr. james Kirkland Davis Theodore K. Farrington Stuart Myron Alley Benjamin F. S. Card Harold Tycho Castberg KAPPA ALPHA Faculty Member Maurice L. Huggins, Ph. D. University M embers Class of 1926 Robert Castle Davies Kenneth Alfred Rogers Class of 1927 Clifton W. Morrill Class of 1928 Class of 1929 john Lee Fisk Sydney MacLean Gray Edward Howard Marx Class of 1930 Edward james Goldie Nason Eustace Hall -lohn Benjamin Hromadka Class of IQZS Robert Ziemer Hawkins Phillip Edwards Wright Frank Benjamin Yoakurn, Jr. Roland Sellman Willis Enos Osmanson Theodore Singiser Rathman Homer Mendel Toberman Stanley Colby Livingstone George Irving Long, jr. Richard Arthur Pease Back Row: Chalmers, Toberrnan, Rathman, Sellman, Wright. Third Row: Fisk, Davis, Brunnier, Hartwell, Hawkins, Second Row Hromadka, Brown, Card, Farrington, Marx, Davidson. Front Row: Livingstone, Hall, Castberg, Pease, Goldie, Alley, Long. 5, 51 flax' I 1' Q Q-, Frank Wickham Ditzler Carl Louis Ankele Roland William Hilmer Danily Clarence Bell George Kingsley Bellows Holden Edmund Brink Robert Brownell William Bayley Coberly, Laird Houston Doyle Oliver Charles Dunn Ford W. Harris, Jr. jr. CHI PSI University Members Class of 1926 Class of 1927 Ernest Albert Dunbar Charles A. McLean Class of 1928 Class of 1929 Homer Theodore Craig, Jr. John Vickers Crawford Thomas Benton Gibson, jr. Class of 1930 Lewis Deming Hobart john Paul jones Thomas Fox Koster Anton Laubersheimer John Baker Lee, jr. Founded at Union College 1841 ALPHA GAMMA DELTA CHAPTER Established April 1 895 Clarence van H. King Kenneth Roswell Walker joseph C. Winterburn Lionel Bayley King Paul Fuller Murphy Fred Mills Russ James D. Roantree Kenneth Reed Shupp Paul Lanz Speegle Robert Lowell Wagner Merrick Peck Winkler Back Row: C. V. King, Gibson, Winterburn, Hilmer, Walker, Dunbar, Bellows, Ankele, McLean, Craig, Ditzler. Second Row L B King, Crawford, Brink, Harris, Dunn, Koster, Wagner, Murphy, Bell, Russ, Shupp. Front Row: Winkler, Roantree Brownell Lee Pal, Speegle, Doyle, Laubersheimer, Coberly, jones. Founded at Miami University 1 839 LAMBDA SIGMA CHAPTER Established july 1894 Thomas Shepard Barclay Class of 1924 William A. Bullis Lewis Willett Andrews, jr. John Albert Bullis Alan David Herrington Frank MacBoyle Lewis john Harlow Alabaster Creswell Chapin Cole john Lionel Hare Richard McCurdy Thomas Gabriel Murphy BETA THETA PI Faculty Members Eliot Blackwelder, Ph. D. James Perrin Smith, LL. D. University Members Class of IQZS Thomas Allen Campbell Class of 1927 Class of 1928 Clifton R. Montgomery Edward Harrison Post Class of 1929 Alexander J. Cook Class of IQQO Harlow Phelps Rothert Lewis Nelson Smith 1 l' .San fl f ' aww . ' Albert Conser Whitaker, Class of 1926 Edwin Llewellyn Forrest Warren S. Pallette Comer M. Thomas, jr. jan Tibbe Newton F. Wheeler john Lee, Jr. Douglas Batchelder Lewis john Kenneth Stewart George Wylie Thompson- Maurice Dean Torrence Ph. D Back Row: Montgomery, Herrington, W. Bul1is,j. Bullis, Andrews, Pallette, Tihbe, Post. Second Row: M. Lewis, Baxter, Thomas Wheeler, Cook, Alabaster, D. Lewis, Cole, Lee. Front Row: Hare, Stewart, Rothert, Thompson, McCurcly, Murphy, Smith. l r his Hans Barkan, M. D. Haughton C. Bickerton Hugh Harrison Brown Leonard Lamson Crary Henry Frederick Hartmann Halsey Lawrence Beemer Ralph Judson Brenner Marshall Roberts Brown Sherman Leonard Crary john Leighton Dales, Jr. Edgar Robley Benninger Charles Park Eddie Merle Frederic Emry DELTA TAU DELTA Faculty M embers Ernest Whitney Martin, Ph. D. University Members Class of 1926 Duncan Oneal Class of 1927 Wallace Kerrick Downey Class of 1928 Robert Wade King Robert Lincoln Miller james Ross Nichols Class of 1929 Hubert Randall Gallagher john Henry Kelly Lawrence Delbert Lewis Francis Whitney Martin f Class of 1930 Richard Louis French Henry Luke Hoxie David Kline William Peirce McDowell 18 , , Founded at Bethany College 1859 BETA Rao CHAPTER Established August r893 Frederick George Tickell, B S Emerson L. Spencer H. Mark Young Dixon Hinshaw Smith Frederick Aleck Wise Chester Carl Moomaw joseph Clarence Musto john Calvert Snyder Elton Leland Tognazzini Craig Stephan Vincent Robert Findlay Paine, jr. Arnold Otis Williams john Kiger Young Back Row: Spencer, King, Downey, Smith. Third Row: Miller, Brenner, Wise, M. Young, L. Crary, Oneal, Nichols, Hartmann H Brown, Snyder. Second Row: Tognazzini, Dales, S. Crary, Vincent, Gallagher, Martin, Beemer, Lewis, Kelly, Musto. First Row Williams, Emry, Paine, Eddie, French, J. Young, Kline, M. Brown, Benninger. Founded at University of Alabama 1 856 CALIFORNIA ALPHA CHAPTER Established March I8Q2 Harold McDonald Davis, B. S Class of 1924 john Herschel Lyon Class of IQ25 John Scott Quigley james Hamilton Allen Windsor Drury Bigelow Gregory Hensley Davis Charles Percy Fonda Kenneth Paul Lloyd Thomas Allen Batson William Hodder Carleton Donald Lathrop Case Tom Lewis Chichizola Frank William Erlin I L ,,'gr,il ,ms kj llgj 4 ' fy-'E:'I I ' N im, i,'s,x .1 'Ta if 2' -H 1: -,,-' TY ,lftw V ', X, L- S '- ' ,f'5'Q , p Wt 'v ' 'lii' , f? ' it A if , 5' .3 'Q lfgi-fi 53. fl'i ff - .i.. SIGMA ALPHA EPSILON Faculty Members University Members Class of 1926 Leighton McLellon Bledsoe Eugene Maxwell Stevenson Class of 1928 Eugene Seymour Duval Edward Morse Hamilton Frank Robert Senn Class of 1929 David Theodore McKeown Clarence Beatty Neighbors Class of 1930 Frank Newman Fleming Craddock Matthew Gilmour Humboldt Walter Leverenz Duncan Douglas Low Burr Delevan Northrop Robert Star Northrop, jr. x 1 A ., .' . Alfred Baker Spalding, M. Class of 1927 Lorirner Benton Harrell Reginald Shepard Rood Harry Wyle Stevenson Walker M. Wells John Gilhousen Sobieski George Cowden Staten Theodore Frederick Trent Richard Kenneth Strauss Robert Kirkwood Whitele Alfred Marlatt Palmer Edwin Compton Randol John William Solomon Milas Erle Walters Charles Burnham Warner D Y Back Row: Harrell, Lyon, Hamilton, Allen, Trent, Lloyd. Fourth Row: Chichizola, Sobieski, Staten, Fonda, Stevenson, Bigelow Third Row: Case, Strauss, Randol, Low, Wells, McKeown, Bledsoe, Duval. Second Row: Warner, Quigley, Carleton, Batson Solo mon Walters, Leverenz. Front Row: Whiteley, Senn, Davis, Gilmour, Erlin, Fleming, Palmer, Neighbors. ,, Q Url, , I -v.'-1 li w L s -. A D. :5'.E5arZ 'w 'FQ V: 5 su Om EE 5? 07 5-F' 'Tim 51. F50 0 Merrill Armour Carlisle Clark Rankin Russell P. Andrews Calvin A. Behle Phillip N. Allen Herbert H. Boomer, jr. Antoine Francis Bovet Harry Louis Bright Theodore T. Daniels Douglas Sedgwick Aiken Clarence Burley Boutell Edwin Ogden Driggs ALPHA TAU OMEGA Faculty Members Edgar Eugene Robinson, A. M. Horatio Ward Stebbins, B. S. Uvziversity M embers Class of 1926 john Harold McCreery Class of 1927 Bruce Carlisle. Toffelmeier Class of 1928 Raymond Charles, jr. Lynn O. Hossom Arthur Joseph Jessop Class of 1929 Stark Fox Sherman Hazeltine John Jost Charles Lock Moore Class of 1930 Benjamin Burt Frost Melvin Richard jones James Alan Kinkead Milburn H. Querna .,,, F.. 1. , -I .V .A . I V 1 . P - 7.1 . , Founded at Virginia Military Institute 1 865 CALIFORNIA BETA Psi CHAPTER Established December 1891 Graham Henry Stuart, Ph Stewart W. Young, B. S. Charles Cullen Stratton john Louis Wiggin Henry Lawrence Levinger Carl Thomas Munson Lyle Williams Olson Robert Treat Paine Loraine Martin Staley john Brooks Wheatley Max Winter Donald Franklin Smith James R. Webb Warren Andrew Wilson . D Back Row: Andrews, Toffelmeier, Levinger, Behle, Rankin, Munson, jessop, Wiggin, Hossom. Thifd Row: Bovet, Boomer Olson, Moore, Staley, Jost, Winter. Second Row: Wheatley, Querna, Allen, Hazeltine, Fox, Bright, Driggs. Front Row: Kinkead Boutell, Webb, jones, Aiken, Frost, Smith, Wilson. .' I., , 7-. . ru... r 1 . .-.-,t 1.-1 4, - .7 TF- -- ---V--- Y- - +7 ,.1 -id '. ,, l-. 5, . 1.-. ... : g:,,.,l.gJ,1, ,J,..i,a,s, .., 1, ,S .F 4 l 4 1 B, f ,J .Li -e-4 L Q4 Founded at Miami University, 1855 ALPHA OMEGA CHAPTER Established December 1891 Huber Ogilvie Croft. M. S. Percy Erwin Davidson, Ph. D. William H. England David A. Fall Elmore Cox Adams John William Clark Forrest L, Bentzien Seymour V. Darling Donald Arthur Farmer Fred Alex Bowers Edward Conner Gerald Rich Daynes John Chamberlain McClintock Robert Mills McClintock Richard H. McCollister -e X, - ll 6 13 131. ff W g . f- 'lllI i f' ' Wx , fii.-'ffi W rf , ', WCS.. 55 yl 1 ruff: . 'QVLI , Atl' 9',.., A , . 5 . 1 e M51 ,I Y ,..., N -,:-- -fr-s--.yr ' ' 'Q SIGMA CHI Faculty Members University Members Class of 1926 Class of 1927 Class of 1928 Henry Lee Flood Arthur C. Larsen Class of 1929 Frederic Easton Graff Theodore Klabau Walter E. Mondale Roger G. Simpson Class of 1930 Hu h Terrell Moss S Harry Safford Nye Thomas Greenlee Roodhouse Frank Alfred Golder, Ph. D A john Armstrong Sellards, Harold George King Carl Ernst Rodegerdts William Maxwell Ramsey Gene K. Walker Robert Edward Mulvaney Irvine H. Nye John Garfield Staub, Ir. Harrison S. Slawson John Sanford 'Tillotson George Chase Williams Robert Chapin Sharp George Shaw Smith Peter Edward Sylvester 1, ., -iff! aslqw .V-uv. Back Row: Tillotson, Mulvaney, Staub, Walker, Farmer, Daynes, Mondale, Darling. Second Row: Bowers, Ramsey Nye Rodegerdts, Adams, King, Clark. Front Row: Clendening, Roodhouse, Nye, R. McClintock, J. McClintock, Sharp, Smith. l, Joseph Walter Bingham, J. D. Class of 1921 Emmett A. Quinn Class of 1926 Ross Reed Hastings Stephen F. O'Dor1nell Burton A. Baker Frederick G. Bullard Robert W, Coons Richard Lawer Downing George Phillip Eisman E. Bailey Cook John Daniel George H. Force George Emery Boclle PHI GAMMA DELTA Faculty Members l Ernest Gale Martin, Ph. D. University M embers Class of 1928 Lyle Benton Everett William A. Fort Gordon Hall, jr. Lewis Warren Hunter William E. Johnson, Jr. Ralph T. McElvenny Class of 1929 Kenneth B. jenkins Sergius Klotz Paul D. McCormick Class of 1930 Founded at Washington and jefferson 1848 LAMBDA. SIGMA CHA Prizm Established November 1 891 J. Charles Winterburn, B. Class of 1922 Raymond Haizlip Class of 1927 Cornelis E. Groenewegen William Ruel johnson, Jr. Robert Louis Philippi David Augustus Russell Frederic Warden Speers Allan Wade Strowger Kryne Vanden Akker Albert G. Putnam Roy M. Tait J. Scott Webster Edward Sheridan O'Donnell Back Row: Force, Baker, Strowger, Coons, Tait, Hunter, Putnam, Eisrnan, Hall, Hastings, Speers. Second Row: Bodle Jenkins Vanden Akker, Groenewegen, Everett, Tufts, Quinn, Philippi, O'Donnell. Front Row: Bullard, White, Downing, McCormick Johnson, Webster, Daniel, Klotz, Morris. , ., .,,,., -AW , - . l Founded at Virginia Military Institute 1 869 BETA CHI CHAPTER Established November 1891 W. W. Crane, M. D. Class of 1924 james Hood Wilson Chester Richard Andrews Arthur Hutchinson Greisser Lemuel Perry Borden Grant Arthur Burton George Isaac Clover Sam Luther Cochran Arthur James Eaton Gustaf Carl Malmquist joseph Clarence Borden Reason Silas Bradfield Newton Boswick Chapman l 1 ' sn I - . , 'wa ' .gy 'fx . 'ix vi - 571 b ,f , 5 9 ' 1 y .- ,. 1- t 1-1611 V 1 - ', .-,-1-,gli ' V - 5' 3 Il ' 4. 'i '. ' 5 1 ' Yi ' 1 P -, ' ff' F3- A: 'iii'-111 if '.i'hsl1i?5i:l i3iEl f' E ' Q . 'T l f '- Till'2i1Qfl'l'9l7ikQ-tifiat 25- SIGMA NU Faculty Members Eliot Jones. Ph. D. Captain Moses W. Pettigrew w University M embers Class of 1926 Charles Willers Briggs Class of 1927 Lovic Pierce Herrington James Avery Watson Class 1928 , Calvin Gaines Collins Guy Kimball Dyer Warren Wendell Littlefield Class of 1929 Lincoln Ragnar Malmquist Ernest Henry Renzel, jr. jamie Logan Robertson Class of 1930 Robert Edward Clarke Stephen Kenneth Clarke Lewis Thomson Clohan Wilber Frank Swett, M. D Class of IQZS Ramund Robert Murphy Thomas Brennan Quinn Victor Charles Winnek Donald George Marquis Rufus Percival Ranney Robert Cuthbertson Swain john Hutchins Singer Thomas Martin Topp Francis Martin Woodward Gordon Lorenzo Gilbert john Ezra McDowell, jr. Criihth Evan Williams Kenneth Chester Christensen Richard Crothers Cook Philip Stanley Winnek Back Row: Greisser, L. Borden, Andrews, Murphy, Quinn, Watson, Herrington. 'Third Row: Littlefield, Eaton, Ranney, Dyer, Marquis, Swain, Wilson, Robertson. Second Row: Singer, Cochran, Woodward, Renzel, L. Malmquist, Clohan, TOPP, Williams. Fifst Row: G. Malrnquist, R. Clarke, Cook, Chapman, McDowell, P. Winnek, Christensen, C. Borden. Q. ,Je s we REQ: 1' i ',i 1 Herbert Lee Niebel, A. B. Harris joseph Ryan, M. E. Class of 1925 Alan Hazelton Robertson Graeme Stewart Doane Norman Grant Larson john T. Long Kenneth Charles Berry Alfred Richard Brown Harry Fredric Dietrich Donald Engelbert Anderson Guido George Caglieri Robert Stevenson Crowl EE lil PHI KAPPA PSI Faculty M embers Thomas Andrew Storey, M. D. University M embers Class of 1928 Lawrence E. McGonigle William Francis Maguire John Earl Munholland Class of 1929 Albert Eugene Kern Alan Ivins McCone Class of 1930 Virgil C. Dowell Thomas Marshall Kester Frank Robert Lasley Kenneth V. Sampson Founded at Washington and jefferson 1852 CALIFORNIA BETA CHAPTER Established November 1891 Clarke Butler Whittier, LL. D. Henry Herbert Yerington, Class of 1926 Wallace W. Knox William Clay Price James Joseph Sapero john E. Stanton Donald Sheets Nelson Richard'N. Prince Robert D'Oyly Syer William L. Shattuck Benton Knight Sparks Robert Dean Speers M.D Back Row: Knox, Stanton, McGonigle, Syer, Sapero, Doane, Maguire, Robertson, Nelson, Munholland, Larson, Price, Long Berry, Kern. Fvont Row: Lasley, Anderson, Shattuck, Crowl, Caglieri, Speers, Dowell, Brown. I .,.. B -A-rf , , . ,QJ Founded at Miami University 1848 , CALIFORNIA BETA CHAPTER Established October I .gmiirlg 9 2 ti gf x .Sr l , ,. 'figefig ...rn ,. 1 1'8QI Faculty Members George de Forest Barnett, M. D. Ellwood P. Cubberley, LL. D. john Ezra McDowell, A. B. Harold Chapman Brown, Ph. D. Edward Curtis Franklin, D. Sc. Halcott C. Moreno, Ph. D. Edwin Angell Cottrell, A. M. Harold Heath, D. Sc. Henry Waldgrave Stuart, Ph D. Harold Phillips Hill, M. D. University Members Class of 1926 Jefferson LeRoy Rice Class of 1927 Phillips Gardner Brooks Lawrence Salmons Fletcher Elmer Frank Riese Wesley Byron Bryant John E. Kenney , George F. Schaefers Lloyd Martin Burke john Roy Prather Clarence C. West. Jr. james Francis Price Class of 1928 john William Clark Thomas Grant McGuire Jack Wilson Shoup S. Robert Frazee james Eugene Reynolds Harold Stoutland Wilson James Donald Garibaldi Carol Glenn Wynn Class of 1929 john Evarts Barry Henry Crane Haussamen Francis Calvert Strong Henry H. Clock Richard Edward Long Thomas Lawson Thurlow Eldredge Ersie Combs john Beverly Preston Cecil West Daniel James Frost Albert Cassius Purkiss Frederick B. Zombro Charles Otto Smalling Class of IQ 30 William George Barks, jr Leo john Devlin, Jr. Reginald Hugh Harrison Clarence Edward Bush Charles Townsend Hadenfeldt George F. Kachlein, jr. William Nunan Clark Robert Shinski McKellip Back Row: Haussamen, Thurlow, Shoup, Long, Kenney, Combs, Frost, Wilson, Burke, Brooks, Barry, Barks. Second Row: W. Clark, Purkiss, Garibaldi, Price, Kachlein, Wynn, Reynolds, Clock, Smalling, Zombro, West. Front Row: J. Clark, Harrison, Frazee, McGuire, Strong, McKe1lip, Fletcher, Devlin, Riese. ...Q , ' Ya' ,hx a f ' ,a':'aj.1'z..,- ' L Edward Cecil Sewall, M. D Manuel Burr Lovelace Edward Custis Crirnmins Clifford Pearson Hoffman Alonzo B. Cass Edmund C. Converse, -Ir. Jerome Holland Bishop, III Donald Davis Flickinger Albert Edward Forster Ewart Wade Goodwin Henry jackson Adams, jr. H. Kendall Albertson Harry Clinton Berg Robert Montgomery Clarke ' i ' JH. , , E igiiflimi.'ii?flqrZ1 1 l . 85.2 f.v7.il'iW- Q J' 'ff fi 'Lf ' -'lil 522' .lib I Q.fi??9TfZ'r21i Q -'..s4m,,, H 'irij 44 734 ,S ,Q .3-L -s fair -i QT:-r.-..-a., ..,,,r..--Q-iii r in C-'1fz4r5g: , 'll Q- ZETA PSI Faculty Members Charles Myron Sprague, A. B. University Members Class of IQZS james G. Sharp Class of 1926 Class of 1927 William Armstrong Percy Class of 1928 Robert H. Harris Harold H. Kelley Class of 1929 Henry Charles Hanna, Jr. Eddie Harlan Marks Houston Rehrig William Brand Riley Class of 1930 John Chester Dutton Charles Marvin Fox, jr. Warner Hobdy . .1 .-. '. 'r u in K - i I Founded at New 'York University 1847 Mu CHAPTER Established October 1891 Stanley Stillman, M. D. F. Lowell Matthay Seraphim Fred Post Ewing Sibbett Richard Simms Lowry Francis Edwin Whitney Frederick von Schlegell, jr Edward H. Sibbett Reese Wolfe Donald Richard Wright Gibson Church Kingsbury William Harrison Laird Francis Raber Schanck William Simkins Back Row: Sibbett, Crimmins, Whitney, Cass, Hoffman, Post, Kelley, Converse, Harris, Marks. Third Row: Matthay Hanna von Schlegell, Lowry, Wolfe, Flickinger. Second Row: Bishop, Wright, Forster, Goodwin, Riley, Rehrig. First Row: Berg Laird Adams, Albertson, Clarke, Simkins, Dutton. .n I L I I ' l I 1 INTERFRATERNITY COUNCIL President . Secretary . Alpha Delta Phi Clifton Moore Foster Rhodes Alpha Kappa Lambda Frank Howlett, Jr. Fred Miller Alpha Sigma Phi Donald Muller Dwight Trowbridge Alpha Tau Omega Lynn Hossom Max Winter Beta Theta Pi Douglas Lewis Frank MacBoyle Lewis Chi Psi - Laird Doyle Paul Murphy Delta Chi Albert Biaggini Thomas Joaquin Delta Kappa Epsilon Edward Anderson John McCandless Officers Members Delta Tau Delta John Dales, Jr. Dixon Smith Delta Upsilon Robert Hefner Walter Hulsman Kappa Alpha Theodore Rathman Homer Toberman Kappa Sigma Thomas Thompson Willis Wolf Phi Delta Theta Thomas McGuire Fred Zombro Phi Gamma Delta William E. Johnson, Jr. J. Scott Webster Phi Kappa Psi John Long Robert D. Syer Phi Kappa Sigma Ward Edmonds Donald Hamblin . William Wolf . Albert Biaggini Phi Sigma Kappa Wayne Byrne Ferdinand Mendenhall Sigma Alpha Epsilon James Allen David McKeown Sigma Chi V Arthur Larsen Gene Walker Sigma Na Kimball Dyer Lincoln Malmquist Theta Chi L. Earl Harris Charles Reasor Theta Delta Chi David Painter, Jr. Ernest Patchett Theta Xi Norman Fain Edward Smith Zeta Psi Richard Lowry ' Seraphim Post Bark Roiuf Burns, Hall, Duval, Trowbridge, Johnson, Hulsman, Long, Harnblin, Rae, D. Lewis, M. Lewis, Zombro, Winter, Hossom, O'Brien. Second Row: Dales, Smith, Reasor, Harris, Rathman, Toberman, Malmquist, McGuire, Dyer, Doyle, Webster, Miirphy, Howlett.'F1-ont Row: E. Smith, Fain, Lowry, Wright, Doerr, Leland, Orton, Biaggini, Wolf, Moore, Rhodes, Nason, Peck, Mi er. Lasuen Street from the Post Office FRATERNITIES TANFORD fraternities are for the most part housed in ancient but adequate structures. Although many of the houses are rather old, their interiors are kept in excellent condition. Living in a fraternity house is but little more expensive than living in a dormitory. In an effort to reduce the living expenses in fraternity houses, the respective house managers appointed from their number this year a committee to inaugurate a co' operative buying system, whereby supplies are purchased in wholesale lots. During the past year, this plan has resulted in appreciable savings. Most of the fraternities own their houses, leasing only the land from the University. This fact, coupled with the advantages of cofoperative buying, makes living expenses among the fraternities unusually low. Out of the 25oo men registered in the University, approximately 550 live in fraternity houses. This number remains practically constant from year to year, varying a little with fluctuations in the total number of men. Interfraternal organization and government exist within the Interfraternity Council which is composed of two representatives from each house. The president and four mem' bers of this body, along with Professors Owens and Cottrell, Dean Culver, and two alumni fraternity men, compose the Board of Control, to which President Wilbur has granted complete control over the fraternities. The attitude of the Administration toward fraternities has been chiefly one of endeavf oring to bring about more democracy in student intercourse and a reduction in living ex' penses. President Wilbur has devised a tentative plan which is aimed toward improving the general situation. If the proposed system is adopted, the fraternities will be divided into groups which will live together. The present houses will be abandoned, and new buildings erected near Toyon and Branner Halls. Each building will be designed to house two or four fraternities. A group of fraternities living together will have a single kitchen, a common reception room, different dining rooms, and study rooms arranged as in a dormif tory. It is believed that this plan will allow freer relations between men of different fraf ternities and between nonffraternity and fraternity men. Spring rushing began on April oth, which was the first date on which freshmen could be asked to the houses. Rushing was divided into three periods, the first period lasted a week and a half, and the other two were a week each. Pledging day was May 4th, .1 IL u -+- our Q f ,Q i' vm. 3 3-Q1'l'fff' . Aff' - my Wy 'Those splendid ships, each with her grace, her glory, Her memory of old song or comrades story . . -Masejield Each ship's the finest vessel in the fleet. From year to year the crews may come and go, New sailors learn the ship ahoy hello, But same traditions, same old chanteys greet- Recalled when, after years, on shore they meet. The captain's care, while winds of freedom blow, Is lest the ship drive on the rocks below, And, guiding her amid the storm and sleet Or in the calm of light paciiic breeze, He steers her course upon her charter's lines- And eke upon the statutes of the Lord High Admiral of these collegiate seas- Guarding that Bacchus be not found on board To make the mastheads sprout, as of old, with vines. H. S. ,El si 4 E 'mi if 5 i fy E+ li if ii. El sk M I1 :Ile li ls W Eg QI Si Hs S? QI 1 H ! ii ! 51 W 24' Elf if qi!! 2!t as Q mg W f 42 2 3 w ali li it 5' 1, mga al EY N Ji 3 . 1 1 1 3 J u 1 l l Back Row: Weinberg, Wenig, Cranston, d'Alessio. Front Row: Littler, Carley, Weigel, Blinn. EUPHRONIA DEBATING SCCIETY Honorary Members Arthur M. Cathcart Robert M. C. Littler Marvin Adams George N. Crocker Eddie Frank Theodore F. Baer Charles H. Binkley Joseph G. Catanich Philip Cavalero Wagner J. d'Alessio Archibald W. Allen Lazare F. Bernhard Irving Breyer Arthur D. Angel Lewis S. Baer Robert K. Blinn Victor M. Burns Ian Marston Ridley Founded 1891 University Members Class of IQ26 Frank R. Karr Augustus Mack, jr. Class of 1927 Burt W. Busch Paul Herbold Class of 1928 Louis Creveling Thomas E. Drake John M. Hiatt Herbert A. Klein Class of 1929 Leon. A. Carley Henry Harris, jr. Henry Haussamen Laurence E. Heiges, Jr. Leonard H. Kirkpatrick Class of 1930 john M. Cranston Harold Crumly Craddock Gilmour Edmund jones Class of 1931 Irving S. Rosenblatt George Shibley Faculty Members Lee Emerson Bassett, A. B. james Gordon Emerson, I. D. Darrell Parker John E. Raaf Stanley A. Weigel Harold W. Peterson William H. Levit James E. Prisinzano George V. White Eugene C. McKnight George F. Mott, jr. Frank R. Sauliere Arthur Schilder Harry M. Tashjian Laurence Weinberg Herbert Wenig 1 Wadieh Shibley Frank W. Young I r Crocker, Combellack, Peterson, Davidson, Truman, Cavalero DELTA SIGMA RHO HONORARY DEBATING FRATERNITY Founded at University of Chicago, 1906 Faculty Members Arthur Martin Cathcart, A. B. William Brownlee Owens, LL. B. James Gordon Emerson, J. D. President . . . VicefPresident . Secreraryffreasurer Historian. . . Class of 1924 A. Ronald Button Alfred E. Frazier Rhoda V. Lewis Clara Rose Brecher Philip Cavalero Robert A. Hume Officers University Members Class of 1926 George N. Crocker Stanley A. Weigel Class of 1927 Darrell R. Parker Class of 1928 Fred M. Combellack Eleanor Davidson Class of 1929 Leonard Kirkpatrick Lorraine C. Reeder Edgar Eugene Robinson, A. M William L. Schwartz, Ph. D. . Fred M. Combellack . Rhoda V. Lewis . . Philip Cavalero . Harold W. Peterson A Class of 1925 Robert M. C. Littler Harold W. Peterson John Edwards Truman Gordon Shallenberger Kathleen Woodward Ruth E. Tinsley I Back Row: Crosbie, Teach, Tinsley, Brecher, Davidson. Front Row: Reeder, Owens, Fordyce, Woodward. WCMEN'S DEBATE OLDING debates has become increasingly popular in recent years, and the close of the fourth season of women's debating at Stanford finds that this, the one com' petitive interscholastic activity engaged in by Stanford women, has expanded in the year 192728 both as regards the number of women participating and the number of debates held. Three debates have been undertaken in the current year instead of the two formerly held. This year's debate with the University of Southern California represents the first attempt of the women to extend their debating activities beyond the immediate Bay region. The fourth annual dual debate with the University of California was held in autumn quarter. Stanford and California women met at Stanford on November 21, and at Berkeley on the following night. The question discussed was Resolved: That this house disf approves of nationalism. Lorraine Reeder, Kathleen Woodward, and Ruth Tinsley upheld the negative for Stanford. The decision was based on change of opinion as indicated by votes taken before and after the debate, and showed that the Stanford team had altered the beliefs of 27 among the audience, and their opponents 9. The rest of the audience had ref tained its original opinions on the subject. The Stanford negative team, Jeanette Owens, Rose Brecher, and Violet Crosbie, obtained an audience decision the following night when it visited the California campus. The teams were coached by Stanley Weigel. A dual debate with Mills College on February 29th and goth was the debating event of winter quarter. The question discussed was Resolved: That this house regrets the present tendency of American college students toward paganismf' The Stanford negative team, Dorothy Fordyce and Violet Crosbie, lost to the Mills team. On the next night, when Kathryn Teach and Rose Brecher were Stanford's speakers, the Stanford affirmative team obtained a close audience decision. In both debates with Mills the opinions of the audience were obtained by the same method of voting that was used in the California debates. George Crocker was the coach for the MillsfStanford debate teams. At present Stanford women are preparing for the dual debate with the University of Southern California on the question Resolved: That American investors and investf ments in foreign countries should be protected only by the government of the country in which the investment is made. The debate is scheduled for May 18th. At that time Marion Klocksen and Katherine Drew, supporting the aflirrnative, will meet debaters from U. S. C. on this campus. Violet Crosbie and Rose Brecher are to travel to Los Angeles. f? . it' 7 1 f I l Gordon Shallenbevger Philip Cavalero Virgil Whitaker THE JOFFRE DEBATE The thirtyffifth annual debate of the series founded by Baron Coubertin of France for the Medaille joffre, formerly the Carnot, was held in Wheeler Hall, University of Calif fornia, on the evening of April 17th. From the general subject, France and World Peace, the specific question: Resolved, that France can exert greater influence for world peace through regional understanding, such as the Locarno Pact, than through regional understanding, such as the League of Naf tions was chosen by Charles E. Martin, dean of the College of Social Sciences at the University of Washington, and announced two hours before the contest, which was pref sided over by Edward Rowell of the University of California faculty. Philip Cavalero and Robert Hume of Stanford as well as Stuart Strong and Sanford Gold' ner of California spoke on the affirmative, while the negative was upheld by Herbert Wenig of Stanford and Louis Heilbron of California. Cavalero was awarded the joffre Debate Medal for delivering the best speech on the subject, the judges being Federal judge Walter H. Kerrigan, Judge john W. Preston, and H. U. Brandenstein. sQuAD DEBATES In order to develop forensic men to take the places of the graduates, this year eight men without previous varsity experience were trained under the direction of Stanley A. Weigel, former Stanford debater. These men represented Stanford in four debates against the University of Oregon, California Institute of Technology, and a dual debate with the College of the Pacific. Cn February zoth john McClintock, Robert McClintock, and Leon Carley traveled to the College of the Paciiic to debate on the question: Resolved, that the results of the Great War have tended toward the peace of the world, while Herbert Wenig, Paul Herbold, and Arthur Angel met three Stockton men in the Little Theater on the same evening. The contests were nofdecision debates. The third squad debate found John McClintock, Robert McClintock and Leon Carley in Pasadena on March and meeting the California Institute of Technology on the same question which this team argued against the College of the Pacific. The judges gave a 2 to 1 decision to the Pasadena team. Ronald Anderson and Robert Sharp lost an expert judge's decision to debaters of the University of Oregon on April 5th in the Stanford Assembly Hall when they argued the question: Resolved, that American investors and their investments in foreign nations should be protected only by the country in which the investment is made. l l l l l 4 Herbert Wenig lolm Sobieski Robert Hume The subject of the debate with the Englishmen this year was of perhaps a lighter nature than those of the other contests, being: Resolved, that this house disapproves of the ten' dencies toward easier divorce. This question brought out very Well the contrast between English and American styles of debate. The Englishmen scintillated and crackled. The Stanford debaters impressed by their smoothness and ease of delivery. Professor Augustus T. Murray acted as chairman and introduced the speakers. Herbert L. Elvin and Hugh Mackintosh Foot of Cambridge and George N. Crocker of Stanford supported the resolution, While John E. Truman and Fred M. Combellack representing the Cardinals and M. A. B. KingfI'Iamilton of the English team spoke against the resoluf tion. Besides being accomplished and experienced debaters, each of the visiting representaf tives is prominent in his respective political circle at Cambridge and at the same time is prominent in athletics, a rare occurrence in American circles. THE SOUTHERN CALIFORNIA DEBATE Debating the question, Resolved, that the results of the Great War have tended toward the peace of the World, Stanford met the Univerf . . . j sity of Southern California in a dual contest on January 12th. Philip Cavalero and George Bodle traveled to Los Angeles to participate in a nofdecision debate,,vvith the U. S. C. affirmative, while John Sobieski, Virgil W hitaker, and Leonard Kirkpatrick argued the afhrmative on the Stanford platform against Clifford Weimer, Stanley Hopf per, and Mildrim Burrill, Trojan debaters. An audience decision based on the number of opinions won over, gave Stanford a S9 to 57 win over the University of Southern California in the local contest. THE PHILIPPINE DEBATE A unique and interesting debate was held April 4th when natives from the University of the Philippines argued for their independence in the Stanford Assembly Hall. The squad from the Islands appeared before many American audiences and gave them the benefit of first hand information on this important subject which is so vital to them. Geoyge 30,115 ---sc a -- PN- -4- - 31 . ,H U, M.. ,Am ,V , M h .f ' 'Q'.Q-- , ' f W' , . f , , . fl'-'3'e'2s f 'Q.'. -. fr ,.g..7'i, - ,. '?-' AHA 4- .1-'n in A y ' ,, ' JI- I. p l,'. '. Xj'lw'l.fYWV .li .,,h' 5,1 W ., . .. Vi . , II,,,,1,,!!li,lF-fa ,Ji f , X , ,. . - -fluff , ,V ,,-, Q7 ,YY . . , ., Vg- 1 . ,.,,. w-. i, ,Yk, v . W- , - v-H --S-' . 1-'-1' john Truman George Crocker Fred Combellack The Freshman debates with California revealed an unusual wealth of material. Sturgis Riddle, George Shibley, Victor Burns, Harry Girvetz, Wadieh Shibley, Irving Rosenblatt constitute a group of first year men of exceptionally high calibre. Not since Oxford has there been a more interesting debate than that engaged in by the the women on the subject of nationalism in the fall quarter, against the University of California. In this debate Miss Ruth Tinsley and Miss Kathleen Woodward were out' standing. Miss Rose Brecher did stellar work in this debate and also in the debate with Mills. Ivliss Violet Crosbie was the mainstay of the Stanford effort against Mills. Assistant Coaches in charge were: Robert M. C. Littler, StanfordfCalifornia autumn debate, Stanley Weigel, Women's debates, autumn and spring quarters, Squad debates, winter and spring quarters, George N. Crocker, Women's debate with Mills winter quarter, Darrell Parker, Freshman coach. THE CALIFORNIA DEBATE As the question chosen for the annual fall debate between California and Stanford was one of immediate interest, a dual contest as first competif ' F F ' ' X tion of Big Game Week was held in place of the single def Lf-I , , bate which previously has been held in San Francisco. I The negative teams of each university stayed at home to . I defend the question, Resolved that the Lower Division .J ig .1 M ' at Stanford and California be abolished. Edwin Mayall 2.5: and William Cherrin, the California affirmative, debated 5 r.'. I in the Stanford Assembly Hall on November 14th, against ii -- Henry Harris and Leonard Kirkpatrickg while the Stanf Hull ' ford supporters of the resolution, Philip Cavalero and Gordon Shallenberger, met Sanford Goldner and Stanley Breyer at Berkeley on November 16th. THE CAMBRIDGE DEBATE Engaging in the third international debate in three years, on the evening of December and Stanford met representaf tives from the University of Cambridge-, England. In 1925 Oxford was debated, and in 192.6 a team from the Leonard Kirkpatrick University of Sidney, Australia. , ,, - --...TW H I , hai. .- , T: -' riff' V l V if l N I 5 M, . i 'i .A ' -Ati. .,. , , at A f ig vi ,rr V v THE DEBATE SEASCN HE debates of major interest engaged in by T Stanford debaters during the year were: The .StanfordeCambridge debate, Deceme ber zndg The StanfordePhilippine debate, April 4th, The Medaille joffre debate, April 17th. The StanfordeCambridge debate furnished the usual contrast between English wit and banter and American directness, the result being little ediiication, but much intellectual enjoyment. The Filipino debaters revealed a command of English so graceful and musical as to call forth from an adversary the admiring and wellemerited come ment that their use of the language must put Americans to shame. T he Stanford team, faced T with the handicap of opposing 'Lhearsay to firste hand testimony, succeeded in presenting most tactfully and forcefully the outstanding objections to Philippine independence. Cutstandingly brile l liant was the work of Fred Combellack. j. G. Emerson, Faculty Adviser This year's Joffre debate is declared by hearers to have been the most brilliant and inf teresting in recent years. No doubt the excellent question submitted by Dean Charles E. Martin of the University of Washington was in great measure responsible for this result. All members of both teams attacked it spiritedly and discussed it with great insight. The victory of Philip Cavalero in this debate was decisive, the judges awarding him two lirsts and one second place, as against one first and two third places given Start Strong of Calif fornia. Hume and Wenig of Stanford and Heilbron of California pressed the leaders closely, and finished in a group in placings. In the last seven years of Joffre competition Stanford has been returned the winner six times. Still in the University are three Joifre winners, Bob Little, 1924, Fred Combellack, 1927, and Phil Cavalero, 1928. Cavalero has also the distinction of having won first place in the Pacific Coast Extemf poraneous Contest from a field of nine Universie ties and Colleges. The Contest was held at U. S. C., March goth, on the subject of The influence of goodwill flights upon international understand' ing. Cavalero is the first man to have won both of these contests. In the three times that Stanford has participated in this Contest she has won first place twice and second place once. The autumn quarter debate with California was unique m that it dealt with the elimination of the Lower Division. So great was the interest in this subject that the Stanford negative team was asked to meet the Berkeley affirmative again at the regular Friday noon luncheon of the Commone wealth Club in the Palace Hotel. The discussion, which proved to be a very lively one, was heard by radio listenersein over KPC. The winter quarter debate with U. S. C. and the Squad debates were notable for their exe cellence and for their uncovering and developing of new material for the future. Kirkpatrick and Henry E. Keyes, Debate Manager Carley show great promise for their senior year. Back Row: Voorheis, French, Rose, Bowen, Behner, Hedges, Thompson. Front Row: Bunnell, Humphrey, Stearns, Bradshaw Cushing, Bogen, Pottenger, Demond. STANFORD WOMEN'S GLEE CLUB President . . . Secretaryffreasurer Librarian . . . Virginia Bunnell Ema Demond Ailsa Dunn May Abbott Dorothy Abrams Lydia Bowen Helen Bailey Dorothy Bogen Elizabeth Bonn Elizabeth Bradshaw Alice Copeland Maxine Cushing Alice Behner Ruth Clawson Founded 1926 Director Natalie Macmm, '14, Officers University Members Class of 1928 Dorothy French Judith Hedges Class of 1929 Page Bradshaw Beulah Gibbons Dorothy Gray Class of 1930 Mate Gunsolus Ruth Hernbrofl: Ruth Hill Foresta Holly Alice Ingraham Edith Jayne Mary Lee Class of IQ3I Elizabeth Cooper Harriet Day Helen Hawkins 4 l . Maxine Cushing . . Page Bradshaw . , Dorothy Bogen Harriet Neall Adelaide Pottenger Alice Rose Grace Humphrey Mary Raney Virginia Voorheis Benetta Merner Lucy Ritter Frances Shoup Muriel Stearns Marjorie Thompson Sidney Williams Geraldine Kinne Caroline Neilson GLEE CLUB . ACTIVITIES .k,.'. UMBROUS difiiculties attending the reforganization of the Stanford Glee Club this year caused the Club to get a late start. It was about the Hrst of November that rehearsals started in the new Clee Club room in the basement of the engineering building. Rehearsals have been held three times a week since that time, some for the entire Club, others for smaller units. The program as arranged by the new director, C. Albert Kulmann, included a wide variety of numbers from the heavy to the light, but so arranged in the program as to be interesting but not tiring. Soloists and stunt men served further to increase the variety of the Club's offering. ' , Shortly after the Christmas holiday, the Club began to show exceptional promise, makf ing its first public appearance in January. From that time progress was rapid, and by the Hrst part of March, after a number of practice concerts, the Club had definitely arrived. From the Victor Talking Machine Company came an invitation to record, and a record was made of a number of Stanford songs. To date no other coast glee club has received such an invitation. Because of the late start, some difficulty was found in arranging concerts for the spring tour, but when the trip was started on March zgrd, eighteen concerts had been scheduled along a route down thru the San Joaquin Valley and up the coast. Concerts were given in San Francisco, Stockton, Modesto, Tulare, Taft, Glendale, Los Angeles, Montibello, Whittier, Santa Ana, San Luis Obispo, and San Jose. So pleased were the sponsors of the concerts with the results that most of them asked for return engagements next year, and others, upon hearing the Club, asked for concerts, so that already twentyffive invitations have been received. As the Club requires a substantial guarantee before presenting a conf cert, this prospect for next year is very encouraging. A number of appearances were scheduled for the spring quarter, including a radio broadcast, concerts in San Jose and Los Gatos, and of course, the Home Concert. In addif tion, invitations came from San Mateo and from one of the leading San Francisco hotels. Plans are already under way for the 192829 season. Two trips are planned, one for the Thanksgiving recess, and the other in the spring. In addition, a weekfend trip down the coast is scheduled for some time in January. Spring quarter tryfouts have been held, and the new men chosen, together with those of the old men who expect to be with the Club next season, are already at work on the fall season repertoire. I , . Glee Club snapped at informal moments during the Southern invasion Class of 1927 ' Y l . l 1 Back Row: Holmes, May, Brooks, Gabbert, Snodgrass. Third Row: Nute, Springer, Waite, Russell, Cook, Grolf, Hill. Second Row: Schwafel, Barker, Galliher, Baker, Anderson, Howell, Armlield, Naumes. First Row: Carroll, Pushman, Wallace, Sanborn, Kulmann, Reed, Culling, Thomas, Young. THE STANFORD GLEE CLUB C. Albert Kulmann-Director President . . ...... . . . . Baylor Brooks VicefPresident . . Russell S. Waite Manager . . . . . Arthur Holmes Librarian . . . .......,. . . Robert L. Wagner Honorary Members Warren D. Allen John Ezra McDowell University Members Wilbur D. Russell J. Shirley Armfielcl Baylor Brooks Frank B. Carroll Ellis J. Groff Harold P. Hill George K. Anderson C. Omar Barker E. Wayne Galliher Harold T. Castberg William W. Cook Adelbert N. 'Culling Jean B. .Iago C. Everett Baker Stephen M. Farrand John Y. Springer Class of 1928 Frederick E. Hines Frederick T. Kline Yale C. Maxon - Garabed T. Pushman Class of 1929 Robert L. Harkness Arthur G. Holmes Edward P. Naumes J. Warren Nute Class of 1930 Earl E. Reed M. John Rowe Jacob T. Schwafel R. Gordon Snodgrass I Class of1931 Howard M. Gabbert James F. Howell Royal E. Hubbard Joseph D. Thomas Thomas H. Pushman George C. Richardson Ralph H. Richardson Russell S. Waite Warden E. Wall Reuben P. Rott Carroll M. Sanborn Edwin Simon George Vahey Robert B. Van Etten Robert L. Wagner Ralph C. Wallace John R. May ' Frank W. Young John M. Willits Bb Clarirzets James Barr Jean Blum Morden Brown Carvel Craig Frank Dietrich Thomas Drake Heber Gooden Howard Greenhalgh George Hartley Wayne Hunter Donald Marquis Herbert Marsh Richard Nason Clarence Neighbors George Pamphilon Robert Reed M. john Rowe George Smith Edwin Snow Stewart Stadler George Staten Leland Thiel Eb Clarinets Adin Henderson Cedric Madison Ernest Whitney Martin Bass Clarinet Dan T. Smith Saxophorzes William Buckwalter William Jones Eugene McKnight Fred Nitchy Clarence Schmid Charles Wagner Arthur Wessels Sarrusophone Hughes Brewster Oboes Bourne Eaton W. Redmon Stout English Horn H. Burress Karmel Drum Majors Frank Compton William Okker as Dan T. Smith Bassoorrs Edward Breuer Humboldt Leverenz Battery Keith Bering, Snare Drums John Byrne, Cymbals Robert Edgren, Scotch Drum E. Gattone, Persian Whip Drum Thomas Gayjarmisary Cymbal Thomas Gibson, Tympani Armin Miller, Snare Drums Lincoln Rode, Daoul Drum john W. Stone, Temple Gong L. Thomas, Doubarza Drum George Warfield, Bass Drum Gloclqenspiel Jack C. Smith Bells and Chimes Fred Mannon Flutes and Piccolos Edmund Babson Alexander Glade Gustav Cfferman l -5 ' ' - V' 4- I iw , 5+ i1 - .'1Hf1i ', ns, ,fvmfiq 7-. YV i.- ..fA,l N f . I . xl V T ,F X' -.Txviff 1 ,nugwza -41 yu ,:,, .Tw ,. . .. i ' i 44, ..1re 'gxr ,',Ti--.1-.,, I - .s 1 L, 1 Q 5,-i-. to .-it .3315-Q t'i'1PL I 1 A- i N' .J ' ' '3t...'.'i.' ..Qi,'f.4 L'L11: ' H fit .' i rw: 1 -2-I Associate Director Student Leader . Assistant Student Leader Manager . . . Assistant Manager Property Manager Cornets and Trumpets Dick Amyx Jean Balcomb Albert Breuer Newton Chapman Wesley Evans Don Hise Vern King Hewitt Mitchell John Morrison Alfred Palmer Howard Rode Jacob Schwafel Royce Skow Lloyd Smith Edwin Thayer Edward Wist Eb Trumpets John P. McClellan John M. Willits Q.. +5 --- -- vi., - .a.4.........M. , THE STANFORD BAND Director Ernest Whitney Martin Trombones William Ballis Bert E. Brown Edward Crane George Dobson Warner Edmonds Richard McCollister Richard W. Ropes Monroe E. Spaght Bass Trornbones Homer Bronson E. Lynn Smith Horns Leonard Brown Carlton Byrne Robert Fredrickson Arthur Kroeger Grove Rawlins Manfred Stever Hubert Troth Laurence Weinberg J'T John M. Willits Lloyd M. Smith W. Redmon Stout . Dan T. Smith Hughes Brewster . David Ehrsam Baritones Merle Bucknurn Francis Martin Storey Martin Edward Rodgers Euphoniurris C. Everett Baker William W. Greene Basses David Ehrsam Walter Heineman Eugene Knight Russell W. Lyster Gerald Strang Alto Clarinets Fred Burlew joseph Cavell ..:P-- Y -f-. . .'-'. . --i. . f--is-f--f 1 Q' -- M . '-.il -Y, -. . , -J.. qi .5 SV:--A-V V- - ---- - .,. -N qv- if 'fn' ' rf.. L+--. s rj. ig xg ?..Q.Lf,.f1f.j.l i The English Singers ' In the fourth concert of the series, on February 23, the group of six talented lovers of their art, known simply as the English Singers, were a delightful surprise. They had not only the round tones and the true pitch, but also the spirit and zest without which the old Tudor English Madrigals, Ballets, and Folkfsongs could never have conveyed the hearty joy of living and singing in which they were conceived. An entirely different technique was required, for these refreshing songs are built around the lines of poetry rather than the musical score. On the questionnaires circulated to determine which events were preferred for next season, the audience's straw vote gave the San Francisco Symphony a large lead over all other contenders. On a questionnaire circulated among members of the orchestra-if one ever were-as to their favorite concert place, Stanford would probably rate very high. The vote of Alfred Hertz, at any rate, would surely be in this direction. Dr. Hertz likes to play at Stanford, he says so himself, and the gusto with which he led the program this year is additional proof. Pavilion audiences are not restrained when it comes to expressing their approval of concerts that please them, which selections of works so light and imf mediately appealing as those offered this year and last can hardly fail to do. BCr1it1711i7'lO Gigli Alf-red Hertz THE CONCERT SERIES Under the conscientious management of Miss Gertrude Baker, capably assisted by Arthur Holmes, Pavilion Man' ager, the A. S. S. U. Series, Stanford's most important musical institution, closed its second season, and at the time of this writing, the Executive Committee's decision to present five important concerts again next year is on record. This series will be managed by Sidney Madden. Carl Mather is to be House Manager, and Jeanetta Gatch and MaryfEdith Jones are assistants. With a voice as clear and pure as spring water, and a calmly gracious personality, Claudio Muzio, in the concert of October 17, proved herself to be not only a great lyric singer, but a woman of cultivated presence and good taste which showed itself especially in the absence of any of Gmfudf Baker those platform mannerisms which are designed to please an audience by drawing attention from the singing. Possessed of tremendous technical facility, Ignaz Friedman was anything but a caterer to tastes for pyrotechnics and sheer display in the second concert of the season on Novemf ber 3. He somewhat disappointed when he played Brahms' Twentyffour Variations and Fugue on a theme by Handel and rendered it with a volume and determination that obf literated its structural beauty and made it a rather poor concertsttlck. But immediately after he played a group of Chopin numbers, and the conviction was fastened in the minds of numbers of the audience that lgnaz Friedman was a very great and discriminating inter' preter of his famous fellow countryman. The recital of Beniamino Gigli, world renowned operatic tenor, was scheduled for February 9, which was right in the midst of the infantile paralysis scare. Mr. Gigli was given an opportunity to be released from his contract if he wished, but he decided that he would not disappoint his public on the Peninsula. Gigli opened his mouth just as wide as though there had been no danger of swallowing a stray germ, and-just to cheer up the local inhabitants a little-ogled the girls in the first, second, third, and succeeding rows. He sang most gloriously. Sweetness is the dominant characteristic of his tone, but there is also a thrilling richness and sonority to his voice, which instantly proclaims itself as great. Claudio Muzio lgnaz Friedman .- ., - as-as -am -a t M , . f'T.rsf-ff . -. . D - - . - - W 4' . .. , i.','2,L? L ll VI' .r :.'i2 ., .N I E V. 3- Il ' I. rj.-V'1'..., r., 'Mr .5 Y Jwui - I , F Q .rV ,-.. I, il, A, . - ,mfr H, n ,.,m- , - . - 4 A 4.1.-wr.. . swam.-. E THE MUSIC SEASON HE 19274928 music season had to its credit twelve major events, including the num' bers presented by the A. S. S. U. Series and the Peninsula Association, among which the most specialized and exclusive taste must have enjoyed much that was both new and significant. It seems very apropos to notice that a changed attitude toward things musical is apf parent on the campus. The order in which a manifested desire to be exposed to the inf fluences of music for its own sake was a Hagrant departure from the spirit of rough and ready manhood which flourished on the Farm, and has gone forever. Tolerance has sucf ceeded disdain, and curiosity has now taken the place of both. Not only have uqueenersl' come to discover value in the genteel and amiable tone of a recital, but there is a certain scattered pride in the existence of the A. S. S. U. Concert Series as a student enterprise. Amongst those who actually frequent the events there is more active opinion in regard to the relative merits of specific performers and groups, there are picturesque criticisms and totally unexpected enthusiasms. All of which is healthy. The Peninsula Association sponsored four concerts: Sophia Braslau, Contralto, the ProfArte String Quartet of Brusselsg Harold Bauer, pianist, and Reginald Werrenrath, baritone. i The San Francisco Symphony Orchestra presented a group of appropriate and dignihed numbers in the impressive Founder's Day Concert. Brahms' nobly cheerful Second Symphony, Symphonic Concertante by Haydn, a delicious novelty built around the unf usual combination of the violin, oboe, 'cello, and flute as solo instruments, and the mighty Wagnerian L'Prelude 'to Parsifal, closed a worthy remembrance to the founders of Stanford. In the same surroundings a little earlier, the choirs of the Memorial Church and of Temple Emanufel, San Francisco, combined to give Handel's earnest and dignified oratorio Israel in Egypt, then produced for the first time in the West. The successful performance with choir, organ, and orchestra represented the fruit of much effort by Warren D. Allen, university organist, and Cantor Rueben Rinder of the Temple. The choir of the Holy Trinity Russian Orthodox Cathedral of San Francisco in their Memorial Church recital on November 6, revealed the liturgical splendors of the Ortho' dox service, and the superb choral singing for which its choirs are renowned. They sang again on April 29, performing the liturgical mass. r Warren D. Allen, University Organist Ernest Whitney Martin, Band Director 1 i mfr, , ,,- W ' , , ,. ip E, . f up . e . 1.1.3. J., Iv, .iv -J .V-L...-. Q' A 'gf-, 'l i,u ,qv IEW!-vw -,.-s. ,,, - V, ,,. , .4 . I' 2- rl-, 1- - ...un ,WM ,, .,i.l.lJ,,IxLtl,1l.4 '- J' 5 mir i '. ,.1 V . 14. 4. L E.,- Margery Bailey, Ph. D. Sarah Margaret Burns Eleanor Davidson Frances Elizabeth Boone Mary Louise Buxton Burns, Davidson, Ewing, Bentley, Buxton MASQUERS HONORARY WOMEN.S DRAMATIC SOCIBTY Founded 1908 Faculty M embers University M embers Class of 1927 Lucie Freeman Bentley Class of 1928 Dorothy Garnier Class of 1929 Elisabeth Lee Buckingham, A. M Janet Harris Julia North Eclwina Ewing Kathleen Fitz 4. Back Row: Wiggin, Moore, Cass, Boomer, Barrett, Lloyd. Front Row: Larson, Funk, Cecil. Maxwell Anderson Lee Emerson Bassett, A. Gordon Arthur Davis, President . Secretary . Class of 1923 Harry Hollis Chalmers John Edwards Truman Frank Baker Fenton Avery Barrett Herbert H. Boomer, Jr. A. B. SWORD AND SANDALS MBN's HONORARY DRAMATIC SOCIETY Founded at Stanford University, 1919 Honorary Members Holbrook Blinn Faculty Members E. Leslie Kiler, A. B. Ojfcers University Members Class of 1925 Alan Hazelton Robertson Class of 1927 Class of IQ28 Alonzo Cass Class of 1929 Kenneth Boucher Funk Kenneth Paul Lloyd Chrysella Dunker Kiler William Brownlee Owens, LL. B Samuel Swayze Seward, Jr., A.M . . . Robert E. Cecil . . John Edwards Truman Class of 1926 Kenneth Neal Chantry John Louis Wiggin Robert Edgar Cecil Norman Grant Larson Charles Lock Moore :K , lt-'T BNIB, ---l . .n 5 fr.. -rv-5 G, -- ,wr .-..-1 rl -, .. 1. , I ...- , . -.I.H,-..l:-if . v . 'f-- --,1,a- .-Y 1 I W. ff- - A------2 --W --i- v-hw' - - . .,. , -. ii T.-- -. '-J Back Row: Malmquist, Moore, Larson, Mullin, Jones, Speegle. Front Row: Lloyd, Mendenhall, Boomer, Miller, Wil1iarnson,Cass Wiggin, Cecil. Charles K. Field Gordon Arthur Davis, President . . . Secretaryffreasurer . Class of 1923 Hollis Chalmers Neil Miller Alonzo B. Cass Robert E. Cecil Theodore R. Duncan Herbert Boomer, Jr. Kenneth Lloyd Edwin Crebs A. B. RAM'S HEAD HONORARY DRAMATIC SOCLETY Founded 1911 Honorary Members John E. Hewston Professional Member Julian Eltinge Faculty Members Henry David Gray, Litt. D. E. Leslie Kiler, A. B. Officers University Members Class of 1927 John Truman John Wiggna Class of 1928 Gordon Hall, Ir. Harold H. Kelley Norman G. Larson Class of 1929 Lincoln Malrnquist Class of IQBO Melvin Jones Stanley Mullin I Edward B. Krehbiel Payson Jackson Treat, Ph. D . . Alonzo Cass . Robert Cecil Class of 1926 Clarence King Gregory Williamsoii F. MacBoyle Lewis Jack Meakin Charles Moore Ferdinand Mendenhall Loraine Staley Paul Speegle L l N 1 l 1 E l v The Deck Swabhers' Chorus SOUTH SEAS PREFERRED iasr of all, there were Shoup and Reynolds-and then they created an estimable hero who believed that college was a place to study, a heroine quite as lovable but not so naive, and a villain simply plated in brass instead of wickedness. There was also Toya, South Sea Island vampire extraordinary, and a whole cohort of other dusky maidens almost as beautiful and nearly as sinuous. Also there was music-under the directorship of Ted Duncan-darned good music of every variety, from the snap rhythm of GoofGoo Isles to Struttin' Along 's saxophone whimper, not glued to the plot because a junior Opera must have tunes for the choruses to step to. The divertisements also wore an air of belonging rather than of tottering on the edge of custom. The dancing-well, Frances Boone's choruses always invoke applause, but these brought shouts. The only thing wrong with the sailors and their mops or the Cannibals was that there wasn't enough. But one of the best things about South Seas Preferred -a was the working in of wisefcracks of local interest and perennial application. These are the traditions that are immortal-there's a joyous familiarity about the union of gasoline and alcohol that can never stale. And then there was that immortal line: 'Tye read in the National Geographic that when the natives beat on their tumftums they can be heard for miles! Arthur Daring Dorothy Sheckel Bee . . . Peewee . , Bob Roberts . Mr. Sheckel . Mrs. Sheckel . Captain Keel . THE CAST . Thomas Watt . Helen Weird . Julia North . Alonzo Cass . Carol Wynli . . Kenneth Lloyd . Edwina Ewing . . Robert Keerl 'Toya . . . . Jeanette Owens Captain .Quidd . . E. H. Conroy Flotsarn . . Ferdinand Mendenhall fetsam . . . Carl Bendetson Mr. Flyswatter Gregory W'illiamson AZ Cass -. .. ,,, 3 ..n,. e.7,,.-.,, f , in Y -Q X K, ff,-A - ff -- H -- .- ,'- V., 7. rf ., -i .1 V,, ,. . . . . . . , . . 1. . 1 V., Q v- . ?V 'if - fl T' T -ff -- l 2--31 1.lf1'c.-JL-1'-thiL-ra .g.4..,- 6 1. '. .. D -A - -i R. a+ .f 'pf' -A .-fs -f ,,,' . -3 A., , h- nA V x--g-A jf ,Arr iwv-iA I Lvl -4 ' 'g A Foxworthy Power Bramlqamp Gornierf TT if W Steinbeck v-Haiglip Grgg -T CAESAR AND CLEOPATRA ONQUEROR of the world, and serpent of the Nile-Caesar and Cleopatra-with George Bernard Shaw superintending their meeting, what phosphorescence one might expect! And true to the appropriate, their encounter and association was brilliant, in this most ambitious and by far most effective play of the year. No small part of the color and vitality of the performance depended on Leslie Kiler's splendid sets. A rumor was once current to the somewhat startling effect that Shaw insisted men and women were psychologically exactly the same, that their only differentiation was a slightly varied corporeal form. Shaw may have said it, but it is impossible to believe him, or even to believe that he believes it. Cleopatra is much too supremely feminine to be a man clothed in woman's body, especially as Dorothy Garnier played her. Ftatateeta, also, is anything but masculine, in spite of her brawn and strength of mind. The professional experience of both Miss Garnier and Raymond Haizlip was responsible for a poise and finish in roles notable for their difficulty of interpretation. The very excelf lent Rufio of Robert Cathcart made us curious to know what he would have done with Caesar, certainly he couldn't have had the maturity, the suave elegance, of Raymond Haizlip, but he would have been distinctly l interesting. More to the point than all these refinements, is the inf controvertible fact that Shaw is Shaw, whether wellfdone or badly, and therefore always amusing. The thmg that seems strangest about him is the naivete with which he endowed his Cleopatra: girls of sixteen simply cannot be so childish if all we've heard about semiftropical climates is true! One of the best of the evening's diversions was the history of English Club Qwhich sponsored the playj ap' pearing on the back of the program. Aside from being inf trinsically clever, it filled nicely two or three of the over' long entr'actes! It is to be wished that the Assembly Hall were built on the continental plan so that there would be diversions between acts other than gazing around the hall in a vain endeavor to find a friend. Dorothy Garnier - a a A- f--ff ,E-rr' . .- ,- , ,,i'. '1 ,Y Y ua.. -, - .Hn' 4' 5 - A . f .- . fri. -f'-fi-u.- ,,' '... 'jx'5'A,g-131 -ETC?-gP:t,fL i Y '..-,In ,4::,J,.l.,'iZJ,1' ii.. ,I l l an 1 E . E ' I li 1 n 'I f I w ll ll l me T l i l 1 . Il wx .l r '.'I L ' 'Y l Mullin Merner Harris Wenig Fitz Moreland THE ROMANTIC' YOUNG LADY EVEN weeks in rehearsal pushed The Romantic Young Lady into a time when the campus wears its most sentimental aspect, and seniors show premonitory symptoms of the gentle melancholy to grow upon them during spring days. The hard boiled cynicism of an afterffootballfseason melted before the charm Kathleen Fitz gave Rosario, the heroine. From a dramatic standpoint, the seven weeks succeeded in lending L'The Lady a polish too rarely met in amateur-particularly amateur college-performances. This professional finish soothed the audience into an amenable frame of mind, and added convincingness to a rather underfnourished plot. Rosario, with her romance, was almost an incredible conception to the Stanford rough, accustomed to the matterfofffact independence of a psychflab partner. Her triplyfmarried grandmother seemed far more in character with her frivolous and altogether feminine sophistication. Janet Harris not only gave Dona Barbarita the wisdom of the ages, but endowed her with the authentic poise of a Spanish dowager. The amazingly tall and amazingly unillusioned Don Luis Felipe de Cordoba, author extraordinary of tragic love stories, was played in a most poetic fashion by Paul Pfaff. His advent as the Apparition was startlingly illuminating, but the philosophy of love with which he wooed Rosario-not to speak of the manner in which he applied it-lent a deeper significance to the play. Maria Pepa, the old nurse and companion of Rosario's family, was one of the comedy hits of this year's campus theatrical season. Benetta Merner's interpretation will be one of the few remembered next year. And if all Spanish authors sport such enchanting work rooms as the one Les Kiler built for Don Luis-or have as pretty stenographers as he was fortunate to have with Lida Rittler-the emigration to Madrid will be increased enormously by Spanishfbound literati. The acts and properties surrounding the Young Lady were carried out with a charm of realism, but with enough suggestiveness to prevent question-as for instance, a real aquarium bowl on a table, but no real goldfish in it! The cast: Rosario ....... Kathleen Fitz The Apparition ..... Paul Pfaff Dofm Barbarita ..... Janet Harris Emilio .... . Herbert Wenig Maria Pepa . . . . Benetta Merner Mario .... , Stanley Mullin Irene . . . Lida Rittler Pepe ..... William Moreland' Amalia . . . julia North Don juan .... Burnell Gould Guillermo ....... James de Puy Leonhardt Thompson Rhodes Pierce jayne Mullin EXPRESSING WILLIE NDER the charming feminine chaperonage of Anna May Price, five Women made their debut to the campus stage in Expressing Willie, to become the potential dramatic lions Cor would one say lionesses ?j of the next college generation. This exhibif tion of the tenderly nurtured freshman Women for the first time is always one of the most interesting accompaniments of a sophomore play-it is more than a little reminiscent of the parade of fillies, next year's Derby Winners, before this year's races. There were men, of course, six of them, and very excellent and important they were-the play is named after one of them l-but the women pretty Well dommated. The whole occasion was particularly adequate, even the choice of a comedy about selff expression, the exercising of the artistic libido, is appropriate as a moral lesson for the young. As farce with a theme, Expressing Willie is successful, and though the opporf tunities for burlesque were many, especially among the group of pseudofsophisticates into whose company Willie, unsophisticated manufacturer of toothfpaste, has fallen, both the play and the players avoided them nobly. The entr'acte music by the Stanford trio gave a social air to the evening most Welcome in contrast with the dead lumpish silence broken only by the scooting of paper airplanes that mars most Assembly Hall intermissions. Mr. Kiler deserves more than mere congratulation on the subtle Enish he gave the characterization of both scenes: it is difncult to suggest a ridiculously pretentious living room without the set itself becoming ridiculously pretentious, and the bedroom was one of the best stage bedrooms we've seen. The roughs were a bit startled at this apparent innof vation of French farce on the campus, but they might have known that Rachel Grothers would uphold the best traditions of respectability. The sevenfminute playerfpiano solo seemed an unnecessarily diligent presentation of the value of selffexpression-and the one sad lapse of the evening into dullness, if you except the astonishment of the roughs at the coyly informal invitation to mount the stage and meet the cast after the performance. But at that, the sophomores only wanted to be cordial! The cast: Minnie Whitcoinb . . . . . Patricia Rhodes Dolly Cadwalader . , . Helen Thompson Mrs. Smith ..... . . Edith Jayne Frances Sylvester . . . . Claire Pierce Willie Smith . . . . Paul Speegle lean ..... . . Mariana Evans Taliaferro ..... . . . Stanley Mullin Simpson .... . . Douglas Gregg George Cadwalader .... Alfred Leonhardt Reynolds ...... . . . Robert Wagner Gordon ..... . . . Sumner Greene . l - r E'sf1TL.,.. F tink Pischel S pirito Mc Cone Conner THE LADY OF THE ROSE HERB was once a playwright named john Meredith who in his youth wrote a drama about a lady and a rose, and then fell very much in love with his Lady. So much so that when he married, it was to a woman he fancied the embodiment of his dream. Lorraine, alas, was too materialistic for the delicate sensibilities of her husband, and poor John Meredith shrank into the retreat of his study, with only his roseflady for solace. And then Lorraine dug up that old play out of some manager's dead files, put it on with herself as star-John Meredith saw it, and locked himself into his study, wouldn't eat, sleep until he could invoke the incarnation of the Lady again. She came at last and led him off into a rosefcolored world all well decorated with illusions, leaving the flower from her hair as a sort of trademark. This was all very sad indeed, and opened the autumn dramatic season. However, the sets in this production were among the finest of the year. The study of John Meredith, with its sombre dignity, and the backstage scene were beautifully executed. The resemblance between Lorraine, the material, and . ... . T. , -.- . , . the Lady, was fortuitous, and close enough to be uncanny. l There were several things we remember, moments of real poignancy: Lucie Bentley's startling beauty as the Lady of T the Rose, and the mellow gold of her voice, the agony of Meredith's hands as he found the fragile texture of his dream completely broken. Nevertheless, the sturdy reality of Dan, the property man, was a relief from these moments-we have a feeling that Dan was the only person in the play who could bring himself to spit. The cast: john Meredith . . . Howard McCone ' Lady of the Rose . . . Lucie Bentley Lorraine .... . . . Olga Spirito Trevelyan . . . . Kenneth Funk Peter .....,.. . Bradley Pischel Brainerd ........ . . Powell Carpenter Lubin, a theatrical producer . . . Arthur Hurt Dan .......... . . Dana Morganson Doctor. . . . . . . Ted Conner Lucie Bentley ,.,,. A . ..-H, f'5Ti4fTT5iw Q' 1 'irvf-:aims ,fr .2-1 , ,-af. ,Sie-i'g,:HQ' 1 ' Il' i ' i 7 ,F T Tr -:All A -E fl lii'fq'5l'5?fQlffr'5f:'fi:-'L-',1 ' i In li ll:lf't+f,if'Q4L.'-, as 11- nr- Q i if lS'irLfAf.l.ilrr fi'f-2' l l W Ll T 4 il ll 1, l r 1? - or r L L r L at r r L , , Atwill Schwartz Buxton Friclq Wiclqersharn Burns l T SO THIS IS LONDON HERE is a certain melancholy hilarity about Commencement Week which makes of the Senior Farce a pleasant cocktail of froth for the later climax of the Senior Ball. The Farce is nearly always the most ably done play of the year. The difficulty was that Elinor Beauchamp was English, and she unfortunately fell in i A love with young Hiram Draper who was an American, and aside from the stigma of his f country, had the horrible handicap of a name like Hiram And the Drapers, being well- l trained in the fancies of stage and fiction, were not only deluded but even a little prejudiced y I about this enforced international diplomacy initiated by then' affectionate offspring. An yi T orphan shoeffactory and a mixfup of names added to the general confusion, and a charming y p cosmopolite, one Lady Amy Ducksworth, assisted gracefully in the final disentanglement. ' The use of contrasted scenes showing the two families as they are and as each thinks the l other to be was remarkably effective and evoked some of the cleverest dialogue heard on l 'p H the Stanford stage for many a long year, though Arthur Goodrich had the penetration to be V in p himself and not pseudofWi1deian. The whole plot was i L bound together with scintillant, sparkling lines that ale ' lowed no chance for dragging. - This is just the sort of thing Gordon Davis is particuf L larly excellent in directing, he manages to attain a prof A fessional polish without tarnishing the spontaneity and freshness of an essentially fragile medium. Most satirical farce has a brittle tang as unpleasing as blatant crudity. As usual, Leslie Kiler's sets were enchanting, and the gowns and accessories of the feminine cast particularly l chosen for harmony and color. The cast: Hiram Draper, jr. ...... Leonard Schwartz Elinor Beauchamp ..... Sarah Margaret Burns l Lady Amy Ducksworth . . . Elizabeth Wilbur Hiram Draper, Sr. . . . . John Atwill Mrs. Hiram Draper . . . . Louise Buxton T A Flunlqey at the Ritz . . . . . Douglas Gregg li Sir Percy Beauchamp . . Howard Wickersham , Alfred Honeycutt . . . George Mauser U Lady Beauchamp . . . . Barbara Frick H 5' y, - Thomas, a butler . . . David Stollery I ii ll l Burns and Wilbur Jennings . . . Robert Sears i 7 r V i gina, ,rm r ,Anal lt- ' Mir-.QL -- -1 -,. lf. 'l ' 1 ei'-Iwi' 4 - ' i ' P ' Under the directorship of Anna May Price, this year, emphasis has been placed particularly on individual interpretations. Because of the serious limitations in the choice of plays, such matters of technique as timing, voice modulations, and so on, have been stressed rather than general character interpretation. The Shaw play offered probably the finest play experience, but in every performf ance of the year the training of the cast has been a matter for the most careful individual attention. Though some may feel that the program of the year has been a trifle lighter and less substantial than in the past, the attention to individual work amply compensated for any possible discrepancies. After all, campus dramatics are intended for def velopmental work as well as entertainment. This summer Gordon Davis will return to the campus. During his trip he has played with the Detroit Players, and with Lester'Seib at Louisville, ' ' Kentucky. He also spent some time in New York Gordon Davis, DWCCFOY and Paris looking for potential material for Stan' ford stage productions. The chorus work this year has been particularly excellent, under the supervision of Frances Boone. She has consistently presented unusual and original chorus dances, as well as the newest of steps. In spite of amateur choruses and the handicap of an amateur stage, she has made a success of the choreography in a professional manner. Enthusiasm for Les Kiler's sets is a standard thing, but this year praise is tinged with a great deal of regret. This is the last season the campus will have the opportunity of witf nessing his interpretations of interior decorations asfitfshouldfbefdone. Both Chrysella Dunker Kiler and Les Kiler will leave at the end of spring for the east. Original music of this season, as pounded out in the Football Gaieties, and the Junior Opera, has been unusually fertile. Melody songs have been more popular-and prevalent -than eccentric blues, and the presence on the campus of harmony specialists has stimuf lated a number of numbers that offered opportune ' s ity for this type of feature. ' ii' it ' A L The remodeling of the Assembly Hall during the past summer, and the addition of new lighting arrangements as well as various badly needed properties has helped tremendously in the produce tion of plays. Although still handicapped by inf adequate facilities, the general situation in draf matics has improved enormously over conditions in the past. So, on the whole, and in spite of the pitiful spot where Ram's Head burlesque should have been, this year's dramatic results have been interesting. The work of individuals has been undoubtedly of a higher standard than formerly. Students who have worked under Miss Price this year feel deeply appreciative of the unfailing enthusiasm and interest she has had in their inf dividual problem. It is this peculiarly sympathetic coaching that willpave the road fora new theater and a dramatic school in theUtopian future of Stanford. Leslie Kilev, Technical Director THE DRAMATIC SEASON TUDENT activities are ephemeral, rising with inrush of new potential tryoutees, and dying as summer and swimming approaches. Draf matics, however, are an exception to the rule, and maintain a wellfpreserved unity throughout the year. Last summer, in particular, offered a theatrif cal program of the highest quality, and the prof ductions were interesting and varied. The performance of MartinezfSierra's Cradle Song, in the Union Court, under the direction of Margaret Shedd Kisich, and produced by the out' door play production class, was one of the outf standing points on the menu. The setting was in the nature of an experiment, but it proved a beautiful environment, eminently adapted for draf matic work. Plans for similar programs in the com' ing summer are being made. Under the joint direcf tion of Gordon Davis, andassistant Anna May Price, Loyalties, Craig's Wife, and The Norman A. Larson, Manager Angel in the House, were also presented. Craig's Wife was one of last year's Pulitzer plays, and Gordon Davis himself played the lead in The Angel in the House. The dramatic torch was taken up early in the autumn quarter, when Sword and Sandals produced L'Lady of the Rose. The Big Game brought the softfshoe dancers and blues' singers out in full force with the Football Gaities under the auspices of Ram's Head and joint directorship of Al Cass and Ted Duncan. With the Sophomore farce, Expressing Willie, the light tone was continued, and the Masquer's play, The Romantic Young Lady, was much the same variety. This translation, by MartinezfSierra, followed the Masquer's precedent, set by the presentation of Molnar's Swan The English Club play, Caesar and Cleopatra, by George Bernard Shaw, was the heavier or intellectual touch to the program for the year, and was the most ambitious prof - P i P duction on the Stanford stage since the undressed . gi presentation of Hamlet two years ago with Lester Sei . With spring came, of course, the Junior Opera, by Herbert Reynolds and Jack Shoup-a light i 5 burlesque comedy of a hero winning his lady love's hand in spite of tremendous diiiiculties. The 1 l specialties and music were rather more original A than in previous years, and less of a secondfhand edition of the latest contemporary musical come' dies. With the Senior Farce to open Senior Week, l the same comedy tone will be preserved. l ' The dramatic activity this year has been serif 1 ously handicapped, however, by the unusually 5 ,, barren choice of plays offered. Very little has been 3 produced in New York that is suitable for campus ' production, and the best of this has been more I A t A 7 ' P Q --5' suitable for Little Theater programs. Even legitif l I A mate stock companies have been curtailed by this S i . situation, and this probably explains the popularity Anna May Price, Director of revivals, which have been prompted by exigency. l HE STA ,. V ., V ,cv , Y tw-1, f.. ,.1 -- . ...,rsr-B.-iv, r 1,'n.n- -A l--- nf, l ,l..'.a..J f -fwirirh-.l,,,1 .... V I, . L- A.. ,- . President . . . VicefPresider1t . Secretary . . . Treasurer .... .Quill Correspondent . Lynn A. Brarnkamp Templeton Peck SIGMA DELTA CHI PROFESSIONAL JOURNALISTIC FRATERNITY Founded at DePauw University, IQOQ Stanford Chapter Established, IQIS O flicers Members Class of 1924 Donald E. Liebendorfer Class of 1926 Wallace W. Knox Class of IQ27 G. Theon Wright Class of IQ28 Frank T. Mittauer Class of 1929 Class of IQ 30 Milton M. Silverman Back Row: Arnoldson, Hembroff, Barnett, Olsen, Farr, Stanford, Hamilton, Dew' laney. Front Row: Hicks, Brown, Keating, Krotozyner, Champlin. Aileen Leighton Hicks Astrid Arnoldson California Prior Andrews Gertrude Baker Lucia Bell Champlin Blanch Ellen Barnett University Members Class of 1926 Class of 1927 Aileen Maude Brown Class of 1928 Marian Farr Fay Dunn Hamilton Class of 1929 Ruth Edwina Hembroif , .,' .lzfjn YI a., .1-,WJ-,,, --1-s'-' . Frederic Speers . . Calvin Wood . . Frank Mittauer . Lynn Bramkamp , Milton Silverman Frederic W. Speers Calvin D. Wood THETA SIGMA PHI WOMBNIS HONORARY NATIONAL JOURNALISTIC FRATERNITY Founded at University of Washington, 1909 Iota Chapter Established, 1916 Honorary Members Margery Bailey Nalbro Bartley Elisabeth Lee Buckingham Marjorie Driscoll Edith Ronald Mirrielees Ruth Comfort Mitchell Ruth Sampson May Hurlburt Smith Carol Green Wilson Allene W. Thorpe Barbara Constance Dewlaney Hallie Joyce Keating Margaret Olsen Helen Winslow Stanford Elsa Krotozyner THE PUBLICATIONS COUNCIL HE Publications Council was organized last year to bring together the editors and mane agers of the various campus publications in order that they might cofoperate upon matters of mutual benefit. The Council has adopted byflaws, which have not as yet been approved by the Executive Committee of the student body. The Council hopes in time to take upon itself the function of electing the executive heads of the Daily, the Quad, and the Literary Magazine, which heads are now chosen by widelyfvarying methods which could bear considerable improvement. Professor Everett W. Smith, head of the Department of Journalism, is Chairman of the Council, and has been from the first the motivating force behind all its activities. He has taken steps toward having the Council establish a permanent fund which will eventually be used for a new Press Building. Members Chairman ..... ........ E verett W. Smith Member exfojjlicio . . . . . . John Ezra McDowell The Stanford Daily The Stanford Chaparral Frederic Speers Winston Norman R. Frank Baker Richard Guggenhime Claude C. Conn The Stanford Quad The Stanford Literary Magazine F. MacBoyle Lewis Margaret Olsen Herbert Reynolds George Mott STANFORD JOURNALISTS' CLUB Honorary journalistic Society Founded H1920 Faculty Members Buford Otis Brown, B. J. Everett Wallace Smith, A. B. Officers President . . .... Frederic Speers VicefPresident . . . , . .lack Springer Secretary . . . . . . Barbara Dewlaney Treasurer ...... Lynn Bramkamp University Members Class of 1926 Aileen Hicks Allene Thorpe Class of 1927 Astrid Arnoldson Barbara Dewlaney Emerson Spencer Frank Baker Gertrude Baker Calvin Behle Lynn Bramkamp Claude Conn Marian Parr Joe Carroll Elizabeth A.'Clark Margaret Cummings Maxine Cushing Merle Emry Class of 1928 LeRoy Hinckley Hallie Keating Herbert Klein Lawrence Lazarus Ralph McElvenny Frank Mittauer Class of IQZQ Douglas Fuller Elsa Krotozyner Templeton Peck Class of 1930 Hubert Gagos Clifton Moore Herbert Reynolds Jack Shoup Frederic Speers Jack Springer Helen Stanford janet Post Clifford Weigle Calvin Wood Edwin Randol Milton Silverman ,, vc.,-.V Q , Y. ji . 4..L ,L , . 1 1 We ' f ' F ' Y 5 . 1 V A V , Y , v , T THE , STANFORD T T LITERARY L R MAGAZINE p '23 ,, R . ui , E I ll 1 Margaret Olsen, Editor George F. Mott, fr., Manager Staff Managing Editors Executive Committee Business Directors Fred Speers Robert Cecil George F. Mott, jr. Clifford Weigle California Andrews Gertrude Baker MPORTANT changes in the form and material of The Stanford Literary Magazine and new organization of executive administration have contributed to its present substanf tial status as a thriving campus publication. At the beginning of the year the Stanford Literary Board delegated the position of editor to the first woman to hold that ofiice, Margaret Olsen. It has been the aim of the editorial board to give the Lit's clientele ina' terial of a lively nature, in order to dispel the conventional condemnatory attitude toward a publication that includes in its name the word literary. Instead of the traditional editorial page, the review section has been enlarged, a section which prides itself on being a worth while channel of careful criticism. A more artistic cover design, and the surprise element of a new brilliant color for each number have added psychological appeal to the new type of magazine. Below is a picture of the Stanford Literary Board and Staff. Back Row: Hodges, Speers, Thompson, McCormick, Somerville, Weigle, Doyle, Sears, Tucker, Mott, Hamlin, Cecil, Gordon, Seaman, Fair. Front Row: Wood, Hembrolf, Cunning, Keating, Olsen, Farr, Andrews, Baker, Force. 4214 ,, i -Qtr Y . .t,,, '..,.LL.Q..I.L'E:Q - N , ,fp , ,, ,, ., V n.,.v.- en., go- ur. .1 - ia 'f.:iT:Tf' -1 5 fm 'fl V, TV' F P. f.,I ' Qu 1 N f VI 'h.2y 'iF V5' '1..' ist' - - -- S ,.,.4?Q1r'1. y1l is ' - -,il i'Il ,'I lf 'AL' -P'l':Lj:QA'l'q-J Ezzlfig LJ'-ff , - nr .. , JA--, , -.H QW A in ,gn ' ' -X mi 44 .an - .. f-,,i,,,'M'-Q 5, L -if.'S,'g ' 1 - G ,-1 i::1:':.i '.-'-..',.'r:.T 'si-Ji? 1-if 'iw -X4-'S'-ft it THE wg A STANFQRD 1 CHAPARRAL l '06 4- N Winston Norman, Editor Richard Guggenhirne, Manager 'T HE CHAPPIES Robert Philippi, Art Editor Joe Carroll, Circulation Manager Jack Shoup, Managing Editor Ted Krough, Managing Editor Associate Editors Marsh Somerville Francis Morgan Frank Baker Fred Speers Jim Tucker Bob Paine Clif Moore George Force Associate Art Editors Ken Ferguson Hal Woolf Link Malmquist Van King Herb Reynolds Fred Hubler H. C. Bickerton i Harold Conroy Honorary Helen Stanford Jack McDowell Allene Thorpe HEN asked to set forth the editorial policy for 19271928, the Chaparral staff held a frantic meeting and after searching diligently about in the rubbish adorning the office, finally located the little rascal hiding in a corner, to Wit: Find a joke and set it up- it probably ran twenty years ago in Puck. Readers of Chappie are forced to admit that this reverence for age has not characterized all the Old Boy's work this year. Chappie's covers have been good throughout the year. The quality of the literary work has been highly praised, and the art Work has been the best in history. The page size of the magazine was decreased very slightly, and at the same time the average number of pages per issue was substantially increased. Among the outstanding issues of the year was the College Rumorn number, which appeared in March. Profusely illustrated with exchange material from other comics, it effectively panned the College Humor Magazine and sold like hot cakes. At the convention of the Western Association of College Comics at Seattle in March, Chaparral's delegates were instrumental in introducing a resolution to suspend the grantf ing of reprint rights to the College Humor Magazine. The resolution passed unanimously, and after the present contract expires, Chaparral material will not appear in College Humor. The reasons for this action are that College Humor furnishes American universif ties with false and misleading publicity, and injures the comics themselves by various forms of exploitation which are not covered in the contracts for reprint rights. i 'T ' B' 'T ' , 'Q , wi. W, l-6--.. ig- 1.7 1 . nv- ' T ' W A ,,,.,,.,,,-, ,tw ,, Hi, 1, ,N N , - r Lv ,A , --. .f-- - ' .. ,-L,.'.YF..:' ,. .v , .,a fl, . An!! Y 'J 9, ,iii 'fl lvl + l 'Q xg' ' '- -g iv' -f ,. -151. , ,1'l,',..- .. e. , ,M ...,., M..-1 lr 1 , . l.'u , iff Il - Q. 'f',,2z.,, A I lx 'l ,ll 1 .,,. if- -5 , -1 ' M -... .1 f,,-.l.,.,, 1 ---ll -'.n,1'! --M ,. ., vq.-4-, .1 ,,f- l l Y 1 l 1 L is u M- , .Y q. -- W- J, 14, ifal 1 W Back Row: Carroll, Baker, Woolf, Moore, Malmquist, Hubler, Krough, Conroy. Front: Row: Shoup, Philippi, Guggenhxme , Norman, Ferguson, Tucker. l l l 1 l 1 l l, John E. McDowell, 'oo N President . l Secretary . A Treasurer . l . Class of 1925 Kenneth L. Ferguson Harry Leslie Noland R. Frank Baker ' Ralph C. McCall I Clifton Hayes Moore ' Francis K. Morgan 1 , 2 l Joe Shannon Carroll 1 1 , Edward Harold Conroy J ll George Heilig Force l ll l .la HAMMER AND CCFF IN HONORARY PUBLISHING SOCIBTY Founded at Stanford University, 1906 Chaparral Chapter Established, 1906 Honorary Members Helen Stanford, '28 Faculty Member Everett Wallace Smith, A. B. Officers University Members Class of 1926 Clarence van H. King Class of 1928 Winston Norman Robert Philippi Herbert Reynolds Jack W. Shoup Class of 1929 Richard E. Guggenhirne Fred Faber Hubler . ga, 1 , .J .V 1 L . , Allene Thorpe, '26 . . Winston Norman . . Marshall Somerville . George Force Class of 1927 Haughton C. Bickerton Gregory Williamson Marshall Somerville Frederic Speers James Bradley Tucker Charles Harold Woolf Edward Beverly Krough Lincoln R. Malmquist Robert Treat Paine THE STANFQRD K 1LLUs'rRA'rED REVIEW . il Frank 1. Taylor, Editor john Ezra McDowell, Manager HE Stanford Illustrated Review is the publication that connects the University and its graduates. No less than ten thousand copies of each issue are mailed to points far and near, conveying to alumni news of achievements, and new problems concerning their Alma Mater. Frank Taylor, who as editor has left the stamp of his personality so strongly upon the magazine, resigned his post in April, the Alumni Executive Committee naming J. E. McDowell as editor for the remainder of the year. Allene Warden Thorpe, '26, appointed managing editor last November, continues in that position. She is the Hrst E. the magazine has had. An alumni publication must be continually aware that it is the magazine of a selected, restricted group of readers, and that that group is divided into smaller groups, each desigf nated by an apostrophe and the latter end of a year, and each retaining its peculiar class prejudices. For this reason, in order that Stanford of 1928 may still be Stanford of 'oo or SIQ, the Illustrated Review endeavors to keep well in mind the University traditions and customs. The experiment of gathering material about a common theme to make feature numbers has proved very satisfactory. Recall the Founder's Day number, with double pictorial spread featuring the Builders of Stanford, and an article on the growth of the Univerf sity. Then there was the Big Game issue, with action shots of football heroes, and a sports story by Dink Templeton. The cover of this issue was the first color plate to appear on the Illustrated. The Hoover theme was admirably carried out in the April Review. Frontispiece-a photograph of the man. Then a double pictorial spread, showing Hoover at, memorable times in his life. In the same trend, Random Recollections of Herbert Hoover, by David Starr Jordan. To quote the editorial of the April number: In devoting this issue of the Illustrated Review to news of the Hoover campaign, the Illustrated Review departs for a moment from the tradition of avoiding politics. The Hoover campaign is a suiliciently momentous event to Stanford, we feel, to justify an exception to this rule. Stanford at Havana by President Ray Lyman Wilbur, The Growth of the Pressf' and A Flying School for Stanford are perhaps representative of the Illustrated Review's able selection of topics of general interest to alumni. In addition to these longer articles the magazine runs a page known as Chronicles of the Campus, which are newsy para' graphs, amusing or enlightening, about doings at Stanford. A book review section, devoted to books principally by Stanford people, is being conducted by David Lamson. I u THE ' ' STANFGRD . 1 r QUAD VOLUME XXXVI H. Lawrence Beerner, Editor Horner Craig, Manager HE editor and manager of the 1929 Quad have a serious problem to face in the financing of a book which will live up to the high standards set by its predecessors. Since the transference of publication from the junior to the senior class in 1925, and the accompanyf ing change in size and improvement in the general quality of the book, there has been an alarming increase in the cost of publication. The 1926 and 1927 Quads received cups in divisions of the Central Intercollegiate Press Association competition. With an income that has remained practically constant from year to year, it has become more and more difficult for the Quad management to produce the grade of book that has won honors among university publications. The mechanical details of an excellent grade of paper and a fine quality of printing are indispensable to high quality in a year book, but it is the art Work which lends it homo' geneity, beauty, and richness. For this reason it seems essential that the color plates and designs should be executed by reliable artists who have gained some recognition. Highly paid professional artists have been consistently chosen for Quad Work since the producf tion of the 1925 volume. r . . Where to make the exf ' 1 as pense cut is the pending question. The crisis in making the Quad budget and cost of publication meet has been reached. Plans for Volume 56 have been only tentatively sketched. An increase in advertising rates, an at' tempt to secure less ex' pensive art work, and a reduction in the number of pages Qwhich has been too large in past yearsj, are some of the means by l l. ' which expenses may be reduced next year. Blanch Barnett, Women's Editor Sue Curtis, Women's Manager , fi- .5 4 3 A-A L '-'DMZ' A'-i ..f'L TTRST 1 1f 'j '. ' ' - .. ibm, 4 --V--A-M .H -5.5,-A' . if- i rt? --V-,14'v,1+i-'. gy-.. l Blinn Dutton Esberg Cliloupek Leacliman Milne Patterson Plate Ritter Robinson Scliu lte Shoup Sliup p Sniitli EDITORIAL ASSISTANTS DITORIAL tryoutees during the past year have been Robert Blinn, Fletcher Dutton, Alfred Esberg, Lily Chloupek, Marian Leachman, Stanley Milne, Ruth Patterson, Phoebe Plate, Lucy Ritter, William Robinson, Antoinette Schulte, Frances Shoup, Ken' neth Shupp, and Helen Smith. Of these, Stanley Milne, William Robinson, Phoebe Plate, Helen Smith, and Ruth Patterson Worked through to the end of spring quarter, and their industry and zeal were largely responsible for whatever success this book may claim. On May 17th, William Robinson and Helen Smith were chosen by the Quad Board as Editor and Women's Editor respectively of the Stanford Quad, Volume 37, to appear in june, 1930. MANAGERIAL ASSISTANTS ANAGERIAL tryoutees during the past year have been Hildur Richardson, Adele Gist, Frances Yeazell, George Richards, Boyd MacNaughton, Douglas McCormack, and james Roantree. Roantree did not join the staff until spring quarter. The managerial tryoutees have done the bulk of soliciting advertisements, selling books, oflice Work, and the thousand and one details attendant upon making the Quad a financial success. The election of Manager and Women's Manager of the IQSO Quad had not been held at the time this book went to press. P Gist McCormack McNaughton Richardson Teazell - ' 4 ,- I gf, D H, A, fig Lg. . ,lt is ..,....f..3?., - Y- ------ .-----Il.,-i ,- A '7'-4 aT 5- jTfl'ih5LflffiisE'7'+-Tfw-E2 if ii35 f 1 b - f , . .- m ...Q 41.7 f 'S' H 1 for-ir fm rirqsff-tlfqrfffr l 'ii Tl-.4--lv f1l'i'l-I '-K'-'l1L 5'.'Zl.,1.1iihifi c H. 1 ' iifi7E i'ii?'.:iL'.Jl A 7 -'..:1'f A N 1 1 1 ll . l l L l ll 1 . l w l i lx V ll li I Il 'I Ii l ,ll ll igil l Draper Cecil Lewis Reynolds Beemefr Hamilton Craig lil' THE QUAD BDARD ' HB Quad Board has as its sole function a supervisory direction over the publication of l ll the Stanford Quad, which is published by the Associated Students and is therefore 1, under the direct control of the Executive Committee. The Board intermediates between ' J U the Executive Committee and the editor and manager of the Quad on matters pertaining to ll the yearbook's publication. ' E The Quad Board is composed of the acting editor of the Quad, the acting manager, the f junior editor and manager, the president of the A. S. S. U., the student manager, and a I A L memberfatflarge. This year the Board has included in its membership, Murray Draper, l . M President of the A. S. S. U., Robert Cecil, Student Manager, Herbert Reynolds, Editor of T l the Quad, E. MacBoyle Lewis, Manager of the Quad, Fay Hamilton, and H. Lawrence l li Beemer and Homer Craig, editor and manager respectively of the 1929 Quad. Although its powers are chiefly advisory, the Board has a very direct relation with the editor and manager of the book. It meets once every month to discuss business and editorial 1 , matters, to review budgets, and to approve expenditures. , W, Toward the end of every spring quarter, the Board appoints from those sophomores A l who have served as assistants throu hout the ear, the editor, women's editor, mana er, ., g Y s ' circulation manager, and women's manager of the book which will appear two years later. 4 The present tryoutee system has many disadvantages, but it is the only method that has been found to accomplish the vast amount of routine work that goes into publishing the i Quad. The tryoutees are forced to work steadily during an entire year for a position that they may not achieve, and the tryoutee who fails almost certainly loses an opportunity to i get into some other activity. l 1 The chief difficulty with the system, however, is the impossibility of devising an accuf rate criterion upon which to base the choice of editor. The manager may be chosen for his I P 1 l i i, ability to sell books or advertising, but the editor must be chosen for a number of inf T E tangible qualities such as personality, originality, and the like, as well as the number of ' l l hours of oflice work he expends. The extent to which hours should be stressed in the final p l choice is doubtful. Certainly, if hours are disregarded, future tryoutees will refuse to T pl work, and the book will suffer. If hours are made paramount a good editor might be over' lsr looked. lt is significant, however, that in the past few years, the person appointed as editor l, i If has invariably headed the list in hours. 3 Sl- F gi as f - - EW. 'L '- J -lf' 'I ful -V 'I 'lg k:'qln I'- ' T 'w ' ' A '1.3ffilf-',I-eQgEfi:T:L,'a i.:.m2if . E ,,, : - , ,Y -- ..f .Tiff-':, T-, ,,,.,..,, ,-:ar --f--li-, , Y -1 -3 W -Q rm.. .. ,r':q 475 -,su -1-1-14. -i-1'yr'-.Lhff'tu.uq'::l',-A-,,fLf- F I-:g Cf' ' ' n -ri 3 ., ,, Y, A.-.7.,,,, -4- ,-4. ,I X ed W -e as A f 1 1 K ' f.wf4r-I1.f1ff' x, A -f - --h ,,1 v, , 1 L ,. , '- 7' 4 ez? -igiegeeis ..- ilu at l' 'l'1i:.l. If l l l Bamett Hill Klein Olsen Speers ' J -Y. ,,-1-:.vl- Frazee Hembroyf Hicks Holmes Keating Keyes Krough McElvermy Malmquist Peck Philippi Silverman Stanford Weil Wood -1 9-7 fffiffi 1 l 1 .1--lm-,f -S we - L-- .,. 4... 'R l Q,-P-J-'el 1 .mr ' ET-' , ' A v li NA . A M J r J . THE QUAD - STAFF . l Lucia Charnplin California Andrews Women's Editor . . . Lucia Champlin Women's Manager . California Andrews Associate Editor ..... Jack Shoup Photographic Editor .... Burt Davis Circulation Manager . . Ellen Woerner Advertising Manager . . . Andrew Blake Prelude ....... . . . Hallie Keating Poetry .... . Helen Stanford Administration . . Margaret Wood Classes . . . . . Blanch Barnett Football . . . Milton Silverman Basketball . . . Robert Speers 'Track . . . Templeton Peck Baseball . . Alfred Esberg Tennis .... . Ralph McElvenny Minor Sports . . . . . Martin Weil Women's Athletics . . . . Leslie Hill Government . . . . Aileen Hicks Publications . . Ruth Hembroff Drarnatics . . . Margaret Olsen Music . . . . Herbert Klein Debating . . . . Henry Keyes Living Groups ......... Robert Frazee Art ............ Link Malmquist Ted Krough, Robert Philippi Photographs ......... Arthur Holmes The Bawlout ........... Ensemble Shoup Davis Woerner Blake , , . Y?F. aaa.,-...--A or I ,QQ H milf. l A 1. .. 7 ' -if 'Y ,Q i f L ,I s , s v ,, f 5 ll J..- .-' 1.4 ,cgi ' -H , . gliip . Aa- .- 4 v I , - .Y . , ., i , .. ,v nn f - '-f.'T -5- , M, , . .. . ,- . .. - . I, , 0 , . . . . 'TffT 'vTlll f ilk i ', 'H ' ' I vfli lf-'L'-'x . ,.,,..'f'43f ' . -M La-'?.,.A hlpi' 4 KY. - 1 . ' . ! 1 ,IKE A .I 'Ti-'T' 1U7'Hi:.Tfs:.-lfgjw' ' ANZ, 'ogg' I , Q J --'. -ills.:-'l.:,'f,'. ' l . i . THE STANFORD , fl voLUME xxxv I2 I Herbert Reynolds, Editor F. MacBoyle Lewis, Manager o matter how much origmality and care are expended in the design and execution of a yearbook, it can never be more than a catalogue of organizations and a record of the events in the university year. Realizing this, most annuals attempt to incorporate in their plan some sort of extraneous theme in order to give the book an educational or artistic significance apart from its primary purpose. The staff of this book has felt from the beginning that such a theme is out of place in a Stanford Quad. The University is large enough and active enough to keep a great many people occupied in condensing its extrafcurricular activities into the space of this volume. Anything not connected in some way with Stanford life is out of place. But if a theme is required, it may be found tucked away in the border designs, or expressed in the color scheme of gold and terrafcotta which are symbolic of the sandstone buildings and redftiled roofs characteristic of Stanford. Now that the Lower Division is doomed, the somewhat light and frivolous under' graduate life described in this book will some day be a thing of the past. Whether this is regrettable or fortunate depends upon the light m which it is viewed. If Stanford's vast possibilities as a graduate school are to be utilized, the Lower Division must go. Volume 35, as one of the last Quads which will have the opportunity, has frankly favored the undergraduate. This is the third Quad published as an annual of the student body rather than of the Junior Class. Under the plan now in operation, the last two Quads have achieved national recognition. Volume 33, edited by Basil L. McGann and managed by F. Lowell Matthay won hrst prize in a competition with the other college yearbooks of America. Volume 34, edited by Allan Klauber and managed by Robert Paradise was ranked with the first ten. These outstanding achievements indicate that the Quad as an A. S. S. U. publication has been vastly more successful than as an annual of the Junior Class. It has been a genuine pleasure to record, in Volume 35, the events of the year just past. The staff has looked with satisfaction upon an almost unbroken series of triumphs in athletics and the various activities, and has tried to set them down in such form that those who are interested in Stanford may look with pride upon the college year of 19274928. In many ways, Stanford is now in its golden age. The next few years will bring sweeping changes in its organization and functions, and though the University probably will rise to great heights in the future, it is impossible to look upon the passing of the old order without a tinge of regret. -- e- l'-- - - - y- ., n. .,, L . ,. . ,,.,i,,,....,,+ K' , .1 li li .. f 1, , -if J-. -QL ,-A, Y,- ., .J-+.if...l hav -1 JV. .ya af si A - .. Editor ..... M ...en Y - - i--1-.t as., . , Eff rr fl' 1 'f-1' 1, -- A+ - Y , .. -if -fi9'rr?3lP f'FS'f'if'fi2 i' 2 Wi f 1 fiii.f-T'Df1- +11 1 2 I 'li Ali' Mele-a29l Q ' r Back Row: Maddox, Skillern, Wright, Wenig, Carroll, Skipwith, Springer, Bramkamp, Behle, Terwilliger, Franck, Hodges, O'Meara, Wood, Blum, Myers, Gagos, Schilder, Cromwell, Peck. Second Row: F. Speers, Conn, Cordry, Porter, Whiteley, Denney, Grace, Isaacs, Wallace, Mittauer, R. Speers, Emry, Riley, Thompson, Clarke, Baker, Cochran, Silverman. Front Row: Fitz, Keating Brown, Weaver, Cummings, Ingtaham, Voorheis, Hicks, Bradshaw, Barnett, Krotozyner, Kahn, Arnoldson, Marrack, Kinsman, Shively. THE STANFORD DAILY STAFF First Term Associate Editor Associate Editor Templeton Peck Frank Mittaucr Hallie Keating Alice Ingmham William Grace Margaret Mudgett Frank Whiteley Night Editors Advertising Managers ..... Bil lie Ka h n Dorothy Brown Editor . . Astrid Amoldson Lynn Bmmkamp Jean Blum John Skillern Whitney Wright Frank Whiteley Frederick Cromwell Mary Edith jones . Fred Speers , Calvin Behle . Herbert Klein Business Manager . . Managing Editor Wornen's Editor .......... Desk Assistants E1 - Milton Silverm n I k Hod sa Krotozyner fstridBAmEldson Merle Emry 3 Egbert sgeegrs Yun mm amp Calvin Wood Margaret Cummings Douglas Fuller Hubert Gagos Reportorial Staff Blanch Bamett John Isaacs Albert Denney Marvin Skipwith Carroll O'Meara James Myers John Skillern Herbert Wenig Stanley Mullin Arthur Schilder Jean Blum Ralph McElvenny Elizabeth Clark Joe Thompson Whitney Wright Kathleen Fit: Harriet Marrack Sylva Weaver Donald Glcdhill Business Staff Sam L. Cochran Circulation Manager ..... . james E. Frank Merchandising Manager .... Lawrence Lash Classifed Advertising Manager . . . Ruth Tinsley Hal Terwilliger Andrew Porter Robert E. Clarke Welsey Visel Steve Halsted Gus Malmquist Elvim Cobb Second Term . . . . . . . . . . FrankBaker BusinessManager . . . . , . . . . Editorial Board Night Editors Hallie Keating Templeton Peck Elsa Krotozyner Calvin Wood Herbert Klein jack Springer Milton Silverman Frank Mittauer Desk Assistants Hubert Gagos Carroll O'Menra Robert Speers Alice Ingraham james Myers Page Bradshaw Margaret Cummings janet Post Gale Wallace Sylva Weaver Reportorial Stajf Marvin Skipwith Florence Colherg Alice Behner Martha Judson John Isaacs William Grace Albert Denney Allan Hart Advertising Managers .... Betty Shively Ruth Tinsley Billie Kahn Elizabeth Ann Lynch Vemon Cord ry I .MMM .- V-H.. . Q-v--A--1 Jai- Mil.-4 T TAT' f ' 'tl-x Lillian Boyce Margaret Kempenich , . Claude Conn . . Frank Baker . . Aileen Hicks Gale XVallace Gunnar Norberg Janet Post Page Bradshaw Virginia Voorheis Vemon Cordry Burt Davis Marvin LaHue Frederick Cromwell David McKeown . Sallie Kinsman . . Evalyn Brown George E. Moore Deming Hobart . . Claude Conn Jack Hodges Merle Emry ,loan Nourse Donald Oswill Adele Smith Mary Lee Richmond Ethel Palmateer . . Sallie Kinsman . . Joe Carroll Wesley Visel Elvan Cobb Philip Stockton Theodore M. DeMotte Charles LaFarge Kathleen Fitz Louise Dohrrnann Hammel MCKQX Virginia Voorheis Joe Gordon Kenneth Man eld Sid Badcon Nini Iago Howard Moore Business Staff Sam L. Cochran Merchandising Manager ...... ' ' James E. Frank Circulation Manager ........ . Lida Rittlet Gus Malmquist Robert E. Clarke Steve Halstead Hal Terwilliger Andrew Porter -1.- ef F-7-A -' Q --'T 'v!'9Q 3' .1 fwfr f- Y Vff' 'fl ilk? ' : ,'f4 F- ' s-ll-L1fI1fs iel'e-'Rial 41F'aYf'sjl1 9' - f,t'!'4-Q fir' Q-,ge-:'f.,-' Uv ' -f-rv- - -- ,gi ,-ew - I 'f , P2-Ti THE A STANFORD DAILY . 1 .l -L i , t Frederic Speers, Editor, First Term R- Fw11kBf1ker, Edifm, Second 41.57771 HE Stanford Daily, Palo Alto, California, October 3, thus announced in a new heading, type, and design was the first to be clicked off the press in the five thousand dollar print shop annexed to the Stanford Daily building dur' ing the summer. In addition to the new press room itself there is now installed new printf ing equipment: a folding machine, to take the place of hand labor, a linotype machine, and a stereotyping outfit. With such advantages the paper has begun an era of advancement, and has introduced a number of improvements editorially as well as mechanically. Aside from campus news items the Daily has made a special effort to give authoritative statements on matters of general interest by members of the faculty especially qualified to comment, or by men figuring publicly in some particular field. The titles, Searching for Humour by Professor J. C. Almack, 'LLower Division Elimination by President Ray Lyman Wilbur, College Men in Professional Baseball by Babe Ruth, and Freedom of the Modern Youth by Judge Ben Lindsay illustrate the wide range of subject matter and I92'7.M The issue of the Daily the dehnite interest of these articles. Seven years ago the editor of the Daily Palo Alto, as the paper was then known, was forced to cancel syndif cate news because of straitened circumstances in the A. S. S. U. treasury. Wire service was renewed commencing this autumn quarter, and has proved a valuable addition to the paper. The 1927 Big Came edition, which ran articles on both the California and Stanford elevens, several columns of dope by Pop Warner and prophetic fans, and numerous cuts of players, goes on record as the largest paper in the Daily's history-sixteen pages. Art work is occupying a more prominent place. The Big Meet edition was accom' panied by an innovation in a fourfsheet rotogravure sec' t1OI'1. The system of selecting an editor for the Daily is underf going revision by the Publications Council, and it is exf pected that it will suffer radical changes. Closeness of staff votes at the midfyear election resulted in the matter 'Lgoing to Quad as an A. S. S. U. ballot, the first occur' rence of this kind since May, 1925. 'lf it iv' L - u ' A i 1 Claude Corm, Manager ,, 1 - -1. . I. , Y 1 G IL-'-'5 fists swf? .9512 , ., . '. . s M- ' -,gif 9 4 - - -A ,-- ,- 1, , 1 , ,,-, :,, up --3 -.' V.,- . ' P' , ' 'P as-'lr' .,,.,c2L'- 31 '.-a.av1'f' , 'L 'J - '-ir. - ...-,Q .4 , - - - J -ju, -75 1, , -. 1 at . M, 1 ,,, .--diy-9, f--- , -- The Press Building JOURNALISM INETY per cent of the activities of the Press Building are conducted on the second floor, which is nothing more nor less than an agglomeration of editors, publicaf tions, and professors. Up the stairs the stranger is greeted by a happy little family of doors, and many scrawling signs designating the offices which are tucked away in every available nook. Lit in nice red crayon- Quad in formal black and white- Chappie announced by a cover-and The Illustrated Review. Here also are the ofhces of the two professors of journalism, who are associated with the journalistic ventures of the campus as instructors and advisors in the editorial and business fields. Professor Everett W. Smith, the head of the journalism division, is actively interested in publications enterprises. This year he has been especially occupied in his capacity of chairman of the Publications Council, a body organized as a permanent center of control for the various publications. The Journalism division again sponsored the California Scholastic Press Convention on the campus, which attracted high school editors from all points of California. f'Problems in Newspaper Publishing, by Professor Brown, is to be published by Harper Brothers in the summer. Everett W. Smith Buford O. Brown H J PQUBLICATIONS l ll- t 4,-' . ., l l , '. ., 4- , L., . -R g r . J , 1 1 The Round Table, whose membership is comprised of the leading women in the organ' ized activities on the campus, is the instrument of the Associated Women which cofordif nates these various activities. This group meets once a quarter to exchange suggestions for improvements in the respective fields represented by individual members, and these suggestions are acted upon by the women. The personnel of Round Table is as follows: Eleanor Davidson, President of Associated Women Students, Chesterlyn Thomas, Presif dent of Women's Athletic Association, Winifred Huntington, President of Y. W. C. A., Anne Hartwell, President of Roble Hall, Aileen Brown, President of Cap and Gown, Lilian Force, President of Panhellenic, Aileen Hicks, Women's Editor of The Stanford Daily, Lucia Champlin, Women's Editor of the 1928 Quad, Margaret Clsen, Editor of The Stanford Literary Magazine. WCMEN'S CCUNCIL The judicial, and hence the disciplinary functions of the women's government at Stanford fall within the province of Women's Council, a body composed of three senior and two junior members elected by the Associated Women Students to serve for one year. In previous years this election has been held during spring quarter but was advanced in 1928 to the end of winter quarter so that it would not conflict with the W. A. A. elecf tions. The reason assigned to this was the policy of not duplicating candidates on the W. A. A. and A. W. S. ballots at the same election. This practice has been found to exclude desirable candidates from executive positions in both organizations, which would not occur if separate elections were held. imposing penalties for violations of the lockout rule is the main work of the Council. Violations of the honor system also come before it, as do other infractions of the women's rules. Penalties for lockouts vary from the withdrawal of certain evening dates to social probation for the miscreant. Granting of special late leaves has been found by Council to be one of its most serious problems. To equalize the privilege accordmg to the standing of the women in the Univerf sity, and to remove a great burden from Council members, a tentative plan of graduated leaves is now being enforced. Seniors are allowed eight late leaves a quarter, juniors six, sophomores four, and freshmen two. Eleanor Davidson, '28, has been President of the Council during the year, while Helen Huneke, '28, has been VicefPresident, and Margaret Owen, '29, Secretary, and Anne Hartwell, '28, Senior Representative, and Janet Harris, SZQ, junior Representative. The new Council members are: janet Harris, l2Q, President, Margaret Owen, 129, VicefPresif dent, Maxine Cushing, '39, Secretary, Ruth Lansburgh, '29, Senior Representative, and Helen Thompson, '30, Junior Representative. Harris, Huneke, Davidson, Hartwell, Owen I WCMEN'S GOVERNMENT 2 ' ' T' EvisI0N of the women's rules has been the chief work accomplished during the year by the Associated Women Students under the presidency of Eleanor David' son. .The most radical change accomplished by this ref vision was the extension of the 1:30 P. M. privilege to men callers in women's living groups on weekfend nights. Modification of the unpopular highway rule for freshf men women to permit two couples to motor on the high' way after dark was also effected. Prohibition of parties of less than six from walking in the hills after dark was amended to apply to parties of less than four, and two women together are now allowed to enter a fraternity house. Signing out until 1130 for Palo Alto is also an inf novation. l Formulation of the new rules was accomplished by Women's Conference, the legislative branch of the wo' men's selffgoverning body, composed of the head of each women's living group and five representatives from Roble Hall in addition to the President and VicefPresident of the organized women. After apf proximately two quarters' work on these rules, the Conference submitted them to the various living groups at a regular weekly house meeting for rejection or approval, and they were unanimously approved. A. W. S. officers for the past year who were elected last Spring have been Eleanor Davidson, '28, President, Helen Huneke, '28, VicefPresidentg Margaret Owen, '29, Secretary, Anne Hartwell, '28, Senior Representative, and Janet Harris, '29, junior Representative. The new officers installed by President Wilbur spring quarter were Janet Harris, '2Q, President, Margaret Cwen, '29, VicefPresidentg Maxine Cushing, '30, Secretary, Ruth Lansburgh, '29, Senior Representative, and Helen Thompson, '30, Junior Representative. W Janet Harris, the new president, represented Stanford at the biennial convention of the western section of the Intercollegiate Conference of Associated Women Students, held in April at the University of Washington. The purpose of this organization is to afford an opportunity for student executives to meet and discuss the problems of student adminisf tration. Eleanor Davidson, President A., 1 f Y X l SL, i Back Row: Marble, Lansburgh, Miller, Shedd, Brown, Huntington, Huneke, Hartwell, Kinsman. Front Row: Bonner, Greene, Davidson, Hill. -A was r , ,- ..1.-fx-7-W... ...W-.. . F , - x .. , , . - .., i., -. - J - -. ' : -'.l 5 l 1-'l' I H, I l 4f.,'Z,, 4 .-' Lf' Q ,-- f M l l Y' ' ' 'V' .V U . '-' ' - . .4.'... ll 1. v' A-'-M s...'1:',- F?.T1.I.'1'f- , . VA V - , - ,p Q , ,.i -.J. Vincenti, Spencer, Armour, Dickenson, Wool ' MEN'S COUNCIL Handling of all traihc violations on the campus has recently been added to the discif plinary work of the Men's Council, whose duty it is to regulate student conduct by im' posing penalties, subject to the approval of the President, for violations of the accepted standards of student conduct. Members of the Council during the year have been: Louis Vincenti, Norman Eain, Philip Cavalero, Emerson Spencer, Fred Wool, Charles Dickenf son, and Merrill Armour. Vincenti is now Chairman, the position held by Wool during the first six months of the period 192728. Pain is the new Secretary to take the place of Dickenson. A. S. S. U. BYfLAWS REVISION COMMITTEE After the approval of the amended A. S. S. U. Constitution by the student body last Spring, Murray Draper, A. S. S. U. President, appointed for the purpose of revising the ByfLaws a special committee consisting of George Ellsworth, Chairman, Aileen Hicks, Secretary, Lucia Champlin, Fred Speers, Eleanor Davidson, Robert Cecil, Anne Hartwell, Philip Cavalero, Leon Levi, and Murray Draper. The committee worked to condense and regroup the old ByfLaws into six concise articles. Disciplinary regulations suffered the most revision, social regulations were brought up to date and clarified, the financial section was condensed, athletics and elections revised, and organizations amplified to include the charters of the various councils. The finished document was submitted to the Executive Committee the Hrst part of winter quarter, and was unanimously approved. If 'Q fl Back Row: Cavalero, Ellsworth, Speers, Levy. Front Row: Hicks, Champlin, Hartwell, Davidson, ,.:.,- W V -.. --.i,...,, --.., 11.96. A as 4 A --ferwss.-.-fy, I 1 ,I YI- 'fl' P ,,'-4'- .52 f.'-43-'. r'f 1 2 fr I . 1. .!f1'.m. .1 I f 1 -ff 5.-I' ff lf' j- ffl 'fl-'2'f'5. wif- -f s- 'l JY 1,'!i.2'.i'.: tt gi T2 'I 1 'Ll .. , -- -- -,f, gi... rv - V 3, - ,.l,5-jg., 1. 3 sw 1. . J EXECUTIVE COMMITTEE HE tendency toward the elimination of the Lower Division and the University policy of catering to graduate students were responsible last Spring for the decision of the Executive Committee, the medium through which the Associated Students' organization works, to substitute one graduate member for one of the senior members ordinarily chosen at the Spring election in order to give the more academically advanced group in the student body a voice in student affairs. The personnel of this organization during the past year has been as follows: Murray Draper, '28, President, John D. VanAmringe, '27, VicefPresidentg Harry W. Call, '28, Secretary, Robert M. Fraser, '27, Graduate Representative, California Andrews, Theo Harder, and Chris Freeman, Senior Representatives, and janet Harris, Edward Krough, and Stanford Steinbeck, Junior Representatives, with four exfoflicio members, Fred Speers, Editor of the Stanford Daily, Robert Cecil, Student Manager, Eleanor Davidson, Presif dent of Women's Council, and Emerson Spencer, Chairman of Men's Council. The function of Executive Committee is to decide on matters of policy for the student body, approve all financial transactions, grant athletic awards and dates for social funcf tions, and manage student affairs in general. To it is delegated the privilege of amending the A. S. S. U. ByfLaws at its pleasure by a majority vote. It also has the duty of approving any changes in the byflaws of the subsidiary councils, such as the Publications Council, established by the passage of the revised constitution last Spring, as well as approving all actions by such bodies. All election returns must be approved by this group before they are valid. In fact, the organization of the Associated Women Students and Men's Council are the only official student body organs outside its control. Its functions, in short, are similar to those of the board of directors of a corporation. Perhaps one of the most important changes in the Bylaws made by the Executive Com' mittee this year was the substitution of the tiefup for that not yet legendary annual struggle between the Freshman and Sophomore classes, the mudffight. At the midfwinter student body elections, upon petitionrapproved by the Executive Committee, a change in the awards section of the constitution to permit granting of Block S letters to athletes not previously entitled to them was approved by the students. This was the first amendment to the revised constitution adopted by the student body last Spring. Andrews Fraser Call Draper Freeman Harder Harris Krough Steinbeck VanAmringe l + STUDENT GOVERNMENT 7 7fi-T o correlate the activities of the students and to coe i 1 operate with the administration in conducting ,I student affairs are the chief aims of the student Q government units at Stanford. The Associated Students is the central organization in 9 the administration of student affairs. The Executive Come 5 mittee and Men's Council handle the administrative and - j el judicial branches of the government. There are also stue . dent representatives on various governing councils, such as the Board of Athletic Control and the Union Board of Governors. The Associated Women Students is an organif zation separate from the general student association but is an integral part of student government, nevertheless, as is the Women's Council. It has been the aim of all student organizations, in a more marked degree this year than ever before, to improve student government in every way possible. President t at A e Wilbur is especially anxious to impress upon these organie zations a sense of their own responsibility for the proper conduct of affairs. They are laboratories through which the students can gain practical experience which will fit them for positions of responsibility in later life. During the past year Murray Draper has ably performed the duties of President of the Associated Students, to which office he was elected last Spring, and Robert Cecil, that of Student Manager, which is an appointive position. The perfection of the working of the Students' Organization Fund has been the chief improvement made in his department by Cecil. Through this fund a careful check can be made on the finances of all student organizations, with the exception of living groups. All but the latter class are required to conduct their financial transactions through this fund by requisitions approved by the Student Manager. This requirement extends to all publie cations, including the Stanford Daily, the Stanford Chaparral, the Stanford Literary Magae zine, and the Stanford Quad. The practice of exchanging speakers with the University of Southern California and the University of California before the annual football games for the purpose of promoting D- - friendliness between Stanford and these institutions has S t ' t t t been continued by Draper. The unwieldy set of old Bye Laws to the A. S. S. U. Constitution has been revised to conform to the provisions of the new Constitution and condensed into about half its former size. Men's Council has drawn up a new set of traffic rules to be observed on the campus and has taken over the function of enforcing them. Another change of note in student organization has been the revision in the mode of choosing the editor of the Stanford Daily. According to an amendment to the ByeLaws of the Publications Council, the Daily editor will no longer be elected by the staff, but will be ape pointed by that Council. A new Constitution and a new set of Byfliaws, should aid student government in functioning more effectively than ever before. All that is needed is for individual stue dents to aid the student executives by carrying out the T i regulations and observing the rules. Only through co' l Murray Draper, President Robert E. Cecil, Manager operation will the Honor System continue to be upheld. GOVERNMENT H ' 1 :gas ' 92 'gr ff J MGE :Q ll :' r : -mm' 5 T ,. Q 4 ' I 1 ' 0 -' ' 'can : 3 Q, A ,F Q, ,rev ,gig ,l14N,a!g,yx A. K eRS9Q ..'-Q 'N '-MF g WJ Q! - uwgf -5 Q, , , ,Ng 1-f-. 1: nr in fi- , avg 5, ,ff - O, I xS ' 'SF W, T 4. Q we A 2 - ls HA -avg, Q xwdgafff .Q--L 5-ff ne, U 0 S. ,gmwqgfggfgf 2 ' l fyfcw 1 ey o , -y. . :Q . -' 'WZa:FE. N 1 fL!4gf 'l k5 sigggzgx 4 .- , .- Hg s YE?-52 'Hz 1 Q, g '+ iv .. A -.gh j - . gg ifqvcgifsg ,b : ' Q i? 5:55 SSE. qigwfxig .- 1 L, 1 A4., 11 4.1 2' wie, Q1ff'43 a-,K .. . T. 4 , 4 Tx zz 1. f, 3 5111, A11 5,-. :nge A fgw, - I V - ,,::ff5.,,, 6155.2 Qgig ..-'ij Ugg f 1: i Qin A' ,A Q. J 1 . 1 H Ap J, wg - 411, -Tx dgg' A -e .- I , - 135:55-a,f5ir:5 fue!! -.54 -' if - F 1- ' A 25: v 'l ' . Il 9 . -R - J 1 7 gy-4-12 ,ggi 'A 'gg 2 , 15,5f.,- fm, - 9 .- V my V fi, :5 H' . gg. : 4 ng e 711' 1' , .. gig? Q' -f YM ? ,,.m,2':,: E xg 7 F1 ., IWW K ' 9 ,535 . MIM 1 if . ' , V wiaagm - gy, X Y L ,r .gn 'ea Rgfe . , ,.w . I1 V'-' 1 'il 'Q N ' Ji.. f 2- 3 sag ' yfg, . .Q 1' - x'f'1I1' f ': -Ti in i? Q2 - . -5 Q' QV gy 1 WM 'P -f .I ,A Qgnffz f lv eg 1: N - ,, ff , 1.11. ,L ,,1, F,,,,:, L . . . , . . Q ag .aww I J wv'.2f:fxg Qea2::f wf aa .3 'S- 1 .. , O p W: -vwfi-1 -' 7QUS ' '. fm? A-:--505 '1 l 17?Ei5f1 XV '. I +: - 64 -I 4? . , 'fl . Q ,. ,M -.ng A . 1 'I-, . ulwny .- N. S1-19.34, lx. 1145 N A -A N- - Wk . 4 X -. 9 f m.. ,,.,.-,J--1 L., vp-::f,15gl:1Qxx+x 5 J-xl.: ,. u 155 a- iff 4 31 ,,-g aaj. -v ' IQ '-? J-. q- -1:1 ,,!.:f ' . ' sig n! ,gf 4 mf x pf 4 5557 V ,Q-1 e I Q.- -1. ' lx. Qu' -X .V --1, eu: r, Q! Q , ln.. , -1 , ' .. .+R :A --,,-9, - m, fee- W ig-,Ill I 1 f . ?'7' 1 f - P 5 'Q-if dm. f K '. '45- nfs.. .1 wf- 'L ' b fi? 535 viii' - L . 'f 'I 1 tgsiglm' V Qllsiif .1 ' C h X el' aiu 1-,--,gu n ,N L. . fiffv- N 6 a:.'.-ffggfy, 1 3, ,, fi g ga 5 J . gigfgw 'fw i , M1 mga y.-.4-ji. 4 . . , 3 'veg , u A: . Q ' 5943 F9464 :,: !:.,5it-ki IL'-4 ,,v'Lag,:G 5221. .r-HH E - I .,.,. 5 .:,-gy .75 -7 'TEC' -5. :ff -Y , ' 35: f 1, ' I f '4?!5!ji55 E21 f5?i9J1a31afw'5l 'A 5335! f'if1ff:2N-'J1 5 -55' 9 L-' . v 1 ,Aw tw ' n 3? 5 Legmp. E55 2555, 5133 5 . g fspliiif? 553534565-.. 'U5S'i5'ZE'h5WSZWJQ-:.ig6IFiQ ..., G.z5NJj. if .,Qf W i? - - n 3 . gl Q1-aries, :?2'.i752g's,v:f .r-?1isi7j'-xmrwdwgfi ,ai -5, 'gm - A' 5: Q' 61, 57 j 11555-gs :QSZJQMLA-6:5r!!.-vwmfll 45-K55Qi7fff 'ff,ff-:Q jg J 'slugs Qi -. ,-an--4 5 ifiififf.iff-'7?5'f2?2?1'f'ii1lx 32'P?2-1221 v 's?Nisii:a+Z'ffff5': W2 Qv?i?'9f' Q55 E' fi 0 - fl lffflyggi-1:3-4' sgffifszij W3 51,5 espn .. Qui ' - A Mfg: I 6'll5fx9,' sg5p1:45,'?f ,QM A 1525. 15--Q :if zft,Q. 5'45fQiyjg 5I6E2a3 :'n,t6:3!5 gf,ff.4xCEx ik 445550 35 ' Qlfgggsiiia-v -5 '5P2.f,afg':a'ff9f3fEL- 5?iffa5u :.!j1f?gi3Qf,waxfa f F211 1'9'W:si'F, QQQJ 'l'Ea5'599?.'J:as -QIE 11 ' A 535 91 ' vwa ,f.fEJ.-.272!ig. Af.y-'-U3-g7lgSg:.'eg 1r4,.fg:L I.'11-fy!-nf, 'ze .1 sg -ai! -5 131 . iizilfyviiggii - ,w1?1f'?f2sQgirf2'5 ' 1 6 z' :1f?7f5l . J,,,,3g4y5K X434 , vig: vw, A 9 455 is , ,554 J Q , . .o af Egg? if-wing 'i 2 '1 A yflgiiiii,.ffvfecigggfwgQi ,' Ji D r A 'e:,a:'25 - , m , Q- Q- '4':f:qi.f:.?3?::l 9 1' N5 :.. 7 pf f giff H55?.:j'5.'1 ' QQ, 3 Qi' f-E555gggyfg-fS?+JQ,Jgfb'5qv.Q,g Mu Qg2?ggf,rg2,gi?fw15g5 511- 'Ffa 'mf ,. mai Jgfggggfm 'HK 'pw-..,,.,5 jigNcJ5g..lg3iQg'fi:4:JE,pl f 5,15 .5555 . I ..51f1'i2agXXQY7-'gs gl xw1l3..yg39-9,5-,rgiff MA: O if if-'I-If-'I !.4'iv::q:ff 1 Q- s'NQ+rIf5isJa f4'-'Hnf, 2' In l 5--. sv' ,J.,5.Q4:g- .lnzgg f-Q1Z, 'i.g5-ig! f V Qxf Q f if .I 'ij-Z'1 :x.-I--,g-,'Q,-fif-X ':-1.5,-'le.ff:. - -- fv 1 A, Q4gf1?QQ,v,f-vnu A ' 7 5 - A . 25,51 ngjgqj-, -5-, 1'5 'wg-h.gJF,5-v - - , -V I g 'L 4, Z '1'.f.i5j5 QQ,-gk. 's , ---- -Q, :3'ff'523GQyf Eg iE',lQ5,b15v'g,gf1 4.FKg1l' -E N Gm -.g:5'5, .f2:iif5g:kl 2 . ,, 5 , 1331 . y-Eyifi-595. 9155? , 1, K .- . 'fi 'li - ' 1- f Q Q . V igy, : og , 5, 'v:ga,'g. z. A . - p575ep,4ag:3:j1,,.,1-'fi ' Lil w:-j:,Ea5f:!5Z::,Q?:4- f',a,gI-. I -h' uf' ., ,I r. .Q-4::f?5.f E-5122.2--'qf1Qgg2g .mf ' .zz ' r'ifNg.!f Qwfgyg. z, 'L 'fi , , f?!gefLf ' L, 'ff-E ' U, F. g W9 ' fEi'f'l Zpfy., 'fri' Wiegfijis . .,..f -s .Q , 'wzial F1311-:1sf.f0f'4w1f5f:5Qf 1 f1?1v'-----.,J- ,g --- '-. ll. -slr.--X-'.-,illllgf ' l.4::,--gn'-.. ' -.,..g-.. -H41 f'fE'f::' -:ff F-:':.i:'ff-1-,in-S-'-.lILz':f'LNf:ss zw- 'Ah fa. f ! :2inrf ?QHSM-4-f'Sf.f. Ji:i!1i?f-fisii-'vgiiw Q A K. ucv--h 'new--. 1. 4 -, kr Q Vfw-: 1,--Y,--Q-'J ..--N,.:jn.x if -U21 Tiff' '- 'ff-':2:s-:swf-2 -rim? .ii -fr gawrmf-fe:f:2:2a 'wgsw fkjgfs, a-3 !4?fsB1gdg4S!.g'fgi 5Ey 4212599 pf . -, g-f, --I,f 1 .v:.g.--,llc--f ,L-Nev '-f X 5.5! 1'--sr:-4 '.gQQ.16fQi':rf-vf,r',-9 M395 3. 3, Q f fit.: 4 - -25.1, ,E-g2:,s,5L -7f,5p:55ig:f:5!M5,qg Q mis. 1 V, 6 . Y jiisghIvwggygffgggzlw 5311 I H K-,. 'qgwfg-5, 1 W I9,i59w1f5i.-:.4a.'yMi . it . gg 1? J I 'igggr-rfg,:'5,ig,a - :.:rg:?:?Q, I' 'f5nSi?di:,525'2E . yjfrzziaqp ' 'E is . . the abouncling, unceasing activity of the entire population t ew pitiless, useless effort . . . the ardent feverish coming cmd gomg of all the general absence of sleep . . -Maeterlinclq Life o the Bee The zealous bee on restless wings afwhirr Makes all the welkin vibrant with his buzz. Betimes and late he's busily astir With great to do about the things he does. Anon you see him. Presto! he's away To dart from rose to rose in frenzied hurry. Yet, tho his humming ceases not with day, Let no one deprecate his constant flurry, Or dare to deem him ineffectual: He manufactures Wax-a Quad or Daily- And then to honey ofa Prom or Ball Transfers his Versatile attention gaily. His sheer delight is work-and yet I Ween That much of it is done to please the queen. H. S V . 5 if' 'J' 4 I1 ' EL ' E9 1 52 ! H ii ,' HE I we -E i il 'I I ile 3 J it 43 5 1 'i M 59 '1 W 11' fl l Tai H 1 in M! 2 gll W I ig lg 1 Fi ug Nl! 51 N H M V M ? M 4 W U H W N5 1 1 my A .9 5' U 1 M lx I I N E i 5 Nm T I. w ..4 A I 1. 5 ll ff 2:. ' M, 1 I , 'H fff 1 N4 ' U lil My ' i 1 I., 4 , 4. ,f ,,-. fd' J, fj , 1 ,Q 1.. . , .,.,. 1' -V ,v ., .,f-- Iva- 3,17 w L . -, J. :Q , n '. sk 1 w fu . . march so fast to freedom it fair makes me dizzy. If Have turned my thoughts to aviation a l great deal lately, what with many of my . fellows enrolled in the Palo Alto Aviation School. Reflected that the ground is hard and unyielding, and man's birds as yet erratic in performance. GC Which does remind me of the nocturnal maneuvers of the army planes over the campus each night of late, wherein powerf ,s ful searchlights sweep the sky to spot the f, I fl -nf. I wx flying machines. And it is a right Hue sight To to see the moving shafts of light cross one another in a frantic effort to first disclose ,fa r .ai . i the birdman. If Around to a multitude of events over , c c H ,. Junior Weekfend. To the Prom with my i zaney, it being a dignified and highftoned l l ' V ' I r ' l 5' ,f' f' :' f W f : in 't 4--:.ns:av,L?2jt,:Tf-.QT ,Hill i After the law ex affair with decorations of the time of Louis Q ' r XIV. - if To the Junior Opera the next night, it being a rollicking show and did nearly laugh myself ill at Al Cass, who was exceeding funny. Noted with pleasure that President Wilbur did attend and laugh at unexpected times. If So to the Convalescent Home where did 1 labor mightily at uprooting trees and mess' l ing about with a rake, becoming afflicted y with many callouses and almost bursting l from the large amount of barbecued meat COI1SUII16Cl. Inner Quad from the Library I Men line up for barbecued mutton after Convalescent Home Labor Day I Quad goes to press-on time Antifaircraft units practice on campus GC This week have noted some Indians trudging about the Art Gallery, clad in na' tive costumes, and upon inquiring learned that they were about showing their handif craft inside. Upon investigation found this to be true. if Did hie with my zaney to the Military Ball where ultrafmodern art did prevail for decorations, and Rube Wolf conducted his estimable dance orchestra. GC All the morning greeting alumni whose names I had forgot, they coming to see the Stanfordfflalifornia track meet. In the afternoon to see the meet where California was soundly spanked. Records did fall all during the afternoon, there bemg seven new ones before nightfall. GC Do find myself of late wasting much time lying about in the sun and up to Lagunita canoeing in the evening with cofed wenches, and about Searsville loafing and swimming and watching frogs grow out of tadpoles, and have resolved to take myself in hand in the matter, albeit I have made several resolutions about such things to no apparent effect. GC Did learn that the new Women's Counf cil was installed and at that was philosophif cal, wondering at women not being conf tent with ruling men, but must rule one another as well. Gf Up early to read the Women's gym cos' tumes were to .be curtailed, which seemed a wise and timely move. The women Cofeds labor at unaccustomed tasks for Stanfofd's Own ry ll l l w l l l lll I I 'J '1 ,I l. l I . I I l I Q lm I I I 1 l K l ,, .. and Stanford belabor one another with cushioned fists, and was much pleased at the spectacle, for Stanford did Win four out' of the five bouts, which were Well attended, I counting nearly 5ooo rabid persons about me. CIC Tonight to the Masque Ball with my vvench, we being in costumes which did filch from my purse a goodly sum, and everyone having such a merry time withal, 'tvvas fully worth it. Did Watch King David Adams and Queen Mariana Evans, surrounded by the Rally Committee disf guised as their court, crowned with much mock dignity and ceremony. llQDid note the start of men's rushing, having Watched with amusement the general housefcleaning and furbishing up that has gone on about the houses of late. Methinks studies will languish for three Weeks. GQ Did treat myself to an excellent concert in the pavilion, it being the last of the A. S. S. U. series. Alfred Hertz did lead his orchestra in all his Whiskered glory. tif Next night did see Caesar and Cleof patra which was Well done but for the fact that after the first scene I did figure that the play must needs last for five hours to go through the full nine scenes, which did afweary me at once and set me fidgetf ingg but was gratined that by a miracle it lasted but three and a half hours. -.,. .. ' - . , V . JU, .., HJ4 . I ' J . at , Lagunicn. overflows And makes the road im pd. University Press nine defeats Stanford Daily by twelve picas THE SENIOR WRITES And Having Writ Moves Out P early and to register and it raining furiously all morning, so what with dabbling about in puddles trying to get programs arranged with patient but adamant professors and with standing in lines to pay tuition fees, lines to get study lists, lines to get programs signed, lines perforce that never seemed to move, all were reduced to a bad humor and did belie the opening of the most divertising quarter of the year. if Was taken in my imagination to a foreign clime this eve in the Assembly Hall where Grace Burroughs did give with much color the dances of India. She is, I wot, a pupil of Ruth St. Denis and a Stanford graduate, which did set me pondering on the diversity of occuf pations of our college family. GQ Next night did again worm my way into a pew in the Assembly Hall, and listened with much interest to a debate between Filipino students and Stan' ford debaters on the question of Filif pino independence. Our island friends did discourse with much earnestness and logic on the matter, and the audi' ence did vote in their favor. GC To the pavilion to Watch aspiring Tunneys and La Barbas from California mul nrmnw ,A H? .Q ,V ,, 1 I .- .ff 1.542 .1 ,,i .':Tl'f '55, .5?E:,,a,i 5' ' ko L ci a o fa Sta o d birdmen pose for the camera A i l 4 l SPRING I. V if When the Stanford swimmers did wallop California and break three Pacific coast records, it eased my mind and did partially remove the sting of the basketball scene. GQ Das Rheingoldw did please me much, being a dance drama given by the young ladies of the dance composition classes. Did understand that this affair is to take the place of La Fiesta Lagunitan which did please the multitudes two years ago, and was forced to observe that the whole was very creditably done, with many graceful dancers and a mass of femif nine pulchritude hitherto unknown to me. Did applaud mightily, and observed with satisfaction that the audience was as appreciative as myself, albeit many did not com' pletely understand why many things were done. if Up and to an assembly, where President Wilbur told of his experiences at Havana in a right interesting fashion. if On Founders' Day did up betimes and to the Chapel to hear the San Francisco Sym' phony Orchestra concert, and to wonder mightily at the growth of Alfred Hertz's whiskers. GC Was hard put to console myself with memories of our major victory in football when the California box fighters did down our team. Cf Was greatly pleased to see Charles Paddock again trundling down the cinderfpaths, and to see Stanford nearly beat a collection of Stars from the Los Angeles Athletic Club. It points exceeding strong to the I. C. 4A for Stanford trackmen. GQ Up and around to spend my last few cents on my candidate for king of the Carnival. The nominees did boast of quaint titles such as Flower Pottsf' Wet Rainv Lloyd, and L'Four foot rule Adams, the latter of whom won the election by ten dollars. Methinks the election did smack overmuch of crass commercialism, though there was much use of apt slogans with which the various candidates did boost their stock. King Adams did choose for his queen a comely maid, Miss Cecelia Sudden, but methinks the glory was too much for her, albeit she did run afoul the scholarship committee and forced the king to choose another in her place, Miss Mariana Evans. K And so to finals. Memorial Arch 7 .. iq I , and was much chagrined to learn that I would have to vote again, since betimes the election committee through bad han' dling ran out of ballots. Such mismanagef ment did put me in a bad humor, albeit I was later cheered to learn that the upper' class women would hereafter have autof matic 1230 weekfend leave. And three extra letters were granted to members of the football squad who had not previously been awarded them, and an amendment did standardize the circle S award to apply to all minor sports. If Did listen favorably to the English Singers from London this evening in an A. S. S. U. concert, and noted that the audience was exceeding pleased. If Much discontented at the basketball series With California, Wherein California did take all three games quite handily, for I do believe our team should have shown themselves to better advantage. And was put in Worse humor when later U. S. C. did take our team down the line in the last series of the season. if Remarked that President and Mrs. Wilf bur returned from the Havana PanfPacific Conference, and that our President had been transformed into a diplomat over the month. If Tonight went to see the Romantic Young Lady, which I set down in my mind as fair entertainment, what with Kathleen Fitz providing divertisement in the cast. -w.lL.2 .1 1 '. Herbert Hoavefs campus home 'i ,Li 4 - l 1, . - I g fe - iii ii az: .f.1.-. 3: 'Lil Adams elected King of Masque Ball 'fa r I1 P V ' f .. rv gs .Qi -1 L ii I w Q . ,,,, g , r '1 .J H lv: '1 C8 0 w-fr ay. Coggisclwll, U. S. C., practices on old oval ,gf lil ' I L ,L -. L....L ..,..:.,n,4.m,,,.m-,-.Y v.. Y, - - - Casrilleja attends Chapel l. A glimpse of Roble Bridge from Fresno State, and we were all brightf ened thereby. GC Up and around this morning early, and wished I were in bed, as it was the coldest day I have seen for some years. Being told the thermometer had dropped to 27 def grees, did don my overcoat to classes. But was pleasantly surprised to see mailfboxes placed in convenient places about the cam' pus by the home post ofhce latelyg now will mail letters more often and easier. flf I do believe the sight that has caused the most comment lately is young ladies of the University pedaling about the campus on bicyclesg the cofeds do seem to be getting so independent in this manner of their transportation that I know not what will be the end of it. Have watched expectantly for tandem cycles, but as yet have not been rewarded. But I like the misses on wheels right well. GQ Of late have been greatly alarmed at the spread of infantile paralysis among the cofeds, and have pondered much- on how long before it will begin to catch among the men. Dr. Story has wisely issued orders stopping all social gatherings, albeit the disease seems to be mild in form, it has a name, poliomyelitis, which fair does take my breath away trying to speak it. But it has abated much, and now, a fortnight and a half after its start, it seems to be well in hand. V GC Did vote today for A. S. S. U. officers, A sunny glade across from the filling station l walking up the Row to their first sorority 'i rushing days of the season: What with their personalities and all being put on dis' play for the sorority women, they must be all aflutter. GQ A meeting this day was held of all the house managers to form a cofoperative asf sociation wherewith to purchase supplies for the houses, methinks it is an eiiicient plan indeed. GK Much agitated in mind lately by lecf 3 tures of Ruke Effendi on the Bahai Move' I ment, in which he seems most earnest in Off0Pe1fw,Gm11fw half-milff his ideas but which are difficult for me to grasp on account of their remotenessg alf 1 i 1 beit they are good, but not adapted to our materialistic and colloquial ideas. GQ Vastly amused to learn that the Rally Committee did throw out the mudfight, so recently instituted as a custom, and ref verted back to the original tiefup, which, it seems, is much rougher but more sanif tary. Methinks traditions are no longer conceived by time, but are made and cast out at the whim of the Rally Committee, and it does keep a body humping to be up on the latest ones. GQ Lately have witnessed many ignominif ous defeats of our basketball team, and have been cast in gloominess thereby. It doth seem we have the men with ability, the spirit, and the support, and yet we lose the games, which is disturbing to my peace of mind, albeit we did win one game Seafsvflie owgows 4314135 T' ,- f, - ,,:.-55:4-f---f am-tvnmv-1-.,,qe.s1.Jnf:w.:-1-ag.-t-1 -s-fimqg nf: ' ' ' Water on its way to stagnation in Lagunim - - - - fr. . -. --,--Z WEN- - -W--.if , Bicycle craze strikes campus EYITIEAV-'iii ' I. C. S. establishes Stanford branches TH E SOPH OM ORE WRITES and having writ wears cords Y train to Los Angeles over New Year's and did witness Stanford def feat Pittsburgh in the annual Rose Bowl game put on methinks for the benefit of enterprising Pasadena business men and snowfbound eastern radio listeners. But the day was exceeding warm and my clothes did stick to me, and I did wonder what the perspiring Pittsburgh gentlemen thought of California weather. The Vic' tory was much welcome to the Cardinals, and withal a satisfactory game. Was pleased to learn that Biff Hoffman was elected to captain the team next year. GC Back again to register for the winter quarter, and it did rain the whole day as is customary for registration time. A rumor that had come to my ears before was conf firmed today, the Sigma Chi fraternity having its charter suspended, which did grieve me exceeding, for they are excellent boys and no more to blame than many others. GQ Was raised in spirits that afternoon by watching Otto Peltzer, the famous German halffmile champion, run about on the track with Emerson Spencer, who methinks is a coming champion himself. GC This day was much interested in the many blushing young freshman maidens X W :an-0 -l-L ---. . . A rainy day-the Inner Quadrangle , . P y i TER . '4 . T ,E Y - --..: if ..,W.,,g ' , . - +. - ' . ' ' '-', ,-,- ,V -4 Aa, up .-H-su - X '-I-' W- ' . 'i3,,g.l,a'l '51m -i -. 1, sf -' ' 4 ji- ,,. n. -,4,- -.. ., ,. - 5 - r L i i 1,-P-A --,M f .-f .,, - --. ' ',l ' ' -ff r-afwfi,-.cflflalrlw ' ' - -'.f,f--t ' M -.f. r 've - . - .., albeit, it seems no other school is half so worthy of the honor as the Alma Mater. Did reflect upon the strangeness of the football season, what with defeats by baby colleges, and victories over all the rest save U. S. C., which was, in the words of Morse, a moral victory. GQ Toward the end of the quarter did hear much controversy as to the speed limit on Palm Drive, Judge Maxwell of Mountain View declaring judicially, albeit wrongly, that the limit is to be twenty miles an hour, and Professor Kirkwood later overruling his decision and declaring the limit twice that, and so much comment was made, including a great deal of raillery at the exorbitant hnes meted out by Men's Council, feeling its judicial oats, methinks, too keenly. Ill Was accorded a rare treat in the StanfordfCambridge debate on, 'LResolved, that this house regrets the tendency toward easier divorces. Did swell with local pride at the valiant efforts of the Stanford debaters, but was forced to admit to ease my own conscience that the Cambridge men were far the wittier and more interesting. Did smirk exceedingly over the remarks put forth by one of our English friends, who said, All that my opponents have said that is new is not true, and all they have said that is true is not new, but puzzled the real meaning of it out with some difficulty. Did reminisce with pleasure on a similarly clever remark made by a Cambridge debater a year ago, when he, speaking on the subject of drinking, said, I would not sell my birthright for a mess of dotagef' Did not recall who won the decision but was much entertained withal. Ill' And later to the Sophomore Cotillion and was greatly pleased by the decorations, which simulated a quaint, Colonial mansion. Noted with smug satisfaction that the scoref board was nakedly exposed. Was not familiar with many of the comely wenches that I saw, for there did seem to be a preponderance of imports, which did threaten me with a philof sophical mood, on whether or not our imports are exceeding our exports. if And so to hnal examinations, with much drinking of coffee and many late hours and frantic seminars, wherein did absorb a great deal of condensed knowledge. Was much per' turbed at having to remain until the last day for an eleven o'clock final-and so home for the vacation. v Scoreboard records imports ar Sophomore Cotillion-Visitors QQ, Stanfori Women 9 a anyhow. Did ponder much on the specf tacle of 87,000 people-more, I am told, than the population of Nevada, though what difference that makes is difficult to understand-crowded into one stadium. If Many good rooting stunts were flaunted between halves, but methinks there should be a large mirror on the California side so that our own students might view their handiwork and gloat over it. Did strain my neck watching balloons released by cof eds disappear in the blue, but came out much satisfied at our victory, albeit later distressed at the looting of robbers, who took advantage of the game to despoil several fraternity houses. Did lose a win' some brace of striped garters, and swore long and lustily at the audacity of the rogues who took them. GQ And so later to San Francisco, where did join with many others in celebrating the victory over California. Did visit every hotel in the City, with indifferent success, there being hardly hotels enough to go around, and all of them so crowded that breathing was utterly impossible. Did finally give up in despair and retire to the Beach, to find that Tait's had closed and all was dark. With heavy heart and aching feet, did return to the campus and so to bed. GQ Did learn soon after of Stanford's desire to partake of the New Year's Game at Pasaf dena, which caused me to rejoice mightily, ames force crowds back v x f. i l it ue . .. Two hours of Big Game Rally and Bonfire at a glance Skyrocket! Stanford Varsity! '1'l1e scientifically constructed benj f i 1' C real police. 'Tvvould look strange to see the president of Men's Council pursuing a fellow student down Palm Drive. No good can come of this. GQ To supper and then to the Big Game Rally where much noise was made by the students urged on by A1Cass, Pop Warner and Dan Evans, former president of the A. S. S. U. And so stumbled with many others from Palo Alto and other peninsula cities to the model pyre of scientific conf struction, and danced about yelling and shouting curses at the Golden Bear, while the flames did leap to the very stars and prophesy Galifornia's doom. Was moved to philosophize upon the tremendous Waste of inilammable matter involved, but did waste precious little time at it, for the fire gave forth a pleasing Warmth and lighted the country around to such an exf tent that could read fine print, were fine print to be had. GQ Did arise on Big Game Day with a feelf ing of tension, what with the game of the year about to ensue, and returning alumni craving more sandwiches than We could provide, and many machines whizzing up and down Lasuen, laden with many comely vvenches who had come to flaunt their finery. GI Did almost miss the opening play, what with waiting for friends at the gate, and then going to the Wrong entrance three times and then getting in the wrong one Holdovers and freshmen swap stories while guarding the bonfire l l GQ Did set myself to study, but thought better of it, so spirited a freshman woman to the City and eluded the highway rule. And so home, with my feet very tired. Clf A busy day, what with the campus swarming with high school journalists, it being the time of the California Scholastic Press Association Convention, wherein the young journalists learned of the ways of their older brethren in college. Was at much trouble to keep from trampling them under foot as they crept about the Quad. llf Did watch with mounting trepidation as Santa Clara defeated Stanford on the gridiron, and the joyous spirits of the Santa Clarans did overflow so that they ran on the field before the game was over. Methinks the Cardinals needed Pop War' ner and a more earnest state of mind. Wonf dered long if I should call off my bet on the Big Came, but soon forgot about it. GQ Did watch also the Intramural Cross Country Run held just before the game. The runners were dogftired when they hnished, albeit some of their tongues were lolling out in canine fashion. Bob Looff bourow won in a walk-methinks he could do little else at the finish. GQ Was much concerned to hear that the councils which control campus morals have taken unto themselves the task of appref hending and punishing students who zoom willyfnilly about the campus streets. Did wonder at the temerity of the councils thus to take upon themselves the duties of l junior College presidents conven Wasliington game sendfojff 'rally - f High school journalists overrun campus-325 of them l . .--.-f- The little 'red water wagon A lass for Cass ',.,,.i ..,,,- . nt.: .' 1' ' sources that the engineering majors will give of their scientific lore to make it a sound structure. The old order change th betimes. GQ Around to a football game this after' noon between Oregon and Stanford, and was but mildly excited by the game itself. Was convulsed with much merriment at entertainment provided between halves when the Hammer and Coffin Society met the Stanford Daily staff in a weird contest which my neighbor told me was a football game. The plays did smack of a burlesque, and many new Ways of advancing the ball down the field were unfolded betimes and again, such as catching the ball in a net inf tended for butterflies, and both teams hudf dling together as though exchanging stories. A comely lass in red cross attire sat on the bench to attend to their Wants, but apparently they had none. GC Was much perturbed toxfind that the campus has broken out with glaring red signs hailing me to stop my ancient vehicle at every crossing. Did try to stop as indie cated and stalled my motor, and after much coaxing did bring it back to life and hicf coughed home. GQ Did trudge down to the station to watch the varsity board the train for the trip north to battle Washington. Was amused at the doughty Cass who hopped on the train at the last minute with but a tooth brush for luggage. Did hope that he would be comfortable and not catch cold in the frozen north. 1 ., , . ...Ln Hammer and Coffin eleven fraternizes with Stanford Daily after the fracas lake bottom at Lagunita, and so into a slimy pool full of imagination and oil. Ill Saw a large seaplane unloaded at the aeronautics laboratory, and Was told that it was for study by embryo birdmen and not for actual flying, which did prompt me to pity the poor machine, it being forced to squat helpless on the ground While its brethren were disporting in the air. if Abroad to classes, there being nothing else to dog thence in the evening to sit on the floor and rise at periods to yell and shout and arouse much ardor for the Stan' fordfU. S. G. Football Game, which folf lowed soon thereafter. if These Trojans did seem mightily anxious to Win, albeit also did the Cardinals, and so it was a tie, I3 to 13, an unlucky number for both, methinks. Did lose my voice and all my dignity when Stanford came from behind to tie the score in the last few moments. GC To the pavilion one evening to hear Claudio Muzio, of highest esteem in Grand Opera circles, open the A. S. S. U. Concert Series with a program that pleased the audience and myself hugely. Did set my mind to come each time, but forgot. GQ To the Phi Delta Theta house tonight Where open house was held in honor of two noted guests, Lou Gehrig and his swatting partner, Babe Ruth. GC The scientific method, so prevalent in these times, has invaded ye annual Big Game bonfire, for did learn from authentic s l 4. i 1 i The Stanford rooting section-U. S. C. Game . : ,ln i l l w l Stanford welcomes U. S. C. -Sari S A -nah -V J -slim 5-iq.-- - La fi..- .Q P ,, law.-Off 0 . ,- , , . .1 R - 4- ' f .4 4 . . . .. . wi. -1-. 4 1 ,- ., , Ea fe-!7i-. - ' 15 V ri.. The Stanford Indian prepares to do battle with the 'Trojan Warhorse Krenz meets La Bai-ba Poised on the brink THE NEVJCOMER WRITES and having writ grinds on ID set my alarm clock to toll at seven o'clock this morning, but awoke at nine to find it had stopped during the night, and so to the Administration Building, where crowds battled mightily. Over 3,000 did set a new record for Stanford roster and I did make a new record in finding three iivefunit courses with no eight 0'clocks. And so folf lowed much handshaking of returning ac' quaintances and much mumbling of names, albeit temporarily unconnected with faces. GQ And so passed several days, and I find the cofeds in galoshes and short skirts very divertising. Went to a freshman on the boat assembly, wherein the new students were solemnly instructed as to the traf ditions of the University, but methinks the instructions were not so received as they were given, which caused me some concern. GC And so to another gathering wherein all the students did gather and creak in the assembly hall seats while President Wilbur did drop words of wisdom on the evils of cynicism and reckless driving. GI Did witness a most astounding spectacle in which the sophomores dressed in pants, shoes and grease, did give battle to the freshmen, dressed, methinks, in anything that was handy, throwing one another about and dragging one another down the I awe it all to my mother 'L ,N -r wc b 1 el. 1. 5.1 F i , .,. ,.,,,,.,g,g,..T, ,,j,,,..-...w-f..., Y , - - - .-. 1- .,.,,..-,c....-Q. ,WV V YH 11, 'F V I , ,111 g I . w. Q! , - 1 1 , , r 4 W Q A . Q g . . O Q , 0 9 Y, Q .A . 4. .i Jg It .R - C f ' . ' Q 0 .n I , . 1 -A ' 0 V-3 O . Q .I'-4'-'Q., I' - Q 0 O ri L. . Q ., I A, . . ,. V 5 , v .1 ,-X. 1 , W: , A , L 'P 1, V -. ,I . x , , in PA ,gf 1- ':J f VI HV W 33451, 'E' ' 1-Q ,W qfcrlii .gg r - 1. .5 i Q15 , , if ' j ' C .l.,:. +5f j4 v4g 4- if I 4,5 .,. .f.' !jQ D, , . may .4 Al? all Dlx 'V-3 f. , .Af Y-, .QNX gg--1,,y, , j , 1 . Y-5--,v D, -4- 4,9 , ' , - -341 fp,-1 ' - .f . -S4 -I 1 , 1' ' 1 1: I . ? X nf: : V: ' ,, a . 1 v 4 sv - J 5, ,,:,,,,,-- L-,.. 4 .' , '- the seating capacity will be increased to 87,ooo. Thought long over where this plan of getf ting bigger crowds would end, and whether I would get three tickets to the Big Game next fall, which I doubted greatly. if Saw a play tonight, Loyalties, by Galsworthy, which was well received by the audience, and I was much pleased by it, albeit I did not recognize many people in the cast, nor for that matter in the audience. The summer quarter brings many strange faces, which I do not mean in a jesting sense. GQ So came the Japanese Navy delegation to the campus, a number of courteous and grinf ning folk. Later the Chinese students units of the West gathered on the campus for their twentyffifth annual convention. It does please me to see us rub shoulders with our oriental friends, and what with the japanese and Chinese visiting us in such numbers, I was pleased to ponder over our future amicable relations with them. If Was greatly entertained by the Horse Show which I attended at the baseball diamond, which in truth was transformed to a veritable circus pavilion, what with refreshment stands, stables and show rings. Did personally congratulate Ruth Lansburgh on her winf ning the prize for the best woman rider. Methinks the atmosphere was one of high society, what with all the elite folk from the Peninsula there, and I marveled at the fine horses and splendid performances. And could not help but compare disparagingly the fine mounts in the show with the sorry nags that are kept for the military department. if Late in the quarter did sit in comfortable seats to enjoy hugely with 1 1oo other people The Angel In the House, given in the New Stanford Theatre, and did wish mightily that such seats might be had in our Assembly Hall, but without success. Verily, even reviewers would be more kindfhearted to Stanford shows could they but have cushioned seats. If A very restful summer it has been, and last night went to see the last summer quarter play, The Cradle Song, with the Union Court for a setting. A beautiful and impressive show, methinks, what with the stars overhead and the beautiful shrubbery of the Union forming a natural background. Union Court fmms impressive setting for The Cradle Song where President Wilbur presented countf less sheepskins. if Did wonder if this be not the reason they pasture sheep on the campus, but without reaching a satisfactory conclusion. GI Up betimes to register for the summer quarter, and it seemed passing strange, what with the warm sun and the blue skies andthe brown hills to be signing up again for classes. And many new faces of professorial mien did greet me, and students who are teachers in their earning hours coming to really study. It set me thinking that this was Stanford as Dr. Wilbur would have it-a graduate school where people come solely for knowledge, and the idea did seem quite good, albeit unromantic. GC Spent a pleasant evening at the concert and reception given by John Sellards in the Union court. And so to bed, with a pleasant, relaxed feeling. if Enjoyed several excursions to Carmel and thereabouts these last few days. Study and pleasure mixed, without the hectic speed of other quarters, is exceeding nice. If Did see Craig's Wife in the Assembly Hall, and thought well of it. With many others in the audience-a cosmopolitan crowd, these summer folk-did applaud the work of Gordon Davis, as many times before. If Have noted that fourteen rows are being added to the top of the stadium, whereby Carmel-Summer qzmrter suburb. Construction work on the Stadium Ruth Lansburgh adjudged the best woman rider at the Horse Show The Senior Ball-far, far into the 'night Page Ben Hur-the Horse Show THE HOLDGVER WRITES and having writ, fiunks out ID spend a hectic time this week, what With bidding goodbye to sentimental seniors and watching them go through the ceremonies of graduaf tion-a technicality with over many frills, methinks. GC So This Is London, a play directed by the estimable Gordon Davis and dealing with EnglishfAmerican social relations opened the week. I enjoyed it much, what with throwing peanut shells from the galf lery between acts. The next night was not to bed at all, it being the time of the Senior Ball, wherein I and my zaney with many other folk did disport ourselves in soft lights to the accompaniment of good music and high spirits. Did gallop about the dance floor with reckless abandon, and witnessed the sunrise, a sight uncommon for me. GC That day saw the Class Day Exercises, and the exercise that intrigued me most Was the placing of a five dollar gold piece under the brass plate. Pondered much on Whether all the five dollar gold pieces were still intact in the pavement. GQ Around to the Chapel on Sunday, where was much awed by a very impressive bac' calaureate sermon and a solemn atmosf phere. And then on Monday did go to the final act of graduation, Commencement, Seniors, shrouded in black, march to the Mausoleum SUMMER --A L x . ' ' 'll L I ,r1:'rW.. . F' 11 V 111'w1 'l-'- 1' 1 D 1 ' i 1 E 11. . 1 Q 0?51QF G!fEm Q 111 , fl I Qf1l11 I1 Y' T1flH'IYh,KXiQn.g 1 K X . .F , . 1.6 .1 1.12 . fy1..1 . G wb' 1 4 ,.-.-f ' -. NXXI' 1 '1 1. 1 11111 , I .. A I 9 , ,..,1j: ',-.' 1 1 .1 D X i ' 2' N M I. 1 11k ., xx 'ff m 'f'1, 1. 'f1m,11 A H 1 'QW f.: EY ' . - 11 f 1 1 1 1 1 1 I ,XXQ15 5 .1'x '. 411. 'fig .-,4 'M' X .1 , 1 -x , W 119' I, ' H V f' x NiX..A5.1 y ' . 'X 11 1 Ll' l Nu ,g t XXX 5' , -351' 2 'W f 5 ,X 11.1 H '11 'IIN X Gx' f 111. f, 1 ISC 1 1.2'v 'WX' A15 'Ili ' JZQ1! 41. 1-.X ff M 'fi M1A1lmV T! ga ' Rf- 1 1 11512 '1111..111.. ' Q . on N110 Jl11 W'11!1 3 x 1.1 '11 ' 11111 1' .?11 1'1.1.11 '1 fx 1 KX 11 .11 1' 1 W' Q K 1. 1! f.f.1'l'lIl' r 1' ',,'Wf'11l1'p X XS X P VX XX id? X ' t 1 1 1 1 X11 X f I n,h X f 5 X 1 1 ' , ' f L I I UN my' X Xu' i 1 1 X 1511 1 W Vg, X 7 f 'I1lX 1 ' fx 15 X A X fl Xb A X x X 5 5 ix X X fi f .1 1 2.7.1 6, 2.1 ' , I x If 1' 1.1 111 .X :P 113 U mai W .M 'L G 11 ner- 1 FE 1 gygylxfv V118 :1 I ., 1 M1314 gl' 15113: '! ' bl 4-1. A 'MQ 1 6 1' 74' xv J Q55- ki 11 Q 'iv' gm! 2- 1 'WEE Auzd an l if ,. 1 ! iff, 1 I 'K m ' ' 1 wil? 5' 1 1 1 K PL 6 H '1111f. 1 'NW lu A il 'lT my 1 '35-.26 x lam. rffy, jj 11,-,svn 5 -Q 1 'HP' ,ffl A 11X ' 31 lm' 'ally fl . ,X 12. x 5. Qi. 'SQ' wg N X.,- 11X11 yi. I Kkx f Vf 1+ fi 1 X wfinxx 5921-I gk g n' qivew l f 'XZ X Nfifhgfsa i, I' f Aa-.X nv .,- ff C111 v-xx Q! IPA ,411 1' :a,P! 71 'Z S ,ul .P 11 I L x4 N that' f'!4lJ, 15, ff N1 5' if 1 W! 11 fl'!'U'f',lr f ,f 1 1 f 1. 3- ..wf1Q1.. f 1?-rt-.1-1w1 ,1 1.1, 1 '11-11'.1111M' X . ' f1'f 1 ' 1 P .N 1 , R '1 ' .' ' Hsfkgyv Y ,, 511 XX X skf NJN 1 n 3 ' '1.', 1f ', - ' 11113. 1' M119 :gl , 11 '1' K 1 11? .' L 'f-fr i'ifi'.- X- 11 ' V1 ' I' L 1 . K ,X , M, . ,-1 . ., ca P 9 Z tv? ,J ZH' 'X Crit Q A fwfr ll ' 1 1,111 Y Q Ki! 1 :Aki ,'ZQ'f'2 ' yfffq! 'Q '1,1lv JJ111 Lg. tl G52 K3 I, 1l,Kq,4 '11 I IU 'QQ 1. Lkv- 1 f -f ft -1,-1 1 I' ,4- 41' S' F' 1 1' fqf 7 fiwl f'4--9:'4:fiiEv 'mv?1'1 !fWWwfWV ff! fX '21 41-vw.. MIL' M 5124? if V ,-v,.1,v , vw., WE' 5 N , :iw Q11 ff 7'Z,,mW1 Zffgdf-svfxl f'7fW'ugWf4.'N I4 ks- 3 6 5 bbw Zf Lhzllpffggjrqzf Wflsglw O11 Qi! 1 r-A 1 1 1 1,4 X 615 31. G Q 'QQ-gg Q gg.. 1.1174 I, ff W, A Wff it ,isa A Q 4yL,f 115.5 gf KKN .MQ J's3lw fb-4 pf xi c' up 7 0 f?fQGf f :BW I ' WO 'Q g, P' I Lx I ff-Qf Zdfffffd Q xwlwllfgf 11 f 0 .0 gf! ,y!f!,,1,p-1151! A qp f 1 f 'N 1 ff f am -.1 1 f f V.. ' iQf.,..,..11.M 1 'iwvl 713' 912411 gfmxwnmv m1mf1!,m.11.1 QWNM GMQWJ Rag .,.J1.4.f'. LMMXZQQQ WZWMM nf- Kg 0 S1 f 1 0111 9154.1 .'1'1 11 -O. XV 11 1 N' 'W I 1 1 : J 1 N N' i',Q111Ff1 'I 'QW-.T- if .1 .' 1 1 1. M-11 ' '1'.1'M, X. - Q. '1.,'1'1. 1: 1- 111 Um 1 H -:Af .. wx f1 1 '1T111.1. ' I .' 9 S 1 if ' .111111 1. 1 1- .511 .- 1 '11 11111, Q3-,5?' 7'. .111. 1 1.1 , 11 ' ,rpg 7141. 1, X ' '.'v'.' , 1 .wif Q : Q. . ,11 'M ..1,1.'I , if.-.L X Q4 gf . .il-L M .111 .3i1x',L.L 1. 'N X' :.j...1..b .xii 1 .. 0 F' X'32 ,.?.:.m'..f1j..fg .,' 111! 111 Ll p: I 1 1,1 10 1' 1' 1111 1. .1-21' 1 111 .11 'L 11 1 1 1.1 1 1 'filjf 9.1 f111'.if1,aEf5Eg2-iggzifii' .1 .V-11 -- 11 1, - -' 111 1 ' 1 1 'il O Pg' .- , ,N.'xl1 . Sg'...1,.11v 11 . . Trfalfqibx-2 15 1 'Qu -1' ' .qpa .-.zfn-1.-, 1.111 N 'Q ' 1 ' 1' -'gf Li 0 11' 7f'l1'W 'x V N3 N . --1' U' M'11w' 111 W1 f '21 - 11, 11-41,'f'5 1 , 1 T '11-gi -H ' 1 25 A ' 'EQ-,Q In '-'91 5.1, 1, 1 vga g, fb .'1.. 11 f11':-.11 1' V. +I my .U 231.9 1 1 N w' .1 I. A.,, .L V1MW1hA.,,.. A My wk -N .J W yigukx XNG: 'gf A, ,2-ii: 11, 1 W . f 'fl I' , , vf Q'l'a'!'m1' V 1 1 I ijffvff' 2 IW I 1 A: F 555--4.1 Q , V11.l' I ' P61 ' -. A' A' 1 1 - 1111 1 1 . 1 11. 111. .1 1 ' 1 1 11. 1 1 11. . 1.1 :Q ..,, -qlb : .I JQLIEI1 W ,P WM N 1 1-.fix 1f .N 1 fu It .'.,x. 1, 'A W .M 1 Q' W 11111 ' L1' I 11' 11. 111 1'1'1'...:x. If K- ', 1' 41 W1 ,- 5 . ' -A 1 f1 -1 ' .K 11' 1 , 1 1 'f .1 . . -i fe' QwQffZ . JN ,.' N:1W., I 5' 1j1f if!5 ?i?iS5i Qi? 1711 5 f . '1. 11 Hi' .W 1'f'J'.1 f -1.-.1 '1 11- 1'1' ' .V I f1'79 5 f 1 ' 1 0 21 71,-.-bm X11 1Wf 1111 131111 j9, .S'RN'M' O 5 11.1 1:1' 11gf.. 11. 1 ai iinii fx ...xr 111 J 1 ,. ,3', 1-f .I '1 11: . 'MEX 1, 1 gl 1 -'lj . Allyll ' xgpb-if-5119.19.,bl51I,gq QI: li-,iizgv ix. g . 45'113:171:111i. 4. 191 517 11 'V .W11f',1'1. 1 1 J! '11 ' I 1 gI!:.'l5jQfe'ii Ea bv '- C 1 ' ah '1 N L. 1. - l11'1. l' 11 4.11 1 1. ' 1 , . - .11 - 1 411 --,- 1. 1 'bs-'fiE'1ifJ.a11:-.v f , '1!'1 1.1.1142 'd 'X-11.-11'.f 9 1 ' 51' . 11. '1 1i' 'Wi' 31 1 1'f'1 1 1' 'A --- ..'- 1 5 1'115i-Y . -X' Y, 111'?a111.'fq111g... 1, 111 , 1.1 .1.,1iB111,, 11, I1 . ,- 1 '1i5.T,?25 h7 .fiK'1 ,'.' f111'U 1 H1 1 1 1' 1'1h'1Y11'1 1 1 1, X N1 1.12. I ,'3l1 !'5.2'.1- , .,'1.,-J Q 1 '. - 1 '- ' 1'1 . ' 1' 1' N5 -1' . ' . 11:11:11. 111 1211. 1 ' M115-151 li '1 '1 'i1'1 W i 1.1 '1' 1' 11' 'Y-1211111s1'1111..11?11 . 1' 55 1 1 X 3 11. Q11 .1 .1111 511' 11. gw1:.111Q1 1, 1 . ', ' 1 ss. .1 11 .111 '.1 11.1 x A 111 4 1 1'f1'1+1.1f.1?, 111111112 5 1 11111 11' 11 1' 1 1' 1 11 151. 1 '1 .-N511-1117111111114 'rv I 111 1,1 1 .1 '1'1y.:aff-1.11,-f1 , . . 11, 1 1 ., 1 . 1, ,1 r , .1.3:..g:1,c,:1a31f1 111 - 1 -.11-111111. I., ff5L:ff7.Q fi 3 1.1711 . 1 1' 1, yi! ' 'E' ' 1' W X 11 N 1 1 N ll ':.3fv'.- F: IQ -'p.,5 . f.:,.kJ dw' D f.:1 g-:p 1fr5z4 f 'X' ,- 1. 1-. 1 XM 1 ggi 1 11: ,bl ,.. ,, ' .1 '1 H M L01 15 , 57-95 5 1- , Y '1' 11. '? 1 N V W 5 ' . 1 1 ' .1523 .fl W. ' I ' 11' 1 1' 1 ' f5I-' if' 1 ML. N .11 j ig iefl1 L..' X I K, :.:1! 11 .lg E. '5 N 1 . . 1 ,dw -.--1 H 51 .1112 f,.1. .1 ' .,'1 '11 'Q 1 . 111 1 Min .,11 ..1? e1 .1'1 . 1 1' Q f R ' 1111 111 1.. 01 W'1..1ff 1' 1' 1' 1.1 -7' 1' 11 I 11 1' ' k'1 1'1- '1 K' f1'11'!1' ' 1.1 Q g.f5'Q1.1, 1' 1, 1 .,, 'f:' '.1 ' 'fb 1 - '1 111 fg 1111117 . 1 ' 'W' 1. 411111 11' 1 W ' 1 1, 11 1 11 31 1 1 '51 1 1111 11 11 11 11. 1 1. H5 1-3 '1f1f ,1. 1,111 '1 .LE-,-'XX1 ' E , Nu QV, N If . b . N 1' 'Y' X11 1. 1 1 K QTQYQQKQ ' , ,: .:1:f1f- 11111- M - fbi N' '11 'Q' H 1111 1 i1'1 -E1:1'1'1'f11 !.1 Q. 1' 1...E1::1w5.:1 5'LS'1S.1. J 1151- 111 . '1 1. T 1' 111111. .2 3 Q '11 1111 4'1i6'X,.' I, N .1g15ifQ-?.v..::-glliglriupl , LM . -,j ,f1.,f. Q 1 g' 5 1.11 N , 1 11 1b , gif-133111 6 1 1 :'.1l.i':P X511 11, 1 '11 1.i 1'Q1 '1 Q 111 1.1 . . 111 '11 1 . 1 11 1' 18 1. 2 -. 1.1,.. 4' 111 1' 15 1' P 'Y i 1'1--WF-11.11-1 Lf 1111 1112 '11 1 '1' . N11 5 - 11 1111..11.1..1.-1.11 - 1 1. U 1 ' ' ' 6 '1 11-Q.. C1 awfi-i1...,1.' .. ' -1:21--- , . . 2-1? ff' . 1 ' f ' ' 1 ' 1--' - CS Q g'f'X. ffm-1,,,,, 1 fi .. we-3112 wg.- 1. 1. 1 1 1 nr!-' ---- ' ga 'Lrg' 5,65 if Y U 1.15 ??',2,':b 312 f 'iii-21-,-mibfgigig 1 ,, y X W ' 1 S. .X.'t.YSf116:f 11fb3'm 1 11 12 ifsaffif- 'vi' Z .. '.: ' 1 ' ' fa 1 '1 5 ?v1 f:fL f'f1 Ni,. 17.1..,111111 '..1ff'ZZ'1f1E'.1g:iQ51,.A .1'1 ', 11.959 1i 1 1 75 151 ff? f:....... ' 1 11.1111111111--1-gig 'ww Q .f .,vJg:1:'1-1.7. I 7 . Tp .,.... .a , ,zfkffk--.,n-,5s54q1 41N xvap Q 1 f11- -r --- .'-afar-1.uf F nys. WSH' fi '..2.11:? -. '11.'11 11' 1 -'Hff-1.411111..,':.'.','f1i-was. 1 ' 1.'t 4'f!:,-'.'1i-T' - . . '1 fg ox If 1.1,...?Z.f.Q 1-g,,1.g.1M1,mY.blu. 11. P2 ,f C, .n .VV,V-,.1L:i34:455.3ai'. g-1.mL.A1 ,la .A -5 0 55Ne5q'1,..1Ci'51.1...,9:-JF' 51,4 , ',:- '-.Qn ' .1f?1ff2wq, ff, U--g 'jf' --ln ...6,1..u.r--Z7-f'f,:,,- X 1 'H: ji--4 N fa?'b.111,.. , I . W1 'W1?-'Fi' ' ,. f11'.',' H T7gi1f:fi?'ff 5'f9?- '-' 1f'f ,fi ' 'yffp' 9 512 ffm Ni 1.'q f2-s,::1' a1f1f.g11m' Lf?.f11I'.ff.,1 '1 ffffk -'1P 1 W-f ' F' 'I'-'frk-lfb'-7117's f'2 '1 I f'1f- 'f5 '1 - 151' 11. 1:-- 1 '1 T...-.2111:r1111'-111119 ' HL-1Lf1.11.1,1:'1 ' 551 1 le?2lf'f.4.111f.1. 525' W T: ..., --1- ' F5 !fw1 E 1'11. I4 1- '1sf.1:-'r?'f4a1'ffi11z- 'Q-1-v?'v.'f,Q51'1414-'gga'-?fJf W, IL. -J L., . -fv 1 1., 7 '- '.-' we -1.-1--.12 L'-f, 1' Ga -'1- ,'-'111g-1111111531 ,-215,111-1. ,,., 1 !',7 .4-15 ' 1, Aff' I ' .. ,,.. .1-. U. I ,, A - We Q Zaggg .1 .1 QVC I 1.4. In 7.7 gklek .Q F1 W1 .f 111, 1 -14--'61 '1 .2,:fffqi'1' .115 ,119 . A Q' ff is 2 1' 11 M,-1 .W 'VVQSFQ-1f.... -saffli f-iff! ,fl.T:.:,1.., Q.TX- 'rx z. ' -.M . ' fag, 1 . 'f .4 . M .g:-,.5Y.f,1 90..rv9w'cm..NK11..IEm51Q YD? emi? 1? 01.?0'i0Lf 1S'0lQ1iG'ZO'fL9,..Ca1oG Still may 'Time hold some golden space Where I 'll unpack that scented store Of song and flower and sky and face, And count and touch and turn them o'er, Musing upon them . . -Rupert Brooke We build and burn our bonlires. Come what may Of victory or defeat, we shout our fame With loud and lusty lungs at every game. We laugh and love and worry, Work and play, We break our hearts and mend them in a dayg We vievv the World, our stage, and, sure of aim, Unloose our critic's shafts of praise or blame. Thus year on year the seasons slip away: Amassing memories, We quickly seize The joyful foolishness each moment yields. And still the sheep graze on in poppy Helds, The lake gleams silver blue in morning calm, The sun goes down thru eucalyptus trees, And the moon creeps up beside a ragged palm. H. S .up-.nn-.g-,,.. A 4, 'P 5 3 . IQ 1' J w ,. 1 Nz, ii 5 I ,. ll X. ..p.v--um.,-. ..4.,.....-.-L........,.., .,.r.h....,...g.,.,.,x....,.,.. ..,.7..,.,,-.f-Q-N-....,....um.... ...Le-in-,.v.-I-1.u2-5-w.K...-un-.,n.,: ---- --f...mx.f-me f 5 'Q H f I 5 ' I 1 5 r 3 E ag - f Q5 Q ,- Qmnwcigvwwad9-:ef,9f,uyofJe4e'snvwRi1erfahY-m':A?Mxvaftimzwrhiixirif?.wG:9His11Se1f.'m59fy:iaaktYa,xfxfQ3iis+i+zFf-1i -wmuixss-if 5 A ? 4 5' a 2 A Y , W, M ng . 1 35 i ZQ S5 E f-'ZW 1 f 1 xw -1- .- 1 m F ' ups. '4 ' e ' 1 3 ' L is 1 5 1 1 .. --.ii 1' -'- e --fr Q ' ai ' 3, , ' s an p 5 o 43, 1 , ' ii 3 :Q-' -2 gs' - ? si 52 I 32: sa-. eq sg 3 1 I 4- s sl 0' 4 s , , . , Q gi 3 1 ,!4':'g!g!,'i:' 37- .U ,, , 3 aa I 1 ?. 0 als. f .1 . ' - Q ie - :ff -wr Sv it V , .' N - 5. 3' it 1 1 fi A ' ' . v A .0 H' - T , I ' wi 1 in , -5- 5' vi as ' 1., -. f' A we: 'sf sg 5 ' , 9,74 . -. 'X .x -2 ' 'f Q- . fi g,?'.'12,1r' ' 1. 12 I Qs -. 0 r' , ' X 2. S 0 -. 14 . 'ff 'x v 7 Y 5 153 3 ' ' x by 'If2.CQCff 1 4' .3x'g25 A' 3 5 F ' A-ef: ' g?i3'1. fi- 1 . 2 - - ,rn M 1 L V fr ' W . 'rn'q:'4?g'f.','?'lri. L' 5:3 .AE - 53 X gs .431 '-Q' :hi V : Y ag Z. 'vp' . i ' :bfi f ' 1 it - 3? 13A,' ' 1- 'S . W 5 2: 3 'sbxkx-1-11-1 --'N I 'I 1 E s ' 1 A KES' F - ' ' ii f 115 '5' ., f ivvf , 'fi 2 1 ie, Y' iff, A- -QPFSY N V '44 ' I E I A -- ' ,. .n-- ' X ' ' . ,f Zi ' k - All ' xi I 2 i2 I . 1 l.- ck-' xg as Ps. Ii, x i 'Sf-0 X- --. ,I 3 + 23 1? 2 5 H ,f +1 E l ei 21' 1 9 , - F' -Y' Q5 lss ff: n i f fzf egl W 1 ' is 1 5 . P I ME ' is 1- W -V 4 - Y -f-'. . .A 17- Q-V,,.----J.--Y-..,-,-N ,,J..- .+,- 1 - ,......K-.-...H--,,.i -,-,Y .. .Y 1 gl g gg J 2. , I , ., W1 . . 1: si 5 S EE if ii'-fX5fF5Qf?lf T? Ev,-W'3F!'- W . 'ff Qzavifsk- gf H4 ' M' Us HAPTER 1 Ei ai -' ' ' f gi 1' 5 V U.: gig 3 THE SEAS 0 'NS 322 Ei 1 SE n - 3 wif' 1 if --'v 1 earn-xnsssvamawnm-rsvirwmawlasffksfraiwwasifez-W4.'Sf'?muv:Je-smr.:nmsr4.czz.asxmifmsz9Lx1m,E.fsv1nfjjjfi,f?g,5:a,fss1a1a'QE al . 3? ii Ed 1 , gi W W- ,E,,,,. . , , , ,, , ,J , Y, , ,. , 1 EB M 5 95 ui WL:-I-if--m-AL.,-.-m.-...-.nm-..--,-Y.,-n-....-.--M....,........BMf.7a.1Z..,.......,,.2.--.,.L.i.J.,.......x.K.....J2.L...,.., ...mi 2 ..-...Z-s.-.r-.1... ...m.....,.....g..........-....-..L.1-7 x-1--.-..w-.1-.,.-',..,..w.1,..v, ...........,., ,..:..,v.-...-....f...:m-m..,x...,..... .f..,,---,-.-,.-.,..,.,-..:.,....w,L-....eu L. -Jijfii-. 4 'D' 1 - H15-, -s . F. , L , 5-1 '-7-A :-Nfl 5,-4 -1 W-: p- '4' - k - . -., .. , n f V4- ' 1. -1-Q-ff: ' 1 v Q x E. A 5 1 '1 ' ' v -Q, Q W 4--br fr, ,nn . - bf - ., . , ,,. .,,... MET 'T-' 1'T 'Q,iT tl:-njb'I.Tf . - -, .., , -v , V -' , 1 .1 .Ag,',.-,,. r'- r'f'd w- . kfffs- ,:-. -, B ww .' ' ' Nl' ., :,, .4 A ' ir, ,' .2w.'3,J ' II, Back Row: Reeder, Thomas, Brown, Huneke. Front Row: Williams, Cone, Demond, Shepard. President . . . Secretaryfffreasurer Charlotte Lovekin Evalyn Brown Lucia Bell Champlin Barbara Frick WOM.EN'S NS SOCIETY HONORARY ATHLETIC SOCIETY Founded 1915 Officers University Members Class of 1927 Lucile Lyon Class of 1928 Dorothy Cone Ema Demoncl Helen Huneke Class of 1929 Ruth Mason Lorraine Reeder . . Carolyn Shepard . Frances Ema Demond Elizabeth Williams Helen Lease Carolyn Shepard Chesterlyn Thomas r .-- -VV. V Back Row Lease Judson, Fenner, Lansburgh, Woodyatt, Bakewell, Shepard. Front Row: Laidlaw Thomas Cushmg Rltter WCMEN'S ATHLETIC ASSOCIATION President . Vice'President Secretary . Treasurer . Graduate . Senior . . junior . Sophomore Freshman . Archery . Basketball . H ilqing . Hockey . Swimming . Tennis . Track . . Faculty Member Helen Masters Bunting, A. M. Ojicers . . . Chesterlyn Thomas . Ruth M. Lansburgh . . Maxine Cushing . Marion Woehnert Class Representatives Doris Kildale, . Carolyn Shepard, Julia Merritt, . Elizabeth Woodyatt . . Gertrude Laidlaw, Sport Managers Lucy Ritter, Marion Holley Helen Lease, Edith Mattson, Wihna Fenner, Ruth Silliman, Martha Judson, I ' n sY'. - v . .gp 9 9 I : 5 '21 Ruth Mason, winner of standing broad jump Harriet Sutton, winner of shot put DANCING ' N event of major interest in the gymnasium department's year was the presentation in the Assembly Hall on March 6th of an original interpretation of the operatic theme Das Rheingoldf' worked out entirely by Stanford dancing classes, under the supervision of Mrs. Helen Stewart Cramer. The Erst act, with the flowing movements of the Waves as a background for the lovely dance of the three Rhine daughters, was very well worked out. The spectacular storm dance and grouping of the rainbow bridge in the last act was the sort of thing that leaves a lasting impression. All of the cast performed well, Adele Cist as Alberich being especially good. Other prominent members of the cast were Virginia Huntington, Jeanne Kurtz, and Helen Ward as the three Rhine daughters, Maxine Cushing and Betty Shively as the Giants, Dorothy Kimberlin as Loge, and Elizabeth Anne Lynch as Donner. WOMEN'S ATHLETIC ASSOCIATICN URING the past year the Women's Athletic Association Board, which is the oflicial instrument of the women's gymnasium department, has taken a number of steps toward the improvement of wornen's athletics. At a conference of the W. A. A. boards of Stanford, California, and Mills held to dis' cuss plans for the next Triangular Sport's Day, which will take place next fall, the matter of interclass'intercollegiate competition on sport's days was taken up. The system used at present is for women of the same class from all three colleges to play on the same team against a similar combination team of another class. The proposed change is to have conf tests between teams of the same class coming from the different universities. Later the Stanford board definitely went on record as favoring such a policy. A new gymnasium uniform was chosen for adoption next fall after a vote of preference had been taken in the gym classes. The new suits are to be made of much lighter weight material than those which have been in use, and of a lighter color. They are designed to be usable outside the classes for horseback riding, hiking, or camping. Possibly the most important thing the Board has done during the year has been to hold a conference with Comptroller Roth about plans and suggestions for building a new women's gymnasium. An appointment was also made for a joint meeting of W. A. A. and the Board of Athletic Control to consider financing the gym with funds handled by the Board. The present building was erected as temporary quarters for the women's gymnasium department when the University first opened. It is a frame building of a size entirely inadef quate for the number of women now using it, and the equipment is sadly insufficient for present needs. I ,f 1 l Marion Holley, winner of running broad jump Dorothy Fordyce, winner of loofyard clash TRACK FTER a season of daily practice, with timing and tryouts in the different events, and a series of interclass meets, the 1927 track season culminated with the interclass track meet on Field Day, May 26th. The outcome was hercely contested between the two lower classes, but the Freshmen finally won the day. Until the events of the high jump and the relay, the Sophomores were ahead with a score of 30 to 28. Then Marion Holley, star member of '30's team, came through with a first in the high jump, while her teammate, Woodyatt, placed second, making the score 36 to 31. By taking the five points in the relay, the Freshmen avoided the possibility of a tie and maintained their first place position with the final score in their favor 41 to 31. Both of the Stanford records broken in the meet were shattered by Marion Holley, ' 30, in the running broad jump and the high jump. Her distance for the former was IS feet, 5 inches, breaking the previous record set by Ruth Lansburgh the year before by four inches. In later trys for distance she leaped 16 feet, 3 inches. In the high jump she broke the record set two years before by Marie Manchee, going over at 4 feet, 5M inches. Holley is now training for the Olympic games in these events. The finals in all the events are as follows: 503151'rcl dash-Won by Holley, '30, Fordyce, '28, Cole, '30, third. Time, 6.8 Ctied recor . Ioofyard dash-Won by Fordyce, '28, Cole, '30, second, Clarke, '30, third. Time, 12.8. 60fya'rcl hurdles-Won by Joyce Lyon, HZQQ Lucile Lyon, '28, and Watson, '28, tied for second. Time, 12.5. Sgfyarcl hurdles-Won by J. Lyon, '29QL21I'1Sbl1I'gl'1, '29, second, Sutton, '30, third. Time, 12.5 fnew recordj. Basketball throw-Won by Watson, '28, Demond, '28, second, Poole, '30, third. Dis' tance, 68 feet, 3 inches. Baseball throw-Won by Watson, '28, Matfxeld, '30, second, Demond, '28, third. Dis' tance, 174 feet, 5 M inches fnew recordj. Shot put-Won by Sutton, '30, Dorn, QZQ, second, Mason, '29, third. Distance, 26 feet, 7 inches. Hopfstepfjump-Won by Sutton, '30, L. Lyon, '28, second, Shepard, '28, third. Standing broad jump-Won by Mason, '29, Woodyatt, '30, second, Lyon, '28, third. Running broad jump-Won by Holley, '30, Lansburgh, '2Q, second, Fordyce, '28, third. Distance, 16 feet, 3 inches fnew recordj. High jump-Won by Holley, '30, Woodyatt, '30, second, J. Lyon, ,2Q, third. Height, 4 feet, 45 inches Cnew recordj. Relay-Won by Class of '30. Time, 38.6. J . ... . K . 1 i .' - TENNIS HE finals of the tennis tournament for 1927 were played off on Field Day by Ruth Thatcher, '3o, and Francis Watson, '28. Both girls played hard, accurate games, but Watson was handicapped by having competed in the track meet before the tennis match. However, she placed her shots well, and the match was not at all one' sided. The results of the three sets were 4 to 6, 6 to 3, 6 to 2. In the 1928 tournament a slightly different system is going to be followed. Instead of having an elimination conf test, with the winners in the Sophomore and Freshman classes, and the winners in the Senior and junior classes competing for places in the one match on Field Day, there will be a preliminary set of tournaments to determine the four class winners. These will each play the other three, the last of the series being played off on Field Day. The four class winners will then be rated according to their matches won or lost, and their classes will get tennis LUCY Riffff points on this basis. An apparent increase in the interest in tennis has brought to the top this season not two or three, but seven or eight topfnotch players who are expected to compete warmly ARCHERY N the women's gymnasium department, archery is one of the more minor sports. The competitive meet takes place during the spring quarter as do the swimming, tennis, and track meets. As in the other sports, each year after the meet an allfstar team is chosen. The allfstar archery team consists of the two players who turned in the highest scores, and the winner of the meet is awarded a silver archery cup. For the second successive year Margaret Melf gaard, 129, took the championship. Although she failed to better her own record set last year with a score of BOQ, she retained her championship over Lucy Ritter, l3O, by a scant two points, her final score being 269. 4--P' for the high places. Maxine Cushing, diving champion, caught in two poses ,- -- , , ' E. Q' 339-1 5'.i--.- - sg-ag -fi ' ..-f w7T '. -..- - 9 -f . ,gr-ff-'iff' Miller beats Doyle to set new record in twoflengths freefstyle FIELD DAY PRING quarter is the gala season on women's athletics. At the end of May, after weeks of careful training and almost daily workouts on the track, in the pool, on the tennis court, and in the archery field comes Field Day, which is the culmination of the whole season, with finals in all events. Although every girl enrolled in the gymnasium departf ment is eligible for competition, those planning to try for the teams have usually taken special competitive classes where they are taught the fine points of meet performance. On tlge final day the carefully selected class teams in each event meet to decide the champion' s ip. Honors in Women's Field Day on May 26, 1927, were carried 0E by the Freshmen, Class of 1930, by a comparative score of 16f14 against their close opponents, the Sophof mores. The Class of 1930 took first in track and tennis, and second in swimming and archery. The Sophomores won swimming, took second in track, placed first, third and fourth in archery, and were third and fourth in tennis. Five records fell in track and two in swimming. SWIMMING HE Sophomores took first place in the swimming meet with a total of 45 points. Second went to the Freshmen with 35, while the Juniors had 8, and the Seniors 3. Individual high point winner of the meet was Maxine Cushing, who took a first in the one length free style, second in the 75fyard free style, and quite conclusively carried off the honors in diving. The main events held in the swimming contest were the 25f, 5of, and 75fyard free style races, the 25fyard backstroke, and the 25fyard breaststroke, the class team relay, and the awarding of points for distance. Two records fell during the meet, both broken by Sally lvliller, '29. She lowered the twoflength free style set by Katherine Doyle this spring by 8'IO seconds, and cut 8'IO seconds off her own record, set the preceding week, in the 75fyard free style. She also placed third in the backstroke event. After the swimming meet on Field Day of each spring W. A. A. makes the award of its perpetual trophy, the Swimming Cup, to the girl who has won the largest number of points during all the season's meets. This time the score stood a tie between Maxine Cushing, '30, and Katherine Doyle, QZQ. Each girl had a total of I3 points to her credit. At the banquet that night the cup was awarded to these two winners to be held jointly until the 1928 season meet. After the barbecue, awards were made as follows: Block S sweaters to Watson, '28, and Arnoldson, 127. Minor S awards given to Wilma Fenner, '27, Evalyn Brown, '28, Ema Demond, '28, Fay Hamilton, '28, I-Ielen Huneke, '28, Barbara Frick, '29, Ruth Mason, '29, Lorraine Reeder, '29, Chesterlyn Thomas, ,2Q. r FW A M TT ,iv ..-,. 2 '- F .fi- 2 1 1 , ' -,.'l','.'-'-i . - -- .- w.g 1 ll F -,.:.,'-4' BASKETBALL L- HROUGHOUT the period of basketball competition last fall it was evident A . that the class championship lay between - 45 'T' ' the Sophomores and the Juniors. By the end of the season the Sophomores had ref peated their triumph of the year before and had come out victorious with a clean record of three games won and none lost. Cn March 7th the Sophomores won from the Juniors by the narrow margin of two points, 7f5. That the game was very close is obvious from the unusually low scores turned in by both teams. Holley, star '3o forward, was so closely guarded by Patton that she broke into the score only Freshmen vs. Sophomores once for two points. Sobey gained the tal' lies for the Sophomores. Cushing, '3o, played a good game at guard, allowing White very few tries at the hoop. The next game of interest was that between the Seniors and Sophomores on March 1 3th. In this game Holley broke into action and no Senior guard could stop her from sinking 23 points. Cushing did good work at keeping the ball from her Senior forwards so that the final score was 31f32 in favor of the Sophomores. March 15th saw the unexpected humbling of the juniors by the Seniors in a closely contested game. The score at the half was 11f8 in favor of the Juniors, but although the Junior forwards played their best they could not equal the scoring combination of Fordyce and Brown. The final score was 16f1 3. AllfStar selections were made as follows: Carolyn Shepard, '28, Lydia Bowen, 129, Matie McLaren, '29, Thelma Patton, '29, Marion Holley '3o, Ruth Roseberry, '31. Sub' stitutes chosen were Juanita White, '29, Maxine Cushing, '3o, and Marian Leachman, '3o. 3 PLAY DAY ITH the Sophomore women winners of the Triangular Sports Day with a total of I5 points to the juniors' tally of I2 points, the annual play day in which class teams from Mills, California, and Stanford participated, terminated Saturday afternoon, ac' knowledged by coaches and players as the most successful of recent play days of the Triangular Conference. More than 2oo women visited the campus for the event, r2o women coming from the University of California. A new program for athletic competition was arranged by the Stanford Sports Day Comf mittee, whereby each college sent class teams to play with groups from the other colleges, the entire competition being conducted on an interclass rather than an intercollegiate basis. Teams from the four . classes competed in swim' ming, archery, tennis, and basketball, and .points were V awarded on a 5f3f2f1 basis for first, second, third and fourth places, respectively. Besides these contests there was a tumbling exhif bition by the California women and a dance comf position, Atlanta, by a group of girls from the Stanf ford advanced dancing class. Soruomomz CHAMPIONSHIP TEAM-Back Row: Cushing, Siegfried, Holley, Woelill-ce, Eells, Clarke. Front Row: Fleming, Sobey, Leachman, Lrg N ..- K . , r YV, ACN, , 5.19, V. ,. K xp y Y W - f- 'v LAi,l1 ' 'fn AA f 1 U' ,l-if -911 t 7 W l AllfSta'r hockey team poses for its picture HOCKEY EALOUS competition between the interclass hockey teams resulted in the final triumph of the Junior squad and the securing to them of the championship for the 19274928 season. Throughout the autumn, under the captaincy of Thelma Patton, the Junior team played stellar hockey, and when the selection of the AllfStar team was made by the staff of coaches, Miss Helen Masters Bunting, Georgina Burk and Miss Marguerite McGowen, it contributed five of the members, three in regular positions and two as substitutes. In the first regular game of the season on November 21, the juniors romped home over the Freshmen with a score of ro to o. The whole forward line played a fast tricky game in this contest, and Patton shot six of the goals with praiseworthy skill and precision. McLaren in right wing and Wright in the left were two of the stellar players, although the great strength of the team lay in the fact that it depended for victory not upon two or three individuals, but upon the entire machine. On December rst, the inexperienced Freshman team met the Seniors, who were at this time the Juniorsl only rivals for the championship. The Sophomore team, which showed promise of a good season, had been disqualified for competition because of widefspread violation of W. A. A. training regulations. Again the score stood in favor of the older team, but this time the Freshmen scored, I to ro. Shepard, Senior Captain and center forward, distinguished herself by her heady leadership and by scoring nine of the ten goals. Lyon, '28, also played a good game at right half. Clawson in left wing for the Freshmen made several fast runs the full length of the field, only to lose the ball through lack of support. Fighting gamely against a stronger team, and weakened conf siderably by the loss of Fenwick, dependable center half, the Senior team lost to the Juniors in the championship game on December Sth. The outcome was not evident at the start, but the successive scoring of Patton and Mason in the second half put the Juniors on the long end of the score and won them theday. Good defense work on the part of Reeder at goal, and of the entire junior backiield kept the senior score low. AllfStar selections were as follows: Lucile Lyon, Lida Rittler, and' Carolyn Shepard, ,ZSQ Lydia Bowen, Matie McLaren, Thelma Patton, Lorraine Reeder, and Editha Wright, 329, Ruth Clawson, '3 1. Substitutes: Barbara Frick and Chesterlyn Thomas, Helen Masters Bunting 529, Hlld Ruth ROSCl3C1'I'Y, ,31- 'TTTT' r..,'A.f- -'-- - --- it-if - 'y L- , I -. , ..'-- J - ,-UL 4 SPQRT S :Ia-if ..s!1'ma5.1'i? w 4 ,. SCABBARD AND BLADE NATIONAL HONORARY MILITARY FRATERNITY Founded at University of Wisconsin, 1905 Company F , Fifth Regiment, Established December, IQ23 Honorary Members Captain Frank J. Atwood x Colonel E. R. Warner McCal:e Major Welton J. Crook Ernest Whitney Martin, Ph. D. Arthur B. Domonoske, M. S. Lieutenant Victor J. Minner Lieutenant B. M. Green, O. R. C. Captain Moses W. Pettigrew, U. S. A. Lieutenant Colonel T. J. Hoover, O. R. C. Captain F. G. Tickell, O. R. C. Major John Keliher, U. S. A. Lieutenant Charles S. Whitmore, U. S. A Kenneth N. Chantry Kenneth A. Brown William A. Bassett, Jr. Clarence L. Bever George A. Connolly, Jr. David M. Ehrsam Edwin A. Gardner Thomas M. Goodloe, J Alan D. Herrington J. Hilty Abramson James E. Frank Paul Herbold , Colonel C. B. Wing, O. R. C. University Members Class of 1926 Class of 1927 Orvin P. Fry Douglas C. Hausch Class of 1928 Arthur C. Larsen Sumner H. McAllister Ralph T. McElvenny Rhodus MacKamey Seth L. McKenna Ralph W. Mossman George F. Pennebaker Class of 1929 George W. McCaughn A. Hubbard Moflitt Richard N. Nason, jr. Class of 1930 Lynn Frisbee H Jack W. Hardy Malcolm C. Little, Jr. Russell G. Robinson Allen L. Ryan Joseph O. Smith Andrew E. Swickard George E. Thayer Chauncey O. Thompson Richard A. Warner David S. Painter, Jr. Edwin M. Painter Roy W. Wood Back Row: Herrington, Bever, Herbold, Wood, Hardy, Swickard, Mossman, Connolly, McCaughna, Smith. Second Row: Moffitt Painter, Bassett, Nason, Frank, Thayer, Fry, Pennebaker, McAllister, Frisbee. Front Row: Warner, Ryan, Abramson, Ehrsam, Thomp- son Lieutenant Colonel McCabe, Lieutenant Whitmore, McKenna, Gardner. j l l. ll.Ai'. XA L j l I Summer camp 'rookies go over the top artillery course devotes one afternoon per week to such subjects as advanced horsemanf ship, training young horses, reconnaissance, simulated firing on the smoke bomb range, and actual command and leadership as a cadet ofhcer or nonfcommissioned oflicer. His theoretical work is principally in advanced gunnery, artillery tactics, military history, and military law. The student who elects the advanced ordnance course devotes two hours per week to such theoretical subjects as materiel, ammunition and explosives, ordnance administration, and 'financial procedure. , In addition to the advanced work done at the University, the student is expected to attend one six weeks summer camp, following either his junior or senior year. The field artillery camps are usually held at the Presidio of Monterey in the heart of the old Spanish district on Monterey Bay. At this camp instruction is given in those subjects not covered at the University, principally service Bring with shell and shrapnel, mounted marches, and the care and maintenance of equipment and animals in the Held under campaign conditions. At the conclusion of the course the student receives his commission as second lieutenant in the field artillery or ordnance reserves, and is eligible for further training by corresponf dence courses. All the work is without expense of any kind to the student. The ordnance camps are held at Fort Lewis and Fort Casey in Washington. Four weeks are spent at Fort Lewis in the proof firing of small arms and medium caliber artillery materiel, in shop and maintenance work, operation of tanks and tractors, and rifle and pistol marksmanship. The remaining two weeks are spent at Fort Casey, in proof firing sea coast materiel, including the gfinch antifairf craft gun, the gfinch rapid fire gun, the 155 millif meter G. P. F., the Iofinch disappearing gun, and the Izfinch mortar. In the annual Military Ball, sponsored by the military cadet officer fraternity Scabbard and Blade, ' the military department contributes its part toward the social life of the campus. ' The final event of the year is the annual horse show, held at the end of the spring quarter. Alf ways well attended, this program provides enter' tainment in flat racing, Roman and Cossack riding, jumping, horsemanship, and mounted archery. Coast defense gun firing McCabe, Atwood, Pettigrew, Whitmore THE R. C. T. C. ILITARY training was given at Stanford in the early nineties, but it was not until 1916 that a permanent Reserve Ofhcers Training Corps unit was established. An infantry battalion of nearly four hundred men was organized at that time, and many of its members did honor to their country and their university during the World War. About a year after the signing of the armistice a field artillery unit was formed. It soon became evident that the artillery, because of its more interesting training and mounted inf struction, was preferred by the majority of the students. As a result the infantry unit was withdrawn in January, 1921. In October, 1925, an ordnance unit was added, in order that students in certain of the engineering courses might receive training along lines more closely related to their technical work. This unit has been expanded since that time, and is now the most important branch of the Military department. It possesses a great deal of modern and valuable instruction equipment and maintains a large stable of horses. The instruction is carried on under the direct supervision of ofhcers of the regular army. The instructing staff for the present year has included Lieutenant Colonel E. R. Warner McCabe, in command, Major john Keliher, Cape tain M. W. Pettigrew, and First Lieutenant C. S. Whitmore, all of the field artillery, and Captain FJ. Atwood of the ordnance department. The training is divided into basic and advanced courses, each of two yearsvduration. The basic instruction, which is the same for both field artilf lery and ordnance, is conducted with a battery of horsefdrawn French 75 millimeter field pieces. Durmg the two years of the course, which may be taken in place of the physical education ref quirements, the instruction is mainly practical, and covers a variety of interesting subjects, not' ably horsemanship, pistol practice, duties of the artillery gunner, and mounted battery drill. In addition, theoretical courses in elementary gunf nery and in horse and stable management are off fered. Upon the completion of the basic course the Department acquires antifaircraft gun student who elects to enroll in the 3.ClVaI1CeCl field O' ff' p c Malo1iey's soccer varsity in action Dave Fall executes a fullftwist Stanford tennis players are also among the Cardinal athletes who have achieved national distinction. Chief among these is johnny Doeg, a freshman, who is considered one of the most promising younger players in the country and is a serious contender for a place on the Davis Cup Team. Captain Alan Herrington and Ralph McElvenny, both ranking national players, have for the past two years been prominent contenders for the national intercollegiate title and promise to do much better this year according to the form which they have shown. In the freshman class along with Desjardins and Doeg came Fidel La Barba, retired world's flyweight champion. La Barba acted as assistant coach to the boxing team during the past year. 1 Besides those men who have received national distinction, there are many others who are known up and down the Pacific Coast. The jovial and everfbusy Harry Maloney heads this list with his boxing teams, his soccer teams and his rugby teams. At the last Olympiad he was the coach of the United States Rugby Team, recruited on the Pacino Coast largely from Stanford, however, the sport was not continued this year. Although they did not capture any titles, Stanford boxers, by securing three second places in the Pacific Coast Championship Tournament, took second place to Washington in the team championships Captain Fain, Hromadka, and Dillon are the three Cardi nals who were runnersfup in their respective divisions. In golf the Stanfordites surpassed all of their previous records, when, besides defeating California, Captain Eddie Meyberg and Leo Devlin won the Pacific Coast Conference Championship. In tournaments throughout the year, Meyberg and Larry Staley, who was ineligible for varsity competition, played consistently good golf and showed that they could give most of the star golfers of the coast at least a good match. There is a possibility that Meyberg will go east to play in the National Intercollegiates. So this spring and summer promise great additions to the prominence of Stanford's name. A successful track and field outfit at the I. C. A. A. A. A. will send high school stars from all parts of the country to the fold of I ,A Dink Templeton. The same is true of Coach Ernie W' f ':: - Brandsten's swimming crew, and another gridiron outfit . - . of national standing, such as looms for next autumn, will WPCF-'fn DCSJY1fdff1S start a great athletic year in 192829. ,.ii?v -- I . . V -- . 4- 4 .,, PQU . ' '- ' .Q r 'Rf' 7 ' -P V 1553 gi - - I' -it' i.'3f':flf7?-. 1 . W '- 4 - . ' - ' . J ' H ' 1 ' ' . .. '1:'-' .1 V, ,' - f -H' '- 9' ff -' ,,1,..,. ' ' V 13' -. -sa ss 5 - . . '- -as i ' ' 1-,V I , .N-' --. ,rg A - :ja r V., . ,L f jfrngpas- .,'., A F ..,rn , QJQP 1 , 172. 5-rvsvf-. X iv . ..j l. ii. -l.-gg Q-: 'Jfg g33,t!f.,?p: g 1.5-af .v .au 1, ,Y ' M JJ V :Fl-All-silis- T ',a1L'luz,,a5f'. 'if-'--'-if , .'..'.,:.s.-Wi'-?5.a.sq '-: 3,-c,,,,. ..-. - 1 .- A' - I -. ,,' 24' -'-- -1 . QJ f-,',-r.-bg? .,. E.,g.g',qtf,1i l!E-'-,, 's:4i 7i?t-Qi1:.: 9 i.' s J , ' ' .. - ,V 'I' -,, - - -' 'r -ab-Q-.Q -.- 4 -- -' W , '- wa -. ,. 5-1 .. , ' N- - .... lll5 Y'f' a SL-'TI ' - .Q--3? l2.a. 555'-?i'3Li ' '1 Q-fs '1f 'lQ- 'lf' f.?:-1-. ' .X 11 '--I-If f -- -fa - . A . -4-2. ..2sQ,,4a ' df' ':'g.:LaEQ2j,--ff:1s,1:i.fw 's 57 . , sqm 5 as -fg..2,. 34- 4.57, N' r . K.. fi. - ,fmt fgfi -..Yl+1 - -,vi - a.LL1:EEE - .iv ljir-.3 ,.,,V: .. .iff Z i 6312. ' 5 'J 1 11, L '. -3' . . .Q .Y . w .1- Y - - Qugiteifi Ernst B'ra'ndsten's water polo team swamps California ATHLETICS RESUME URING the past year Stanford athletes have taken a place of constantly increasing prominence in the athletic history of the country. Besides the football team which, since the arrival of Pop Warner, has been an annual contender for first place in the national ranking and this year climaxed its season by defeating Pittsburgh, one of the strongest elevens in the country, 7f6, several other Stanford coaches have made themselves and their teams nationally known figures. The most notable of these undoubtedly are Dink Templeton and Ernie Brandsten, who this year developed the strongest teams that have ever represented Stanford. Both have been appointed to the coaching staff of the American Clympic team. The track squad, with a great aggregation of stars, is conceded to have more than an even chance of winning the I. C. A. A. A. A. meet for the second year in succession. More than that, many of the men should earn places on the team which will invade Europe this summer to compete in the Olympic Games. Among these are Captain Bud Spencer who should place well up in any quarter mile race in which he competes. Eric Krenz in the shot and discus, Rothert in the shot put, Bob King in the high jump, Dyer and Zombro in the broad jump, Ward Edmonds in the pole vault, and Nichols and West in the hurdles are also Stellar performers. Coach Ernie Brandsten's mermen have already made a r H I ' name for themselves this year in national competition. The I: ' its T t swimming team took fourth place in the national intercolf f za , 1 i. . legiates due to the efforts of Captain Vanden Akker, Har' In T at -' 1 r1son,Dr1ggs, and Bramel. The Cardinal water poloists surf 1 if 'jfs ' - ,. ju . ' passed this achievement when they won the title of Na' f ' j Y tional Intercollegiate Champions for Northwestern Uni' lg? j C' 'ji ' versity and placed third in the National A. A. U. meet. Al', F . V is Reggie Harrison was immediately made a member of the 4- Ig 5 T ' 1- - team to accompany the victorious I. A. C. team to the jj if f ' ' ' , T , . 4 Clympic Games, and Captam Cal Strong was given great ' ' l f f 'T praise for his allfaround ability. -:-s - - - L - T , X As usual, Stanford divers are among the foremost in - -1 the world, just as Brandsten is the world's leading diving . A , ' coach. Following on the heels of Clarence Pinkston and 5 S, : , W 3 .vp A , Q Al White come Dave Fall and Pete Desjardins, a fresh' - l l Llp ..,-'V man. Fall placed second in the last Olympic Games, and is 54 'Fi -- .-'1,,' once more out for the team, while Desjardins won the A . ff- fr A 7 National A. A. U. Diving Championship in April and Fidel La Bavba thereby proved himself to be the best diver in the land. , .rr ,- A up--'J'-V A v INTRAMURAL SPORTS ITH several new sports added to the intramural program, a record number of men competed for their respective living groups during the 19z7f 1928 season. The records show that 835 individuals competed during the fall events, 1,077 in the winter quarter, and over 6oo by the middle of May in the spring qllarterv Wlth Several HCUV1' Kappa Alpha Intramural basketball champions ties yet to be completed. Warner Edmonds and Bob Lewis, playing for Encina 3E, won the finals of the intraf mural golf tournament, the first event to count towards the winning of the trophy. The Encina representatives defeated Kachlein and Perkins of Phi Delta Theta 5 and 4 on the Emerald Lake course at Redwood City. El Toro's speedy harriers defeated a fast field of 49 crossfcountry runners in the second event on the intramural calendar. Carley, Bush and Crandall gave their club a total of twentyffour points. Individual honors went to Robert Loofbourow of Sequoia Hall. In one of the most exciting and hardffought matches that has been seen in local com' petition, the S. A. E.'s downed the Dekes in the final match of the handball tournament. Stevenson and Duval were the winning combination. The feature of the fall quarter intramural competition proved to be the track meet, in which eight records fell by the wayside. Taking six iirsts and collecting a few seconds and thirds in other events, Breakers won the intramural track trophy for the third consecutive year. Les Hables, freshman flash, was the high point scorer of the day, garnering victories for Encina 3W in the century, the furlong, and the quarter. Bobby Gooden, Breakers, and Aus' tin, Encina 2W, tied for second place, scoring honors with ten points each. They also lowered one record apiece. Basketball, tennis, and swimming were on the card Typical Imwamaral baseball game for winter quarter competif - tion, but play was somewhat hampered by the poliomyelitis precautions, which caused the postponement of activities for a number of days. The basketball tournament was finally won by the fast Kappa Alpha five, which defeated Sigma Nu in the last game, 18 to 15. The Alpha Delta Phi racquet wielders fought it out with the S. A. E.'s for iirst honors in tennis, and won out through the excellent playing of Frank Dunn and Ed Kengel. In the intramural aquatic meet, Sequoia earned a bare onefpoint victory over Theta Chi, and managed to retain its swimming championship, won in the 1927 contest. The Theta Chi relay team won a close race from the Alpha Delts in the recordfbreaking time of 1 :1 r flat, and Scott Webster of the Fijis smashed another record by winning the oneflap free style in 16 seconds. I .NN -.i up ,- . T. f l INTERCLASS SPCRTS EALIZING that valuable material has in the past been developed through inf terclass competition, the athletic directors urged an immediate and large turn' out for football at the be' ginning of fall quarter. By practicing twice a week, and holding scrimmages with the Goofs and Palo Alto High School, the strongest teams thus far seen in interclass football were developed during the 1927 season. ' The championship was virtually decided in the evenly matched first game of the schedule when the juniors defeated the Seniors zfo. The Class of 1929 later trounced the Sophomores and the Frosh, while the Seniors were second with only one defeat. The Hrstf year men ended the season in third position, while the Sophomores claimed the cellar championship with three straight losses. Basketball was the next sport on the interclass schedule. Frosh varsities in both first and second divisions swamped all opposition and came through the season undefeated. The Sophomores, smarting from their football humiliation, were only able to place second, although they pressed the victorious yearlings to the last minutes of play in the game which decided the championship. The Juniors were snowed under in three straight contests. In spite of un' favorable track weather, encouraging records were turned in when the Juniors decisively won the inter' class meet with a total of 69 points. Freshmen were second with 37 points, Seniors third with 36, and Sophomores last with 23. Running in the fast time of 9 minutes 44 1f5 seconds, Henry Coe of the senior contingent surprised fans with an unexpected amount of power and speed in the twofmile. Maynor Shove, a freshman, clipped off the 44o in SI seconds flat, and Johnny Lauritzen did the roofyard dash in even time. The historical Irish Marathon, the annual activity sponsored by Quadrangle Club, was also won by the thirdfyear men, when Fred Zombro and Johnny Lauritzen saved the day by pulling the Juniors from second to first place. The Freshmen took second place. Although pressed by the Frosh to the last race, the Class of IQBO was at last able to crash through with a Hrstfplace victory in swimming. A win by Milt Burns, Freshman, in the breaststroke, in the fast time of 1 :rg flat was one of the features of the tournament, while Reggie Harrison and Austin Driggs turned in a majority of points for the second' year men in the natatorial competition. Little trouble was experienced by the Babe nine in downing teams from other classes. The Seniors kept clear their record of no firsts, but they took second in baseball. The junior championship Interclass football team Lauritzen, 129, wins century in Intevclass meet . 1 l E I I l v i l. ll i L. l .L ll 'r P l l FRESHMAN SOCCER 7 1 5 T the start of this seaf son, plans were dis' cussed by the Stanford and California Freshmen, San Mateo Junior College, and San Jose Junior College for a soccer league, from which the California team later dropped out. After two games with Pescadero High, which ended in 1,0 victories for Be BpckLf1gw:tC'gan2on Coacl?xDi Filleyj Bulgns, l:Erry,1gfIichgs, Blackgldz. versoc , es , ac son, er unior anager, font ow: iez, omoto, oore the Freshmen, the team met Avery, Reynolds CCaptainD, Churchhill, Mujica, Isaacs. San Mateo in the first conf ference start. Lack of teamwork and of an effective offense brought a 4'O defeat. Starting the game with San Jose in the same listless fashion, our men found themselves two goals behind before the game was well started. When they Hnally settled down, the plays were working perfectly and the Freshmen ended up on the long end of a 4f3 score. Overconiidence resulted in the loss of the California series, which was next on the schedf ule. The first game was won by the Bear Cubs zfr, and the second ended in a rfr tie after futile efforts to make a rally in the final period. After a zfo victory over San Jose, in which they completely outclassed their opponents, the Babes still had a chance to beat San Mateo in the last game and tie her for Erst place in the conference. However, San Mateo was too strong, and won by a 41 score, which gave the Stanford Freshmen second place in the final rating. FRESHMAN GCLF HILE there are no golfers on this year's squad who are outstanding when compared with their colleagues, Captain Homer Burnaby, Bob Lewis, War' ner Edmonds, Ken White, Dick Stevenson, and War' ren Johnson form the best freshman golf team that has ever represented Stanford. are able to Shoot the Back Row: Edmonds, White, Anderson, Allen, Stevenson. Front Row: Freeman, seventies fairly consistent' ly, which is good golf for any college squad. After making good showings in the Fall Quarter Intramural Tournament, several of the members sprang into prominence in the California Intercollegiate Tournament at Del Monte. Ken White and Warner Edmonds turned in the best performances there. The only outside competition which the Freshmen had as a team was with the Califorf nia Freshmen, who were snowed under by a score of 24M to 25. Only the first two men on the California squad could give the Cardinals any competition. The remainder of the matches were easy for the Stanford men. The results were as follows: Singles-Captain Burnaby CSD 3, Lindner CCD og Lewis CSD Q., Potter CCD rg Stevenson CSD 3, McCarthy CCD og Johnson CSD 3, Wilde CCD og Edmonds CSD 3, Miller CCD og White CSD 3, Mulks CCD o. Doubles: Burnaby and Lewis CSD 1 M, Lindner and Potter CCD IM, Stevenson and Johnson CSD 3, McCarthy and Wilde CCD og Edmonds and White CSD 3, Miller and Mulks CCD o. Lewis, Johnson, Sutphen, Brink, Burnaby. S S FRESHMAN SWIMMING ONTINUING their string of victories over Calif fornia and demonstrating their ability throughout the whole season, the freshman swimmers give promise of developing into excellent varsity material by next year. The outstanding man on the team was Captain Back Row: Brandsten CCoachD, Tanzer, Hunt, Dake, Scott, Lucy, Thomas, Smith P6116 Desjardins Wl'1O Hgalll CManagerD. Second Row: Burns, Smith, Brown, Morrow, Roberts. F-rom Row: T. Smith, Won the National Diving Championship. Like the varsity, the freshmen mermen had little difiiculty in winning from the California Cubs by a score of 56 to 12. Milton Burns made quite a name for himself by swimming the roof yard breastfstroke in 1 :rg 115 seconds, this not only broke the existing freshman record but bettered the best varsity time by a fifth of a second. Captain Pete Desjardms was the high point man of the meet. Moffatt, Smith, and Thomas also showed excellent possibilities of winning places on the varsity next year by winning their races in very creditable times. The results of the meet were as follows: Sooffoot relay-Won by Stanford CMoifatt, Tanzer, Scott, and ThomasD. Time, 2 :46. roofyard breastfstroke-Won by Burns CSD, Helm CCD, Roberts CSD. Time, 1:15 rfg. CNew record.D gofyard free style-Won by Moffatt CSD, Thomas CSD, Cady CCD. Time, 26 3f5. roofyard backstroke-Won by Smith CSD, Lambert CCD, Scott CSD. Time, 1213 4f5. roofyard free style-Won by Thomas CSD, Tanzer CSD, Wisler CCD. Time, 6o 4f5. Diving-Won by Desjardins CSD, Marsh CSD. 22ofyard free style-Won by Desjardins CSD, Hunt CSD, Wisler CCD. Time, 2:52. Medley relay-Won by Stanford CSmith, Burns, and MoffattD. Time, 5 :33 mfg. Hawley, Desjardins CCaptainD, March. - an--ea' FRESHMAN WATER POLO Back Row: Brandsten CCoachD, Cuthcart, Smith, Burns CCaptainD, Lucy, Scott, OLLQW-ING the example Smith CManagerD. Fvont Row: Smith, Graff, Dake, Brown, Thomas. of than Older brother? Coach Ernst Brandsten s freshman water polo team handed the California team their annual drubbing this time by the score of I2 to o. No preliminary games with other institutions were held, but frequent scrimmages with the varsity served to develop the teamwork of the Stanford Babes to a high point. Throughout the whole game California was kept on the defensive as Thomas, playing center forward for Stanford, got the ball on the sprint almost every time, and passed it back to his teammates who, by fast dribbling and accurate passing, successfully kept it out of the hands of the members of the Blue and Gold team. The freshmen scored a goal soon after the opening whistle, and with remarkable regularity after that put throw after throw past the California goal guard. b The following made up the starting combination: Moffatt and Hillman, forwards, Thomas, center forward, Burns and Smith, guards, Scott, center back, March, goal guard. 7127 51.112 .vii 'Q Back Row: Maltby, Fell, Jacobson, Gibbs, Fletcher, Fain, Vanden Akker, Strowger, Cannon. Front Row: Burns, West, Moffltt Thurlow, Ophiils, Farewellg Ross, Strong, Smith. Ernst M. Brandsten Ernst M. Brandsten President . . . VicefPresident . Secretaryffreasurer . S. Clark Cypher Phillips Gardner Brooks Humphrey Bayford Butler Norman William Fain Cyrus Farewell Herbert Holmes Robert Edward Burns Walter james Fell Allison Johnson Gibbs CIRCLE S SOCIETY HONORARY MINOR SPORTS SOCLETY ' Founded at Stanford University, 1913 Honorary Members Faculty Members Henry Wilfred Maloney Ojficers University Members Class of IQ25 Alfred Emery Rogers Class of 1926 Class of 1927 Robert Proctor Cannon David LeCount Evans Class of IQ28 David Jacobson Harry Lee Maltby Class of 1929 Albert Hubbard Moflitt Ernst Carl Ophiils Colin Hubbard Smith Henry Wilfred Maloney Alfred R. Masters . . Cyrus Farewell . . . Alexander Ross . Allan Wade Strowger Edward Anderson Smith Lawrence Salmons Fletcher Theon Wright Alexander Treloar Ross Allan Wade Strowger Kryne Vanden Akker Calvert Strong Thomas L. Thurlow Cecil West I if' .'.-' J :H f : '- A 1 V' A, VARSITY FENCING 1TH but one member of last year's fencing team still in college, pros' pects for a victorious squad were rather dark at Stan' ford. However, seventy' five men turned out for the sport and from them a team was formed that, though it lost to the University of California, had a fairly suc' Back Row: Bugge fCoachQ, Adams, Williams, Dutton, Coolidge. Front Row: Hull, Cessful Season' Although several infor' mal practice meets werefheld with the different clubs in the San Francisco Bay Division of the Amateur Fencers League of America, the team was prevented by final examinations from entering the annual Bay Division championship meet. Several of the swordsmen did enter the individual championships, however. In the dueling sword competition Assist' ant Coach Bugge placed third in the novice meet, and later won the open championship. Cn March 1oth a team composed of Captain Adams, Scotten, Taft, Hull, Dutton, and Kilgore was defeated by the California team by a score of 13'12. Despite the fact that the Cardinals scored more touches, the Bears managed to take the deciding match. Captain Adams did particularly well, making the highest score of any man in the match. During the spring vacation, Captain Adams, Dutton, and Taft went south to compete in the Minor Sports Car' nival, but were defeated by the more experienced swordsmen from the Uni' versity of California at Los Angeles. '9 QS? we . VARSITY GYM ANDICAPPED by irregu' Q iii! .ilk i Sauliere, Taft. H . if ' lar practice and lack , V- ,-,f w of sufficient material, the 2 IQ28 gym team has had a year quite unmarked by Back Row: Long fCoachj, Ridley, Gooden, Skillern, King CManagerD. Second Row: anythin g conspicuously brilliant. Under the stimu' lating efforts of Coach Royce R. Long, Assistants Peavey and Perren, and King, manager, something of a team was developed, but the coaching staff bewails the fact that few men show real interest in gymnastics. ' Captain Dietrich led his team against California on March oth. The score was a dis' astrous one for Stanford, California having little difhculty in totaling S2 points to Stan' ford's 19. On March 16th, the team was invited to Santa Cruz High School to give an exhibition. Because of their improved showing at Santa Cruz, the men anticipated redemp' tion of lost prestige when they would meet California again in the State Meet. The State Meet was held in the U. S. C. gym at Los Angeles, March goth. No official score rating was determined, but the Cardinal gymnasts were content with their having given the Bears better competition. Cn April 24th and 25th, another exhibition was given at Moun' tain View for the Kiwanis Benefit Minstrel Show. The final event of the year was an ex' hibition in Encina Gym on May 18th. Men who received the Circle AS were Ray Taylor, Ray Naff, Bob Gooden, Jack jordan, and Andrews. had l Peary, Crismon, Naff, Murphy, Phelps. First Row: Putholf, Taylor, Dietrich, Andrews. l .L -7. , ,. , -. 1 1,1 Back Row: Purkiss, Anderson, Edmonds, Meyberg, Shattuck, Combs, Cooper. Front Row: Syer, Kachlein, Devlin. VARSITY GOLF HAT the popularity of golf is rapidly increasing on the Stanford campus despite the lack Tof proper playing facilities is evidenced by the fact that eighty men entered the Fall Intramural Tournament and that thirtyfthree Stanford men journeyed to Del Monte where they made up over half the held in the California Intercollegiate Championships. Seven Cardinals qualified in the championship flight, and of these Captain Eddie Meyberg, the defending champion, and Larry Staley won their way to the semiffinals. Staley lost to Gibf son Dunlop, the eventual winner, in a very close match, while Meyberg was defeated in this round by Allen Moser only after they had played five extra holes. Warner Edmonds and Budge Carlsmith, of Stanford, won the second and third flights respectively. The interest in team play for golf was greatly stimulated during the past year by the inauguration for college golf teams of two new tournaments, the Minor Sports Carnival, in which sixfman teams from each institution engage in best ball four ball matches, and the Pacific Coast Intercollegiate Championship. In the Minor Sports Carnival, both Stanford and California scored the same number of points in their matches with U. S. C. and U. C. L. A., but in the final match between the two, the Bears won by one point. Meyberg and Devlin, playing as the Stanford first team, were the stars of the tournament, making eight and a half of the Cardinals' seventeen oints. P The Redshirts had their revenge the following week when they won their annual match with the Bears by a score of 17M to QM, The morning singles matches were all closely contested, but, led by Captain Meyberg who won three points, the Stanford men battled their way to a tie. The doubles matches of the afternoon completely upset the dope, which favored the Bears because of their recent victory. Playing wonderful golf, the Stanford conf tingent captured eight and a half of the nine possible points, and repeated their victory of last year over California. The Hrst annual Intercollegiate Championship, held at the Lakeside Country Club in San Francisco, concluded the season. After trailing the California team for thirtyfsix holes, Captain Meyberg and Leo Devlin stepped out in the last round. By playing the last nine holes in two under par, Meyberg won the championship for Stanford, and captured second low gross for himself. Each of the following was awarded a circle S for winning points against California: Captain Edwin Meyberg, Robert Syer, Ward Edmonds, I-Ierbert Fleishhacker Jr., Leo Devlin, and Eldredge Combs. -A We a'r 'tru A is W 1-L i.. ,,, ,X fl- 7-W . M .v. ,f:. .V- R, ,, ,u '1'., ll I 1 . . . I , f EI fr ir-'rrzrafr-4.1 i.','r-smgfrfi :AL .E . J 3 qi'-is . . .I ,V g . i . .rsrgrlre-,L !t:g.Yl'd.IJv 4:18-,G ,LY rs- g-,U ',- 4- ' ,,f1'Q'L..-,..'.,. ,lS...1i'in-J Back Row: LaBarba, Maloney, Hazeltine, Lalviarsna, Rachford, Kenaston, Doyle, Hollingsworth, Doerr, Dillon, Hromadka, Toberman, Gordon, Clover Clvianagerj, Schall. From: Row: Skelton, Mendenhall, Dulin, Fain fCaptainJ, Sands, Levit, Goodloe. VARSITY BOXING NTEREST in boxing has greatly increased at Stanford during the past year, principally because the University of California was placed on the schedule for the first time since 1922. In two matches with that institution, each team won a majority of the bouts once. Over fifty men turned out for the boxing team at the start of the present season, many of these were eliminated in the novice championships held in the fall, but as usual several promising boxers were discovered. By winning the first five bouts on the card the California fighters defeated the Cardinals in the first match between the two. Captain Norman Fain and Ed Dillon redeemed the Stanford contingent by beating their opponents badly, Fain winning by a knockout. In the best fight of the evening Danny Frost boxed remarkably well and should have been given the decision over Captain Ribble of California at the end of three rounds. However, the bout was called a draw, and Frost lost in the extra round. In the return match held at Stanford, the Cardinals were more fortunate and won four of the seven fights. Sano and I-Iromadka took very close decisions in the bantamweight and lightweight classes by outfighting their opponents in the last round of their respective matches. Harold Crumley and Marcus staged a great slugging match which the former won after he had Marcus almost out in the last round. Ed Dillon won the deciding fight for Stanford by beating his opponent to the punch. In the other three matches, Levit, Frost, and Fetzer found themselves up against bigger men and lost by knockouts. Seven Stanford men were entered in the Far Western Intercollegiate Boxing Tournaf ment in Los Angeles on March 3,0 and 3 I. Although they did not win any titles, Hromadf ka, Fain, and Dillon got into the finals of their divisions, winning enough to give the Car' dmals second place in the tournament. It was won by Washington when her boxers carried away five titles and secured one second place. Though no members of the Stanford team tried out for the Olympic Games, Phil Smith, who is a student here but is ineligible for intercollegiate competition, won the Northern California division of the A. A. U. and went to Boston for the National Championships. At the close of the season each of the following was awarded a Circle SN: Captain Norman Fain, Daniel Frost, Edward Dillon, John Hromadka, William Levit, Harold Crumley, John Sano, Jacob Fetzer, Homer Toberman, and Harry Birch. WWW ' ' ','l ' ,l Fi7f..i-FD fi ff' 1 ll l l I I I 4 ,ffl r Weymouth, Post, Connolly, McDougall, Thompson Cflaptainj VARSITY POLO LTHOUGH Stanford was not represented by the same strong polo team which went through the whole of last season undefeated, Captain Thompson, Weymouth, McDougall, Connolly, and Post made up a team which to date has seven of its ten starts. Games with the Ninth Corps Area and O. A. C. still remain on the schedule. In two preliminary practice games the Menlo Circus Club and the East Bay Polo Club, both very inferior teams, were defeated by onefsided scores. Following these a twofgame series was held with a team representing the Ninth Corps Area, both were extremely hardffought contests. After winning the first game 8 to 6, the Stanford men had a complete reversal of form. All semblance of teamwork disappeared, and the Army team won by a score of ro to 5. Captain Thompson and McDougall played the best polo in the first conf test, often taking the ball down the field for long runs, the two tied for high scores with three goals apiece. A game was next held with the crack team from San Mateo. Despite the nine point handicap which the Cardinals received, the wonderful shooting and riding of Arthur Perkins and Willie Tevis earned the San Mateans a I4 to 1 3 win. During the spring vacation the team took a trip to Arizona and New Mexico, while they were gone they played three games and were the victors in two of them.. The most imporf tant game of all, that with the University of Arizona, was lost by a score of 9 to 3. The lack of practice of the Stanford team was quite evident in the early part of the game and combined with the unfamiliar horses served to give Arizona a lead of 7 to 1 at half time, which was too much for the Cardinals to overcome. Following this the team triumphed over the New Mexico Military Institute in a two' game series. In the eighth chukker of the opening contest with the score standing at 6 all, Bud Post scored the winning point for Stanford when he put the ball between the posts from a difficult angle after carrying it the whole length of the field. The Stanford men were more used to the horses in the second game and had little difficulty in piling up a 9 to 5 lead on the New Mexicans. ' In two games played with a Presidio team upon their return, the Stanford men won by overwhelming scores. Too much credit can not be given to Lieutenant Whitmore for the able manner in which he has coached the team during his three years' stay at Stanford. He has been transferred, however, and next year his place will be taken by Captain Gordon. Back Row: Hodges flvianagerl, Mofhtt, Wright, Farewell CCaptainj, Stollery, Morris, Jennings, Maloiiey fCoachJ. Second Row: Hyde, Fell. Strowger, Jakunin-Malushin, Hopkins, Jacobson. Front Row: Dawson, Bishop, O'Donnell, Birch, Mayer, Gibbs. VARSITY SOCCER TARTING the season with the best material in years, the soccer varsity was expected to have a highly successful year. Eight lettermen and a number of the members of last year's freshman team were among the candidates for varsity positions when Coach Harry Maloney issued his call for practice. However, because of the limited time for practice the men were so handicapped that only the rudiments of a team could be developed. Fine defensive work on the part of Holmes and Stollery kept the Cardinal goal comparaf tively free from danger in nearly all the games, but as a rule the forwards could not co' operate well enough to score the winning tallies. The Hrst three games, against comparatively weak teams, resulted in victories for the Redshirts. The Teutonians of San Francisco handed the Stanford men their Hrst defeat of the season with a o to 1 score at the end of a bitterly contested game. In the final pref liminary game, the Redshirts exhibited a highly developed offense when they defeated the San Francisco Theological Semif gnary yo. The first game with California resulted in a 3 to o victory for the decidedly superior Blue and Gold team. Poor passing and the inability of the defense to sustain the California assaults allowed the Bears to get the ball into the net three times. ' Concentrated practice on dribbling and passing caused an im' proved varsity to oppose California in the final game. The Cardif nals rushed the Blue and Gold back time and again, but their inaccurate shooting prevented them from scoring. At the close of the season Allison Gibbs was elected captain of next year's varsity, and Buster Holmes, for his excellent work at fullback, was awarded the gold medal given each year to the most valuable man on the squad. Each of the following was award' ed a Circle SM: Captain Cyrus Farewell, Nicholas Jakuninf Malushin, William Silva, Edward O'Donnell, Walter Fell, Hub' bard Moiiitt, Herbert Holmes, David Stollery, Edwin Robinson, Herbert Mayer, Allison Gibbs, Theon Wright, Wade Strowger, Coach Hay-ry Maloney David Jacobson, and Harold Hyde. J fiE'awrJrfm:i.l ' I 1 '. i . 11.1 , V E-F Back Row: Brandsten CCoachD, Harrison, Thornton, Strong CCaptainj, Driggs, Parker, D. H. Smith CManagerD. Front Row: E. VARSITY WATER POLO HE successful season of Coach Ernst Brandsten's swimming squad was not only equalled but surpassed by the Stanford water polo team which, after decisively defeat' ing all of the college teams on the Pacific Coast, went east and captured the national inter' collegiate water polo championship from Northwestern University and then took third place in the National A. A. U. Championship. After holding the Bears scoreless for the second year in a row, the team travelled to Los Angeles and there showed remarkable superiority in turning back U. S. C. and U. C. L. A. on the short end of 6 to 9. and II to o scores. The game against California was very onefsided as the'Bears were completely baffled by the passing of the three forwards, Vanden Akker, Burns, and Harrison. These men kept the ball in California territory the whole game, and the losers seldom got their hands on the ball except to throw it back to center after Stanford had scored another point. So well did the forwards work together that the Blue and Gold seldom threatened the Redshirts' goal. Reggie Harrison was high point man with four goals to his credit. Burns and Vanden Akker scored three and two points respectively, while Captain Cal Strong scored once. The final score of ro to o just about indicated the difference between the two teams. Coach Ernie Brandsten took this same team, which was composed of Vanden Akker and Burns, forwards, Harrison, center forward, Captain Cal Strong and Driggs, guards, Maltby, center back, and Thornton, goal guard, on the trip East. The first game played with Northwestern was for the intercollegiate championship and ended with Stanford ahead I2 to 9. This game was one of the hardest that the Cardinals engaged ing after being behind 5 to 3 at half time, the Stanford men staged a big comeback, and in the last minute of play a goal by Harrison tied the score at 7 all. Two extra iivefminute periods were necessary, but finally the Northwestern men tired and the Cardinals slipped the three winning tallies into the net. In the first round of the A. A. U. Championships, the Redshirts struck a tartar in the Olympic Club. After trailing throughout the whole game, the clubmen spurted, and in the last thirty seconds of play scored the winning goal. In a game to decide third place the Cardinals, by taking advantage of the breaks, completely outclassed the team from the University of Illinois and beat them 8 to 4. Each man on the team was awarded a Block HS for winning the national intercollegiate title. Further recognition was given to Reggie Harrison who was chosen as a substitute for the I. A. C. team which will represent the United States in the Olympic games. Smith, Vanden Akker, Cole, Maltby. i Back Row: Brandsten CC0achj, Pascoe, Bramel, Harrison, Ophuls, Pahl, Littleiield, Cunclall, Laubersheimer, Pryor, Conradi, D. Smith QManagerj. From Row: E. Smith CAssistant Coachj, Kinkead, Throndson, Danford, Mills, Vanden Akker, West, Driggs. VARSITY SWIMMING ROVING beyond a doubt that they had not only the outstanding college swimming team on the Pacific Coast but one of the best in the country, the Stanford mermen concluded another most successful season. Besides defeating California and U. C. L. A. decisively in dual meets, Coach Ernst Brandsten took a five man team on an eastern invasion and secured a tie for fourth place for the Cardinals in the National Intercollegiate Cham ionship Meet. The team further added to its laurels by breaking six Pacific Coast Intercollegiate records in a meet at the San jose Y. M. C. A. pool. They suffered their only defeats at the hands of the Hollywood and Indianapolis Athletic Clubs. The Hollywood men avenged their defeat of last year with a score of 33 t0 22. In the National Intercollegiate Individual Championship, Stanford qualified five men for the finals. Captain Vanden Akker and Harrison secured places in the Bnals of the 50fyard event, and Harrison also placed in the roofyard free style. Driggs gave the Cardinals their other two places by qualifying in the 220' and 440fyard free style swims. In the iinals on the following day only Harrison and Driggs were able to take any pointsg they took thirds in the 100 and 440 respectively, both breaking the existing meet records. The 20ofyard relay team corn' posed of Vanden Akker, Harrison, Driggs, and Bramel captured second place and gave the Redshirts enough points to tie with Brigham Young University for fourth place in the team totals. The varsity duplicated its feat of last year when it defeated California by the score of 58 to II, smashing three Coast Conf ference records and allowing the Bears only one second place. Ogden Briggs was the outstanding man of the evening, breaking two of the records. After swimming the roofyard backstroke in 1 :08 to beat the existing mark by four seconds, he came back in 5 the 220fyard free style to establish a new record of 2 :26 445. Reggie Harrison walked away with the other new mark when he swam the 50fyard free style in 24 3f5 seconds. Hadley Bramel showed that he was a real iron man when, besides winning the Ioofyard free style in the very creditable time of 57 1f5 seconds, he took second in the 220 and swam a lap on the winning relay Coach Emst Bnmdsten team, if .f . Y -- -.- -am v. .-L l- . . .-. aff-,,., -,, , --P' , - - f- - f- - - wfvga- -wx.. 1 - '- Q A,.f+,, -i',f,.' .V ,, . ., . pri, .1 -f- :w- fs-w , M. ,t , ig' - ,-Ni . vi ,--.1-'r-5 1 fiil . .Lb I ,sz .1.. I7 If r-,:'.Q-,ii-T911 , ., he 5 , 4 ,MV A A . ,g,1,.,g--w fl vi f.,.,.I im.Lg....- . 4 . C., ', ,J ,,-4' lr . . Y: 1' ,fi -U----.. . '- n. -4--. Ll'-. Bugge, Maloney, Schall, Davis, Brandsten, Sprague. resumption of the California matches, second, the visit of Gene Tunney to the campus last year, and his talk to the student body, third, the presence of Fidel La Barba on the campus. La Barba has shown that boxing can be made only a means to an end, like any other profession. Fencing as a sport is appealing more and more to the man who has not the robust strength needed for football, but who desires to take part in an activity that will give him poise, clever footwork, and quickness of eye. The season as a whole was fairly successful, although the California match was lost. Several practice meets were held with different clubs in the San Francisco Bay Division of the Amateur Fencers League of America, but the team was prevented by Hnal examinations from entering the annual Bay Division championship. A record number of seventyfflve men turned out for the sport, and from this number the team was chosen that went south during spring vacation to compete in the Minor Sports Carnival. W Due to the postfseason football game with Pittsburgh University, the plans to send a Rugby team to British Columbia this winter to compete with the University of British Columbia were not carried out. At the meeting of the American Olympic Association, Harry Maloney was appointed as a committee of one to pick the American rugby team for the Olympic Games at Amsterdam this summer. A team composed of Stanford players was to have represented America, as this University occupies the unique position among the colleges in the country of being the strongest rugby center in the United States. At the last moment, however, the International Olympic Committee decided that rugby will not be played at the next Olympiad. The fact that American teams won this sport in 1920 and 1924 might have had something to do with this decision. Under Coach Ernst Brandsten, the strongest swimming and water polo teams ever to represent Stanford were developed. The swimming team took fourth place this year in the national intercollegiates, and the Cardinal water polo team surpassed this achievement when it won the title of National Intercollegiate Champions from Northwestern Univerf sity, and placed third in the National A. A. U. meet. Brandsten was appointed to the coaching staff of the American Olympic team. Because of a late start, the soccer season was not so successful as some that Stanford teams have seen, but Harry Maloney's squad developed rapidly after changes in the physical education department made it necessary that a large number of men attain a certain standard of physical efliciency before going in for soccer. After once getting started, however, an unusually large number of good players were developed, and the prospects for next season are the brightest in the history of the sport at Stanford. -1- J. lg 'AL.., Vi YK qu, - The Encina gymnasium MINOR SPORTS By Martin Weil INOR sports are an integral part of the athletic program of Stanford University, I and under the supervision of Harry Maloney, the department has increased immeasurably in the amount of good it is able to do for those students who are not outstanding athletes in some major sport. Although the cream of the participants on the gridiron, track, diamond, and tennis courts are awarded a wide amount of publicity, they form only a small percentage of the number of men who take advantage of the opporf tunities of Stanford's athletic plant, which is one of the hnest and most complete in the United States. Assisting Coach Maloney as boxing coach this year was Myron Schall, former captain of the Stanford boxing team. Schall has been retained as a fullftime assistant coach in this sport, and was one of the main contributors to the Cardinals' ring success during the 19Q.7f 1928 season. To complete the minor sports staff, Elwin Bugge was secured as fencing inf structor during the last year. Like Myron Schall, Bugge is a Stanford graduate. Remaining from the previous staff were Ernst M. Brandsten, nationally known swim' ming and diving coach, Charles W. Davis, director of intramural athletics, Charles M. Sprague, and Royce R. Long, gym coach. Minor sports were again capably directed by Harry Maloney, under whose supervision each department has been able to do more for the students than in any other year, which is shown by the increased number of particif pants, and the teams' results against outside competition. More interest and greater crowds at the matches marked the boxing season of the past year. Renewal of matches with the University of California was the one move necessary to place the ring sport before the student body as a first class minor sport. The Golden Bears were met for the first time since 1922, not in one match, but in homefandfhome engagements. The Harmon Gymnasium at Berkeley was packed to the rafters on the night of the CaliforniafStanford matches, and in the return match on this campus, 3,500 spectaf tors saw the Cardinals even the year's score with the Bears. The hnals of the university boxing tournament aroused campusfwide enthusiasm, and I,SOO fight fans were in the pavilion to watch the fighters compete for the gold medals awarded by Gene Tunney to the winners in each division. In the absence of Tunney, the medals were given by Harry Smith, Sports Editor of the Chronicle. During spring vacation, Harry Maloney led a squad of fighters to Los Angeles to compete in the Far Western College Boxing Tournament. The phenomenal rise of interest in this sport can be attributed to three thingsg first, the 'ff - - 11 W , i 1 1 1 V . - Y , , , , 1 , 1 1 4 W 1 1 1 1 1 t1 1 5 1 1 ' N 1. I 1. I 1 1 1 L1 . 1 L 1 x 1 FRESHMAN TENNIS 1NUs the mighty play of John Doeg, freshman Davis Cup star, the first year tennis team ended the season with one defeat, but that at the hands of the University of California cub net men. just preceding the end of the winter quarter, Doeg, who had been the main strength of the freshman team, was called by the American Na' tional Tennis Association to compete in the Davis Cup tryout competition at Augusta, Georgia. The absence of the Stanford star turned certain victory into defeat. Robert Seller, expert California racquet man, won first singles for his college in a close match with Charles Weesner, Stanford, 6f4, f5f7, 6f2. Ted Easton, Stanford, lost quickly to Lloyd Budge, Calif fornia, 6f3, 6fz. Stanford tied the score at two matches all when Trowbridge Stephens won third singles from William Olney 6f3, 6f2, and John Gantner and Robert Forbes took second doubles from Hanlon and May 7f5, 6f8, 6f1. Berkeley's two aces, Seller and Budge, cinched the meet for the Blue and Gold with a victory over Easton and Weesner in first doubles, 6f3, 6fQ.. In the preliminary competition the freshmen were invariably successful. Beginning the season auspiciously on February 18th, the freshmen whitewashed the St. Ignatius yearf lings six matches to none. In the first two singles matches Easton and Stephens trounced Gallagher and Smith respectively without the loss of a single game. Ranney and Dodd conf tributed two more matches to Stanford. Ranney beat Reynolds 6f3, 6fog Dodd thumped Brady 6f4,6f2. The doubles were as painless as the singles. Easton and Stephens took it away from Gallagher and Smith 6fo, 6f1g Dodd and Ranney bumped Brady and Reynolds 64, 6f9.. Again on February 25th, the freshmen showed their power by defeating the San Mateo Junior College, seven matches to two. The first singles between Doeg, Stanford, and Mauser, San Mateo, was sensed as a real match. Doeg used his wonderful serve with venf geance, winning the nrst set 611, and the second 6f4. Easton, Stephens, Gantner,and Forbes, other Cardinal singles players, played good matches. Easton defeated McCamley 6fz, 6fog Stevens won from Reed 6f3, 7ff5, Gantner defeated Foley 1f6, 6f4, 6f3g Forbes defeated Woodruff 6f4, 6f3. San Mateo made its two tallies when Sanders defeated Cameron 6f4, 6f1, and Foley defeated Ranney 3f6, 64, 6f2. Stanford was supreme in the doubles. Two weeks later the freshmen ran up another whitewash score against St. Ignatius High School. Doeg defeated Joe Coughlin, California state junior champion, ,6f4, 60.. Easton, Stephens, and Forbes contributed three more singles victories. In the doubles, EastonfWeesner, and GantnerfForbes won without trouble. P 7 I '- Pnuf ,fvf'i ai ' Moore fManagerD, Forbes, Stephens, Gantner, Weesner QCaptainD, Easton, H. Davis CCoachD. PRELIMINARY MATCHES LL other team matches were equally sucf cessful. A hint of the general strength of the varsity was gleaned from the opening match of the season, with St. Ignatius College on February 18th. In the three singles and two doubles matches, Stanford won every set with a total loss of but eleven games. The following Saturday, Stanford ref pulsed the attack of the powerful Occidental team in conclusive fashion. Led by Benjamin Gorchakoif, third national ranking intercolf legiate player, and seconded by Art Kussf man, Los Angeles junior star, the Tigers hoped at least to repeat their last year's tie. Alan Herrington, Cardinal leader, put confif dence into his teamfmates by defeating Corf chakoff in straight sets. Gorchakoff was mas' ter of his favorite shots, but they availed him little against the steady, hard driving of 7 . Renzel prepares to serve Herrington. The Cardinal's beautiful forehand was working perfectly. Herrington's singles performance was equalled by the play of Herrington and Ralph McElvenny in the doubles. The Occidental combination of Corchakoff and Kussman was often mentioned in the south as the strongest college doubles team of the coast, and the fitting candidate for the coast national intercollegiate honors. The Stanford pair, ranking third nationally among college teams, won the match in two sets. ' Kussman, Occidental, outlasted Wheatley 1of8, 3f6, 1614 to win second singles. Several times through the fiftyfseven game marathon, Wheatley fought off defeat, several times in the final games he worked up a substantial advantage only to see it slip away in a series of errors. McElvenny and Hall gave their college a clear majority of the matches by taking straight set victories from Robinson and Maeno, respectively. Occidental got onefhalf a point when the fifth singles between Renzel, Stanford, and Osborne, Occidental, was called a tie at the end of the second set. On March ioth, the University of California at Los Angeles came north to receive a complete shutout from the Cardinals. In the first week of April, the varsity added the scalps of the University of Southern California and Oregon to its swelling collection of trophies despoiled from the vanquished. THE SOUTHERN INVASION VER the interfquarter vacation, a fivefman team composed of Alan Herrington, Ralph McElvenny, john Wheatley, Comer Thomas, and Ernest Renzel invaded Los Anf geles to do battle with the Southern California colleges. The matches resulted in a series of complete Cardinal victories. On March 28th the team engaged Midwick Country Club, taking all but one match in easy style. The follow' ing day the Red Shirts swamped Pomona in similar fashion, losing only one match. Over the weekfend Stanford, University of California, University of California at Los Angeles, and the University of Southern California engaged in a fourfway individual tournament, each university entering four singles players and two doubles teams. Stanford came through in fine style. Alan Herrington won the singles and Herrington and Ralph McElvenny captured the doubles. In the singles Herrington defeated a fine field, including his teamfmate Wheatley, and Bob Laird, U. C. L. A. star. The match with Laird was nip and tuck from the first point, but Herrington kept the ball in play, capitalizing on Laird's unsteadiness. In the doubles Herrington and McElvenny did not lose a set. ln the national intercollegiate rankings for 1927, Stanford set a record with three men in the first eight: Herrington, five, Ogden, seven, and McElvenny, eight. In the doubles McElvenny and Herrington ranked third. Holman was not ranked in the singles, nor were Holman and Ogden placed in the doubles. Following the intercollegiates, the Stan' ford four campaigned throughout the - ' fV, ' ' J--U 1. . . '.-- -- -I '- V ' .f ' ' ' f' --fa-.1..f'g.' -' ., ' 5 'srt summer in various eastern tournaments. fIfj,2.:, I .7 ' Q41 At Providence, Rhode Island, Herrington f 1 Us put up his best tennis of the summer in def ' , ., . feating Holman, McElvenny eliminated f 1 Fritz Mercur, one of the seeded players. ,,,. pk.. .-MW I 1 ' I A Holman and Ogden defeated White and l - B, ,V . it Thalheimer, third ranking national doubles 51. a A' 'I YL4 'gii if, , If O . team. ' I 'TT The following week at Longwood, Boston was e ually successful. In this com' petition Holman Hrst hit his real stride. Unseeded, he dlefeated on successive days, Van Ryb, Arnold Jones, and Lewis White, all first ten candidates. He lost in the finals to John Doeg, Stanford freshman, in a match of a unique thrill. McElvenny and Herrington distinguished themselves in the doubles play. They defeated Van Ryn and Appel, intercollegiate champions, early one afternoon, and later carried White and Thalf heimer to the three set limit. National recognition was given to all four players in the rankings made at the end of the season. Holman achieved tenth place, McElvenny twentyfeighth, and Herrington thirty' first. Holman and Ogden placed eighth in the ten doubles teams ranked. CALIFORNIA MATCHES 'J' ' ' V., .4-. , V , . McElvenny dailies with the ball FOR the third consecutive year, Stanford found Berkeley Bear meat to its liking. The annual competition proved a complete rout of the Bears. In Eve matches the Bears capturgd but one set, and that in second doubles after a Stanford team victory was already assure . Alan Herrington won the first match from Bud Hager in straight sets 6f4, 6f4. Hager had a 4f1 lezid in the initial set, but could not maintain it in the face of Herrington's superior all' court p ay. John Wheatley took second singles from Dick Hoogs, California captain, 7f5, 614. In the Los Angeles tournament Hoogs had given Wheatley a terrific battle. With this experience in mind Wheatley worked hard from the first. Hoogs got in the lead at 4'I the hrst set, and again at 3f1 in the second set. The pace was too much for him, and Wheatley pulled out of both holes safely. Ralph McElvenny added the third singles at the expense of Martin McKee, 6f'3,, 6fz. McKee, leftfhanded loop artist, had a large bag of trick shots. His crafty cuts, and heavily topped drives bothered McElvenny when they came over the net and inside the court, but they were outside the court and in the net too often to win any sets. ' Herrington and McE1venny won hrst doubles from Hoogs and Rhoades 9f7, 6f1. After an erratic first set the Stanford pair settled down to tennis, outclassing the Bears com' pletely. California got its only set when Martin McKee and Chasseur carried Wheatley and Comer Thomas to the limit in the second doubles match. The scores were 5f7, 6f3, 6f3. Immediately following the match, John Wheatley was elected captain to succeed Alan Herrington, 1928 honorary captain. A l l THE EASTERN TRIP ' MMEDIATELY following final examinations in June, last, four men, Cranston Holman, Lionel Ogden, Ralph McElvenny, and Alan Herrington, forming the strongest varsity ever to represent Stanford, left for the Merion Cricket Club, where the National Inter' collegiate Tournament was scheduled. Hopes for a Cardinal triumph were high and wellffounded. In the two preceding years, Cranston Holman had reached the singles finals, losing both times to Edward Chandler, who was ineligible this year through graduation. In the doubles Holman and Ogden had lost both times in the late rounds to the eventual winners of the tournament. McElvenny and Herrington were unknown quantities in national intercollegiate tennis, but their records in T Coast competition were excellent. ' The Cardinals mowed down the early round com' . viii at - . petition. Ogden was the first Cardinal to fall, going out 1' if if 157 l L it ' . i . Ei at the hands of Benjamin S. Gorchakoff, Occidental ace, Captain Al H-'fffi118f0fl in the round of sixteen. The three other Stanford men came through to the quarterffinals, and could go no further. Holman went down before Whitbeck of Harvard, McElvenny fell before Corchakoffg Herrington lost to Van Ryn of Princeton. Holman's defeat was the only upset, but it was a hard one. The blonde Cardinal had most of his usual steadiness, but he had lost all of his forcefulness. Whitbeck was on the top of his game, and returned Holman's soft shots with unbeatable precision. The doubles tournament was even a greater upset. Holman and Ogden played im' pressively until matched with the Kline brothers. The day was hot as only eastern weather can be. Ogden had previously completed a gruelling game with Gorchakoffg Holman had run himself limp against Whitbeck. The Kline brothers played sensational tennis. Elimif nated early in the singles, they were fresh opposition for the Stanford men. Lobbing, dinkf ing, lobbing again, they outran and outlasted the tournament favorites. McElvenny and Herrington plowed through to the semiffinals, where they lost to their old rivals, Gorchaf koff and Craig of Occidental. V -.ah , 2 , , uk 1 1' it-173211 Q z1,f, 1'N-Q. ' ,., ., 1 v . ' f ' -4: V-.sa , H, vu,-keel., up 4.5, . i.L..,f.,i ' giL'1'25?l1'.:'1:1' -f -' 1 , ' A H+-ff HWI: fp-I , 1g.fll'V'f :--1 '.. . xl T . if a W . V . 1, is I .. . . it Herrington serves a hot one Wheatley 'retwrns it l THE TENNIS SEASON By Ralph McElvenny ITH three lettermen from the powerful 1927 varsity as a nucleus, Coach Hal Davis was able to produce for 1928 one of the most 9 successful tennis teams in the history of Stanford. Beginning the season with the University of Southf ' ern California in February, Stanford swept through all the strong college tennis teams of the State. Occidental, Pomona, University of California at Los Angeles, U. S. C., St. Ignatius, and the University of California fell, one by one, before the sweep of the Cardinal rackets. Particularly gratifying was the victory over Berkef ley. Coached by the famous Howard Kinsey, California ' presented a team claimed by Kinsey to be well qualihed to represent its Alma Mater in any company. When I the last point was tucked away, the Berkeley rout was Coach Hal Dam complete. Stanford lost but one set in the five matches, the soundest beating ever given a Blue and Gold tennis varsity. California collegiate individual honors were also cornered by the Cardinals. ln the official fourfway tournament held at the University of California at Los Angeles on March goth and 31st, Alan Herrington won the singles and, paired with Ralph McElvenny, capf tured the doubles. As this goes to press, Stanford is practically winner of its second consecutive Pacific Coast Conference tennis title. Already victorious over California colleges, Stanford added to herfregional prestige on April 7th, winning four of five matches against Coach Aberf comie's state championship team from Oregon University. Graduation takes Alan Herrington and Ralph IVIcElvenny, both three year lettermen and nationally ranking collegiate players, and Gomer Thomas, one year letterman. John Wheatley and Ernest Renzel remain as the framework of the 1929 varsity. John Doeg, Charles Weesner, and Ted Easton of this year's freshman team will undoubtedly conf tribute a great deal to the success of next year's varsity. , 'iii N. u xml Back Row: Davis fCoachJ, Herrington, McElvenny, Renzel, Moore flvlanagerj. Front Row: Wheatley, Thomas, Castellanos. TENNIS FRESHMAN BASEBALL BSPITE their defeat by California in the annual series, the Babes had a very success' ful season. At the start of the season the outlook was very gloomy. There was a wealth of good lielders but few good hitters or pitchers. However, as the season progressed, the men began to hit their true stride, and fortihed with several latefcomers from the basketball squad, the team soon developed a formidable attack. Cn February 28th, the Babe team rose to great heights when it defeated Burlingame High School. Don Story, newly discovered pitching marvel, allowed the visitors neither a hit nor a run. His I7 strikeouts and no walks coupled with perfect support from his team' mates and a homefrun by Spud Hardy tell the whole story of the game. Inspired by the example of Don Story, Vard Loomis came very near to pitching a perfect game against Mission High on March Ioth. It was a nofhit and nofrun game until the fifth when Loomis was replaced by Story who allowed two runs to score. However, led by the hitting of Loomis and Chuck Teague, the Card Babes were never in danger and took the game ofa after a deluge of hits. By the time of the Cal series the men had been fairly dehnitely assigned to their posif tions. Hunk Hunken, the captain, Wittenau, and Allen very ably took care of the outfield positions. Teague, first base, Magee, second base, Johnson, shortstop, Hardy, catcher, and Story, pitcher, were certainties to start against California, but it was doubtful whether Hedge, third, would be eligible to play. However, Mears, a basketball star, was quite capable of stepping into his place. The first game of the series ,developed into a pitchers' battle between Story and Horner. Story was slightly erratic and, profiting by his eight walks, California took the decision 4f3. Eloth pitchers kept the hits well scattered, but Spud Hardy continued his sensational tting. On April nth the Frosh ran into some tough luck and lost to the Bear Cubs 71, in the deciding game of the series. The California team did not show a very superior attack but kept its hits well bunched. Vard Loomis pitched until the fatal seventh when after two outs, the Cubs cinched the game by scoring three runs before the third man could be ref tired. Story finished the game, holding the Bears scoreless, but Horner kept pace with him by retiring the Cards Ifzfg in the sixth, seventh, and ninth innings. Back Row: Hardy, Story, Loomis, Oswill, Teague. Third Row: Pearson, Mears, Reynolds, Howe, Fessio, Miller. Second Row: Stone, Gillett, Eberhart, Tickner, Ricklefs, Bowles, Cooper. Front Row: Hunt CCoachj, Allen, Hunken, Hedge, Magee, Wittenau, Johnston, Russ, McGarr. x 5. N . Q , .. A-. il l '.' Ig- . V. LA- QQ ' Q .fi ff, if .lslwf x. Q JJ, - ij' ? ,:P 4 ,Fav-' ,. . 1,- ' A 'va 1 ily 1 J g u l X .4 , . F 41 K ' or ef-' ' ' y ., V v--- f . Tl: , - Qi' 1' 2 A 6 HY' 'A f L' - . ,4 ' L . ' ' , i ff ' f 5 A . ' , A . I v pm .- .-. af-.rg i - P 5-3- ,ss Vi ' -JL nu 'N .' . hw 'sr-fp A, r--ir., f r ' '- ga, 'f ' A iii-sizf' 'iv i4 - .f1x r' 3- .rig AB' l Q 'tee lf ' H+-'P9':.r:ra-1' gi:-5 ' - 'U 'Q'i-qgfigpc' ' -- - , 'TIS'T.. ' .j Sypher leaps safely to frst Garibaldi out, with feet to go double, and scored on a sacrifice. The following inning Wyatt garnered a hit and then raced home to score the second and last California run. Red Berg scored Stanford's lone tally in the seventh. With two outs Berg went to bat for Levin and managed to reach first on an error. He then proceeded to steal second and scored on Sobieski's hit. The game was hotly contested throughout, and it was only Douthit's three hits that turned the tide in favor of the Bears and enabled them to win this game and the series. With their backs to the wall, in an intermission game, the Cards revived to defeat U. C. L. A. 8 to 4 in the deciding game of the series. Due to their sloppy and defective playing the Bruins were honorably endowed with last place in the Conference and Stanf ford won its first game in three weeks. The only redeeming features of the otherwise list' less game were the antics of Weaz,el Wilson about second base and Frank Wilton's destruction of a fence while pursuing an elusive home run. Bob Philippi pitched the whole game and was given much better support than were the Bruin hurlers, who were presented with many errors by their teammates. Not daunted by having lost two games and the series to California, the Cards proceeded to lose another. There were some rumors that the infallible Nemechek had been disposed of by some Stanford wellfwisher. He did not start the game, but appeared ominously in the field in the ninth inning to relieve Jacobson who had Hlled the bases with but one out. True to form, he retired the remaining Cards, enabling California to win 3 to 2. Cene Kern pitched fairly well until the seventh, contributing four walks and seven hits, and was ref lieved by Lewis who kept things well controlled during the last two innings. The Bears started the scoring in the second when Douthit doubled and was presented with a run when Maguire miscued. Nothing benehcial occurred until the fourth when Pooch Cari' baldi singled, advanced on Levin's hit, and scored on Maguire's sacrifice-but that was all. Toward the last of the game Sypher developed a dislike for the Bear catcher, Williamson, and to prevent a pitched battle, he was retired to the bench. Despite this curtailing of blows, Douthit and Clymer for the Bears and Maguire for the Cards got in some deadly work with the willow. The team is now preparing for its summer invasion of Australia. The past- season is for' gotten and the men are endowed with new hope and energy. They are going to play in a country where Nemecheks do not abound and baseball is well supported. It certainly would not require too much imagination to predict a successful 1929 season. There will be a wealth. of sophomore and junior stars and a number of excellent men coming from the frosh. I fl D . 3 ,f -, ,' ',, .-'A V - , ,' ' i.. I l It-'I' - Q 14 , . .f-y.. ... -.. ' 1.1- Sobieski connects with a fast one McGuire nabs California man at first THE CALIFORNIA SERIES FTBR a fairly successful Southern invasion, the varsity returned to Stanford to open the California series. Faced with a possible cellar position and an overwhelming ma' jority of series won by California, the team was determined to make every effort to defeat the Colden Bear. Chaperoned by Coach Harry Wolters, the varsity travelled all the way over to Berkeley only to lose in the first game of the series. Gus Nemechek, surnamed Nemesis, proved entirely too much for the struggling Cards and by bearing down in the pinches, let them down with only two runs, while California was scoring six. For a while it looked as if he were going to have a very rough time of it, because he walked five men in the Hrst three innings. It was soon evident, however, that he was just having some fun, for he would ref peatedly throw away three balls and then strike the man out. Doug Lewis started the game for Stanford and pitched erratically until the fourth inning when he was relieved by Bob Philippi. Despite the fact that the Bears gained only one hit in the remaining innings, the Cards were unable to get started and did not threaten seriously at any time. The Bears bunched hits in the first to score two runs, and in the fourth they fell on Doug Lewis to the tune of three singles and a double to score four more runs. In the eighth inning the Cards staged a belated rally when an error put Sims on first. He was advanced by Sypher's hit, an error, and then scored on Caribaldi's sacrifice. How' ever, the rally was soon curtailed and nothing more happened until the ninth when Laird scored another lone run. California was not particularly strong, but Stanford could not hit. The team had several good opportunities to score, but seemed to lack the necessary punch. At this point, in an attempt to revive the failing Cardinals, Cook Sypher was chosen Captain. It was hoped that the inspiration furnished by the Hery leader would give the team an added impetus and provide a feeling of unity which had been lacking until this time. In the second game the Cards made a valiant but unsuccessful attempt to topple the Bear from his lofty pedestal. However, the Bear was playing at the door of his own lair, and with 3,ooo rabid Berkeleyites cheering him on he could not fail. Again the Stanford team was confronted by the demon Nemechek who downed the Cards for the fourth time in two years. Count Sobieski lasted the whole game and managed to keep the ten hits he allowed pretty well scattered. However, in the sixth the giant Bear, Captain Douthit, started his team's scoring when he hit a neat single to left, was advanced by Millett's . I - CCNEERENCE SERIES HE varsity opened its California Intercollegiate p , .eu- . ' 'U I Conference season on February' 18th by losing a -I ' ' 11, close game to Santa Clara, 5f6. Incidentally, this was the Missionites' third major sport victory over Stanford in the 199.8 season. Doug Lewis pitched a good game, but poor base running and a lack of headfvvork nullified his efforts. 5 The next week, after some intensive practice, the team staged a comeback to defeat Saint Mary's. The 5 ' game was featured by a parade of pitchers-eight in all -and the last survivor, Sobieski, finally won his own game in the last frame by lifting one of Hamilton's offerings over the far fence. On Saturday, February 25th, the varsity evened its f - series with Santa Clara by takingdaf spectacular tenf ' innin ame go.. Dou Lewis toi e or seven innin s :ff and hilgl the Missioniges well in check until the eighgh I when he was relieved by Gene Kern, who pitched two Capwm CookSypl1e'r innings of scoreless ball. Levin, Stanford outfielder, was the hitting star, but the game was won by a single from the bat of the fleet Frank Wilton. Awkward base running gave St. Mary's the opportunity to even the series when on February 29th they took the second contest, zfl. Count Sobieski pitched the whole game for Stanford and was master of the situation at all times. The following week, fired with vengeance, the varsity swamped the Saints 1 I'I to take the first Gael ball series it has won in many years. Stocky Bob Sims led the hitting with four hits out of his live attempts. During the Easter vacation, the Stanford team broke even on the games played during the Southern invasion, by defeating the strong Kern River Standards only to relapse and lose to both U. S. C. and U. C. L. A. In the U. S. C. game, Count Sobieski got his name in the papers by pitching a nofhit game and yet losing because the Stanford men could not convert their hits into runs. The team lost a second and deciding game to U. S. C., 4fz. Fourteen hits and a home run by Sypher were not suHicient to compensate for poor base' running, four errors, and U. S. C.'s seven hits. 1 1- I ' -. . , in ,, , . fi . 4.12 -1. McGuire tags U. S. C. man Wilton safe at first-U. S. C. game THE 1928 SEASON By Alfred Esberg HE baseball team started the 1928 season with an unusually bright outlook. There was a great Wealth of veteran material and as Coach Wolter said, L'It was the best defensive team Stan' ford has had since rom. - The outfield was well taken care of by Wilton, Sims, Berg, and Levin. All these men were heavy hitters, especially Wilton, who distinguished him' self in early season practices. Levin and Berg, both small men, but sluggers, came up from the frosh and .44 . practically alternated all season in the odd garden position. The veteran infield-one of the best Stanford has ever had-consisted of Maguire, first base, Cari' baldi, second base, Laird, third base, and Busch, shortstop. Each of these men, with the exception of Laird, who was the star of the 1930 team, possessed at least one year's varsity experience and all were capable of playing high class ball. Laird very ably filled a large and ungainly gap in our airftight infield. Spud Harder, a veteran of last year's team, although he could not be classed as a regular, was a constant threat, and he furnished many thrills during the season with his spectacular batting and fielding. Coach Wolter was blessed not with one good pitcher, but with several of about equal calibre. Doug Lewis, Bob Philippi, and Count Sobieski were all veterans, and Gene Kern soon earned his place by his hard work and excellent delivery. Although lacking a very fast ball, he made upfor this by superior control and greater care. Sobieski, although wild at times, pitched some very good games, one of them being a nofhit game against U. S. C. Bob Philippi, one of the steadiest of our hurlers, got into some tight places but usually pulled himself through by his baffling slants. The pitching staff was further fortified by Bill Simpkins, Rudy Riese, and Mike Reynolds, who could do their share very eiliciently when called on. Needless to say, the receiving end of the battery was Well taken care of by Cook Sypher. Coach Harry Wolrer Back Row: Harris, Garibaldi, Marx, Harder, Kern, Sobieski, Berg, Purkiss, Sypher. Front Row: Maguire, Levin, Wilton, Bush, Laird, Adams, Paxton, Wolter fCoachj. V a152ilA-Es1: f 1225212 :sp-Qwa-:2.f.m.i Nz! J . 3. 1.3-Mg.: 13,320 .-ZA.-.-2157? ,l 4 .4 ,Vg.g,r':- '4T:,,:-:-:-:-f:,.15- -zu.-.-' , -.x -- ' , . , , , 1 . , , ' ' 94 -5'f-1, -' 'lalffl-14I', 5 , - 1'fi'f2--1- I':-A-1. '-'ff N' '-'11 '- - 'ZH '.','1: -'-11 2-52. I- f-' 34-f'f ' - -x -4-- . . . ' - +:r:g:.RrffdE,7g-Hs:-531322-4:1:m.'-:ff 1,9-4 g.H:'s- --,c5:..gg-. gi ffl: gt-Sr-1.1-'-f4:2,:5Q-:gs',:1:' 1 41115:-: :.:i.'.?f v-:v ' 1 fwfr ' 1. '..,:f:-:':-NrHw'5'f.f.i 1-3:41-51341.34 55-4 g3A:5:'1:g -v .194-.Az----,-' f.,1L-I-mg.. , , +51 :-g-. fxggjgzis na: -1: . fsidgiiif' ' 1-,-13,51-4gg1::1,.,. feyfg.-zggg, D if Wiifk..-3 is igaiifi-, if f f my- iE93Eff52'1'2-lil? f5'f:1z4 Z3', -4'?i1 1.'T. :'. 155523 '-6'?l?E7.! , -' , if f-f X'-M V Q:'f?:f- '.f-:'E-El:f11'AE if-:1,.,:11-Lag?L-,QL If' - 1 -3- as1Jiv32,:i1 Q gp-1-.:g:f9 FH 3-wg. 5 ,.-I ' mf-.i'if:E-'fit'-,'1e'f:hr5'-'l.-1231 T-Z ' iff??f.1:?f1iiff:1:-:FA1. .,-:Ig 555-'A5: 'l 'IVY L? lic: I: ', V 113: J- '1f:I'1?5TifE5 f . - ' A ':--PF'--D1 -JL.: V:-.ve-3' V fIN1.':1:f:f:?.'--1' 1+ .1- -4.54 L12-I . :f. .- ,. . -' 5' 2-lf -1-n-2.lfkf1:2 -. 7 5:l5'i'f4:,'n6 211 .'::-. LJ - X- . .-4.-'-fy- 'Z5M132,'C-+1-. 5 111117 ' I' R32- '1l,i:, ffijfn ,Z A' 1, , ' ,:','- 'ft 4 ff! I 3:f.' -J: ' 'fgI'f1'11l ' cw,-zfww.-:14-'2..-.l::2'f:'1-14- .: 1-4f:1:f'f . -.vii12:29-Elrdfszif-fJ '- 'Q ' -' .'!'::1'2 rpm .SE-i,'-3555-Ei'.IQf'121Qfjf'-Ef5?'f..l-' 'i. 'f.1 - 1'if2E2fiY:11:Qf3'1 -:IT ' 5 ::'3?i'1355553?f'E:7'Ei'5'i':-'V' '.I'.'.'I 7 'ff355l.I'.'f f1'f.t-1.2721-.,P.C5f . f E-6' 5. P j11:1i'f'Ei3Sfil5fg. '11 -.f:-1e-f'-.u.2- 'l12e2..:bai2f1 r2:3:.':1:-5552511 I'f:i'f1Z'Ew3p::'-- 1..,:f-,:,.j,j ' ' 1115 -. , -. A - 1. ,.f:ggj:g.1+-' :S:1r.wf5.' ' ?ff:-1-f-1::g.f: ::'.-'1 :':f.'i,'.I,7:g'f'--.3.i. '-If' -..5'5-.'-:-- ' ' -, -5.3:-21.-'-fiffig1.r2f' -'fx-v 1 :-'ul'CA-2:-:EfNIS1:?T11:'2: - '- :-.f.cf5,,-.,.g-1-.f.5g1.L.g,A,,.g .-.tax-21-, ,, 15' ' - - A .,-3: iz- A-1--1 - . ' -Qs--,-A-6 .-55: -4.,+ : 1,q1,:ff,g,g1-g-.- 1f-i- - - H ,,f , , , f:'g-'elf -- -1,-f:g- 'Ay ,A -f,,:,.-1.,.L:::g' f-31:22:15:5.1:Vjgggmfxgzg-122,1-?f3.'r-'91 'EH' ' - ,ff S., 'W-Isa: 1.-g,'::.'--1:05, :,:s:-.ws-z:1,-1 ' ' ff f V ' -'Sfi.2.fEtif?'i'2'1 riff-:f. gg: 41:4zi.cffpj,r,-.:1,4:1:--X-.y,.::...,q ' ,. , ' 5:21:11 g- , .I 415x133 211+ - 3,22 ,:5.'.1:--,ww-zirzf. .,f:5. Y- ' 1,11 ,-1,:.,1.i:i:':'.:.:r:r: : 1::.a4r-f:-:,- 221212: .-'1.Q32::5IEf1':1LEi- f.:-.155 1' NNN 1 'Y '03-.':EE2:2Z-'5f1'1f51.?,'L':E3':1:-24 -af.. .1:,'-+':2'2.r:53: u, ,351 I 1'-2:-.i+1r9g:-:Wi12 '51.v:4::as1?E233E'E2E Qi- .1122 . N if ffF', e11::tf2f2':a3f f' X 'ifb2122eaftf1?ii' 4:16 .:2'.3-'A':f.s.5? J - 'i2fE'E:5, -1 222255 ,,Zz'fi1f-.53-lf' I V f13f'::1SI1223Q24lgH 1 .--frqggfg.-'igpzy' . ig5,.j1-ici? 43:54 1 1:1552 v'5E1E1Ev'5??f fl . F :2:3'.- ' S',l-1-- ir - ' C:1'2'v2ch.12' ' , H 1 1 1, ':' .,:-, ' lx N ':E1 :3:f4 ' 'E2:aw1:asA :.- f- 1 , W-fi1:x 2 I GLW'-Bt'-1T 4 C 1:3543 L! A ,..x,,,,,,,. . 4 ,,. ,Q .4 g :L:f...1:..':f'1-155 V ' ':-f3'fE:,:1 g 25151215253 , ' . N ,J -.g5:fg - -.gag -, 1. xr . ..: 1. .-,.-.g. 5 -. Y -3. 4g.- .. 4 , 45 51:1 1 1 1sfff2 .Q: ' ' Eli: 52 , 'gfjggi-Q . . 2: ff: s ,555 Vzgfsf' .':,- - - ,x M 1 5? 5512? mga , N 15. 452 15-H ' 3.5: -gzgfkspgp. -2, -:,:517z'?r .Z I I-511. +9334 -1 . , . 1 ,5,:.:.:.-. I W 91555 -... - - ii :jf -21, ' ,L . wi- ' N ' 1 miffifzfffz Q ' QQ., -' 1-.-- E' '0ZI . . 1 ' by L 'F ' 1 .3511-Z 2 1, g:'.agj:54 , -91 ,-: g3:?f?Ef'sf SQFSLWT . I 'Q1'23:Z14 ifirhbgg .- 51 -' v11fA::+. , w:- 1:1'2ii11:':V' , -:I:1f:'.?f:l'LE' 1 , iI.'5?:?QT2f:f: - ' -i9?22??i l' 325512 5 . a ff-1-,5fga?eg:gzg. - egafefgqaf - 1 5 :zfqzrzz-g:',, fw:.::v -:ng 313 .545 ' 116155 , cf.-Irby -P' gg-.,:-'i5:1..:j!e- fig?-?'. 531, . ,435e3g::':-'QQ o.Q'j2ffg.1Zg - -1 -' X 242532553 . : 195Ze:H59f? ' N , -: ass: siiisflc .,::f:c-:wg 2-L 2 -Vf::2-.- :L 'SF:' T . :'+1af2-Q22 c . ii:. STKE? N wffzezigrai' seen.. M ' kr-'fxsrf-2.-1 1 gf- lffmgzl agpgmiiiz-'5 , 35255532 3 SE 1 :fab 51.23. '4 1.5331-.faqs 'iigesfiiesze 9- -icnifxf ' 1f EjEtf5gE? '5?iE2Erw-2 1- .5515?5Q:5r ffgifffilii , : i--::3ea,g' ,2fE1:a'24f+, 1 -.wmzzf - :2,Miwf15: ' - fE52?rkC5f:. ,E?'1'. 21:jE,i41 5, 5 -5Il:ffffE3EIi:? a2ffs2fsLZE'fg3- . ' 3535-2ff1i22a52ia?. , . 1 'f1:i5ff:i1ii3iL .. 1: ,:?: 31, :5:'t'1 59, , - , V 12:-3,-gf-11-11'-3. X 55-,f-+::2f:g:,:::2231: -- , , . X A 1, ,:f'f '1ZT:12E4-mf 55:3-j:5i1'Q-5:5-,gr1:g',:,-is51-3'- fwgsbgr-'-'-xg: :.-:4.:.-:+11,y r i q-vw 1 - ,. , . ' RQE3EE'i,1i1g! ug gi- 1. ' . - wg-11.-f. .-.-.- ,.,: g . ,fi :- iq 1: W Q :'fZlJ:Lff-- - 2f.5E1i-525' . fl 55:f'-,- ' - WA 1:5 '-5 Ff 'Z I:'4'71'f ?31:5Tl-z -'ilfififff 255.17 -:-.:::.,.'. :.i: Y, ':':':.-I'-U '1 -1 -5f5'g'ii:.'i7 ' , j 4312.-., C I, j It: +fC.:I:,1Zg,-'-:-:' ,, 1-'gi-f I gg-i',: 411:59 ,zf,':,-Q ,3 51 kr- 19 ,.fg-:-g,ggQ-.- ' x4 f X . pig-Q13-1:,,! Q: 'Q j 3 :':-1,--j:::,f:.53lI.: :Q .,,f:: ' 'gZg'. L1-.-y1hfg,:i:31.'f 'g'gf3, f.-'I -tf :'3?,::',-,qjj -' ,gf'4 ,-3S- ,xx-1 q.yt3I.,. , -, , Ig 1 3 ' -, ' , I' . , , ' ,, ,,jf,1Z1I-,gf:grg', :Y -3 3.3222 I ' 11315 -J'1c3gl'I'Z'Z1I'- 'V -'C J, . ,'g1'i' '7 ' '.'?g,g'v-L' -13 i.1'1. , -5. fp-5 'Qf1. J1 f- 1,11 if ,ffy-:' L- , - ', ..g' -FQ '14 v' 3,3- W fiE11'ke.f11:E,:'15Q -.531-5: ?-,E'E -ff .fi-':.E'121.-15-.II-sffrg, 3 -. ,:1g1..j'g:rJg,j ' 'S-1 :1.,1.5i,1qiHy.1.f .ggi ' fr: . 22:i???9Q i?wi?2'. .. - 5i '5f 1 '1 - Q2 -5V5W2A.f1l'f f--471-5223.553 5? f'L,5i?k?1 -:W . f5'Y.,1-313'-' - .V : :- fv,1.zf:',,::- zZQ,2'-g-fw' : g -4 :ly Q .1i g- :'.- I xiii-if,g?1'2 s?z':.g.x5l:efff'3arg, ' .- ' .,.:f:1Q5fs:i.1: inf-'1 'Sgt-,:.g,r i-f-'uf'--,Q . 'f.g:2:r5-f,.'ff4'.-:sw--.'L. qw ear, 1 qi- 1 1 rf. -4 1-f,f5.3 1q:':1j1:e-,:,.A V - 2 15:-. .5 A: -v 41 , fEIg:H1f:,jx: '-421342,-.Q uizulgz. ,, -. - , - MT.,-f -f q-, - , ' .-'-gm ,4,.i ,1.g.gL.,:z,,,355jf , YW f . ' , 1 vt P ij ? 'fQifrtiE'ST .Str-101211312111 QA nf21 . ' i K t :rr :ii FRESHMAN TRACK OUR meets were held during the spring by the IQSI Freshman track and held squad, and in none of them did the Cardinal Babes score less than 87M points. The team had strength in virtually every event and in addition possessed two or three unusual per' formers, to wit: Hector Dyer, hurdler and sprint marvel, Captain Maynor Shove, quarter miler and anchor man on the relay team, and Arnold West, who consistently got beyond 22 feet in the broad jump. The season's scores were as follows: Frosh, 87 M-San Mateo and Modesto Junior Colf leges, MM, Frosh, 92-Oakland high schools, 21, Frosh, 89 zfy,-San Francisco high schools, 39. 1f3,g Frosh, QI mfg,-California Freshmen, 39 1f3. The Babes won nine out of fourteen first places in the Little Big Meet, whitewashing the Bear Cubs by 1 f1f6 more points than the varsity did in the Big Meet. Stanford made S3 points on the track to 24 for the Bears, and added 38 zfg, more on the Held while Christiefs men were collecting but IS 1f3,. Hector Dyer, high point man of the meet, captured IS points and tied the roofyard dash record at ro flat. The only sweep of the day was made by the Cardinals in the discus, when Goldsmith threw the plate six feet farther than he had ever done before to win first place. Captain Shove ran the quarter in SI 215 seconds to win by three yards, and Burt DeGroot cleared 1 1 feet 6 inches in the pole vault to nose out the favorite, Reynolds of California. The summary: roofyard dash-Won by Dyer CStanfordJg McDermott CStanfordj, secondg Hunter CCalifcrniaj, third. Time, 10 flat. Ties meet record. zzofyarcl clash-Won by Dyer QStanfordJg McDermott fStanfordJ, secondg Hunter CCaliforniaj, third. Time, 0:22 340. 44ofya1d dash-Won by Shove CStanfordJg Neikirk CStanfordJ, second, Wright CCaliforniaj, third. Time, 0:51 2f10. 88ofya1d nm-Won by Mossman CCaliforniaJg Parker CStanfordj, secondg Black CStanfordD, third. Time, 2:03. Mile run-Won by Mossman CCalifornia'Jg Parker CStanfordJ, second: Wright CStanfordJ, third. Time, 4:29 7f1O. New record. Old record 4:30 415. Two-mile mn--Won by Rice CCaliforniaJg Brown CStanfordD, secondg Philly CStanfordJ, third. Time, 10:10 215. rzofyavd high hurdles-Won by Young CCalifornialg Smith CStanfordJ, secondg Austin CStanfordj, third. Time, 0:16 1-10. Low hurdles-'Won by Dyer fStanfordDg Smith CStanfordJ, secondg Sheridan CCaliforniaD, third. Time, 0:26. High jump-Won by Austin CStanfordJg Duwell CCaliforniaj, Woodyatt CStanfordJ and Miles CStanfordJ tied for second. Height, 5 feet 'YK inches. . Broad jump-Won hy West CStanfordjg Werder fStz-infordl, second, Browne CCaliforniaQ, third. Distance, 22 feet inch. Shot put-Won by Dawson CStanfordlg Young fCalifornial, secondg Pike fStanfordJ, third. Distance, 44 feet 1 Z inches. Discus-Won by Goldsmith QStanfordlg McLeod CStanfordJ, second: Colvin CStanfordj, third. Distance, 128 feet 3 M inches. javelin throw-Won by Churchill fCaliforniaj, 187 feet 11M inches, new record. Old record, 173 feet M inch. Akers CCaliforniaj, second, 180 feet 1 M inches: Perelli-Minetti fStanfordj, third, 163 feet 3 inches. Pole vault-Won by DeGroot fStanfordjg Reynolds fCaliforniaJ and joujonfRoche fStanfordj, tied for second. Height, 11 feet 6 inches, Relay-Won by Stanford team, composed of Neikirk, Howell, Crisler, and Shove. Time 3 :29.8. The freshman track squad . 4 rr- 4-1-i,1.-..1 E-iii? Y, -: rp - . , - ,I ,,:- M , . . ' ir . ' aj. . ,, 1 ' ,'.. V - 1, af, . Il .,. i I ' H ..... T ' -f- riQR.rz-.QUAl1W fw3 ' so - A Flaw Pomrfwmnrns-Back Row: Nichols, Krenz, Templeton CCoachj, Spencer fCaptainj, Dyer. Front Row: Forster, King, Edmonds, Zombro. THE I. C. A. A. A. 'A. MEET CORING fortyfthree points to beat off the threat of four powerful eastern rivals, Stanf ford's track and field team successfully defended its l. C. A. A. A. A. championship in the rainfdrenched Harvard stadium on May 26th. The Cardinals, battling to retain the title they had won the year before, ended the meet with four individual champion' ships and two new records. Record times were impossible on the muddy track. Poor marks were prevalent not only in the runs, but in the pole vault and high jump. Eric Krenz, however, saw to it that spectators were given their money's worth when he shattered two records in the weight trials. , The real upset of the day occurred in the 44ofyard dash, when Captain Bud Spencer, favorite to win, was passed in the home stretch and lost by three feet to Ray Barbuti of Syracuse. Ross, Spencer's outstanding opponent, brought third to Yale. The old mark of 49 feet UM inches, set in the shot put by Clarence Bud Houser, was broken by Krenz with a throw of 50 feet 1 inch. His team mate, Harlow Rothert, came perilously close behind him with 5o feet M' inch. Fifth place went to Al Forster. After wiping his hands of the shot, Krenz took up the discus and flung it 154 feet II inches into space-which was good for first place and another new record. Phillips of California and Welch of Pittsburgh took second and third, respectively. Bob King once again scampered off with the high jump championship, which he captured with a mark of six feet. Maynard of Dartmouth, who was favored to win, cleared only 5 feet ro inches to tie for second. A Stanford man took the fourth championship when Ross Nichols, captainfelect, swept through his two preliminary heats and then raced to first place in the finals of the mofyard high hurdles. His time was 15.1 seconds. With the meet already won, the Cardinals continued to heap points on their fast' mounting total. Three points came from the javelin, where Kibby and Sparling counted for third and fourth places. Ward Edmonds hung onto a triple tie for third place in the pole vault at I2 feet 6 inches. And in the broad jump, Dyer and Zombro, with leaps of 24 feet 5M inches and 23 feet 9 inches, took second and third places, respectively. In the final point standing, Stanford won first with 43, Yale second with 25 1f5, and Cor' nell and Penn State tied for third with 16. Other totals were as follows: Syracuse IS Harvard 14, Georgetown 11, Michigan State ro, Princeton 1o, Columbia 8, Holy Cross 8 Pittsburgh 8, Dartmouth 7 1f3,, Brown 7, N. Y. U. 7, U. S. C. 6, and California 5. 3 3 .. . ' 4 M.. . . .1 1 - 187 feet S inches, Kibby QSD, third, 185 feet 11 3f8 inches. J- -- -- ,e-. ,Y-I .. v1'. 1- 4' ' ,. i . - - - . - - , ,., aw, . ,I , ....,,, . .,, I. .1 . -, , ir. .1 ., v1 -f1.- -w 41 il 1 1 111 if Y-11 -.- . .- -'ra wr--' F' -' .' Ll' ' ' ' V- ' ' ' i '-'rp' -A -'w.-Ml '-- . , -1- - 1 11 ai 11l1+1f . S P Tai 1,,'-rf.,--,F me . Q . 11 - 1 . -' ' 15' Dyer sets new record in broad jump-24 feet IM inches Dink Templeton's dream of a Big Meet in which all first places would be won by Stanf ford men went glimmering in the first event, when Harry Carter of California won the mile in 4:23 245. Alex McKinnon, the Cardinal hope, was unable to beat Ned Cherry for second place. john Lauritzen scored two brilliant victories in the dashes, winning the loo in ro flat and the no in zz flat. The 880, Stanford's only notably weak event this year, provided California its only other first place of the meet. Kenneth Van Tress won in 1 :59 3f5, Tom McGuire, Stanford, taking second. The rest of the story is an easy one to tell. Bud Spencer and John Morrison finished one and two in the quarter. Henry Coe broke the record in the twofmile in 9:38 reg, giving Stanford the right to claim this mark for the first time in years. Nichols, West, and Bullis took the honors in the rzofyard high hurdles-the first sweep of the afternoon, followed by a second sweep, West, Nichols, and Nelson in the lows, and a third, Krenz, Rothert, and Forster in the shot put. Bob King won the high jump and Ward Edmonds the pole vault, but both men failed on attempts at heights approaching the world's records. Kim Dyer broke Fred Zombro's 1927 broad jump record, Zombro taking second place in spite of an injured tendon. Eric Krenz extinguished Biff Hoifman's old record in the discus. The final scores were as follows: Mile run-Won by Carter QCD, Cherry QCD, second, McKinnon QSD, third. Time, 4:23 2-5. . , IOO'ydTd dash-Won 'by Lauritzen QSD, Kiel QCD, second, Ewing QCD, third. Time, 10. . . . ' 44O'ydTd'1uH-WOO by Spencer QSD, Talbot QCD, second, Morrison QSD, third. Time, 48. . I2O'yG7d high hrerdles-Won by Nichols QSD, West QSD, second, Bullis- QSD, third. ' Time,'14 415. ' ' Twofrnile-Won by Coe QSD, Fox QCD, second, Smith QCD, third. Time, 9:38 1f5. 88o?yard run-Won by Van Tress QCD,XMcGuire QSD, second, Chase QCD, third, Time, 1:59 315. U F V I A -szofyard dash-Won by Lauritzen QSD, Kiel QCD, second, Van Gelder QCD, third. Time, 22. ' , zzofyard low hurdles-Won by West QSD, Nichols QSD, second, Nelson QSD, third. Time, 24 3'5. .. - . , -- - - Y 'Shot put--Won by Krenz QSD, 49 feet 2 inches, Rothert QSD, second, 48 feet M inch, Forster QSD, third, 46 feet 1Of5A inches. . . , I ' Iavelinthrow-Won by Sparling QSD, 193 feet 11 3-8 inches, Curtice QCD, second, - High jump-Won by King-QSD,.6 feet 5 1f8 inches, jacklevitch QCD, second, 5 feet 11 inches, Fitz QCD, Davies QCD, French QSD and Madison QSD tied for third, 5 feet 9 inches. Pole vault-Won by Edmonds QSD, 13 feet 6 inches,,Hulsman QSD, second, 12 feet 6 inches, Scrivener and Hempler QCD, tied for third, 12 feet. . , . Discus throw-Won by-Krenz QSD, 154 feet 6M inches, Phillips QCD, second, Q 4 ' ' M751 1 1 ' - 131 feet 5 inches, Way QSD, third, 128 feet 2 7f8 inches. Broad jump-Won by Dyer QSD, 24 feet IM inches, Zombro QSD, second, 23 feet SM inches, Lom QCD, third, 23 feet 1 inch. Relay-Won by Stanford team composed of Dyer, Dales, Morrison, and Spencer The grand finale California team was composed of Giguiere, Rust, Pratt, and Talbot. Time, 3:19 1-5. - KFC.. ' f - .-1. I ...I-'-gh -ff I ' ' ' Y .. . 'Q' .. ' any ,f v WW 'L -L ' v 1 3- .f - . ,L ', ' 2 'f - . .Q , W 1, , ,,..l-,.-,,J --,... ' i Nichols breaks high hurdles record in Big Meet THE BIG MEET HE thirtyffifth annual StanfordfCalifornia track meet went perfunctorily to Stanford, QOM to 4oM. Throughout the season there was no doubt that Dink Templeton would give Walt Christie the short end, and indeed until the iinal week of practice, when Christie declared to a reporter from the Stanford Daily that California had nothing to fear from any Stanford quarterfmiler, i. e., Bud Spencer or Johnny Morrison, one might almost have complained of the meet's promising to be dull. Far from dull, it provided a number of honest thrills. The most significant fact, and one that will doubtless take posterity's breath in awe, was that Stanford men set seven Big Meet records, with the result that fourteen out of fifteen of the mutual marks are down in the books under Alma Mater's name. Only the roofyard dash time of 9 4f5 seconds, set in 199.6 by Captain Phil Barber of California, remains to the Bears, elsewhere the Stanford times, distances, and heights are supreme. California previously held four of the fifteen records, but Henry Coe, Ward Edmonds and Bob King easily made new ones for Stanford in the twofmile, the pole vault, and the high jump, respectively. Bud Spencer in the 440, Ross Nichols in the high hurdles, Eric Krenz in the discus, and Kim Dyer in the broad jump, 1 wiped out four marks held by former Stanford athletes. The list of recordfbreakers and their marks follows: 44O'ydTd nm-Captain Spencer, 48 secondsg old record of 48.9 set by Miller QSJ in 1926. rzofyard high hurdles-Nichols, 14 4'5 secondsg old record of 14.9 set by Leistner CSD in 1925. 'Twofmilc run-Coe, 9:38 1f53 old record of 9:43.1 set by Stevens QCJ in 1925. High jump-King, 6 feet 5 1'8 inchesg old record of 6 feet 4M inches set by Maker CCD in 1916. Pole Vault-Edmonds, 13 feet 6 inchesg old record of 12 feet 11 M inches set by Hill CCD in 1926. Discus throw-Krenz, 154 feet 69,1 inchesg old record of 153 feet 1M inches set by Hoffman CSI in 1927. Broad jump-Dyer, 24 feet 1M inchesg old record of 24 feet M inches set by Zombro CSD in 1927. C Most of these records will hold their own for some time. King's mark in the high jump is especially note' worthy, as is Krenz's tremendous heave of the discus. As Krenz is only a sophomore, he is liable to break the world's I'6C01fCl 1'16Xt YCBI. Coe wins twofmile with ease fed! .K 19'-'34-vv-,,'f', .fl -iii B West and Telson beat out Leistner CO. CJ and Nichols in the lows STANFORD 87 OLYMPIC CLUB 44 HE Olympic Club Meet stands out in the memory by reason of the fact that in the Tmile, the opening race, one of the smartest stratagems Coach Dink Templeton ever conceived was executed. Alex McKinnon and Jimmy Charteris, the latter a former Unif versity of Washington halffmiler, now running for the Winged O, were supposed to be the leading contenders, while Bobby Gooden of the Cardinals was considered a weak third. The race was expected to be a nip and tuck struggle between the two opposing aces, Charteris had a faster sprint, it was thought, than McKinnon, but he was not an experf ienced miler. McKinnon was instructed to stay in third place until the final turn was reached, Gooden to take the lead. This they did, and Charteris ran with McKinnon, thinking that the little fellow was the man he had to beat. Gooden, meanwhile, took a substantial lead and maintained it until the last lap. It was then that Charteris cut loose in a mad effort to win. But Gooden managed to head him to the tape, a firstaplace winner in 4:41 315, and McKinnon, his legs wearied by a geology field trip made during the morning, straggled in to place third, happy in Gooden's triumph. The mile was not the only thrill of the day, however. Russell Sweet, O. C., won the . ir. sprints in 9 4f5 and 21 5f5, he and Phil Barber, his team' mate, giving Johnny Lauritzen the competition which set him up to win the dashes in the Big Meet, two weekslater. Bud Spencer ran the quarter in 48 flat, and Morrison beat out Bill Storie, former Cardinal quartermiler. Ross Nichols tried to run too fast in the high hurdles and fell on the fifth barrier. Clarence West was booming right along, however, and he finished the no yards in I5 secf onds, Jack Bullis beating out Swede Leistner of the Club for third. STANFORD 92-ALLfSTARS 48 The Cards made their highest score of the season against a team composed of picked men from the minor colleges of Southern California, winning Q2 points to 48. An extra event-the hammer throw-was included in the meet, and Casey Kazanjian, the husky guard, put his shoulders to the task to win for Stanford. Bud Spencer ran a beautiful lap in the relay, and as a result the quartet turned in its best seasonal time, Eric Krrrrz prepargs ro, break rr record equalled the following week in the Big Meet, of 3, :19 rfg. H., 4,,..,--,,i. Clarence West practicing on the high hurdles STANFORD 77 U. s. C. 54 Hoss few students in the University who were not on one varsity team or another, and hence in Los Angeles by necessity during the Spring holiday, went down anyhow to see the U. S. C. meet. And it certainly was worth the prices they charged-at the Cocoanut Grove. From the time that Alex McKinnon stepped out in front of Adams of the Trojans to win the mile in 4127 4f5, until Captain Bud Spencer pulled into the finish of the relay, the Coliseum track fairly scorched with the friction of flying spikes. Chief among the day's performances was the duel between Ward Edmonds and Lee Barnes in the pole vault. The two cleared I5 feet 6 inches to tie for first and then agreed to hoist the crossbar to I4 feet 9. inches, one thumb's length higher than Sabin Carr's world's record. Thereupon, they went to it, each taking three jumps. Edmonds showed up better than Barnes and amazed everyone when on one try he cleared the height only to graze the bar on his fall to the sawdust. Ross Nichols and Clarence West took the measure of Payne and Webber, U. S. C., very neatly in the high hurdles, finishing one and two with their hands clasped in fond mutual congratulations for accomplishing a feat which had previously appeared impossible. Payne came back in the lows and won from West in 25 4'5- Hank Coe, the question of whose eligibility brought forth a number of the farffamed Hunoflif cial protests from U. S. C., most of which, like those of Yale's 1927 football star, Bruce Caldwell, started in newspaper oflrices, lost the l2WO'II1ll6,x anyway. Warren Woodruff beat hirnin the time of 9 minutes, 47 4f5' seconds. Aside from the poles vault, the field events offered little in the way of excitement to the Stanford supporters, who are accustomed to the prodigious things done by their athletes on the greensward. . , The relay was won with customary neatness and despatch by the Stanford team composed of Syer, Dales,-Morrison, and Spencer, in the excepf V tionally fast time of 2,221 1f5. This team is probably one-of thebest Stanford has ever possessed. It is . , - . is almost the equal of the 199.6 quartet-Babcock, c A Us Storie, Richardson, and Miller. Fred Zombm, byoadfjump J A Paddock and Pinney nose out Lamitzen in the Century-L. A. A. C. Meet Charles Paddock came out of a welter of runners like a comet in the last twenty yards of the century to win in 9 415 seconds, with his teamfmate, Hugh Pinney, placing second and Johnny Lauritzen third. Lauritzen steamed up in the no to second place, making' an envif able showing against the speed aces. Throughout the season Lauritzen's work was notable, in that he ran in fast time races for which he has no natural gift. He is an rrfsecond runner capable of io seconds, and usually able to beat men touted as habitual 9 4ff5 runners. Captain Bud Spencer ran a beautiful quarterfmile in 48 9.15 seconds, and was followed to the finish by John Morrison, while Larry Babcock, last year's varsity captain, was third. Spencer won the relay when on the last lap he passed Percy Niersbach of the club. Ross Nichols capered gracefully over the high hurdles to win in I4 4f5 seconds, and Henry Coe ran a 4:37 twofmile to place second to Hank Lunney, L. A. A. C. This meet was probably the most exciting of the track season. The large number of nationallyfknown stars competing, and particularly the presence of Paddock attracted many spectators, who watched the L. A. A. C. flash with a great deal of interest. Paddock made an attempt to break one of his own records, but was unsuccessful. The results of the meet speak eloquently of the severity of the competition: roofya-rd dash-Won by Paddock QL. A. A. CJ, Pinney QL. A. A. CJ ' , secondg Lauritzen QStanfordJ, third. Time, 9 4-5 seconds. Q 220-yard dash-Won by Paddock QL. A. A. C.jg Lauritzen QSJ, second, W - ' Pinney QL. A. A. CQ, third. Time, 22 flat. l 44ofya1d run-Won by Spencer QSjg Morrison QSD, second, Babcock Q QL. A. A. CQ, third. Time, 0:48 25. 4 Half-mile nm-Won by Scovell QL. A. A. CJ, Carter QL. A. A. CJ, secondg Lovejoy QL. A. A. CJ, third. Time, 1:57 4-5. Mile run-Won by Carter QL. A. A. CJ, Lunney QL. A. A. CQ, 2 secondg McKinnon QSJ, third. Time, 4:22 3f5. Twofmile run-Won by Lunney QL. A. A. CJ, Coe QSJ, second, Lupe QL. A. A. CJ, third. Time, 9:35 2f5. High hurdles-Won by Nichols QSJg West QSD, second, Maxwell QL. A. A. CJ, third. Time, 14 4f5 seconds. Low hurdles-Won by Maxwell QL. A. A. CJ, West QSJ, second, -. nr Welsh QL. A. A. CQ, third. Time. 24 1'5 seconds. High jump-Won by King QSDg Smith QL. A. A. CQ, secondg Webster QL. A. A. CQ, third. Height, 6 feet 5 546 inches. Pole vault-Won by Edmonds QSJQ Graham QL. A. A. CJ, secondg - 4 Harry Smith QL. A. A. CQ, third. Height, 13 feet 6 inches. ' i Broad jump-Won by Zombro QSjg Dyer QSJ, secondg Meeks QL. A. A. CJ, third. Distance, 24 feet 10 1f8 inches. QNew Stanford record.b Shotput-Won by Krenz QSJQ Kuck QL. A. A. CJ, second, OrloffQL. A. A. CQ, third. Distance, 48 feet 4 3f8 inches.- javelin-Won by Eaton QL. A. A. CJ, Harlow QL. A. A. CJ, second, Sparling QSJ, third. Distance, 208 feet 10M inches. Discus throw-Won by Krenz QSDQ Alexi QL. A. A. CJ, second, Way QSD, third. Distance, 152 feet 2 M inches. ' A One-mile relay-Won by Stanford team composed of Syer, Dales, Ward Edmonds vaulting at I 3 feet 6 inches Morrison and Spencer. Time, 3 :22 2f5. P ' T L - VARSITY TRACK SEASON By Templeton Peck HE varsity track season was not typified, as normally it is, by the twofmile run, in which the runners jog for many laps, gathering speed only at the end of the race- rather, it was a halffmile run, every man going at his best .pace as week lapped week throughout the long spring. It was a topsyfturvy season. The best dual meet of all those scheduled came Hrst, on March Ioth, when after a warm Saturday afternoon's work the Los Angeles Athletic Club trackmen walked wearily to the showers with a 69 to 62 vicf tory to their credit. Each succeeding meet found the Stanford team the winner, exhibiting that invincible power which in May sent it hurrying across the continent to Cambridge to defend its national championship, won in 1927 in the I. C. 4A. . The season's schedule was as follows: February 24th-Interclass Meet and Irish Maraf thon, on the old oval, March roth-Los Angeles Athletic Club, in the stadium, March 31st-University of Southern California, in the coliseum, April 7th-Olympic Club, in the stadium, April 14th-Southern California Conference allfstars, in the stadium, April 21st-University of California, in the stadium, May 25th and 26th-I. C. 4A. champion' ships, at Cambridge, Massachusetts. STANFORD 61-L. A. A. o. 69 A NB of the finest athletic club teams assembled in the United States during this, the year of the Olympic Games, came north from Los Angeles to beat Stanford or wear out its spikes in the attempt. Charles Paddock was the most famous of the Southerners, but there was a wealth of other crack athletes. Coach Boyd Comstock had sixty men wearing the L. A. A. C. emblem. Though Dink Templeton's team took a defeat, it fairly shone therein, for the meet proved it to have great power and evenly distributed strength for a college aggregation-a splendid point winning machine. . Particularly did the field department of the team come through. Five out of six firsts were won. Bob King pranced up to and cleared the bar at 6 feet 5 I5 I6 inches in the high jump, Ward Edmonds vaulted I3 feet 6 inches, Fred Zombro set a new Stanford record of 24 feet ro P8 inches in the broad jump, and Eric Krenz was a double winner in the weights, heaving the sixteenfpound brass pellet 48 feet 4 343 inches and making a mighty throw of 1 S4 feet 9 inches in the discus, after he had won the event with a lesser throw. l , I Eric Krenz, sophomore weight sensation Captain Bud Spencer, star quarterfmiler THE 1928 VARSITY i By R. L. Templeton on a Paciiic Coast track team to take the long trip east and still have a chance to win the I. C. 4A., it is almost essential that its strength lie in the field events. The runners, with few exceptions, lose their condition on the train ride to such an extent that their performances cannot be relied upon. In this ref spect, Stanford is lucky this year, for it is in the three weight and three jumping events that we will make our bid for championship honors. The shot will be our biggest scoring event, for with Krenz and Rothert both over 49 feet, and Forster at 48 feet 6 inches, the East will have only one man, Addelf man of Georgetown, to offer them serious competition. Krenz is easily the outstanding discus thrower of the country's colleges, and should add another five Coach Dinh 'TCYHPICIOH points to our score in this event. Sparling will meet real competition in the javelin but with one mark of 204 and two at 199, he should not place lower than third. Bob King holds the I. C. 4A. record in the highfjump at 6 feet 5M inches. Maynard of Dartmouth beat him last year ati'6 feet 4M inches, but King was out of condition at the time. He is jumping better than ever, and it is impossible to conceive of his being beaten. The polefvault will include the world's three greatest vaulters: Sabin Carr of Yale, who holds the record at I4 feet, Lee Barnes of U. S. C. who broke it at Fresno with I4 feet 1 Z inches, and our own Ward Edmonds, who though still a beginner, has far greater possif bilities than either of the others. Our broadfjumpers, Fred Zombro and Kim Dyer, have both bettered 24 feet, and are at least on a par with anything the East has to offer. From these six events we have a right to expect thirty points, which is considered to be enough to win the meet. And added to them will be the points collected by Captain Bud Spencer in the 440, and Captainfelect Ross Nichols in the highfhurdles. There are no better men in the country for their respective events. The Varsity Track Squad TRACK 5' .1 'I . ly. l FRESHMAN BASKETBALL LTHOUGH the Varsity basketball season was not an overwhelming success, the Freshman season was something else again. The Babes played fourteen games and lost only one. The Freshman team did not seem very spectacular at Hrst. But when they hnally got together on the hardwood under the watchful eye of Mugs Mitchell, Coach, they looked like champions, and were. They took on everything from military companies to business colleges, with high schools and dental colleges in between. During slack periods they amused themselves by trimming the Varsity. Mike Reynolds was chosen Babe captain. He was equally able at guard and center, and possessed a certain knack of sinking the ball through the hoop from deep in the court. Fawcett, Hawkins, Mears, Reynolds, Tampcke, JoujonfRoche, Hepp, and Moffatt all ref ceived major numerals for basketball. The season began on january 6 with the defeat of the C. C. P. quintet, 35 to 11. Then followed the Oakland Grays, 73 to 5, the Armstrong Business College, 34 to QQ Piedmont High School, I7 to 542, San Jose High School, 41 to 5, Santa Clara, 22 to IO, Galileo High School, I7 to 1o. These scores speak for themselves. By way of finishing a phenomenally successful season, the Babes annexed the Stanford' California hoop title by winning two of the three games of the series. On February 15, the Bear Cubs were beaten 24 to 22, on February 22, the tables were turned temporarily, and Stanford took the short end of a 30 to 22 score. The Card Babes won the final and deciding tilt of the series, 29 to 27. The scores alone tell the story of these three games. Both teams played firstfrate basket' ball and fought doggedly for the lead. In none of the games was the outcome ever certain until the very end. The last game was probably the most thrilling. Stanford took a 23 to 16 lead early in the contest, but California staged a threatening rally and tied the score, 27 to 27. A Stanford goal in the last few moments of play decided the game. A great deal of the credit for the successful Freshman season must go to L'Mugs Mitchell. Although he had a number of individual stars to begin with, he was faced with a difficult problem in making them into a team. This he succeeded in doing, and constructed as smooth a basketball outfit as has been seen here in many seasons. With this year's Babes to choose from, the outlook for Varsity basketball next year is satisfactorily promising. Back Row: Gatzert. Roberts, Tampcke, Mears, Ehrhorn, Colvin, Reynolds, Hawkins, Lovelace. Front Row: Hunt QCoachj, Loomis, Smith, joujonfRoche, Moffat, Eastman, Freeman, HEPP, Levi CManagerj beating handed Husky I-Iunt's five in the following contest goes to show just how much things can change in the period of a few days. Stanford displayed what was prob' ably the worst 'basketball of the season that evening. Cn the other hand, California was playing a good game, which contrasted sharply with the miserable and disheartening Cardinal showing. The Stanford performance went from bad to worse as the game prof gressed. Where weight had handicapped the Bears in their first game, and given advantage to the lighter, faster Stanford men, that same avoirdupois sounded the death knell of the Cardinals in the second. The heavier bluefclad warriors simply stood in the way when Stanford had the ball, and trampled the lighter Redshirts under foot when California was onthe offensive. - W , The Cards were baflled in their attack, and ineffective in their defense. They seemed -unable to hit the hoop, and showed evidences of complete disorganization: The effective California machine charged up and down the court with smooth teamwork, lightning dribbling, and a sharpshooting eye for the basket. Desperate playing was of no avail. Substitutions did not help. The tide of score swept forward. The sweating, fighting Cards battled on. No one can say they didn't try, and didn't work. But all their trying and all their battling was fruitless, and the contest ended with Stanford on the short end of a 29 to I2 score. After the slump in Friday's game Stanford fans had hopes of getting a hollow revenge by seeing Hunt's warriors trim their transbay rivals in the final tilt. But Saturday's contest was almost as rough and dull and hopeless as the one which preceded it. Nibs Price's squad was just as good as it had been the night before, and Stanford was almost as weak. The iirst few minutes of play were a little hopeful. For a moment or two the Cards looked more like a basketball team, and less like a baffled group of erratic players. Faint signs of their old speed and precision of the Tuesday before raised the hopes of the Car' dinal fans. But the tide soon turned. The Dougery brothers and Corbin lost no time in starting their ,vigorous attack, and piled up a comfortable lead for California, which the Bears kept until the end of the half when the score stood II to 8 in their favor. The Cards still did well in shooting fouls, as is shown by the fact that all of Stanford's score was accounted for by eight out of ten chances at free throws, but as for actually scoring in play, they were baffled and overwhelmed by the superior California power and skill. The Cardinal offense again got under way at the start of the second period. Richards sank the Redshirts' first field goal, and the prospect g was better. Immediately the Bear defense tightened. Stevens and Tripp began to occupy the California limef light, and added three more baskets to the Berkeley score, which put the Stanford outfit under the ropes again. To Thompson and Rothert goes the credit for keeping the Bruin's score as low as it was. Each of these sophof more guards played the game of his life. Thompson was removed from the floor because of personal fouls, as were Corbin and J. Dougery of California. This final game was better, on the whole, than the one which preceded it. Stanford's team showed more iight and organization, and in spite of their comparative weakness, i gave the Bears a pluckilyffought contest. It is to be hoped that the material from the 1931 freshf man team will furnish the necessary new blood for a sucf cessful season next year. There seems to be no legitimate excuse for the poor showing of the varsity this season, for their occasional brilliant playing showed that they had possibilities which, for some reason, were not developed. George Dobson, Came' THE CALIFORNIA SERIES ROM the first trouncing to the last one, the 1928 StanfordfCalifornia basketball series Fwas a sad tale for Stanford. The Bears were victorious in the initial tilt, on February 21, by a score of 31 to 25. They took the second, 29 to 12, on February 24, and the third, 28 to 17, on February 25. All three games were played in the Kezai Pavilion in San Franr cisco, much to the disappointment of the Stanford rooters, who did not enthuse over the long trip up to the City to see their own Varsity in action. However, they turned out loyally for the first contest, and it was only after the second defeat, which gave the series to California that they really lost their usual interest. Stanford's showing in the first game was comparatively good. The Bears won by only a sixrpoint margin, which was garnered in the last two minutes of play. The two old rivals fought bitterly that night, and the tradition that there can be no prediction made on the outcome of a StanforclfCalifornia contest again held true. When the Cards had carefully built up a sevenrpoint lead, with the score standing 23 to 16 and only five minutes to go, things looked promising. Then, while the Stanford rooters waited for the timer's gun to send them a victory and end the suspense, they saw a fighting California five tie the score, 23 to 23, and then 25 to 25, in three minutes of whirlwind play. In two minutes more, they saw the struggling Cards let their rivals creep ahead by six points, and before they had a chance to recover, the game was finished. Stanford outplayed California in defense and attack during the first half. The Cardinals were a fast, slippery bunch of clever performers. Vincenti opened the scoring on a short pass from Smalling. Vincenti later piled up eight points more out of Stanford's total of I4 for the period. The Stanford guards, Rothert and Thompson, and Clark, at the forward por sition, all played stellar ball. California's shooting eye, which later played so much havoc with the series scores, was not yet opened, and the heavier Bears seemed unable to get their bearings against their redshirted rivals, who were playing their best brand of basket' ball. Throughout the entire period the Stanford Eve kept the score safely ahead, and at the half had the satisfaction of seeing the score stand I4 to II in its favor. The second half appeared to be a repetition of the first. Stanford played the same speedy, skillful game with the same auspicious results, steadily pulling away from the Berkeleyites. After an overhead shot by Smalling, Clark counted with a free throw. A long shot by Thompson was followed in short order with another basket by Vincenti, and the Cardinals were at their peak. They held a sevenrpoint lead, and according to all , indications, were headed for a victory over their ancient foe. Suddenly the Berkeley team rallied, and the Dougery brothers and Corbin, center, staged a sweeping counter' attack which swept Stanford farther and farther from a win. Struggle as they might, the Redshirts were unable to stop the determined onslaught, and could do nothing to prevail against this first and only spurt of superior basketball shown by the Californians, which finally overr came them and took the game for U. C. Good basketball and a multitude of fouls usually do not go together, but the fact that fourteen fouls, seven on each team, were called, did not have the usual effect. Rather, the rough playing injected just the necessary pep into the teams and their audience. In addition, Stanford took the occasion to profit by doing the best foul shooting of the year, and netting herself scores on six out of seven free throws. Although Stanford lost this first game of the series, the team performed creditably, and gave no indication of the Harry Berg, Forward slump that was to come in the next game. The 29 to I2 By Biaggini, Guard Wes Bryant, Forward i'Whitey Bowers, Forward period with a dynamic drive which netted them the game. Stanford's main source of tallies was sucker shots made by Smalling, with Cook, Richards, and Berg feeding him the ball. Nip Mcl-lose paid a visit to his Alma Mater with the Clympic Club basketball quintet on January 28. Nip and his fellow Olympians romped through the Cards for a 42 to 27 victory in a heartbreaking game that finally developed, from the Stanford point of view, into a comedy of errors. But. Stanford was up against a very strong basketball team and the defeat was not at all unexpected. Dropping two contests with the University of Southern California, Stanford continued its descent to a cellar position in Pacific Coast basketball. U. S. C. took the first clash 34 to 23, and captured the second by a ZQ to 25 margin. Better all around playing on the part of the Trojans combined with the inaccuracy of Stanford's shooting decided the Hrst game. Displaying a close passing attack, the Southerners took a lead early in the contest, and main' tained it throughout. Stanford's usual last minute rally, which had saved the day on pref vious occasions, failed to materialize when most needed. The score at half time was 18 to 12, and during the first period Southern California had maintained a varying advantage of from 2 to 8 points. A feature of the play during the second half was the tight defense presented by both organizations. U. S. C., however, was more successful in sinking long shots over the heads of Stanford's guards, and managed to keep a comfortable margin. Richards and Berg led the Stanford scoring with five points each. For the opposition, jack Bruner was high point man. About 22oo fans saw the game. The Southern California pavilion proved inadequate, and approximately a thousand more were turned away from the ates. jgst as the Sons of Troy were beginning to squirm in their seats, and just as the rooters from the Farm were beginning to grin with satisfaction, two field goals in the last minute of play gave U. S. C. its second win from Stanford by a ZQ to 25 score. The game gave U. S. C. a tighter hold on the southern division title, and shoved the Cards still deeper into the mire. ' Stanford played topfnotch basketball that night, and held a slight lead through most of the first half. With the score 25 to 25 and with six minutes to play, both teams fought doggedly. Then jess Mortensen, Trojan forward, sank a goal from midffloor, one minute from the end. Captain jack Bruner followed with another just before the gun sounded, ending conclusively the hopes for a Stanford victory. Louie Vincenti tied with Mortensen of U. S. C. for high point honors and accounted for ten tallies. . -.' 1, 1.1,-.Y 'I 1 . ..j I, LlCl1llClQll Srnalling, Center Bill Clark, Forward Dowell Richards, Forward In the first contest of the twofgame series, which was played on the Farm on January I3 and 14, the Bruins beat the Cardinals 29 to 22. Stanford allowed a certain victory to drift by when the Southerners staged a powerful comeback in the final four minutes of play to snatch the game from danger. Up to that spurt the Redshirts, with Vincenti and Berg playing flawless ball, held a IQ to 16 margin. The score was almost the same in the second clash, but the story was considerably diff ferent. Ketchum and his henchmen beat Stanford 28 to 22 Saturday night, but the brand of basketball .played by the Cards was greatly improved. Up to within two minutes of the close of the first half, the Cardinals outplayed the Bruins at their own game, but the south' ern boys sneaked through a scant twofpoint lead just before the end of the period, and managed to keep ahead until the game was over. ' By way of preparation for the third U. C. L. A. clash. Husky Hunt's cohorts let Santa Clara eke out a 21 to 20 win. With both factions playing rough and tumble basketball, and the score standing 20 to I4 for the visitors, Stanford staged a smashing rally in the last five minutes of play almost to win the game. It was a good battle, and the Redshirts looked much better than usual. Revenge came in a measure to the Cards on the next Saturday evening when Stanford's battered five journeyed south and admmistered an unexpected 34 to 27 beating to U. C. L. A. Exhibiting a whirlwind attack in the last half, Hunt's organization wiped out an elevenf point lead piled up by the opposition during the Hrst period, and decisively defeated the Southerners. At half time the U. C. L. A. team led the Redshirts 24 to 13, but at the start of the sec' ond period Hunt sent in the combination which had given Santa Clara such a close race in the last few minutes of play-Smalling, center, and Cook and Richards, forwards. Long occidental arms and legs proved too much for smaller oriental statures when Stan' ford played Waseda University on January 23. The Cards won by a lopsided 52 to I2 score in a game which afforded the Redshirts a good workout in preparation for the St. Ignatius clash. The Japanese tried hard, but were unable to cope with the superior size and ability of their opponents. Stanford showed a new brand of basketball in the tilt against the Jesuits from St. Ignaf tius College on January 25, and dissipated the Gray Fog to the extent of a 50 to 24 score. The half time count stood against the Cards I3 to 1o, but they came through in the second PRELIMINARY GAMES ITH the eyes of Stanford fandom in particuf lar, and of the Sporting world in general, on the StanfordfPittsburg football battle at Pasadena, Coach Husky Hunt's quintet got off to an unpretentious start for the 1928 season during Christf mas vacation. After a 27 to 26 win from Y. M. I. in the first of the holiday battles, the Cards traveled South to take a 26 to I4 beating from the Los Angeles Athletic Club, and to repeat the process, only more disastrously, in the tilt with the Hollywood Athletic Club, which ended with Stanford at the short end of a go to I4 score. In spite of the defeats, the Redshirts' playing showed decided improvement in the second contest. The difference in the scores may be explained by the excellence of the Hollywood five, which was rated as one of the best in the West. On December go, Stanford's play tightened, and the Cards defeated the San Bernardino Teachers, 28 to Captain Lame Vmcemi 19. In addition, I-Iunt's squad beat both the San Jose Colds and the San Jose State Teachers, College, so the end of the holidays found the ability of the Stanford team still something of a mystery. Cn Friday night, January 6, the Card quintet let College of the Paciiic's Tigers run rampant for a 29 to 18 victory in one of the worst games seen locally for many a season. The Stanford Varsity seemed green and inexperienced beside the smooth machine of the visitors, who were held fairly even in the first period, only to have things their own way to the end of the game. Next evening, however, the Redshirts saved their reputation by beating Fresno State's much heralded varsity, 25 to 2o, in an extra time tilt. Vincenti, Smalling, and Berg enf gineered the Cardinal victory. Vincenti and Smalling furnished the iight while the redf headed Berg dropped the ball through the hoop with sufficient rapidity to cinch the game. Then the Pacific Coast Conference's infant school, the University of California at Los Angeles, started Stanford's regular schedule by spanking the Cards twice in a row, only to succumb to Hunt's men in the final clash. Red, Thompsori, Guard Milonic Virlcenti, Forward Harlow Rothert, Guard N THE 1928 SEASON By Robert Speers . ERHAPS scores aren't of the greatest importance in judging the success or failure of a hoop team. Nevertheless, the accepted criterion is a record of games won and games lost, and if the Cards are judged on that basis, the verdict leaves something to be desired. The impending season looked quite favorable as the squad turned out for early practice sessions. Several veteran players were on the roster, aided and abetted by some promising sophomores. Few were optimistic enough to predict overwhelming success for the Cards, but it seemed likely that they would finish the season with a rating comfortably above the bottom of the list. As the early games came and went, it was increasf ingly evident that Stanford's team could not find itself. V The intangible something which converts five men into a basketball team appeared to be lacking. The Cards played hard and well upon occasion-there's no denying that-but they lost nearly every game they played. To make a depressing story short, the Redshirts went from bad to worse, and when the end of the season finally arrived, Stanford was clinging to the bottom side of the lowest rung of the Conference ladder, while the University of Washington Huskies perched triumphantly at the top. At the close of the CaliforniafStanforcl series, the skipperless Stanford outut conferred the position of honorary captain upon Louis Vincenti, veteran guard and forward, who closed his college basketball career with the last California game. At the same time, Har' low Rothert, sophomore guard, was elected to lead the Redshirts through the 1929 season. The following men were each awarded a Block S at the close of the season: Smalling, Rothert, Thompson, Dobson, Berg, Richards, Clark, and Vincenti. Coach 'iHuslqy Hunt Back Row: C lson, Bryant, Thompson, Elliott, Rothert,Sma1ling, Clark, Dobson. Front Row: Hunt CCoachj, Bower, Stewart, Richards, Cook, Vincenti, Berg, Biaggini, Levi Clvlanagerj. BAsKET B ALL THE BOARD OF ATHLETIC CONTROL HE Board of Athletic Control and the General Manager control the business side of athletics in the University. The board is composed of Thomas M. Wil' liams, 597, Chairman, J. Pearce Mitchell, '02, Treasurerg Alfred R. Masters, Gen' eral Manager, Richard W. Barrett, 504, William B. Owens, 'rig Thomas A. Story, '96g Frank L. Guerenag and the under' graduate members, Murray Draper and Donald A. Robesky. In the summer and early fall of 199.7 the Board of Athletic Control increased the size of the Stanford Stadium further to ac' commodate the thousands that come to Stanford every other year to see the Big Game. The greater part of the S175,ooo that was spent for stadium improvements was used to increase the size of the bowl. The seating capacity, which was formerly 7I,4S8, is now 87,466 The new additions are of timber, with wooden piles serving as supports. The outf side of the bowl has been painted with gunnite. Two new Red Cross emergency houses have been built to care for the injured and to guard against fire hazard, and a sixfinch water supply line has been laid to the rear of the Stadium. The outside of the bowl has been made more attractive by the planting of many shrubs and small trees. This year has seen also the completion of the new Board of Athletic Control Building, an important item of the fifteenfyear building program for athletic development. The crowded conditions of the old gymnasium made another building imperative. The new structure furnishes oflices for the Graduate Manager, the Director of Athletics, the Medi' cal Department, and the various coaching staffs and student managers. The new building has made possible the use of more space in the old gymnasium for lockers. It is of buff brick with red tile roof, and conforms well to the general architectural plan of the campus. The total cost was 2B1o5,ooo. Together with the recent additions to the stadium, this new structure gives Stanford one of the most complete athletic plants in America. The Board is planning to install a loudfspeaker system in the stadium next year in order that spectators may keep more closely in touch with the action on the field. Other plans for the future include the construction of a golf course on the campus and a new swimming pool. New Board of Athletic Control Building Robesky, Draper, Mitchell, Sypher, Williams, Owens, Story, Guerena, Masters, Barrett. Klorz California P. Andrews Frank Baker Harry William Call Alonzo Cass Philip Cavalero Robert Edgar Cecil Edmund Converse, Jr. Theodore T. Daniels Eleanor Davidson -. . . .ZS 101,01 Cass THE RALLY CGMMITTEE George I. Ellsworth Robert Fraser Robert Frazee William Glen Major Bryant Godsol Frederic Easton Graff Donald W. Hamblin David Jacobson Sergius Klotz Gregory Hensley Davis Edward Beverly Krough John Thomas DeErees Leon Herman Levi Wesley Doe Alexia Helen McCarty Murray Draper Alexis Ehrman Sidney Madden Q? Webster Charles W. Mahin jack Brunker Meakin Albert H. Mofiitt Virginia Moulton James Joseph Sapero Carolyn Shepard Dan Throop Smith john Calvert Snyder Frederic W. Speers 'George Watkins Story Chesterlyn Thomas J. Scott Webster Charles Harold Woolf Donald Richard Wright Back Row: Smith, Story, Jacobson, Cavalero, Krough, Doe, Davis, Mahin, Snyder, Webster. Second Row: Speers, Sapero Wright Frazee, Converse, Woolf, Ellsworth, Hamblin, Draper, Ehrman. Front Row: Moliitt, Baker, Thomas, Moulton, Andrews, McCarty Shepard, Fraser, Cecil. THE BICGRAPHY OF Aa RCOTING STUNT TANI-'ORD University has for some years been noted for the variety and color of the rooting stunts which it provides for the edification of football spectators and of the opposing side between halves of important gridiron contests. Those who View the stunts. as innocent bystanders usually have only a vague idea of how they are managed, and the students themselves, who obediently suspend various colored cards under their noses, are often as much in the dark. The genius behind it all is the Rally Committee. The most spectacular function of this committee is to plan and carry out the betweenfhalves stunts of the Big Game, the U. S. C. Game, and the possible postfseason contest at Pasadena. To stage one of these stunts effectively is no easy task. The Hrst step is the collection of designs, which are suggested by members of the Rally Committee, or by members of the student body in a prize comf petition which is held each year. . After the entire series of stunts has been chosen and the order of presentation deter' mined, they are individually plotted out on cofordinate paper, each small square of which represents one seat in the Stanford rooting section. The design is colored up with crayon as it will appear, and then cut into strips, each strip representing two rows of seats in the section. Corresponding strips are cut from each stunt, and they are all put together on one card. This card then represents all the color changes for two rows of seats, and it is only a matter of time to transfer these colors to the small instruction cards that are tacked on each seat. On the morning of the game, the Rally Committee turns out in full force at the stadium. First the rows of seats are lined up with stringg next the instruction cards are tacked in their proper places, and finally the large colored cards which form the stunts are tacked below each seat, and carefully checked with the instruction card, in order that each rooter will have every color of card called for on his list. After this the success of the stunt def pends upon the ability of the rooters to follow instructions. The illustrations below show the McCreery stunt as it appeared on paper, and as it looked in the Stanford rooting sec' tion during the Big Game. In the Big Game this year, Stanford had a rooting section of zooo. Twentyffive color changes were provided for, necessitating the use of over 12,000 cards of assorted colors. Because of the lack of time between halves, a number of the stunts were never used. I I v - I .y ' p ' l X Y I I 1 I . I.- , . , - ' I The McC'rce'ry stunt on paper And in the 'rooting section THE STANFORD GRAYS HE Stanford Grays are the unsung heroes who are buffeted about on the practice field by the Varsity, and to them must go a great deal of the credit for the past footf ball season. Without their practice competition, the Warner plays could not be brought to their highest state of perfection. In addition to their countless battles with the Varsity, the Grays engage in a number of games of their own, employing the regular War' ner plays, and enjoying all the benefits of competition except the plaudits of the multitude. For it is the fate of the Grays that they serve without glory. The hrst game of the season was with the St. Mary's reserves. The Stanford Grays, ably guided by Coach Hal Davis, did what the Varsity and Freshman teams had been unable to do, and took the little institution down to the tune of a I2 to 2 score. The Carf dinals ripped the Saints, defense to shreds in the first quarter, and scored a touchdown when May grabbed a pass from Taylor on his own thirtyfyard line and propelled himself down the field to a touchdown. St. Mary's scoring was limited to the Hrst quarter. A Stanford fumble resulted in a dash over the goal line to the ball, which was eventually recovered by a Stanford man, St. Mary's being awarded two points on the safety. Early in the second half, Rehrig plucked another pass from Taylor, and accounted for Stanford's second score. McCone and May were leaders in the victory over St. Mary's, and the former, a transfer from the East, has possibilities as a defensive player that may catch the eyes of the coaching staff next season. The Grays did not originally intend to meet Dud deGroot's aggregation of trained assasf sins from Santa Barbara, but when the Freshmen found themselves unable to keep the origif nal appointment, the Grays substituted. Snyder opened the way for both scores by blocking kicks. In the first period he smeared a Santa Barbara punt on their twentyfyard line, and Cohen smashed across the goal line after a few plays had brought the ball within striking distance. In the second quarter, when the visitors tried to kick from behind their own goal line, Snyder ruined it again, and Benf son recovered for Stanford's second and last score. By sending a pass over the goal line in the last minute of play, the California Reserves robbed the Grays of a victory, and tied the score, 6 to 6. Coach Davis started the second eleven in the fray, and held the Bears in midffield during the first half. The regulars went in at the start of the second period, and began in great fashion. Recovering a California fumble on the Bear twentyffive yard line, ' Q ' H :sn 1., rf the Redshirts heaved their way to the goal line, but were held for . downs when Groenewegen was stopped a foot short of a touchf down. Stanford's only score was made by Cohen near the end of ,. ,IM the first half. California scored on a sensational pass at the very end of the game. The members of the Stanford Grays were: E. G. Anderson, S. Arata, W. J. Bardin, A. C. Beeson, F. L. Bentzien, F. B. Bown A. R. Brown, K. Clagstone, L. Clark, P. L. Coats, M. M. Cohen E. C. Crimmins, R. S. Crowl, L. J. Devlin, S. M. Dietrich M. Doyle,T. A. Driscoll, G. A. Duncan, J. H. Fetzer, M. Fickert R. A. Goodcell, C. E. Groenewegen, J. Hollowell, W. T. Ingram G. P. Kimball, J. Lee, D. B. Lewis, P. Lowe, J. May, A. I. Mc Cone, J. W. Mead, R. Miller, C. C. Moomaw, C. T. Munson J. E. Prisinzano, H. Rehrig, R. W. Richardson, F. C. Ruling J. C. Snyder, R. Stephens, E. L. Stockbridge, P. N. Taylor, I-I. M Templeman, E. J. Wilson. The squad was coached by Hal Davis, tennis coach. Several of the Grays will probably be in Varsity uniforms next year, q-Tame, Wallace Denny thanks to their showing against the Varsity in practice. consistently, but the Santa Clarans showed themselves more adept in the art of recovery. The strange hoodoo which dogged the Varsity in its game with St. Mary's and Santa Clara seemed also to extend to the Frosh. Following the example set by the Varsity a few days before, the Freshmen swallowed a I5 to 7 defeat at the hands of St. Mary's. But the yearlings covered themselves with glory and played football as one does not expect a freshman team to play it. For nearly four quarters Stanford outplayed the Saints, and piled up a substantial onefpoint margin, but with seconds to play, the St. Mary's team sneaked a pass through and won the right to tear down the goal posts. Led by their newlyfelected captain, Pete Heiser, the Freshmen invaded the south to take a disastrous 22 to I3 defeat from the Trojan yearlings. It was a vicious game. Heiser and Moffat were both carried from the field in the Erst quarter, one with a broken nose and the other with a dislocated shoulder. Starting out with a strong offense, the Cards were soon handicapped by the loss of two of their strongest men. A fumble was converted into a score by the Trojans, and the war was on. Stanford scored in the second period on a long run after a pass to Tampcke. In the same period a twentyfiive yard penalty for clipping gave the opportunity for their second touchdown. Suffering through lack of reserves Coach Huntfs men were forced to take punishment in the fourth quarter from a fresh lot of Trojans, that were little inferior to the Erst string. The Cardinals, nevertheless, retained sufficient power to hold off all scoring in the last period. THE LITTLE BIG GAME An amazed crowd of fans saw but refused to believe that they saw a downtrodden, underdog team of Stanford freshmen grab California's freshman wonder team by the nape of the neck and pour down its throat a 25 to 7 score. Stanford came very near to scoring twice in the hrst quarter, and gave indubitable promise of the storm that was to break in the second quarter. In the second period, Hillman, moved from fullback to the halfback berth vacated by Moffat, snapped a pass to Winneck, who cruised thirtyffive yards to a touchdown. The storm had broken, but even when Hillman grabbed a fumble on the California twentyfiive yard line and led a march to the second score, there were still some who kept faith in a forthcoming downpour of California touchdowns. Many were unable to forget that the odds had been four to one, and that the Bear cubs had beaten the Trojans. But even the most staunch supporters of the Bears became dubious when, in the third quarter, the Stanford freshmen, with Dawson and Hillman alternating, paraded down the field for the third score. California made a feeble attempt to salvage the afternoon's wreck by displaying the power that had triumphed over stronger Q foes than the Cards. A series of passes and savage line smashes f were too much for the Stanford defense, and the Bears chalked ' I up their hrst score of the day. Although the try for goal was wide, the Cubs were awarded the point on a Stanford offside. In the last period, the Cardinals resumed operations and, with a few bucks and a thirtyffive yard pass from Hardy to Reynolds, gave Hillman the privilege of bucking over the final touchdown. Saunders failed to convert. Though the Freshmen experienced as many startling upsets as did the Varsity, they showed evidence of good Varsity material for next year. The loss of several preliminary games was comf pletely overshadowed by the crushing defeat administered to California. Had Stanford suffered less from injuries earlier in the Coach Husky Hum season, the record of games won might have been more imposing. f -fran - .1144ll..' ' l The Freshman Football Squad FRESHMAN FOOTBALL HOWING flashes of excellent football to win the first start of the season, the Class of 193 IQS offering to the gods of the gridiron slumped to lose three games-Santa Clara, St. Mary's, and U. S. C., and merely to tie the San Mateo delegation. With such an inauspicious beginning, the Cardinal yearlings were given a scant 4 to 1 chance to break even in the annual Little Big Game with California. After one Week of training under the surveillance of the Warner system coaches, the Freshmen pounced fiercely upon the 250th Coast Artillery. The entire regiment might have made some headway against the Stanford Babes, but eleven soldiers were only able to keep the Freshmen down to a IQ to 6 score. Those wearing the Stanford jersey for the first time in this game were Dawson, Moffatt, and Hillman in the backfield, and Tampcke, Heiser, Winneck, and Dick Bogue, brother of the notorious desperado, George Bogue. All of these men displayed promise, and should go far after the ragged edges in their play are I smoothed out. f ' ' '- rf ' r The Freshmen seemed to be a different team against the San Mateo junior Collegians. The peninsula eleven, vastly stronger than the milif tary team, held Stanford to a scoreless tie. But the weak points in the yearlings' play were rapidly disappearing. On offensive formations, the Freshf men went through their plays as smoothly as if they were Working out on the practice gridiron. Twice they threatened the San Mateo goal. Once they were vvarded off by penalties, and once they were held for downs. Bringing gloomy forebodings of later disasters, . 1 . the Santa Clara freshmen came to Palo Alto to do 1 , I L. battle with Stanford's young hopefuls. They ref if if . 1 l turned to Santa Clara with a rather fortunate 7 to S i if . . ,D , g ,L ' o victory. Stanford's heavy line became too pon' ,ff cz., jf f derous, and was unable to move around fast Q , ' ' F enough to stop the Colts. Both teams fumbled 'Captain Pere Heiser, Guard V ' , X R z kan.. Hojjrman steps coyly out of bounds as Sims blocks Pittsburgh tackler STANFORD 7-PITTSBURGH 6 UNDER a scorching sun, before the 65,000 spectators that packed the Tournament of Roses Bowl in Pasadena, Stanford battled Pittsburgh for the intercollegiate football honors of America, and Stanford won, 7 to 6. Pitt received the kickfoif, and after three ineffectual attempts to gain, Hagan got off the first of his long, beautiful spirals. An exchange of punts followed, until Stanford changed its tactics and carried the ball to the ninefyard line, where the Panthers tightened their def fense. There was no score in the hrst half, the ball seefsawing back and forth with brilliant playing on both sides. Refreshed after a rest between halves, Pittsburgh came back for its strongest drive on the Stanford goal, and advanced to the twentyfyard line, where a pass to Welch was knocked down over the goal. Stanford fumbled on its first play. The speedy Hagan was on the ball and had carried it to a touchdown before the Stanford backs could find themselves. Diminutive Walt Heinecke, substif tuting for Freeman, crept through the Pittsburgh line to block Booth's try for goal. Stanford scored in the same quarter, when after carrying the ball for the length of the field, the Redshirts paused for breath on the twofyard line. Sims fumbled, but the pigskin sailed over to Wilton, who himself put the balloverthe goal.Hofff A man converted, to give P ' - .,. ,iii . Walt Heinecke, Tackle Stanford a onefpoint lead. Dynamite Post, Guard , ii Y ,: ' : . . . ..,....,.- r,,.,.,...,....- . W ......----.-V..?...,..-,.-.,, gg., Y. ...E -.,, ' Trfiillilgl' ' ' ' N 'i s.--14,--.LH - I,-,--. if irq-5'-,j'g,fi'5e'-'g.,lj4F2fi?w:1'fif B 7' E-F if wiiiiifl 5 : E tri 9-2 2 nl W-I Tri, T' .g.,r-re P J-.HL Q A-i1'ii5rfEci?1c c? '- +?Qagai1f?c1.5uQf- iilflirfg. a. Q1 .l lf .I rw r ln ix Hyland is hernnied in and almost loses his sliirt 5 . , his teammates. He was replaced by Cook, who barely had time to participate in another I ' play as the referee's gun sounded the end of the game, and the Stanford rooters immediately v swarmed down on the held to celebrate their third consecutive victory over California. H The Lineup: I' i O 'l I Stanford California H Preston . . . . . L.E.R. . . . . . Phillips l Sellman .... . . L.T.R. . . . Coltrin CCD N Post ...... . . L.G.R. . . . Kaufman is McCreery QCD . . . . . C . . . Riegels K Robesky . . . . . R.G.L. . . . Schwarz lu Freeman . . . . R.T.L. . . . . . Green Ll Harder . . . . R.E.L. . . . J. Dougery l' Murphy . . . . . Q . . . . . . Evans 5 g' Hyland . . . . L.H.R. . . . . Newman I Hill ,... . . . , .... Lom ' I. Hoffman ...... .... F ..... ..... R . Dougery 2 l SUBSTITUTIONS: Il . Stanford: Muller for I4 Harder, Sims for Hill, , Wilton for Hyland, Heif i necke for Freeman, Vin' centi for Preston, Hyland Q for Wilton, Hill for Sims, Smalling for Holfman, Cook for McCreery. 'l l California: Koch for . Kaufman, Marcus for Tl Newman, Eisan for Evans, Fitz for Green, Cockburn for R. Douf lk gery, Barr for Cock burn l i OFFICIALS! Referee, Sam Dolan . , I, .A 'ff Y , Umpire, Ralph McCord, l . A 3 Head Linesvnan, A. IH. if ' i 'l Badenoch, Field judge, . Dick Hyland, Halfbaclg C. Cave. Chris Freeman, Tackle 3. t +-- M- - -- - --1. , . f , -,-i.- ary,-H'-L,.4:.: ,552-1-,T y,',L'g ,gffr --1-Ai'-1 f -+-f W f ' 1 4 - Wi. L f -Q ---' ' H-'fi ,, -V -1 V,-f Pr .4 f , ff- '- .- 1 1 ..-F 1 - ' - . i... .. i a-i '-.,. A . ... . n i,- . ., Q' , ,Ti'f3Q'.-.-?'L..-.-.- - T AM ' . wi.. 4 -, 59.4-'AJ H R14 -!.., ,' ' ' !x...h.m'-fc. .1 .,-'?C .r' 1,4 Yiqgkhi- vw ,i -, l uf, -- . ,W '., 1. '1f.,.a..,-a ' 1' , .4-J- . ,i -4, I., 1 -I -v - ...: .-- I Qui 5 :-'-be-its ...K 1'-Ar, i a-.j, v'lgl. 1 ', V , , ,if , -,,'f'al,,fT -- .i.... 1-Yrvv, 5 F' . 'L ' 'IH if-ir V ' , ,, .IJ,l, --.WY YW.-...F. H' -'v yhVL.-4-L-l-- 'I .J . ., ., 1..-.gn a... Murphy straightfarrns a Bruin tackler while the interference ploughs through In the beginning of the final period, Post made five yards on a peculiar guardfaround, sleightfoffhand demonstration. Hoffman demolished a trio of Bears in a twentyfthree yard sprint, then added six more through left tackle and six through right tackle. At this time the California fullback, Cockburn, was replaced by Barr, while Hoffman girded up his loins and prepared for fresh mischief. Hyland, thoroughly rested, replaced Wilton and slid through tackle for a yard. Sims tried the Statue play just once more, and made it worth eight yards. Hoifman decided to give it still another try, but finding no one handy to ref ceive the ball, carried it behind his back around left end for a touchdown. This was prob' ably the most spectacular and exciting play of the game. His try for goal was blocked. Hoffman was taken out for a well earned rest, and Smalling sent in as fullback. The stands cheered wildly as Hoffman made for the bench under his own power, and there were many who were bold enough to say that Nevers at his best would have been no match for him. With one minute left to play, Smalling made eight yards through center, and a first down in the next play. Captain McCreery, after playing the greatest game of his life, was helped off the held at this point, and given a tremendous ovation by the stands and by Perfect interference for Hyland on a drive through tackle Y Hoffman again! The tangy fullbaclfs plunges were the outstanding feature of the game completed pass, and Stanford kicked to Newman, who returned the ball fifteen yards to his fortyfthree yard line. Marcus, substituting for Newman, was stopped around left end. Two plays gained only three yards, and Lom punted to the Stanford tenfyard line. The Redshirts could not gain, so Hoffman kicked. Lom made six yards on the Hrst play, but lost an identical distance when Hoffman stopped him behind the line. Four downs and one yard later, Stanford inherited the ball. Hyland and Hoffman made hrst down in two plays. Then they brought up out of obscurity the old Statue of Liberty play, which netted a welcome thirteen yards. Two more plays failed to gain, so Stanford kicked to Lom, who was stopped in his tracks. And so the half ended, with Stanford comf fortably ahead. Little Lee Eisan, twisting his way sixteen yards into Stanford territory while engaged in returning a punt, started the Bears on their touchdown attack early in the third quarter. Marcus glided through somewhere for three yards, and Cockburn, in three bucks, created a first down, while the California rooting section became incoherent. Marcus made five yards, and then passed to Phillips, who was downed on the Stanford sevenfyard line. Lom tested the line twice, found it all there, and lost a yard. Cn his third attempt, he opened a hole to let Marcus gain six yards. Cn the next play, Marcus began a wild gallop around Stanford's right end. Wilton, who had replaced Hyland, anticipated the play and forced the Californian out of bounds on the threef inch line. Stanford punted out of danger, while the Stan' ford supporters heaved sighs of relief. Heinecke for Stanford and Fitz for California replaced Freeman and Green respectively. After an exchange of punting courtesies, the Cards took the ball on their own seventeenfyard line. Wilton and Hoffman made four yards, but when Hoffman tried to kick, seven Bears slipped through an opening in the line, Coltrin ni the lead. Fitz grabbed up the ball and went over for a touchdown. Heinecke ruined the conversion, which made the score 7 to 6 in favor of Stanford. Sims took Cockburn's kickfoff and returned it twenty' four yards through inhospitable territory. Hoffman squirmed through center for eighteen yards and a first , Y down on the California fortyffive yard line. Two more a plays gained five yards as the third quarter ended. NFTHHRH Wilton, Halfbaek Hojfmarfs consistent gains through the line were reminiscent of Nevers at his best BRAND new, shiny football, soaring away from the toe of Clifford Hoffman, brought 87,ooo spectators to their feet to watch twentyftwo young men charge down on each other with reckless abandon. California watched Hoffman's first kickfoff roll over the goal line. The second did likewise, and the Bears took possession of the ball on their twentyfyard line. Two losses, followed by a penalty for holding, forced California to kick, and the long spiral was downed by Hyland on the Stanford fortyftwo yard line. Hyland, playing his last Conference game, inaugurated the afternoon's entertainment by gathering five yards around left end. Hoffman added twelve yards through dead center. Hill made five yards more, after which Hoffman repeated Hrst down with a sixfyard plunge. The Card fullback took the ball twice more, but fumbled on the second play, and Phillips recovered for California on the twentyfyard line. Hoffman's continued jabs at the center portions of the California line were impressive and deadly. More than one onlooker breathed fervently to himself, Shades of Ernie Nevers! as the towering Stanford fullback crashed through again and again for long gains. Hill and Hyland aided in the grand march, and a long pass by Hoffman eventually brought the ball to the twofyard line, .where McCreery was injured and time was taken out. On the next play, Hoffman ticked off a yard. Cn the next, Hyland took the ball, but was stopped without making the necessary thirtyfsix inches. Finding, however, that only his legs were pinioned, he stretched out for a yard or so and deposited the ball across the last chalk mark. Hoffman converted, to give Stanford a sevenfpoint lead after five minutes of play. Following the next kickfoff, California marched from her own thirtyfthree yard line to Stanford's thirtyfnine yard line. Cn last down with a yard to go, Lom fell back and kicked over the goal line. Stanford carried the ball to a. first down on the thirtyffive yard line as the quarter ended. At the beginning of the second quarter, Hoffman smeared center for nine yards, and Hill added a yard on a reverse. Hoffman falways Hoffmanlj faked a pass and - i gleefully plunged through guard for six yards. Hyland . - . nicked tackle for three more, and Hoffman made it first Biff Hoffman, Captainfelect down with a yard buck. A penalty, a fumble, and an inf i... A .Ade:nihn'lfe.ssLnIBeiE1 wrlfglj . . r , l . - A arf: 'llffd-lgtxis' E'- -wik Tbjiit L E Njvwl ,-I Y. 1 -'Y -if ll:f',':F-,.'1:.':.'-,EJ Y 4.fg-- M- - . :' ' I ... '? 'fJ:'i17'I'i 4' nd.. -MQ Q g LQHH4' 'iiiiu 5 'fl'1iwl l!'l J I' 'Y'-Y' ' ' ' iBAN p',i2l2E.'SH:sQ Q iV :'AwZ.,4 ' ' 'l:k'3:1n'flK:a1'lv n ::g14.'.:ng.'-3'.-z- '- -.W 5. ..:'-'.-.f' L, 'is 7-11 r 1.-1 Above: A pancramic view of the enlarged Stanford Stadium, Below The 124fpiece Stanford Band pa- rades between halves. R1gl'1t: The Cardinal meg' aphone follows the ball mer the bar-the Big Game Serpentine. filled to capacity with 87,000 fans. Left: A tribute ro Cap' tain Hal MtCreery. Below: In honor of The Old Fox, Coach Pop Warner. Warner and his henchmen lay taxidcvmic plans for the Gal' den Bear at the Family .Farm while Cllightj the Varsity rests up for the battle. Right: Stanford Univer' sity, California. The Stan' fofrd rooting stunts were unusually effective. . THE BIG GAME OME thought the 1927 Big Game was confined to the afternoon of November zoth, but they were wrong, for speculation as to its probable outcome began when the final gun sounded for the 1926 contest. It was then that the first bets were made, and the first plans were laid for the postfgame festivities, and the interest and excitement lasted throughout last year, coming to a climax in Autumn Quarter during Big Game Week. Come join the band, and give a cheer for Stanford Red, sang the hurrying, halffrunning, halffmarching men on the night of the annual Big Game Rally. Freshmen, proudly taking part in their first one, started the parade from Encina Hall at 7 o'clock, and it wound up Arguello and down Lasuen, gathering rooters, until the doors of the pavilion were held open to the largest crowd that a Big Game Rally has ever drawn. The arrival of the team was the signal for a tremendous roar, which continued with few interruptions for the balance of the evening. In a brief talk that was the hit of the rally, Dan Evans, former student body president, announced that Captain Hal McCreery, eminent sign painter, was just the man to lead in painting an Indian sign on the Golden Bear. Pop Warner himself was the everfcautious coach, fearful lest his men grow overfconfident. Captain McCreery, Trainer Wallace Denny, and Bob Fraser, chairman of the Rally Com' mittee, managed to make their words heard above the roar of the multitude. Stanford songs and yells were strictly in order. As soon as the program was over, the crowd again pushed its way through the doors, this time to hurry to places near the bonfire. The tremendous pile, consisting of carloads of ties, shiploads of boxes, and quantities of every conceivable form of inflammable material, represented the work of the entire freshman class, and was tastefully surmounted by a huge coffin containing California's spirit. The bonfire was officially touched off at 8 :z7 o'clock by Murray Draper, student body president. In scarcely ten seconds the flames were licking far above the pyre. just as the flames were at their highest, the cars filled with members of the Varsity drove slowly through the crowd-the team was on its way to the Family Farm to rest for the battle on the following Saturday. There were spontaneous songs and yells, and wild serpentines around the fire, and the sandstone buildings of the Quad were thrown into golden relief by the leaping flames. Eventually the crowd dispersed, but the fire blazed far into the night. Ram's Head Society did its bit toward Big Game spirit by presenting the Gaieties on Friday night, November 19th. An appreciative audience, suffused with the rosy haze of prefgame excitement, watched and applauded a show filled with original songs and amusing skits, and embellished with an unusually goodflooking and wellfdrilled chorus. Big Game day arrived. So did streams of cars and people, and more cars and more people, until a sea of automobiles washed against the flanks of the stadium and spread away to fill every parking space for miles around. Palo Alto struggled with its oncefafyear traffic prob' lem, but by 1230 every one of the 87,ooo seats in the enlarged stadium was taken. The two massive rooting sections of Stanford and California stood out in startling relief from the mass of spectators, and changed color like giant chameleons. Radio station KFC which began the broadcast of the afternoon at 1130 was painting the picture for the unfortunate thousands who were unable to secure tickets. L'Well, folks,it's certainly a beautiful day. The sun is shining down into a stadium packed to the top rail with Stanford and California rooters. The bands are coming on the field .... Now there is a tremendous roar from the California side of the stadium .... The California team is comf ing on the field! Now the Stanford team .... Another tremendous roar .... The referee calls the captains together for the toss .... The teams are lining up. . . The ball is in the air! The 1927 Big Game is under way .... N. w 5 'N N Q , N ': N , , i , w r K , , 1 I W N W W. ,, W K 'I I N f-' 1, 1' N , 'i f L w N L L. N STANFO R A LIFORNIA6 ,L-..,1 ,I ',...:,h.g7,-'3'-fL ' --:gg -1: L ,.'Cll:j.?4A-Y-Q,-if-.ww - ' 4i?T, 'S nr - ,'1 r N ' 'N 1, V P-' Yqv' W ' 1 Y L - I S 'TW' ,ilkfbl ,',',: Wm, ..- 'Q' r , '.. m.- I, , II- X, ,,I'.-E,-, l,.' L l 1 EJ ll,a'q,---AJ-'35 142- '. . - r. qi gf.L.'W 'q,1,l7T,g'il ' F , ' Q 4' 'g',Qp' ' 3 5 Qi QF.l il'f'fl lI'I,,l!:, 1 ' -3 , 5,1 uf Lt' l.'75ih... 55' -M4-.ajjf--, , ,,,,, w:,.,g3?'v..1.af .Us.. '5'- af.-9 f.-4 ' Nl Frentrup drops back to pass while Santa Clara. threatens STANFORD 6-SANTA CLARA I3 LET'DOWN after the hardships of the Washmgton game a week before, the absence of Pop Warner from the bench, and of Captain McCreery from the field, and a dan' gerous overfconfidence all contributed to an inglorious 136 defeat at the hands of Coach Adam Walsh's Santa Clarans. Opening with a kicking duel between Cummings of Santa Clara and Frentrup of Stan' ford, the Broncos gradually worked the ball down to the Cardinals' thirty yard line. Here McCormick tossed a pass to Cummings, who ran through the Stanford defense for the first score of the game. McCormick failed to convert. The second quarter brought the expected Stanford comeback, with Sims opening the attack on a reverse play. Two long passes and a buck by Fleishhacker accounted for the score. Lewis' try for goal was blocked. But when the hrst strmg marched out in the third quarter, the Stanford rooters saw the Bronco defense hold, and the offense plunge through the demoralized Redshirt line. A seventyfhve yard kick from Simoni made the second Santa Clara score a certainty. A frantic, lastfminute rally on the part of the Cardinals was hopeless. Hoffman's passes over the goal line were knocked down, and a surprised but jubilant Santa Clara rooting sec' tion swept over the field to give due honor to the victors of the after' noon's fray. After this second def feat at the hands of .a non f Conference team, v Stanford supporters had very little to say. Probf ably the Santa Clara game was the most f avoided topic of conversation dur' ing the season-avoided by everyone but the San' Al Cook, Center ta Clarans. Luci Fventrup, Halfbaclg TT VLTT - -T' S C' VTT CTZZTT S-if--'-ii: me QS TT?- ,W , X, - Q.. 1. .. 1 ,I X gl LIL., ,. ..- - 'TQ ---f ' , -l ' Hyland sidesteps as Husky tackler coasts by A brilliant display of line bucks and passes from a kick formation were too much for the Cardinals, and they temporarily retired from the scene. Tesreau, Carroll, and Captain Pat Wilson, who led the northern slaughter, did noble work, but their strenuous efforts tired them more than the onefpoint lead deserved. The heavy, plunging brand of football played by the Washington team had a telling effect upon their play in the second half, when the relatively fresher Stanford Varsity evened things up. Thus, when Stanford elected to start the pyrotechnics anew, the exhausted Washington backs were unable to cope with the situation, and the tide of battle turned. Entering the fourth quarter, the Cards were obviously determined upon some effective plan of action whereby at least two points could be gained. A Held goal, with a prospect of three points, failed. Lewis, Stanford quarterback, grabbed a Husky pass from the air, and in two plays, saw it carried to the Washington thirteenfyarcl line. A penalty and four bucks failed by six inches to make a first down and Washington took the ball, while the Stan' ford varsity hitched up its eleven rnoleskins and prepared to iight. Cn the first play, Tesreau, standing behind his own goal, hurled out a long pass that fell incomplete way out in the Styx. Stanford called time out, and huddling in the mud, decided on the best practical method of blocking Washington's kicks on the four yard line. - Cnce again, the Huskies lined up, and this time Tesf reau, who took the ball, had honest intentions of kicking. But luckily enough, the new Stanford system functioned perfectly. Biff Hoffman crashed through the line and buried the Washington halfbacks in the slime. The two Cardinal ends, galloping around the corner, found little or no opposition, and flung themselves at the ball as it was leaving Tesreau's toe. Harder was elected, and with great satisfaction felt the mudfcovered ball bounce against his belt. Then, folf lowing the soggy pigskin as it whirled around behind the Washington goal line, Vincenti pounced upon it to score the winning touchdown. Cn the line, Captain McCreery, Sellman, and Free' T man covered themselves with glory. Most of the heavy ' Washington attack pivoted around the tackles. johnny Preston, End , 1 l 1 i I l 4 Hyland splashes down the yield from kick formation STANFORD 13-WASHINGTON 7 LAYING the entire contest without a fumble, despite a wet and muddy field in the Seatf tle stadium, Stanford defeated University of Washmgton's Huskies and advanced to first place in the conference standing. Ted Harder, Stanford's renovated right end, made himself hero of the battle, when he blocgiredlthe kick that brought the laurels of victory to the mudfencrusted brows of the Car ina s. Harder's return to the game greatly strengthened the Cardinal offense and defense. His plucky playing featured the early season games, and when he was seriously injured in the St. Mary's contest, it was feared that he would be out for good. He surprised everyone by insisting upon going back into the game before his injuries had completely healed. Three times in the first quarter the ponderous Purple and Gold machine drove its way through a Stanford eleven that tightened only when the scene of action was staged near its own ten yard line. Gnce a pass was incomplete on fourth down, once Cap' tain McCreery scooped up a Husky fumble, and once Hyland intercepted a pass. Though continuing to outplay the southerners, the Washington eleven weakened momentarily in the second period, giving the longfawaited opportunity for a Stan' ford score. Tesreau, Husky halfback, fumbled a pass from center, which so rattled this rangy gentleman's composure that he sent his kick out of bounds on his own thirtyfyard line. Hyland, dropping back to pass, found a veritable menagerie of Huskies surging toward him. He turned to flee, bi t first sent the ball soaring in the general direction of Tacoma. The pigskin, however, did not reach the northern metropolis, but was intercepted by the caressing arms of Preston, who ambled over for the first score of the game. The try for goal failed. Between halves, the Husky warriors were given a conf densed lecture on the ways and means of offensive foot' ball by the learned Mr. Bagshaw. Therefore, when they once more established themselves on the soggy turf, they at marched seventyfone yards to a touchdown and additional point without even the suggestion of opposition from Mike Murphy, Halfback the Stanford team. 1:32:15 O Y Muller takes ball on typical Warner endfa'round play STANFORD 19-OREGON o oa three quarters, a smoothfworking, hardfhitting Stanford varsity ran at will through the University of Oregon Webfooters. In the last quarter it barely retained the IQ to o lead it had acquired. Twice in the first half the Redshirts crossed Oregon's goal. Muller, Stanford end, paved the way for the first touchdown when he recovered the ball after an Oregon fumble and carried it to the Northerners' Hvefyard line. Frentrup nudged himself over for the score. Stanford scored again in the second quarter when Joseph capped a march from midfield by crashing over the goal line. The Redshirts held even more of an edge in the third quarf ter when a Frentrupftoflvluller passing attack drove the Webfooters from the field and counted for the final touchdown. This unheralded passing attack, coming from the wrong source, temporarily disrupted the Oregon forces, but at the start of the final period the Webfooters returned from their retirement. The Oregonians, considering themselves badly treated, set out for restitution, but they made poor work of it. Their farffamed passing attack proved to be a comparatively inferior exhibition, but it assisted in enlivening the afternoon. First there was a pass, starting six yards from the Stan' ford goal line, that Frentrup, startling sophomore, just managed to spoil. But this did not Hnish the Oregon threat. One minute before the end of the game, the Webfooters were driven to their own twentyfeight yard line, and un' leashed their last pass. It travelled ten yards, landing in the arms of Burnell, who found himself between the Stanf ford goal line and all the Stanford football players. He started off with Riese in hot pursuit, and ran for fifty yards before the latter overtook him and dropped him a few paces from the goal line. A few moments later the timekeeper's gun saved the Oregon aggregation from 1. . V . - w, iv W 1 .lcv . a worse defeat. ii 1 '-in Between the halves of the game, the Hammer and p p Collin varsity amused the spectators by staging a contest i S O T 'TTT i with the Stanford Daily eleven. 'i'TiHy 5Cllmf1H, 77167116 f.. , Hill pauses in midfair Wilton begins to cut in STANFORD zo-OREGON STATE 6 THREE Stanford touchdowns, each scored after a sustained drive, supplied the enter' tainment for the handful of Cardinal rooters who made the trip North to watch Oref gon State's championship hopes buried ni the sawdust of the Portland stadium. According to gridiron experts and the doubtful mathematics of comparative scores, Stanford should not have defeated O. S. C. The Northerners had a passing attack as farffamed as the aerial feats of Pittsburghg they had Howard Maple, the most elusive quarterback since the days of George Guttormsen of Washington, but Stanford won, and won decisively and easily. In the first quarter, the Redshirts tramped sixty yards to a touchdown. The routine was simple and easy to follow. McCreery gave the ball to Hoffman, Hoffman gave the ball to the refereeg the referee gave it back to McCreery-that was all. In the second quarter, after two excellent demonstrations of the art of intercepting passes and running diligently with them in a given direction, Stanford scored again, while the Portland football fans gnashed their teeth, and both of Stanford's rooters cheered hoarsely. An intercepted pass again put the Cards on their way in the third quarter. Hyland plucked an Aggie pass out of the air and romped to the O. S. C. fortyffour yard line, where the Stanford eleven un' covered a bewildering deceptive attack which left the Northern team in a complete daze. Sims, substituting for Wilton, scored the third touchdown. Late in the last period, the Oregonians recovered, com' pleted four passes, much to their surprise, and came perif lously near scoring. Stanford held on the twentyfyard line, took the ball, and attempted a reverse. The ball was fum' bled, and Carlson of the Aggies brought back memories, of his famous California namesake when he scooped up the ball and trudged to the twofyard line, where he was def tained. A pass over the goal gave the Aggies their lone touchdown. The brand of football played in the North depends largely upon weight for its success, for the chronic wet condition of the fields makes a fast game impractical. The , ,-,Iii-al,-. 15,5 ,.,, i,1,1g.,.g-1.55, Warner system was a revelation to the Aggies, and prob' s 'fr-N .frl . ,f ,,'-' ig ',?'.q'.1f.ri,.45,l.., ,QM . . . V ably intimidated them to such an extent that they could fx- W -A . .A -V -N1 , g ,A --. a-.. ,.. m-a-L:1.. Don Hill, Halfback make no headway with their passing attack. Referee registers amazement as the mighty Drury is stopped With the score tied at half time, speculation was rife as to the outcome of the game. The spectacular playing of Morley Drury had surpassed all expectations, and the final outcome of the game seemed to depend upon whether or not that gentleman would last the full four quarters. The Stanford defense at no time adequately stopped him. Beginning the third quarter, the Trojans kicked off to Hyland, who received the ball on the fivefyard line and started moving. As he gathered speed, tacklers slipped from him, and he reached midheld before he was brought to earth. Stanford could not move farther, and was forced to kick. Drury and his associates once again slammed themselves at the Cardinals, but relinf quished before doing anything dangerous. Drury kicked over Stanford's goal line. A conf troversy ensued, after which somebody decided that a Cardinal had gripped a Trojan jersey, and therefore the Trojans could have the ball on Stanford's ninefyard line. Drury carried the ball over in two plays for the Trojans' second touchdown, but Hyland prof tected Stanford's future interests when he arrived in time to block the try for point. Early in the last quarter the Trojans passed and cavorted around the ends, until Lewis intercepted one of their passes and struggled to the Stanford fortyffive yard line. Follow' ing the accepted tradition, Hyland got off a pass to Vin' centi, who was downed on the U. S. C. thirtyfive yard line. Hoffman was forced to kick, after another pass was unsuccessful. In a mad scramble for Drury's fumble, Wilton was found under the pile with the ball clutched to his bosom. Cf the many passes that were thrown frantically by the Stanford backfield, none reached a suitable destination until Sellman leaped out of a cluster of players, and broke up an exciting volleyfball game by grabbing the ball, and shoved his way to the Trojan thirtyfyard line. A pass to Vincenti gained nine yards, and then big Herb Fleishf hacker was sent in for Hoffman. The two lines moved closer and closer to the Trojan goal as Fleishhacker flung himself at the tired linesmen. With twenty seconds to play, and three yards to go, Warner sent in Patchett for Hill. And then the Trojan line, braced for another charge of the giant fullback, saw Fleishhacker swing an easy leftfhanded pass to Vincenti, who stepped over the goalfline. Murphy failed to kick --Don-s Robesky Gumd goal, but nobody seemed to care. ' .Q-. A A fur Q ., 4' J- ' : .'AL r.'X ini 1 .. Q .. . 1 l Don Hill navigates around left end Spud Lewis gallops past 'Trojan defense bounced around on the grass, and he scampered with it over the goal. U. S. C. converted to take a seven point lead. The quarter ended with the next kickfolf, and the Redshnts were able to gain respite enough to start nefarious activities of their own. Starting on its own twentyfyard line, Stanford advanced to midfield in two plays. A pass to Preston added sixteen yards more, while Hoffman and Davidson filtered through the temporarily dazed Trojans as far as the elevenfyard line. But here the Cardinals stopped, losing three downs and six yards. On the last down, with fifteen yards to go, Hoffman passed over the line to Preston, who juggled the ball all over the end zone, finally spilling it on the turf. Once again the tide of battle reversed, and the Trojans battered the Redshirts farther and farther back into Stanford territory. But this advance was stopped, and Stanford acquired full possession of the ball on its ten yard line. Stanford seized this opportunity for repetition of its big display of the first half. Sims took the ball and plunged into the line. The plunge, however, became a tour, and Sims ended up sixteen yards farther on. ' Only one more play was needed to make the drive complete. Wilton supplied this when he grabbed a thirty yard pass from Hoffman from right under Saunder's nose and chugged slightly over forty yards to a resting place on the far side of the U. S. C. goal line. The score was tied when Hoffman converted. A Southern California passing attack was interrupted as the half ended. Between the halves, Stanford rooters provided a large and colorful variety of stunts for the edification of the spectators. The Trojan Horse, the State of California, and various other designs were worked out in colors. The giant Trojan band paraded, looking like a swarm of yelf lowfjackets in their brilliant uniforms. The Stanford band made an equally impressive spectacle, and gave the crowd an unexpected thrill by releasing a number of pigeons, which fluttered around the held and invaded the stands, while the aeroplanes roared overhead. Cne of the features of the day was the Southern Cross, the gigantic threefmotored aeroplane, which spent the day flying over the Stadium. Later this plane attempted to Herb Fleishhackef, Fullback break the world's endurance record for sustained flight. -.'-,.- f .. - .L ga J-1. -M 5, --- , ,,...,4?-- W, DJ.. Y Y , -.- -,, , ev-af., ? ..' QL . ,. , . ' -. 1. . l....s .l 1 . A 11-.f-'A v-S-' -,rf . . 1 . 1 k'14 Tj '-. 'v V tilrffffigffqi l l T il 1 T-5 iff-', ij 1, Q l l,fg'T.fi? 3j.l ' 4'1.l1 7 All i' ri-5'5 li lib '11 rg -1. 1, r iigLT:L,.,1a ff ' : : .: fgzflf 'f-313. L W ' Captain McC'ree1'y exchanges greetings with Captain Drury STANFORD rg,-SCUTHERN CALIFORNIA I3 IXTY thousand spectators came to Palo Alto to see the Pride of the South, Coach Howard Jones' Trojans, scramble the championship hopes of Stanford. The same sixty thousand left the stadium in a state of mental and physical collapse. They had seen a Stanford team pounded unceasingly for three quarters by Morley Drury, Troy's AllfAmerican quarterback, until it was wilting under the attack. And then in the last few minutes of the game, that redfshirted eleven stiffened its defense, pointed its offense with a deadly overhead attack, and with ten seconds to play, blasted Southern California's dream with a touchdown. The Trojans had the Redshirts cooped up in a far corner of the field until those bombshells from the skies, aided by a marvelous exhibition of pilefdriving by Herb Fleishhacker, sent the Southerners back home with a mere 1313 tie. It was a moral victory for both sides, but neither won. Stanford received the ball on the Hrst kickfoff, and before the teams had even squared off their lines, sent a forty yard pass down the sidelines, which fell incomplete by a scant yard. The Cardinals could not advance the ball, and gave the Trojans an opportunity to demonstrate their tactics. For the rest of the quarter it was all Drury and Edelson. The latter, Trojan fullback, did considerable damage to Stanford, but it was nothing compared to the sabotage of the quarterback. Drury's deceptive hipshifting, and his general allfaround power, behind the sweeping interfere ence of the veteran U. S. C. backs, counted for yard after yard through the Stanford defense. ' The Trojans took the ball on Stanford's fortyffive yard line and with a minimum of difficulty, carried it to the thirteen yard line, where the Redshirts, made' desperate by the shadow of their goal posts, stopped the advance. Wilton kicked to midfield and the Trojans once more started their parade into Stanford territory. This tirne, however, the visitors could not repeat their first drive, and were forced to kick to Wilton, who ran the ball back to his twentyfseven yard line. Stanford took time out. On the next play Wilton was nominated by the huddle to carry the ball, but he brought it only up to the struggling mass of players at the forward wall, where the pigskin dropped from his arms. Saunders, UQ S. C. halffback was one of the hrst to reach the ball, as it Bob Sims, Halfback ? Mill... -- -.,,... ,. , , , ,-.. . L,.., t,....--..--,.:q, .-.---P-.-f.5j--,ia ,a Lg .. f -'ff ', , A-ffm-13 ' nr-All-,V-Wfur.. - H l ,1. - .f.:I -L .w ' ' fu... ijlFH TT V - O ' , , ..,,r,,.-, . -' ls -1-.I 2.3. l.,,,'. W U . . . . , , , , I -'ui'4 f ,I-' f T .. 2.51 3 ' Riff 'fl J' . . ' 5 . 1' .Y t ' .J if I ' 7 . , f ' ' P f . .ff ' ,fr , , .f .- 1 . . F 4 1 i F- 1' ' 731' ll. Z r A ry Y . . 1 ,' I ' Y -'A . 1 . . , . l' 9 . H - .' ' ' . . , , U1 ' -sw? ,L s ' i. g 'Ll '40, 1'4- ' 1 -A I ' ' T ' WT. 'T 'iw ' 9 I 2 1 5 I. If 'U xJ',-4-JJ i ' ,v 'l' ' ! 'lf 'f T' -' ' ' ' . V . -, 1, ,U r vi ' 4 1, 4 in in tyfd I 'Y ' I V l . I . I A' I K ..-W 2 -. . E 5- . f -if: -lv 4g ' V 'H ' , s 'e x , 4' A- ,, +P . - Q R ,- 4 5 , lk - , N, :jg-'1 - T Q at if Qi, -if J Qa i I ,Y M., ,M,,g-.-, I J 3. l--, , ' ' - - - . , , - 1 f 1 5.- .. . W.. , ,--. - ' r ,I ' f V A W. in ' ' ', 7 ' jig .H 'f ,. ....,.4 24- . .a- 3,4 .-'41-f.-'sap ' --ff ' gy... -se ' ' ,. f 'r: ' .V-Min v- 'f- :g.:.-. ,Af-gifs.:-it:.1?fgi5k1:31. - gg if full 1 T, .ag et.-'i-3 A as-L . za A-'lTni1fQ :5. 'ewiiv- 3 ' l'7Ef'--.rib'4ff.1f-'Eff-.-ii11- ' gli ' f:'7l.,?'5' fiiffhf su- .- W ....-,-.- -A-:sas-e..-1,. -1.6.1 .- f. -fp .-ff - f- .S . . . .. , . V. . A V 1 -13.11 -31i ?f'vwLfs.:4532Sf','-rep:i5f.i??a'l'i?-'15' ' f -:. 17' - 'T ff' swf - . .. . . , ,,. , .-,.,,., . , . -. .I , , , .,. . ,, L.. ,. .. - -fr'-'S'1L,A f ZL-11225-iff.-L1:.3L'3i 'sE F': 'f,. . -..-.V -hgh - --1-. 1 .. -.ues i 1' . ...4:.:.2'awLri? Nevada Wolfpack closes in on Wilton STANFORD zo-NEVADA 2 MERB zo to 2 victory over a team that a week before had gone down before Nibs Price's Golden Bears S4 to o was a discouraging game to take from the Nevada Wolff pack. Only a week remained before October 15, the U. S. C. game, and the start of the conference schedule. For three quarters the Stanford backs occupied themselves in Nevada territory, but could cross the goal line only three times. In the fourth period, when the entire first string was finally put in the game, Stanford crossed the fiftyfyard line but twice, and on neither occasion did it make a prolonged visit. Starting a parade in the second quarter at the twentyffivefyard line, the Cardinals, led by Biff Hoffman, scored in fourteen plays, incif dentally making live first downs on the excursion. In the same quarter, Wilton got another march under way when he ran back a Nevada kick for twentyffive yards. A reverse, and two twenty yard passes from Hoffman to Vin' centi and Murphy respectively saw the ball safely over for the second touchdown. Hofff man converted to make the score I4 to o. Again Stanford scored, this time in the third quarter, when Fleishhacker pierced the Wolfpack line for nfteen yards in three downs, to end a seventy yard advance. For the remainder of the game, the Cardinals were not only kept from scoring, but were lucky to keep their lead. Twice the Nevada eleven came charging down on the Stanford line. Once it was stopped by a fumble and once by an intercepted pass. With but a few minutes left to play, Stanford tried to punt out of danger. Frentrup, standing far behind the line of scrimmage, could not get the ball away before Cooley had come in and batted it across the goal. The referee def cided that only a safety should be awarded. The redeeming feature of the game was the punting of Frentrup, the linefhammering of Fleishhacker, and Stan' ford's defensive work against an aerial attack. For many, the game was disappointing, coming as it did a week before the decisive U. S. C. game. The San Franf cisco newspapers gleefully predicted that Stanford would have little chance against the Southern University, 'land Spud Lewis, Qumefbacli the fiction of comparative scores was worked overtime. . , Y I it .. i., Hyland in the clear while McCree'ry bites enemyfs shoulder STANFCRD o-ST. MARY'S 16 IXTEEN fumbles in sixty' minutes of play offered St. Mary's a slovenly victory over Stanford, and the Saints accepted-with a score of 16 to o. Starting on the opening kickfoff, when Smalling juggled the ball around the field, the Saints were a relentless pack, following the pigskin in all directions. Being able as well as willing, they soon had the ball deep in Stanford territory, and tried a placefkick, which went wide. The Cardinals took the ball on the twentyfyard line, but lost it on the Hrst play, when Captain Larry Bettencourt scored the first touchdown for the Saints after recovering a Stanford fumble. In the second quarter, the same formula was applied, with equally efficient and disasf trous results. A St. Mary's try for field goal failed. Stanford took the ball on the twenty' yard line. Stanford fumbled on the first play, St. Mary's recovered, and another touchf down went to the Caklanders' total. After the score, Wilton took the kickfoff, and paced off seventy yards before he was inf terrup ted. Four hard smashes netted a first down on the thirteenfyard line. Ten more vanished under a short l pass. Then four slaps at the line saw the Cardinals still on the wrong side of the goal. St. Mary's concluded its offensive program for the afternoon when it finally managed to hoist the ball through the goal posts from somewhere out in the mass of strugf gling humanity. Spud Harder, end, sus' tained a badly injured jaw in the melee. He was out of competition for several weeks, returning to play in the washing, Louie Vincenti, End tOn game. Spud Harder, End Vincenti eludes Olympic Club end STANFORD 33-FRESNO STATE o STANFORD 7--OLYMPIC CLUB 6 FTER witnessing Stanford's first football game of the 1927 season, in which the Car' dinal eleven bestowed an avalanche of touchdowns upon the bowed heads of the Fresno State aggregation, fifteen thousand people remained to see the varsity scrape a one' point victory from the Olympic Club's notorious collection of former collegiate heroes. Sending the Famous Sophomoresf' last year's freshman eleven, into the fray, Coach Warner watched the Class of 1930 at least keep everybody from scoring. Heinecke, Rothert and Frentrup proved themselves capable of handling even such notables as Kaer of Southern California, Cowboy Kutsch of Iowa, and Casanova of Santa Clara. The first string, taking the field at the start of the second half, was heartily welcomed by a Club touchdown, scored after a fiftyfyard run, a few passes, several penalties, and a blocked kick thrown in for good measure. Bogue, a former Stanford star, once again gave his teammates a boost when he sent his try for point in the general direction of the players' bench. He was given an ovation by the Stanford rooters and bowed gracefully. Then Stanford scored. Taking the ball on their own twenty f five yard line, the Cardinal cohorts marched in perfect for' mation to the Olympic Club goal, and then stood by while Hoffman gently boosted the ball over the goal for a substantial one' point lead. Twice was that lead threatened, once at the start of the final period, when Bogue's try for a field goal bounced up against the goalfpost, and again at the end of Stanf - I A r ..-' kj' - ' ' ford's second sustained , J -4 12 ff H--C Hodge Davidson, End offense. uDo'n Muller, End . - . I THE 1927 SEASON By Milton Silverman HE football season of 1927 marked a change from the heavy, plunging team of past years to a light, fastfcharging, deceptive Varsity that eventually planted its foot on the necks of heavier, more experienced opponents. At the start of the season, there were two gaps on the line, left by the graduation of Ed Walker and Ted Shipkey, that promised to give Coach Warner and his staff conf siderable trouble. The loss of Captain Fred Swan and George Bogue had elicited sighs of relief from the ' ardent undergraduates of California and U. S. C. What Warner and his assistants did with this apf parent dearth of material is history. The outlook for next year and for several seasons to come is promisf ing. With spring practice well under way, Pop Warner sees such a walloping amount of material on his shelves that he announces two Stanford Varsities to sling against next year's foes. Six members of Pop's regulars sent in their regrets at the end of last season, nearly thirtyfsix are already scrapping for the vacancies. Heinecke, Cook, and Vermilya are the outstanding contenders for Captain Hal Mc' Creery's post at center. Heinecke, a deadly little sophomore, has the edge in the race unf less he changes to guard, where he would struggle with Bogue and Bigelow of the 1931 ' eleven. Sellman, Post, and Robesky will be back to handle their old positions at tackle and 1 guard. Harder, Preston, Davidson, Muller, and Worden will continue their endless battle for the end positions, and will be reinforced by Tarnpcke and Reynolds of the 1951 team. Mike Murphy leaves a red void at the quarterback berth, but with Crary and Jack l Murphy on hand to help Spud Lewis, there should be little trouble on this score next year. 1 Hyland, Hill, and Patchett are gone, but Wilton, Sims, Frentrup, Simkins, Riese, Clark, Y Hillman, Dawson, and Moffatt will carry on at the halfback positions. l Captain 'LHal'l McCreery l, T , l l 9. 11. l ll .Lil rl 'l Thornhill CLirze Coachl Warner CHead Coachj Dick Lowry Blackburn I Assistant Coachj Winterburn fAssista'nt Coachl 'Football Manager I i-T fl ,f- A '-1 THE 1927 VARSITY t By Glenn S. Warner HE Stanford football team of 1927 had a somef what inconsistent record. It did not lose any of the Conference games and tied the Univerf sity of Southern California for the Conference chamf pionship but lost two games to nonfConference teams. The defeat suffered at the hands of St. Mary's was not due to any lack of effort but to numerous fumbles and mistakes which were converted into scores by St. Mary's. The latter made only two first downs and could not have scored but for Stanford's loose play. This was an early season game and Stanford's plays were in a crude state of development. The defeat administered to Stanford by Santa Clara late in the season can not be explained except by adf mitting that the Stanford team was the weaker team M that day and lost to a superior foe. The reason Stanf Coach HPOP Wamef ford was the weaker team was due to overconfldence and the lack of wholefhearted effort. This game was a good illustration of how a strong team may be overcome by a supposedly weaker, but harder lighting one. Luckily Santa Clara and St. Mary's are not Conference teams, so Stanford's defeat at their hands, while humiliating, was not fatal. When the IQ27 Stanford Varsity realized that nothing short of its best efforts would prevail against its opponents, very good football was played, and the victories over the University of Oregon, Oregon State College, Washington and California, were the result of fine playing and an irresistible fighting spirit. This fighting spirit also enabled Stanford to come from behind and hold the University of Southern California to a tie. In the post season game with the University of Pittsburgh, considered by many as the best team in the East if not in the whole country, Stanford gave an exhibition of champion caliber football and clearly outplayed the representative Eastern team. Stanford's versaf tility, deception play and sturdy defense were the main factors in that well earned victory, and it is doubtful if any team in the country could have defeated the Cardinals that day. I - ia The Stanford Varsity Football Squad F f0 OTBALL 1 v', X 'algal 1 , 2 s 1, any I I M69 1 '14 1-a ,- r 1 '.L E' Q1 4' 3 76 fb. ff. .I 5 fue. f' -LJ- I r' SV k 2+ Q92 ,ib- 1 a ir' 4 1.w A 741 I ' 1. ' l. l7ffj,,fg-r .vi J . .e 4' wwf F,-' I N ' 1 .,.. A f 1 ff. fr.-.1 rf.. -ffl -, M' ew wr 'M' 114, v 'W x. K L f s . .fzff ' .r .x bf fi' 1 1 rl w wwf, 7' Nz.. ow ,,, 1 -KW 5 -f ' YV' Z PN I fs, 7. . 5 ix! y xxx' . ,., A u1,. .-., he A -gb, . ., .. 1 'V' f 11-xx. ,R 1 M 1' -!,,p,3x. .4 MN S 1 N, uv .H 1, 5, 'Q VP 'NV2 NJ I .2 if Cac'-f 1 j, iw ,r .J 1.-, - N L -. .1 4' 'T'-S: .lx rw, S' f'6x'g1k 112151 1 Q- Yr Y'X-Sf? A , , . v, 'ww .mx , .X -v' ,1 Wig :5'..klf THU.. w. 4 ,if '14 Hx '..K.,Qf if--'-.,.J vm, .1 n,'m'w. ,Qi 'IH' v--Q. 'S-vh-mf ff.. 32 4 Txlf.-U' td . fl? U. g -cn,.,,, x-1 Ko: V qw I, f 1,2 af, 5' 4- 31:41 4-P? a I lx fphg' 1' 015'. 1 J' 67? I , ,N ' 'Ill . un-' xg. .Hem 1 u 410 ' 'P P 'fa I I .Q n o P 4 4 vnu' C14 . .W 1 ol, . cl or If f '-' 4 47, ' nv N I ' mg!!! sw' N - 4... . . 14 'ay Nga, 'U -,ff 5 5 :qgsg fu me 149 U ,O 11 vu r Q. ,aa nn., L 4 - 4 .-. lurk. . ,ilggguh : , .Ml .. . ,146-,. . . fifvf with N - -Lx. .1 , wh M, ,P .H fu V J J 1-1 r 'nn Il 1. 1 ,M f. ,nf 1 W w vu' 1-4, .- L Jhfwr . vu' 7 alln ffl ,,,-4 .1 '-A 1' 2 .Q , .A ,yn rv, . ru '13 'nf F p ' 'px 'A 49' N .u .' 'r ' 1 . J xufw- ' 1,- - -mv? up 4l,1A gf :mx 4.5. I4 , . ,., , .. A s Wx am. -1. - I . fu . lm A - r I 5' -.'1fJr' 'n MA:-iL1'5'E'f' fir?-G-'uf- 4 lvl bi' 4 nd N2 1, ' 'gnaf .: wa ,,r 1 M15 lg. K- 1 4 , u vw,- ' . , N4 1 Q 5 v D .w.-N A H' 1. ,. if 'Zn ve, 1.5 1, f 1 V ve 'P ' I -.1 v.-.v' 4 1 f 1 gr we 1 1 . ., . . va .ww I v , MA,uA.,'? x,J1 . c A - Q-522'-MW M1 -5 . ,Xara-QL g.7Ahgx:gg3ww' A 042,410 'Pu ,Jq Wil! 3' Q W U' 1 ' 1 ,. -4 - w .. Q :nf-w - iw- , . r ,,p.'g4,5 1. ,v x v. , 4 , 4. lr gl g ' ' U -viii. 4. , Q' v sul ' P ' 1 M. ,RHF 9 9 he . ' 1' 1 . . rg 1 , . . , ., ,M ,, 4 . x 'X -72 1. J'- 2 Sf' 43 M1-rs M3 r :'xf-CH .Z fix-K. we Q. K, ll 415.11 0,64 4 , vw. mga, Y s Q I M mlilk .B 'S' lf ' 1 ? 'W' f '- . W. --. L- --- x x ' ' 5 -alma' , .W-L' . , ,,, - uns, , , 1 -N' 'uv 'x 1.5 Q , 1 I N 1 V W- '1 ,-.4 x L: .4130 X 4' 5 :D .- , --f' QQ, L 0 ,-.. r 1, Q Ill' 1 Y - :.- -1, fe -1, 4 31' K ,-., ,J s V-Z, W. 9 fn ,ff ,Al' SEQ , v 0,1-Q' I A gf. :Jar Av v 5 ' ' 4 1' 441464 7 I .4 4 I . .mv ...viii 1 X 1 A K, 1 L ws 1 lln.f-m ar , 5- 1 ll I ,' . -, 'O , ' ' as-af S W L r wg... 4. v bn '1 A Q og fm nv, YW lgfuvgnn' J: ,Q 'Q Y 1 ll' 'W' nifkf' FM 2. 1 -fn. e' , in 4.1 f., X :.4 '5Q1fm'1!' ff .vu-q 1 .Ur ,, ve, G14 .aiu I . ls 1, r 19 W :uv ' 'x-nd: L 9 1 , vi ful. iq.: ,gzqnq 9119, ,, fn!-.M:m'.h -I -' N.. . '1 'ml 2,-. I ls , , My-4, , 1 1 L, - Dx, -sf ,,f. ,,j,f 0 .fx ,,,f 1 ,E L .1 pp, 'lr ,B if' ' ' 5 Jr' ' .v n' 'L S16- , 4 my nn K -1: as - ' I ' W , .G guykll f .','7.'l . !.w .1 nk? ' '1 nv' v 4'1'f'-1' 4 -.. .- 2.40,-.v., .az-.f , , v! '5'Q?,J'r Hgh-'1',':'9ii 45: ff M! -5 41.3-,v5'A5nu4 ' ' . , ., .4 : - , , , fx, I' ' uv, 'n.n u -. ai. '31 aq,,..-2 .qi-by !Q,,..'v1S'n..,. 'f .. X . , ,l'.' .X n, v, , aw- .W x L 0 ,+'..:vE' . , It z :Xa uf w 5 TSI: Wu' , .' ' ,A 1 W, U10 -.vm ' .7 .VL V . X gif: -'N I uh 1' T15 C- ' Lg' 1.6 . l'Y'v f 6.L,zpyu,' 1 , ,. gn . , rg f a 4 A 5. . N, .nf ' f 1 .-muI:' his sf- ' ' 5 ,L , . xl Y, ff we I ,- Q.. L' yr r d X. Ya Q. f W Jr- . ,, -1 my 1 Jigx Hia .., J 'ijvii ' .1 15 4 04' L fs 1, Rwk-yy. . Un Ln, .Q 1. Mfg, . Skrfgw .. L X 1' 45 Y N 4 3 K? qw .L M 3. ez-40' X ' x ,J J 12 81 , gf an r W f' ky-1 M N TC' xx s xx QQQNH ,, M 3-1 wifi, .Q.3'4,f.wl W. y wa. vii 'I 'J' km IJ1, S H , 5 L k'41C'3.2 JN'gM?t,u,1 gifbvn ' 'K lk ' vjff ,y f- f W .L YTQIQ? ,J . ,l f fr M XJ- -N-J, 1 4 Tim: r fx fik XX wa. 'YXQZENQX W mmmi QXXQX1 g.3Tg,E'J 'H fix 'x 11 f 'x :N?X ax 'A' liwx 3X xr 1 vw ff 1 ,dffwf x f-fx 1 ,.. ,fx 1 - .vga ff f 134,-179 f!, af-.. I .H . ,I ,.. 21 5' ,f w.. L I N ,.+ f J, 13 A, ,-11'-.. x 1 fy 5.711 vw- 7 'wi sjiiff -W ,,, n-I xxx f u ,V fl' sg 7,1 f Q 1 fn, ,f in .AED nl, 45' J? Lg.-.r 5 .52 wt Zyf 14: -1- .- 4 4. 22-7'-'M .ani-'P M , K. NJ .1'.f1,,-, X I I, ik f 4x7.f YW .,. f 1 W'f'f.L . 1 1 4 J -f X X JY' r, fi, ff' ,,, ' -ji' 1 ff MZ: -'Za .Di ,Aj ff ff' f W Affffgivvf' if 4' Q M., ELF' P' 521 fl f ' I Mfr ,' ff: 58.3 yn .1 K gf Q E ,H 1.3 I F' ...lx ff 1 .E-r pl fl! I 6. 434. Q 4- 1131, . .5 H WH . 'ff ff' I ya 'HMM N. -Il-0' 5 'F-Qfrl X fl: ff Vu' x? K XX 4. , ynx 4 HN ' 'va 5. mail A AP f lvkkr 'ff' 'JI N mqfmmw ff WAN 1 iwvwm. X N l 11 fit: '7 .f 5 uf- +1 '1 'L X N M11 f 4 , v' QM f s ,ff 1 X I XX wtf A N' f.l'd 511 iw 34 11 qu nr xxx f '4 'Vw-f if Mvwg 9,4 x W if uf n 2 's 1 f1?'i f nf' 1 1 x N 0 ffl 1 we f X.. S AN M-'J few 1 lat? N... . 'fry ' 'QQ A M , , DMMWML f Af, , 1 L Z , . X56 ff fl, ff 1 ff' ,uf fQf -ef., L at G ll X '4 1 X 5169 ' 1. , , 97' ,f . xi. ,, 'E,... . 5332? My f'f?'i?'fQ in asf L 5 i Aa. 1,8 .f 1 , ,s we WP! 2 f X -ind Q- 3-3 .N-S... a 1 ' .A 5 ,qyi 1 fi' A ,, A ,ks ...I ,- I e x. x V M xi In A -41 1' 'fhgfvw I 'L 'JJ Vie.. .41 , f 1x.9'1iflNfh'Q'k .JJ-1' 1 1 'iff' ' 5555. 3 .f .3-L fb- .WW 11 L .-5.1 ff, Hx I4 TM t 4 hx. ff- P CH x .- xg N 0 gs. 1. X W Q 1 we ' iiq ,. wi, 'fx .fps-.1 gy J -M L wwf' -. 1 1 A r-. -. ,Mr , M 15 ,axe had ry qw. X N U., rnfp. xg lx xy he X Zf3iZ4 kits? 5. U .. ,i ark' lf' Ixta- Af x NLS u- 1 -uf ,ff v, x 1 Sf M ng ..-. 'if wx r ,R 12541 r L' s 'K r r ' 'X ,Af x KJ K f-W1 'PEL-4' can v Xu X., v 1 fs.- wx ,iw , W A vw .Pk '1 x J fm. Q ,xf R na Sl 41 ,, f Jw u f-gif: 1.-dsl v Nm QL 'f x., 7: -f n I' 4 N-A S Ju 'X A A sd. -1 ,. ff fx .1 s. , 4 X Q 1 X N J? N'3f f 1 ,gm Qnvw 5 fm... fm . 1 if A J... .IL mm .1 yu: lx , -, X q nun up ,aim ' K M JN GY' ,, .nm Q vp-Ks. ' 'E ,, nn. ,L V r, 0 .1 g n 'em-a ...Hs x N '31, aww D6 Bm, N ga X X., ,'?. 2'v, . 1- 1 xx . 7: I-.y l rg Uyargafa , : -sh.: gm y 4,315.5 .fx It F., J, -.Mx Jw- ' .,.'-ri' Q ., 1:5 if - 'KA 35- V N M. '9N. 1. ,sw , Q, f .J 1 , r 'vw xp'- ' 1 411, s M.. Q ' XL. .ijl',:2a.9f'fdlfi-115521. 1f ! F4 ,fr Q-fi?-..,T f9fmg-fiififf' .early T'f'l1 4:31 -. A V. .'2-'P' -'-i 2 .f-Q.-7.94 M 4- ' . -w fi -f r: -f WE-'ff 1: 4122 We 5: E5:fu?. . f:'54k:f ma. 5' ' .zhz--.1--arf: Q51 ,L .. 'ws.1 '-':. :,.':y-'5..-.fQ:fe,- -,.'-g..Vq'551,.,gh5yf'5. Q .1 L--'f ..-1. 43, g1:'1 .-599: e. 'uf-'-'-ucsxafivgfzsaimisisgf' wang? 1 ,, V' -im . Tlil-.-E1-'. -?:3'r?51s:,g1 if ?f 14345152 qgmhgfray-..Sg'.i,'1r2ifv f22:w ' gcagfsv-assi 'nj '.1...fvf::.,.:'-1-'ia-fx.' J fx- ::: :fain :fam f:f fi, , -1- 4--'4F2..',4 es--:Ge-s :z1f.'w..'..-:AQ-.-J: 'E' lil-'rffiqf --. ' .1 f .'f.i51f'P.': i- .'fPr'FEf 11-5 -' ...WZ JT -' fbi?'f'iZ5 .512 '52, 1tZJr '.?9-'- 4 '3E'11.G: 45 .-.lhiuifiz rfivkyn Tis: '- ..FI!'4 - . . M. .fgaffm-.--. ,-.,-.-..cf.v.,,.. J -. .:f,:.L ...- .- .1 Q Q: .J L f. '.,-...W ,, -i .-,-41... g. 1.-... Q1 .N 1 . A,-.-'--.--. .3 gg gr-Yr 3'-4.-uf,-I.-'-gr uma:-2' 1 1. 1, .::..Q .-5ifl?'.',.m --.ev ,gm rim , .gf-, :-. - ,n :gi ng.-V -4 14:2 'Q'--gs 1--wx, .fi ,' ii, 2,Qlf:X2a'Ik.yf2fi -':.::af.:s1Qf'sfef +316 Q. '-J .-'swiasf-S '-Pi?-a1f'.22if2???ad:Q' Ef:f5:'f:a5 ?5EF'?fi:95'5 irf.,J1L5k4:T1..:'1,?L?T. 3 lw 14Jf'f1 f1,1G22:i'1f'.6f4fA' .. ,.:.'? -sly? 4'5E3'H...i .,'T1?rE?ES2' 1. :'1lf?:.S9J' :3?:- 4-'LIE ENE .' 5-3 '9?'?f?iL ' -z., zkffifly-3 HR 421 ex.:-If rwffm 5 .ini guess? 22 5 1:-:we 1-jfsh-faire 11-fq1f4g.z,..2 122115, .' -if'-J.-1 4' v-r?:cF1q5r'Z'i-ah' 11 2Q -12115'-mi'ar,,,Y- M5512 .1 53?-J i f 9255-195 at-1laua'!3 l2:?.:.sp3 155.5-b'z.f. . wi.-gferg Q.. H -2? '. Za ::gg:g,f.-1:-' sg2,.,,.- .v?.1. 'gE new 2:65.31 ns. ,aahraqf-:ir-' wiafh 3'E5 3.-'Fffl-I -ilfcii-'2fl'1.,Q:q 1 'aff 635. E,-4zw!' 'Wie ' V H5 Z'35II1 ' -' 1 , ':.:.. 1-.zu-,J .ry f Us . -.f:,.:f'-'a-'ww .1r:.rQ-mi .. fy -ffm ,: , 1 L-:sf - 2. ' 5. ' . fm.. .:,.g . A, ' ' .n 1':: ,-,.-r-.---.- .::'- -. '-. .9 '-L.. -0. . 1 IMS'I.'+:f1'.r'+ 's-'f-'.. ,2g.P'L5f'.-:Qi5215512f1..i..1,fi'-'pg-15 - ff- EAM...-5.,. 4g2,'!q:-,Q-1-QS:-f:l:a ffrifsfzs.wg.-5-s1etn.fe'4 .1 .Mai .5 -5411 'QC .aw-'W 1'- ' gil ... ' '-z:.e5f'.':bE : :. -..fP:::?' 'iam-'4-Li-5'.'-'sssavi ., ff 1faqf-f..fP,'f,43a -5113:-ii J r.f.:.pIr2 ..,1w'2f' .-aqg. 554. ! in-ix. . .5234 1 Fi' - -.1'52,'2 5 4 -.Ii ?'j. , .'.'1f:'.5:'11rwg, 1-.-,QEQJV 5 ,i'fAg-1J'..f.l'f1'- si,ff.f,wL'f'...-anyr--u-sf' 1.4 .1-'fr' 'ff-'P ' , 7 .,1i'6: g,.zai'15'. 1 - A 'gg : F Min' in :se::f.'1.e1 '-1.1 f -F72-L'. .sn-f 51.'ff:-...FQffm. 'iw-2. ,f P . - W- -2 -' L 'bk-'f 'w+.mS ? -11? fc ' im? f.i.r?:1l'fnY ,r.f:-r-'EBM -' .. -iw' .u1,if1a'.-' 3-.'ff7?1:f1'mq5:g'l1 ?f55' rf' J 4z 6.:I::.u SL 'inf 6- .u.:ib.h2.'fjii.w'-:sb 4 5f'a'. g 12'5:,7' fm -- 14- 1-.'-IQ'-.P .ff 'sg-r'f:1.1:y-1: F1141 -'-.E-7 If 'jf-:Ll.--,..F:'f'3r-22' ...-,.-' Zngrf . .Ne-, '. .-Rub' z, . ' gk: Q , e5':'f55:0: .'. . .. 5- ,' ,-5 .. 1 .,-3.6 ,EJ .1-32.145 ,-,geaz-+1: ' , ff5.,15.g.i5N 'Si 'fHff.?f J. - 52:25-: gi-4 41.35 :af 59:-ff? -2115 i??5?5?Z 7'L-27' J-'lf 4- ' '--v 5 2 !f 1 'mr' 2555- 'i'? :135?':, 5 iiiff Q0-.1 .cs-f.v'...,:-.-,.,.-l .. :V :' Nm :ai 2: '11-: va' 9 - ':3':'.4vjfT ?-C. .-wif--: 2 1.9 11Jaz. 5,131 A -7. ' .v' ' Y v. 15.5 ' 'v'!u'3.0' gl :uv ..' r. H f.32.'5.ffp 'M 2 .1 ' T' .Qu X .-' my . Eu- . , . , :M sw 93 .-' 42 53. 'Q 'HEL -r.-1 ' ii, fi S2He ag - Q, .aff f-ifzvr-im.:,.-za-9.-.-:-fr.5fb... .-.-.ff-.v.-prick 'H Aff.. f-A-1-f - 2'n:9.:1SYf.. .. nr-z-L-.,.--af fu: 7,1 :P-' 1-La -,f --.1 P .na mf- ap, v 5- 'L' ' g - - ga-:J 4, wr5:1+,.-,wg :gs-Q. 1 w2pt:Aer..u-.--mf:-. 'vw 4-v.:v..f'-. Lsf,-5-1.' an mt..-.f:.3'.. .- .f-14.4. .. .... .5 af.--Q J, a' exit . ' -2 :.-H: r-..-' -ea -., ,.ey5-wav.: 1 1 1 'f '!4f'1?1.'5s5f1 :::. H ' F12 5-1-.r 'bf Wifwz- rf.-2 Eg-. LP 'qsfzgfvn Qifi, ,Q-fwxi:'-eu:f'.'gng5'X5af51E?',fff ,bg fa.: ,,..,,-wig. ggi.. E'4, fi Eigfijijqg, .5435-' .4a'5::..-4:-:S --4.f,1:,5:,f1 ,--f: f . 1-w 2.02 N ,'-f. '1 13:53:42-44L'r'-, -'A--f La.,..' inc' army:-' iq. - C- ' 15 - - f . ' , . ' - .9 uzswnlis. hw- 54251 15i'.:QE'fs zi..,i:- 5.1 2if1f5fSx:.'4.1.-:Q-Aff:-53-. fffi' f 1' a . .J ...15:'T,.tjf:f.,.-.1 1' -.SSH :- .-..f A--' .1 Q.: uilweift E1'3'P '-.lv ming' 4-Q2 l- ' gif.-N1 -1 f' ,, 5, .. :.- gx,2,i,'fp-F1 cf LIT 1-ff f'3413I?3I5ii:5SfE'ff555? .11 5 R143 W5 12113 Fx? 'hi' f .- i f-.. QM- 5a:'1'S T- ,r.::1.3,,.eg-g-x-,,-5..::.-1....31 , ws--Q. Q S N 1,1 i 1.-'n7g,ff3z,1..,, ,,,.1,..,.3W,L, ,.-4.4. ... -fab, .. ...I r F - i -.., .- :, n 'u ...-56 ,ggi .,a,. .g. F., .,4rg,,x1!.- - 4-. .- :f'2u'5..J.f3+41LpQ:'1fy'5:b.113 'VE - '24- .51-1' : .. JI- : 1 .2 .lf .Em . ,, . ' ' ,.1, vw, '- 'PH 1. :M f -, 'J,. 'f'i. A 'i.,: ,b, - qmjigg , RT-.4 1-. 1'2Lrr..?5 liivvil .P--'fI4fJ.w1'La '-W---'IE 5 '-i'5.'i.'!f4u-lfff-.? 1u':'1aJ:.1f 5.1Tu Q:f:21fQ'f 129151.-f:T2f1. 21.?5. 3-is 5-,'.':w.j-.QQ--A.- '3::'fl- Ev:--..xi 45-1.3 Z' mgzgayivx,5:.-v -fitw.1lo '1-Swv! 'li' 2-if -2'.sfs'1s.-:F-.'5-ivf..-.ff'-2 f' f?.:Q '.f l. .,, 1:.f'x .Qs ' 1i..vfT:f ' ' n4::'eI' 2 -. sus-.LQ Wslrvgir' . :si Q-sp a L- f '1f'Q:.:5?'Pf7'i:if.: 1 . -bi 1 final' f '- ii W 1 ' 251'-'11-fgx' '11E1f 'fiarJf :Safari -fF?31i:- . .fx - 'Q'-1152. -ff..fliZ?f .422 .11--ii '1.3f 'viy Ja... ,..nf.g....... ... .. - . A -f . . .- 'awe-. '? ' , V F WF 735 :+L -,J 1152. f-115' '1'H':- Rafe.: 2,521.19 -gif' - .. .. ievfiiw wif--f,9f:i ew . I ' .- Q.:-.f,5J,5 ' ff yi, ET-ii??g:p.4 . -35:4 1.- gL'4'... ..g.i..--ns.- ':a':m51, g,:?: :fini-ailfx-' fl 5--1'g..E'.!1','.ff-24. ,- 25'i,f1 Jf 'fwiia 'aff- - A-f '. ,.f . .. .. : :. 1.1, ..-,a,-.-4 1: N .. ...ta fave: .p ff- f'- - ' :url-fag .iii '-.11 sxhf1.2:F:sf..s':f:sN .-vf.::1?f .1-1.3. -:f1r1f1:. f4.. if M H 1 X? ,.fQf'9'Ef5-ag.,'ggi--3,57 -- .fg.5...,v5.:4.: .If f'..,s'gf,:f-'.f- rg ff 7.g.kf. .f2 if . .fgg. ..3.'a..a':a. rss- 5-:Q .Ha -. .. 11' f':'E'52-.:':'.-PIE 1.-.,:' Lirsix ,icw-1 51.33. .g 'J . ? rv .:1' -1.M5'S2f L:L5-2 'fl 1 2 Q., ab:-f '-NA5.f1CP.-'A ' '..,a .f .-5,-f'2.,H.f..1. . .ff ,1' .511 - .-h.,-ii.. x 'gif ',--,-'..q, 1-4. J .-,.. . A-.,.. ' -n 1- rg ...3wj,, .5-i fe. Lf... ' '-:S , '.-.,. ,: 1--2 V - 'ul' V L -3.14 , '5 -ef., 'rx .gf--'..4g.:zg .- f-I. 1 3 ,U 4, A 1 .flfivs gigzwff-:'g.5 ,-ff' M f 'n fl -. 312+ 'fs,zgr5..f,:...g .ixfe -1' QF- 1 1-qbafz' .L .'f.'.- -gg.-wi-..... ,.15..'2.1 ffl' Q'-f .fif -fn. . gltfx.-4':.f1.-2.1-iff' jj -. 'fl -5-. -lffffzwiaax .354-5.11.-fi .5 1? :xi - gf Hex' V-. 5-ffv3'1:.:4V. -aff. .A ,E ?? x'nY,Xf.'1l ...,- ,f.--...1 .V -.1 .. . 1- ,..:u..A. -: .f.. -. ,. , - -A ' A J -:mp -L..-....f... .-1'::.w--:.,'.:.,f.-.., -...Q 1... - . ' f.-.fig 4..'..:-FN, Mr: 5315 :jig JP-5.2-'Y1 1 f ww- ir. ., . .cb ., .. 5. , 1 f.'fm,-'G1Lr' .,1-14' L?rc.-L,:,1.- ff Q- . Q'-' gg' ...WV 'xy-X 1. .- lf 7, 51. .f:a',-r-L.:-H+ ...ei .- -4'-':1-v...:q:,f : : . -Q. ,.c-wg 5 , 'ge . - ', ,, - ' V.. pf. - -, 1 1' .aa-iw i.. ..1g..,,. ,Inf ..f.. --,L Q... 325. 'ffm gfF f TF'Ei??f X'-'f. '4 f' . 'nff nff fsf .fifl'x'3'g,-' 'Q Y- ri 4-4'..1.z:g.. ,ff -. .-.-.g:,--if-1' ' mf? :ER - ...,,'2g:f ff'-5 1-If-af Hwy? Jf2 .' .ff -'fx ' ff 'vf-1' Ax? iv . 1'T:'f'L ?:M f 'Lii'4-Any. . - f1 'Q .ICS ., . 'Qian :oi'F.::'v'fE .Mil -i' , g-mf:-if-45. 1118. -f. 2 . 1.g.,v,f:7.-.wax-fn g:.g..ff, .,fr+E..a,i'1 aft g.,.:f.v .1-, - 1 ,A 1 Aw. 'T af-61 -EF-199' 'uf-mf' ,: ' G 9:1-!.,4:1:L':2 .1 ,f7::0 v ', hi' .1-nv.z1 w .- - pf., 5 K fa,-.41-: -'e-1:-22 5 ' QSM ff- fs f f , 5 . .e.2fs.21-51 .'m :v,9f':1'k?s4.. 2. be f 4 wi 1' 5- - KI 1, In ' ,-if- 2 .3- 'f1..4':?.' U, r-.b P f 'Fw -K' , - ., .. wwf ' J' ' 2: ' ,i-wr.- f.-.:i...m ff. .. '4g.,f1 ,-4' f 15 .'--affifmnidiigf. .1.... ,Qe:g2 , '- ,, P' -kg ..1.:.f3,5-,:f,:'14+y- .gr 19. .. . ' , iv- .gg-.,3Qg.:x:Qg''gig' hy' f,,5j.:.- A. ,. J . : 1 '. 'I,!.,W,.--.:5- 1551- 2' iieiligu- X if ' 555, -fs' .Qs-1:- .1'.' ts:-f A, ':'1J?'i '??f:a7-?77:'.n?'.i+:,:i.-' 1-has-gif -6' i!.c1:'z'i '-:,g.'l5Sx:, X ', .1 , ' -14 2 ' ..Ti'--::':1fQ '.e f . nv v, , -fi ..v? 'f' M123----'f . f r--1: . -f,z,,g...---:1..f-f., '1 , ,.- . . 1.1 ::-.- 4-U1 ' uf. . v .mr .4-.p,.'.:.-L-23--1-U4 ,F' My 4 ' -.,..r- , ..- 11. - A . . . v .Me y'.'.Q1.'.1'Jf.f-1.-1 ,ga .,- .. f.. -z:-'s...-..'41...1:.- 3 .-. 1 Xu. .lfW7 ',J -1'-:..1:1g53,yf, r.,11?,' .. 1' 4' e1m....a?..-5. y.-1. 5.3.5.1 f.,ghghfaf f' ' ' gy -1-SW '-.,, i gf' MM? 1,5 1' '?f,.:,j , , 'fy , 'znfiof' 1-5: 's SJ. -nb 1 fP :'- iw..--:f' ' f . -' . - Y-SN. . , 'f'U.1 ' f' 1, W, , . 4 - f -'S' -QI'-ax 34' 5 331115 j?gQ,f3116,gg, digg' rf A ' Y -wg , , V J V . i : .gym .Lv -Ay , . ,141-, ,474-'-f , . ,U : x, n , I .- .51 nz: .4 ,. .4. ...Q 3. . M -K f hvfff-:fm 1-4 ,51.I 'i4:f'f , U: :',.f??1a'.R3ffl?3-41'f.1-lafifff' ?f . '7 WIFW 4Y51 ':hl'f - .. '5f ?5f'5L'?x'fs ff- f .z f' -' S- . 'HX nw ' v ',.'gf1 ffxzsvfs ' .i71',,.es31ff' . ' . 151212, .ff . 0 v ye. Maypx-'. V -1 ,.,.5 :,1'y..1f. 2 .1-7: 'ffh'-'Sf:?'!Aj1, . , g-fl f -11, iw! X.-.',-.-1g-11'g,wy-- ..,s.,'5i1,5'. ' ' ,, q.Jf9-.gli .' , ,.h.:1:-' 5595? - fyvgg 1- -W. . fz.. , 'Aff gf.. ' gif ...TZ 1 '-'.i-.'gM:x'1.4p -'21, -b .. -.-fa -5 za' .i 1' '. . im., A ' ,- ' 3 0 . -fi f,.i.. ff .1 riff:- .Ju33' .iLf5F1 1' ' 'FF' 'if f 1 1143.34-15 Iv! 15'-1.5.45-: A 'fa-V. w 'v -. '.:..a -..+'-1,-. .. in J -51.121 Yi ','-.2.r'::1,.. --.:.g,.fg. 2.36 -.fm pea.,-gf. ', w' M N H -X. '-uv ' -45 1 W 'Eff' lm. 5 -' Q 'fifif ' i.r'J:e'-'xiii '. 5 ff J?5..M' : 'Q ' . ' f . N .V - . -1 ,- ?a.jE'Q:5if ' 33 -1 5 11, 2 .'i:fQz:1,.r5., ,-amz.-vqg-'. '+fy if : , '..,--.'a.?,p-'11, M!! :gf ' . ..,., 'E , f',' .' g' V, ' A-ff -1 1, ' ff '-.g Yfzz.-lpiliaei. '5ZGE5'f.4,fgff4., '-J. -1-5,33 Gigli' -' 151- ff n. - ' m m.. ,,',..' -N ,,:j,'-'w, 5, gsqgggp-: 4? wen. ,.., - 1 A ' - 1 1' I 1. .1 N' : -inf?-A fi .ffm -iv.. . f iiffijl' . 'fGQf.vn1 1-r5g'Q.:1'g.ef1r.1v,. ' V wil-Q-6, '-: t ' '.-.QW-sv-T2 fpugif 1.1 , ... .ff.:::-11' ' Y'-,fLi'!fE-7-lgf.'.-1f j L'P'f Sf?Lf. F:Q 2 ?5 '! -HifiN'.:g::If5i1gf ,.- QM' 1.1 , ,' ..,:1',f ' -1.9.3 'f,i5':Q.'fJ:6'- x?!ijFe??'2 ?'f.::-x35.. f -.- ' N 1 Q 'ff ' 9 . , 1 . , Vw.: ly '1','r.' , 1 , 1 . .JF ? I',KN.'.'1..' Y .,e.',, T': f::-:ir M-11...-:.'f9:.':.2 ,::qm','.a-.1 ' . , , - .,. H. ' - 1: J-.. - ' .ffgf 4 an f sf.-, 1 Qmuwrz-21-,. 1 5...-fb-.1 02:15.-af 1' .-5-fu... - 4' 5. - A . 51-1 Hg.. , -2. .f-. .f.f- . - ,ff 'f x2'3'.'..:-'N1.'.'f..'l 'f 031'-' A.2'ff.:,EIf',3 Vi-vEJi':-ff-Z4.1H-iff! -'f. funfiz . f i. ' sl' r '3- il . Ki 'ii z-'Y ' 5 ' '- ' f C -f , - ' 3321 - I. 'Ll Z- fu: .- ..,fp....l... .......,.,.. .... . .c. ,. . , . . - .- ., ..f,,,, .. . . . ,. Ly.. ., . ,. ,., . fpg-.4.gQg2f:-gilra. wa.-.'gw?a::qe1f fg.-,-14.11:QA , .1 . 2 ,- ..gf- 'F 3 31.2. a- -5 1.f, .q.,f 8,4 ,' Pi':--ff-'H-'1 . RW... jf.. - I .33 f-ff ,ig 5 :F 31 .4 Q. ' J A -45 -Q , .-5? ' f v .p-e..-f-A :' fz '.'j'5111-.iz:aifi1f ' 7 f ::?f : .i iff 11 .sg Q. if 415 Q5-223. ', J.. g .4g:'!7 1'Hf'1' -if -mf .' :A f ' . -f. ' . -1.4-W ',.'.w- 5. Eff.-Q , 'S?f:?1'-:ii2?i2?fa'.1v' .3-7:2 . - -'S ,L 'fisf - 1 ' ff1'Y'if:2f limi..- P5-gi5:.'1,:-Lia.'13,-551333, ---53.7-14.-4: :5.: - if .f,: 4.15 Fi :g. 15 11: hw. a L, 3' .5551 . -5- , ff jg .. 51 fa 6.33, 5 .:vf-1412.3 .531 ,buy 5 !EHf,i,g.,- fe.-:. 1f:'.::f. . g,'-f2.H:p,'-pa'-1' ...if -. .1 : ' - . Ja' -' . . Y-4 f r.-,. - -1' 1 ,f 1- df' ' -12 - ' + N 1 .'1':'1-' Eun- 3.112.1f:.c-f -55151, fs,..f.T .- 5 .f F ra? ' -J '-1 5 E f.-- 1521 - E, ff' '. 2' - .- 1 'im ' .Q-'.'ff.fT1sg+ V P1Xf'. f!f. 'mf 'f-'rv 'J - 5 S' F5 .aff me .1 :+V . fue' TL 5. Y .' -, an .-..':'fif-'s Cme1:2+1 QQ..Q14fpp:.:.-..-.13'F.4..zf.1 a:.Lu'' .' f , ,Q 1.54, ... .ns .ug isa. 5 Q -' J . w.-' r 1. .-1:9 4' .ffm Ni wma' M '--'..1 5'- :: '1 'i'1'i.-'Fifi'-u.' , I ,. .-' -35, 2 fi' :-If IPF E' v' P ' A I '3' -xw '9'1:- '- .' , ir. G' ' '51 If ' '1t1'f 'v 1 -7 'W 1 'hull ' .1 1-: ' - '- 7. 52: -lf: rf - pg. , . 3 1 ' f ,. , 9,1-. a'1:'i . .. .swf zlwxgrk 5, . . ..,.... . -. , .., .... .-...- . . .,. - ,..- - ...,, , .V , fm? ,:-11. -A ZF' .- Q .z A .-I A -2.3 .1 -L, .E 1. 'f..ff:'J,' i '35 .. R 'W V 1 iii? Y' ' ' 1 .L i -: E ' . ii' ' a5fE'fiiE.g3.2.'r :.Z. 402- :ff.: ,f., , - ' -2 : ' -' N - -1 . .f .- -fm at fit, ,:,a.3s1::,, -11' - f' .P ,MMV -isa... -- 11A . , rf. .4 5323. '11'::fg :f:g::'E5w'-sg , w :. -. J lf., --1, wh, , I I . f HY, -1, .. 45.-11-.1 ' '--T-.. - . - 4 .- ,. - ' , .J 1 4. egg . , ,,-.- ,, -A 1- GM.-5:-f'-',w:,., . -r . .. , '-11'.G:-f5x'i'2ff.-1- .,1-g:'wr:A'. '. '.-.-.ef'.,.-,: :P'5a.-Q. Q .. :-' . - ..-. ..'.--nin a . -4... x gla-1. -'arsia-.': w?'1-M2!?s'xiuL.- . . xv--X if 52,411-xdfx-2-'-ul: ' ' '2-'-. ff-951923:-' i ' . 1 w- 2'-f'f '..Q:.:g.+iff.ff' 1-'.:'-12:53-1 f'4a 'E.. ...L-' 91212--EP-921'r. 'i'fs.'fe:!: .:ck'rf 15f52. f315 Eu P? ...iz 1:3 G,iiLiEslS:!?4'if - 11 -..ev :ug 1.5. ,M-v4 .2 jg .ah -.,-.11585:34-j.21q:4-tggpqz:m'ii1.g5.' -,...,rn:,f:xtgeglxQ-'pictaz-12.1S?J,r,hqggv 55:31.21 :wi-ez51:f::G..aQag:-- '. .ff 'fgQ5i:Lbi53rf2FS L1 Hu. wig ' . , F ,ififg-5.121414515721511 NG!-'31...'3.1'..:p--parm ngi'g'1+.-.Sg:,,:g,::Q-.Wiff.-g'n:Z2:3Evg1:-rea. .3-F-gg,-.:J-gl.-1:--.1:,' 4,1 ,iZ'.1s,'w3.-z':j,.-1-:?1:-lfgiiwgwf ,.,..'55t:,... sqv..-,E,11:1.ss4.-.:: ':.-aezfgzz af'-5-..-: ...15.,.'-...rw ,.. 7 I-21.9, 7,-,t,.:q..:..,. -n:5,..4,.43',,,L.:..,.,..1 .g, ,ff .f.,.:...-4,ggg,:15:.,-ff 5-:LA-d:.g,,-sq-E,5vL:. ..,. ...np - -, .,,-:-5.14 1-.,.-5-1-.E...ww , ,Lg,,.,,.,.-,,,x.,g,5. . .Q ,.,p.,.5,.,.. ,g..1l,v-L---.154 frm..,-,--.z'q..1-'ef-nr? c' HG kv --.,p,-a x..'gr?'L-.1-A-:lin .-:-ffvf-1.'..A--Q:---:.fez:. , . 'fx-'.:-f-'f,.a....: -:?3',f:.-x-' .2--5 -'+4- :.-:aw--fo.. , Ye was .'.-:.-.1n.'f.,:. 'v-fgw.-:E '. if' E 1'?12i'1i53'1i5a 125.2-E ff-'Q 5251215353?-Egii-!sfgis.I,Hi-fi?Tiefwf-'EJYLQIIW. ,gj Q Fir?4G923EX:EE5h22i1iQ:5'iiie?32a.: . ff - W - - 1 T 'Q:9.:J,f-1. , 'f'2'.g-1-mgfif. 'EfA4z.i-:H-1, 41:4-ze.,.,..1jff-fmsfbxga-5gEtg.ac.gq1jJ'.2:'K- H.afuftfril.,f2g:a,1:,'ii-2135251135.2 ig., - !fJ:,2s,,. ,Q-f.f'.n'51 ' Qcsiiy:-.f55i,:.-5.1Y3g:i'L'1 'g'..4s:i31.fI3','ggi.:--133. 41, .gm ..,.',1g:3.-,.aQ.Q-52 Aw-,1:.-.. 2...:,.-1f,..-- , .1-f-!.',g.-5521.-'1.:.n1-.4 .vteggg-L:--,,g1,,-5,11 ,mmf-..-1.,.,'.q-.-nw,--1.. 3.1-,.:,v.':'-.1113 .1 .'q4...g:fa-g1.:n-9195.1aa.-f?.'-2-gr' ---- up-:. 11.1:f:1x4':.-: 15gg:f fm ,, 'FiT?C'Iaf- -.:Q2 r,R.'1..-tif -Ift.i'1'iT'1'5i'2:.-31: .bE3.f.ifi'i'1a'.7.'EC'-:'97'f3?-Ls!-Tir-1 Fi'-'Tc ,, VH!-'i:TG5.':?12Zt.fEeIT?':I'ii- ' ' .', :51'j?f1T:-f'Z'f.7i?if-5' 2.-:11i1fE:.11iT-ff 216.41g-Fgfl-3-,213Cdl'-:iinf.,-.Z-L2 - ci1E,ii'1-'w,jg?f.1e . - .T .. - ,- , .'+ffL1ga.' , A 1 ' ' . ' . ua -- L.1gi35'.5E-Qfeahi-.51.:g+a',3A:p2-mm.N ff g'g45.1::L:'2- 'hfvvf' -Pais' .4.g, Q2s7QqE:gg.,,.f - mi?,:gr.-ggaff-5.11:-:q1'X-'.' ecum.-'iii-'-jr:.ft-zsgmhff-4:::2-5.fm.1:i1.3f.1::f:f1-pg:-.Qi f-:vw : .-:J--wgcm Q. :-.Lys-QL:-3,-ffyzim ' -2 -aw . .51-.: :E5?z:k,g.5,. 3 .5-' Q.:-+1 .g'..:g.r5yfQ..aq,,::,.qM.s,i.' ..'-' 193251. .f3,-11.3,-5L11,:::,f'..f.55. mg. ,,-:.-....- ':y1z'.-..g,--g- qig.f:1:-35.4 ax.: .1 -Ef5ff'-.1.1'f.-.f ly . P -.Er-i1'1a2ae'er :'f:f.'-if.:-ff3'f:s.2xqgee.-we-X.iga3f?f:r'aZv2aff::'r11s-...',1f2'52.-'A':.t:-.,1e.4:. f2f'z::1::v1-fig. ..,,., . - z:?:f., e - J' 2 Wfqvin -nf :isisss5i.'g.z1.:a'gf,'sr1:.E...auf+:r'Zg5pa1:-3-.ggsg-2fx.--sfuf:-.ra-5 3 1ff'2zfs.-.airy . 1: :PCS-5 '1--if fnf: 'H' H- 'flsauw' il' .J-1 . L+... :v'rf.'PSr., ' f 'UF nu- rv -1:.r'1-..- '1'ls!'r. ' f.Q.': 2Ewz!u'P.':-'J' P, si.1u.i:. e':.ie'i's'i.':3f.f:H-Iwi'HI--.3'-2211, M-'TIER-q . . Cave Men are the fashion now once more They rage among the jction magazines, From 'reel to reel they ramp through seas of gore Where quivering crowds ga pe at the movie screens .... -Don I sing the man of brawn, the truly great, Who, as the gladiators stood and bowed Amid the clamor of the classic crowd, Now thrills the throngs of a much later date. His exploits hll the coffers of the state. An easy victor, modest and yet proud, He sees his adversaries rneekly cowed: Tho they were tigerfstrong, they knew their fate He flings aside the dagger of foul play And throws himself barehanded in the fight, While tens on thousands yell with hoarse delight And bellow forth approval roar on roar, Flocking to witness the terrihc fray And drop their ducats at the entrance door. Marquis H. S. s z V I .n..v,.1,.m.........f.- 2...-. wan. -.w..,.,Y.1..,.,...u.. .mfw-,.. .wuw .n-L-mw.f...x. .,,..:n1-..-.,... ng x-,.,...-.-4..-Qw--..n.n,x-gef..-,...1.,...1..,-.- W .ummm ...,.:,r,...-.4f...,f..-.M-r E' , J 4 xx 2, TE S-,ngeg-,Agn -g-,v,qE5,:N',y,.,-fp,-.Lyn-7-ggu v-fmyeg -,1 1-21143,-pggg.a-o1,v.L4,L 1x441qexn:g1ynryu1'.w1rxe:4u!nmngggr na:wp lf. igxsalsavfxazslg- 5 , f f f -V -- V 'V - 1 E ' ' h 5 F QQESK5 '3'VH'!5 lv 7-3' V 5512 if'!i?7K ?2?:!lT?'H 5K'iffi h3 Y'fE 'J fF?:i?-'3i':5?.f-25112-'Y!Y4'9E Q 5 V My vw 5 s Q ff E3 . Q 5 , -f ...., - 3 5 3 . 1 I ' -X. . . 'F . s i A 5 V 1 , , -,Q , if V 1- . 1 f P V 1 ' 1, v 3xVV4-1:4 V E E N . -r. I 15. .'.i.'ffK.,' 6 W s - is ax ' ' 9'-fif-Q 3 ' 5 2 V V. . - -Yan-.ffl 15 2 i 1- X Jr- X -sa 'W'--f?773V 1 l 2 - f fm 1144 9' 2 V 4 1 1 -: I ' . ' - .' - 1 1 5 5 l 'I' fs .. , , f J.- U Q 4 Q 3 1 E D. M A RB! :Sy gf Q S 5 1 'A s ' ' Q' r-. ,. ' ' 5 V 5 13 em ,x ,1.C!N.t 1. r I 3 1' ' : 'Qi I f. u rf P' . ' A, V 5' ' Q Q ...-. V ' - , ' I ' f, 1. ' - ' 5 V V 1 'ff, Ku- E 72 E A , - .5 V Q , .Cl V 5 s ., , ' -'. 1 .- Q -' - ' f- E W ' - '. . ' .L ' ? 9 5 ea V .f--' if V xg - 'A r' 1' 5 i V.-5 -A .Qf fg1Li4f S E 1 W -' 1 , ' ' V ,,,,. ii' ' ' 2 V 'Vi iff' A-QF' S , 3 , A , ' A- ' , I V- ' gg-V, k ,.,L-T I 152 g u D Q 'CQ V .2 l F' l ff- V is f : E ' ga E 1 fi 1 5 W R 'Huw , rf z 'P 1 V' 1 gh .- 'ff Q 2 V 2 ---.915 ff V 1, i ' -' - - . - : - 2 e 1 eg . S. L-2-'fl -fg hirs 0- ,Q : . -1 V V 2 I? A: ' Tia I i 4 XI 2 Q t , -I 4 ' n -r.--A- V 3 EA lf pf , ,S -. . Y --,gr , 4 V an '1 5:4-.-, ,. -fx ,J gf' 2 'I 3 3' ' 5 i ' -Q ' ' , z V V:z..f':,Fl'r-4-T.'!: N , +.,,'-- .i g , , K , , , , 5 I ' 1 I H Af 1 3 V f: -+- --N- - - - I I' I 43' 5 Z , .- . Z, , , Q -2 V ... V .-1' 5 S 5 , ri ' -- - 1 1 u 2 - I 2 I 53 ? V E 2 -W f VW f--W V' P F 1 ,P Q 1 . Vat ,ez ' 1 V 'x EZ - ,EPM '5'.4:QW fish ,- V Q . f -H12 .A Qg,+9'f if VET. , , Q 3 Z Vl5if'4'f,y7'ffi.Fi V5-1 '.1 i3s9ff.afP'?g'.Qfl f2vm3, I s 1 E 322'-gg--,nagyir wp He ff.-fiaurigu'-5755 'v5'f1:f?3'5+'-i3- V' 5- ,, ii 5 4-Hlvgg 45:5 1 2 2 V ' ' Q E 1 5 T ff' ' 3 Tl 1 , fi -1 2 H AP I E R III f 2 1 5' ' n X P. . P 5 A T H L E I I c s V .I Q E iE:' Cg''Yfi' !g,:f91k-E2'1fLiwlJ: ,ZLff532':NlxY5?f-FJh?xWP5?416!-iiN5H1W.0i'15P157-:Vi-5f.r:'f:3':hW444It-fafiii-1i1.'SGY42f55i55352 5ES1??wl5L'KY24PDW3Wfi?5iM i?Q?H4W5Fnx? 1 if V 1 E V Y , VV , N , Y , 4, - , I 3 . 2 Mn., ,W.,.,,w....,,.,,.,.,..,..,,.m,..,,...,,..-.x1,..,.,,m:, ,,.M.,,,, 1::--12,.,,.,i,,,,.Mm i f I 4-, 91.9-'ln- ? 5. L 1-11 My x L11 -.- -El J TIA N In-,'fQ't ZL-1 1 3 Jig.-ji? .. -1-af, f JIJIFI -' . ff' r 4 V xl ,. 1 5 F L r 'V N I 'I Y ? . yy fl! , L --- nnin, iii-:Ziff i Q - Y v F :- na.-ME 'LLl l?j'J.ivi italy- J , ,-- e 1 wr X. ,.,.,, .4,,..v . .r ,-'.-- - L .,!, .,. ., :fr- : 'ri I-5 QIVQ -al' Ty, .L THE CLASS or 1931 '23 Thad McNamara Officers First 'Term President-Thad McNamara VicefPresident-Norman McLeod Secretary-Meta Jury Treasurer-Jack Snyder Norman McLeod Second Term President-Norinan McLeod VicefPresident--Elizabeth Alden Secretary-Lillian Schuck 'Treasurer-Jack Snyder Girls' Chairman-Elizabeth Alden Boys' Chairman-John Saunders, I Bonfre Committee Chairman-Tom Pike John Doeg Robert Filley Richard Oddie Vance Fawcett Frederick Hawkins. Boynton Tickner Philip Moffatt follyfup Committee Elizabeth Alden Joseph Campbell Norman McLeod Richard Grant Freshman Dance Committees General Chairman-Philip Moffatt Arrangements-Charles H. Brink, Floor Manager-Richard Grant Lillian Schuck Reception-Charles Weesiuer Decorations- John Bryan Elizabeth West Sarah Grant I'. J A--1 Back Row: McNamara, McLeod, Grant. Front Row: Jury, Schuck, Alden. SOPHOMORE CLASS First Term President-Stanford E. Steinbeck VicefP1esident-Alice McCreery Secretary-Elizabeth Woodyatt Treasurer-Stephen Clarke Basketball-Paul Speegle Baseball-William Warner Second Term President-Burr Northrop Vic:efPresident-George Bodle Secretary-Maxine 'Cushing Treasurer-Stephen Clarke Soccer-Philip Smith Tennis-Craddock Gilmour Sophomore Week Committee General Chairman-Louis Lieber Q Refreshments-Helell Thompson Business Manager-Stanford Steinbeck Programs-Bernhard Grarnatky Decorations-Edwin Crebs Chapevones-Maxine Cushing Music-Virgil Dowell F loor-Warren Wilson Sophomofe Play Committee Mariall Leachman Patricia Rhodes Kenneth McRae Paul Speegle Edward Dillon Alice Ingraham john L. Hare George Thompson Back Row: Northrop, Clarke, Steinbeck, Boclle. Front Row: Woodyatt, McCreery, Cushing. THE CLASS CF 1930 023, Stanford E. Steinbeck Burr E. Northrop President, First Term President, Second Term ROM mudfight to Cotillion and from Freshman raid to Sophomore Play, the Class of 1930 has displayed noteworthy versatility and ingenuity. Under the leadership of Stanford Steinbeck, president of the class for the first term, and Burr Northrop, second term president, a novel program of events was innovated and the old traditional customs achieved unprecedented success. ' Jollyfups, a good old Stanford custom begun in the freshman years and continued throughout the remaining years of every class, under the ingenious management of the Sophomore Class continued their early popularity and were enthusiastically supported by the class. Unwilling to be deterred by the unfortunate and costly outcome of previous freshman raids, the Class of '30 paid a nocturnal visit to the Freshman Class as a prelude to the annual mud fray of the following day. Advancing one hundred strong, they demanded action and rushed the Encina steps, and not until they were met with a powerful stream of water from the freshman cohorts and a convincing line of argument from Murray Draper, president of the A. S. S. U., did they retreat to await their revenge on the Lagunita mud pits the next day. Splash! Blub! Splash! So the annual mud immersion began and raged with unabated en' thusiasm. Concerted action was directed against Fidel La Barba, freshman leader, who was one of the first to taste the murky dregs of defeat. Assuming the aggressive, the well' greased Sophomores, led by Eric Krenz, employed organized tactics which succeeded in routing the superior but inexperienced numbers of the Freshman Class. Turning their talents from the gentle art of mud slinging to the finer, and at least more delicate arts of the theatre, the Sophomore Class presented as the annual play, the comedy Expressing Willie on December IO as a Hnal event of the Sophomore Week. The soft strum of a banjo, the low sweet melody of a saxophone, an orchestra playing on a roseftrellised porch with white columns, dancing figures Clike swirling bits of confettij, a roseftumbled garden wall, and an old plantation comes to life again. Time, the presentg scene, the Sophomore Cotillion of IQ28Q cast, the campus at large, unanimous in its apf proval of the social capabilities of the Class of 1930. The Sophomores also established their reputation as a class to be respected in the achieve ment of their interclass basketball team. Bowing only to the Freshmen in the first game of the series, they defeated both the Senior and Junior teams with decisive scores. First Term President-John Wheatley VicefP'resident-Carol' Gray Secretary-Lorraine Reeder TreasurerHKenneth Funk Baseball-Edward Naumes Kathleen Fitz JUNIOR CLASS O Ulcers Second Term President-Robert Hume VicefP'reside-nt-J. Scott Webster Secretary-Alexia McCarty 'Treasurer-Kenneth Funk Sport Managers Tennis-John Wheatley Scccer-Ellsworth jackson junior Opem Committee Chairman-Herbert Boomer Charles Moore Kenneth Lloyd Chesterlyn Thomas jollyfup Committee First 'Term A Chairman-'William Sparling Fred Hubler Katharine Crane Elizabeth Cramer Second Term Chairman-Joe Carroll Nancy Campbell Roy Mitchell Paul Mahoney Chairman-Paul Herbold Business Manager-Richard Guggenhime Music-Hubbard Mofhtt F loor-Craig Vincent Decorations-Powell Carpenter George Mott Helen Smith junior Week Committees Refreshments-Kenneth Berry Programs-Ruth Hembroff Tickets-Edward Krough Chaperones-Janet Harris Publicity-Templeton Peck Cord Ball-Robert D. Edgren Back Row: Herbold, Berry, Boomer, Funk, Carpenter, Naurnes, Peck, Krough, Carroll, Guggenhime. Front Row: Hume Hams Reeder, Gray, McCarty, Hembroff, Wheatley. I ,frat I vcrtti-7 iTf5fff3i7355hvfw:fMfa:w. . 1 V1 if I ' 'lEJP:i.wf'-i,9vl- s:El'l .r ?-TM ' 'TT ' . - 'af' ',l...'i:- 1 lIijm'v My ' -It I TTIE CHJASS CDF 1929 F23 john B. Wheatley Robert A. Hume President, First Term President, Second Term BANDONING all sophomoric dignity and taking a last fling at gaiety before entering upon a career of seniorial dignity and cares, the members of the Junior class devoted their talents and energies to the diversihed class festivities among which the most notef worthy were those constituting the junior Week program. Beginning with the gaiety of the annual promenade on May II and ending with the highly amusing class opera on the following night, the class succeeded admirably in justifying its reputation as a class and the junior Week as a class tradition. The problem of a junior Promenade was brought out from the closet of class customs, dusted off, and, after a period of study and labor on the part of committee men, remodeled after the design of the period of Louis XIV. Within the Pavilion, softly draped rose hang' ings covered the Walls and hung in heavy folds to the floor. A frieze of gold rope with long, heavy gold tassels hung at theiproper artistic intervals, joined the side drapes to a ceiling of stippled blue, which in thetirregular lighting effects assumed a silver cast. From the center of the ceiling hung a large, crystal chandelier with flame' shaped bulbs, radiant with scintillating lights. Beneath the chandelierand onafslightly raised platformfdecorated With more gold rope, the orchestra blended its inusicalistrains with the murmur of voices and the undertone of gliding feet. Thus were imports and modern music introduced to the era of Louis XIV. ' ' I Programs for the dance combined both the practical and. the artistic in clever 'White miniature-holders made of suede leather and lined with white satin. A small black cameo and a dimly visible halfftone Wash of period design carried out the dance motif . . s , In the presentation of South Seas Preferred, an original production written by jack Shoup and Herbert Reynolds, the junior Opera was transformed from an inevitability-into a thoroughly enjoyable program. The pony chorus with its diverting song and dance numf bers contributed in no small measure to the evening's enjoyment. 'i I , , The junior Class exhibited their diversified talents by amassing athletic honors as vvell. In the track events they reaped honors for the class and the University, having as their most accomplished members jack Dales and Bob Syer in the varsity mile relay quartet, Johnny Lauritzen in the dashes, Ross Nichols in the rzofyard high hurdles, Al Forster and Herb Pleishhacker in the shotputting event, Bill Sparling in the javelin throw, and both Ward Edmonds and Walt Hulsman in the pole vault. Y, ---1 - --1 V . 2 1'-'l,.-g.-'i'1- ,:-'- -,,.l ,F'7 -ffg- 1 4 ',,:.7-,f rf , , Pfiiw bl-v-1-I-'--4'-----H -- - r?-:-:.-- -4--,,-,.,5z.i-if , ' '1 bl, 1,1 -V711 -'.A: - V -f ,,' .Juan-u-ai.--gi.-1-....- -......i.. f'1f1'fWaf-nffwfii afrfa-frf aff' A s - - in. -.J 1 ' - Y ' - mai buhiasauls l l., A.. -1 V.---X .Y V-i- a -,, ,. . 4.-1 '- -s. . --a Y'i1 df' 'Ns , 'via ,-. 1 , Q , ' - y.n'.'.'.' I,-, , il., 1 . 1- 'F L I V. -tigl ,Y a.. V .' . - GRADUATING CLASS STANFORD SCHOOL OF NURSING Ilene Betterton Barnard Isabelle Bunker Helen Burwell Marjorie Clark Wilma Counts Emelie Dale Helen Dickinson 'Laura Feliz Charlotte Ferry ,V Marie Fidel Sarah Foster ' Dorothy Franks Agnes Gafvert Elizabeth Gardner Aileen Gordon Mildred Gossman Helen Greer Elizabeth Harms Josephine Hawes Irene Heffernon Harriet Hinze Mary Hockley Anna jansse Tania Karpova Kathleen Lowden Margaret McConnell Mildred McEwen Margaret Maguire Frances Meder Florence Morrisoim Ethylmae Perrine ' Martha Pitman Mercedes Rhodes Margaret Riassetto Alice Robinson Dorothy Ross Eleanor Schneider Lois Smith Carolin Stadlinger Elspeth Stead Elizabeth Steinbeck Grace Struble Katherine Tasker Frances Thompson Ruth Ustick Marjorie Vermilya Myrtle Wadsworth Miriam Whitiiey 9 -af' li Bac Row Hockley, Lowden, Schneider, Jansse, Stadlinger, Ustick, Hinze. Third Row: Hawes, Karpova Whitney Burwell Harm McEwen Second Row: Perrine, Verrnilya, Feliz, Struble, Heffernon. Front Row: Robinson, McConnell Gardner Gossman Gordon Foster Maguire. I I I l :ff , I 1. r 1 il A - I- I -- I . I 1 JOSEPH CHARLES WHWTERBURN I History Sausalito Chi Psig Junior Prom 'Committeeg The Devil's Daughter CID. I , ,I ' 'FRED Wise Metallurgy Virginia City, Nevada Delta Tau Delta. WrLus CARLYLE WOLF - Economics San Bernardino Kappa Sigma: PhiPhig Scalpersg Election Com' mittee f4lg Interfrateznity Council, President , 4 . MARGARET LOUISE WOOD French Campbell Roble Clubg Theta Sigma Phig Biglish Clubg Le Cercle Frangaisg Quad SURE Ca., 41g Stanford Literary Magazine Staff C453 Orchestra Cal. WALTER MAC WOOD School of Engineering San jose Breakersg Toyon Clubg Freshman Socceri Nurnerals. CHARLOTTE KATHLEEN WOODWARD Economics San Diego Transferred from University of London, 19272 Delta Sigma Rhog Women's Debate Society, President Qzlg Intcmational Relations Club 00? California-Stanford Debate f4l. CHARLES HAROLD WOOLE Social Sciences Tempe, Arizona El Campog Hammer and Colin, Treasurer fglg Toyon Cluhg Rally Committee 13, .ily Chapar- . I ml Staff C1, 15. 'I , .,. 4 J 6 W WW 'ia'- M W' I' ...i,. t.. . - Ii. RICHARD CARL WORDEN Education San Jose Brezikersg Toyon Cluhg Varsity Football K3, 47Q Freshman lFootbal1g Freshman Basketball. Nu- ' meralsg Rugby C135 Executive Committee C105 , Junior Prom Committee. I I I i PHILLIP EDWARDS WRIGHT Mining ,N Sausalito Kappa Alphag Geological and Mining Societyg Interclass Football lr, 31. CAROL GLENN' WYNN Philosophy Pasadena Phi Delta Theta. I CH! KUANG YEN History Yunnanfu,'China Chinese Club. I N . J i I JAMES THOMAS YOUD I Mechanical Engineering I Merced I El Tigreg Toyon Club. ' CARL ZEH Economics San Carlos FREDERICK AUGUST Zmcowslcr Y Law Denver, Colorado ,' El Campog Delta Theta Phig German Clubg Toyon Club: Quad Business Staff Czjg 'fHam- ' leti' C375 Hay FCVEIHCBJ. A ' I,-. , J -If, if - -1-lx? S - EVAN HADLEY W1Ln Economics Carmel Transferred from Principia, 1926. OLIVER IVLECARTNEY WHLARD English San Francisco CARL ELLIOTT WELIAMS Geology Lakeview, Oregon E1.1zABErH Moooy WLLLIALIS EducationfGmphic Art Palo Alto Kappa Alpha Theta GRACE WILLIAMS Economics Madera Pi Beta Phig Chaparral Stall' lil: A Kiss for Cinderella' ' C315 Football Show C3J. JEAN Louise WH.LIALiS Philosophy Fort Leavenworth, Kansas Alpha Phi. VERA ALBERTA WILLIAMSON History Hollywood Kappa Alpha Themg Basketball C03 Track C119 Women's Conference CQQQ Ace High fel. PEYTON TYLER-WILLIE ' 'School of Engineering . Sacramento Sequoia Clubg Transferred from Sacramento Junior College, 191.63 American Institute of Electrical Engineers. CATHERINE NEWBLL WILSON History Los Angeles Kappa Alpha Theta. HKROLD S'rom'LANn Wrx.soN Political Science San Diego Phi Delta Thetag Transferred from San Diego State College, igzq. JOHNlCORNBLL WHSON Chemistry San Jose Phi Sigma Kappa. ROBERTlHBNRY W LSON English Burlingame Transferred from Kenyon College, 1925: Phi Beta Kappa. JAMES WIELE W11.'r Geology Balcerstielcl Los Arcosg Geological and Mining Societyg Toyon Clubg Manager Micropaleontology Bulletin QQ. Doaomr HELEN WINEEEEG , Classical Literature Evanston, Illinois Roble Clubg Transferred from Northwest' ern University, 19z6g Chi Nu Kappag Junipeto Sena Club. 1' I' Umgeem U , ' 1 DORIS WELCH Economics Lodi Alpha Omicron Pi. HARRISON VAN DER WERRER Law Everett, Washington FRANK EDWIN WEST Social Sciences Los Angeles Transferred from Loyola College, 19271 juni- pero Serra Clubq Interclass Football LO. JACK NORMAN WEsrsMIrH School of Engineering Hollywood El Cuadrog Transferred from University of California at Los Angeles, 1927. LAWRENCE BURBANR WEYMOUTH Chemistry Salt Lake City, Utah El Tigre: Alpha Chi Sigmag Bmnner Clubg Rifle Club, President Kal, Varsity Polo Cz, 3, 41, Circle S QQ. NEWTON FRENCH WHEELER Economics Monrovia Beta Theta Pig Scalpers. EDWARD ARTHUR WHITE History Madera l ,. A, - ,MMM I I l ! l 1 GEORGE VERNE WHITE , Economics Courtland E1 Tigreg Transferred from San Jose State College, 1916. LYNN TOWNSEND WHITE, JR. History San Anselmo Phi Gamma Delta: Nominated Rhodes Scholar I at Large, 1918. L l l FRANCIS EDWIN WHITNEY Economics Altadena Zeta Psig Weight Basketball 12.55 Ride A CockfHorse' ' Q11 . ,I MABBL ANITA WHrrTEN l English Burlingame i Transferred from San Mateo junior College, l 192.69 Cosmopolitan Club: Women's Debate Society. l . JAMES ALEXANDER WHYTB School of Engineering Fresno Transferred from University of Utah, 1925. JOHN Lours WIGGIN Political Science Bombay, British India Alpha Tau Omegag Ram's Headg Sword and Sandalsg Junior Opera Committeeg Ace High lil: Boomerang C05 Devil's Daugh' ter Qrjg Daley Qrlg Oedipus Rex Crlg The Green Goddess Kal, The Importance of Being Earnest fzlg Music for Football Show Qrlg Merchant of Menace C03 So This is Eden CID: 'Ray 'Ray Rover Boysl' Sak Ride A CockfHorse C213 Track Show zlg Wicked William Q35 Q Musical Direction cf Football Show frlgchgiajor Dramatic Award I . LEONARD FISK WILEUR BiochemistryfMedicine San Francisco Alpha Kappa Lambdag Y. M. C. A. Cabinet iz. si 43. .'u'. ,. r.v, s,,.,Ir- .'-1 ,-3 If -.,v'1w 'I V'-1 1' .. 4. . 1 1'-, L-1 lil il-r ik .. .r.w'V ,L C ce, ..,,,e nn. . PAUL CHARLES VINCENT! Economics Pasadena. Breakers Clubg Transferred from University of Southem California, 19Q.7g ,junipero Serra Clubg Toyon Club. VIRGINIA Gmcn Vooiuuais School of Letters Sacramento Chi Omegag Transferred from Sacramento Junior College, 19163 Chi'Nu Kappag Stanford Wornerfs Glee Clubg Stanford Daily Snail' K3, 4,1 The Swan QQ. Cx-menus CHRISTLAN WAGNBR Chemistry Stockton El Cuadrog Alpha Chi Sigmag Toyon Club: Circle S Swimming ful. ERNEST DEAN WAGNER Law Santa Barbara Breakers. MARGARET WAITB Education Los Angeles Gamma 'Phi Betag Schubert Clubg Football Show 43, 47- Russeu. SCOTT WAITB Economics-Classical Literature Riverside El Capitzang Transferred from Riverside Junior College, 19261 Glee Club, VicefPresidentC4lg Sequoia Clubg Princess Ida 137 WARDEN WALL Economics Selma Encina Clubg Transferred from University of Redlands, 1926Q Clee ClUbQuPl'il1CESBIdil,7f3J. -.. :-- -,- ...- +f-efi 1-If 1, ff- A-'T -ir-'Z A 43-:A 1' rig -ev: 'I 'I l -I .I ,I i ,. .. II J I I I II I I I Il II P .pf - - .1 gn-ff .- 4 W, If iff, .K In' I'-K V-417-4.x .,, I.. ...I rf,---,Mx H. . -M , ,,l'.fj-K' -, , Af I' -we -' . I V gk 'xg eil.. - it dl I :L-'34 will ' vi!-' :lj I. 4, ,'-jgl.-af.. 'Y fn... -fail 'i g l'-'Lx on-ga-Q ,ca ,.' WLC, ,,. , - -ara 'L 5-1 re. I- ,ju - 14 . .J,'Iq L-'Q 4 Y C' ' 'Xp' ' 4? :l'-1 4 L ' 'IL.- 74-f-.f-'-X ,., ,. 1 ..-.,-f .'.,.-L,,, -LLT-.,.?..r..,Ai. A -.--:-:P-144g-Y------Y A A A it .- ,L X -- , . -- ,Xa Ill I i u S' 54:- 7! I NORMAN Bbw.-mb WALSH I , , ' , H Economics Fresno ni H Theta Chig Transferred from Fresno State , , l Teachers' College, 19163 .Manager Stanford I i , Il Literary Magazine LQ. 1 l I g In , I II , I X I II I 'I :I I l l , X 'Pi-man 'WArxms WARD ' English San Diego I ' I Rpble ciub. Y I I.. I I I I , I I I I' I RICHARD .AIDNZO WAnNna I , ' I I Economics San Francisco 5 ' 'Sequoia Clubg Scabbard and Blade, Secretary ' I I-fl: P010 42. 5541, JBDiQl.M3mE9f Cal: Fresh- ' I man Dance mmirteeg Sophomore Cotillion I I Committeeg junior Proni Coimxiitteeg Military ' Ball Committee 13, 47, Chairman 1455 Junior 'I I Cla'ss.Couuci1. I I I I il I . I4 I Il I I Ii -EDWARD WARREN I I, Chqmisgry Modesto I I Se uoiaEatk1gClub1'1'ransferredfromMQdes- I 1 toillunior College, 1926: Phi Lambda Upsilong ' I - A Sequoia ciub. , I Ig , I I I I - I. ' I N 1 I I I A I ' .. A I F JAMZBS AVBRY WATSON I , I Economics Palo Alto I fx ll ISigma Nu. I ,II I In I I In 3 ' I l II 'I I I I I I I I I 'I I 'I I I II , IH-'mow WAY I I - I 'Law Petaluma I ,, I , Branner Clublg Interelass Tennis 61, 1, 3, 41. If ., I' A . F I . X I I! 5 ! I 1 MI ' I. I I I ii MARTEJ JOHN Wan I II , i Economics Sanf Francisco I Branneri Club: Interclags ,Bagketball C323 Junior . I, Prizm QQfi1i19iQr2ea Quaifswif Cz, 4liSf3l'lfQ1ld- I I D1ilySt:iiff3l. I Q I 1 ,- f1+fif'4'1':7' :IF fi ,,I!,V. - , I ' '!' as -1- ll I 1 L A! x -I A 'all J F , t ' :irq ---Wee T f---.---1----.w gf. 1 1.,-If .,.,.'.,'. Q.-.. ' .xl .1 -ge.-f:+.T.-.. 5 , ,f-,.1gJ' ,ig i.,.,f'J,f.,L.- - V ' 'i .. Y Y,,. . ki, Y -,...,? -,ff FLORENCE MARIQUITA THOMPSON Spanish San Francisco Delta Delta Delta, Rifle Club, Spanish Club' Stanford Literary Magazine Staif K3, 41, Adi W i vertising Manager C41 'gllomance of Resanoif Q. . JAN Trane Economics Oakland Beta Theta Pi. WILLIAM TaAvERs, JR. Civil Engineering Fullerton El Campo, American Society of Civil En' gineersg Toyon Club, Sponsor C41. THEODORE FREDERICK TRENT Economics Honolulu, T. H. Sigma Alpha E silon' Transferred from Cole P v lege of the Pacihc, r9z6. ,4- Dwrorrr HOWE TROWBRIDGE, JR. PrefClinical Sciences Fresno Alpha Sigma Phi. JAMES BRADLEY TUCRER Mathematics Twin Falls, Idaho Toyon Clnbg English Clubg Haminer :ind'CE? En C3, 415 Chaparral Staff C3, 413 Stanford Literary Magazine Staff 141. RUTH TUTHILL History Portland, Oregon Delta Gamma. LAWRENCE SAMUEL TUTTLE Civil Engineering Waimea, Hawaii El Campog American Society of Civil En- gineers, President 141, Toyon Club. GEORGE MERBDITH Um. PrefClinical Sciences Sacramento Theta Chig Transferred from Sacramento Junior College, IQ26Q Band 13, 41, Orchestra 631. KRYNB VAN DEN AKKBR Law Los Angeles Phi Gamma Deltag Phi Delm Phi. MARY ACELIA VAN HORN English Monrovia Sigma Kappa. JOSEPH WELIAM VANIER School of Engineering Hollywood Uniong Transferred from University of Illi' nois, 19163 American Society of Mechanical Engineers. ROBERT VERM1r.rA Economics San Mateo Delta Upsilong Phi Phi, Scalpersg Freshman Football, Numeralsg Golf la, 3, 41, Captain C31. Lours Runotrr-I VHWCENTI Law ' Pasadena Breakersg Phi Alpha Delta, Marshall 1415 Skull and Snakes, Secretary C415 Law Associationg Toyon Club, Varsity Football, fa, 3, 41, Block S 141g Freshman Foorballg Block S Basketball Cz, 3, 41, Captain f41Q Freshman Basketball, Nnmemlsg Freshman Basehallg A. S. S. U. Secretary ghjunior Prom Committee, Men's Council, hainnan 1414 Sponsor 141. N HARRY STRICKLER - Political Science Alexandria, Virginia Toyon Club, Transferred from Pomona Col- lege, 1927. ALLAN WADE STROWGER Economics Portland, Oregon Phi Gamma Deltag Alpha Chi Sigma, Treasurer 131, Secremry 141 g Circle S' 'Sociery, Secretary- Treasurer 1413 Circle S Soccer 11, 3, 41. ROBERT CUTHBERTSON SWAIN Chemistry Stanford University Sigma Nug Alpha Chi Sigma, Phi Lambda Upsilong Varsity Track 12, 31, Block S 131. ANDREW EMERSON SWICKARD School of Engineering San Jose Toyon Club, American Society of Mechanical Engineers, Scabbard and Blade. 1 H.ARVEY ARNOLD SWICKARD Economics San Jose Toyon Club, Transferred from College of the Pacific, 1924. CLARENCE SYPHER Economics Tacoma, Washington Breakersg Scalpers, Skull and Snakesg Toyon Clubg Block S Baseball 12, 3, 41, Freshman Baseball, Captain, Numemlsg Class President 131, Board of Athletic Control 141. TANENOR1 TAsH1Ro Economics V Kagami, Kumamoto-Ken, Japan japanese Club. L 14114,- '..Q2Ll -.' ' GEORGE Enwm THAYER School of Engineering San Mateo ThetaXigScahhard and Bladeg Band 11, 2, 3, 41. 1 1 i l WELLMAN PERRY THAYBR Civil Engineering Los Angeles Phi Sigma Kappag Transferred from George Washington University, 1915, American So- ' ciety of Civil Engineers. ARTHUR Uuucu THEUER Civil Engineering Salem, Oregon UniongTra.nsferred from Oregon State College, 19:63 American Society of Civil Engineers. l GEORGE FRED THEUERKAUE School of Engineering A u ' , Mountain View W Transferred from San Mateo Junior College, , h 1916. e J Ames BELLE THOMAS History Palo Alto Delta Gamma, Cap and Gown: A. W. S. So' cial Committee 1415 Women's Conference 141, Y. W. C. A. Senior Cabinet 12, 3, 41, Vice' President 1313 Sponsor 141. l GOMER Tr-romAs, JR. Law Los Angeles Beta Theta Pig Varsity Tennis 12, 413 Freshman W Tennis, Numeralsg Weight Basketball, Cap' tain 121. A i t CHAUNCEY THOMPSON , Military Science and Tactics Memphis, Texas El Tigreg Scabbard and Blade: Branner Clubg Circle S Po1o12, 3, 41, Captain 141. . A Y T T' tio, .- V, . 1 V 1 -at 1 -+- .. MJ., MARSHALL SOMBRVILLB English Burley, Idaho El Torog Hammer and Collin: Toyon Clubg Stanford Daily Staif 11, 21: Chaparral Staff 12, 3,413 Stanford Literary Magazine Staif 1415 Band 12, 31. JEAN BBNBDICT SPAULDING Chemistry San Bernardino Roble Club5 Iota Sigma Pi. Faeomuc WARDBN Srerzas History Denver, Colorado Phi Gamma Delta: Si a Delta Chi, President 1415 Hammer and COEIQ Stanford Journalists' Club5 junior Prom Committeeg Class His' torian 1415 Class Secretary 13, 415 A. S. S. U. ByfLaWs Revision Committee 1415 Rally Com' mittee 1412 Stanford Daily Staif 11, 2, 3, 41, Editor 1415 Chaparral Circulation Manager 131, Associate Editor 1415 Stanford Literary Magazine Staff, Managing Editor 1415 Quad Staff 1313 Illustrated Review Board 121 JACK Lowsu. SPMNGB11 Journalism Upland Delta Chig Transferred from, University of Washington, 19255 Sigma Delta Chig Stanford Journalists' Clubg Stanford Daily Staif1z, 3, 41, Associate Editor 141. ELIZABETH STALL Biology San Francisco Roble Clubg Cosmopolitan Club, VicefPresi- dent 141, President 141 5 Spanish Clubg Women's Debate Societyg The Goose Hangs High 121: Romance of Resanoifu 1215 Princess Ida 1315 Choir 1r, 21. HELEN WINSLOW STANFORD English V I Piedmont Kappa Kappa GammagTheta Sigma Phi5Ham- mer and Cofiing English Clubg Quad Staff 1415 Stanford Literary Magazine Staff 12, 31. JoHN EDMUND STANTON History Delavan, Wisconsin ' Phi Kappa Psi: Transferred from University 5 of Wisconsin, 1926. l -i 1 file .- -Sli 1 -A rl 4 .J - rll Gaoncrz Cownrau S1-A'rrzN Economics V El Paso, Texas Y Sigma Alpha Epsi1ou5 Transferred from Baylor University, 19265 Band 13, 413 DeMolaY Club5 Freshman Baseball5 Intramural Basebal '13,' 415 The Man Who Die? ,At Twelve O,Clock 2 . .JOHN GArusuzL1:- STAUB, Ja. PrefClinical Sciences Los Angeles ' A sigma cm. l H WHLIAM S1-MN , V . ll.. Economics Los Angeles 1 Uniong Transferred from University of Calif iornia at Los Angeles, l916Q Stanford Daily I Staff 131. W I JEAN Crnusrrn STEWART English Rio Vista ' Roble Club: Class Secretary 1415- A. IW. S. Flower Committee 1115 Fiesta Costume Come i mittee 1215 Sophomore Cotillion Committee 1 E215 Quad Staff 12, 415 Romance of Resanolfn 212 Dance Drama 1315 Sponsor 13, 415 ' Stabat Mater 1215 Choir 1215 Y. W. C. A. Member' ship Committee 121. PARNIB HAMILTON STOREY Biology Stanford University Delta Gammag Transferred from Barnard Col' lege, I91SQ Track 1215 Swimming 12, 315 Basket- ball 131g Wicked William 31: Football Show 141. GERALD STRANG - Philosophy San Carlos Transferred from Principia, 1926. ARJUNA DRAYTON STRAYBR - Economics Pasadena Tmnsferred from Occidental College, r927. . , Z M 'H' J rag . l CAROLYN BLANcHe SHEPARD English Visalia Rohle Cluh5 Cap and Gown5 Women's S Society, President C415 Rifle Cluh5 Hockey Cr, 2, 3, 41, Captail1C41, AllfStar C3, 415 Basketball Ca, 3, 415 Track Cz, 315 Tennis Cr, 1.15 Block S C415 Class Secretary C215 Executive Committee C315 Junior Prom Committeeg Class Endow- ment Committee C415 Senior Ball Committeeg Election Board Cig, 415 Rally Committee C3, 415 W. A. A. Boar' C415 Literary Board C315 Wo- men's Lodge Committee, Treasurer C312 Con' valescent Home Drive Committee C311 Sponsor C315 Y. W. C. A. Cabinet Cr, 11. ' GRACE NEWLAND SHEPARD Graphic Art Palo Alto Pi Beta Phi5 Transferred from University of California, X92'1Q Delta Epsilon. V JAc1r WILSON Suour Law Los Altos Phi Delta Theta5 Hammer and CoHin5 English Cluh5 Stanford Joumalists' Clubg Stanford Daily StalfCI, 1, 315 Associate Editor Quad C415 Associate Editor Stanford Litera Magazine C415Co'Aurhor South Seas Prirredu C415 Freshman Debate Squad C115 Chairman Senior Farce Com mittee. HENRY EDWARD SILVERMAN History Los Angeles ROBERT FLOYD SIMS Economics Long Beach Delta Kappa Epsilon. CLYDE JAMES SMITI-I, JR. School of Engineering Los Angeles Theta Xi. COLIN HUBBARD SMITH Geology Los Angeles Alpha Delta. Phiq Transferred from University of Southern Califomia, 191.415 Circle S So' ciety5 Circle S Swimming C31. I . C DrxoN SMITI-I Economics Sacramento Delta Tau Deltag Freshman Water Polo, Nu' meralsg Circle S Swimming, Managerg Inter- fraternicy Council C41. DAN Tunooi- SMITH History Stanford University Los Arcosg Toyon C1uh5 Varsity Track Ca, 3, 41: Freshman Track, Numerals5 Cross'Couuf try C31Q Rally Committee CA15 'Ray 'Ray Rover Boys C215 The Swan ' C315 Califomia Tech Debate C311 Varsity Debate C415 Band Cr, 1, 3, 41,Assistant ManagerC31, Manager C41. HERBERT ARTHUR SMITH Law Oakland Branner Club. JOSEPH ODELL SMITH Law Los Angeles Delta Chig Scabbard and Bladeg Ride A Cock' Horse C215 Band Cx, 2, 31. Btsuz MARGARET SNYDER - English Salt Lake City, Utah Rohle Clubg Transferred from University of Southern California, 1917. .louis GILHOUSBN Sonuzsxr Law Los Angeles, Sigma Alpha Epsilong Phi-Delux Phi 5 Skull and Snalresg Chess Clubg Block S Baseball Ca, 3, 41: Freshman Baseball, Numeralsg Freshman Footba1l5 Stanford Grays C215 U. S. C. Debate C415 Interfratemity Conference C315 Interfra- temity Board of Control C41. Aucn Sox-Ii.INosR E11glisl1'Puhlic Speaking Los Angeles Alpha Ornicron Pi. x s WELIAM SANDERS History Los Angeles Phi Kappa Sigmag Sponsor C4J. JOHN Hmosnr SANO Chemistry San Francisco Japanese Clubg Weight Basket ball fab, Varsity Boxing 141. JAMES Josaerr SAPERO ZnologyfPrefClinical Sciences Long Beach Phi Kappa Psig Nu Sigma Nug Class President C115 Rally Committee 1413 Chairman Bonfire Construction fr, aj. NATHAN Avaom SAPIRO , Pre'Clinical Sciences Stockton Sequoia Club, Transferred from College ofthe Paciiic, r9a7. ELIZABETH BRAmeaD S.-awe English Santa Barbara Roble Club, Junipero Serra Club, Stanford XVomen's Glee Club. CLARENCE LINCOLN SCHMID Economics Palo Alto Transferred from Snn Jose State College, 1926 Band Cz, 41. DAVID GORDON Sonmrnr PrefClinical Sciences Fresno Sequoia Club, Transferred from Fresno State College, 19262 Phi Rho Sigma. ,,. o E . :LAWRENCE Sci-IMrrT ' Economics Albany, Oregon Transferred from Oregon State College, 1927. ROBERT WBLLBR Scorr Economics South San Francisco Transferred from San Mateo Junior College, 4IQ26Q Interclass Football 141, DeMolay Club. GEORGE HAROLD SCRIBNBR 1 Economics Sacramento Sequoia Club, Transferred from Sacramento Junior College, 1916. FRANK Rosen SBNN Economics Sandusky, Ohio Sigma Alpha Epsilong Transferred from Dart- mouth College, 1926. GORDON SHALLENBERGER Law Los Angeles Toyon ClubgDelta Sigma Rho, California De- bate f4J. Louisa DAWBS SHBDD Zoology San Jose Roble Clubg Cap and Gown H413 Japan Club C433 Y. W. C. A. Cabinet Cr, 1, 3, 414 Women's Conference Q3-, 4Jg Sponsor 145. ALLEN SHBPAKD Economics Denver, Colorado Toyon Clubg Transferred from University of Denver, 1915. l T. ' if .. -1 f., , D i ,,-l., i'5L ntl i - . -,-.. - 'F' i .t H 1. . DONALD ALBERT Roiansrcy Economics Bakersneld MARJORIB HUNTER RonrNsoN Philosophy' Phoenix, Arizona Pi Beta Phig Transferred from University o Califomia, I92SQ Social Service Committee fajg Executive Committee Czjg Quad. Staff hh Track Show Cr, :DQ Ride A CockfHorse C225 Romance of Resanoifu fuk Football Show Cz, 31g Dance Drama f3lQl'WiCkEd William C3J. Russizu. Gmnou ROBINSON School of Engineering , Santa Monica El Cuadro, Transferred from University of Califomizi at Los Angeles, l916Q American Institute of Electrical Engineersg American Society of Mechanical Engineers: Scahbard and Bladeg Rally Committee QU. HOWARD SCHAEPFBR Rom: Political Science Oakland El Tigreg Branner Clubg Band Cr, 2, 3, 41. I ALICE MADBLINB Ross History Newman Roble Club, Transferred from San Jose State College, !Q2fQ Pi Lambda Thetng Sigma Delta Pig Cosmopolitan Club, Secretary 133. Trea- surer C413 Education Clubg Japan Society: Spanish Clubg Stanford Women's Glee Club. ALEXANDER TRBLOAR Ross Bacteriology Honolulu, Hawaii El Campog Circle S Societyg Toyon Clubg Circle SH Boxing iz, 31. HowARD Dems Ross Mechanical Engineering San Jose Phi Sigma Kappa: American Society of Me' chanical Engineers. l 1 5 ff- of k A .. I L ,. - ,i , ,,...A,. ,. - ,, J- ,.f-2--, an 1' '-i' 'I 'Haul h , 1., 'I ll: -, 1 -.... -wir ,V V l J - .,- '. ' ,, .1 . , ,Z1C.....f..-.1 .-.bn V I 4-..1.- I i . . FRED JOHN Ron-r PrefClinical Sciences ' Sacramento 'Sequoia Clubg Transferred from Sacramento X junior College, 1926: German Clubg Radio X Club. l i i i , DONALD EARL RUPPE ,Low V V - - Y Los Angeles Sequoia Club. I DAVID Aucrisrus Russnrr. l Economics Los Angeles Phi Gamma Deltag Transferred from Univer' sity of Califomia at Los Angeles, x9'z6. i EUGBIQE RUSSELL I ' Economics V Auburn I Toyon club. I i li I WHLIAM FRANCIS RUSSELL . .I Psychology , Highland Transferred from Fullerton junior College, I 1917. 4 i ALLEN Lnwxs RYAN Economics Cincinnati, Ohio Sequoia Clubg Transferred from University of California, 19153 Scabbard- and Blade. BYRL RICHARD SALSMAN Law Needles Delta Chig Freshman Track, Numerals. ai-. J --F..e-.....i, -. -- .. ,.,. . , . r '1 , .1 . . --e -V I . - ,w-'-nv-o - .I -.N 1. - I I- . ..- i . - - - I - -- i - f - . - l yi P f T '- , .'iI I Ll ,i 4, ' 1 L '4, ' .L f.. 1 '- -' r 'x ..,-.Q-4, ..e CHARLES RICHARD RAY School of Engineering San Francisco Toyon Clubg Transferred from University of California, 19251 American Society of Me' chanical Engineers, President C jg Engineering Council, Secretary-Treasurer ip, Basketball , fel, Interclass Basketball fa, 3, .QQ Interclass Football fail. Y.. HERNDON CARROLL RAY Social Sciences Menlo Park ll I I ROBERT RAYMOND . Economics New York, New York JOHN SNivELY REASONER Law San Francisco El Torog Toyon Clubg Varsity Track lglg Freshman Track. 1 1 AUGUST RBIOH , I P1e'Clinical Sciences i Bakersfield Brariner Clubg Omega Upsilon Phig Masonic Club. l l 1 l l l GERTRUDE EMMA RENDTOREE . EducatiowEconomics 1 Stanford UHiVCf51tY L l Pi Lambda Theta g German Clubg Zoology Club. l 1 l HERBERT KITTRBDGB REYNOLDS Psychology Portland, Oregon Theta Delta Chig Hammer and Colhng English Clubg Quad Staff iz, alg Editor C4lg Quad Board , 13, 41g Publications Council Q25 Co'Aurhor ll South Seas Preferred ' QQ. l JAMES EUGENE REYNOLDS Economics Pasadena Phi Delta Thetag Varsity Basketball lglg Var' sity Baseball fa., QJQ Freshman Baseball, Nu' mera s. MERNON RICHARDS Economics Long Beach Delta Kappa Epsilon. CHARLES RICKETTS Economics Los Gatos Sequoia Clubg Transferred from San Jose State College, 1926. CHARLES 'FERGUSON RILEY Political Science San Francisco Transferred from University of Santa Clara, 1926. LIDA RITTLER Spanish San Francisco Chi Omegag Basketball Ci, 41g Hockey Cr, 2, , 4l, AllfStar Lili Tennis Cz, 32, AllfStar G39 Football Show Czlg Track Show C113 Dance Drama iglg In the Next Room fglg Princess Ida fill: Romantic Young Lady 141g Y. W. C. A. Cabinet Cz, 41. J IM ROBERTS School of Engineering San Mateo El Torog Toyon Club. JOHN DONALD ROBERTS K Civil Engineering San Jose Transferred from Universigy of Santa Clara, 19265 American Society o Civil Engineers. -Y , -- , .,. l f 1 - f- 'li ,dwil ,AM .- '- .. . I: -. -- 4 i x I V-. -- .A if--, , Y ., ...Y A .- ,M-. ., . r . , . i .. ..,, , N . A, .., . -, , , '. ..-s. ..,. .- , . 1 . 1 ,J , X . it t -..H ff'l lf- lf if F-1.'.,y..-Prep . .,- - 4.-,-.,.. , x 4 l.' 'l if 'xml W - '1,'h . 2: I- ,fr I I 1- f 'l - I QJL1- L 1 I.- 4 . ,lin .. Y ,1,, .,, I. -,g., i i HENRY PBABODY POWELL Il THOMAS HALL PUSHMAN Mathematics Santa Ana ll Social Sciences Chicago, illlinois Sequoia Clubg Transferred from Santa 'Ana 1 - Cl b.T mt., i I i SW U.:n,sz',25i:':2?is?4:13'ff,t'?Wfm , 5 I. I i i joan B.-xsvn Pnxcn .M Zoology Stanford University l 1 DORQTHY MARGARET QUINN Sequoia Clubg Zoology Club, Secretary' ' ' Enghslvpubllc Speaking Tfmufef fill' I Stockton I lx Alpha Omicron Pi. .va i ,' l T ii ll , W Ill l Wx1.uAM CLAY Piuca n ' E M DWARD QRGAN , Law Los Angeles - Zoo! CEUINN Phi Kappa Psig Phi Dena Phi. I y 059' tockton i i I I ' l I l , 1 . vi i Inns Enwmw Pmsmzimo l CHAN-B5 LEO RACHPORD Law San Francisco A , Law Alfufas El Tigre: Encina Clubg Euphroniag Junipero l I Seq'-'Ola Cl'-'b3B9xinBf3'4?1 UYHVCFSWY Cham' Serra Clubg Inteiclasgsiaotballg Interclass I' P103 K3 - RSC . ' DA:-mzL Ono Pmaors ' Political Science X 1 JAMES BWING RAE Portland, Oregon EC l P d V Encinu Club: Transferred from Columbia l . onmmcs asa ana University, 19z6gPi Sigma Alphaq Cosmopolif f Phi Kappa Sigma. tan Clubg German Clubg International Rein- lb A tions Clubg Stanford Grays 131. J l yi Jams Conor-:tm Puncau. Amin 'ROBERT' RANKIN Law Represa Law Samoa Sequoia Clubg Junipero Serra Club. Bmnner C1ubgDeltnTheta Phi. I Q G P l l Amana THOMAS Us:-IMAN, Jn. f Rufus Pnacxviu. Bnzngnzy Philosophy Chicago, Illinois. I ' Law Cleveland, Ohio Sequoia ClubgTransfe:xed from Northwestern ,l l 5'g N 9 ph' D it pm: ph' Phu Sk Il d university, 19264 gf? gjlubs Stanford my 5 J Sl1allr!:ag1?lock3fS'2f?iIf.?k 4i5F.l1.Iln. ' , i me , um . l ' 1 - IVA C-, i ff. f .fs . I . 'P 2: Eff in ' . X,-E N'j.c Hulani N lu H i i i li i l View -QLD faux? sign-T .lf -, ues. .fl ,..i-'l.-H1 -L4 'LU . , f -1 . ,.-.4.- 'F'-Q7kjf'a,QJ'Q1,', ,Ljj.,j.,f v YEZNEEG CONSTANT PASHGIAN Economics Pasadena Branncr Clubg Transferred from Occidental College, 19163 Football Show 135, U. S. C. Bleaeher Stunt Trophy 145. EDMUND De Wrrr PATTERSON, JR. Social Sciences ' Redlands Bmnner Club. ORVAL HENRY PATTERSON History ' f -- Chico Breakersg Transferred from Chico Junior Col' lege, z9a6g Euphroniag Varsity Baseball 135. ALBERT CARL PAULSMBIER Chemistry Cakland Sequoia Clubg Transferred from University of Nevada, 19262 American Chemical Society. ROGER MCKINLEY PAXTON History Ashland, Ohio Delta Chl? Transferred from Ashland College, 1926. CHARLES Cum-is PAYTON Civil Engineering Ferndale American Society of Civil Engincers3 Inter- class Football 125 . JOHN BRODBRICK PEOK PrefClinical Sciences Honolulu, T. H. Fbi Sigma Kappa3 Interfratemity Council 145. l .,l.ii M - .. r 'N . t W' ' V GEORGE PENNEBAKER Economics Los Angeles Uniong Transferred from Occidental College, 1926. I Trroims JOHN PETERSON Social Sciences ' Royal Oak, Michigan 4' El Campog Glee Club, Varsity Soccer 1353 'T Interclass Soccer 1253 Ride A CockfHorse 135- N l ll ' l l ,. ROBERT Louis P1-111.1221 Graphic A1tfEducation , . Norwalk Phi Gamma Delta3 Delta Epsilong Hammer and Coiiing Sigma Delta Chig Varsity Baseball 12, 3, 453 Freshman Baseball, Numemls3 Quad Staff 11, 3, 453 Chaparral Staif1z, 3, 45, Art Editor 1453 Sponsor 145. w AGNES GROVES PLATE PsychologyfBiology San Jose Roble Clubg Transferred from University of California, 1927. 1 l J EDWARD HARRISON'POST, JR. Economics San Diego Beta Theta Pi3 Transferred from New Mexico Military Institute, r9z63 Varsity Polo 13, 45. ADBLAIDE MARIE POTTENGER Classical Literature-Latin Monrovia Delta Delta Delta3 Transferred from Otterbein Collegeof Ohio, IQ262 Stanford Wornen's Glee Club 13. 45g Hockey 13, 459 Tennis, Numerals 11, 353 Basketball 13, 45, Captain 145. R GEORGE HAMrLTON Ports School of Engineering , V- Los Angeles Alpha Sigma Fhig American Society of Civil ' Engineers, Treasurer 1 53 Freshman Football, Stanford Crays 145. ' A l JULIA MIRIAM NORTH Englislifl-'ulalie Speaking , La Jolla Gamma Phi Beta: Masquersg The Goose Hangs Highv C113 Princess Ida Kgjg Wicked Williami' 1315 The Romantic Young Lady C45- ,ROBERT PALMBR4 NULL - Economies ' Los Angeles Transferred from University of California at Los Angeles, 1926. WHLIAM BUliRCWS.NUTB , Economics - - Palo Alto Transferred from San Mateo Junior College, . l916. IRVINB HoRAcE -NYE - Accountancy - Alhambra Sigma Chi. STEVEN FRANCIS O,DONNELL Social Sciences-journalism . Los Angeles A , Phi Gamma Delrag Ram's Headg Sigma Delta Chi, Stanford Daily Staff fl, 2, 3, 41, Associau: Editor 141: Quad Staff 141. Yosrno OKUMOTO N Pre-Clinical Sciences Hilo, Hawaii, T. H. - Uniong Transferred from University of Hawaii, 1925, japanese Club. MARGARET OLSEN Philosophy Los Angeles WQLLIAM IRvrN OLEEN Economics San Mateo Transferred from San Mateo Junior College 19z6. CHARLES DONALD O'MALLEY History ' San Francisco Toyon Club. CARL FREDERICK ORION Philosophy ' ' . ' San .Francisco . Theta Delta Chi. I .af .. . Yosruo Oucm . . Entomology Tokyo, japan Japanese Clubg Transferred from Tokyo Agri- cultural College, 1917. WILLIAM ALEXANDER PAGE Law - Los Angeles Stanford Daily Staff 111. JOHN 'FREDERICK PARSONS School of Engineering San Diego Union: Transferred from San Diego State Col' lege, 1926. Lrovn SAMUEL PARsoNs Economics Palo Alto Tl' , .. N. Q af!- W ip I-.P .'Tr fi I Q-2 I4 '-if 1. I 7 ll f ..., -I It - ' . ET ., ,, .. . - ,4 ,mw1 -.,, 1' -'- . v- ,' - ' . iw ' V., , .-. . Q I V'4,4mIwi A,--'f t i f-- V ,Q 3,I -I, A ,NJ -, eta-, - 4- -. I - , wt., 1. ,., ,,. .- , ., , ei .J W ,Q .,'L . , ,.i'.., -,A:,4-,lAj Y W - -4-'?'.-.s-- ?..'f..4 -' ,J -4 5' ,X P ., 1 A , H' ' 'TTS I T' T i i 1. Ctm-on Mo1uuLL Economics Santa Rosa K Al h gPh' Ph',S cretaryf 1g,Var ity Bggbihll Cs, 213 F1ieshrhaneBaseball,4NumerIalsg Freshman Footballg Election Board I 13 Inter- I fratemity Board of Control Lb. HELEN EL1zAn1z'r1-1 Mosman History Long Beach Q Delta Delta Delta. I Gus'rAve ADOLF MUELLBR 1 Law San Diego Phi Kappa Sgma. , I !'I , I I., I ROBERT EDWARD -MULVANBY I Economics Billings, Montana Sigma Chip Transferred from University of Montana, 1916. I I I JOHN EARL MUNHOLLAND QI Law ' Long Beach W Phi Kappa Psig President Encina Club C115 , junior Prom Committee 1856 'Ray 'Ray Rover Boys Lak Ride A k'Horse 121. ,1 CARL THOMAS MUNSON Economics Azusa Alpha Tau Omegag Transferred from Pomona College, 1926. MICHAEL MURPHY A Civil Engineering Berkeley Delta Kappa Epsilon. ' i 'I DONALD ANGUS Mummy 1 School of Engineering Suisun Sequoia Eating Clubg American Institute of -Electrical Engineersg Sequoia Club. CHARLES EDGAR MYNARD Economics Oakland El Campog Toyon Club. Hmuua-r ELIZABETH NEALL Psychology Eureka Roble Clubg Transferred from San Jose State College, 192.65 Tau Psi Epsilong Women's Glee Club Q41. 4 Faso Hmms Newcomn History Ashland, Ohio Delta Chig Weight Basketball 121, Captain: Interclass Basketball 13, 415 Interclass Football Cz, 313 Chairman Cord Ball Committee. HAROLD Mlznsium Nrzwrm Economics Hutsonville, Illinois Phi Sigma Kappa: Transferred from University of Illinois, 1917. Tizn KENNETH Noam-mm School of Engineering Los Angeles' Sequoia Club: Transferred from Fullerton Junior College, 1915. WINSTON NORMAN English Los Angeles Alpha Sigma Phi: Hammer and Coihng Sigma Delta Chig Freshman Tennis 111, Election Boardf 1, Chapar1a1StaIH1, a, 3, 41, Managing Editor 331, Editor 13, 1g Quad Staif Publi- cations Council I3, 54 CofAuthor Wicked William 131g Freshman Handbook Commit- tec C31. I II , we ',' lj II ' ,1.. ' ', I -qv, I, - ,L .,, . , Y A z I V I I ,I I--., ' '21-'.'1I--'. IIQ - J c'ff'13 1-W a sa 'I I,-'J , -in Ai, , ,N e il, .1 ' JOHN EARL MrLnaRY s 2 Chemistry San Diego I 1 Transferred from San Diego State College, X 1 IO27. l i ,l i 1 ARTHUR CAPPS MELER l Law Salt Lake City, Utah X i Los Arcos: Phi Alpha Delta: Toyon Club: i Stanford Daily Circulation Manager 1213 Stan' i ford Literary Magazine Stalf 131. l BERNICE ELIZABETH MRLBR Hist San Francisco UTD' Kappa Kappa Gamma. FRED ALLEN MILLER School of Engineering Anaheim V Alpha Kappa Lambfia: gvlasonic Club: Band r, 2 . LAURA MINTY MILLER Social Sciences Los Angeles ' Alpha Phi: Track Show 111: Romance of Re' , sanolfn 121: Football Show 131: Wicked William 131: Sponsor 141: Women's Confer- ence 141: Y. W. C. A. Cabinet 11, 1.1. l l L i l ROBERT LINCOLN MILLER , Political Science Berkeley ' Delta Tau Deltag Transferred from St. Ignatius College, 1926. l l ' , l . A FRANCES ELEANOR MLLB 3 History Hollywood l Roble Club: Transferred from University of Q ' California at Los Angeles, r9z6. N ' , . ,.. , ,ll , . f r WALTER Mins, JR. Mechanical Engineering I Oakland American Institute of Electriml Engineers: American Society of Mechanical Engineers: Circle S Swimming 12. 3. 41: Freshman Swimming, Numerals. FRANK Ti-rnononn MITTAUER English Albany, Oregon Transferred from Oregon State College, 19a6g Sigma Delta Chi, Secretary 141: Stanford Jour- nalists' Club 11, 3, 41: Stanford Daily Staff 12, 31, Night Editor 141. Associate Editor 141: 'The Green Gocldess 1z1. CLIFTON REYNOLDS MONTGOMERY Law Lodi Beta Theta Pi: Varsity Football 141: Freshman Football, Numerals. CLIFTON HAYES MOORE Social Sciencesefoumalism Lodi Alpha Delta Phi: Hammerand Collin: Stan' ford journalists' Club: Varsity Swimming 12, 131: Freshman Swimming, Numeials: Block US' Tennis Mamet 141: Freshman Basket' hall: Chaparral S 11, 3, 41, Associate Editor 131: Stanford Daily Stail 1r, 1, 31. FRANCIS KBTMAN MORGAN P'refClinical Sciences Palo Alto Sequoia Club: Hammer and Collin: Chaparral Staff, Associate Editor 13, 41. NATHANIEL MORGAN School of Engineering Palo Alto Sequoia Club: American Institute of Electrical Engineers, Vice Chairman 141: Radio Club: Sophomore Cotillion Committee: Junior' Prom Committee: Stanford Daily Business Staff 111. V1v1AN ALBERT MORLEY Civil Engineering 'Bakersfield El Toro: American Society of Civil Engineers: Masonic Club, Vicefresident 141: Toyon Club: Varsity Football 13, 41, Bloc S 141: Freshman Football, Numerals. 7:11 T I, I-Vi ,I L W.. i.,m , I Q 1 - is A JAMES VERNE MANSFIBLD Economics Palo Alto Alpha Kappa Lambdag Varsity Tennis Cz, 1, 45g Freshman Tennisg Interelass Tennis CQ5. MIRIAM MARBLE History South Pasadena Ka pa Kappa Gammag Transferred from Smith College, 19243 Track Show C253 Sophomore Cabinet C255 Women's Conference C45. DONALD GEORGE MARQUIS Psychology ' Bellingham, Washington Sigma Nu, Transferred from Bellingham State Normal School, I9z5gPhi Beta Kappa: Tau Psi Epsilon, Treasurer C455 Glee Club Novelties C353 Wicked William C355 Football Show C45g Band Manager C55. FRANCIS MARSHALL English North Adams, Massachusetts Phi Sigma Kappag Transferred from Williams College, 1917s English Club. LLOYD ALEXANDER MASON Law Riverside . Union. EDITH MA1'rsoN ZoologyfP1efClinical Sciences San Bruno Roble Clubg Tennis C155 Hockey Cr, 2, gl, 45, Manager C453 Sponsor C453 Y. W. C. A. Cabxf net Cz, 45. YALE CANDEE MAxoN English Campbell Sequoia Club, Euphroniag Glee Clubg Y. M. JACK BRUNRER MEAKIN Economics Salt Lake City, Utah Phi Kappa Sigmag Ram's Head, German Clubg Football Show C3, 453 Glee Club Novelties C35- ZELDA MENDENHALL , Political Science Palo Alto Delta Gammag Transferred from University of Califomia at Los Angeles, IQZS, ROBERT MBNSINGER, JR. Economics . Modesto Transferred from University of Nevada., 1927. EUGENE SGI-IERB MERRILL Economics Pasadena El Torog Transferred from Oregon State College, 1925. DONALD MERRIS . Economics . Pasadena Los Arcosg Transferred from Pasadena Junior ' College, 1916. EDWIN JULIUS MEYBERG l Economics Los Angeles Branner Clubg Glee Clubg Varsity Golf Cz, 3, 45, Circle S C3, 45, Captain C455 Freshman Golf 3 California Intercollegiate Golf Champion l35: Glee Club Novelties C153 'Ray 'Ray Rover Boys Cz5. A MARGARET MEYER EducationfCraphic Art , , C.A.Ch' tC, 5,SctryC3gBusiness '- Managera Prlishrhad Hinibaook 215g Choir . Sacramento ' C , 5, Alpha Phi. 3 4 ' 'I , . I , . .1 , - 1 P . V -. . . r.,, .' . '- J I THOMAS GRANT MCGUIRE Economics Santa Rosa Phi Delta Thetag Phi Phig Scalpersg Iunipero Serra Clubg Varsity Track Cz, 3, .03 Freshman Track, Numeralsg Freshman Soccer, N umerals. CHARLES GALEN MCKNIG HT Economics Fresno Uniong Transferred from Fresno State College, 1 927. DONALD lnvrmz MCMURKAY Civil Engineering Aberdeen, Washington Encina Clubg American Society of Civil En' gineers. DEAN BROWN MCNEALY Political Science Los Angeles Alpha Delta Phi: Transferred from University ofChic:1go, 19l7Q Wicked William igjg Foot' hall Show LQ, FRANCES EVELYN MCNELLY English Miami Arizona Alpha Omicron Pig Transferred from Phoe- nix Junior College, roa6g Stanford Literary Magazine Staff Q13 Stanford Women's Glee Club K3, 41. Rosi:ANNA MCQUESTEN Economics Tacoma, Washington Roble Cluhg Transferred from University of Washington, r9z7. THOMAS MALCOLM MAcQUmny Y Y W' l v MARION MACK Economics Bakersfield Alpha Ornicron Pig Transferred from Bakers- iield junior College, I92f. Fmzneiucx MACY Civil Engineering Los Angeles El Campog American Society of Civil En- gineers. Corresponding Secretary C4J, Presif dent 1415 Weight Basketball C213 Junior Prom Committee, Chairman Senior Plate Com' mittee. WILLIAM FRANCIS MAGUIR1: Economics San Francisco Phi Kappa Psig Phi Phig Scalpersq Skull and Snakes: Block S Baseball fa, , 4,Q Freshman Footballg Freshman Baseball, Numerals. jonu Tuoms Mani, School of Engineering Berkeley El Campo: Transferred from Rensselaer Poly- technic Institute, r91.6g American Society of Mechanical Engineers. Donorny MALLE1' Graphic An Palo Alto Delta Delta Delta: Transferred from University of Idaho, 1927. Romzru' YALE MANN Economics El Paso, Texas PAUL MANNING Economics Watsonville Political Science Los Angeles El Capitang Transferred from Hollister junior Transferred from University of California at College, 1926, Chaparral Staff Ctl. Los Angeles, 1917. il PAW-TTY T Fi P ',i,:k'1, -ir' ' 'R l4.u 'fiI'1. 1 Q iw, iv .V ,F-.'l-',L' ' Q4 !'.cl FRANK ARTHUR LUNDY E11glish,Lite1ature Hollywood Los Arcos' Transferred from Universit of Y Southerri California, 19265 Encina Club. ROBERT FLOYD LUNDY ' Economics San jose FRANK WALTER LUSIGNAN Pre'Clinical Sciences Stockton Uniong Transferred from College of thc Paciiic, 1926g Interclass Tennis 131. CHESTER FRANCIS LUTHER Mathematics Auburn Sequoia Eating Clubg Sequoia Club. LUCLLE LYON Graphic Arr Burlingame Sigma Kappag Delta Epsilon, Presiden tC41g Wo- men's, S' ' Societyg Le Cercle Frangaisg Zoology Clubg Hockey CI, 2, 3, 41, All-Star Ci, 2, 413 Basketball K2, 3, 41, AllfStar E312 Track C2, 413 Swimming 121, Block S nf31g H400-Point Star C413 Women's Co erence Q41. JOSEPH ARCHER LYSLE Law ' Los Angeles Delta Them Phig Rifle Clubg Polo Cz, 5,' 41. WILLIAM QUINN McAnoo Education Hayesville, Ohio Delta Chig Transferred from Ashland College, 1927. f 1 MARION MCCARDLE Social Sciencesefournalism Fresno K. Alpha Th tag Cl Secretary C113 ' Wa Hwfckefi Williazgis' 433. DAVID MACCLYMENT V Economics Riverside Phi Kappa Sigmag Transferred from Riverside junior College, I925- THBRON Lewis MCCUEN Education Palo Alto W1T.LIAM CLIEroRn MCDOWBLL Social Sciencesffour-nalism ' Alameda Phi Sigma Kappa. RALPH TALBOT MCELVENNY Law Salt Lake City, Utah Phi Gamma Deltag Phi Delta Phig Quadrangle Clubg Smbbnrd and Bladeg Stanford journalists Clubg Block S Tennis 12, 3, 41g Freshman Tennisg Stanford Daily Staff Cr, 2, 3, 413 Quad Staff C31 41- CHARLES THEODORE MCGAVIN School of Engineering Q Los Angeles Phi Kappa Sigmag Transfered from Purdue University, 1926Q American Society of Me' chanical Engineers. LAWRENCE EDMUNIJ MCGONIGLE Chemical Engineering Y A Los Angeles Phi Kappa Psig Alpha Chi Sigmag Scalpers. -,fr-wa.. nj' A ,...- ... 'Ir ' I 'If- ffi--I . V -rv.. ,., .. . .I : I Th gig I ,LL um I 4- - . .. .-- -1 - , - . - .-. Q , .' f' . I. -1-.- -1' I ' IIIILTJII QflI,,r.s.I.. '., ' ',,,'f1,5--1 -- I I , , f , a ,, ,,.,.,I. -I, , ,xr 'sl 1 I , 11.1. L . .. . . -.-I... . ...-:fy ...av-IJL I , I! F J, LEON HBRMAN Lavr Political Science Los Angeles Branner Clubg Quadrangle Clubg Block S Basketball Manager 1411 Rally Committee 13, 41- I HENRY LAURENCE Lnvmoaa I I Economics Baker, Oregon 1 Alpha Tau Omegag Transferred from Oregon ' I State College, 1927. I I I WILLIAM HAROLD Lnvrr I Law San Francisco I Branner Clubg Euphronia: Varsity Boxing I 13, 415 University Bantam Weight Champion I 131: Stanford Dail Staff 1r, 11, Advertising Manager 1:15 Calitlorrua Freshman Debate 211, U. C. L, A. Debate 1313 Squad Debate 41. I III II AYDOLPH HAFFENBBRG Levy I Political Science Los Angeles Toyon Clubg Polo 141. V I I I LIONEL ANNIS Lava' I English Joplin, Missouri I Toyon Club. I FRANK MAcBoyLIz Lnwrs Law Portland, Oregon Beta 'Theta Pig Phi Delta Phi: Ram's Headg Quad St'aif12, 3, 41, Manager 1414 Quad Board W 13, 41g Publications Council 1411 In the Next Room 1z1g 'R.1y 'Ray Rover Boys 1:15 A ' Kiss for Cinderella 1315 Football Show 12, 31. I Ronrnvr LINDSAY Social Sciences 1 Stanford University Theta Xi. I I I I I -aaa ,. .f L1I' -' 'J IQ- -I-. If-- 1.1. ,I ,I.I. W -KEN,-FII4 ' ',! . , ,. - 1' na... ,I - - ,. I Y I., Ls... I 1 I I I I WI' I ' JAY GRBBNHOOD L1ssNI:Iz I ' A Economics Los Angeles . ' Toyon Club: Freshman Trackg junior Track Manager: Hamlet in Modern Dress 19.1. I I I I I I I ,Ions TOWNSEND LONG I Law Chatsworth I Phi Kappa Psi. I I I I 1 , I If II' Rrcr-man EpwAao'LoNc I Economics Ashland, Ohio H X Phi Delta Thetag Transferred from Ashland F College, r9z6. I I, I P I I I I I I W, I ' JOHN STEWART Low I1 I School of Engineering Berkeley I I I Branner Clubg American Instituteof Electrical Engineersg Stanford Radio Club. I Zeta Psi: -Phi Phig Saalliversg Freshnliarifwini- 1 i ming, Weigh: Basketb 121, Block S Foot' I' ball Manager 141. I I I MARION TEiAIS LOZANO 3 I Political Science Reno, Nevada I Delta Gamma. '. II I I I I II I I IDA Maam LUNDQUIST I 1 EnglishfPublic Speaking ' Middletown , Cosmopolitan Club, Secretary 121. I I , X - m W W V Y E A P -.1 jfi :.- L faqL-.Qm ',g.l,. -J -LL A - - L- f -pf ...J I 'I T I I I M RICHARD Sums Lownv I ' Economics Oakland CLARENCE HEALD LANGSTAPP Political Science Pasadena El Torog Tmnsferred from Pasadena Junior College, 19262 Encina Club. ARTHUR CHRISTXAN LARSBN Civil Engineering San Francisco Sigma Chig Scabbard and Blade: Varsity Polo 11, z, 3, 41, Manager 1313 Weight Basketball 1113 In the Next Room 121. ROEINA HENRY LARSEN Spanish Palo Alto Sigma Kappag Spanish Clubg All-Star Archery 1213 Y. W. C. A. Social Committee 131. NORMAN GRANT LARsoN School of Engineeringfconomics Berkeley Phi Kappa Psig Ram's Headg Sword and San- dalsg Freshman Golfg Dmmatic Manager 1415 Dramatic Councilg Macbeth 111. STANLEY WARREN LARSON Economics Claremont Transferred from Pomona College, 1926. CAROL LASATBR Public Speaking Wichita, Kansas Delta Delta Deltag Music Clubg Schubert Clubg Princess Ida 131. HowARn BBECHER LATHROP, JR. Geology San jose Alpha Kappa Lambdag Transferred from San ,lose Junior College, 1926. ' -laik LAWRENCE HENRY LAzARUs Chemistry Los Angeles Toyon Clubg Phi Lambda Upsilong Euplxroniag Stanford Daily Staff 11, 2, 31, Assistant Busif ness Manager 131. CLAUDE LEACH Geology Placentia El Campog Toyon Club. HELEN LEASE Biology Santa Cruz Roble Clubg Women's S Society, Secretary- Treasurer131gScbubert Clubg Hocke 12, ,41, AllfStar1z, 1, Manager 1315 Basketball 5, 2, 31.All-Star Ch, 31. Captain 111: Track 11, 21: Script S 1215 Block ' 57,1313 Field Day Man' age: 1215 Y. W. C. A. Cabinet 11, 21g Hiking Manager 12, 41g W. A. A. Board 12, 3, 41g W. A. A. Delegate to Cornell 131. NBLTY DELMAS LEERANC French San Jose Alpha Phig Transferred from Dominican Cole lege, 1925. .JOHN WILLIAM LEHR i Economics Palo Alto N Theta Delta Chig Tmnsfeirred from Fresno State College, 1925. FRANK LERCHEN, JR. School of Engineering Los Angeles Uniong Transferred from Occidental College, 1926. FRANK CHARLES LERRIGO English Topeka, Kansas El Tigreg Transferred from Washbum College, 1927g Toyon Clubg Band 11, 21. -. Tw, , V ,ir EDWAILD FRANCIS KENGEL Economics Los Angeles Alpha Delta Phi. DOROTHY STEWART KERLEY History Los Angeles Pi Beta Phi: Transferred from University of Arizona, 1925: Schubert Club: Chaparral Staff fel. HENRY KEYES Economics Minneapolis, Minnesota Delta Upsilon: Transferred from Carleton Col' lege, 1926: Class Treasurer QD: Quad St:-1Ef4l: Debate Council K3, 43: Debate Manager C3, 43: Band QQ. NARcrs JAMES KHAZOYAN Economics Pasadena Sequoia Club: Tmnsferred from Oregon State College, 1916. ' MARTIN RAY KILGORB Economics Imperial Encina Club: Transferred from El Centro junior College, rgzo: l?e, Molay Club: Fenc- ing 4 . ROBERT Kms PrefClinical Sciences Lima, Ohio Delta Tau Delta. VERN Erwoon KING A Economics Pendleton, Oregon Sequoia Club: Junior Baseball Manager: Sophomore Cotillion Crgmmittee: Band Cr, 21 31 4 ' r -,, 1 l ARTHUR Krmcrzr., JR. Geology Hollywood Branner Club: Freshman Swimming, N umerals. SALLIE KINSMAN English Yorba Linda Chi Omega: Transferred from Fullerton Junior Colle e, 1917: English Club: Stanford Daily Stalf iz, 3, 41, Merchandising Manager 1.0: Y. W. C. A.Senior Cabinet filr VicefPresidenr 1.0: Women's Conference 141 : Stanford Fellow' ship Governing Board 135. HERBERT ARTHUR KLELN English Los Angeles Toyon Club: English Club, President LQ: German Club: Stanford journalists' Club: Var- sity Swimming Cz, 31, Circle S fzl: Freshman Swimming: Freshman Water Polo, Numerals: Chairman junior Opera Music Committee: Stanford Daily Staff fr, 1, 31, Associate Editor 1.0: Stanford Literary Magazine Stall' Cal: Managerial Stall' A. SS U. Concert Series 3' 4 - CARL ROBERT KocH Electrical Engineering Sacramento Sequoia Club: Transferred from Sacramento junior College, 1926: American Institute of Electrical Engineers. FERnrNAr-in LEONARD PHILIP Koen Bacteriology and Experimental Pathology Wauwatosa, Wisconsin Transferred from University of Wisconsin 1917: Alpha Chi Rho. Wu.r.r.-aM BRADFORD KOTTINGER EconomicsfAccou-ntancy San Jose Br-takers: Transferred from San Jose Junior College, r926. Tim ON KWAAN Economics Hongkong, China Chinese Club: Transferred from Lingnan University, 1924. i l Z---sv , T A , , ', '.L'.l' II f'.,'2-i. + K, f, 5,411-L.gYg,.,,jiW ee' 5 - '7i.,..i'i'T'i'l El 1 - FS - - . 4.1 1 I WILLIAM EDWARDIJOHNSON Economics San Francisco Phi Gamma Delta. WILLIAM BARKSDALE Joi-1Ns'roN Economics Fresno Los Arcosg Toyon Club: Class Treasurer C113 Senior Program Committee C413 Freshman De- bating Squad C11. Wnsuzr FRANK JONES Economics Pasadena Sequoia Clubg Transferred from Pasadena Junior College, 1916. RAPABL JOSON Zoology ' Gapan, N. E., Philippine Islands Transferred from San Mateo Junior College 19165 Cosmopolitan Club, MARGARET KALENBORN Economics Redwood City Gamma Phi Beta: Schubert Club C1, 2, 315 Sophomore Cotillion Committeeg Ride A Cock-Horse Cz1g Wicked William 231g Princess Ida' C315 Fiesta Committee 113 Women's Lodge Committee C313 Ai W. S. Health Committee Cz, 3, 41, Chainnan C413 Sponsor C41. 'KATHERINE KAMM English Fresno Alpha Phig Le Cercle frangaisg Track Show C11g'Football Show Cz, 3, 413 Ride A Cock- Horse Cz1g Romance of Resanoifu C11g Wicked William C313 Junior Opera Commit' ICC. JOHN KENNETH KASEBERG Law Portland, Oregon Music Clubg Orchestra. , fr. -..A- e 1 -v...e.f V.:-..,g.,,,i,v . ia- .- -a. 5 :nf ,A . 14 1 A' 0 'fi I' .... - 1 if 1 ' tl '- x 2 4-T if! rf-1 of 1' .. .. i., . .. M., Iyw Il Il' Ii I-I I I I I I QI ' I I.. Ili IiI I I 'Il I , I Il I I I I I Ia, .I I I 1 ,I I I I, HH I I I 1. lf I HI Iii 1.2 I, I I II II, I rv 's 'I 5. ff?-we -- JC . ififi A-,g '-wr' ati YA 'Al' K , 4 o-M. A , , ., ,,,,l1qr- I , ' f II. . ' 4 J avi. .-,ii ,l 418,-' .F 1, ., -.L -4- .. :J-, . -.V-Y .eiwis 4 , V , , --- - --., A , - . -,- ', .if-4' -' -5 ' HAL1.nz Jovcn KBATING English San Francisco Roble Cluhg English Clubg Stanford Journa- lists' Clubg Theta Sigma Phi, President 2412 Jolly'Up,Committee Cz, 313 Class Secretary 313 Junior Prom Committeeg Class VicefPresident, Acting President C 15 Stanford Daily Stair' C1, nf, 3, 41, Review Editor C41g Stanford Literary Magazine Assistant Editor C412 Quad Staff Cz, 41: Green Goddess C213 Romance of Resanofff 'Cz1g Fiesta'Publicity Committee C213 Dance Drama Committee C41. LEONARDB Keizten Psycl1ologyfMedici'ne Berkeley Transferred from University of Califomia, IQ24Q English Clubg Tau Psi Epsilon. Roannr DENISON Karim. Economics 'Los Angeles Alpha Delta Phig Varsity Boxingg Freshman Boxingg Sophomore Play Committeeg Junior Week Committeeg Labor Day Committeeg Green'Goddess Cz1g ln the Next Room C213 Wicked William C31. Gnome KELLENBERG Economics-Atcountancy Manteca Encina Club: Transferred from Modesto Junior College, 1915 Junipero Serra Club. HAROLD KILLEY Social Sciences South Pasadena Zeta Psig Ram's Headg 'kAce High Cl1Q Devil's Daughter C113 'Ray 'Ray Rover Boys Cz1g Football Show C31. KENNETH Keruay Social Sciences Redwood City JOHN Faeoaiucx KBNASTON Economics Santa Monica :Delta Kappa Epsilon. r ll L ' TTDYVk 'l ' iilldii' l 'TID :TW I' I 1 1- - 'sv -'L ,, , . -., . . , 7 Q- , , A if i If 'Y l I 41W':'1 r I ,iw 4 'H 1 a aa .'.f'nQ-. K, - A-- ,.' 1 f .L 1- . , ,-q L - M- A .Q f., F i 'ei wo- 4 'M f Y 11 ii, 5 2. . .L L. jpg K- Q 1:4577--74 P A-.vf-,f?'N,b?V-V Ii--5 H L. I -1,,,,,,,- Mo-r . ,I T-if',,'1y.5 L- L, -qlq ' f' t'i A .AQ inf .' 7 ,'1l,f ,ff To ' ' f---------f. 'pi 'C' 'V' ' , l l A 5 1 ,I , 4 l r i Q i Hmom HUNT HYDE I N ' l Ronrmfr Lyon JANDA Economics Cupertino I i Y Political Science Pasadena El Campo: Transferred from San Jose Smte l 1' N College, 19261 Toyon Clubg Soccer 13, 45, l ll I' VI Circle S l4J. I I ll ily , il , ' . 5.1 i I i or . ,N X ll K l . Ig l l l Amr-run Josner-1 Jrssov f ' WALTER Knrsuxz lnncr W ' 1 l , Economics Coronado Pre-Clinical Sciences Oakland Alpha Tau, Omega: Transferred from Sun Japanese Club- W Diego State College, 1926. I . l ' , l l . fl N, I J 1 w ,. ' L i l f 1 F WILLMM IRVINB , W l ETI-romfxs Tx-nzonoxuz JOAQUIN English Stockton W Fi Delmccglxllnlirlfoik S Tr ck I 31 Slilttiln . I ' I ' 3 2. Q IES III Chl Nu Kappa' I X 6 ,X Q Track, Numerals. l . 1 fi N l a i I 4 Q 1 1. . I i , J . ' u I , 1 4,1 ui -Y Lois EDMUND IRVING ' I I Spanish Hollywood l ' 1 , EDN-4 MAE JOHNSON llgelta Dagltacgell3 SpErxisl?Clrgn5 lfllloritfance of I i I ' English Sacramento emno 1 s : ' -. . ,,Aries,, bk Y. W- 13 K d:bi:Z 721, ij. W b Alpha Phi, Scbubeazyglub, Football Show D . 4 'F i l l I 1 in l l l or li i l l Jonrm ELLEN jameson li Illistciry Long Beach ' llRlJClJgP'LalJdTl1ta:LBCel 3 DONALD PORTER JACOBS 5 ' X Fgmgaisg gaslretlaall gig Igiestaiaublicity 1 Economics San Francisco f mittee 621: Quad S125 la, V451 R0manC2 Of Q Phi Sigma Kappa. l l I Lnwls GRANT ji-icons, IR. I P'rcfClinical Sciences ' San Francisco Transferred from St. Ignatius University,x926. . l D.-win JAcoBsoN History Brawley Circle S Society: Circle S Soccer 13, 4JQ ' Rally Committee C3, 41. 5 - . al . l l Resanolf' Kal. . l , , . l w, i Invmo Laumzucn JOHNSON ' ll W V School of Engineering 1 i Sacramento il Sequoia Club: Transferred from Sacramento - , junior College, I926Q Intramural Commit- ' l tee Lp. ,yt ' l , l l l Warren ANDREW JOHNSON 1 Law Los Angeles , Alpha Delta Phi. . l 1 Yi , i 1 X - 1 -vi-.... ,A:. ' V 4 Ross HOLMES Economics-Accountancy Sacramento Sequoia Club, Transferred from Sacramento junior College, 1926. Dorus JOYCE HOLSTON French Palo Alto Alpha Omicron Pig Transferred from San jose State College, 1127, Le Cercle Fmncaisg '- C oir. HARRY TATSUO HoNco Electrical Engineering Okayama, japan japanese Clubg American Institute of Electrical Engineersg Cosmopolitan Club. ALLAN I'IoovEE Economics Stanford University WILLIAM GEORGE HOUVER School of Engineering San Mateo Transferred from San Mateo junior College, Iqz6g American Institute of Electrical En- ' gineers. MASARU MICHAEL Hoiux Physiology Glendale japanese Club. LYNN OVERTON Hossom Law Long Beach Alpha Tau Omega. ARDIN DALE HOTCHKISS Civil Engineering Covina Toyon Clubg American Society of Civil En- gincers. ELIZABETH HOWLETT Graphic Art San Francisco Pi Beta Phig Delta Epsilong Sophomore Cotilf lion Committee, Legend of the Laurel 1133 Womenls Club House Boardg Y. W. C. A. Cabinet 11, zj. WILLIAM HENRY HUBBARD, JR. Economics Los Altos Phi Kappa Sigmag Sophomore Cotillion 'Com' mittee. RICHARD HULL Civil Engineering Alturas Branner Club, American Society of Civil Engineers. MARY LOUISE HULME French Palo Alto Delta Gamma. HELEN JOSSELYN HUNEKE French Spokane, Waslungton Roble Clubg Cap and Gown, VicefPresident 1.09QunitsgWomen's S Societ gHockey21Jg Swimming 1r, 2, 31. All-Star 11lIg Tennis zlg Women's Council 13, 455 Women's Conference 13, 41g Vice'President A. W. S. 14Jg Legend of the Laurel 1153 Dance Drama 1325 Sponsor 13, -tl. Head Sponsor 147g Stanford Fellowship Board 1.05 Y. W. C. A. Cabinet 11, 2, 3, 41, Chairman 11, al, Y. W. C. A. Treasurer 13Jg Y. W. C. A. Finance Chairman 131. WINIERED HUNTINGTON Law Los Angeles Delia Delta Delta: Cap and Gowng Quoitsg Hockey 11, :Llg Basketball 11lg Track 121g Y. W. C. A. Cabinet 11, 2, 3, 45, President Y. W. C. A. 1455 Sponsor 141g Womcn's Conference 13, 41 g Social Service Committee 133 3 Law Assof ciation, Secretary' 1-03 Stanford Fellowship Executive Committee 143. Joi-iN Hicoms Mechanical Engineering . Watsonville Toyon Club, American Society of Mechanical Engineers. ALEXANDRA Lasrnz HII.L Economics Konocti Bay S'g1n Ka QH k C, , DgBsk b'll qi, .i saiiifa Dcaililgtalf G, 5: Qlladegtaif QD: Women's Conference C451 Y. W. C. A. Publicity Committee 137: Social Committee is. 49- FORREST MACAULAY HILL Economics Sacramento El Capitan. HAROLD PRESTON Hm. School of Engineering Orland El Tigre, American Institute of Electrical En- gineersg Glee Clubg Sequoia Club. Josnrn HILL Education Whittier Encina Clubg Transferred from Penn College, I927Q Loyalties 431. ROLAND WILLIAM HILMBR Histo-ry San Francisco Chi Psig Transferred from San Mateo Junior College, 1915. LBROY HINCKLEY Economics Watsonville Alpha Kappa Lambda: Stanford Journalists' Clubg Stanford Daily Staff Cal. JOHN Loon Hnms History I Willimantic, Connecticut Union. I I I I I Fuomxrcx EDWARDS Hmas I I Law San Jose I Los Arcosg Glee Clubg Toyon Club: Stanford I Daily Stuffit, 1,75 Quad Stalffgj. CLLPPORD PeARsoN HOPPMAN journalism Petaluma Zeta Psi: Quadrangle Club: Scalpersg Skull and , I Snakesg Block S Football la, 3, 41, Captain I LQ: Block S Track C312 Freshman Football, Numemlsg Freshman Track, Numerahg Execu' tive Committee Cab. ' I ARTHUR MLLNER Hoon Economics Nevada City Sequoia Club, Transferred from San jose junior College, 1926. ROBERT Bnucz HOLLINGSWORTH Economics Herndon , Transferred from Califomia Institute of Tech' nology, 1927. WILLIAM HOLLINGSWORTH Economics Los Angeles Delta Kappa Epsilon. HERBERT McGmN1s HOLMES Chemistry Hayden junction, Arizona Toyon Club. ,4-'Ep 1 7 ra. .4121 Yr . A e. fff1'--1- .-7, ,fs--fa .-- -L--F--eff., 1,1 -5-:lil ,ff .-.. V. f.,.:L:.,'.+1. .r.11f.1 -11,1 11.1 - . 1.1 11 1 ' ... Il.4P1,1 ?U.Iv,b'1,1.',. .lI.,,..11 E, ,Lair AV In ,1 1 I . 1211-1 'ar i'111't 'tr 4'-4'--'1-4.'-1-F 1 - 5+...Z'..5,f,1,,-,.,f'U mfr' c i A'1,-f - ' ,fry -3- ,, , ,, , .1.-l-Vg in - vb 1 - 1,11- i i ar-.J I 11 1 1 PAUL KIDDER HARLOW I 1 , Education 1 A Thompson Falls, Montana 1 Toyon Club. l l 1 I 1 1 1 I I l , Russnu. HARRIMAN l 1 Law ' Pasadena 1 ' Delta Upsilon. 1 1 l f 1 1 1 l :II 1 ll 1 Il 1 '11 LESLIE EARL HARRIS journalism Fresno 1 Theta Chig Block S Baseball Manager 1.05 ' The Green Goddess 123 3 Inter-Fratemity Council 141. ' I 11 11 11 1. l ' ROBERT HARRIS l 1, Zoology Cando, North Dakota 1 1, '1 '1 1 1 zm Psig Circle s swimming 11. 37: chaff' l l man Junior Week Lake Sportsg 'Ray 'Ray 1 l 1 Rover Boys 1al. 1 1 1 I 1 1 1 - HENRY FREDERICK HARTMANN German San Diego Delta Tau Delta. 1 i L 1 ANNE DAVIS HARTWBLL 1 History Santa Barbara Roble Club, Cap and Gowng Zoology Clubg Basketball 11, al, Captain 112, Al1'Star 10, Hockey 135g Class Secretary 1zJ5 Class Vice- President13, 413 W. A. A. Board 1315 A. S. S. 1 1 U. ByfLnws Revision Committee, Women's 1 1 Conference 1433 W0men's Council 1315 Quan' ford DailyStalf11,a, JgQuad Staff 215 ' of 1 mance of Resanolfn zlg Y. W. C. A. Senior 1 Cabinet 13, 41, Sponsor 141. 1 l WALTER HAWK Social Sciences Los Angeles Transferred from Northwestem University. 1917. 1 ' I F. 'J ' I . P - 11.1-,. 1 'l ' 1 1 1 ' ,'.,,l.I,'r1 -.., ,- '..-. ' - ., ,. . J, 1 1 ' ...f'ffj'. ICQ. lflff, 3, ,vi '--L . -.. N in 'l m . , r.. Y In ,M 4 114-'. .1 - . 11, uf. ..- .1 --A DOROTHEA CAvrrr HAWKWS Economics Berkeley Alpha Omicron Pi. JAMES ROLAND HEDGE Law A Redwood City Sequoia Club. ROBERT AIJEXANDER HERNER, JR. Law Oklahoma City, Oklahoma Delta Upsilon. RAB HELLAG Geology Port Seward. Football 13, 47, Track 12, 315 Junior Prom Committee. ALAN DAVID HBRRINGTON Economics Hollywood Beta Theta Pig Phi Phi, Scabbard and Blade: Scnlpersg Varsity Tennis 11, 3, 41, Block S - 12, 313 Freshman Tennis, Captain. JOHN MEREDHH HIATT Law Rivera English Clubg Delta Theta Phi, Sigma- Delta Pi. ' O'r'ro I'IELMu'rrI HIEE German Lodi Theta Xig German Club: Junior Football Manager13J. ?-el C - .' , 'a'- 1' -. 1 1 1 - .. 1,1 ...,.., .- , 11. .. A,.-3fe--..,.1 Q 5.1-f 3-K r-51,11 ,aaa-, .51-1 L- .-'T F' -. 11117 4 ' A.--1. a 111'-.. ,,- F1 ,I l ' 1 ,' - 2 . ' '. .L '-. 1,',g- - 2 ', -, I V F' 'Q V '. V ,,, ffl 'f Y- ' I' lu...-'QI T ,l-fe'-J ,,,' 71' ' ', A LJ If-. I,,.f af: LI' 'Q ., Q ' lf . 'l '1 37,15 ..-.,-g, 'Q '-'ef IT. Ll 'LL' Q: -lj 1 , il 1.32-119 J Lag l 4, , bwf LL'nA'fT T',:f Fm' T 'I A1 ' f W : '1'?f :h 'Q' W' 'g -, 1 im ' W ' ' ' 1 1 1 1 . 1 , ll 'V 1 1 l 1 H 1 ' 1 1 Joi-IN HAMLYN, ja. ROBERT MACKBLCAN GUNN 1 l 1 11 1 Law San Francisco School of Engineering Sausalito 1 L ElTorogUelta. Theta. Phi:f1'oycn'Club:Chap' Phi Kappa Sigma. 115 1 ' ' :mal Stuff Cr, :Jg Union Board of Govemors. 1 1 1 1 1 . ' 1 1 1 1 1 1 1 l 1 1 1 1 FRANK DONALD Gun-nun 1 l 'N ' ANNBTTA HANSBN Economics 1 Mountain View 1 I - 1 journalism San Jose Varsity Football f4J,Interclass Football Cx,2J, 1 1 sf d f san J sm T h , Stanford Grays l3lgI1-nterclass Basketball Ka., 3. 1 Nl Tran erre rogxou use te enc ers 47: Freshman Basketball. 1 1 1 1' egg' W27' 1 l j 1 1 1 , 1 1 1 l 1 - A 1 1 1 1 l 1 ll 1 1 WILLIAM HARRISON HALB-Y, ja. l11 XI 1 CARL JOSEPH HANSBN Electrical Engineering Fresno I I lg Chemist? Morgari Hin Seqpoia Clubg Transferred from Fresno State l ' i' . in b' Al h Ch. S. College, 19155 American Society of Electrical I sequma ' ' P 3 l 'gma' Engineersg In rramurnl Basketball. I I 1 5 1 1 1 1 J Iosnru SARGBNT HALL 7' l CARL VERNON HANsDN Classical Literature 1 ' 1 Eco11omicsfAccountancy Los Angeles 1' '1 Sacramento Chi Nu Kappa, Secretaryfflreasurer QI, Vice- F Q' Sequoia Clubg Transferred from Sacramento President C4Jg Euphronia. . ' l Junior College. 1916. . 1 11 I 1 1 I 1 31 ' I ' , .N F FRANCES ADA!-1 HALLMAN 1 ' 1 l , . . 1 l Ronmu' Lnzorre Hmusxson Bacteriology and Expenmental fn . ' , ' d. PAW Omg: 1 1 .1.fW31:f1 : z R bs T f Ed E' SK l Cm U IQ UXDUI OIIIDBISIS Y U1 UID' 0 elunilor CoE2Z,e:D26i'Fcel'I11nis-gl? Ana 11' V1 ford Daily staff tl' all Football show CA' 1 1 1 1, 1 1I -N' , 1 . 1 - 1 1 .1 1 EDWARD Mortss HAMILTON 1 17 MAY GENEVUWB HARDY Botany San Francisco 1 I' 1 R 5115371 Mongrgsebfslogeadz - - 1 1 oe ugCosmopo1n u, crery SWE' Alpha EPS ' 1 1' 1 C333 Y. w. C. A. cabinet 11, 1, 41. l I 1 11 1 1' 1 1 l 1 l 19 A QQ' 1 l - 1 FAY DUNN HAMILTON 1 I A ROBERT LAWRENCE HARNESS Spanish Tulsa, Cklahoma 1 1 ECo,nm,mbs,Acc0umancy Delta Gammag Theta Sigma Phig Rifle Clubg 1 1 . ' Sacramento Spanish Clubg Track CI, ah Basketball C315 1 . Hockey 133: Quad Staff Cz, 3, 41. Circulation 1 1 1 El flapnang Transferred' fron-i1 Sacramento Manager C J: Quad Bvard C-sl: Fwrbnll Show 1 7 ' I- Junior College, 19z6gSequoia-ClubgGlee Club. 33, 4,5 Wicked William QD. 'l ' ' 1 1 1 l 1 44-- - Q --1 A H l ' 21-1-wrwv.-if '.-ru' Fw? 1 1 , - XA-1 Q I 1 :Cf :Ag-I-L11,rJV::7a,'.4? 1 L' 4'11,'1 '-111, ev- -be - -1 wa ff - M -1l1.l'kf A,.,.t, ,J in -,v .25 v , r--.-bag., , ,i-,gg , - 11 Ji., 1 ,,, , ,..., ,,i.i.....- eff.. f -lx, ., an-vrfi, A WILLIAM GLLEEILT, JR. Philosophy Los Angeles Delta Upsilon. ELON CALVIN GISH W Economics El Paso, Texas ll ALEXANDER GLADE Chemistry Palo Alto Breakersg Glee Club, Assistant Manager 1315 Freshman Soccer, Nurneralsg Band fz,3, 413 Orchestra, Manager Cz, 31. JOHN RICHARD GOLDEN Political Science San Francisco Pi Sigma Alpha. l THOMAS MEADE GOODLOB, Jn. Mining Hollywood El Tigreg Scabbard and Bladeg Toyon Club. CARL EDWIN GREEN Civil Engineering Los Angeles Toyon Clubg American Society of Civil En- gineers. Secretary 1419 Junior Opera Com- mittee. VIRG114IA MARION GREENE - History Ogden, Utah Gamma Phi Betag Meer the Wife 0.15 ' WOmEH'S Conference 141. l HOWARD GEEENHALGH School of Engineering Jackson El Tigre: American Institute of Electrical En' gineersg Sequoia Clubg Band C3, 41. ELAINE ALETHEA GREY History Alameda Roble Clubg Quad Stal? 121. ' CORNELIS GROENEWEGEN Economics Santa Monica Phi Gamma Delta. ELLIS JOHN GHOEE EconomicsfAccountancy - Sacramento Sequoia Clubg Transferred from Sacramento junior College, 19261 Glee Club. 1 MERLE Roscoe Gnoss History Modesto Sequoia Eating Club: Transferred from Mo- desto Junior College, 19261 Sequoia Club. RUTH DOROTHY GROVE Germanic Languages Madera Roble Clubg Transferred from Mills College, x9265 Cosmopolitan Club: German Clubg Rifle Club. , l N, 11 SANMUEL LESLIE GROW 1' English ' San Mateo Transferred from San Ixgiateo junior College, ' 191. . . 6 I - i --- Q 1 K CHRIS FREEMAN Economics Y - 'Mexico City, Mexico El Torog Transferred from Bakersield Junior .College. 1915 Skull and Snakesgfroyon Club: Block S Football Cay 3, 413 Gym Teamg Eicccutive Committee 141. DOROTHY MAY FRENCH Spanish Los Angeles Roble Cluhg Sigma Delta Pi, Secretary i413 japan Society, Secretary C415 RiHe Club: Spanish Club, Treasurer C415 Stanford Wo- men's Glee Club. MADELLNB Fluor: Psychology Los Angeles Kappa Alpha Thetag Tau Psi Epsilong English Club, Secretary 131g Hockey fr, 213 Swimming CI, 11gCaprainC1, 21, All-Star fi, a1glndiviclual Championship 111g Swimming Manager C213 Romance of Resanolf lz1g Aries K31g Das Rheingoldn f41Q Women's Conference C413 Y. W. C. A. Cabinet 11, a.1gDance Drama Com' mittee C3, 41, Chairman 141g W. A. A. Board C219 Junior Prom Committee 131. MARIETTA FRY Law Palo Alto Kappa Kappa Gamma. DOUGLAS RAYMOND Purina i Economics Stockton El Tigreg Phi Beta Kappag Branner Clubg Stanford Joumalists' Clubg Chess Clubg , Freshman Chess Champion C11g California Team QI1, Manager C215 Samford Daily Stall' Ca. 31, Copy Editor Cs?- WALLIS EDGAR GALLAGHHR Economics Los Angeles , El Campo: Uniong Transferred from Univer- sity of Southem California, lgzfg Glee Club. 'Wm l xl ,J l Looms MORTON GANAWAY English Crown Point, New Mexico i Kappa Sigmag Transferred from State Univer- sity of New Mexico, 1926. V f P Enwuu Airrox-1 GARDNER Political Science , 1 Ventura El Carnpog Enclna Club. . JAMES 'DONALD GAmBAi.ni Law Merced Phi Delta Thetag Phi Delta Phig Block S Baseball fa., 3, 415 Freshman Baseball, Nurnerals. Doaofri-:Y VivrAN Gmunar. Engli.sl1fPu.blic Speaking Los Angeles Gamma Phi Betag Transferred' from Univer- sity of California at Los Angeles, 1917: Masquersg l.oya1t.ies Q15 Wicked William C311 Football Show C41. Bomonn GATFONE EconomicsfAccou.ntancy Los Angeles Branner Club: Transferred from University of Sourhem California, 19063 Football Show C31. MARY BBULA1-I Gnaaous Graphic Aft San 'Francisco Kappa Kappa Gammag Transferred from Mount Vemon Seminary, rgzgg Delta Epsi- long Stanford Literary Magazine SraE Cal. N On.-x jAMas Gnasor: Pre-Clinical Sciences San Francisco Transferred from Universit of California, 19271 Omega Upsilon Phi. JOHN- Glrroan Biology East Bethel, Vermont HENRY Las FLOOD Petroleum Engineering ' Ponca City, Oklahoma Sigma ChigRam'sHeadg AceHigh C11g The Devil's Daughter C112 In the Next Room C215 'Ray 'Ray Rover Boys C213 Band Ca, 3. 41. ' JOHN WINSTON FLDRY Law Pasadena l Los Arcosg Delta Theta Phi. l I I , r A l 1 l , LILIAN Foace English Oakland N Alpha Omicron :Pig Transferred from Univer' sity of California, 19273 Cap and Gowng Pau' hellenic President C413 All-Star Archery C213 Stanford' Literary Magazine Stalf C415 Assis' tant Chairman Convalescent Home Drive C315 Sponsor C413 Y. W. C. A, Senior Cabinet Ca., 315 Chairman Class Day Committee. Hnruurr ALLBNA FORD History Los Angeles Kappa Kappa Gamma: Boomerang Ca1g Lc- gend of the Laurel Ca.1g Romance of Resanolf' ' C315 Clubhouse Board C31i Sponsor C41. JOHN josnrr-r Form Economics Los Angeles Toyon Cluhg Quad Managerial Staff Cz1. DOROTHY Er.rzABn'rH Fon DYCE EnglishfPublic Speaking Sunnyside, Washington Roble Clubg Women's Debate Societyg Schu' V bert Clubs Track Cr, Q., 3, 41, All-Star Cz, 31. Block S C413 Princess Ida C315 Mills Col' lege Debate C412 Choir Cr, 2, 31. PALTL WELCH Forucrzn Law Los Angeles i , Branner Club. DONALD Lrvemvroruz Foes-ran Economics Oakland Kappa Sigmag Transferred from Washington State College, 19157. Loursn FLORENCE Foucr-I P'refClinical Sciences Maxwell Roble Club: Iota Sigma Pi. EosoN Fouurn, ja. Economics Yreka El capim. Imam: HBNRIETTA Fox History Greeley, Colorado Gamma Phi Beta. Faso CHRISTIAN FILANCK School of Engineering Santa Clara HARKY FKANK Economics San Francisco Eneina Clubg Transferred from Oregon State College, K97.7g .Masonic Club. Roamvr' Frmzrzrz Economics San Diego Phi Delta Theta: Transferred from San Diego State College, rgzg' Assistant Yell Leader C313 Rally Committee C3, 41g Quad Staff Ca., 41. rr. I , , ROBERT Orrurr EWBLL Economics San Francisco Uniong Transferred from College of William and Mary, 1927. NORMAN FAIN Political Science Prescott, Arizona Theta Xi: Circle S Societyg Varsity Boxing 12, 3, 41, Captain 14h Freshman Boxingg West' em Intercollegiate Boxing Champion 151, Stan' ford Novice Boxing Championship 105 Stan- ford Boxing Championship 11, aj: Men's Council 145, University Day Committee 1455 Y. M. C. A. Cabinet 11.5. Enwn-I ALEXANDER FAIRBAIRN CiuilEnginee1ing Sacramento Sequoia Club, Transferred from Sacramento Junior College, 1926, American Society of Civil Engineers. CYRUS FAREWELL Political Science Oakland Kappa Sigma. DONALD ARTHUR FARMER Economics Pratt, Kansas Sigma Chig Transferred from Southwestern COll8gE,'l916Q Choir 13, 4Jg Oratorio 13, 41. NANCY C1-11.02 FARMER Economics Alhambra Gamma Phi Beta: Schubert Clubg Basketball 103 Hockey 11, 2, .Qt Joll 'Up Committee 1351 Football Show 12, 3lg Ride A Cock'Horse 1aJ. MARIAN FARR English Piedmont Roble Clubg Theta Sigma Phig English Clubg Stanford Journalists' Clubg Junior Opera Committee, Stanford Literary Magazine Staif 13, 41g Legend of the Laurel 103 Green Goddess 111g In the Next Room 1215 A Kiss for Cinderella 131. I V , 1 i A . , - I, , f . l l r' l 4. f. i. KNOX FARRAND Economics Los Angeles Branner Club. BARBARA Kansa FBNWICK English San Francisco Roble Club. Curroan Goncx-:Aux From. Economics San Francisco Brunner Club, Varsity Handball 12, 313 Inter- class Football 121. ELMnR HOWARD Fismzn Electrical Engineering Santa Cruz Union, Transferred From Califomia School of Technolvgy. 19273 American Institute of Electrical Engineers 12, 3, 49. THOMAS CHAUNCBY FLAHBRTY Economics Riverside Phi Kappa Sigma. DONALD ARTHUR Fucxmcza Civil Engineering Phoenix, Arizona Kappa Sigma: Transferred from University of Arizona, 1927. CALVIN CnARL11s FLINT History Long Beach Kappa Sigma, Transferred from Occidental College, 1921 Q Junior Manager Football 3 Senior Manager Boxing. - J.. , J- '- l AILSA LIVINGSTON DUNN 1 School of Biology San Francisco l I Alpha Phi, Stanford Women's Glee Clubg L Spanish Cluhg Senior Endowment Committee. I . I l ' I 4 l ' l I l l JACK DUNN I English St. Paul, Minnesota Branncr Club. I I EUGENE SEYMOUR DUVAI. Political Science Ventura Sigma Alpha Epsilon. GUY KIMBALL DYER Law Auburn Sigma Nug Phi Delta Phig Phi Phi: Skull and Snakes: Varsity Track Cz, 3, 41, Block 5 Q3, 413 Freshman Track, Numeralsg Inter' fraternity Board of Control. I MARY HAVEN EDWARDS I Biology Alameda l Roble Club. l I 1 I . l 'I I , DAVID MULVANE EHRSAM Chemistry Enterprise, Kansas ' Toyon Clubg Scabbard and Blade: Band QI, 2 3. 41. Pwpfrrfv Manager Cs. 47. GEORGE PHILIP EISMAN, JR. Economics Portland, Oregon Phi Gamma Delta. THEODORE ELIAS ll Economics Los Angeles I Tmnsferred from University of Southern Calif ll fornin, 1927. :ly i 1 , GEORGE lNNEss ELLSWORTH History Grass Valley El Toro, Uniong Chairman A. S. SQU. Election Board Cz, 313 A. S. S. U. Constitution Com- mittee Q13 Junior Prom Committeeg Rally , Committee K3, 4,13 Chairman A. S. S. U. By- Laws Revision Committee K41Q Chaparml Business Staff fr, 213 Union Board of Goverf nors K41. LLOYD FREDERICK ENGELI-IARD1' Mathematics Hartford, South Dakota Brunner Club, Chess Club fa., 31g German Club, Treasurer 141. ELVIRA ALIDA ERICKSON Political Science Weed Roble Club. l FRITZ BGIIARD VoN EsroREI' , Geology Potsdam, Germany El Tigreg Geological and Mining Societyg Encina Club. l l WARREN RAYMOND EVANS Economics Shelby, Montana El Capitang Masonic Club, Toyon Club. I l LYLE BENTON EvEREr'r Civil Engineering Santa Rosa Phi Gamma Deltag American. Society of Civil Engineers, Football fa., 3, 415 Freshman Foot' hall, Numeralsg Freshman Track. HELEN DBLATOUR French Long Beach Alpha Omicron Pig Transferred from Santa Ana Junior College, 197.73 Le Cercle Frangaisg Romance of Resanolfu C213 A Kiss for Cin' derellan C31: Footlaall, Fiiow C313 Princess I ri 3 . FRANCES EMA DEMOND Mathematics Los Angeles Gamma Phi Betag Transferred from Pomona College, r9z53Wornen's S Society, Secretar ' Treasurer C412 Stanford Womerfs Glee Cluhg Music Clubg Schubert Clubg Hockey Cz, sg 41, AllfStar CSJQ Track Cz, 13, 413 Tennis Ca, 3, 413 Basketball C413 Script 'S C313 Junior Prom Committeeg Convalescent Home Committee C313 Princess Ida C31. MARY CARSON DENNY EducationfG'raphic Art Los Altos Delta Gamma. JEAN DBNTRAYG ues Mechanical Engineering Burlingame Transferred from Lycee de Rodez, France 1916. JAMES DB PUY Economics Tacoma, Washington Alpha Tau Omegag Transferred from Univerf sity of California, 1927: Delta Phi Epsilon. CLARK DAVID DILLBY Law Glendale Branner Club: Stanford Daily Staff Cz., 31. DONALD CALVIN DOANE Chemistry Stanford University lil GRAELIB STEWART DOANEV 3 Philosophy Pasadena Phi Kappa Psi. Gsoaon PALMER Doason .Political Science San Jose Band Cr. 2. 3. 41- Wesuay DUNCAN Dora I Social Sciences Berkeley Breakersg Transferred from Modesto junior College, 19272 Brarmer Club3 Varsity Track C413 Rally Committee C41. SIDNEY STODDARD DoN1zR Economics Santa Barbara Transferred from Santa Barbara State College, t9:.6. RAYMOND GEORGE DRAKE Economics Long Beach Them Delta Chi. THOMAS EDWARD DRAKE History ,Palo Alto Sequoia Clubg Cosmopolitan Club3 Euphroniag Choir C213 Glee Club3 Band Cr, 2, 3, 413 Y. M. ' C. A., President C41. MURRAY DRAPBR Law San Bernardino Breakers3 Phi Alpha Delta3 Quadrangle Clubg Skull and Sriakesg Track M2H3gEEC41Q President A. S. S. U. C41Q Class President C213 Secretary A. S. S. U. C313 Executive Committee CSJQ junior Prom Committee: Rally Committee C3, 413 Board of Athletic Control C413 Stanford Daily SmlTC1, 113 Sponsor C3, 41. Breakers: Varsity Basketball Cz, 3, 413 Inter, class Basketball Cz, 13 Interclass Tennis C313 vvl , . I l,.i, Louis Cniavzuuo Economics Pasadena I.c1Arcosg'Transferred from Pasadena Junior College, IQIGL Delta Epsilong Euphroniag Inter' class Football 131g Intramural Swimming 131g Intramural Basketball 1413 junior Prom Com' mitteeg Chairman Senior Jolly-Up Committee: Chaparral Staff 13, 415 Quad Staif13, 413 Stan' ford Daily Business Staff 13, 41. FERDINAND CuMMrNs History LeGrand Sequoia Club. Fmzn CARL CUNNINGHAM Civil Engineering Los' Angeles Sequoia Eating Club, Uniong Transferred from University of California at Los Angeles, lqa6g American Society of Civil Engineers, Vice' President 141g Engineering Council 141. Wmnson Coomzn CUTTING Pre-Clinical Sciences Campbell Sequoia Clubg Transferred from San Jose State College, 1926. WILLIAM HARWOOD DANFORD School of Biology Kelraha, Hawaii Phi Kappa Sigmag Circle S Swimming 11, 3, 41: Freshman Swimming, Numeralsg Freshman Water Polo, Numerals. ALBERT DANIELS Chemical Engineering Pueblo, Colorado El Tigreg Alpha Chi Sigma: Phi Lambda Upsi- long Riile Club, Secretary 121g Toyon Club. SEYMOUR DARLLNG Economics San Luis Obispo Sigma Chig Transferred from Lafayette Col' lege, 1926. ELBANOR DAvmsoN Political Science Stanford University Kappa Alpha Thetag Cap and Gowng Delta Sigma Rhog Masquersg Pi Sigma Alphag French Club, Secretary 111g President A. W. S. 141g Executive Committee 1413 Rally Committee 141g A. S. S. U. By-Laws Committee 141g Presi- dent Women's Conference 1413 Women's Council 13, 41g Sophomore Play Committee 1219 Stanford Daily Staff 1r1g The Goose Hangs High 111g Aren't We All 1311 Califomia Debate 11, 213 Debate Manager 121: Choir 11, 219 Sponsor 1413 Y. W. C. A. Cabinet 11, 3, 41 Bunsr LINCOLN DAv1s, Ja. Economics San Francisco Quad Stal? 13, 41, Photographic Editor 141. GREGORY HLNSLEY DAVIS Economics Napa Sigma Alpha Epsilong Rally Committee 141. STANLEY SPENCER DAVIS PrefClinical Sciences Westwood Branner Clubg Omega Upsilon Phig Band 11. 2, 31- CARLTON DAWSON Mechanical Engineering Palo Alto Alpha Kappa Lamhdag Varsity Soccer 141: Freshman Soccer. FRANK HOGBLAND DAY School of Engineering Cananea, Mexico Toyon Club. BONNYE ELIZABETH DEAL Psychology Pasadena Roble Clubg Phi Beta Kappag Tau Psi Epsilon, VicefPresident 1413 German Clubg Track 1215 Swimming 121. CAROLYN MAUDE CONVERSE 1 English Wellsville, Kansas 'i l Delta Delta Deltag Transferred from San Mateo junior College, I916Q Women's Debate Club: Mills Debate C31. 1 EDMLTND Cosswnu. Couvnasiz, ja. Economics Alameda Zeta Psi: Rally Committee C414 'Ray 'Ray Rover Boys Cz1g Ride A Cock-Horse C213 Hamlet' ' C31. l ALBERT Lruz Coon Mechanical Engineering ' Los Angeles Sequoia Clubg American Society of Mechanical Enginecrsg Weight Basketball Cal. w l STANLEY JAMES Cooir Law San jose Breakersg Phi Alpha Delta: Varsity Basketball C413 Interclass Basketball Cz, 313 Interclass Tennis Cz, 3, 41. , Faiznaizxcx Jams Cooke Econo-mics San Francisco Alpha Kappa Lambda. I w Con' Coounon English Santa Barbara Branner Clubg English Club, German Clubg Freshman Pencingg Varsity Fencing C3, 4.1. MARYfVmGrNm Coomzn English Los Angeles Roble Club, Chi Nu Kappa. r WHLIAM ALEXANDER Coornn Chemistry Mountain View Amon Bmcimm COPBLAND Romania Languages Chico Alpha Pbig Transferred from Chico Junior College, 1926: Stanford Women's Glee Club, Junior Hockey, Numerals. RUTH RosAr.rNn Coveney Philosophy Hollywood Pi Bela Phi: Archery, Cup CI1, All-Star C113 Convalescent Home Committee C213 Sopho- more Play Cammitteeq Club House Board C313 Junior Prom Cammitteeg Senior Flower Com' mitteeg Senior Week Committee: Sponsor C31. JOHN BILNJAMINXCQWAN 'Education johnson City, New York Masonic Clubg Glee Clubg Stanford Grays Cz, SJQ Interclass Football Cz, 41g Princess Ida C31. Wzsty Pnzur Cox Mining Dallas, Texas El Tigreg Branner Club. EDWARDZCMNE Economics Austin, Minnesota Branner Clubg Transferred from University of Minnesota, 1926. Lnoimnn Lamson Camo! Spanish 'Burlingame Delta Tau Delta. .',. i, - 7 V1-ki'i'--11- lil M YLiANATeH CHEN' Pliilosdphyh Nanchting, China Chinese Clubg Transferred from Tsing Hua College, 1916. DONALD LANGER CHERRY :History ' I Santa Cruz ' F l El Campog Toyoo Club. TzefAN Cnow Economics Peking, China Chinese Club, Transferred from Tsing Hua College, r916. WILLIAM TURNER CHRISTIAN English Minneapolis, Minnesota Bmnner Clubg Y. M. C. A. Cabinet Cy. CHARLES Kirrmzocn CLARK Chemistry Berkeley Toyon Clubg American Chemical Society. EL1zA1snTn ALLBRTON CLARK History Berkeley RoblefClubg Le Cercle Francaisg Stanford jour- nalists' Clubg Stanford Daily Staff C1, 1, 3, .QQ Book of Charm 1155 Princess Ida Czlg Romance of Resmolfu fzlg La Main Leste C45- Gsonce CLOVBR School of Engineering Woodland Sigma Nug American Institute of Electrical Engineersg Weight Basketball Czlg Boxing Manager f4j. fl 1 V A L D0l'lALD'EDWIN CLUXi1'ON Political Science ' ' Denver, Colorado Beta Theta Pig Transferred from University of Denver, 1925. ll W. l , A' . 1 HENKYYSUTCLIFFB C62 ' - l Accountancy 1 San jose I Brealcersg Unionl Transferred from College of the Paeilic, 19165 lrgtnuamural Cross Country, - 1, 3 . 1 WILLIAM LEAVENWORTH COLBY Philosophy San Diego Uniong Transferred from San Diego State College, 1916. Fnanmucic MALCOLM COMBELLACK Classical Literature San Francisco Sequoia Clubg Chi Nu Kappag Delta Sigma Rho, President c4JQ Califomia Debate Calg ,loifre Debate C215 University of Southem Cali' 'fornia Debate C139 Eastern Tour Debates Q05 Winner Jotfre Debate hh Cambridge De- bate LQ. Donorur HLLYARD Comz N Political Science Carmel Kappa Alpha Theta: Women's S Society, l Hostage. 1. 314l,A1l'5f21l'lI, tm, Garmin or 41 Basket all fz,1, ?J,All'Star QI, 3,21-l.'BCkfl, 11, ll Captain 111: Bock S Q05 Romance of ' Resanoifn ialg A Kiss For Cinderella QU. + CLAUDE CONN Political Science W Greeley, Colorado l Sequoia Clubg Stanford Journalists' Club: ' Chairman Junior Prom Committeeg Class Pres- ident LQQ Publications Council, Secretary 141: l Stanford Daily Business Staff CLD, Advertising 1 Manager Cal, Assistant Business Manager QQ, i i l Business Manager LQ. l fl I l ll Gnoncn CONNOLLY, Jn. Law San Francisco 1 ' Pbi Kappa Sigma: Scabbatd and Bladeg Varsity , Polo fa., 3, .QQ Freshman Polog Military Ball ' l , , Committee CD. I MERRILL LAWRENCE CARLSMITH Law Hilo, Hawaii Breakers3 Toyon Club: Varsity Track 12, 313 Freshman Track, Numerals. HELEN ELIZABETH CARPENTER Spanish Richmond Roble Clubg Music Club3Ril1e Club, 1Vornen's Manager 13, 413 Spanish Clubg Women's De' hate Clubg Romance ofResanoif 1z13 Dance Drama 1313 California Debate 131. HOWARD LUxMooRE CARPENTER Pre-Clinical Sciences Santa Paula Union 3 Omega Upsilon Phi. WLLLIAM HERBERT CARR Economics Hanford Union3 Masonic Club3 Varsity Track 1213 Freshman Track3 Interclass Track 11, 2, 313 Interclass Baseball 11, 114 Budget Committee 1313 Class Treasurer 1313 Union Board ofGover' nors13, 41 3 Stanford Daily St.aif1r1. MARGARET Lois CARR11-uERs Nursing San Francisco Roble Clubg Cap and Gown 1313 Sophomore Cotillion Cornmitteeg Junior Prom Committee3 Class Vice-President 1313 Labor Da Com' mittee 131g Women's Conference 1313 Ro- mance of Resanoifn 1213 Sponsor 131Q Class President Stanford School of Nursing 1413 Vice President Stanford School of Nursing Student Council 141. FRANK BERNARD CARROLL Political Science San jose Sequoia Clubg Transferred from University of Santa Clara, 19251 Pi Sigma Alphaq Glee Club 13, 413 junipero Serra Clubg Princess ld.i 13,1. BENJAMxN Crmnwrcrc CARTER Economics San jose ALONZD CAss History South Pasadena Zeta Psig Quadrangle Club3 Ram's Head, President 141: Sword and Sandalsg Yell Leader 141. josern GEORGE CATANICH Political Science San Francisco ' Encina Clubg Transferred -from San Mateo 1 Junior College, r9263.Euphroni:i3 Masonic , Club, Secrerary'Treasurer 141g john Fergu- son 131. I PHILIP CAVALERO l Political Science Stockton l El Tigre3 Delta Sigma Rho, Secretary'Treasurer 1413 Pi Sigma Alphag Euphroniag Toyon Club3 A. S. S. U. By-Laws Revision Committee 1413 Debate Council 12, 413 Men's Council 1413 Rally Committee 1413 Califomia Freshman Debate 1113 Marquette Debate 12.13 Utah De- l bate 1213 Califomia Debate 13. 413 University I , of Southern California Debate 1413 Jolfre Medal Debate 1413 Stanford Representative at Pacific 1 Coast Intercollegiate Forensic Contests 1413 E Sponsor 141. l RoEER'r EDGAR CECIL K Social Sciences Palo Alto Theta Delta Chig Delta Thetzi Phi3 Ram's Head, Secretary-Treasurer1413 Sword and San- dals, President 1413 Freshman Baseballg Dra- matic Manager 17., 313 Dramatic Council 11, 3, 41: University' Day Committee 12, 313 A. S. S. U. By'Laws Revision Committee 141Q Bonfire Committee 1413 Debate Council 141: Executive Committee 1413 Freshman Handbook Commit' tee1 13 Rally Committee 1413 Student Manager 141 3 Chaparral Business St:iif1i13 Smnford Daily Business Staff 1113 Quad Board 1413 Stanford Literary Board 1413 Football Show Committee 13, 413 Senior Play Committeeg A. S. S. U. rep- resentative to Institute of'PaciEc Relations 141. LUCIA BELL Ci-LAMPLIN Political Science San Diego Chi Omegag Transferred from Pomona College, 1 igzgg Theta Sigma Phi. Treasurer 1413 Wo- men's S Societyg Hockey 12, 3, 41, AllfStar 121g Basketball 11, 3, 41, All'Star 1213 Swimming 1213 Block S 1413Freshman Handbook Com- mittee 1a13 Sophomore Cotillion Committee: A. S. S. U. Constitution Committee 1313 A. S. S. U. Byflaws Revision Committee 1413 Quad Staff11, 3, 41, Women's Editor 141. GEORGE CHAN Economics Marshield, Oregon Chinese Clubg Transferred from Oregon Agri- cultural College, 1926. MARGARET CHANDLER English Palo Alto Alpha Phi. 1 Wasuzr BYRON BRYANT Economics San Diego Phi Delta Theta: Transferred from ,San Diego State College, 1927, Phi Phi, Skull and Snakes, Basketball 12, 3, 41, Block S 131, Track 11, 41, Block S 141. EUGENE MBRLE BUCKNUM Economics Emmett, Idaho Encina Club, Transferred from College of Irlaho, 1926, Band 13, 41. FREDERICK GRAY BULLARD Law Piedmont Phi Gamma Delta. JOHN ALBERT BULLIS PrefClinical Sciences Los Angeles Beta Theta Pi, Nu Sigma Nu, Phi Phi, Scale pets, Block S Track 1311 Freshman Track, Numerals, Junior Football Manager 121. ToM McCoNNELL BUNN Economics Los Angeles Beta Theta Pi, Transferred from Univer- sity of Oregon. VIRGINIA BUNNBLL Spanish Los Angeles Gamma Phi Beta, Schubert Club, Sigma Delta Pi, Spanish Club, Stanford Women's Glee Club, Y. W. C. A. Publicity Committee 111, Chairman Y. W. C. A. Vespers Committee 121. FRANCES BELLAME BURGER English San Diego -Alpha Phi LUCILI1 BURR Spanish Madera Roble Club, Phi Beta Kapfag Sigma Delta Pig Treasurer 13, 41, Spanish Club, Secretary 141. Louis SWANTON BURNETT Economics San Francisco Transferred from University of Washington, 1916. SARAH MARGARET BURNS 1 Education - ' '1 'Pasadena Pi Beta Phi, Transferred from University of Califomia at Los Angeles, r9o.6, Masquers, SecretaryfTreasurer141, Aren't We All 131, So This is London 131, The Swan 131, Football Show 13, 41. GRANT ARTHUR BURTON Economics Walnut Creek Sigma Nu, Freshman Track, Numerals, Class President 111, Junior Football Manager 131. JAMES ELMER Buscrr Law Ukiah Breakers Club, Skull and Snakes, Toyon Club, Block S Baseball 12, 3, 41, Freshman Baseball, Numerals, junior Prom Committee. HARRISON WILLIAM CALL Law Eureka Breakers, Delta Theta Phi, Treasurer 141, Law Association, Masonic Club, Sequoia Club, Assistant Baseball Manager 131: Interclass Soccer 11, z, 3, 41, Convalescent Home Finance Committee 12, 31, Business Manager Junior Week Activities, Class Treasurer 131, Business Manager A. S. S. U. Handbook 131, Rally Committee 13, 41, Secretary A. S. S. U. 141, Chairman Senior Class Endowment Fund 141: Band 11, 2, 31- ALPRED RICHARD CANNON Geology Millbrae Theta Xi, Geological and Mining Society, Chaparral Staff1a.1g Geology and Mining Year- Book Smif, Managing Editor 141. Wrttmm EAM.: BRADLEY Chemical Engineering . , San Diego Uniong Transferred from San Diego State Col- lege, IQZGQ Alpha Chi Sigma. LYNN ALDBN BRAMKAMP Social Sciencesfjournalism - ' San Jose Toyon Clubg Sigma Delta Chi, Treasurer-C411 Stanford joumalists' Club,.Treasurer C3,4 13 Stanford Daily St:ifFCz, 3, 41, Night Editor C31, Associate Editor C41. CLARA Ross Baacnnn' English ' San Jose Roble Clubg Transferred from University. of Califomia, roz7g. University of California Def hate C414 Mills Collegigebate C419 Delta Sigma o. Lomm Baum Graphic Art lLos Angeles Chi Omegag Delta Epsilon. Humans Biuawsren G Political, scfenee Dixon, Illinois Los Arcosg Toyon Clubg Band Cx, z, 3, 41, I A I Assistant Manager C41. 4 IRWIN ETTLINGER Bam. .A A Economics, , , Los' Angeles Union: Transferred from University of Cali' fornia at Los' Angeles, 19261 Masonic Clubl Lewis ELMB11 BRONSON Law l Red Bluff Breakers. , . 1 BAYLOR Bnoors Philosophy Los Angeles Los Arcosg Glee Club, Advisory Board C3, 41., President C413 Maclxth C113 Glee Club -Novelties C115 ln the Next Room C11- - Princess Ida' ' C31. ,Romani WORMALD Bnooxs Social Sciences A , Erie, Pennsylvania lfhi Kappa Rsiq Transferrediroin Lafayette College x927. TGEORGSCALBBRT Baoowznr. ACeology D Santa Ana. Sequoia Club: Transferred from Santa Ana Junior College, xox-.63 Geological and Mining AILEBN BROWN Politicol Science Sacramento Alpha Omicron Pig Cap and Gown, President C415 Pi Sigma Alphag Theta Sigma Phi, Vice' Presidgnt C1,,41Q,SSf3.l1fOId Journalists' Clubg Hockey C113 Tennis Cr,'a1, Manager C115 Class Vice'President C315 Executive Committee C315 University' Day Committee 'C2.1g 'W. H. A. Board Cz1g Senior Flower Committee: Stanford I i :Daily Staff C111 Desk Editor Cz1f Women'a Editor C312 Quad Stall' C212 Football Show C215 Ride A Cock-Horsef' C215 Princess Ida C313 Football Show,Committee C319 Sponsor H2313 Y. W. C. A. Cabinet C213 Women s Co er- ence C3, 41. I , -, Enipzasr Bnoym , ,Political Science A. Los Angeles A 'Toyon Club ' ' I . EVALYN BROWN History .Winnemucca, Nevada Delta Delta Della.: Woxi1en's S Society: Schubert.Clubg Basketball Ci, a, 3, 41, All-Star lrfal. Civmiu C311 Husker i21:'Tennis C1. 21: Stanford ,Daily Busiuess,,Sta.if C31, Classiied Advertising Manager C41. Kiznuim-r ANSEL BROWN . Political Science Eureka ' Kappa Alpha. i Q 4 1 l vi EVERAILD BIERER Chemistry Salt Lake City, Utah ' Bmnner Clubg Transferred from University of Utah, 19159 Alpha Chi Sigma. ' WINDSOR DRURY BXGELOW History ' San Francisco Sigma Alpha Epsilong Freshman Football: Freshman Track. - 'HARVEY ELLSWORTH BILLIG .Pre-Clinical Sciences - ' Long Beach Branner Club: Transferred from California Inf stitute of'Technology. 19155 Phi Chig Band la, 371 JOSEPII ANDERSON BII1cHE'r1' Economics Tempe, Arizona Toyon Cluhg Transferred from Tempe State Teachers' College, 1925. Joi-IN HAILE BLACKEURN, ja. Matheinotics Burlingame El Campog Bmnner Club. ' JACK DENNIS BLAIR . School of Biology ' Vancouver, Washington Transferred from Reed College, 1927. WADDINGTON BLAIR Education-Graphic Art - San Francisco Toyon Cluhg Sophomore Cotillion Committee. 4' ANDREW COBB BLAKE Economicr ' Santa Barbara Branner Cluhg Transferred from Santa Barbara . State College, I 255 Christian Science-Society, Secretary L05 Cguacl Staff C3, 41, Advertising Manager 141. ALBERT EDWARD Br.uE'r'r Q .Political Science San Jose Transferred from College of the Pacific, r9z6g Pi Sigma Alpha. WILLIAM LuciAN BLYTHE :Economics Palo 'Alto Phi Gamma Deltag Freshman Dance Com- mitteeg Junior Prom Committee. X WILLIAM ESTEY BODEN School of Engineering . Sacramento Sequoia Cluhg Transferred from Sacramento junior College, 19:63 Glee Club. i LOREN CHARLES BOLLINGER I i .. . I Chemistry San Jose Transferred from Sanjlose State College, 19:63 Alpha Chi Sigma. Doars RosALLA BONNER Economics K V Fresno Pi Beta Phig Quad Surf C215 Ace High grlg Football Show izlg Ride A Cock-Horse al: Wicked William C351 Women's Conference, Secretary 141. , GEORGE ETHELBBRT BRADLEY Law A A Santa Ana Alpha Sigma Phi: Varsity Track 1411 Freshman Trackg Weight Basketball fal. ' JEAN BALLOU Economics Los Angeles ANNE BANCROET History Walnut Creek 'Kappa Alpha Theta: Rifle Club Q, 0, Rifle Award C3, 4k Class Vice-President C09 Fresh' man Dance,Committeeg Sophomore' Cotillion Committeeg junior Prom Committee. OVERTON BARNES BANKS Geology Beaumont, Texas Transferred from South Park Junior College 1926. WILLARD FOSTER BARBER Social Sciences Riverside Transferred from State University of New Mexico, 1927: Y. M. C. A.g International Relations Club. I ROGER G.-uuocic BARKER Psychology Palo Alto Tau Psi Epsilong Cosmopolitan Club, Presif dent Kal. FENTON AVERY BARRETT Law 'Long Beach Kappa Sigmag Sword and Sandals: Chairman Sophomore Play Committeeg Chairman junior Opera Committeeg Ace High C03 Football Show Q03 Macbeth C05 Fashion Cal: Princess Ida 135. WILLIALI ALBERT BAssE'r'r, ja. V Law Los Angeles Delta Theta Phig Scabbard and Blade. - 4 I DOROTHY MABEL BECKWITH Spanish' ' ' 5 W f Mount Vernon, New York Roble Club: Transferred from North Dakota State College, IQZ6Q German Club: S :mish Cluhg Stanford Women's Glee Clug. -ALBERT Cummins fBEESON Economics V Evanston,1llinois Theta-Chigfransferred from Principia Junior College, 19265 Stanford Grays 12, 31. QALVTN Auousrus' BEHLTZ Law Salt Eake Citytlltah Alpha Tau Oiiiepg Phi Alpha Deltag Stanford Joumalists' Club: Chairman Sophomore Co' tillion Committee: Stanford Dail' Staff cI, 1., 3, 41, Associate Editor 2:41. . , 5 HERBERT,ADOLP- BEHNKE Law-History A Rivera DANLEL NEWELL BENTON Chemistry . . , Oakland El Torog Alpha Chi Sigmag Phi Lambda Upsilong Branner Cluhg German Clubg Quad ' - ManagerialStaiffzl. - I QHUBER1' HAYWARD BERNEP. . h Economics A Sanjose - Delta Upsilong Transferred from San Jose State College, 1926. ALBERT B1AGGxN1 Education 1 San Jose Delta Chi: Black Hs Basketball 45, 3, Lg 3 Fresh' man Basketball, Numemlsgzlireshman Baseball, Numeralsg junior Prom Committees Labor Day Committee, Secretary? gnterfratemity Council 4 r I l 1 i l Russrzu. PHILLIPS ANDREWS English Palo Alto Alpha Tau Omega. EMU. BRACKETT ANTONELL P1efClinical Sciences Phoenix, Arizona Kappa Sigma. JOHN SHIRLEY ARMHBLD School of Engineering Woodland Sequoia Clubg American Institute of Electrical Engineersg Glee Clubg junior Prom Committceg Glen: Club Novelties 121. Etus BROTTON ARMSTRONG Mechanical Engineering l Fortuna . El Torog Encina Club. I l l 1 Lasua HANSBN ARPS V Political Science - ' Columbus, Ohio Phi Gamma Delta: Transferrcd from Ohio State University, 1927. TAKAZUMI ASAKURA Economics Santa Barbara Japanese Clubg Transferred from Santa Barbara junior College, 1916. WALDO Aar-IBY Economics Oakland Kappa Sigma. ARTHUR Wattastay ATKINSON, Ja. English Ventura Transferred from Colorado Agricultural Col' lege, 1926. JOHN RICHARD Arwru. Political Science San Gabriel Kappa Alphag Transferred from University of Southern California, lQ7.7Q Pi Epsilon Deltag So This is London C31. HAROLD MArI.z BACON Mathematics f Los Angeles Brarmer Club, German Clubg Mathematics ' Club. FRANK BAKER Law Osage, Iowa Alpha Sigma Phig Hammer and Cofhng Sigma Delta Chi, Stanford Journalists' Clubg Sword and Sandalsg Macbeth C115 UR. U. R. 5115 Football Show fa1g In-the Next Room 215 Ride A Cock-Horse fa1g CofAuthor, Wick- ed William C315 Craig's Wife Q13 Loyalf ticsl' C413 Chaparral Staff C3, 41g Editor Hand' book l-113 Publications Council Q41g Stanford Daily StaE lr, 1, 31, Editor 1413 Rally Com- mittee C41. HUGH CHENBY BAKER English Brentwood Branner Clubg Transferred from Modesto - - ' .1uniorCollegc-, io26. ' WILLIAM Aacrrre BAKER Economics San Mateo Er.1zABa'rH VAIL BAKEWBLL English Santa Barbara Roble Club: Cosmopolitan Club, Treasurer C315 Y. W. C. A. Cabinet Cr, 2, 3, 41, Under' graduate Representative 131, Convention Dele- gate 131g Hockey KI, 21g Basketball iz, 31g Track Cr, 11, Captain C114 W. A. A. Board Cz, 3, 41, Treasurer 131, Women's Conference 131. if 'alrfqi-'o.-,. , , 4 -.3-in 'II JI.: 1. . . I ' . f i' P I 1' .L .- M . -J -J- :--f f r .,1 -.I - ,.. ,.' .-,,..... -.. .,-..i if ,i ,I HILTY ABRAMSON School of Engineering Los Angeles Delta Upsilon: Varsity Track 11, 3, 4,1 Fresh' man Trackg Junior Prom Committeeg The Green Goddess 123. DAvm SNELL ADAMs Economics Woodland Kappa Sigma: Varsity Baseball 11, 3, 435 Fresh- man Baseballg Junior Prom Committee. HELEN MARIAN ADAMS Economics Berkeley Roble Clubg Transferred from San Francisco State Teachers' College, roast Romance of Resa.noE 1133 Dance Drama 133. MARGARET GRACE ADAMS Graphic Art Los Altos Sigma KAPIHZ Transferred from San Jose Junior College, rgzsg Riile Clubg Y. W. C. A. Cabi- net 1214 Track 121g Agamemnon 1rj. CLEO GEORGE ADBLSBACH Mathematics Visalia Branner Clubg Mathematics Club. THOMAS AKAMA Pre-Clinical Sciences , Los Angeles Japanese Club. Joyce ALDAI-11. Philosophy Long Beach Delta Upsilon. ..M .M D ,. t.-A II. 1 4 ,I 4 - ,,M,.,..v. -.,-.,. ,A Y... E Born-1 Wnnmeo ALLEN EnglishfPublic Speaking Palo Alto Pi Beta Phi: Transferred from Mills College, 19261 Princess Ida 13JQ'D3.DC2 Drama 131. , GARLAND THOMAS ALLEN History ' Palo' Alto Alpha Tau Omega: Transferred from Univer' sity of Wyoming, 1924. JAMES HAMETON ALLEN Economics San Francisco Sigma Alpha Epsilon. 1 Rosmu- WILLIAM ALLISON i Biology Sunbury, Ohio , Eucina Club: Transferred from Otterbein College, 1926. l A 4 ALBERT LOUTREL ANDERSON X X Economics San Francisco i i Theta Xi. N l I F 1 CALIFORNIA PRroR ANDREWS Spanish San Francisco Transferred from University of California, ' 19253 Sigma Delta Pig Theta Sigma Phi: 2 Spanish Clubg A. S. S. U. Executive Committee 141g Rally Committee 1413 Quad Staif 12, 415 - Women's Manager 143: Stanford Literary 1 Board 1.0. Ride a cockauma' an ffwickea 3 f William 13,Q Football Show 141. , l , w CARROLL BAUGH ANDREWS l PrefClim'caI Sciences' ' X San Fernando Transferred from University of California at ' Los Angeles, 191.65 Phi. Chi. 1 ,Y 'I P x A I l .' ' I , IA Q ' A l ' el. 39 r l I 1. - , ,, . Encina to pay a friendly visit the night before the mudfight., This social call was heard about for sometime after, expenses of the party being estif mated at from ive 'dollars to ten thousand. Sophof more Weekfend, however, restored the economic and social status ofthe class. The pavilion was hung with drapes disguised as hollyhocks, and bordered by a garden wall. In the Next Room, an ohfsofsubtle mystery play was given the next evening under the auspices of the class, with many murders, J secret cabinets, missing papers, and slinking women. ' In the course of time, and scholastic regulations, junior year arrived for the Class of 1928. Under Cecil Doll and Clarence Sypher as presidents, the class plunged into a major activity of jollyfups. Autumn and winter passed, and with junior Week came a resurrection of class spirit. The junior. Prom .stepped off the beaten path of decoraf tions, and the Pavilion went even further. Panels, resemblingshow windows with delirium tremens, The '28 kindling pile ' masked the bleachers. Grotesque insects and - 2 2- a .W Q . animals were represented in silhouette on them. Programs in the form of medieval books were favors. The opera Wicked William was written by Frank Baker and Winston Norman, who both happened to be juniors at the time. It was an amusing play, with some good jokes, and some 'pretty' awful. puns. - 1 8 W 9 f - i Senior year found the Class of 1928 a sobered group of individuals. Under thepresidency of Bob King, first semester, the sociable habit of jollyfups held on. Owing to theillness of the president, the duties of the last half of his term were carried by the vicefpresident, Hallie Keating. More serious activities were interrupted by the exigencies of an epidemic upon the campus, but with the midfyear election of Claude Conn as president for the last semester, plans for the class were again taken up. The program for graduation week presents as happy a prospect as Lazarus returning home from the grave. The Senior Farce, scheduled for June 13th, promises to start the week off with amusing gusto. Cn the fourteenth, the Alumni Dinner and Senior . . 2, 2 .2 e Promenade will be colorful events. Spanish shawls will be worn as usual. The Senior Ball, on the fifteenth, will be the climax of the week, and will mark the passing out of the class. 9 And on Monday, june 18th, with Graduation Serv' ices, the Class of 1928 will officially leave Stanford Uni' versity, with only a few ghostly holdfovers to retain dead memories of this most tumultuous-but no doubt, exemplary-Class of 1928. '28 sees its jfrst Big Game at Berkeley .,' 1 SENIOR CLASS HISTGRY By Hallie Keating INCE its first timid entrance into the University, Quad hazing, whereby freshmen servedup enter' f adrif t-Fqgfiie-..,e1g5 .. on +3 , , 3, 3 R H' -FQ ,il i'1QT,i,, L . fl the Glass of 1 28 has had a volcanic histor . 4 4 53. ' 24 - KJ lg l -l V I - 9 Y A ' 'J- ,fl The career of this remarkable rou of students -1 ,Hi l F ,, '-1r il. 'l .' - g p i igagggi. e Q has been strewn with fire and earthquakes, and '5,m'. j with breakage bills and resolutions. It arrived on ' 5- the horizon just as the University was changing , yi ' T QP - ' from kneefbreeches to long trousers, and the rather ij, ,i 2. tumultuous events of the past four years are no li l, T doubt results of being about in the growingfup L -. Q. L- A p L , T , period of an educational institution. Q ff 2, . 5Q:2,f1:..1l-'W-,fig 1 In the beginning, there were traditions. Grganf QL' 2.5 iff , ized under the first president, James J. Sapero, the - .Q freshman spirit then evidenced was the last shout QQQQQ ff ,Q-gian t . Ag 9 , 5-if W of the collegiate. At one of the first meetings it was 2 enthusiastically moved, seconded, carried, and fore lg I T33 ' x gotten that the jean becomethe olhcial uniform of 2 f . t' i .1 -' , all freshman classes-a le islative move to com' , . V, .QB Z. uw., E , I Y . g . Y . J -gil lsjni . 5, p pensate for the stigma of the frosh dink, stillqworn it . f 'iT,f'H,yaN game p V in those abandoned days. This year also saw the , ,...'fPf'C 2' f 9 passing of Rough's Day and of the practice of an Y The last of-the sophorrlore posgnsvg tainment for the upperclassmen on the 'Law Steps.- lnterest on the part of sophomores in the Class of 1928 was evidenced by the enthusif astic surprise party given at Encina the night before the mudlight. At the mudlight the next day, tradition, the Class of 1927, and the Salvation Army were declaredvictors. The indomitable spirit of '28 was not downed by. this upset, however, and ina few days To Hell With 527m appeared in large fiery red letters on the sacred tablet before the Law Steps. About twenty frosh and transfers were forced to scrub off the offending words with their dinks. 2 9 The Little Big Game, on November Io, 1924, was the first of the series of class athletic victories. The frosh team faced what was heralded to be the strongest Cub eleven in years, and won with a score of 16fo, under Don Robesky, Captain. The women turned out to cheer, and there was a pseudofserpentine. The bonfire, burnt the actual 'night of the Big Game Rally, was the largest in history -seventyfnine feet. Statistics ran that if all the bits of lumber used in the .2 1928 bonfire were placed end . to end in a chutefthefchutes, someone would probably have been badly splintered. ' With Grant A. Burton as president second semester, the class career proceeded pleasf antly enough, with rushing and other spring sports. The Little Big Meet, with a score of 7556, was another linkinthe chain of class athletic victories. Profiting by the object les' son of the Hrst year, 1928, as sophomores, rushed over to ,-...., i A . Q .., Y T T l27 draws first blood in the mudjiglat an ,:-f ..,- f ', 'T' was l 1' . , ...V ,i l Hr, , ,X PERMANENT CLASS OFFICERS-Back Row: Ruppe, Draper, Conn fChairmanj, Davidson, Force, Davis, Creveling, Lewis, Shoup Front Row: Wilson, Hartwell, Stewart, Bancroft. BCOND term senior oiiicers automatically become the permanent officers of the class. When the Class of 1928 has added its plate to the long line in front of the Chapel, and when the members of the class have had their respective names added to the files in the Alumni Secretary's oihce-an irrevocable evidence of graduation, by the way-the per' manent class ofhcers will carry on in the interests of Stanford, 5.8. They will oiiiciate at class reunions, and in every way be responsible for the success of the class as an alumni unit. The Endowment Committee, another important permanent body, will attend to the collection and disposition of the permanent class endowment, utilizing the plan instituted by the Class of 1927. Class Plate Committee Chairman George Clover John Higgins Chairman Anne Bancroft John Byrne Gregory Davis Chairman David Adams Hallie Keating Chairman Shirley Armield Babette Bailey Charles Myiiard Seraphim Post Charles Ray Senior Ball Committee Murray Draper John Hamlyn Programs and Announcements William Johnston Senior Promenade Committee Robert Philippi George Potts Frederick Macy Howard Ross ' Lawrence Tuttle Richard Worden Thomas MacQuiddy Carolyn Shepard Louis Vincenti Gregory Davis Herbert Reynolds Donald Ruppe Harold W. Woolf Fred Newcomb Virginia Voorheis Catherine Wilson .r 1 , 1 l .1lr' SENIOR WEEK COMMITTEE-Back Row: Shoup, Macy, Ellsworth, Creveling. Front Row: Call, Conn, Force, Davis. ENIOR Week is a period of hectic activity for the entire class, but particularly for the members of the Senior Week Committees. Upon them falls the responsibility of attend' ing to all the social functions in which the class must indulge in order to make its exit im' pressive and memorable. The Senior Farce must be chosen and the arrangements for its presentation madeg the class plate must be designed and castg graduation announcements and Senior Week programs must be designed and printedg and finally, the Senior Ball must be given in such a manner that all the members of the class will remember it to their dying day. The last month of the senior year is a great deal more strenuous than all the other months of undergraduate life combined. Endowment Committee Chairman, . . Anne Bancroft Cyrus Farewell Paul Forker , , I I Chairman . l Daniel Benton l l Richard Cannon I ' Donald Cherry l Chairman l Alonzo Cass Marian Farr l Anne Hartwell John Hamlyn ' Margaret Kalenborn Harry Call Herbert Klein Leon Levi James Purcell Finance Committee . . . . . . . . George Ellsworth Fay Hamilton Aileen Hicks Wesley Jones Gordon Knight Donald Marquis Jean Stewart Senior Farce Committee ........JackShoup Hallie Keating Margaret Olsen Sallie Kinsman Herbert Reynolds Winston Norman l 1 l 1 - .- 'mp' . -fn' 1 1 -- I.. I i -rl m. THE SENIOR CLASS President . . VicefPresident . Secretary . . Treasurer . Claude Conn Anne Hartwell Jean Stewart George Ellsworth Representative on Alumni Advisory Board for one year Murray Draper Permanent Class Secretary ...... Jean Stewart Class Orator . Class Historian Class Poet . . Class Will . Philip Cavalero Frederic Speers . John Hiatt . . Frank Baker . Claude Conn Publicity . Lynn Bramkamp Committees l A Permanent Class Execiitive Committee l - - Chairman r '. ' . . 4 - .W . A .... . l Anne Bancroft Louis Creveling Eleanor Davidson Gregory Davis Chairman Harry Call L Louis Creveling Gregory Davis Murray Draper ' Lilian Force r Anne Hartwell MacBoyle Lewis Donald Ruppe Senior Week Committee George Ellsworth Lilian Force Frederick Macy Thomas Peterson :l..l. - Claude Conn Jack Shoup , Jean Stewart Clarence Sypher Catherine Wilson . Claude Conn Jack Shoup, Harold Woolf Richard Worden Srconn TERM Orricnns-Back Row: Manslield, Hiatt, Draper, Bramkamp, Cavalero, Speers. Front Row: Conn Hartwell Stewart, Ellsworth. 1 V 3.65.-ali.. : 4 -'iv-a....i t tl H137 . THE SENIOR CLASS First Term Oficers in President . . . . . . . . Robert W. Kmg VicefPresident , . . Hallie Joyce Keating Secretary . . . . Frederic Speers A Treasurer . . . . Henry Keyes l Interclass Sports Managers Baseball , ........ Theron McCuen Soccer . . Wade Strovvger Tennis . . James Mansfield Robert W. King Committees Church Committee Flower Committee Chairman . . . . Jack Shoup Eleanor Davidson F. MacBoyle Lewis Commemoration Committee Chairman . ......... Thomas Peterson California Andrews Ema Demond Chairman . Byron Bryant Fenton Barrett Chairman . Alonzo Cass Margaret Kalenborn Class Day Committee George Eisman jollyfUp Committee Aileen Hicks Jack Springer Ernest Wagner . Lilian Force Harriet Ford Helen Huneke Louis Creveling William Worthington Fmsr TERM Orficans-Keyes, Speers, Keating, King. W,-X, xv 1 .1 un 2 if fa 1 vi-I a yy-'f' rw vu w f Lv wh U, -, Tw 11 ff' . ma -,CNA ,f ff -uf ,.u 5 . 0,1 Q- L, u,., uv ,-0 .:f-', I 'N .nu . .',:'nnu1 -v..',. .lv 1 - . 'I ' XA M -. M, jury, .. iii? 'gunz 'S if , Qpfvrg, I r' J A na. U.-I M, ff :SMX nf I MGH' fff1Jji:.53 f K fi hifi? X L. x A Lf. JLWM K mag, .X tr Li'-XL? 1 ' 1 ff i 1.-J S QW? aa 96 7: Q2 in Eff -'E ks. '24.Q,fv1 if'f mga- :hel-Sn, ,.J,-53. quwr 1 C ev- 1 ,K A r!?f,1Yfa.L? y -.riff A 4, A I J JJ: G gg- if 'Aim :Jn r ' wah .mf ,f Q ' 4 'f 19,4 4 1 ug. ,. - .a. M . N, 'x is s., . wr 1M f1p1-M 1 Mr -' , .- -5 f' 1-'G sb S f 'F I 1' 7 ' Kg , qzghu 5' x ff. A? , , fam 'H J' r 'R- KJ 6,-'A I 1 .f .-J U ag, Mgr- I fl J' Y: 1 1 -S K QQ Ag E. M wav' mx Q BX -. 1 Y' 5. 4 gr Lx rszvkfp 4 We M ,wi -wf 5 r :RF R 1,11 :Q on 'W Q r xt' V-I4 -. 1 x x at gf- , a P E34 Ay Nxrqvkf 45145 f Pk-if M-v 4 M175 -4- 1 ,fa ,. , ,J fir , 4, 1 jxm xiii f J ',,f-WF Winn N' 1, an if NWKQ3- W Q 0 mqaqilg gif! lggxmffg, 4 ,M 4' ,gi-an 52331. S gd, 1 wh 31112 fn-45iff?W'-W L46 ,y .living wh' ig , 72174 0 a N ,W 9M-0, I F193 r'4 '5-'affnig M30 ,, 2525 gg PM U W qw E4 Yo 'Drk Pr' W 7 f n 0 KX 1 -ff a D x I Wea-.W -,HN '15 ,mv is f : Q 1 M 434 ' 'X jx5I ' t I . ' 2 ff w' 'SQ - v E A, 1 4 V w v E 'XL as wyifx lkf- ' C sf-3 3751: 2 Sh ,.1'5 , bfiv- I ,ww ,ii LQ, 1 u 1 H ab N131 xx w v M 'Z ' .a 18.5, Y A 5. :J w ,, , -gp 'K 5 X v Nvw 4 .4 H c 'ir 1 Q 'v 5 ax' r ' A vi 'gf 4 4 191' 7 1 x A 1 L-H-If 3 15,2 gt 11 Y L . K,-Q -4 'YE 1 'J Q xbingxhw , :arf 'i'- gyiwi L2 -1-4 3 HJ A Q. ,, Cr-lf ,Q 1 L I xg.. F' -qffw' wh- 'H-L s Vg ivpk '4 ' .fx Eff, -4 XS fm- in 3 vi faf f , . EJFSQV ixxzvvifss' n.gg,1 5 :QL 1 '3a:3?7ffE -w fr , M ,110 , gg X,-L1 ' ' Y 'ff-SW.: -q1'f..E-ff vlfwx r,4,1 bgiigggww, 'iv g +.,, 'Li x3f..Aw Q x ,, , 3, 3911? M at -Q-m.-a ggi I '9-Qg.iv, 1 S .z-rib J f?-'f 1f 'wg Juli W F E5 , ,JP ms 4' .- K 'JW M! 5 4 J f f Q' .Bw 61 WV 5 5Wf 3 F 5945950 a if u. f,,,55.: a fx ?QgqcSef59 4 -5 J. W x q 4 4Tf1L5'Sx5j'f'Q 1+ .. 1 -51 ' 1,13- 0 Q6 meagre 495' 5 -yf K av ef 45, Q1 ,-.1 W M ff Jigiigiiiifafs ff ' X' G mah. :Q H ,' ' X ' K agcggyawfhm .Mg 5,62 ef, 4 .ff if 4 ' me GQ QBQI Y ,k A ,ff . sam 2.0220353595 g Nj 2- ' 'S r-X C3292 2e:991gm'tQ',rQ dba T34 1, cg 'fd S '39w12w '9Q'3 wwfga-192 5.-f eww -.mf 'a we 3'1'a'j5S3'5-' wife' Um Q5 sw., B Ei 67 , 0 U E: Wg mzfigqfwigiwwfwdfw -ffwfa,-fs Q ff S3 Q ESEami'fzsws- 3'5s?ff56'5'WZ'5SQ: 1 A vga 9 nl g a 5 .6 QW Mi, cz E N,,mq'gf9wr1 mfg. s 440: 652, 1 - Q I gl gui' fn BQQF 5 IE E, m,vfi3T':6e26E 52321292 H25 Q 5:5 SQAQMQW Q s My QTSVQG' m99mgi'muD151 defflrfg :W bgmfg 5549 0 f WV Q31 SW 3.5, 6'10em69Qv'a ,Q GI' B QW ,sang 4:-Z7 La WEN iiqgigh g'Q5Q1?3 viii QS xx My WQgvg-Ww::5o6Qgq fm xr Q 5 sim few: f' G 0. 1i'1,, PN Q Q 02,-6.5 X 3559 gg9:0fL-FZ'o 15, Q WWE 2 ,Qmnw ' A wg mg web f Swv Www 6 X .9 mf S 'Q Nga 9 xegag W 045 in E, save 9 CJ 5 X2-39, A WM wzisfffw ., .u afsfwms-e1,.:Qfg 5 W gem 5 W? oe W 0 wav f E QEQ-2 Dogacgg-343' as I lu D cfs Q 'Qbcffis Qfeweg. Simca gpwgggm W g U qv, 922,12 HL M 9 zz , 'QQsPswZsQB9'xSe0.,e. am 1-ff'-f-052-Pisa' Q' 1 fbwag Gem 0 'EB Q9,',gw's '7'fg,, 1, X JM 14 ?amuw5QA 9 V W7 W6 929 .' Mkgig WF mmpif' W Eb I ma.. va 'bgoegaoo 'f YW!-qgliv, bw ' Q 639 :ae .1-f',m'l6z1'YFUv53, fm -J' mm , nap. QW ,Q , go 1 H 65 vw wwe-0 -,eau Q.f:e0eQ.- eg w w ff is -. r Q59 BQ MIN f'iN?W'9?X :Fx-x w an E -ooo o SQNYWVLMMN WTS? ,QQ f ,T 92,3 QQ53. ,T qxQ,3,f1 QW ff . , -, ,,fff1eWmmxW5-9 , www 'O ,Lf-ffnrwmfgefl maj IQ ,fm wr 3-wk, x 1, M 2,1 we 5' E : ,g QMISQW' ? W'-A Xe- yn? Xwi 'x My E E 5 ,5 fy , W ,PW QQ gs Q A,giom0S?P'7P Q g1Ag5.K4R:6'5?4 I Wfixgirqi mn 4169 Hman ff , W f Q wlw'2574??'g1I?'1 S 2 Www fmvs, aaiifisauw WSWM N 2 2 I K Cf' Wlglg www,-f ess ? XL pwc,DNvffh I mg 342 Vmasa-I mn ,+ fm MASQ QAM, i ffm?nSm3.F WWFRQ uf' 3? W a im Q' Aww f M ' 1' UQXV 3 L14 1 A :N 1.1 JY 50' , 'ff ' ang' 7' 5 A 1 425111: x we 'f Wg!! v I -A W m W 55 24 2 as M. MSR ,K f f 4, V ' vfw og J Jw -LLL? R yafsg'-1: w k fig emu, 4 gui 1 5 1 .V w , AF? 1 ,- . M-fly LQXK' v 'llkffgs-AN M f' A ARA, Wuxi 51' ni? x -A' A 41' 'H ir!.,'5QW2 E Q W? fig, K X 24.4- v' Ai 'fe r ,A , ,M ff W. U f 1' .i is E y P lgg.-1 5. 1 'if PM 9.254 , A N X W J f f x 1 1 q. f QW Q f. ff , X 2 Q 4, 'Xx- 'X S .A 1 'V -L 1 fm 'X , B 1, a'w XV .1 R Rox zkgviz E f K '-5 K , 's m ain I 1 Wa I, K1 K 1' 9 H 1 wllb 'QQ '5 '25 74 TP Vx ,K fy. , L. P. by 1 5' 'f ,f X M 'E A7 ,, 4 WL Y ' f TJ' 9 M fs, i X 1 + f -,X ' Asn 1 an qw' X K H ir Q M , 1 131 11 ,K ' ,u Q :Q 5 A 9ff'2r E 3 ' ww -4 f ug '- K 'fr ZFM1 Q I 4, 5' f m' V 1' 'Sf YR ,Q ,H W 5 Y ' 'if-rf Q 1, gall a e , 4.1 Q 9 .Q ifiqi R 59 Q 42 ' 2 X f 5' 1 , V f v. .R , 3 Fx, Q 2 'Q P f X ,X 1 Wg BYRO 1 xx ,V 'ff E, ix N D6 BULIP 9 V , 1 4' f' Qi v VX' 'Ri 'Y Qs xxx 1 1 1 V Q f A -, ll MY n x A 1 1 Q '9Fb 'frH. ng L 'Y w Q 393 i y t Q A W, 1 gnu E f T L k mag J 'fx ,Q -KA YV rrjif., .xg 'E P 9323 'MT ff fr K - 1 Afqgk, f 5 X ' H' C ' ff f 2 Q., ll, ,ff 11 , -,f ,f, A, 'N J ' i K , wr , M f ,- af , ,, wa, ,X L5 XA 2' 5? S' Q H gc 'x '5 333 ' 13 Nl 5 J h ' HL' Ii 4 Qu x ig 'I '-1 u 3 x x 1 xx . W 1 1 + c I 1' x ' 'Rh c C w 5 V '5-:E ' 1 , if 1. 4 L QTMP4 L1 K hy 'W P? in QQ 3 1 K VK H J W If N W ,F A hi , 'W J , , ,Q 4 , . . ' 1 .41 ' w ax M NWS' WaEafQ.'5.5J9Lum. N53 f'2P'o Q' 1'- mfr. 'E R1 N L g If 5' ' 415 'JL 5 L -X an -T' a H f,H 'bhbwm 6 Elm-,.5 i'P'? Wi g.W-'Rmb-'E Us a,:.1'.'is.':.-'-Ib:fI::f,.::f'.5'I e 1 .2:,.'1,Q1-'1 -5.:- -.ggpks.'.:cf:f -..15ffz - hei1:u:,.f4: '4ef:.f,f1-- 1:1-farm, '4 ff-5 gy fag - sem-.324113.12-gli.,-,Q: 53.125:g.5,31g1f:x,:f9g-15 , .,:. ff-gg ,,g:,q A.:- X-J .qw - 5.1-,rg Q f - , if. ,1- :-14zEs!i:'f::,-fj 21 22551221-12 5:5-.ziir'.'i-fizqizf:f52::,:,y.ggi':f2:Jf--i'- f-f-iff 12-Pliifg-22-1f.3.E5f.?212zileiiif' .fgsfjqg 2y,.ifa'1ff-5-gi iQ:-3fLji:jz1ggI.- f-512' frgg. ' fi?-j --plz is 11: if S921 Eff, 2532 f' nj-554 - 5 . gi -5 f 1,3 ', Fi-3':?.f3+5iA22i2.ff5'?'f -,fiiii 29123 15. im-3 3251 . : 1-ff'5'5'l -'fainf' ' Ziflzat-.-.'-a 2'ff:f:3 ' ffxifici-3 1 I 4 1: -- L' , -, ' 1 4 A -H eEx2Sf23E4s221-251i-fFrm' -P'-fi5?3'i1':'5fi-.:'. Jail-F--' ,1fiHT'.fffs,1:+I91- Nzwfkili r..-:2w:f: :avr z':::s,I.' ?i' 1-ff'-vfq f, :Win as . mf? IL, -,.-:w-.f-v-..:1-Mxf,-1.3-gs,-,.,-1g,.L1.v--3,--.-4,-mcg-1,-,VV, .,... U.:.:,.,,.,r: ---'-- .. . - ,-lq,.-ar.-Q - -- r '--- fu,-1-:. ,-,--.-.',,,,.-.-1.,,-3.4-1-f,f 3- , :-2:.3,',--1,1-, :eggp Tea:-1 w55ifi'Q,1-- Q,-.egg3.','-1-I-3i',reE' fsfagivsy-:j g,-wg 7525-:,:,f-':'3'Z-5.f3gQg.JI'? ,.,'5:::'.21'-'-T315 -ir-2-a -r: E.--- f1ji'a'r555u5'I,' flizfl-'j,.:f-z-'i':,:':'13g3?.1gg ::','?:,:f:.1 - 1.-'.:2-f.::::'ff-ff'-fs' aw:-Z1-fiiitaues-Qr::wh f uf':lf..wseewifwia-L'A-ix 52.25f,1fL21Ef5s,:r -2361341fZe5:+?'3g:f:f2,.232-iiwQ:::i:33222651 5:12.-5.,1-1' :-:-:if-'A'-I+:-12'-QF: ,x::a!'ie4fr. Qfiig V A gn-.-:I- 1a:a::5?535,,,-5-5 .z ' :Q 4- if' S72 '-E'2'!r1!:i ii. 72 2 1:9M-5' i.EE:.L .ir -, -.2'1:f:af??e'1P'1 . '25 2 ,- -' f -' L.. -,g,I-.-::..',1V-:mga-,.n-.1,-:-.-.3L,.,-,wa., up, -. .751 . 1 .,,,.. , - --. I. 1.,1,-:-. ',,-H.-.-,Qt - .j. .1P:,..1.-.!,-.:g- f'-,-f E iw mr-- ra Q ,.,.1z:ff:. . irq-:1a3714.,E5qq5-3 43:3-3.-,.gg..: .g.:.j:Q1'f-1..1'-m?'-'11, Q 1. 1--.-tt..3A',.l'.-::.. - me' 3'.H1:-1-2:34 41:51 S: , ':'-?.e'.f--A: yr-X .5 12122,-,-A f- 11 51- ,---H11,5' fam!-5-:1.v:.Gff-gif',QIffff.-:Sain'-ff?-2:9254 L, - P.H '.---'Aff -. .':Z. ik . - -i fl . .,fr'fG.'5. '- V '- ' , 1- V L-a 'H .'1'rf'22:-11-1' ., 'P V-. ,J -iz -V f, -f'.m,f .. fy ' ' I 15 gm 1 .. - 'Z .1-..'E'e 'i'.1. W' ,-1 :H 1'-Talib'-X ' '4121 WW' 1 '-45j.,fF'-':-Sf'-'.'ffT,fj-'Rf-3'-1 :TGIF ', 'S 1Ef1'w'A'L'L .3 ,4 Srfl,-h-dw. - xv - - -J.-fLfn'?ff'1- ,, ri-241' V , -.,-,,' X:-If - .w.:'ffmsef'.,.1.f.f4-'-'a't5e:.:1,-,H ws ,s':1w,,..1,.-rv -. --.PA-.-gllg.,-..,.g,.Lf1151.1, ,-411,-,-,iv .- M11 'ep-:,, Y -+1 'H ,, f 2- Q. 33-51-zu' 1' '-fn Z . Ziff?.-1-L:Zf3Qfi25'Q:!:l-:Jin ' 4 f 1-C. T r:.-fL4'f.1:fsil -'q? ?T'-'Prr.'s124'E':H':15-, ,f S?'ff '1zEfL:iZI5 ,- . 1-cg:-1523. z,..:'inL:g.f M' if -f 'ir ' f -'..-- Eu ' -1 Lf' : 'YVHVF 9 .'?:.f:!'.::' -'-x 1::,14f ',c1:s:':.a1-.5 :1-fr'.:i3xf,2flpfg11 -:- x,,1-Lfrfgi' .ff E:f'35f':T'JI'-1121- fig 4 ,.-f ,. wgM':c: :'1.E- - . .144 , -- 'P' - :.:e?.m,h.f''Q-n'??a'f: 1:-ff fl''-'W1- ia:5C5:K-:'f51'.,v.','1:12,5- ff.'1-2.151.120 IW' 1.11,,af-.a7y'y:.w'Qff:f1v-,nl 511. , 21 '--7 '-E-, mai. ,. uw ' 4 4 - --v:-- --: -Xu-Am .-nv 'us' 'lf-f4:f::-.v-1:25-:2?'- :.1,'wg-25-1- '-,::'f1 :-sz-. ':-evra: 7' wr. -521-'-:vs L1 .ah 'J'-1:55 11.55,-mzzjf,-Q-1'.gf 2, 3 J- .figjp .' .- 21 -, L .- ., -. ew-N45-,f 1 . .... 4. X 55 1, fx. - - W S .V -, uve .. -- K9 X 1, - .. ' ' 3? 1, fa w--:n v if f'uia :iama11z' 'ff 121.4 95- -JIT - --'fha -.ff if-.Hafw f -2 ar .-'S'-'-:2'iLL'., gifuvgi-:wa 9 ' ,-11 , ff. I 'frm' 12 Q ----A . :Jr-f 'asf-7 ..,'ff:.- f-:rf 1:-5-1,... ' -, '.'1'- g -1 ,- ':-x-gqg, ,J ..-. 1 .fre-.1211-, 4- - 1 V b. , . -...':1,' - ,g wiv-.'.'2'? -,gn-.':,'-:1 111: '5.A:. b:- ,119 1.-.' ' ,.m,N:Z4::ff'. safe- ' . 22' Bm..:.fg.,n5-4-1- :4,,:4.-gg-. 1m,, .wp ---'- ',--,-74 ,w.5..f.-.. -Q-.-,uw A . 5 xx ., 9 -. 5.-xwsig-.-1 wi.. 44, .-, J43? --,.-,lq4,w1,,.fL-:rig-. .-:L:wWv--'-.- W7- . ':'.'L-ac: -,' : A .f.' -1. wi'-Q . 0. - '. 14' 1' L-'HI 'HIYL' E ' 5 .'l.. 7 ' Y 'f-7 .'1- 55.3155 :lf I-5:-154. '-:'I3'i'.l-'-'L-'-gl- L. A-rf:.f-1-,-:wk-.34-Bi-112-1-w 2 .wa '..-.fmiif-I f.1:'- ','.:- --'P-11--11':f:'4 -71.-, ' T4 1 'H' .f-x ' - N S-14.1.1 q:f.::5-ag 'pf 1, :A -.'g',1a.-m spzivb'-: .1 mg, ..,-I: '-z-5: uv e 41.15 X' ---, -1'-.s 21 !- -r-fe-QQ2f,eJm1sf-maff -L'1.:3.,w n:s,r?f-1,-1321:-b I- f 222351-f'a-2551f9Ei:,:S'?-Q ?'fi:e if 1, ' l tr'--an . f - '- M ' - . .2I'1ra:13i5.a1aY::i'i'-- 2 5233? 'r-.+:qa1511 x A. A ' -W Q Q F , - ' -NA 0 'Pe . 'lf J ' oomg gm . 5 Q' :b1v?2:1 A1'2:212 1:5--. , ., 445.11 V 1 , ef- . - ' in J-14fiwv:L V -4' -'--izizifff.-.-E:.-1 1'f 1:' 1' ,-: -i '-'--g.. .-aw'-1 ,N -N ..:' ' -:M '-ww. - :- :-.,.::- Tis-5321.1-gfrezfr .X -' V 0 Q4 Q69 Q! -,W . ,lim me 4 0 53,3 fi. 'J 5 ?gZfgE.s'-,AQBIFZ 'lgTjQg1:2?'f,5g??1-S:3f5fQ2Q,'si 0 K' ' ' 0 ' 331.-,, '-g-::-:- ' ' ,nfsiafl-PW:-:JW 0 QW ,Q 25 fb -S 59,5 . 32:1- 3. -w 'R::-- : .-, T ,QQ--:.':fg 2 Q::g1,f'.'n'3:f3fQ',.5f:,:g4:J.az - 2-A Q QQ N E, W9 J 64 Q 9 n'H.1Llf:33E:x QQ? fa 9 ff' 'W ff 5 S in v. -:::.-- -- fra':u'52r-Ew-'.:-:f2- T 'ff''-55:ffl.:.'43',rfE.:'Q41'1-ffrif'lv-til,LFG!XJ- 'ch-'--1' .Q ig, '20 9 - .4 - - . y Q55 , ig pgg -'iff 9 0 Q, S MQ 5 Q 157 wg' 'i5' 9 0 Q, ff Q, QQ? H we Q am ? 51? fs, . ,. iffy- I 111155 -,1'fi2L2'f'fef'3'I.'Z',.,gE-,QE-Q-I'V! flip-2,A 51.25 , A ' T 55, -1? , Q5Qfi!Q'ff1?i 6 Q Q 1 ' 'g - 'avg' 5 W G Q .f Q amy Q -.12--11,-,,-,'-22 2 2- . V -f,x ,,z, I n - Q , .5 jqzgfz-53. . if 'O 0 ew We 'S 0 WW Q 5 eg S9 , -3:-1.2.-: Yf,'.f f4f:.:,H- -. ,w.-wik -QM .1 -fr -1 me Wg 9 9 69 .pf-,. g 9 0 Q . sf -'-- M C2 2,4 Q QQ W Ei? 1.1 -.' 1 i ' E ' 5 '5 -1 V : -f - -ff 'aff:11- ,-52:55--.,j,.2'.-:ga 5 G ., , .- -wi, 1. 5.55 5 56026 6 Q' ,Q W 60 H O U A f. we vi 'fa Hia, 'E-?':-:11:s-2w.f1 W1 Wig:-f' 0 Q 49 VV' -' ' 0 ' 0 -Q, f 2' - f - ' 2.--:'1'::-?e?-:- . H fz+2::1, ' isa' W . d L . ' N as Q- i f-,-g:f7'- lgiffi-Q2 'f1?s2s:g-ze ' gg:1z.f2f:-, WQQGQQE D9 ' ' . 3 X f- 1, 99 Q-,J 'gun ,avr-'T ,, ' 15-' A 2 ' A 9 w 6 9 ga ', I -, , 2 , Q , f Nw 'Q 11- -- 0 ' QA Q-'J Y' QQ 50 SJW '?-QQ- Q Z9 5 W fa . VU N W : . Q21 'Q Q' ws M N- : Q A .w W: Q UU' .' '.'5ES?'V. 1' fifi.. -,:!If 'f?1'L.rgQ gf 91.66 '0 6 QQ9 '9 ' ' 5 Q? ' M Ya, U-fi 5 '- -J'-2' - 1 f,f. :,:--iq'-k:fjicE'fei::fsf.' ' .2' ,2Ei'-C:-. '. 9 -5 . 1' 'E 3512 1 , g g '-1-Qi.: ' few 0 9 0 .4 . A Q -.v ,g5','1.3 b w 1 , gna gi 12 ff' M 'g Q5 Q0 -. f-QW ' 4 . Q gf , ffli f Bw Q -fmfa 1 il' -im' 'xksfi' .1 55:72.-'? 'f 'DW Q 9 0 f -A. .ff 21 2 4. 9 En . : p-nwqz. -f' , N 9 WDM - gpg. QQ? ,N - ,. . , Ya a- 5 P s- 'Qifa 74519 . 41621, E-?9 ?g1f3-sk : ' , -M1 -:Qty 'J gf-fm wg - , QV' 7 'f' ts' riff' .g 4 ,' , af -'gl ' 'lf ,ax .'r.Z'a.f1f. :!2r1,, , ff W fzfis-.W - NA ,- - f-Q15 A151 7. A-, rf 'f - 5, -gg' A' .f4 i7V ' 1 1 . ' - '. , .?L!i'F .,- ff- , ,117 '- H '-xi i: ' - A65 '- ,A If f- 1-- ' -1 , r .- -.-11 .t'. ,-gf. .p f f 1-Mf - 1 4 as ,5 X' .4 -'N 1- Q Silk ' . vwg, 5 4'-fi' 'fig 3,5 , Rv. 5vLMSI'?-.Q q ' - :QU ' ' H ,frm -aff-'- :asf 2. . ' , Q w. X . -,- 1 swf V- , P . -A mfr 5 Vggw- 1336, FW 'W 1-3 V' , ' ' 4 . , 'if wP'4?V ,ni Q ,-.-'Q-'S' ' n 7' 3' gf' 3 . ,, ' , . , ij ,I .229 '1.,xf',,, J' v' WX ,ff gf':C. V' if 2593 W 'E ff' W' v . -'Ei' W' 'if tl 775 ' '?l'T91- ia 03 K ' Q I Ti :v G , J. ,Q 5 :. ' t ef V' ,'h,s'--:fs'g3:y.f,:i:- '-an t , V 1,5 - ?f A-u 1 X -f Zf.f fSfw'f'l':,. - :W--..s.+f:4 w. 1 - ' 'Wk' ' P' x 'H :'a 'f- i.5. 2 1-lf. 7 'M--1 9 5 - H V-nff'-'ff: q,q',, ' 4 Y' MP: Q I QUE ifigff 1 . 2 we-f , 1, .Q-Qigl-,5. V1 ':-,zu ' J W - .Y 1, Q ,..f . , ,rwa wrgx, Q 1 , -sw.- ' isa -f 55 l .yv.'-in, at Hr:--wifnr. 1215 . is L ',-'Q 11-gag, Ning, .ff-lib . ,. 5.4. QM ,-- f M: , V . ,L - gg -5-., .QM ,-u f, .,., 1 1 , S. -.Q se . ,. -V, - -fwf', 'f,... fr fm . 'er fa-2 11951: ,,:2,q1w ,Q-1.r ,f-.E-r fwp gf---14--,1-f Q. .Mg f 1, 5 ' 'fexyskl g ar f4,ag'mff.:.+- vi.-wiv ' .. L vs. .ilfvisjazw -OV f:,, -'six it', :2f:-'. 5' E ff '?: EWG. g r' if 1 ,1. , 'i,' 5,1 are Q If- fin QA4, ,5:.,::t,.'f, ,.,.g in '.r5p:,5Lsfa 49:1 1? -an M , -J w-sf-:.3 'w2 i5o'-,'2-S Q2:f:..'L .. -: sy,,vK '-fffrff -,A -HI ' ' 1- 1 Fl- H 1if41g 'i:'5i5E. T.1ii!i5 x f.-.ii: Q'iv'1f?PSl The coral fisher, who had been a long time beneath the water, rose to the surface with nothing in his hand but a spray of crimson seaweed. In answer to the master ofthe junk he said, 'While I was in the world of fishes this miserable weed appeared to me more beautiful than coralf -Allen Upward ln search of treasure trove that's said to be Hid deep within this wondrous watery world, As coral fishers hopefully we hurled Ourselves therein-but we were all at sea, Distracted here and there. We madly whirled Among the wavering brilliant plants uncurled And frantic fish that scurried actively. The professorial masters ofthe junk May deem with reason that our wits are dulled- For tho perchance we managed not to flunk, We find, on graduation, all too late, In lieu of 1earning's coral we have culled The crimson seaweed ofa heavy date. H. S. .a..u,.1Kw.m..2...:,.. .-..,-,....a.,.fw...-.,,..,..f,.1-.-.,..,m.:,.,,..:...... f..f...Q.g.....c....u-51-. ng., .n',.,Q.-.,..,.,-.,..........u-K. x-....,-.M -,VL ,hum .. .., in-,.....,mAgv.1,E.....m ,..-.., ,..-..,:..,.f:.,.'n.-1 :WLM ,..f.,W......,...mv..-M..U.-.,z,.x:,..wu-m.,.-..-.A-,.-.-,-,...,f,-..f.7f.,,..-..v.f..,-,-dx-:.,.:..L.T.Y 1 -4 'X 6 33 A IC' 4 'I Ja li 5 :J 2 ii E vi -n 5. ll in .f LJ ,. ve uf .. gs ,. fl 21 IJ J H . 5 i 2 E4-,gym gg an 4127345-aiurinis 1 1- 'z :tx .?.1s219g:,m'1r:L 1-Av,-3: ewvtizatwszffvf ern mlvvmfxya 1-4-vs: w1'rfLE-.mxvvev-'fywww 7: 1 sfzff ,U 6 E 1 l ' a I-,F 1 . f i fy All- f 11 S2 g ff 37 20 , QS 1 4 f - f Q- - r 5' 4 - 5 i X 'E .A ll 'r I , f L' 5, v H' ' '1- Z' ,fi 'J , ' ff ' ' - Q11 - Q, EE 1 -FW ' '47 .- Q' 2 ry f'N'll , ,f -ffxxffx - . X A .I -1 . , .i xii , ' ' f y Xu -Q- I Ag , Q 55 'ffw gl - M x fif + .'l -1+ -f- Q ty! I I f 1 ' 1 I3 ,Q f 'f u ' X 1 , f EE gg -5-1-'ffl-'i' I ' ' X ' 13 'Xt ,X fi 1 2 . - . . Q 'E 2 gt' 5 5 Qffxk-: ff- sa jf ga f . fic' f f v , , ,ligvay 5 bi . . nf 'Lf' ll-A -Eg 1 f an . ' 49,0 ylkx 273.1 .JA 'HZ-7 5 N 2 iii, --f -A1 - - if- :ig-?'g Q . .. - -1 - -f - . -:, H bv A I . :ai E ::,5553, , f.- -iz' 55- E QE 2 ff? R-' 'iff' ' ' 5 si ' f I ' f QI- -w-5 'fF,pQx 4 - 3 ,Q .4 K.. 1 f.,' fist. 4 s- -vi I 1 5 L rx i, . l N 5 ? ' - , 1 ,Q ,T df .5 'i' ' , ,S 1 A , Ov Q A , F. -. -- 4, gg . Q- -' ' .: , 1 Q 2 ...,, if w -T ' JO 'JFS' f x ' ii --1--in , 55 A 55 rv ' K J Q Q r 515 ' M 5, is 51 f' 1 -- '- ' I1 - I if ' Q- A , --- 5 ' - V gv ----' L.,- : v , , if - .- f 53:3- '-' 1: 51? U ' x f'- sg 'J 1 2 X I 5,513 if . , FINE!-m -- . .jig E5 .3'gfQ5s?'P'4?- fw,. ,q'ffi'i1-2,5751-5 19'5?-:gg 1 M'-if , . .jlfgfg --Q , iffy-nf1gw:awN.,, sign- 6 ?Eg,vc.m1z,g-qi if . U , an J X' A riff W p gfwpwj' 5 -2 '- 5 a- may sf 2 if gf 1' W P TE R II 2,1 Q 2:- 5 C L A S S E S as 1 5 f FE QR, ,ii E ESi-Taw52f+z-sefgg4i??isQfS:+!wb:Qxy?.Ss!sf4f?1iqu23sxtw:-fc-Qxv--hsifz-i?f.1i:imJawr1Rffiuiasali-'6f7ie?:1w:fs4f.f2z5Xs1-'Q' sz:f1,:ue?.15m,a'1.s1:w1'e' ,e 1: X. A '- ' H--fr-f-l'Nm--'f-Q-vmsl-frm-'fra-1---vf-1--H P--- Q-M5 --mb., km-..-.::.m-.f 1-.1 ..,..f.. Y , .,.-M.-..f,g..........LB,w .f,.-n.u:f.w.-:....u, Hwy. vu-.-.f,.fm, mm -,. :A-Mn.. 4 9' r 5. ,.g:'z,:f . ,, A . 'lx ,na i l'i N, ',. 1 I . V Lf' .Y 1 ' L V j.. M-. . ,gl-1g Construction work on the jacques Loeb Laboratory at Pacijic Grove THE HOOVER WAR LIBRARY DEPARTMENT of research which is unique at Stanford is the Hoover War Library, founded in 1919 with funds provided by Herbert Hoover, 595. A permanent endow' ment was given in 1924 and is now administrated under the chairmanship of Professor Ralph H. Lutz of the History department. The Library is an historical workshop and an integral part of the extensive research equipment of the University. Nowhere in the world is duplicated the facility for studying the period of the World War and Reconstrucf tion that the Hoover War Library affords. It is international in scope, aiming to secure all the works of real historical importance written during or since the War. Curators are maintained in countries in which the book trade is little developed, in order that the library may he provided with every important document and book concern' ing the War. While Professor Lutz was in Europe last year, he spent much time securing rare volumes that were needed to fill in gaps in the various collections. Of particular im' portance to the Library are certain official documents which were not made public during the War, and which were meant for circulation only in the government offices. The whole collection of documents, manuscripts, newspapers, and publications of societies has been grouped into seven separate sections. This year the Library has received a number of valuable gifts, many of which are of a confidential nature. Some of them will not be avail' able for research for from twenty to forty years. Students from all over the world, as well as foreign government officials, come to the Hoover War Library to study the rare collecf tions that are found there. ' CONCLUSION LTHOUGH the outstanding work in scientific research has been stressed here, every department of the University has its scholars and investigators. Here there is little absolute belief in authority. From the year of its organization, Stanford has attracted men of creative thought, men filled with the pioneer spirit of research. The spirit has changed, to be sureg it is not so supremely enthusiastic as it was when the student body and faculty formed a small group. But for all that, the creative spirit of the pioneer is still with us, stronger and more definitely directed than ever before. The University of the future will undoubtedly have one of the most important research plants in the West, if not in the United States. V V The Hopkins Marine Station The Lane Hospital THE HOPKINS MARINE STATION HE Hopkins Marine Station, situated at Pacific Grove, was built in 1917, and since that time regular classes have been conducted there in marine biology during the spring and summer quarters. During the summer there are so many applicants that a conf siderable number must be turned away. In addition to the regular curriculum, individual investigation is carried on at the station throughout the whole year. Thus it is that the station fulfils a twoffold purpose: it provides not only for elementary and advanced inf struction in biology, but also for research work. During the past year, Professor Walter K. Fisher, the Director, completed the second volume of his monograph on the Sea Stars of the North Pacific and adjacent waters. His study included the coast of Asia north of Japan, the Bering Sea, the western part of the Arctic Ocean, and the Pacific Coast of North America north of Lower California. The other chief research of the year was carried on by Professor Harold Heath, who has recently studied the life history of one of the most primitive termite, or white ant, genera known. The particular object of his research has been to understand the various stages of colony development, with the practical purpose of taking remedial measures which may lead to the eventual extermination of these pests. In addition to the regular Marine Station building, the new jacques Loeb Laboratory for Marine Physiology was built this year at the same location. The laboratory will make special studies of the vital processes of marine organisms. THE LANE HOSPITAL HE Lane Hospital, founded in 1893 by Dr. Levi Cooper Lane, and the Stanford Univerf sity Hospital, built in 1917, are both under the direction of the Clinical Committee and are operated for the purpose of giving clinical experience to the medical students in conjunction with the Stanford School of Medicine. There is much research work carried on at both hospitals in the study of diseases and their remedies. In addition, practical clinic work is done by the students. The large scope of the work done is shown by the fact that in the course of the past year over one hundred and hfty thousand visits were made by outfpatients to the clinic for student treatment. The Stanford School of Nursing, which has developed out of the Lane Hospital Trainf ing School for Nurses founded m 1912, has also grown steadily in importance. Its educaf tional program and progressive methods have made it one of the leading nurses' training schools in the West. The School is situated across from the Lane Hospital in San Francisco. Dr. Miles testing tlie reaction times of football players PSYCHOLCGICAL RESEARCH F outstanding interest to college students is the apparatus that has been invented by Professor Walter R. Miles of the Psychology Department for the measurement of the time required by football players to get startedf' An illustration of the apparatus appears above. By an accurate mechanical measuring device, the reaction time of each man may be estimated. Employing the old method of critical observation, an expert coach needs a year of study to tell which of his players are the fastest and most alert. It is believed that this machine, which is original at Stanford, will soon be in common use at the other universities. A track squad may be measured by the same apparatus. Professor Lewis M. Terman, head of the Psychology Department, is continuing his study of gifted children, which he started seven years ago. He has already published two volumes of his series, Genetic Studies in Genius. The outcome of this study will no doubt throw light on what can be expected of precocious children, as well as the degree to which their superiority depends upon education. THE FOOD RESEARCH INSTITUTE HE Stanford Food Research Institute was founded in 1921 by the Carnegie Corporaf tion of New York and the Trustees of the University. Although the Carnegie Cor' poration guaranteed funds for a period of ten years, it exercises no control over the policies of the organization. The foundation of the Institute was a direct result of the war, when it was seen that food problems needed cofoperative investigation. Such research called for the joint supervision of three directors, an expert in economics and food distribution, an ex' pert in agriculture and food manufacture, and an expert in the physiology and chemistry of nutrition. The directors and certain members of the research staff hold positions on the University faculty. Although the Institute has not been accorded the status of a depart' ment in the University, its affiliation with the Departments of Chemistry and Economics is very close. The purpose of the Food Research Institute is to collect and make available an accurate and comprehensive fund of knowledge concerning the trends in food production, trade, consumption, and prices. It endeavors mainly to increase the understanding of the physical and economic laws in this field. In general it does not undertake studies that involve ex' tensive collection of original data or prolonged research, it rather seeks to call such prob' lems to the attention of agencies which are better equipped to cope with them. The opera' tion budget provided by the Carnegie Corporation is nearly 570,000 a year, and additions to this in the form of grants are made from time to time. f ,V .pq I , I .l ' -. 1 I i 1, IQ-tr' f . r The Stanford Seismological Station Dr. F'ranklin's nitrogen apparatus TI-IE SEISMOLOGIGAL STATION N the autumn of 1927, a new unit of research came to Stanford in the form of the Seismof logical Station, which is under the direction of the Seismological Society of America. A lightfproof cement house containing the sensitive apparatus has been built on bed rock back of the Lathrop residence, free from the disturbing influences of traiiic. An illustration of this very unpretentious structure appears above. Its diminutive size is due to the fact that the apparatus is very compact, and very simple in construction, despite its extreme sensitivity. Professor S. D. Tovvnley of the Mathematics department is the supervisor of the staf tion. He is Well fitted for the position, as he has held important executive positions in the Seismological Society of America since 1911. The fourfunit system of stations, composed of those at Stanford University, University of California, Golden Gate Park, and Lick Observatory, has as its purpose the recording of earthquake disturbances and the determination of their exact locations. Observations from at least three of the stations are needed in order to fix the precise point of any particular tremor, so it is imperative that the stations Work together. By means of the elaborate AndersonfWood torsion seismometers, every slight disturbance can be noted at its actual time of occurrence. In fact, a continuous record is being taken, and a print is made daily of the previous day's observations. Distant quakes can not be detected by the instrument, but disturbances Within several hundred miles are most effectively and accurately recorded. Dr. Bailey Willis of the Geology department, nationally known authority on earthquakes, is largely responsible for the establishment of this station at Stanford. DR. F RANKLIN'S EXPERIMENT NDER the direction and supervision of Dr. Franklin of the Chemistry department, ex' periments are being carried on with the reactions in nitrogen compounds and the decomposition pressures of metallic nitrogen compounds. The complicated apparatus that is used for these experiments was originally constructed by F. W. Bergstrom, and it has had important additions since that time. As the same apparatus can be used for several experiments simultaneously, three major experiments, as well as a number of minor ones, are being carried on at the present time. Dr. Franklin has published a number of important papers upon nitrogen compounds, particularly the derivatives of ammonia. L Naval rnonoplarie a campus curiosity Interior of the Aeronautics Laboratory THE GUGGENHEIM AERONAUTICS LABORATORY ESEARCH in aeronautics claims Stanford University as one of its American pioneers. During the War, in 1916, a laboratory Was provided at the University, and with funds supplied by the National Advisory Committee for Aeronautics, a wind tunnel was built in one of the engineering buildings. Although the facilities were meagre, the experif mental results were important from the start. In fact, the first systematic investigation of the characteristics of air propellors conducted in this country was made here. From that time, the Stanford Laboratory has developed and expanded its scope until it is now an ex' tremely important feature of the University. During the past year the Laboratory has made great strides, thanks to the generous gift of the Daniel Guggenheim Fund For the Promotion of Aeronautics. An initial gift of 315,000 put one of the engineering buildings in shape for the use of the Laboratory, and subsequent gifts of 330,000 for equipment and 515,000 a year for the operation budget have made it possible for the University to introduce this year several courses under the direcf tion of skilled instructors. Prior to 19271928, only one course was offered. The course of instruction provides for three main divisions of Work: theoretical aerof dynamics, theory and practice of aircraft structure and stress analysis, and experimental aerodynamics. The courses are open to a limited number of graduates and to specially qualined seniors. Research is the principal aim of the Laboratory. Practical experience in flying and in the mechanics of aeroplanes may be gained at nearby flying fields. PRGFESSOR SLONAKER'S EXPERIMENT N experiment of great importance to science is being conducted by Professor James R. Slonaker of the Physiology department. The National Research Council, realizing the unique importance of Dr. Slonaker's investigation, is giving him financial support. The object of the experiment is to determine the effect of varying amounts of protein in the diet of rats on their spontaneous activity, growth, and ability to reproduce. Starting in the Spring of 1927, Dr. Slonaker decided to carry the experiment through three generations. This necessitates a very elaborate system of recording devices to measure the protein consumption of the rats, their voluntary activity, and to tabulate their genealogy. The main importance of this experiment lies in the direct bearing it has on the amount of protein best suited to the needs of man, a study which has never received the attention it deserves. '74 ,fe-Lien' Giant transformers in the Ryan Laboratory Exterior view of the Ryan Laboratory THE RYAN LABORATORY MONG all the prominent men who stand out in the various fields of research at Stanf ford, none has gained greater distinction than Harris J. Ryan, who is internationf ally recognized as an outstanding authority on electrical engineering. The new Harris J. Ryan High Voltage Laboratory was erected in recognition of his phenomenal discoveries in the field of high voltage phenomena. The large size of the building and its modern equipment make possible much more detailed experimentation than could be carried on at the old plant. Moreover, zoo acres have been provided for the Laboratory to allow the construction of a sevenfmile transmission line. Last year the department spent much time investigating the field of high voltage trans' mission conductors, with the goal of decreasing the loss of power incurred. The tests were conhned to the Laboratory. During the summer a practical checkingfup was made by further field experiments on the great 2zo,ooofvolt line of the Pacific Gas and Electric Company at the VacafDiXon Substation. At the present time the erection of the new million volt threefphase outdoor line, which was commenced at the beginning of this year, is nearly completed. This line will be used mainly to conduct coronafloss tests on the various specimens of conductors. Of particular interest is the present investigation of lightning, which has always been one of the major problems confronting electrical engineers. In fact, the question is of such great importance that it is being studied throughout the United States with the hope that some protection may be found for the reservoirs in oil fields. The physical nature of light' ning flashes is receiving special attention, for it is believed that a real understanding of the true nature of lightning may reveal the determining factors in the behavior of the flashes and their path to the ground. THE ENGINEERING SHOPS LTHOUGH almost no research has heretofore been done in the shops, new equipment will now make this possible. The foundry has acquired a 'Lectromelt Electric Furf nace, which was obtained from the Pittsburg Furnace Company at a cost of S35,ooo. It will be used for regular cast iron heats and research in steel melting. There are only three or four others of its kind in the universities of the United States. The forge shop has acquired a forging and annealing furnace and several electric heat treating ones. The Rockwell Dilatometer, a very sensitive instrument, serves to obtain the arrest points in the cooling curve of steel specimens. It will be used only in research work. SAEARC . 1 . , ,, Back Row: Weller, Draper, johnson, Ferguson, Cook, Willey, Richards, Behle, Miller, Weigel, Vincenti, Goudy, Bledsoe, Kocher, Adams, Home, Foote. Front Row: Lirtler, Himhert, Shepherd, Kirkwood, Cathcart, Stratton, Beardslee. PHI ALPHA DELTA Professional Law Fraternity Founded at University of Chicago, 1902 Established at Stanford University, 1911 Faculty Members Joseph Walter Bingham, J. D. Marion Rice Kirkwood, LL. D. WilliamBrownleeOwens,LL.B Arthur Martin Cathcart, A. B. Harold Shepherd, J. D. Officers justice . . . . . . . . Robert Littler Viceffustice . . Robert Beardslee Secretary . . . Paul Harold Kocher Treasurer . . . . Lynn Richards Leighton Bledsoe Ronald Button Claude Adams Robert Beardslee Calvin Behle Stanley Cook Murray Draper University Members Class of 1928 Kenneth Ferguson Bert Green Kenneth Johnson Class of 1929 Lucius Foote Paul Home Paul Kocher Robert Littler George Tackabury Stanley Weigel Arthur Capps Miller Lynn Richards Louis Vincenti Fred Weller Emerson Willey i ' 1 Q I Back Row: Chalmers, Murphy, Dyer, Quinn, Withington, Fletcher. Third Row: Robertson, Price, Knox, Dunn, Yoakum, David' son McElvenr1y. Second Row: Adams, Sobieski, Garibaldi, Brooks, Vanden Akker, Coleman. Front Row: Ranney, Hill, Osborne, Whittier, Vernier, Morrison. George Bliss Culver, LL. B. Stanley Morrison, LL. B. Magister . Reporter Clerk . Alan Robertson Herbert M. Bingham S. Clark Cypher James L. Adams Phillips Brooks Ray J. Coleman Horace Davidson Kimball Dyer Lawrence S. Fletcher PHI DELTA PHI PROFESSIONAL LAW FRATERNITY Founded at University of Michigan, 1869 Established at Stanford University, 1897 Faculty Members George Edward Osborne, S. J. D. Almon Edward Roth, J. D. Officers University Members Class of 192 3 Harry Hollis Chalmers Class of 1925 Class of 1926 Ward Ames Hill Wallace W. Knox Rarnund Robert Murphy Class of 1927 Harry M. Conron Eustace Cullinan Drummond Wilde Class of 1928 James Garibaldi F. MacBoyle Lewis Ralph McElvenny Harry Maltby William Price Chester Garield Vernier, J. D. Clarke Butler Whittier, LL. B. . . Wallace Knox . . . Frank Yoakum . . Lawrence Fletcher Alfred Rogers William R. Ouderkirk Tom B. Quinn Dennet Withington Frank B. Yoakum Rufus Ranney John G. Sobieski Archie M. Stevenson Kyrne Vanden Akker I l 4 1 l l Back Row: Messner, Warren, Chuck, Harmon, Benton, Leicester, Fernelius, Daniels, johnson, DuBois, Wood, Lazarus, R. C. S-Iwain, G. Smith, Binkley, Ogg, Thomas, Ramsperger, Griiith, Fulton. Front Row: Burks, Luck, Sloan, Bergstrom, R. E. Swain, Franklin, uggins. PHI LAMBDA UPSILCN HONORARY CHEMISTRY FRATERNITY Founded at University of Illinois, 1899 Stanford Iota Chapter Established, 191 3 Carl L. Alsberg, M. D. Francis William Bergstrom, Ph. D. James Stuart Blair, Ph. D. Edward Curtis Franklin, Sc. D. Dana Burks, Jr. John H. Griffith Robert A. Fulton Robert Greenleaf Bramkamp Harold D. Chope Charles H. Binkley Carlyle Harmon Daniel Newell Benton Albert C. Daniels Faculty Members Maurice Loyal Huggins, Ph. D. I James Murray Luck, Ph. D. james William McBain, Sc. D. John Pearce Mitchell, Ph. D. University Members Class of 1918 Class of 1921 Class of 1922 Faw Yap Chuck Class of IQ25 Hugh Martin Huff an m Class of 1926 W. Conard Fernelius Louis A. Gaspar Class of 1927 Arthur B. johnson Henry M. Leicester Elmer A. Messner Class of 1928 Lawrence Henry Lazarus Class of 1929 Richard Ogg George S. Parks, Ph. D. William Henry Sloan, A. M Robert Eckles Swain, Ph. D. Stewart W. Young, B. S. Robert DuBois Royal Fred Sessions Hung Chan Wong George Edson Smith, Jr. David Alvra Wood S. Benson Thomas Dennistoun Wood, Ir. Robert C. Swain Edward Warren President . . VicefP'resident . . . Second VicefP1esident . Secretary . . . Treasurer . Edwin S. Anderson Katharine Boynton Louis H. Brownstone Barbara C. Dewlaney Madeleine K. Doran Aurelio Espinosa Wilma E. Fenner Norman W. Hanak Lotus O. Hargreaves Dudley H. Harkleroad Frank Carlyle Harmon Fay Harrison William C. Herrington Edith M. johnson Malcolm N. Jones Ross G. Kingsbury Lucile Burk Pao Hong Chang Bonnye E. Deal PHI BETA KAPPA HONORARY SCHOLARSHIP FRATERNITY Founded at William and Mary College, 1776 Califo-mia Beta Chapter Established, 1904 Officers University M embers Class of 1927 Paul L. Kleinsorge William D. Lawrence Kenneth R. McDougall Almon F. Manspeaker Barbara Mayer Dorothy C. Mead Elmer A. Messner Marcia E. Morton Henry W. Newman Marion I. Nicholas Cora Dorothy Olney Robert E. Paradise Kenneth M. Park Barbara S. Probasco Reginald S. Rood Class of 1928 Douglas R. Fuller Maurice H. Mandell Donald G. Marquis Augustus Taber Murray, Ph. D . . George James Peirce, Ph. D . Graham Henry Stuart, Ph. D . . John Pearce Mitchell, Ph. D Harold Shepherd, J. D Charles C. Scott Mary D. Sheffer Nellie L. Shepherd Charles E. Smith Stacy H. Smith, Jr. John Y. Springer Frederick P. Stapp Masao M. Suma Edward C. Tabler Joseph D. Thomas Ethelind Thompson Harry R. Turkel Wilbur I. Verplank Florence Williams Thomas A. Work Robert M. Yeatman Margaret Olsen Anne J. Russell Robert H. Wilson Frank Angell Edwin A. Cottrell, A. M. Henry Wilfred Maloney Alfred R. Masters, A. B. J. Harold McCreery Clifford Pearson Hoffman Cranston William Holman Alonzo Cass Murray Draper QUADRANGLE CLUB MENSS HONOR SOCIETY Honorary Members George Bliss Culver Faculty Mem bers William Brownlee Owens, LL. B. Almon Edward Roth, J. D. Everett Wallace Smith, A. University Members Class of 1926 Class of 1927 Seraphim Fred Post Class of 1928 Robert King Leon Herman Levi Ralph McElvenny john Thomas Nourse Thomas A. Storey, M. D. Robert L. Templeton, A. B Harry M. Wolter Stanley A. Weigel Emerson Lane Spencer Clarence C. West Donald Albert Robesky Louis Rudolph Vincenti Clifford Gilmore Allen, Ph. President . . . Treasurer ..... Correspondirig Secretary . Hannah Frances Foote D. Aurelio Macedoiiio Espinosa, Lotus Odeal Hargreaves California Prior Andrews Virginia Bunnell SIGMA DELTA PI Spanish Honor Society Founded at University of California, 1919 Kappa Chapter Established, 1926 1111 Faculty Members Alfred Coester, Ph. D. Officers University Members Graduates Class of IQ27 jr. Class of 1928 Lucile Burk Dorothy May French Class of 1929 Lorraine Caroline Reeder Aurelio lvlacedonio Espinosa, Ph. D . Aurelio Espinosa, Jr. . . Lucile Burk . Dorothy May French Irene Beatrice Wicklund Berneice Marjorie Little Barbara Merrihew Perkins John Meredith Hiatt Alice Madeline Rose Class of 1927 Back Row: Crawford, Tuttle, Weymouth, Cox, Barnes, Adams, Koster, Morris, Greer. Front Row: Matfield, Crane, Hull, Willis Carpenter, Grove, Hamilton, Sutton. President . . . ViCC'PTCSid6nC . . SecretaryfT'reasure'r . Executive Officer . Orvin Philip Fry Anne J. Bancroft Helen E. Carpenter Wesly P. Cox Martha J. Blackwelder Mary E. Crane Henry J. Adams David M. Greer Thomas F. Koster STANFORD RIFLE CLUB Cflicers University M embers Class of 1926 Thomas R. Barnes Donald P. Goodall Class of 1928 Dorothy May French Fay Dunn Hamilton Class of 1929 John V. Crawford Ruth Dorothy Grove Class of 1930 Dora K. Matiield Hewitt Mitchell Class of 1931 Margaret Willis fwbirv Thomas R. Barnes . John R. Morris . John Crawford Lawrence Weymouth Alan C. Taft Lawrence S. Tuttle Lawrence Weymouth Sheldon K. Wirt Henry E. Hill Mary J. Huff John R. Morris Harriet E. Sutton Robert Watkins Back Row: Winnek, Simon, Hulsman, Barks, Forster, McGuire, Eddie, Devlin, Fetzer, Dietrich, Berg. Front Row: Murphy Harrison, Krenz, Rothert, Frentrup, Clark, Albertson, Simkins, Torrence, Steinbeck, Thompson. President . . . VicefPresiderLt . Secreta-ryfTreasurer . Alexander Cook Albert Forster Daniel Frost Theo Harder David Hawley Ray Hulen Walter Hulsman Douglas Lewis H. Kendall Albertson William Barks Harry Berg Clarence Bush William Clark Leo Devlin Stephen Dietrich Charles Eddie Jacob Fetzer SGALPERS Sophomore Honor Society Founded 1921 Honorary Member Ernest Paul Hunt, A. B. O ffzcers University Members Class of 1929 Lawrence Lewis John McCandless Thomas McGuire Alexander McKinnon James Melton Chester Moomaw John Preston David Robb Class of IQQO Ralph Lud Frentrup Gordon Gilbert Gordon Grilhth John L. Hare Reginald Harrison William Hobdy Gibson Kingsbury Eric Krenz William Laird . William Clark . Charles Eddie . William Simkins John Rogers Paul Sexson Charles Smalling William Sparling Ray Tandy Thomas Thurlow Frank Wilton Fred Zombro John Murphy Harlow Rothert William Simkins William Simon Stanford Steinbeck George Thompson Greer Thompson Dean Torrence Phil Winnek Back Row: Draper, McKinnon, Robesky, West, Ross, Harder, Dyer, Sobieski, Post, Busch, Ranney, Bryant, Freeman. Front Row Vincenti, Forster, King, Edmonds, Spencer, Hoffman, Maguire, Sypher, Zombro, Wilton. David Folsom William Fletcher Vernon Kellogg Ephraim Douglass Adams, Ph. D. George Bliss Culver, LL. Ernest Paul Hunt, A. B. Henry Wilfred Maloney President . . Secretaryffreas urer Class of 192 3 Alfred Masters Richard F. Hyland J. Harold McCreery Clifford Hoffman Byron Bryant James Busch John William Clark Murray Draper Kimball Dyer Chris Freeman SKULL AND SNAKES F MENHS HONOR SOCIETY Honorary Members John Nourse, Jr. Ernest Ponzer Ralph Reynolds Faculty Members William Brownlee Owen Almon E. Roth, J. D. Robert Lyman Templeto Officers University Members Class of 1924 Donald E. Liebendorfer Class of 1926 Howard L. Mitchell Class of 1927 Cranston Holman Emerson L. Spencer Class of 1928 Donald Hill Robert King William Maguire Michael Murphy James Ross Nichols 5, Us Henry Suzzalo Thomas Williams Frederick Woodward Claude E. Thornhill Payson J. Treat, Ph. D. Glenn S. Warner, LL. B. Harry Wolter . Clifford Hoffman . Louis Vincenti Class of 1925 David Oliva Chester E. Ross Stanley A. Weigel Clarence C. West Rufus Ranney Donald Robesky Roland Sellman John Sobieski Clarence Sypher Louis Vincenti Back Row: Griset, Way, Wells, Holmes, Knapp, Alden, Schmitt, Cranston. Front Row: Culver, Brown, Drake,Watkins YOUNG MEN'S CHRISTIAN ASSOCIATION President . . VicefP'resident . Secretary . . Treasurer . . General Secretary Chairman Board of Directors . Donald H. Alden Morden G. Brown Arthur M. Cathcart, A. B. Karl M. Cowdery, Ph. D. Donald H. Alden Morden G. Brown Lyle E. Cook John M. Cranston Thomas E. Drake Founded at Princeton University, I877 Stanford University Branch Established, 1892 Officers Board of Directors Thomas E. Drake David Charles Gardner, D. D. Oscar F. Green Yamato Ichihashi, Ph. D. jacob Hugh Jackson, A. B. Student Cabinet Orrin K. Earl, Jr. R. Ray Griset Arthur G. Holmes Francis A. Knapp Lawrence F. Schmitt Dan T. Smith . Thomas E. Drake . Arthur G. Holmes . . Donald T. Purvis . Morden G. Brown . Ben F. Culver , . Karl M. Cowdery Almon E. Roth, J. D. Harold Shepherd, J. D. E. James Sparling Joseph D. Taylor, LL. B. James T. Watkins, VI John W. Way Stewart Way Phillip Wells Leonard F. Wilbur Back Row: Taft, Myers, Brown, Price, Hungate, Wood. Front Row: Steinweden, Croker, Bowen, Dr. jordan STANFORD ZCOLOGY CLUB Laurence B. Becking, Ph. D. Leonas L. Burlingame, Ph. D. George Bliss Culver, LL. B. Rennie Wilbur Doane, A. B. Gordon Floyd Ferris, A. M. Walter Kenrick Fisher, Ph. D. Charles Henry Gilbert, Ph. D. President . . . VicefPresiclent . Secretaryffreasurer . Merrill Brown Lucile Burlingame Helen Lois Dale Donald Fry, Jr. Harlan Holmes Joseph Hall John Bartlett William Carter Black Lydia Bowen Helen Bailey Richard Blackwelder Founded I8Q2 Honorary Members Harold Heath, Ph. D. David Starr jordan, LL. D. Mary Isabel McCracken, Ph. D. Frank Mace McFarland, Ph. D. H. C. MacMillan Ernest Gale Martin, Ph. D. George Clinton Price, Ph. D. Officers Graduate Members Edna Keeler Doris Kildale George Myers Helen Page Eugene Scofield University Members Class of 1928 Anne Davis Hartwell John Price Class of 1929 Morden Brown Richard Symonds Croker Class of IQ3O Charles Wood Collier Class of 193 I Willis Horton Rich, Ph. D. John Otterbein Snyder, A. M John Steinweden Edwin Chapin Starks Charles Vincent Taylor, Ph. D Frank Weymouth, Ph. D. Ray Lyman Wilbur, LL. D. Richard Symonds Croker . George Archie Wood . . . Doris Kildale Seymour Smith Evelyn Snyder George Struble Alan Taft Ludwig Waitzinger Allen Lewis Ryan Nancy Elizabeth Dorn Sidney Hayes Robert Hungate George Archie Wood Beth Pinkston YOUNG WOMEN'S CHRISTIAN ASSOCIATICN Advisory Board Mrs. Rex C. Bell Mrs. R. B. Cherington Miss Elizabeth Gamble Mrs. R. L. Green Mrs. James M. Hyde Mrs. J. H. Large Miss Margaret Lothrop Mrs. Mrs. Arthur W. Meyer I. P. Mitchell Mrs. Lester L. Morse Mrs. William Mudgett Mrs. Guy Shoup Mrs. Elbert E. Smith Mrs. Mary Stearns Mrs. Robert E. Swain Mrs. Edwin J. Thomas Mrs. Fred A. Wickett Miss Mary Yost Back Row: Cogswell, Shively, Huneke. Second Row: Cooper, Reeder, Hardy Bakewell, Patten. Front Row: Merner, Tinsley, Hartwell, Huntington, Lee, Davidson Kinsman, McCarty. President . . .... Wiiiifred Huntington VicefPresident . . . Sallie Kinsman Secretary . . . . . Alexia McCarty Treasurer . . . . . Florence Cooper Undergraduate Representative . .... Sally Miller Chairman Advisory Board . . . Mrs. Fred A. Wickett General Secretary . Harriet Cogswell 1 1 1 1 1 Back Row: Alden, Utt, Nobs, Burroughs. Second Row: Ball, Briggs, Dohrmann, Zitkowsl-ii, Jones. Front Row: Smith, Clarke, Keho, Schuck, Yeon, Gillig. Freshman Cabinet Chairman . ........ Katherine Keho Secretary . . ...... . Adele Smith Treasurer . . . . . . Elizabeth Clarke Elizabeth Alden Mary Edith Jones Janet Briggs Benita Nobs Gladys Gillig Pauline Yeon Senior Cabinet Elizabeth Bakewell Eleanor Davidson May Hardy Anne Davis Hartwell Helen josselyn Huneke Barbara Lee Edith Mattson Benetta D. Merner Margaret Owen Eleanor Patten Lorraine Reeder Louise Dawes Shedd Betty T. Shively Aimee Belle Thomas Ruth Tinsley Editha Florence Wright Bark Row: T'an, Pubols, Van Rysselberge, Bower, Bantle, Petersen, Donnay, def Brouwer, Maradudin, Schumacher, deStrycker, Moreland, Shen, Talavera. Front Row: Hardy, Way, Stall, Dr. Schwartz, Manning, Bakewell, Ingraham. STANF CRD CCSMCPCLITAN CLUB Honorary Members Dr. David Starr jordan Dr. Ray Lyman Wilbur Faculty Members Yamato Ishihashi, Ph. D. William L. Schwartz, Ph. D. Payson J. Treat, Ph. D. Ojfcers First Term Second Term President-Fred A. Bianchi President-Elizabeth E. D. Stall VicefPresident-Elizabeth E. D. Stall VicefPresiclent-Robert deStrycker Secretary-James T. Watkins, VI Secretary-Leopold Schumacher Treasurer-Alice M. Rose 'Treasurer-Carl deBrouwer GERMAN CLUB Founded IQO2 Honorary Members William Alpha Cooper, Litt. D. Mrs. William Alpha Cooper Clara Eberhard, A. M. August Carl Mahr, Ph. D. Helena May Nye, A. M. Carl Gustav Rendtorlf, Ph. D. Ida Wehner Henry Marshall Leicester Coit Coolidge Fritz von Estorlf Ruth D. Grove Harry Barker Lydia Bowen William Aldwell John Dayton Back Row: Barker, Bantle, Larsen, Schwafel, Pubols, Engelhardt, Coolidge, Klein Hieb. Front Row: Harris, Peterson, Grove, Pierce, Bowen, vonlistorlf, Bacon. University Members Graduates Class of 1928 Milton Hartman Herbert Klein Class of 1929 Wen Ching Lo Winifred McClatchie Class of 1930 Jack Dohrmann Betty Ford Class of 1931 Henry Mabry Nash Herman Salinger Daniel Pubols Burton Queen Fred J. Roth Sally Miller Wilbur Rowland Fred Safier Jacob Schwafel DELTA EPSILCN Honorary Art Fraternity Founded at University of California 1912 Beta Chapter Established, 1924 Faculty Members Arthur B. Clark, M. Ar. Edward M. Farmer, A. M. Mrs. Chloe Lesley Starks Louis Creveling Elizabeth Howlett Lorna Brem Mary Denny Edward Krough Baclq Row: Clark, Swain, Farmer, Malmquist, Creveling, Krough. Brem, Meyer, Shepard, Howlett, Mrs. Starks, Williams, Gibbons University Members Class of 1925 Kenneth Ferguson Class of 1927 Lucile Lyon Class of 1928 Beulah Gibbons Margaret Meyer Robert Philippi Class of 1929 Back Row: Van Rysselberge, Delatour, Wood, deBrouwer, deSt:rycker, Donnay H. Jones, Johnson. Front Row: Drew, Mead, B. Jones, Chloupek. Carl L. deBrouwer Joseph Donnay John Holmes Elizabeth A. Clark Alice Bingham Copeland Dorothy Chilcott Doris Joyce Holston Lily Laura Chloupek Katherine Drew University Members Graduate Members Francis Johnston Dorothy Mead Laura Peniwell Class of 1928 Helen Delatour V Class of 1929 Leonard H. Kirkpatrick Phyllis Mar Linscott Joyce Cowling Lyon Class of 1930 Helen Frances Jones Class of 1931 Sarah Allis Grant Morgan Stedman Elizabeth Williams Grace Shepard Stanley Swain Lincoln Malmquist LE CERCLE FRANCAIS Language Club Honorary Members M. Laborde Mme. Laborde Faculty Members Clifford Gilmore Allen, A. M Frederick Anderson, Ph. D. Albert Leon Guerard, A. B. Lydik S. Jacobsen, Ph. D. Oliver M. Johnston, Ph. D. Helen Marburg, A. B. William Leonard Schwartz, Ph D Stanley Astredo Smith, A. M. Agnes Peters Robert deStrycker Pierre Van Rysselberge Judith Ellen Johnson N elty Delmas Lefranc Mary Schofield J. Chilton Shirley Ruth Patterson George Archie Wood Front Row Class of 1928 jefferson Elmore, Ph. D. Benjamin O. Foster, Ph. President . . . VicefPresident . . Secretaryffreasiirer . Aurelio Espinosa, Jr. Fred Combellack MaryfVirginia Cooper Martha Blackwelder Frank Copley jean .Iago Aurelio M. Espinosa Class of Eustace Cullinan Frank Atkinson Joseph Bantle Carl de Brouwer Albert Biaggini Frank B. Carroll George Connolly john Ford George Anderson Thomas Burns Thomas Cameron William Clark Leo Devlin Spencer Austin Ralph Campiglia Gilbert Carr George Cousins Walter Craig Daniel Cutter CHI NU KAPPA Honorary Classical Literature Society Founded at Stanford University, 1925 Honorary Member Helen Marburg Faculty Members D. Officers University Members Class of 1927 Doris Fee Wilma Fenner Ernest Whitney Martin, Ph. D. Augustus Taber Murray, Ph. D Wilma Fenner . joseph Hall . Doris Fee Wirufred Little Charles Edson joseph Hall William Irvine Class of 1929 Ruth Lansburgh Class of IQ 30 Helen Thompson Virginia Voorheis Dorothy Wineberg Arthur Scotten Virgil Whitaker Helen Yeomans JUNIPERO SERRA CLUB Founded at Stanford University, 1912 Honorary Member Reverend Joseph M. Gleason Faculty Members Henry Wilfred Maloney Harry M. Wolter University Members IQ25 Class of 1926 ' Clark Cypher Class of 1927 Aurelio Espinosa Mabel Harrison William Scully Margarita Espinosa Richard Raoul-Duval Robert de Strycker William Espy Camillus Rogers John Hamlyn, Jr. james Prisinzano Donald Pryor James Purcell Thomas Grimm Van R. Hamilton Fred Hubler Daniel Dilullo Edward Dillon Joseph DeLucchi Berchman Devlin Manuel Espinosa Howard Gabbert Richard Grant Class of 1928 Dorothy Quinn Elizabeth Sawe Leopold Schumacher Louis Vincenti Class of 1929 Katherine Miles George O'Brien John O'Sullivan Class of 1930 John Jennings Robert McKellip Class of 1931 Arthur Hardy john Harrington Alfred Howell Felix Joujon-Roche Katherine Keho Francis West Catherine Wilson Dorothy Wineberg Frank H. Smith William Trigerio Paul Vincenti Dorothea Wyatt Gandolph Prisinzano Herbert Wenig Marron Kendrick Fred Kormann George McKee Thad McNamara Mario PerellifMinetti William Scott ,- xv g ,.. 1' : ina I 4 4 . L A--I enm- P 1 I 5 E ? E?-25 i S E 3 E 1 3 , 2 Z L X I 3 Z 3 Z : 4 1 1 a I 1 ' 1 f ir- 45 Ji F 2 5 3 2 I E E v , s v E I , 1 4 Z 4 1 E J 5 F 1 2 J 2 5 4 L'Tl1ey've all got tails but me. --A. A. Milne Spectator, walk apart from all the crowd And watch the greatest show on earth with me- You wonder freaks like these should be allowed- The circus of our university. See-For A Short Time Only-over there Behind the bars of his impromptu den A Certain Student squirms, a surly bear, Prodded by curious canes of Councilmeng Yonder, professors do their sleight of hand, And muddy creatures battle in the slime, Parades go forth with booming of the band: Come in-I'l1 take you 'round if you've the time Yea, chortle, friend, at all absurdities: Ourselves are not less comical than these. H. S. Wow MAKE C HEC KS PAYABLE, STANFORD UN lVER5lTY ' TBP RIGHT UP layoeeze, 8. gentilmen the big show the BIG show the most stooPENduou5 galaxy of fieeaks evah assEl'lblecl you will LAWFF you will ROAH wilh mirlh See prexy see PRliXy is he HUInin folks is he l'lUmln see culvahsee C ULvah you will HAVE io soonah or laleh lay deez ci genlilmen he is the blood hound of SIN lo nighl loNlGHT onlelri 'che mens COUNcil will deeLI6HT your EARS wilh Blaaaahsee ine facullgy the l'ACulfiy they RAVE lhey ANT 'Lhey EAR their l'lAlR unless they re BALD see Lhe engineers ine lllxlgin eers they Rave lin BARS ei llfials no LL STEP RIGHT UP laydeez cigeniilrnen 'Lliie BlGge8'L ci most GNAW rnis co CATenashun of I3'lAl-lvils in the Uneevers and lhe price of adP'llSl-IUN is onleh ON lelfi ninely .V- THE HONOR, SYS TEH 'IS AN 1N5TlTUTl.ON IN T1-115 UNIVERSITY six clollalris 100 much - QSJL J fx MENS X iff X-fu X PREAMBLE TANFORD UNIVERSITY is too old to be useful and too young to be responsible. When Barnum said, The public likes to be fooled, he had one eye on the benighted hope' fuls that flock every year to matriculate at Stanford. Were the great showman alive today, his fingers would itch eagerly for the shekels that might be accumulated by exploitf ing the Stanford Sideshow, but since he isn't alive, we might as well drop the matter and get down to business. We were going to write this section in ballyhoo style, but we ran out of ballyhoo and besides the stuff is absolutely unreadable. We have tediously trans' lated the following matter into orthodox English, and the reader will kindly preface each sentence with the remark, Step right up, Layfdeez and gentilmen . . , which will automatically give this section the circus sideshow atmosphere and save us a great deal of troub e. THE ADMINISTRATION The Administration is the relentless, unseen force that is supposed to direct the University in its progress toward power and pelf, mostly the latter. The student's first experience with the administration is when he plunks down his ninetyfsix dollars on registration day, and from that time on he gets more and more experienced. Any student who can weather four years at Stanford without going bankrupt is a cinch to succeed in life-this is the principal reason why the Graduate School of Business is so unnecessary. The Administration consists of Prexy, more deans than there is any good use for, a sprinkling of professors, and a lot of Trustees, Boards, and other unnecessary rubbish. Prexy tops the list, both in stature and importance. Though he is something of a stranger on the campus, he is nevertheless quite well known through his kindly interest in fraterf nities and campus social affairs. When he feels that interfering in any case where a man has been guilty of that heinous crime, conduct unbecoming a Stanford man, would be unwise, he delegates the power to his Men's Council, which provides for the necessary punishment without saying a word to Prexy-not a word, mind you. And there is a marvelous form of mental telepathy involved, for the Men's Council instinctively knows just whom it must punish without being told. Men's Council is not a part of the administration, for the members do not draw salaries. But it is the benevolent connecting link between the powers that be, and the powers that soon won't be, and any member of Men's Council is automatically granted the privilege of fraternizing with the dean. The students composing the council are not entirely responsible. They only seen their duty and done it, and it is rather touching to watch them sturdily deny themselves the pleasures which others enjoy. This disposes handily of the Administration, which will now proceed, we fear, to dispose of us. fr YKAA, I L? No CHAN fe? THE FACULTY It is never safe to speak of the faculty in a derogatory manner because they are, in their way, kings, and the king can do no wrong. The members of the faculty range from the full professors to the instructors, with the assistant professors doing all the work and the professors getting all the credit for it. A peculiarity of the educational system at Stanford is that the average student never even sees a professor, which is fortunate. The grades are determined by the correctors, who work like day laborers and get about the same results. It is a well known fact that a real professor never looks at an exam paper-he spends all his time doing useless experiments and writing dull books that no one ever reads. The students are forced to buy these books by a clever ruse: the professor refuses to teach a course without his own textbook, and if the student does not buy the book, he flunks the course. This is only too true. The greatest tragedy that can happen to a professor is to enter his classroom and End all the chalk gone. The next greatest tragedy is to have a dog fall asleep during one of his lectures. The third greatest is to have a student fall asleep. This disposes rather neatly of professors, who have always been a thorn in our sides because of their irritating habit of asking the reasons for unreasonable things. UNDERGRADUATES Undergraduates are youngsters who have not yet graduated and probably never will. College is a continual battle between the faculty and the undergraduates in which the faculty is equipped with brass knuckles. The undergraduates support the school finanf cially, and the administration shows its gratitude by hurling them out on the slightest provocation. When the students protest at this unjust treatment, some official with an eye for statistics retorts that the University pays about a hundred per cent of the expenses of educating every student, which leaves little else to say than thank youf' Undergraduates are very frivolous and irresponsible, and are always doing simple things. They hang pennants up in their rooms and steal turkeys and get their names in the papers with no apparent effort or discretion. As a result, the tendency of the adminisf tration is to regard all undergraduates as unnecessary evils, a tendency which has resulted in the proposed plan for abolishing the Lower Division. This plan will be greeted with unrestrained enthusiasm by future Stanford students, as the only excuse for the Lower Division anyhow was to give a lot of economics graduates the chance to teach Citizenship to a lot of freshmen who were not interested. just what they will do with the assembly hall when citizenship courses are abolished makes no difference to us. It would be an excellent place to store old razor blades, and the seats might be used to good effect in the next Big Came bonfire, if that hasn't been abolished, too. 4 Q7 D .mlzxa ace ,aff LIVESTOCK Cne interesting fact about the Stanford campus is that a stone's throw in any direction is liable to hit a cow, or sheep, or dog. The campus was nicknamed The Farm long ago. It has lately developed into a ranch, with cows of all shapes, sizes, and sexes, herds of pudgy little sheep, and a number of intelligent dogs. No campus dog ever attends the same lecture twice, but makes the rounds of them all, and then goes out in some isolated field and lays him down to die, content that life can hold no more. During the Spring months the campus breaks out with haystacks, which add to the rural atmosphere and offer a wonderful opportunity for petty arson, which is immediately taken advantage of by the frosh. There is a rumor current that the hay is fed to cows, who furnish milk and meat for the various university eating establishments, but the rumor is probably unfounded for no nice rumor would ever do a thing like that. Anyhow, the hay is here, and on a moonlight night it has its advantages. Sheep are used to mow the university fields and for mutton chops. ATHLETICS Athletics, i. e., football, is the principal source of revenue for the University, aside from syllabus fees, fines, and the interest on bad debts. All the pipe courses in the univerf sity were introduced in a desperate effort to keep the varsity in school, there being some silly conference rule to the effect that no decent fellow can play football without at least making a pretense of going to school. As a result, all the football men do make a pretense of going to school. Track is another form of athletics, and probably a source of revenue, too, though the University will never admit it, what with the expense of ruling new chalk lines for the javelin throwers and so forth. Other athletics are basketball and baseball, which are supported by football and not by the students. Every student is required to go out for some sport at some time during his college career. Most of them attend to this up in San Francisco. lnterclass and intramural athletics were developed to give the unfathletic youth a chance to play just like the other fellows. The various living groups compete with each other throughout the year and the winner is awarded a handsomely engraved beer mug, and the whole thing is rather silly, but what can you do? Athletics are controlled by the Board of Athletic Control, the principal activity of which is selling Big Game tickets to alumni and keeping students away from the games. The Board is planning a lot of new improvements for this and that, but has never quite gotten around to them. It added several thousand seats to the stadium this summer, but the women's gymnasium is still a woodpecker's paradise and there are hundreds of rabid golf fans on the campus who have nothing to do. - cfs f N. f 1 e 1 WOMEN Stanford women are divided into three classes-those who come here to be athletic, those who come here to study, and sorority girls. The first two classes live at Roble. There are five hundred too many women here, and their principal virtue is that the number always remains constant, discounting marriages and other acts of God. Women's athletics consist of such strenuous sports as archery and interpretive dancing, both of which are designed to make women more durable. In the interpretive dancing classes, the Stanford woman is given a sheet and told to interpret a phonograph record. The results are often startling. A great deal depends upon the phonograph record, but a lot more depends upon the sheet. The costumes in which Stanford women ply their sports are ominous, black, voluminous affairs which have been the subject for much controversy of late. It is an inspiring sight to see a cofed clad in one of these shrouds go leaping over the hurdles and be carried off by the wind. Some difiiculty is experienced in playing basketball, for the ball is liable to be lost in a poor girl's bloomers without her knowing it. COURSES Courses are conhned in the Time Schedule, which may be obtained upstairs in the Administration Building if necessary. It is something like this: Schools, Departments, E99 Divisions Cwith Executives and their wrong office numbersj The rooms in the Inner Quadrangle are numbered indiscriminately, from left to right, ten numbers being allotted to every building and eleven numbers to all especially good buildings. Numbers are also allotted to every cash customer, and winning numbers receive an S11 meal ticket at Morey's. All courses not marked with I, II, HI, or IV, dhur, r, rg, r4, MWF9, t, or Standing Room Only it is well to view with alarm. A dagger by the side of a course means that the professor is married but human. All courses marked r are to be repeated in the follow' ing quarter, but in a louder tone of voice. An s before a room means it will be given in the telephone boothg an X means it never was given and never will be, a 1 is a misf print and doesn't mean anything. dhr means days, hours and units by arrangement. R and B by A means Room and Board by Arrangement. The numbers in red and underlined twice are the laboratory and syllabus fees for the quarter, and are due and payable at once, with a two dollar fine for all checks returned from the bank for any reason whatsoever. Having thoroughly read and digested all this informatory matter, the student is privif leged to make out his program for the quarter, provided he can find the courses he wants. TANFORDANA Q- . nos o. o . D spirit of baseba rhsk Ske , 'l' of 1 associated Wi A. 1 'Yness oi H509 g I nashing of toet ds COIUC1' S at : .M N of Lao . - . 'nitrate AGAINST CALlFORNl,A I. a hard hort it Mg!! Gx0WlHg A -.i.. I Zudsmeld of 8' 'Favs qc better -'ony XVarner, author. artist, strenuous ractj .SCZ mmm-ilicr urlwersmcsles F W anus football mach' p ce' 5' 0 --flared GW- ,. . Jo AGO ' 'nam against .i. .ich with the dialr-tha I .Q livin: Y thc Sheriffs Posse' Nabs Ten?2ni'f12dstf'1flZrf'lLlr' , ll W fn firm... Q1fsIfNGs Youthstag Birds Re- . ,,,,,,,,i,,g the em lllfs W 01,160 3. Q. -tqrirfoofballt YMEN sis ap ure fi yon ns: Friday . 115-it G' l'o-----Neon. ,S I il ,P h , bi? our. ' C , N 1...--buugd ...Inn fm of o 'S-S' 6' . 0 'f S 008111 but eight Stziniord Izniversitgl sgua ' ' ' m fl5A1.iZ.ii?5.e3R.liJlLii'eslifrtlli Wiz. Professors Con Bo Wroos 'lg 14 y the Stamford men were two students i- . J 0 of the Menlo School for Boys. At last we have discovered that our'1n,,nn Perhaps the T 1mV5,'ud not want Unlversity's better half -,nnm7 ' DEA C to leave their comiurrmirle home on I H N P the farm ot Etlwnrcl Schroeder- the faculty-13 ' OST which is on the Portola road a few takes quite as 1. ' fte To miles west of the university. They 1 1310 TAL set up a. terrific squnwlcing when It all COIDGS LG ZZ HJ USS, I If attacked and frnsiritted the nlens by the Board Dt! In eiltgd I Jlflcjg- of the ten younf: men to feast on , . . , d as Uni, V horrowed turkey Thanksgiving ticket applies-UCI ' . L noon. ulty for the Big G S lhY0UT :S FASE 'VRML k No less than eiE Sm or FORMTXCS - ' h - ' . 1 ..::::,:fih..i.z1a::. .:21:.:.:.t::.:e, roof-om one f NECE5 N5 NTHLE uothirrs ,Was hlorrgw-if of it Until ' ,n Wood me 2, yesterday. T e t nn ori men arc JI h og v i z at liberty on their own recognlzancc. And Specill Officer Fred Freho promised that they would appear! before Justice of the Pence Edward MeAullitt'e on a date as yet unset. However, the Menlo youths lacked outside help when it came to get- ting out of jail. So, for several hours, they langnlslried in a cell. Lately there has been nn epidemic of turkey raids on the poultry farms in the vicinity of Stanford. The Schroeder ranch has suffered at least twice. Consequently, when Schroeder was awakened Tuesday night hy, the chatter of his flock. he telephoned for Sheriff James J. McGrath of Redwood City. TURKEY THIEVES CAUGHT McGrath organized a. posse, col- lected Officer I-'rehe en route, and arrived at the Schroeder ranch be- tove the turkey thieves had de- artld D ,. A The Stanford men gave the fol- lowing: names and addresses: 5 Llewclyn Forrest, Son Francisco: Douglas Lewis, Menlo Park: Ed- ward Post, Palo Alto: Jack Stewart and Thomas G. Murphy. Los Ah- geles: Dean 'Terrence Palo Alto: Gordon Griffiths. Stanford, and George Thompson. Pasadena. All rare members of Beta Theta Pi fra- ternity with the exception ot' Grif- fiths, whose affiliations could not be learned. and Thompson, who is an Alpha Delta Phi. DENIALS ARE ENTERED Edwin Forrest, 771 Thirty- 'ith avenue, father ot' one, ot the 1- ford boys implicated in th to denied last night that 1' '99 9 one of the turkey at 95 stated that hc into 6' 99 .e boy yesterday, nr ,G ,Go his statements, the zvgx' .ras 11 mlsundersm' 09050 b Beta! ET Qo as .nity mem- ers rr ' we .inc of their mem' o'5',439' et-ted with the aff' Wx .lentlon was that o other college hoys t -.mes of everyone who ha around the scene of the ther A thereby imnlif-ora.: mn-.. hex no' gui THREE NEW made. Robert Talbot iFZn,'.lgggfrg,hiln' ELECTED T0 Y.M.C.A. no . 'ldv Tc-hn Sell TIYZTIZI-Si,lCi.i0iYlS ine N BY Btusnmc us:-ini SHWRS.. SETS. IS FOUNDDN QUAD ' oaggiaent. is A rea msebud, fading but snr L fragrant, with the stem plucked QP 1 F . fZlZQj14y Q, BEFORE NOVE EES Reed Advocates Qigaafagqiy Q MBER8 Honest Men For 4? 90 443 diode . f C' 48 Federal Offices lbfaqff' QW Qffia . 52' to it GO 'or One Out of Six Students . AM, oqie 912 W0 Q Works at U. oi Mltillgande id nee -is ist, 63 916 fb C ' 'li CONTROVERSY ovni itil? fiiiifii Qs' Q ig he V seldom thr Zzgz ggrgggrlaihg ITOUND-Q55 bill. Can be recogered hyi STANFORD STILL 0N Neel Engaged 1 gmlifiQuill?nifiiioinfftiireptficigaiii TEilWrl:li0USAND FOR business office. !- ' '7vl'lE6sfuI'KroTEoT.1?' V l the classic 1 artists of th varsity Held l E v runs our NOT ON . CENT ron sEQll0lA fi CONDUCT. EASTER EGG E35 HUNT ON ROBLE LAWN lk- -Mariorie Bailey Sails to Europe Aboard Freighter MEMBERS faculty attention. men were hi onion hither ing the nooi The sturdy man drew l: from the far: ple practice g iTI-IE MEMBERS OF KAPPA KAPPA GAMMA wish to thank those who l helped in moving the furniture out of the house and otherwise assisted I the night of the fire last month. :ALL THOSE wishing to direct traffic for the TT SXT. zomf- may get in LGISCELLANEOUS LOST-One small brown pup. ronn far past the f, clumsy, black nose: would have Catch S 1. ' been police but for frailty of mother' ef' Pmff Notify P. J. nulon, P.A. 3192 an -BKOTY. narzne reward. Chilclren's Corner. Roble's Committee of Five has serious things to consider when the women are brought before it on various charges. Most serious, perhaps, is-the case of the Robleite charged with throwing butter while at one oi the dining tables. Student control should end hereg this is a matter for THE STANFORD CREDO HE research department of the 1928 Quad has this year conducted an investigation unique in the annals of American yearbooks. We have dipped into the mind of the undergraduate, and have discovered the philosophy of the average Stanford student. After extensive investigations, and careful consideration of facts and ideas discovered, we have found that certain pernicious beliefs are prevalent on the Campus. A Certain Student believes : if That men from Los Angeles are much better dancers than men from other parts of the state. Cf That President Wilbur drives a Rolls Royce, and that he is always in Havana or Washington, D. C. If That the editor of the Quad receives a salary of 51800, and that he has scores of former high school editors to do his work for him. ll: That women from Los Angeles are much better dancers than women from other parts of the state. CfThat most of the eating clubs at Stanford are petitioning Psi Upsilon. Cf That there is a maze of tunnels underneath the inner Quad, where a certain group of Campus Bohe' mians holds meetings, at which candles are used for illumination, and wine is served for refreshment. if That the University of California is trying to entice Mr. Warner away from Stanford. If That Herbert Hoover was studentfbody president when he was at Stanford, and that every Stanford alumnus will vote for him. if That sooner or later the Administration will give way before the entreaties of the fathers and mothers of this section of the country, and allow a thousand women to enroll in the University. Cf That all freshmen in Encina throw water, put California pennants upside down, and keep intoxif caring beverages underneath the washfstand. if That Stanford University is somehow unique among the universities of the country. if That the alumni will give no further endowment to Stanford if fraternities are removed from the Campus. If That studentfbody cards are never the same color that they have been in any preceding quarter. GI That everybody saves the receipts given at the Bookstore, in order to receive a share of the profits, but somehow there never are any prohts. flf That gifts of money given to the University are promptly and wisely expended by the Trustees. if That the Boards of Athletic Control of Stanford and the University of California are controlled by the same corporation. H Cf That Stanford Students of this era are bound by convention and sophistication. If That the Dinky appears every seven minutes,but that after the present contract with the University expires they will take their rails off the Campus and lay them down the main street of Palo Alto. CLI That the cars of the Palo Alto Railway Co. were purchased second-hand in 1897 from a street car com' pany in Santa Barbara. GI That David Starr Jordan has four standard Ames' sages for publication in campus periodicals. if That Mrs. Stanford's brother believed in ghosts. KI That preachers of every denomination appear in the Chapel at least once each year. GC That the editor of the Daily writes most of the letters in Campus Opinion. GQ That the mosaics on the arches of the Quad were made in Italy and brought over in pieces four inches square. If That a walk in the inner Quad by moonlight will result in poetic thoughts. If That the Frenchman's Tower was constructed in three nights by torchflight and that it is necessary to carve one's initials on it. If That all upper division cofeds regard each man they go with as a potential husband. ClfThat the 1906 Quad was put out in seventeen days, after the earthquake had destroyed the Press Building, which still looks like that. ffThat other universities are especially eager for transfers from Stanford, but that no other school would ever be the same. llf That the group which runs campus politics has already decided upon the next live studentfbody presidents, and that no studentfbody president will ever be a fraternity man. GI That a Stanford cofed would rather stay out all night in an automobile than get a lockfout. If That all Stanford women eat their meals at round tables. If That a Stanford freshman woman is safe if accompanied on a date by an upperfclass girl. Cf That locked in the vaults of the Hoover War Library is a paper telling who was responsible for the World War, but that it cannot be put on Hle for fear of international complications. GI That there is a line of two dollars for checks ref turned to the Bookstore for any reason whatsoever. if That it is impossible to flunk a plusfminus quiz because of the law of averages. - ,X Webniiigcms 'ff f , , Yrslnrriix irls 'A g g U . X, vo stasis Q E Ni - SEED ww QQ zmgxi, 5 Q I n? 1Qv 6?,.FwVv fr A fa W G W Timm 5, l .. S f I W I Il, fi Fld. 3 ' l N , 1 li ,aff Q? mf X Q 1 Hr- OGQQWL v Q 17 INCOME TANFoRD UNIVERSITY employs a very carefully regulated system of checks and balances. The students write checks and then try to make their balances come out even at the end of the month. Fines are levied on any checks that are returned from the bank, for late registration, for early registration, for speeding on Palm Drive, and for not paying syllabus fees. If the income from these sources fails to meet the university dencit, the Trustees vote to pasture sheep in Memorial Court, and the situation is saved. Other sources of income are tuition, interest on bonds, and interest in athletics. They are not important, however, as the primary source of income is fines. If all the fines collected from Stanford students in one year were placed in one pile, Mitchell would probably take a day off. These few words and the University dispose of income. There is a rumor afoot or on horseback that the timefhonored motto of the school, Make all checks payable to Stanf ford University will soon be changed to Make checks payable to cash. This should have been done years ago, as it would result in an enormous saving in ink. SENIORS S Seniors are those benighted beings who have survived four hectic years of University regulations without flinching. It is a gala time for the University when the graduation arrives. The seniors are furnished with uncomfortable black robes at five dollars a throw, and treated to a tiresome Commencement service for the benefit of their parents. The presentation of the diplomas follows, after which the university washes its hands of the matter, and the seniors are branded outcasts, targets for the relentless alumni secretary. Being a senior is very pathetic. just below the seniors are the avaricious juniors, waitf ing vindictively for their opportunity to step into power, and just outside is the world, waiting equally vindictively to put the youngsters through the ropes. The senior's only solace is his senior record in the Quad. In it he attempts to condense all the activities in which he has indulged, excepting certain ones which would not look nice in print. Senior records are useless things, but so are seniors. The most pathetic person in the world is the joiner who tries to make his record at least an inch long, and then finds that another and greater joiner has omitted everything in a noble gesture toward modesty. ROBERT SEASALL Expense Accounts Colma Chess Club, Memberat-large 1115 Secretary 121, Vice'President 131, President 1413 Member Stanford Branch S. P. C. A.g Membermt-large, Freshman Rebateg Ham's Head, Refreshment Committee 141: Freshman Kind ling Comm ittee, Splinter 1113 Stanford Daily Business Staff, Dropped 1115 The World makes way for the man who knows where he is going 11, a, 3, 419 Rotary Club 12, 3, 41QlKiW3Hi5141. ROBERT RAZOR Ballot Stuffing Tammany Hall Garbled A. S. S. U. Elections 111g Forgot to print ballots 1115 Forgot to count ballots 1313 Chairman, Election Fiasco Committee 1411 Ray, Ray Rover Boys, Second Tryouts 113 Rally Committee, Washout12, 3, 41g Member' at-large, and growing larger all the time. KATHLEEN Qurrz Physical Culture Coconut ' Grove Football Gaietiesf' Oiffkey 141g Assistant to track captain 111g Campus Institution 1413 W'omen's Track, weights 141Q Lockouts 11, a, 3, 414 Stanford Daily Staff, I mean she railly wasp Delta Upsilong Kappa Alphag Phi Gamma Deltag Alpha Delta Phiq Zem Beta Tau. Louis Eccsnriuc Crime Chicago Probation 11, 2, . 411 Study Rules 1115 Fresh' man Basketball 1315 Football 12, 35 41: Block head 1414 Encina Sponsor, water 'iggcd 1415 Bronchitis 121. HALLELUJAH BLBATING Activities Caramel Stanford Daily Smlf, Masthead 1almost1g Values 1219 Stanford Literary Magazine, What's the Matter with Stanford? 1Every- thing1g W. C. T. U. 1r. 21g The Green God- dess, Noise Oifstagcg Social Probation 141. Tmztorznlsmy S1-nz PHERD Committees South San Francisco Northwest Mounted Police 11, 1, 3, 41: Senior Record Contest, runnerfup 141g Womcn's Hockey, Sprained Ankle 111. Bsvraiumr NEARBBER Agricultwre San Jose Stoics Club 13M1g Euphronia, Janitor 1419 Fallen Arches 121. v' --if Y' . .. W Ronmvr C-imc Athletics Pikes Peak I-mv Ymr141:.ToHvfups11. 2, 3. 41: Hiccups 1415 1. G. A. A. A. A. A. A. A. A. A. A. A. 13, 41: uP0llvanna 131: Rotarv Club 141. CARRIE NATION Womerfs Rights Amazon W. C. T. U. 1411 S. P. C. A- 1412 Antifsaloon League 141g Stanford Daily Staili Memberfat' large 1412 Mortar Board, Trowel 1 1g Goose Hangs High, Mother 17.19 Cosmopolitan Club, English Representative 12, 3,115 Late Leaves 1PA 10141. Bouzo Cxass Miscellaneous ' - South Cassedena. 0 ll11:C0 ll5i1:R 1: Shliiii-lin 1413! Loud lgrzaker 7131: B?l1lf13e1i1gl3ln Memoriam 1 1: Spcvtllight1center1g'Zete Beacon 1114 Curfew 1 1: Winner, Our Gang Contest 1lSecond Chi1dhood1. Hoonav DRAPBR Paleontology Wallow Wallow Bamyard Golf 1113 African Golf 1213 Student Handbook Committee, Index 1413 Freshman Debate, Goofs 1l11g Executive Committee, Grand Exa ted High Mogul 141. SPREAD Ci-reeks Slueening Boston Kappa. Alpha Themg Alpha Phig Bicycle 1113 Skates 1213 Buick 141: Class Knife, Fork, and Spoon Committee 1415 Freshman Gravy Com- mittee 111g,St:inford Daily Editor 1Why?1. SCARPAACE BULL Intersections Orange County Alias Bull Finchng alias joe Tankon: Con' valiscent Home 111g Whittier Reform School 121: San Quentin 131: Sing Sing 1413 Board of Athletic Control 1513 Swam over from Alca- tmz 101g Last crime on record, Chairman,Men's Council 141. CLYTBMNBSTRA Dove Home Economics Butte Roble Club. DEDICATIGN If The fraternity and sorority tidfbits scattered through the following pages are dedicated to President Ray Lyman Wilf bur, who, since his accession to the throne twelve years ago has maintained a kindly and benevolent interest in Stanford Greekfletter societies. Aetna Fire Insurance Co. . . . Agard Electric Co. ...., . Alcove Book Shop ..... . . ..... . . Ambassador Hotel .............,.,. American Building E99 Maintenance Co.. American Trust Co. ....... . . . ..... . Anderson E3 Fox ...... Anderson's , .... ..,..... . Wesley E. Angel ........... Anglo California Trust Co.. . . Anglo London Paris Bank.. , . . Arnest s ,.... .... .... . . New Atascadero Inn. . . . . . . Bakewell E? Weihe .... Bank of California ..... Bank of Italy ....,.... H. J. Barneson Es? Co.. . . . Richard W. Barrett ....., Bernstein's Fish Grotto .... Walter G. Bernthal ,,.... Fred L. Berry.. .,.,.. . . . . Blake Es? Amber ............ Blue Ribbon Ice Cream Co.. . . , Bond, Goodwin Eff Tucker ..., Booker Es? Petermann ...,.. John K. Branner .....,.. Brookdale Lodge ,.... Arthur Brown, jr. .... . Bullock E99 Jones ..... Daniel W. Burbank ...,............ California Pine Box Distributors Inc. . . . Campus Shoe Shop ............, T. J. Cardoza ............. ..,..... William Cavalier .....,..........., Certified Laboratory Products Co.. Chartier's .................... City Restaurant. ................. . Clark Es? Henery Construction Co.. . . . Birge M. Clarke .........,..... CofEd Shoppe ............... Cosgrove E99 Co. .... . Cravat Shop ...... ......., William H. Crim, jr. ....... . Crocker First National Bank .... Crow Pharmacy ............ Cyclops Iron Works ..... J. B. F. Davis Ee' Son ..... Desmond s ........... DieterichfPost Co.. . . Ralph C. Dodson ...,. Ducruet Furniture Co.. . . Eames Co. ........ . Earle E? Co. .... . Ehrman Bros.. . . . Paul Elder's ......,............... Elliott-Horne Co ..... ,...,......... Erbe Uniform Manufacturing Co.. Fernac School of Language ....... Fidelit E99 De sit Co. of Md.. . . Y P9 H. P. Fisher ................. Foster E-P Orear ............ General Petroleum Oorp. ,...... . Glens Falls Insurance Co. ....... . Golden State Milk Products Co.. . Goldstein E-9 Co. ......... ........ . Gorman Metal Co. ....,,.... . INDEX OF ADVERTISERS Page 432 470 466 413 463 433 428 466 472 441 429 472 475 479 442 440 437 478 462 450 478 416 463 433 408 473 453 479 409 473 417 45 4 422 428 422 475 471 446 478 472 448 420 478 428 454 422 439 411 440 459 455 451 424 464 474 435 423 461 432 469 406 443 434 464 475 424 Gotham Shop ......... M. Greenberg's Sons ..... . . . Hall, Glocker Ee' Prost .... . . . Haslett Warehouse ,.... Marco Hellman ........ . . . HellmanfWade ff? Co. .,.. . . . J. F. HinkEs'Son. ....,. ... Hotel Fielding ,..,,.. . . . Hotel Leamington ..... . . , Hotel Mark Hopkins ..,. . . . Hotel Plaza ..... ..... . . , Hotel Whitcomb ..... , , . Hunter E? Hudson .... . , . Hutchinson Co. .... . . . john G. Ils ......,... ........,..,. International Mercantile Marine Co.. . F. S. Jaeger EE Son .,.,.. . . . JonesfThierbach Co. .........,.. . Kellner's Cleaning Es? Dyeing Works. , . Knox Shop ....................,.. Kopper Kettle Tea Room ......... Gustav Krogh ............ . . . Langley H Michaels ..... Laundryowners' Club ,,.. , . . Lawson Bros. ......... . . , LeibfKeyston E99 Co. ..... . Leslie-California Salt Co.. . . . . . Littlepage-5? Sheehy ..... Live Oak Service Station .... McDonnell E? Co. ........ . I. Magnin E99 Co .......,.... . . . Malcolm Es? David ............ . . . MarshallfNewell Supply Co.. , . . C. W. Marwedel ...,.,..,... . . . Merner Lumber Co. ....,. . MoisefKlinkner Co.. ..... . . , Charles C. Moore E3 Co.. . . Moses.. .... .. ........ Mullen Manufacturing Co. ...... . New England Mutual Life Insurance Co. Newton Studios ,.........,.. . . . Nia ara Fire Insurance Co. of Md.. 8 Nielson E? Culver ................. Northwestern Mutual Life Insurance Co. Olympia Knitting Mills. ......... O'Meara Tire Service Shop ,.... Louis Orr ................. Owl Drug Co. .... ,.......... . . . Pacific Mutual Life Insurance Co.. . Pacific Telephone Es? Telegraph Co.. Palo Alto Dairy ..... .............. Palace Hotel ,,..............,..... Palace Hotel Barber Shop ..... Palo Alto Book Shop ......... Palo Alto Feed ff? Fuel Co.. . . Palo Alto Garage ........... , . . . , Palo Alto Super Service Station. . Palo Alto Upholstering Co ...... Pan American Petroleum Co.. . . . The Paragon .... ..........,. . . . Patek'Ecklon Co. ......... . . . Eva Pearsall ....... . . . Page 420 451 479 456 436 430 475 474 462 477 466 462 479 418 424 411 404 464 454 407 458 424 447 425 471 435 474 441 460 436 410 478 446 451 456 470 418 456 470 435 473 430 460 439 401 454 426 441 427 403 471 404 475 415 423 450 444 458 419 452 470 479 Pelicano Rossi Floral Co. ....... . Peninsula Building Material Co.. . Peninsula Creamery ..... ....... J. C. Penny ...,....... Peralta Pigeon Farm .... ..... Petri Cigar Co .... ........... PhelpsfTerkel College Shops ..... James H. Pinkerton Co. .... . Podesta Es? Baldocchi ...... PostfTaylor Garage Inc.. . , Roos Bros .....,. ,.., Esther Rothschild .... . A. M. Robertson ..... Russian Tea Room .... San Francisco Bank ....... San Francisco Chronicle ..... . San Francisco Ice Rink .... San Mateo Tobacco Co.. . . , Santa Maria Inn ......... . Scheer E99 Co. ...,.. . . . . Schwabacher 6? Co. .... . Shell Oil Co. .....,... . Sherman, Clay E? Co. ..... . W.E?j. Sloane ......,.... Slonaker's Printing House ..... . Fred H. Smith ............ Solari's ..,.............. A. G. Spalding Ee' Bros.. . . J. W. Stacey ..... ......... Standard Varnish Works ..,. . Stanford Auto Co. ....... . Stanford Hotel. ...... . . Star Theatrical Co.. . . Stanford Bookstore .... . Stanford Upholstery .... . Stanford Watch Shop ..,.. . Strassburger 9 Co. ...... . Charles K. Sumner .... . Sunset Press ......... . Sutro Eff' Co. ........,. . Schweitzer Ee' Co. ...... . . , Syrene Chapeaux Shop .... Tait's Inc. ......... . George H. Tay ....... . Technical Bookstore. . . . Thoits ............... Thompson's Bakery ..... H. S. Tittle ........, Tire Service Co. ......, . Traver's Surgical Co.. . . . Union Barber Shop ..... ........ Union Oil Co. ........... .... . University French Laundry Co.. . . VanfArsdale Harris Lumber Co.. . George Wagner ..... David H. Walker ......, May G. Walsh .......... . Walsh O'Connor Es? Co. ....,.. . . Walters Ea' Son, Inc ............... WellsfFargo Trust Es' Savings Bank .... Western Cooperage Co. ........ . WetherbyfKayser Shoe Co. ..... . Westinghouse Electric Co. .... . Wideman's ...... ......... Wilson's. ...... ........ . Wolf E? Co .... ........ Rudolph Wurlitzer Co.. . . . Page 416 450 471 460 472 470 449 447 459 463 468 467 459 467 43 1 414 456 461 421 461 431 480 402 405 455 455 459 414 479 446 423 449 456 412 449 448 430 473 457 432 445 466 458 454 449 415 455 479 444 423 471 455 460 447 423 448 406 429 474 438 465 410 461 448 412 479 467 ADVERTISING F OREWORD The advertisers in the following pages have here expressed their appreciation of the patronage of Stanford people. Believing that these jirms deserve the greatest measure of consideration from the student body because of their cofoperf ation in making this book possible, the .Quad suggests that they be rewarded by increased attention from the students. A Sweater ls A Sweater BUT TI-IE AWARD SWEATER IS A MASTER SUPERIGR VARSITY jAVEE Any one of the four Worthy to carry the Letter Wmnmg Athlete's school emblem Produced Exclusively By OLYMPIA KNITTING MILLS, Inc. Olympia Washmgton Manufacturers also of Www THE SEALSKIN OF SWIMMING APPAREL 401 Steinway and other pianos Duo Art reproducing pianos RadiosffRollsffRecords Band and orchestral instruments Moving picture equipment Sherman, Qlilay 85 Co. Stores in Forty Pacific Coast Cities-including 262, UNIVERSITY, PALO ALTO wE.u..THev oueum 35 up ANY manure Now lL!l llll KAPPA ALPHA The news that Nevers has been signed up to coach next year is the only silver lining in the gloomy cloud which hangs over Kappa Alpha. On bidding day this spring, there were frequent cries of Sister Anne, Sister Anne, do you see someone coming? which continued far, far into the night, but when day dawned again, the brothers were still alone with themselves and God, who apparently could offer no relief. The Kappa Alphas need young blood. It is indeed a pitiful sight to watch the doddering old men who live there now discussing their chances for next year. Their chances for next year are pretty slim, we fear. e 00 5 5522 The Chi Psis got away with their Pirate's Ball again last fall, but it's a good thing the Administraf tion doesn't know a lot of things we know about it, else they'd all walk the plank. Not a great deal of general interest has happened around here this year, if you get our meaning. Un' mistakable signs of a Chi Psi Dramatic Invasion may be observed by the tendency of the brothers to inf sert themselves into chorus parts on the slightest provocation, which makes them Boone companions. 402 Keep your family advised by Telephone! gvuousg SSJAGX rlzfcb 'F A 1? V 5 S 5 2 ap ' 5 fx ' 9 4412- g,Xf63. IEPHONES-A THE PACIFIC TELEPHCNE AND TELEGRAPH COMPANY 403 For Sheer Fun . . . a Party at the Palace Bright lights . . . perfect floors, music that's made for dancmg . . . all these await you. rj !I'1:QUq.! ,HA LT , 3 In ,V For your next party in town come to the Palace. I fl ll' J1!!nlll ilk Generations of Stanford Men have enjoyed a hosf 5 , pitality that 1S traditional. vlljjl nm .N xg vin, N ln 'u., -rf' ll -H' iff. XYMA1 l jill! ,fad ,Jr IM 1 Q N! X432 1 jj fu 'lj' , Tn, in Nur, Qi I, ,sr lnijilj i -g,.:,,, I in Tx' NIM! '1 g aw' 'Tx'--j!!!.!i!l fi il I claw T - .fl la H lf lf l!!Kl' ! !'! U! 3! '11L-ifunl 'G' I! - 2 M Yi!7ii1W: 'E!??l 113- tif, il it .1,,i!w'v!,,ijh Nw. -. . U ,M W ji- ' ing!-,jj ...lmjjgjj j j ffmw iy ijlil ,Alb ' --' ,L it f-' h 1 1-r Uv, -gpm,-b wa- T kv IZ . , l'l!'rF'g,i1j I-I ' lla 'A f 1 l. 1, 2 'I lk 'yyljlllljilj A N! My v-S as I r if I f' J f 8 Slim A X '!l!Wlgv?lN5 Ju ,, -.: 5 f We Palace Hotel SAN Fl?ANCISCOg CALIE ' I .Mana emeni' ' ? H0lYg'lg!VOHWOF1Hg ' SALLY Z F. C. Jaeger 6? Sons Master Florists 141 Powell Street San. Francisco Douglas 4945-6-7 , FLOWERS FOR ALL OCCASIONS THE STANFORD DAILY Dearest Bee: My dear, I've just been reading the CUtest COLLEGE newspaper! I could just turn over and BUTter BEETS at this point, I'm so TI-IRILLED with it..I mean I REally AM! It is called the Stanford Daily-can you bear it, my dear?-and is owned and PUBlished daily except Saturday and Sunday by the Associated STUdents -no less. And my DEAR! Can you BEAR it: that perfectly AWful Frank BAKER is EDITOR! And Claude CONN is business manager-I could curl up and die at this point but what can a poor girl like me DO, darling? And do you know this SWEET paper is a member of the United PRESS Associf ation, and that it receives their full NEWS services? I mean they ACtually DO! 404 Fine Homo-Furnishings 4 Intefior Tecorating wafj. SLQANE SUTTEIZ STREET HEAR GRANT AVE, SAN FRANCISCO 405 .warg CLOTHES EDXCL USIVSLT ffff 453 iPOSfT STREET .-f SASNQFYQANCISCO Near Post Siren Enlmncc Sl. Pivmcis Hoff! I TL iv TT I - T ' T' l Foster 599 Orem' if . fF'e?i9 .QA 1111 I G Candy as LL gift always portraying the dignity of the donor 'ff FOSTER E5 OREAR CITY OF PARIS 157 GRANT AVENUE ARCADE OF RUSS BUILDING FERRY BUILDING l l B. F. SCI-ILESINGER, OAKLAND 1 f I rl r ,T..,1r-, v vi , 7.1 Y. SIGMA ALPHA EPSILGN The S. A. Efs are competing with the Alpha Delts in pledging sophomores. The reason for this is that sophomores are apt to be more mature than freshmen and therefore better material-at least, that is their story. Necessity is the mother of inf vention. The most conspicuous feature of this house is the row of ashcans in back. Some day the University will move the S. A. E. house over to the corporaf tions yards Where it belongs. 406 H cfm X Wm ,, MVK, i J KK W M X Sf L ! x'5g N7ig f ,O M K H., yQg,N,k 1 f ', x .iff X VERY latest z erlbretatzon of the KNOX Idea rea rms the stamclmg ofqualzty as the soul 0 sgfle IN ATTIRE FOR M N AND APPAREL FOR WOMEN f 1, S op WKNQXA FIFTY ONE GRANT AVENUE ,f fp A - 4 V .2 1 X 'W R ff 'I MW ' R ' Q ' , 1' P, TAY, 'x X 2 X 'W - '- uiwvonx A 1 ' I , nib fx ' --Q ' .Y-W? ' .Az V 1 ' V 1 ,A ff- J? . ' 3 l if , 'i fd X' WIT, 1 YJ-, X 131. 1: ' 4: fu My -,1 , Q, 4- , iw J 5 I . N y 1 1. 1 . 4 -f x X. L4 4: fl O '. ' is t'.Q 'n I -O Fl , gy.. , Q 'V' K ' X , O ' - My X ' . X' 5 .. K X' vii-'fri xx X6 3 'j 55? 7 in ' N 5 f WH -as 'za' 1 ' 'f f Y NNW' X ' 'v-oYw! ' . ldv 1.- f y,,f? 'X ,,, ' fa, f ' 4l .4 A H if V iff! xlxsff . , I '5 X3 .L?ff:xIN 5 ,V rf' 'nfl X' ' X , :hge-Q? II' 'A i :I - - xx ' 2'- U . . ' 'f- ' E 1 E'T ' 23? M552 i'- ., if Nw X xi X WQ1.. . , I... 'Q' xv ,X ' J .' AN' 1- ,, , ,, ,.. . X xx RQQ :Vw wlmgt! 1. n u RIN ,, 1 f 1 x f f, , wa Q A X .' 1'7 ,f 3 'X ' ' 11' 'E kk I fl E 'lf - 1' kg' J X Rf VN AVQYX- 3 Na WT fm V I' 3 X , 5:' H' '5 J xkvlwv, l 9 ' . I mx X J! A I 5 X ' I 'Ya-9 A 1-X, ff -Q R , V-H, 1 Q in -A . In - Q HAH. Kami!! . l I 4. Q 1,-W . 3 X y V b xi -5 l I If iflf ' n 0 E 407 Leading Models of the Selectlmporraticnslsytheonrf famous Nettleton Shoes standing English Craftsmen ff . .nu x x ' X -zgg-. ,vs 6 O 0' Y . xl N lix x ssl... .,eN. o o l ' IFE ts sweet when you fmd youre self in the shoes of 0 the great Champions. Only be sure those SPORTOCASINS have been expertly jltted to your pet feet by BOOKER PETERMANN 0 THE SMARTEST EXCLUSIVE GENTLEMAN,S BOOT SHOP IN SAN FRANCISCO UNION SQUARE AT POST STREET FORMAL SHOES RIDING BOOTS SLIPPERS lj ll 4 l Y! l l. iv r I l i li M -l BETA THETA PI The Betas have always been a quiet, conservative group of blue blooded aristocrats, but they have ex' hibited a tendency of late to attract the white and searching light of publicity. The little electric brougham with the sweeping lines was so obviously imported to command attention that it hardly de- serves mention. And then the chicken episode-a masterpiece of fowl play. The Betas are vying with the Alpha Delts for space in the San Francisco newspapers, and at the present time the odds are even with plenty of money in sight. They are teaching all their pledges the pathetic poem by Wordsworth, Now We Are Seven. -1 SPOT Ll GHT 1 ZETA PSI If you don't think we have a good house, and we don't see how you could think of such a thing for even a moment, just look at our alumni, the prolific scalawags! Of course, confidentially, we're proud of them and their wealth and prestige and all that, but we do wish they wOuldn't have quite so many off' spring all of a sudden. Legacies are all right, now-we haven't a thing against them-but then you know how it is in rush' ing. The nuggets will hold out against the paidfup securities. Anyhow, we're still in the spotlight, thanks to Al Cass, even if he doesn't get over so big with cer' tain high school authorities in the south. l ll il l i , ,. l T, Wil W. il ll ll' li l ll i, l l l f l ll Il sl ll 1 l. El I, 3 l 408 ,Sits-, , if ,.. VWQ1 F a I Nos 1 uttocis stbloivts Coq, San Francisco and Los Angeles Custom Tailors Custom Sliirtmalkers - Custom Cravatmakers , llmporters Of FABRICS, READY'TO'WEAR CLOTHES HATS, LUGGAGE ea HABERDASHERY NVITES the patronage of gentlemen Whose Professional and social activities call for utf most correctness of taste, an individuality of style, and the quiet evidence of refined quality in all Personal attire. Range of prices of any article will be sent in answer to an inquiry addressed 340 Post Street, San Francisco, Calif. 409 I.Magnin E99 Co GRANT AVE. AT GEARY Correct Apparel and Accessories for the College Woman GNN? ALSO SHO PS AT Los Angeles: The Ambassador Hotel Hollywood: 6340 Hollywood Boulevard Pasadena The Maryland Hotel Santa Barbara 1 3 1 5 Estado Montecito Hotel Biltmore Coronado Hotel Del Coronado Del M onte Hotel Del Monte Seattle, Washivigton Fifth Avenue at Union l l THE Joi-ms RPHY ' GSI-ICE T H E H I G H L A N D - L WETHERBYKAYSER MEN'S SHOP 536 WEST SIXTH STREET LOS ANGELES Also Shopsfff HOLLYWOOD PASADENA SAN DIEGO IW? J hlf '1 THE LIT To the casual observer, the office of the Lit looks like a combination Juarez gambling den and an Old Gold advertisement. The inmates of this den of iniquity While away their time blindfolded, smoking innumerable cigarettes, and trying to guess the different brands. Wheli this sport becomes irksome, they publish a magazine or scrape out another wood' cut. Every member of the staff has at some time or other tried a frontispiece, and the efforts have invariably gone in. Not long ago a critic on the Lit staff was reprif manded for using the word fair in place of Made' quatef' 10 l T 'C l l Eggllglillll SEQUGIA HALL Sequoia is the campus eyesore, ranking just below the Corporation Yards and just above the pest house. It used to be Roble Hall, but the Adminisf tration Woke up just in time and turned it into what it is today, whatever that is. The earthquake helped, but not much. A great many freshmen go to live in Sequoia when they become sophomores. The atmosphere is the same. lj 1 , l ll l A SOMETIMES EVEN SOCRATES would he pressed to know whether it's the Clothes or the Mau. Good impressions have a habit of registering, just UNSURPASSED LUXURY on The Qcreation 'Route to New York 'via Tamzma Canal and Havana WSW THE NEW S. S. Cvzlwrnioz LARGEST STEAMER EVER BUILT UNDER THE AMERICAN FLAG Every room an outside room, many with private bath. Elegant lpublic rooms. Two open air, built-in dec swimming pools. Children's playroom. Gymnasium. Decks of unusual width with every provision for outdoor recreation. 32,450 tons displace- ment,601 feet long, 80 feet wide. Operating regularly with the comfortable homelike steamers Mmzrlalzrifz and Mongolia in a semi- monthly service. Carrying First Cabin and Tourist passengers. QWGD Around and Across America One IWW Wlflter- One lwzy Rail the same. A vacation trip without an equal. Sixteen days aboard ship and return across the Con- ds tinent, visiting points of interest enroute. ' ' Q 1 Q L 515 'Tl'?JlZ .E'27ES Panama Pacific Line INTERNATIONAL MERCANTILE MARINE COMPANY 460 Market Street, San Francisco 510 South Spring Street, Los Angeles or your local Railway or Steamship Agent lfif- 'xg,gigeeifiifze 4 ' Af i355 lg,-is ,--V , -P A-:Z-tiif T54 ff . ., f W ilson s at the Bellevue R1 ,f Pg P, P ,f Pg Pg Pg Pg P Geary and Taylor, San Francisco V ' l Graduates: The Ninth and newest of M 'Yoo know the kind of the Wilson confectionery p service we have rendered stores. Restaurant,Candy, l h 'l la th . i w 1 6 you wel? We O71 .C Soda Fountin. W onderful campus. This service rs p .tall available after you Banquet Accommodations. leave the University. A , letter always brings a ' 1:3 ', prompt answer. ll .I The Stanford ' p . 9 Bookstore , J n P 'mr 0 cANnY wire A QEDUCA I f R 3 3 R I R 3 PALO ALTO f SAN Jost f Pusno 1 SAN DIEGO f srocxron P I I J 'V I I I I SACRAMENTO p 333 Geary Street, 708 Clement Street f p and Hotel Bellevue, SAN FRANCISCO l .--git ra, We it em. -eff-ll A. ,,7,,,ALL LL:-it -21.1 ,Y V Y gi- -. - - . ji Y ,Ye l. l ev' ' 3 5 5 N L0 x ,U P i 5 S UMW ' 9 Ana H17 . E lj ' L 0 ii KAPPA KAPPA GAMMA DELTA TAU DELTA Wheii the girls can't attract attention in any Aside from the filet that laundry Wagons and li' Other WHY, they have a fire and then rush out ofthe freshmen never can find this house, the Delts have hOUSC,fhCiF1'10SCS U9iltlYP0WdC1'Cd,tO greet the YUCU several other claims to notoriety. Bud Spencer is who have assembled from miles HfOUnd in hOpe of continually making records and Bob King is continue l something better. ally breaking them, and the Delts are liable to tell I In rushing season this year, they got the Cream about them oo the slightest provocation. It is not separator out of the moth balls where it had lane l hard to see Why the house rung to track, for the guished for two years and saved themselves just in amount of energy expended in elimbing up to it, if time- HOW they did if is 21 IUYS'fCfY to CVCFYOUC, put to useful purposes, would probably cause a lot iI1CludiHg the KH.pPZ1S. of damage, r When the carpenters repaired the roof this sum' New that the Whgle hguse has left for the I mer, they made some interesting discoveries, but I. C. 4A., we wonder who will be there to tend the i that is another story, and a doggone good one, too. red and green lights that distinguish the house from y its next door neighbor. V 1 V -Y 11 ff' - Y + V - -A -+- 1 f ln ' ,ff i 2- A 74 1,,i : 1 ,2 'l!L3' Y 412 Q ,Xi 2LfQf':-1 ,. if QI: 5 gfffk' uf 3 . C 'YXX A6 L , 1... we , when in os Hnqelef Dance at Wmbdssa def Cocoanut Grove fo the Entrancirgg 'Wfusic of the Cworld gamous COCOANUT QROVE Grcbestra GUS EARNHEIM, Qirector' SPECIAL 'NIGHT COLLEGE 'NIGHTS with Gontest every Friday TEA fDANcsEs ever:-y Saturday at 4-:OO in the 100 Q Piesta'Roonf1.,Tea Service 351.25 A QD l - Ypx X 'I ,, ' N' 1 X Q - Q, N 413 Stead Excellence San jfnmtfisrn Qlljmnwle L L71 w ,am-N.4 Nasa..- 'ff' fp? A, H. Wx .:5:,, V., :ij J AM'W Ii oull Sirlke . I i g Q sa? the Athlehc Equlpmenihu Wan Jael., ,MN Q San Francisco Stores in All Principal Cities l 'll PHI DELTA THETA Always gluttons for publicity of any kind, the Phi Delts actually advertised the names of their star pledges in the papers this year. They still refuse to pledge a man who can't swim or run or jump or something, though they are not utterly exclusive. This spring the Phi Delt house, after a long and honorable career of bearing up under the roughest kind of treatment, underwent some renovations. The reform movement spread to the brothers, who immediately tried out for dramatics and all sorts of other harmless activities. The Phi Delts believe in a wellfrounded house, but the old adage about the silk purse is as true as ever. 1 P-r 's'-'W l l f Keep in Touch with the TOYON HALL The network of political wires in this building is simply appalling. Moreover, there is a ticker tape machine in every room to give the results of elecf tions, and to tell how things are swinging in each district of the hall during primaries. The inmates lounge around in open vests, and plug hats, smoking big black cigars, and if you ask any one of them who is going to be the next student body president he will wink mysteriously, and point modestly to him' self. Toyon is a better place to live than Sequoia, but it has its disadvantages-about 250 of them. PALO ALTO BOOK SHOP 158 University Avenue Palo Alto ------- California Everything in Books Anything in Stationery ah- -.-. F K,-.wx wq.. l ,ff - l :atlas L - ,RS 4? . Al' e srl -mix 1 .. , , :QQ Ee A?-li 1 ...Qi FL iw ill 'la lieth-ilugfva E' J .ME fs 5-'M-fx, ' lv 1 A LF. ,f ' i r' ,- E, H' -viii , 4 Q: I if 1 1? A AS. 4 -F ' . E 'it' ai, ---' 5 L. XI- . i ,WFW EFL E 1 X1 MVN 'f' -22 RFQ :N-'lffgfiitl . it if , ,rs . i 'sry-.f f- - WX:-. 1111? fi.-ass:,,z:51u,f 54.914 .S '--- il- aGhUPGvbHZ-XGYSLSYYIBQKELG-nlslvxvvlkltb 'P' J w 299' film J mf Yu .lust Like Folks---Shoe Stores Differ Did you ever see two people exactly alike? Never. There's always some difference-appearance, habits, character. Shoe stores dijfer, too. Some go after quick wealth, by any means. Others builcl for honorable reputation ancl permanent growth. Some sell Bargains, Others sell-Service-Style-Quality. There's Something Different about this store. Modesty compels us to soft petal. But there must be something about our methods that brings so many folks back here, time and again-for their shoes! SHO. I 415 BLAKE E8 AMBER Costumers Including NORMAN'S INC. 1 f 'f Y Serving THE PRINCIPAL SCHOOLS 1 CLUBS 1 AND DRAMATIC ORGANIZATIONS IN NORTHERN CALIFORNIA 'ffff M aiu Display Rooms WILSON BUILDING, 973 MARKET STREET, BET. 5TH E59 6TH PHONE DOUGLAS 400 - i.. ,W 77, ,-,,,, ,il -A SAT IT WITH FLOWERS Pelicno-Rossi Floral Co. ANGELO T. ROSSI, PRESIDENT PHONE DOUGLAS 426 123 KEARNY ST. CHAPPIE Chappie is made up of puns and twofline jokes. The editor is never at a loss for illustrations for the latter, either. The little rascal has tons and tons of extinct cuts of two people, one for each line, and he simply runs them one after another, using new jokes whenever possible. For instance: Give me a sentence using the word 'asterisk'. A soldier asterisk his life for his country. 416 CALIFORNIA PINE BOX DISTRIBUTORS CROCKER FIRST NATIONAL BANK BUILDING SAN FRANCISCO, CALIFORNIA 1111 We Manufacture and Distribute California White Pine Boxes Crating and Car Strips 1111 Standard Production and prompt delivery guaranteed either direct from our factories or through our BRANCH SERVICE WAREHOUSES: SACRAMENTO SAN JOSE WATSONVILLE Los ANGELES FRESNO TURLOCK SALINAS BRAWLEY EL CENTRO MODESTO LODI SALINAS SANTA MARIA SANTA ROSA No order too large or too small to 'receive our prompt and careful attention a Train or Wagonload Annual Shook Capacity 300,000,000 feet WE WILL BE PLEASED TO RECEIVE YOUR INQUIRIES ' C. R. WISDOM, General Manager 417 im LT T' Y T V-Tm T I T l I 4 I X HUToH1NsoN oo. ,A A Q , A arisen '2 2 L Street Improvements ' 1 :Aged N TI-IETA DELTA CHI This house is making a valiant effort to struggle CRUSHED BLUE ROCK I back, what with tea parties at the Plaza and pledgf ing student managers, but even its newlyfacquired I 059 I upperclassmen have been of little aid. They lost two men to the Phi Sigs this year, we are told, and had ' some difficulty rushing against the A. K. L. s. 1706 Broadway Otherwise they are doing well, thank you, and the scholastic and moral conditions of the house are CAKT-AND, CALIFORNIA better than ever before, which has lifted a great I load off the Administrations mind, if we may call it that. Gsm Some of the brothers have taken to living outside the house for reasons best known to themselves, and others have taken up aviation, in a vain effort, l ' bl , ' f ' ' ll. We Sell Street Improvement Bonds V pm M Y to get away mmm cl I C. C. MOORE Sr CO. ENGINEERS CONTRACTORS FOR COMPLETE PLANTS HIGH GRADE MACHINERY Babcock E99 Wilcox stationary and marine water tube boilers Foster Wheeler Corporation, condensmg machinery, evaporators, air pumps Corliss high speed and poppet valve engines Cochrane feed water metering heaters Lagonda automatic boiler stop valves Moore automatic fuel oil regulators Babcock EG? Wilcox superheaters Cochrane feed water softeners Copes feed water regulators Cochrane feed water heaters Cochrane steam separators Green fuel economizers Diamond soot blowers Lagonda tube cleaners Leslie reducing valves Hamilton compressors Reliance Water Columns And All Power Plant Auxiliaries Address our nearest office for catalogs and complete information HOME Orifice: SAN FRANCISCO, SHELDON BLDG. Los Angeles,fCentral Building Phoenix, Heard Building New York City, Hudson Seattle, L. C. Smith Building Portland, Casco Building Terminal Building Salt Lake City, Kearns Building Vancouver, B. C., Standard Honolulu, T. H. Bank Building 418 Q Coufrtebu-s Serfvice ,., . . . Quality Products . . The sign of the fourfleaf clover is your guide to better motor performance through better motor products-PanfAm Motor Oils-PanfAm Motor Greases-The PanfAn1 Motor Cleaning Machine-and The New GREEN P N-BAE ?3anJm Oils andGreases PM E010 D- . r 0 5 r Q- 9 'ULE9 PAN AMERICAN PETRCLEUM CCMPANY 9 THE CRAVAT HOP ec tie op Here you may End the unusual, as we Make Ties to Grder You can make your selection from our large stock of imported silks, or find just the Tie you have been looking for 1 1 among the many Ties all made up. No extra charge for Ties made to order. i Our Ties are guaranteed not to stretch or pull out of shape i All Ties purchased here are kept cleaned, pressed and repaired free of charge We welcome visitors PRICES 352.00 to 356.00 622 Shreve Bldg., 210 Post Street, Corner Grant Ave. Tel. Garfield 6985 SAN FRANCISCO, CALIF. PLEASE RIN Q ov I s mast' ROBLE HALL Roble contains the overflow from the sororities. Inside its sheltered walls the sweet young cofeds are protected from all the pitfalls of campus life. Time was when a man in quest of his zaney could merely walk into the Hall and ask for her, but the everfwatchful powers that be have installed a sign which warns the visitor to ring before entering. Us y -1 suivluumllmulwllm O -0 E, E U rn r+ '-l be W De to an be rn to 2 L-' O Z as-raft ,-,fb I L-':'rCf',-ijt'-D '-HQ r-Q,-, 5.5122 ag' Z 'NETH- '3' '10,-.v-1 .-52.0-5-'D grow' can '?5j.8sDg SS-EQ Z1'f:H'D 53.g-D '5-fvOnJ'-15.g- cg 338111 2 moo-snow O5 'Of '- N 53+-. Gr-rom D Sages. gmrv DD' g: gf-mf-'ln rf'UD- U. O ess a Q we m5 cn0.I OD Pofvmm Eg D ,Uv-I-ga-.gm P--0539-'Q..f E2'. nu, UQ UQRNQ-SUN We D'Of-if--K4 rf O33 SHUT G q-rm:-mm U, 9736, r fg B-9,,...-.Wi .. We-f,-v-xml When they install an automatic burglar alarm and fit the windows with iron bars, their equipment will be complete. 'DU 2 S-rv :- Q7T'Tv-. .-.rvsego Emo? I5-235' -55282 air? 5w8 E-50 e' m ..., sa? ENQQT 0193. fo: C-' 'U QS ,T-it '19-N S-'A SDC 3,2- E-E' :QQ mn 5? n l l CN . --HR' ,.,,g.1yx':f'.: ifgjve3 -3 1 fb Ou'rFi-rre rs to women 1 5 ' ll: 520530 Remom sms' 1 . ...W5 II Eg' ning,-:' U . e -ll! -2 a -Palo AI16, Cal :forma 420 .eff 72 2,fi'Zff,-s ff f ,af . .ff ..., . i . , ff ,. :.s af. .eq-Q. , ,-'Rv -Q. 1--HX -- P-- f ,. , 5? '-45-5-iw ,3 - '44 sgsimc-, s. jyfwf, -1 -'L M f fi L sw -1, - f 'fmsffs-X 3.3 ' 1'-we-. ' ' 'ffl'-H..e-fx. tw-, -2-IA.-'J-' -' '9t : sa:'1- ss If ff A .f -. if .N ik f sf'-is . '21 Ts'f ,.-F Q61ff-y.'1'Z.'-:Qt-f: ,'i' .Las A . m g: :gf -wg-V -,3.jw- -f if '- . aw Q-.ii 4-:,:5i:2 'xy Y- 4 - 41,-A 1-1, ap.-,v,,,..,.-5-t,vr5.,.:. fx?.e.:Qbv iff. 4 :af ,- ' ,i '.: 'I,.-'- g.ii'f,1f- 'L'f-IL 1 if l'.':2,,57'-hm -Q -b.l.i.3 3., Q: I Lie! - 'ids-A-ig 1' .Q,,:.i'Mi'1:1,...-Q,f,5,3,Q:',4-M-.:g.:11g - sh .-j,.ff:. '- is 3: ' . Hx! -hl'5f:g62y1.0514:.2..JiJ,l.'QkgIQ.:' -- 3,qd.f :,3,,v...f. Q. .' by ,-hs., N J- '- fc-was -if 1 f .A-4,-.izl--Lrg, i.,,,.3 1-, H, .,?45.-,Y . - - A ,fig-I., pg.,- 5 ,, ' XG-fi, '?-A '12-r'I ' E1 '52,-Qktr'-. ' J Miki? 1 1 f ?L' QMFY f'-914:-. 'l 'ffrul z A .- 1-, 'H ' f -P55-i1f3'ai' JJ -. hrvbf. 'T-'5. -'Qi-i13E'Qf- so , . ' AJS JA' 5 1' 7811. , a 1i.' 1,5- :.F11'2' -' T ii' , . fi - . .ii-is 1 N .. W4 1 r -N . .. gh. - -Iii, jZ,'i,,'7f.i13,- 'firm T.I'L .::w- .--if ill' '. .kr - -,ge-., -' -Jzgw-galgmggfgia .,v,1.1',. . -'bmjw' 11.2, 4.151 254-.1 ,gh .1 5 I .V .55 H3111 ., ' -1 -QF-3' my ' . - H :-,.l'1'H- 3 L ,tif--i- rfX.l,,d: 17 4723 'IV LI .Tahari Q ,-,gf f MYJQR 1. MV ,tn-, - .iv .W AM Y, nywi. 52833: -'neigf-'-X, A f . ' V fell-2f:. - . ' '- -'sugar I, 'Y 'ff 'S 'iff gEys1l+.:s-f. f if 1 l lf?-:f 'II - gif .: ' -' K Ssfxsfgw .L -- rg-t, s , ' --'-. ,- - - . .' Y A .' :ff 'flllili ffl' ww- - ' X 3 . -'+,fr'f7' ' 14: ff.-1. 7 ,51 69? . . .a .n,. ,lf1r,.i.1,iQ .q..g- ,r. ., , . . t.. . in-1 ,, 1.,m- Y Jul, -1 vi.- - Vi .df ilk., LJ. , 4- in-1 , ' rn. ,ff , K ,325 x: 7-, ,fur E1 'EW gf. , i .diggs '-1-.IV :gf i-Iggy num I, 54.55 - .mpg rr? .1 Iv 5 IFGTYHWI, jaw? 1 v'-- .r- -iff 4 ' w. L, i 1 rf - . 'NX -1:1 7' 'def-' P Lswagiik . . - - :qui ,.. 3i.:5,,ii-. I ' 7 ..,:24:.. Q-1 ,, Axes, ' --1: - - , - I-f 1 4' 2, . .,. .- 1 -- -we ' 5:4 if 115- fd :fo - ' .fi 1 --in 5-I -. aw- 'I-Q.: I .L 4' , Q.: .- 'mt .- KU-ei 'avg-an F 'z'-'af' 'ii' gt'z'f'- ,, .' . fri fi 'l Wy ' A-sv .-qi, 54 -' .4-,ei pi H x-, -A - - :f1s, .', s-,.. '- :. .- J- 1- r M r' 'X - . '-IJ. 7. fx- , lf Ll.. -3 8' .5522 '. X. -, ,... ,. '- 'FW ,sl 5-.If'l'.l, .. 9 . , 4 'N' J ,sf-lf' ' '-wr'-1-W ru. -!,f..:- . M .1 e Q2-sc' -fr ,. 2--. CA'. i..-: : - I 'Iwi 'W .- . lr. 'Q - ' 242:--', Y, . '- fnff., - - -'I 1 X' Lx' '4 I 5 J-',.-4. HT, ,,4.F-s5., ,4kx -my fl. if '-- .Y ' Q l I. j:.,, ' 5. Qlydg - . ., ' fl' I n Q-'T f a re ECE mf512i!'.l' -slS2'iis:.asasg-gg 7 .?s Qfg:.,-21 'y4 'Q . EE F, - , ,Q- , E53-Q.- fgl-K. ' I' Ha- 1 'L 'L--el ffirl' ?1f - i +-f-eff-V - , ' .L-5' -A' '- f-':T 'f' ..: A. -4571 . T ' -1 1 .- - '-'1.5 ' I jig? p f -A is gif? 1 ?7,,. v -I . Q ---QT QZX -.H firm.- -, .4,. . -. . D., P., -1-., -,g...'f ' '--L 557 - Q .f.f Q45 gf? ' - :iii ' L' SBNTD757-9 -lun frlj' -f -1 k, H TQ1f g.5 k Smnlfhglm CAL There is nothing which has yet been contrived by man, by which so much happiness is produced as by a good Inn. -SAM1L JOHNSON. 1111 Conveniently located on the Coast Highway midway between San Francisco and Los Angeles is this hospitable Inn with its luxuriant Spanish atmosphere. Every room with bath. AN INN OP DISTINCTION FOR THE DISCRIMINATING TRAVELLER 1111 NN S A R I FRANK J. MQCOY, Manager SANTA MARIA, CALIFORNIA 421 XTE ' NITROUS OXIDE n ETHYLENE SE AS . - Paooucis ' - Certijied Analysis EM Certified Weight OXYGEN CERTIFIED LABORATORY PRODUCTS 1379 Folsom Street, SAN FRANCISCO ISO3 Gardena Avenue, GLENDALE Cyclops Iron Works Established 1873 Manufacturers of Ice and Refrigeration Machinery Over 1400 Plants Operating in California Automatic and Manual Controlled Y Y Cranes Electric and Hand Controlled All Types and Capacities Write for Information 1 1 MAIN OFFICE AND WORKS 837 Folsom St. San Francisco, Cal. Patfronize Western Industries B -E K 3 NUDE S Zepgi GAMMA PHI BETA The campus was recently electrified by the appearance of a bevy of Gamma Phi arnazons with unclad limbs. It was a noble gesture toward recogf nition and economy, but for obvious reasons the scheme did not Work. Perhaps it Was an unconscious result of the chorus training that every Gamma Phi must endure before she is privileged to join the select few who have served their time as ponies. THE T. J. CARDOZA COMPANY MANUFACTURING STATIONERS Paper Rulers 6? Bookbinders ' ' School Supplies 455 MISSSION STREET SAN FRANCISCO 422 COAL and WOOD We have served the campus for 29 years Phone DOUGLAS 2269 Erbe Uniform Mfg. Co. Manufacturers of UNIFORMS Palo Alto Feed SL Fuel Company SAN FRANCISCO' CAL- 122 HAMILTON! PALO ALTO BAND Factory and Salesvooni UNIEORMS 149 NEW MONTGOMERY ST. Telephone A SPECIALTY ONE BLOCK SOUTH OF PALACE HOTEL How ABOUT 7 Youfl. FAM icy ? t DELTA GAMMA Time was when the. Delta Gammas held per' GEORGE WAGNER petual open house for the Phi Delts but now the Bulldlng only time the boys approach the .house is when ClO'l'lSf'Y'LlCflO'Yl they play baseball on the front lawn. Such popuf larity must be deserved. The girls are delving into politics with some suc- 181 Sguth Park San Ffanciscg cess, not mentioning any names and in order to keep the ancestral backing of the house impeccable, they very carefully investigate the pedigree of each pro' spective sister. Some day a prospective sister is going to do a little investigating in return, and then there ought to be fun! Stanford THERAPEUTIC LAMPS ABDOMINAL SUPPORTERS MEDICAL APPARATUS ELASTIC STOCKINGS ROGER ROBERTS Exide Batteries Goodyear Tires S C CO Open All Day-All Night 24fHour Tow Service ' BUICK SALES AND SERVICE OFFICIAL A-A-A Surgical lnstfruments and Hospital Supplies 511 Alma St., Palo Alto Telephones Palo Alto 77 and 78 1 1 1 372674 SUTTER STREET 435 19TH STREET SAN FRANCISCO OAKLAND ThLgt dMrCo lt1E' dG dSh , ' e ar es an OS on 552 lasnlnsgllilppe Mage an Op California s Leading Surgical Supply House 423 EARLE no Grocers Known as the House of QUALITY, PROGRESS and ACCOMMODATION Our Prices Are Right A Complete Line of DOMESTIC AND IMPORTED WooLENs GUSTAV KROGH Merchant Tailor Repairing-Cleaning-Pressing MASONIC TEMPLE BLDG. PALO ALTO, CALIF. 537 Emerson St' PALO ALTO' CAMP' if FB EH S r ., S. - 0 .III Nc 6 5:52 SIGMA CHI ALPHA PHI In extrafcurricular activities the boys certainly shone, as all of them were out for this and that last quarter. And then what did they do but step into the old homestead, dust off the twins, and pin the family escutcheon on a number of fine, sleek freshf men. What with Ed Walker coming back to coach, Fall in the air, and pledges who part their names in the middle, the fellows should be able to make more hay while the sun shines. It might be well to remind them that the West is wild no longer. Also it is rather silly to acquire a brand, new roof and then have it go to waste. The Administration has been trying for some time to abolish Greekfletter societies, and has finally won over the first sorority to the cause. The Alpha Phis are voluntarily committing suicide by refusing to take in new members. They still have one of the biggest musical comedy stars on the campus, howf ever, so they can't go wrong for a couple of years yet. Then, there is a song that is sung about them. It goes like this: The girl of my dreams went and told both the deans- She's the sweetheart of Sigma Chi . Telephones: SUTTER 936937 G av Facotory: 3271529 IVIINNA STREET Manufacturers FRENCH RANGES AND BROILERS Coffee Urns, Dish Heaters, Portable Gas Bake Ovens COMPLETE KITCHEN AND BAKERY OUTFITS Office and Salesroo-rn: 8531855 Mission Street Between Fourth and Fifth Streets, San Francisco, Calif. GORMAN METAL CO. Manufacturers of ' TYPE METAL ALLOYS FOR PRINTERS AND NEWSPAPERS 785 BRYANT STREET SAN FRANCISCO, CALIF. 424 I. , ru ,,,, . 'l' H1 H Send If Where clothes snowy white reflect methods right CONSOLIDATED LAUNDRY COMPANY Phone Ballard Q0 RED STAR LAUNDRY COMPANY Phone Ballard 69 STANFORD LAUNDRY COMPANY Phone Palo Alto 2340 TEMPLE LAUNDRY COMPANY Phone Ballard IZQ TROY LAUNDRY COMPANY Phone Ballard 8Ql QJVE Compliments of the Laundryowners' Club of Santa Clara. County 425 Rmarms Caruisniim. Louis Orr s famous etching for which li: was accorded the Legion of Honor etching of Pont Neuf Paris. LOUIS ORR The American Etclfzefr of Paris To Make a Folio of Etclrings of Stanjhrd University ouis Orr, the American etcher of Paris, has been invited to make a folio of etchings of Stanford University similar to his etchings of Williams College and Yale University. The Stanford University folio will be patterned after Mr. Crr's famous set of Old Paris which suggested the Williams folio. The folio will consist of six etchings, each approximately eight by ten inches, with a decorative title' page and index plate, each signed by the artist. The folios will be limited to an edition of 150 and when these have been made the plates will be def stroyed, thereby enhancing the value of the etchings. Mr. Orr has already visited Stanford and made his preliminary drawings from which he will etch the plates in his Paris studio. Louis Orr is the foremost American Etcher in Europe and the only American artist whose work is in the Louvre. He has three times been commissioned by the French Government to do important work and for his beautiful triptych of Rheims Cathedral, sketched during the war while under fire, he was awarded the coveted Legion of Honor. Mr. Orr is also represented in the permanent collection of the Luxembourg Galleries by 33 of his original drawings. The Louvre has very recently purchased the original plate of Mr. Orr's wellfknown Abside of Notre Dame to add to its collection of original coppers which already included his celebrated w The subscription price for the complete folio will be Sroo, and subscriptions may be sent to M Edward H. Ma-rsh, 422 Besse Building, Spfingjield, Mass., representing Mr. Orr in America. l -' T TT: TT il ' ' T ?T 'V I 1 S GXACKAC R G A3 tif.-si: i rs KAPPA ALPHA THETA THE UNION The girls have worked hard this year to prove that virtue is its only reward. That is about all they have proved, although Women's Council, an old Theta custom, meets regularly in front of the firef place and, believing that chastisement begins at home, practices on the sisters. The usual line of picnics is being offered this year. This is all right, but when better picnics are given, it will be a good idea. The Union is the limbo of the forgotten heroes. It is infested with exfstudent body presidents, ex' editors, and eccentrics. Here, also, live the graduf ates from other universities who flock here with the mistaken idea that Stanford has a law school almost as good as Harvard's. After spending three years vainly trying to subfdivide Blackacre, they sud' denly realize the futility of it all and emigrate to Hastings. l T in-0 A l 426 ' i iriri'f1 iiff A W i -inf. i ' it l r e f ' Heier' V W .' -uw. .lf-'f1,.ln., ,,'v, .3:,.f.,Q 5'-'egg px! -' U, sw '- 'gn --.QS yi 1' , ' ff', , 5'2. qf' . peg Q-, n is-.:. I'd,.3Q1v,?x.5gi3,!Q'Uirg.i-i .' ,.. r , i mma, 4 N Z .. 'f ' J e- 54. , ,,,, KX- A I. I I xx' xr i - ' ,tv r ,N 4, Q ' -- '11 53' hv fix if ' l l at 1 ' 'Mi 1, gs l l is-:fi ii-'15' v-v-0'--28:-qv sf. 5 j,1TA ff , jj' 1. , 12 . 'rf Q, -A - , ',' , ... GAEFFY A , fLi ,i.?- I. gf ' L 1' 'f' 'K'-f fg 1g55,, V i 3. f 5' 1, , ,f s f Q i 'M' f ' ' or f sf W ' ' 44 -ls ww L r mee L ,, , I fLIfe Policy.-5 and I0 year paymentsj --- -3-1 , --. WA- 11111111011 nf April. 1868. ! ' l l ' M 4 ., U? . Q5 .QF 'f ,. . .. .. . i ' 'share f of Ellneuvenee -- W' eta' - 1- 1 i 1 Y, . .dlrmzal 5 ' - Y: by . 1 KL' :A .ul that fLfH!13P5ACII'IC QSKFSUTUAI. 'SHE 'QIONSURANCZZ QQOMPAHY or Wrcrllirzllz, E ' Y Y' R' gQ'AI.1f'0RN1A, in eortsizluf-z1t1'on. of the representatiorts made to them in the 1 6? 70 ' . czpfrlir.-afinlr tltr-f'efo1'.r1nui of tltf' .su-nt of,QjllV . . --- M . Lfrfgaill-eff dollars and. ,dkwflag ' f' , 9 rfrfrrfs, Iazrjlll C704-N Of tlto United States, first in hand paid by fuzz Jfffffe' A-,wzflgrlf-, Mfg, ' K ' . fi J ' .fklfda ref ,E-Lflrzmz rfeeff' the assurzvt under this Policy, and alt loafrts a71.ctintere.st made upon this if ' ' ' ,Q Policy at any time. and of the n annual payment of ,lfzf 'ali 1 if it f .qi ,. ff. ,o t 5.11-,,..Qf,,'?f,2 ,,,,gf,1!'L -.Z!:'Ll440QfZi 124244 . we dollars and KZYZZA- lfff x 1 - f rf 5 1'L'llf-Y, in, like I 6900721 , to be paid our or before tl:-q,..4l!fl'cZfly of X245 :type .qi . J, 7' X I A lj'9f,,52-4,3 V ru every year lllbflllrg tho term of i. .ilflflf years front the dale of thus' Q Policy, at the office of'-.saict Company 'ini the City of Sacramento, Slate of ' - - -' Mi' California, or to their Agents, as ltereimzftcz' provided, Q .....f.cDo SIISUUG the life of...-..........i.. ,il e1,ar1O girazifopzidt ojj2'jZCf2lL77L0fL5 in the County of .- 'fL62 7ZZ7'f3f. cuzcZState offfalfdgez-1feedf'Ib1't1te sole use Of-rtlirt 16011492-Z7 l ' T VI -in the amount of Lgf7fy' f1fJf0l'Zf!Z ., I f' forthe term, oflvffl natural life. f m.. 31111 the szud ilauiit jlinfunl llrife llnssurnurr Qyunipung do herrhg rumuae illlll glitlg to pay the amount of bla: said Ittsurance at their office in the l Citylof Sacramento, in lawful ff90'f7fQQ?6'4e7-QV! f7'!!ze lvzitcct ,States t0 ' 1 the said ' 6M1!'J',jZ!!.fLKf ,. . ' W'hen Leland Stanford organized and became the first president of the Pacifc Mutual Life Insurance Company he applied for and received Policy Number 1 for SI0,000. That was on May 9, 1868. Twenty'-five years later, during the eventful panic of 1893, Mr. Stanford died and Leland Stanford, jr., University faced the most discouraging condition of its long and eventful history. 'Times were had and no money was available to run the University. At this most critical moment the policy on the life of its founder was paid and Mrs. Stanford was able to turn over to Chancellor David Starr jordan enough funds to lqeep the doors of Stanford University open. The incident forms one oi the traditions of your institution and should you desire a more complete account of it the Pacific Mutual at Los Angeles will gladly send t e story to you. 427 CROCKER FIRST NATIONAL BANK OF SAN FRANCISCO CROCKER FIRST FEDERAL TRUST COMPANY COMBINED RESOURCES AS OF FEBRUARY 28, 1928 f f 31r7,746,516 Post and Montgomery Streets SAN FRANCISCO .mit , mix, ffl' mi -ff 3' 'ie .mgili imma! q-,Zi--ijm....m-,.,. A .1 1 mgmjf Alia iiflji 'SW o I I QQ -. A i SAN Jose ' , i , C A B 0 O 5 E v 1,4 li E : 9 T , 'I .7 7 COlX4PLllXfIENTS l lv s Of l l ip PHI GAMMA DELTA SL X Some of the boys were whooping it up on the farf I flung bottle line while all the rest were in San Jose M b I R doing little else than time. Prexy has always mainf Un Us tained a kind, paternal interest in this house, but of S Neg' Yofk Stgck iixghagge , late his patience has been a little strained. Q31 Ffxllii Ciiiigclixitilcilailqxgic l Adopting the policy of more mouths to feed, the ' Fijis Occidentally emerged from our annual Hypocf risy Season with so many victims that a brother I can't fall out of a secondfstory window any more Q Without landing on a pledge. The house is simply infested with yell leaders, and the brothers have a playful Way of pitting them against each other. This way they figure they can't I lose, but we aren't so sure of that. A Complete Bond and Brokerage Service WM. CAVALIER 81 CO. 433 California Street San Francisco First National Building Chamber of Commerce Building Oakland Berkeley Members San Francisco Stock Exchange San Francisco Curb Exchange 428 1 l v ll ill me il ll u A-f 5 -' 1?' ' Lf' if-'I 'if '-1 if T LT 7 'f,?:i-ir 27' he 1 is V . ll ill THE TRUST DEPARTMENT W fffffour Safeguard The Anglo Ei? London Paris National Bank of San Francisco is equipped it and qualified to act in every fiduciary capacity. rl: Two of the important services rendered to the individual by the Trust lil Department of this bank, include acting as ill EXECUTOR OI' TRUSTEE UNDER W ILLS OR DEEDS OF TRUST lil The officers in charge of this branch of the bank's Work will be glad pi to have you consult with them regarding your problems of this nature. 'T all ll' THE ANGLO E99 LONDON PARIS NATIONAL BANK yi, OF SAN FRANCISCO NO. 1 SANSOME STREET ll li PL Alf :ZA-A . at rr- mmol mr:r,,,,f 71:7 --- V- gf -W ..-rwa A AAA, lv -E 'gp ll i i . l 7 ll X aa-T , WALSH,0 CoNNoR 4 Nl MNNQIQKE UU li AND COMPANY A B l I ,il A I X w 1 Q B ii Members T bi Ji New York Stock Exchange W gl San Francisco Stock Exchange lg li ,l DELTA uPsILoN pl, 5 After the departure of Bill Richardson, the DU's li il acquired a reputation for being ucookie pushersf' l i Teiephnne Suffer 700 In a frantic effort to mend their ways, the brothers ll RUSS BUILDING li KO'd La Barba and are already vvondering what will SAN FRANCISCO happen to them all when initiation comes around. W IM The swimming pool is still there and provides a VXI T' very effective means of disciplining freshmen who i E are somewhat reluctant about performing their ab' l il Tel- TRinilv 2973 Tel- Glenwurt 444 'ii lutions. Occasionally some of the more loyal brethf l 540 WCS! Sixth Street Central Bank Building ren are brave enough to go in swimming volunf T LOS ANGELES OAKLAND tarily, but most of them prefer the lesser stagnation lil of Lagunita. i A! 1 gi Fully equipped to handle out-of-town market orders ll V lfrl A e V me - tl le-- rf-,,- -1- -We --Y -- 429 l i i l li W Niagara F ire Insurance Co. 576 Pine Street ' A SAN FRANCISCO 1 Automobile Insurance A P Mewnbers San Francisco Stock Exchange and San Francisco Curb Exchange HELLMANN- WADE SL C0. formerly A. C. Hellmann 5? COQ Established 1883 l . IU! . ' FIRE THEFT I Brokers m Stocks ln PROPERTY DAMAGE CoLL1sroN ! and Bonds E l ii HARVEY A ALLEN EWU ul R. H. HELLMANN M. C. WADE, JR. P l v L M. C. M S E D , Manager Automobile Department ICTOR EWIN , , A OR H A F 517 California St., San Francisco ll ' 1 Davenport 1030 l. l 4' yr if i' ffti-W li ' 4. . Y 'W' Y-A - -'D ' Yi 92 ni? OCS gm EEC an Zn '41-n no Z rn 5592 9-'nf 3.30 waz' 0:21171 QE-M 850515 mm 5-Sn? ONE isrm l55'x E5g.n RWE 023' rvZ C3 rn NEVVYOILIA Za Q55 F' in gi A gp .fcsileh-' in Q.: if ixasf 3 ESNVI-43343 s-rocw. 133 Montgomery Street San Francisco Telephone Douglas 2220 ACCOUNTS CARRIED ON CONSERVATIVE MARGIN DIRECT PRIVATE WIRE 8 i c1sr4rfuu4 ! A : Z X EE EE' ALPHA KAPPA LAMBDA The water bill is high at the A. K. L. house these days, and the Chinese cook suffered a reaction from the exemplary influence of the brothers and turned to much more remunerative work. When the Sigma Chis were temporarily removed from our midst, the A. K. Lfs cast eyes of shameless envy and desire on that nice, newly painted white house on the row. It seemed to Ht their characters so beautifully. Needless to say, the Y. M. C. A. still meets in the A. K. L. telephone booth. 430 THE SAN FRANCISCO BANK SAVINGS COMMERCIAL INCORPORATED FEBRUARY IOTH. 1868 One of the Oldest Banks in California, the Assets of which have never been increased by mergers or consolidat ions with other Banks MEMBER ASSOCIATED SAVINGS BANKS OF SAN FRANCISCO 526 California Street, San Francisco, Cal. DECEMBER 31st, 1927 Assets ............,,....................... . . S117,394,234.04 Capital, Reserve and Contingent Funds ....... 4,850,000.00 Employees' Pension Fund over S600,000.00, standing on Books at 1.00 MIQSION BRANCH ............................... Mission and 21st Streets PA lx PRESIDIO BRANCH ...................... Clement St. and 7th Ave. HAIGHT STREET BRANCH. .... ............. H aight and Belvedere Streets WEST PORTAL BRANCH ........,.......... West Portal Ave. and Ulloa St. Interest paid on Deposits at the rate of FOUR AND ONE-QUARTER per cent per annum, COMPUTED MONTHLY and COMPOUNDED QUARTERLY, AND MAY BE WITHDRAWN QUARTERLY if I THE SUCCESS OF ANT l I L FINANCIAL INSTITUTION ll IS MEASURED BY THE rl ll If l OOODWILL OF ITS CLIENTS. p IN COODWILL IS GAINED ONLY , BT CONTINUED PERFORMANCE ALPHA OMICRGN PI l Time was when the Alpha O's had made quite a II l' name for themselves, so to speak. NOW, for a year I OF FAITHFUL, HONEST SERVICE they have been troubled by nothing but virtue, and I their patience is getting a little strained. The girls have taken to taking after men, and it is l tl unsafe for an eligible bachelor to pass within hailing l 1. distance of the house. It is being bruited about that I I' several men got a mistaken idea of the Alpha O S h bd hs type from the junior Opera. Ermre humanum est. l C WH l 7nveshpent 0 i Securmes I PALACE HOTEL BUILDING I I 665 MARKET sr. noucuis 500 U ,fan Francisco ll ' if fr- l JF- - -7- - 2- 3 Y if Tl' ::k, 431 For over one liunclred years the name 33 5, Q ,gimin , JZETNA INSURANCE COMPANY '- f f? n'E . ' . . e4--eQ -e has signijiecl DEPENDABILITT ----- RALPH B, IVFS, President PACIFIC COAST DEPARTMENT f 219f221 SANSOME STREET f SAN FRANCISCO F. H. R1-IOADS, Manager f f f H. F. MILLS, Asst. Manager f f f P. TOMLINSON, Agency Supt. GUSTAV S. SCHWARTZ, '20 ESTABLISHED 1858 1 7 1 utro SL CO. Infvestment Securities SAN FRANCISCO GAKLAND Y Y Y Members SAN FRANCISCO STOCK EXCHANGE Direct Transcontinental Wires THE QUAD The Quad is a little smaller than the San Fran' cisco telephone directory and just about as inter- esting. The principal activities of the Quad staff are missing appointments for group photographs and putting names in alphabetical order. If all the energy that goes into publishing a Quad were expended in useful channels it would be a good idea. The most pathetic thing about the Quad is that after the staff has worked for a year, racked its respective brains for something new under the sun, and struggled to get the book out on time against Overwhelining Odds, the linal result of it all is just another Quad. To hell with it! Fidelity and Surety Bonds Burglary, Forgery and Plate Glass Insurance Fidelity and Deposit Company of Maryland ASSETS IN EXCESS OF S25,000,000.00 Executive Office: 814 Financial Center Building, San Francisco GUY LEROY STEVICK, VicefPresident LELAND W, CUTLER, Pacific Manager Branch Office: 412 Financial Center Building, San Francisco, Cal. C. K. BENNETT, Resident VicefPresident E. W. SXXYINGLEY IMHHB ,rg JOHN W. LATHAM I gt M Branch Ojicc: Hellman Bank Building, Los Angeles, Cal. H. D. VANDEVEER, Vice'President WM. M. WALKER, Manager 432 AMERICAN TRUST CCMPANY Since I854 0 GYO ONTACTS, like friendships formed in college years, endure beyond the Farm. Thouf sands of Stanford alumni everywhere have profitably preserved the banking conf nection established with the Palo Alto ofhce of the American Trust Company, formerly the Bank of Palo Alto. GYXD SAVINGS COMMERCIAL TRUST EOREIGN INVESTMENT SAFE DEPOSIT Resources more than Sz75,ooo,ooo HEAD OFFICE: 464 California Street San Francisco, California c-194, n foosarsfli F f T s Investment Banlkmnig Efaqe l l P-N- So ,, jo 'il . . Atwflf' Q i f'-'LA faiior zn the IW , 4, 2 of the community 15 l ll I ,.,,.,,,p t l Today, more and more, the investment 3 L t I l banking house is taking its place in the r 1 l life of the community. This institution T not only provides capital for municipal KAPPA SIGMA and industrial improvements-it pro- The Kappa Sigs had the president of lntrafraf l 3 l vlfles fis wen a medium for the Conserv' ternity Council this year, and were not penalized MWC Investment OfSufP1uS funds' for illegal rushing. This seems to be stretching the l ll Invest yt-,ut first savings after gtaduation long arm of coincidence out of all bounds. ji in high Class bonds. The roughfhouse atmosphere that has always t pervaded this aggregation extended this year to the I Lff 'U d'lmf3'0 ' Memorial Church, where one of the brothers forgot ll himself and was almost thrown out. Freshmen are advised not to enter this house, as t A the chapter roll resembles the San Francisco tele' l BONDS, phone directory and doesn't mean a thing. i l Investment Securities Out of a touching spirit of loyalty to the house, 1 the Juniors beat most of the fugs this year, l i 485 California Street Piigifd Oakland Bank Building SAN FRANCISCO LM A,,g,1,t OAKLAND I , l .u - A T f 'lf' f A ' ' 433 f iii' jg.--.cm ,ff- ' l Q - l 'll . I l . 4 X L 3: 1 , - 1 .... ..,.1 ' 1, '1 '47lflillliiWWfW v,h 5 I I ' Why go to old Niagara, On expensive pleasure calls, When in every town and city, You can always see Glens Falls. Old Founded and in Tried 1 849 Insurance Company Glens Falls N. Y. ' 1 l GQ 1 C1 DELTA DELTA DELTA A terrible catastrophe visited the Tri Delts this year when they dropped down, mind you, to third place on the scholarship list! As a result the girls are all looking for quiet places to study and the situation has become so tense that no Tri Delt can look at a Phi Beta Kappa key without blushing. They haven't been doing so well in activities since the earthquake. Like the Lord, they grindeth slowly, but exceeding small. BRANNER HALL The engineers they have tin ears and they all live in Branner. It is the home of future empire builders and captains of industry and pawnbrokers. Branner is a sort of purgatory, midway between the Hell of Sequoia and the dubious Heaven of Toyon. Both Toyon and Brunner proudly boast of a waiting list, but what the list is waiting for is beyond us. lv,,, Y 434 SPECIALISTS IN CALIFORNIA SECURITIES LEIB. KEY STOII Ann coMPANY Members San Francisco Stock Exchange 50 POST STREET SAN FRANCISCO X,g,Zm ef' 90 M - 17 TAX FREE H nun 'O O 0 STREET KY Q ' 2 L L A , A G I Issued by CALIFORNIA ALPHA SIGMA PHI MUNICIPALITIES How we do love to see those little pudgy rascals out on the front lawn telling each other jokes that 5 s will go in the next Chaparral, probably' The ' The Street Improvement Bond ranks first in brothers have fallen into the habit of laughing every line ahead of all mortgages, present or Lime onli of them says anything. Who knows? It may future. Available in amounts from S100 up e a Jo e. Not to be outdone by certain sororities, all the to 5100900 Of more' members have been taking sun baths on the roof. There ought to be a blue sky law to cover this. Write for full particulars together with Oh, yes-what about parking? Current offerings ' l l ' ' -Mme . 623 chl-I Sn 1 wsMgSles ' hu-fzsqauommuummn , BOND DEALERS SINCE 1905 as as A ll l W: Q. NEW ENGLAND MUTUAL LIFE INSURANCE CO. LIFE Insurance offers an honorable and lucrative career to men of ambition and vision. The New England Mutual, the Pioneer Company in California, offers to men of this type a guarantee of success through its splendid record of service to policy holders and its unexcelled contracts. You can represent this company with pride. Apply to OSCAR C. LE BART, General Agent 1080 Mills Bldg., San Francisco Telephone Garfield 2646 435 McDONNELL E99 CO. MEMBERS New 'York Stock Exchange New York Cotton Exchange New York Produce Exchange Chicago Board of Trade New York Coffee and Sugar Exchange HAROLD L. MACK Resident Partners ROBERT M. RIDLEY xxx. Our direct private wires to New York and Chicago enable us to execute orders for the purchase and sale of stocks, bonds and commodities with accuracy and dispatch. In connection with the facilities of our complete statistical department we render a particular and constant service to outfofftown clients. Our special market letters include a discussion of the general situation and specific recommendations on stocks and commodities. These letters are mailed to clients and to prospective clients upon request. Orders for cash and conservative margin accounts solicited. Correspondence Invited SAN FRANCISCO NEW YORK OAKLAND 653 MARKET ST.-PHONE SUTTER 7676 OFFICE 436 SEVBNTEENTH STREET Branch: Financial Center Bldg. 120 BROADWAY PHONE GLENCOURT 8161 PRIVATE TRANSCONTINENTAL WIRES i 1 Compliments O MARCO HELLMA 436 I-I J- Barneson 8 Co- M em hers NEW YORK STOCK EXCHANGE CHICAGO BOARD OE TRADE SAN FRANCISCO STOCK EXCHANGE SAN FRANCISCO CURB EXCHANGE LOS ANGELES STOCK EXCHANGE if fs Direct Wires to New York, Chicago and Los Angeles I I s San Francisco Los Angeles Barneson Building Board of Trade Building 256 Montgomery St. III West 7th St. Sutter 4500 TRinity 6181 ' I K 1 J' I vi I r l ll W 1 D: Nl I lg I if rc-X, l ' I - K li - N I I - l CHINESE CLUB Back in 1910 the Chinese students at Stanford decided to form a club and beat themselves over the head with it. It is the most perfectly managed fraf ternity on the campus, for the members cook their ovvn meals. Whether or not they eat them is another matter. We suggest that they also do their own Washing, for the economic possibilities of the Chinese Club are as yet only partially developed. I l A ll PHI KAPPA PSI In an effort to encourage a milk diet among these inveterate queeners, some kind spirit pastured a cow in the house one morning. As far as We are able to determine, the brothers did not take the hint. Neither did the covv. The Phi Psi house is the most exclusive hotel on the campus. It is built on the same plan as the cataf combs, and trying to ind some one up there is about as discouraging as finding him. l I l 437 Will lllllnf OLD FRIENDS are best, and it is wise to choose care- fully those who are to be comrades through the years. A banking connection of long-standing is a great asset. -rv It should be made early and carefully. We invite the accounts of young men and 'women WellF S U and O Bank mop lfrust Co. EL TIGRE These boys are making a valiant effort to be like a fraternity, what with real, honest to Balfour pledge pins and petitioning Psi U. It's hard to be' lieve that they are really organized for the purpose of eating, especially after sampling the food they put out. Their one bright light, God save the mark, is the new A. S. S. U. president, who has preserved the old, unbroken tradition that no man may achieve political heights without Hrst serving his time as a debater. El Tigre is a very cosmopolitan organization. The boys are thinking of drawing the color line, but they can't decide on the color. T og DEAR.. ALPHA DELTA PHI The boys inadvertently crashed into fame with a little aifair that turned out to be one of the skylights of the social season. A unique highfdiving exhibif tion was accompanied by the Chorus, which rendered softly, Hotel Me Not in Mournful Numbers. Now and then the brothers hold a spellfdown with Men's Council, which always seems to win. In a vain effort to show that they are only boys at heart, the Alpha Delts installed a toy train in their parlor and then sat around and watched it with many childish exclamations of Goo and Da When asked if he believed in chastity, one of the neophytes said No, and anyhow paddling and other forms of chastity ought to be abated. This policy should keep them busy for some little time. 438 MAN WANTED THE NORTHWESTERN MUTUAL LIFE INSURANCE COMPANY has an opening for a young man of ambition who has the capacity to study and work. A man who has participated in campus activities and maintained a good scholarship record is preferred. To such a man the opportunity is offered of becoming associated with an organization in which he can take real pride and which will advance him rapidly if he demonstrates unusual ability. If your ability has already been proved or if you feel that it might be developed, I shall be glad to talk with you confidentially. ' E. J. THOMAS, GENERAL AGENT 564 Market Street fffffff SAN FRANCISCO, CALIFORNIA UR KNOWLEDGE of and EXPERIENCE in the business of INSURANCE in all its branches, together with cooperationgj- organization and competent representation, is the basis ofthe '- SERVICE our clients enjoy. I A y ' A .- If means sEcUR1TY AND SATISFACTION to' themi. 17 WINEIELD S. DAVIS BURT L. DAVIS J. E. E. DAVIS sr soN INSURANCE BROKERS Representatives of the Insured SAN FRANCISCO 405 Montgomery at California Street SEATTLE Los ANGELES 211f214 Colman Bldg. 714 So. Hill Street 439 ,sf sg A Insist Upon , A gg A B v.'A 1, 55 Goods beafmgthe Label of 'Tiff I T VVYA f ' ,zijn 45- '. I I -:Y J 54 ,I .lf 1 .,f-3 ,, S At your service-289 branches of Bank of Italy in California Bank of Italy has anticipated the banking needs of California as the airplane anticipates our transporf tation needs. Over 7oo million total resources aid California industries and agrif cultureg ZSQ branches in the progressive cities of the State offer unequalled facilities to our depositors, Neither millions in increased ref sources nor great consolidations have taken from the Bank of Italy that intimate, human quality which is the guiding prmcipal laid down by its founder. Bank of Ital NATIONAL 2235532 1250 QIATION National Bankitaly .Company C 0 M B 1 N'Qllfn2fflI'li'Inif1'5'E .STM E NT 2.00 MILLION DOLLARS I COMPANY 75 New Montgomery St. SAN FRANCISCO BLUE AND BROWN PRINT PAPERS SURVEYING INSTRUMENTS DRAWING MATERIALS Y BLUE PRINTING and all other DUPLICATING PROCESSES X vt! WOW! I X VOMOX ha! , . :A W bi' ri.:-of f7 '??0 4?-:qt oi,,.R' ,c ,f si rf i'f?-in SWL W ' X f f 1' 1 M Q! N xr CITIZENSHIP See the LOWER DIVISION Students. They are laughing at the poor MONKEY. WHY are they laughing at the POOR MONKEY? Because a PROFESSOR told them that ONTOGENY RECAPITULATES PHILOGENY, and that's enough to make anyone LAUGH. The MONKEY isn't laughing. HE has just learned about the DAR' WINIAN THEORY and is feeling his responsif bility rather keenly. CCaps courtesy of Brisbanej. I . 440 l WHEN VACATION TIME COMES ?Z3Qfif5..5'.fii3S5f You can Well afford to join your friends in just the sort of a vacation you Want-if you've made a habit of saving your money. lfjust so -whatever your vvants may be, you can satisfy them with the money you have saved. fIlt's better to have money than to wish you had. Provide now for the plans you'll make later on by depositing reguf larly in a savings account in this friendly bank. 421, Interest on all Savings Deposits ANGLO-CALIFORNIATRUST Co v COMMERCIAL SAVINGS nuusr norm SAI-1-:nEPosl'r DEPA.Kl'Pl2N'l5 Branch Banks N67-he Branch Banks Ling-kit 86 loses Main Bunk Mission BL 16th Geaivegffeft QQ Market SL Sansome Streets Fgiafaeaazgfcn Twentieth Ave. Montgomerydc Sacramento Streets 101 Market NINE COMPLETE BANKS IN SAN FRANCISCO ll' has Q I C l NO AW: X N 1 x ' , YN V, 3' I O I l Q - H 'C f ' Kkg-gm 1 A C. I QT ENCINA HALL The freshmen are very particular this year. B During the rushing season it was found that no member of the Class of 1931 would join a fraternity unless he found its references thoroughly satisfacf D tory, and there is one touching case on record of a 1 house that begged with tears in its windows for a hardfhearted freshman to join, without success. There is a lot of money in the hall this year, but , K E most of it has been lost in poker games. But Encina I l l U has not changed fundamentally. The passerby who ' ' shouts What ho? will still receive a vigorous l I response' 1. I A national institution l 1 JOHN F. SHEEHY, '16 L. C. LITTLEPAGE Telephone Davenport 3110 LITTLEPAGE, SHEEHY SL CO. Investment Securities Kohl Building, 486 California Street SAN FRANCISCO 441 Serfvice that spans the years This Bank-out of its long association with Western progress -has developed complete commercial, foreign, savings and trust services available at its head office and at each of its branches. PORTLAND SEATTLE Oregon Washington TACOMA MISSION Branch Washington San Francisco 16th and Iulian Ave. THE BANK OF CALIFORNIA National Association 400 CALIFORNIA ST. Founded SAN FRANCISCO 1864 Capital, Surplus and Undivided Profits exceed 317,000,000 7?-4,,o'3k,f o .r !E.,-A 14 E J L W. 4, Em- 0465 x-l 5 W L THE BIG GAME GAIETIES 'YV QW' This is a picture of a man celebrating the Big Game. In the first Q picture he appears to be a Stanford man, but the expression of intense gli, melancholy exhibited in the third stamps him as a California rooter -gg' A trying to drown his sorrows and having a rather tough time of it. Q Next year the San Francisco hotels should add a breakage fee to A their table reservations, for after spending a year in Encina, Stanford K6 men are inclined to regard furniture as only a means to an end. X .RQ K' if 442 CQENER I GA Pig-E OUR motor is endowed with a new quality-a certain something that gives a new exhilaration to driving-a new pickfup vitality, quick action-vigor and power. What a difference a tank full of General Gasoline makes. Look for the green and white sign -it is the mark of a service station or garage where you can get this quality gasoline and Parahase L motor oil. LINE JZ-. l SOLD ONLY THROUGH AUTHORIZED INDEPENDENT DEALERS ll ll l l l 443 i- Palo Alto Super Service Station SZ Discount 510.00 Script Books 59.50 1 1 1 1 Richfield Gasoline Wasliing Greasing 1 1 1 1 Cor. Alma ff? Hamilton Phone PA 2163 SAN FRANo1soo's .321 Greatest Tire Service Station - LQQOHO 5 lI'2St0fl2 ' 1 4 T 9 ll? Gum-Dipped l ' T I R E S SIGMA KAPPA BALLOON S SOLIDS The girls look Very demure every time they pass CORDS CUSHIONS i that new mail hox the Government thoughtfully Expert Repairs f Vulcanizing Service Cavs put up in front of the house. According to Baird's Mtrniuzll, the Sorority once established a fund to aid the lonely lighthouse girls on the lvlaine coast. Kindred spirits, no doubt. i l l TIRE SERVICE CQ. A nth and Mission Sts. l Facing Van Ness Ave. Hemlock 7120 SAN FRANCISCO l ggi is S ,S S l lr S? i S? 2 E Q, ll 444 SCHWEITZER E5 C0 '23 Wholesale Butchers and Meat Jobbers '23 136 FIFTH STREET SAN FRANCISCO 445 W. R. CLARK, President Geo. H. CLARK, VicefPresident Clark 59 Henery Construction Company GENERAL CONTRACTORS ASPHALT PAVING P00 MAIN OFFICE 601 CHANCERY BUILDING SAN FRANCISCO Minimum Maintenance Expense Insures Maximum Economy I -C XVGQK WILL A '1 Q fa BEGIN NEXT BRONZE E I - H KALSAOERQ ll ll ' Pl- ' L L ST REN Ewo VALVES at ,I m ass NEXT NEW REGFIINDABLE AND RENEWABLE QOISRO A ' E N NT NICKEL SEAT AND Disc , ! H , , To A s. gg I QSPGRTB in ,Q ' EM.. . . Sgr H59 I5 -t J -UNK ,,.I1 I III R : --QQ N' :A: THE B. A. C. . ,,:'. f ,W , .,', , Hg .... . 'R vb, If , , I Lackey: Surah! There is a mob of students with' iii '1.., . .. I1 I - I - ' lllli-ia ff , H435 I Out- f , V Grand High Ticket Dispenser: Without What? Union Bonnet Outside Screw and Yoke LCICRCQII Without tickets. Once installed, Lunkenheimer Renewo Valves require Give 16111 IUICRCIIS Ill tlI6 section GOCl very little attention. The freedom from costly delays due to frequent repairs and replacements make them the most I-OI'gOl1l inexpensive valves in the end, and particularly desirable for . Marine Service- Lackey: But they all have student body cards, sirrah. . . 1 . . . 1 1 sooliigociaxgalglepiin sizes A to 3 In. Inclusive, for 200 and Then ten em We re Sold Out' Our large stock enables us to serve you promptly and efficiently. MARSHALL-NEWELL SUPPLY COMPANY A Spear and Mission Streets SAN FRANCISCO, CALIFORNIA KOVERFLOR The floor Covering supreme for concrete, cement, and Wood floors, also linoleurn. Both outside and inside. Used at the Stanford University. FOR SALE B Y PALO ALTO PAINT COMPANY Manufacturers, Standard Varnish Works, NEW YORK A 562 Howard Street, SAN FRANCISCO - QSend for Bookletj 446 with I I - - - need Lumber quick? VAN ARSDALIPHARRIS LUMBER CO. FIFTH AND BRANNAN STREETS SAN FRANCISCO Kearny 2076 , Sole Md11MfdCKUT8T5 I INTERNATIONAL AND INTERCOLLEGIATE REGULATION SPRINGBOARD PARIS 1924 Ojicially Used at the Olympic Games AMSTERDAM 1928 These springboards, manufactured from the design of Ernst Brandsten, Instructor of Aquatic Sports at Stanford University and Coach of the American Swimming and Diving Teams at the Olympic Games, Paris, 1924, and Amsterdam, 1928, are specilied for all pools where oiiicial meets are held, and they are l used generally at all prominent Athletic Clubs, Country Clubs, Universities and Beach Resorts in the United States and Europe. Drawings illustrating proper fulcrurn construction and installation of board I furnished OU request. Pacific Coast Lumber of Every Description I I A... L POI OAK I instantly 'relieved l I as Q , F THETA CHI It is rumored that Theta Chi will soon be afhlif ated with Breakers, and the house is so close to the eating clubs already that a change in location will not be necessary. The 'ibrothersn spend most of their time playing bridge and waiting for a second Richman. Lately CALA POISON OAK CREAM f Instant relief-yes! Cala Poison Oak Cream has a definite germicidal action against the rash-and it prevents 050 Q2 OAK REA l .. il as aim fa ,Pl N I T if , I f 2 , vgy, L. ', N. they have taken to giving serenacles, which is the its Spread! Q Q 42 ' f d rd . one sure sign o utter eca ence Include 3 tube in your bag this hw'-mmm summer. IANGLEY Sr MICHAELS Co. OAKLAND SAN FRANCISCO ERESNO l l l JAMES H. PINKERTON COMPANY Q'2,'7'Q3I Howard Street Phone Kearny 1737 YYY PLUMBING VENTILATING AUTOMATIC HEATING SPRINKLER SYSTEMS POWER PLANTS WATER SYSTEMS GAS APPLIANCES SAN FRANCISCO 447 mv L, 3 17, :LW -W -- C- - ---1-,YL-ii, T - - fff1-M Q - 1 --f ' 1-U94 I -If-I--I-I --------------------- I---It-I-Ie ISTANYORD I l Complete line of Ladies' and Gentlemevfs Wrist ' Watch Shop Watches. ff' Official distributor for Tavarmes and i J. Jay Baker : Longines Watches. ff They are Different. ill at your service 571 Ramona Street ------- ----------- 2 ---- - Ii PROFESSIONAL BLDG. 1 31 ijj,,,, 4, -7 ' i 3 5-iT.7l1? 'A T' iii' E-YL '-' Y- 71 AL l i i I , . I , 'wirsemanlg Men's Shop PALO ALTO CELL ct Cm l 'W I -'W Y F' Y Y NOTICE It is not our wish to encourage any one to disregard prohibition, but for . the protection of our furniture and for your convenience you will find in- I I stalled in this room a bottle opener. MANAGEMENT. u DORMITORIES Stanford dormitories are furnished with all modern conveniences except ice water. In a sin- cere effort to make life in the halls bearable, the University has spared no expense-or at least very E little-to give the inmates all the comforts of home, and what a happy little family they are, to be sure. The above card is a mute testimonial to the benevolence of the University. If it were any less mute it would be illegal. JNO. E. COSGROVE and Inc. W. W. KEITH l ANDREW J. LYNCH . JOHN T. COLLINS Insurance Brokers-Average Adjusters 343 Sansome Street SAN FRANCISCO Los ANG1zLBs PORTLAND NEW YORK LONDON LIFE INSURANCE FGR STANFCJRD MEN 3,33 PINE STREET, SAN FRANCISCO DAVID H. WALKER, JR., 109 448 .1 P. R. MORRISON I MANAGER PHONE GARFIELD 19 I TECHNICAL BOOK COMPANY I TECHNICAL f INDUSTRIAL f SCIENTIFIC AND BUSINESS Books Representing , RONALD PRESS Co. JOHN WILEY E99 SONS, INC. LONGMANS, GREEN E99 CO. I PRENTICE, HALL, INC. D. VAN NOSTRAND Co. E. P. DUTTON Co. A. W. SHAW COMPAN1' J. B. LIPPINCOTT COMPANY CHEMICAL CATALOG Co. I 525 Market Street, Underwood Bldg., San Francisco I .4-TY fl- VAL 'l illiigii 'Q 'AEI' 375 is fir 3:1 Y: il? 7----7--i Y- Y I II III I II ' I I OMPLETE OUT' I I I I I FITTERS FOR MEN D I WHO DRESS WITH dx II DISCRIMINATION EL CAPITAN III I El Capitan is a very conservative eating club III The boys began rushing on October lst, and were II so particular about their new members that they :I II never did make up their minds, and neither did the I prospective nuggets. They struggled through the I year with ten members, and the only thing that I made life endurable was being in the same room I P I-I E with El Cuadro and its new I'Vic. , The members of this organization have the most original names on the campus. Some of them are so I TEIIKEL I II III II I I III III 'I II I II III II III unique as to sound suspiciously like aliases, but we I KTIIE O, New Idea-Sn II trust no scandal will come of this. NEXT TO THE CARDINAL CN II I RAMONA ST.-PALO ALTO I II I I MI ITT E221 EZ-.. AJ .I O ,sei -- as : -- Ngw P-fQg35 of TS I TA d U hid l T DRAPTEREZSTTIURTAIN WORK EVERLASTING MOTH t a nfo T P 0 S t e T y and FIXTURES PROOEING ON FURNITURE, ADOLF RICI-ITER, Proprietor ,RUGSI ETC' Telephone P. A. 852fM 636 Ramona Street Mattresses and Box Springs Furalggplgggiiicfj and Estimates Furnished PALO ALTO, CAL. Made to Order and Renovated I NIIIIIIII. STANFORD HOTEL 250 Kearny Street, SAN FRANCISCO 150 rooms with hath 52.00 daily 75 rooms at 551-50 dailv 449 The NEW 54? 55 to 65 Miles per Hom' HE outstanding performance of the new Ford is the direct result of the quality that has been built into it. Clflts beauty is not confined to externals only, but goes deep down into every part of the car-even to those hidden, covered parts which you may not see. CllThroughout, the new Ford is an example of Ene automobile engineering. Its inside mechanical beauty delights the engineer and technical man, even as its unusual beauty of line and color delights the artist. WALTER G. BERNTHAL Ford Dealer HOMER AND EMERSON STREETS PALO ALTO, CALIFORNIA PHONE 3500 Telephone MENLO PARK 1661 I cezx Peninsula Building Material Co. Sand f Rock f Gravel -95' HARRY MOREY Telephone MBNLO PARK 5 MENLO PARK, CALIF. AUTO TROUBLES l . EXPERT REPAIRING ON ALL MAKES Call 575 or 576 CTwo Tow Carsj One of the finest equipped garages on the peninsula l PALO ALTO GARAGE l P. J. MIBBACH, '14, Prop. 440 Emerson St. CADILLAC STAR LA SALLE AND ALLS wsu. i EIGHT dc'-OCR' PHI SIGMA KAPPA Each year it becomes increasingly harder to think up anything to razz these people about. They have a childish habit of making their neophytes perch up on the roof and call out the hours of the night, which makes the unoffending neighbors wonder if perhaps Wilbur isn't right, after all. 450 THE HOUSE OF TRUCKS AND WHEELS Mailufacturers of labor saving trucks to suit your lg V needs, and also repair and reftire your old ones l A COMPLETE LINE OF CASTERS and WHEELS for jig J , I TRUCKS, Toys, TEA WAcoNs, BEDS, ETC., - '- ' - -' in Stock at All Times l -I We Also Manufacture, Rent and Repair Invalid Chairs JAPANESE CLUB The japanese Club is often mistaken for the A. T. O. house, a fact which makes the little brown men pretty mad. They still have Wilbur and Jordan in their house picture every year, so the war be' tween the United States and Japan won't come just yet. 920 Howard Street CNCGT Fifthb Telephone Sutter 4996 FIRE AND WHARF ' Q F HYDRANTS 9 A p .iii U 1 Used on the Stanford Campus ' .- is 'A and in Palo Alto ' l Manufactured by A M. Greenbergs Sons fi-1 V, lip :aj .D-f U l I A 765 Folsom St., at Alice St., SAN FRANCISCO f? f,x f 7 A .ummm V la-. . V 1 a ' ...N . ' '- iii fi 4 . X , tx... ,f .u - :ax i L: 1 Z' I ,Alf ii A Mil lu v is jllllig 'T ll will 'X tif ' Eff ' ' W lf -4' v 'lim j iiii it Q ,. AQWEE BEL lllll TDDLS METALS-SHOP SVPPLIES - ns? STREET I SAN FRANClSCD.CALIF'0RNlA I - ' qui s-- ' Ga B2SZ22f:'3:. A IN SHEETS -R 76 Fl PER-STEEL.-ALXIIVUNVIVX DNEl.'NlCKEL SILVER DDS-TVBES AND WIN! U H GRANT AND GEARY, SAN FRANCISCO OMENS smart and distinctive apparel for town and country wear The home of the famous NCU- FRESHMEN This is a Stanford freshman practicing up for life in a fraternity. He is trying to throw a seven, and when he makes a fraternity he will learn to throw other things as well. If the freshmen believe everything they are told about life in a fraternity, they will be pretty dumb, Next year they will all long for the marble sinks and the single beds, or we don't know our Greeks- 452 A World Famous Dining Room. A poefs dream of a place to eat This World Famous Dining Room has been enlarged to include a marvelous dance floor. fff Where Stanford ' Eats and Dances 111 BRGQKDALE LODGE BROOKDALE, CALIFORNIA 453 TIRES TUBES VULCANIZING ACCESSORIES O'MEARA TIRE SERVICE SERVICE f EFFICIENCY f SATISFACTION Retreacls Guaranteed 8000 Miles A. J. LiDICK,l OHMEARA 529 Alma Street Phone Palo Alto 2757 PALO ALTO, CALIFORNIA Phone 1316 Campus Shoe Shop Union Building For GOOD REPAIRING 'I .uf A. DELYON, Proprietor M ullistrihutors of Reliable Merchandise Since 18491, WHOLESALERS OF PIPE - VALVES - FITTINGS pm wwf PLUMBING AND HEATING SUPPLIES SAN FRANCISCO OAKLAND SACRAMENTO MEL LOS ARCOS The boys of Los Arcos are the bonfton group among the eating clubsg they get so used to wearing tuxedoes at debates that they even wanted them for their Quad picture. They carry out the atmosf phere of refined taste at meals, what with flowers in long thin vases, piano music, and pictures of women hanging about here and there. The Club has the full indorsement of the Palo Alto Parent' Teachers Association, which, however, does -not know of the carryingsfon with the pantryfgirls. Led by one of our four leading class presidents, the fellows make it pretty hard for the girls to keep from spilling the beans, in more ways than One. The Crow Pharmacy I L. A. lljimmyll CROW P H A R M A C I S T Complete Drug Store Service Quality Work Popular Prices We Cater to Stanford Trade . .. ollnCr's Cleaninrlr and Dqein? works 330 Universlty Ave' L L S S Palo Alto! Cahf' 219 University Ave. Fourth Ave. and Middlefield P l Alt 194 Redwood 80 Phone P' A' 400 H O Woodside and State, San Mateo 2188 li C7 Y 1 1 ll 1-- , , W H L gi-,Q4-,-fi: V Qi l.:Q-1'- I-jf' ff.- .E??gEi my W I :ul-4, V --I-2, I ,, - lm El ll igklp ijil I In . , l ll ' 'uv ll lk l I I ' 4 gr ., Mm M l 5 Eavzmsiesfw aff? ll ll A I ' A I Ejg5QNwq A W' I ER A ' l DUCRUET FURNITURE co. I We solve your furniture problem ll ,lil Successor to Warren Furniture Company HAMILTON E? EMERSON PALO ALTO CALIF - Ad Y ll ai-- it , UNION GASULINE Ih l 5PEeDaP0w:n ' Compliments of Union Cil Company of California BEST E73 L o1L X I , K f ALI f MQTQR 1 I ANN CONSISTENT GOOD PRINTING ! V with our equipment SLONAKER'S PRINTING v HOUSE ' EVERYTHING EOR EVERY SPGRT Sporting Goods - Typewriters - Bicycles CUE SLONAKER, '22 y 225 Hamilton Ave. Phone Palo Alto 387R non the cg,-cle S ' S PALO ALTO 455 NERN I MERNER LUMBER COMPANY PAULM P MERNBR 21 President L On the Highway PALO ALTO THE HASLETT WAREHOUSE 60 CALIFORNIA STREET l Compliments of I Star Theatrical Lighting Co., Inc. Electrical Effects, Borders and Foot' lights, Stage Electrical Equipment, Lighting Effects for Banquets, Pageants, etc. f ' Stanford law graduate CR1ghtD taking the V 965 Folsom St. San Francisco bar examination CALL AND SEE MOSES STANFORD UNIVERSITY COLLEGE CLOTHING We Pay Highest Prices for Second Hand Clothing If you don't find me on the Campus come to the Store L. ROSENBLUM, Proprietor CMosesj Every Afternoon and Evening at the SAN FRANCISCO ICE RINK 1557 48th Avenue Sunset 9340 456 ROM humble beginnings, this issue of THB QUAD has ,grown to its present size. Of course it is the ofli sprmg of a noble ancestry of previous volumes of QUADS, but even so, We of the Editorial staff realize the importance of the nursing it has received at the hands of Sunset Press. CCC In this room in the Sunset Building, def cisions have been reached, advanced, or reversed, on every page of this book. Throughout, We have enjoyed the full cofoperation of the staff of Sunset Press in whom we en' trusted the final step of publication. GC The members of the composing room, press room and bindery have co' ordinated their activities to produce this Quad with true precision. We thank Mr. Reynolds for this signed statement-SUNSET PRESS 457 ' me me The Kopper Kettle Tea Room QQ . iqflgaj Good food waz cooked QQ? for Standfordites and others Sl g g 3MmW??f2?d fE2?HQi3q??K? g g aw M we Palo Alto Upholstering Co. O. H. ZIMMERMAN Prop. :xii Ellis Interior decorators and manufacturers of high class furniture, draperies and curtains Special prices to fraternity and sorority houses LIGHTS OUT There was a little Roble girl Wlio left the City late, And as she sped along the road She pondered on her fate. My, here we're passing Burlingame, We have no time to spare! If you donlt go at sixty per, I'll polish silverware! And here we are at Menlo, As plain as plain can beg And if you want to see a wreck, just take a look at nie! My God, I've got a lockout, - You see, it's almost two: Welll have to ride till sunrise, Drive on, therels work to do! Eat at ..... TAIT 24 Ellis Street 920 Market Street 168 O'Farrell Street 2539 Mission Street 458 FOR STEADY DIET, GOOD BUT NOT TOO EXPENSIVE: A LITTLE CAFE IN THE SHADOW OF THE 7 ST. FRANCIS ON GEARY STREET. -Frederick Lewis, author and traveler x 141' 5 AHS. lllwry K Sofarp H'op1'icto1' 354 GEARY STREET ' ' f ' ' TELEPHONES DOUGLAS 2161 Ei 2162 SAN FRANCISCO R 0 B E R' T S O N 1 S zzz Stockton Street Book Store Union Square 1- HARRY ROBERTSON, ,IO Z ' . NjU, 10'g:Mf'AoLJTAff Efverytl1mg for the .55-., L- ' Music Lover als 1 l To live up to our slogan we carry , 0, an everflarger stock of the best in 4 I ' l I I l ll pianos, Victrolas, radios, hand and orchestral instruments, sheet EL CAUDRO music and stmdries of all sorts. This is the hangout of Fraser and his Rally Com' mittee, which leaves little else to be said. The inf mates decided to buy a phonograph for 33300, but sent it back in favor of one for 55150, and ended by buying a portable at 575. This proves nothing but the inability of the Rally Committee to decide on anything. El Caudro garnered three times as many pledges as members, and when the time for initiation arrived, most of the regulars went into hiding. Fraser dispenses the edibles QD here, and never gives the boys enough food. He exhibits the same stinginess in providing ballots for A. S. S. U. elections. You will find our stocks complete and our sales force capable and competent. 'N RALPH C. DODSON 367 University Ave. PALO ALTO, CALIF. WD ' OF SUPERIOR QUALITY 2240.26 GRANT AVENUE Next to White House SAN FRANCISCO 459 , l Fashwns Change But Feet Do Not A very witty Irishman once said, Fashions change but feet do not. What a world of wisdom r is wrapped up in these few words, and how we y should all take them to heart when we set out in our quest for shoes. We have tried to do our part by providing you SIGMA NU l with shoes made of honest leather and whose excel' The Seelety fel' the PfeVeUfl01'1 Of Cf'-1elfY te lent workmanship insures the wearer real comfort. Pledges Would do Well to Pulllsll the Sigma NUS- l That isn't all, however. You must do your part and Their neophytes took such a ruthless heating during l select shoes adapted to the use you are going to give hell Week Chef l3l1eY all fell HWHY to H P2110 Alto ,l them. Don't teeter around on spike heels during Hotel- Q workaday hours. It never was comfortable, and The Sigma NUS used to be Uleea quiet fellows- lf DOW jtislft even fashionable' Mike Ely were in the house such things would never happen. But Mike wouldn't recognize his l f f f atavistic brothers now. il l l FREE CRA K CASE SERVICE l NIELSEN ea CULVER N i Telephone 2381 jewelers and Opticians Q . . 165 University Avenue Live Oak Service Station y PALO ALTO ASSOCIATED, STANDARD, GENERAL AND p RICHFIELD GASOLINE lZn2Aml?'ff1fglHl?3E oaa Quart on Free with Each 30 Gallons of Gasoline p - JAMES T. COTTER l at lgwgy than Sim Fmncisco C. A. LA PEIRE Q EMERSON AND LYTTON p-,ices PETER R. ARNOTT, Ex 20 PALO ALTO, CAL. a LLL, L L-. i V' - iw -- When your work doesn't suit you-just call P.A. 547 W A l fl l UNI V ERSITY FRENCH LAUNDRY l Tour work is always guaranteed l l , l Standard Prices 642 Ramona Street l me l x T home, at work, at play, and on sea' MGR ' your way from one to the Other, you live in an electriied world made possible PWR- by the generation and transmission of PHI KAPPA SIGMA The Phi Kaps are hanging desperately on to the old managerial tradition, and the pledge who can't make out an expense account is of no use whatsof ever. There are enough Bar S sweaters in the house to make an awful lot of rubbish, and most of the pledges, before they are old enough to know better, are instructed in the gentle art of packing hurdles. l l alternating current-the great contribution of George Westinghouse to his fellowmen. The organization which he founded has made the application of this power to every phase of human activity so natural and simple that few realize how it has revolutionized our civilization. Westinghouse SAN FRANCISCO Orricss 1 Montgomery Street zsrmunouss zuzcrmc K H. S. TITTLE COMPANY Electrical Engineers and Contractors 85 Columbia Square SAN FRANCISCO dndprivate PHONE S. M. 549',l 'iHouse of Service San Mateo Tobacco CO. WHOLESALE CIGARS, CIGARETTES ' TOBACCOS, CANDIES AND GUMS Stanford Union Suppliers SCHEER CC. Wholesale Grocers and Dairy Produce Dealers Phone Kearny 3 368 7, IS L. BERNARD 314628 FI'Ol'1t SC. ' SAN MATEO CAL ' Representative SAN FRANCISCO 461 HOTEL WHITCCMB At Civic Center SAN FRANCISCO ' fe Exceptional facilities for college activities and entertainrnentsg special rooms for fraternity banquets, smokers, etc. Saturday Night Dinner Dances in Drury Lane D. M. LINNARD Managing Director ERNEST DRURY Manager The Finest FISH DINNER Q in T3 'T' America ,f ,afar That's what you'll say after you have dined in the 'fr . F ishermen's Cafve at 123 Powell Street. ' In a special setting that reflects a real atmosphere of a Fisher- men's Cave we will serve you the Enest fish dinner you ever ate. The surroundings are typical ofa buccaneer's home with nets, ' oars, pirates' lamps, waterfalls, etc. X The menu changes daily, so come tonight. Dine with us as you have never dined before. SX , RESEARCH Fish caught at 5 A M served here the same day + + No, the naughty man in the picture is not mixing a cocktail, though you can bet he would like nothing better. Prexy has just announced that alcohol U A BERNSTEIWS and gasoline will not mix, and this Wag is applying the scientific method. Later on he will try to drink it and then he FISH GROTTO l23 POWELL ST. will find that Prexy was right. 6 SACRAMENTO ST. sm rmmcusco DINING Rooivi Q G PIPE ORGAN H 'inert iiEAMiN 'r ,N NINETEENTH AND FRANKLIN STREETS ' OAKLAND, CALIFORNIA Eaeelleaa Facilities Three Hundred Comfortable Rooms Garage la for Banquets, Basement for lime? and Conveniently Located Moderately Priced CO YOU? eunlons MANAGEMENT-J. G. KIEFABER nvenlence 462 II A I A - W PEPP PP I II THE AMERICAN BUILDING MAINTENANCE CC I 1 I Contracting anitors or Stanford Universit I I Y I I 1 I Head oaices-SAN FRANCISCO C SUTTER 264 I t f -e - mC,S I II ' rf ' I I II II II I II I I I I II II I I I I III Ey Popular Demand IX I I PI BETA PHI I - I I Blue Ribbon Ice Cream I: The Pi Phi's are having a tough CUTIE regaining II the lofty position they still claim to have once occuf I NATIONAL ICE E92 COLD STORAGE COMPANY I pied. Since time immemorial, they have been strugf III I gling to make some headway in campus politics, but OF CALIFORNIA I all they have been able to do so far is to develop a habitual candidate, like William Jennings Bryan, If -I and the outlook is pretty black. I SAN FRANCISCO OAKLAND SAN Joss I But spring is come, and the Pi Phi's are the undisf I puted sirens of Lagunita. They are always to be III I found reclining on the life rafts of a sunny afternoon, III II but as far as we are able to determine, which is far II C, X-jj-fig I 4 enough, not one of them has ever got her man. ,I I II I I ISU C I C II C CEC C C C CT C C V - HW T ,WCW C, Air, A- if I II To the Students of Stanford: ,I . . . . . III We solicit your patronage, and, if given, will do our best III . III to keep 1t. II A I I III POST-TAYLUR GARAGE, Inc. II Post and Taylor Streets San Francisco I E. -. I e te fe 463 EHRMAN BROS. HORN AND CO. IT'S A RULE WORTH REMEMBERING Leadership can be by Sluality Alonev GOLDEN STATE BUTTER Z Golden State Milk Products l o Joneslfhierbach Co. ..,4, ..4k.N,. ------,- N -----' A '55 1 - -salma Ngrw E ,. if 1 L ' ll smann ll . 'T n .. ----.. .. .......... ...... - 1 The lure of the mysterious East is caught and sealed in every pound of ALTA COFFEE. There is flavor that bewitches the most critical taste-there is aroma that suggests soft, perfumed Oriental nights. Your first cup of ALTA COFFEE will, with the celerity of a magic carpet, transport you to new heights of coffee appreciation. P T 1 Cgmpany Truly, Guest Coffee for Every Day in the year. I San Francisco f Los Angeles - Palo Alto - San ,lose l l OPTIMO ST. FRANCIS 2 Fon zsc The flnestVueltas of the new Crop of Havana Tobaccos now being used. xx' I ! CHI OMEGA These girls may be dreadfully active and all that, but they still have time to do right by their boy friends. The screen recently stuck by the side of the back swing was a noble gesture, and should make an effective man trap. The Chi O sitting room looks like the Y. M. C. A., with mobs of gentlemen lounging around at all hours of the day and night. At a recent house meeting, a rule was passed to the effect that none of the sisters may chew gum except in the privacy of their rooms. Also, they are making a valiant effort to regain their former su- premacy in dramatics. Aside from this, we have little to say about them, as they have been keeping their shades down lately. ,YYXERE 49 gy Ll ARE SMWES sl l 1 l in l I i o il l l I 1. l Western Cooperage Co ' I4th and Harrison Streets SAN FRANCISCO 9'-'-:Q Esziiiitii W FIR my V fb 'ff Q f Ksoff Tight and Slack Barrels of S e All Descriptions QJVQ Kits, Tubs and Pails for All Purposes BVS SCO f TTLE, WA A 4- O 'gre for gour appetite A L IG O R iff lll sswiw c cacsnv if Ramona are or , sg, rhiia 10325 F 5?'Rom coo-fine wakes Street XA - .... .. ' and I ff X A I New ALTO ufuisian ui-51 v Bmfiv Hit: AQ ' ' J gkpieso :warren -N 5p 'N ' cuuwimw- .mmf if SWELZIQITUE M 'E.ff ME CHAPEAUX 3 U' ,N A-Lg, TE. was 474 GEARY ST. OPPOSITE Curr HOTEL , iq gagilvery night an equally Exclusive models of original design, savory trip . . Toll 51 reasonably priced I-I O T E. I.. T KUPPENHEIMER UN'0N CAF.:-TERV5 A' s x G o o D o L o fr H E s 66512 1 T., 06 sv Noi MAKE EEFORE W5 wif rffffft' A HE NASH- For over half a century Kuppenheimers P A have been making good clothes for men g ,Emi .ug K -k 'Q and young men-always striving to make their product better and finer. The results of this constant effort can be seen any time you will favor us with a visit. You will be interested in the wonderful values and the moderate prices. ow 539.00 and higher me ANDERSON'S The House of KUPPENHEIMER GOOD CLOTHES -li fm .Ulf li THE CAFETERIA As the visitor enters the Stanford Union Cafe' teria his nostrils are beset by the odor of burnt toast, burnt fat, burnt potatoes, and burnt umber. This, however, is immediately neutralized by an odor of greasy dishes, greasy trays, greasy silver' ware, and greasy aprons. A tempting array of yesterdays food is offered, but anyone who can eat it after absorbing the pref liminary odors has an iron constitution and is wastf ing his time in college. In the Union there is strength-there has to be. 466 THE RUSSIAN TEA ROOM Corner of Taylor and Vallejo l LUNCHEON TBA Phone DINNER Prospect 2432 Esther Rothschild Dresses, Gowns and Millinery 251 Geary St., Opposite Union Square Showing lovely hats and dresses for the college girls Hats, 315.00 up Dress and Sport Garments, 3329.75 up Would be pleased if you will come in and let rne show them to you We don't see why they have Stop signs on Palm Drive, because the only people who come out of the side streets are neckers and theylve been told to stop often enough. x 1 l l I 4 'ill ' ' T .. K, .. . 1 . 'W . ' A all R WURLEEER Studio Grand at a new low oNEfPRoF1T National Price 645 The World's Greatest Grand Piano Value Here is the world's f nest example of OnefProft merchandise. Uniform tone purity, superb performance. Music of rare and satisfying charm is always yours from this instrument of undef niable superiority. See and hear this matchless Grand Piano offering. Lowest Terms Guaranteed WURLIEER 250 STOCKTON STREET SAN FRANCISCO 575 FOURTEENTH STREET OAKLAND Over 50 Wurlitzer Stores in California f I 467 DO YOU REALIZE THAT A Hos. BATH SUIT CAN BE HAD Foa ssc? Some young men seem to think they'd have to mortgage the old homestead in order to get into the Thos. Heath c1ass...that's silly... for S50 you can buy a Thos. Heath suit of splendid American wool' ens, tailored with exactly the same personal supervision, the same handvvork, the same everlasting hissing with details, that distinguishes every Thos. Heath suit. Mmm 7-Store Buying Power ALSO HEADQUARTERS FOR HART SCHAFFNER SL MARX CLOTHES Jiri? 1. - , A 1' Q Q , ', o TEMPORA! o MORES! 1 1 1 V , He's gone, the virile Stanford rough va , Witli manly countenance and tough, So rustic, hirsute, hale and gruif, ! The bearded engineer. No more he scorns that he be caught At dances, as in naughtyfnaught: -' Instead the years to us have brought K 1 .4 . iw:-. 'SSI ' '-TPR: Qt -:sf L' The type thatls pictured here. 1.15 '1:1:,.- X Behold the 'modern Stanford rough: 1' ' N . . He wears a shirt with laundered cuff, A dainty sweater blue or buf, A tie with sprightly bow. He wears plus fours of basket weave, A sight to make old timers grieve And thank their stars they had to leave Some twenty years ago. 468 P 0 R T R A I T S in tl1eIQ28 .Qauacle 'made exclusively 4' by H. P. FISHER 165 Post Street San Francisco Telepl1one Kea'rny 341 l Mullen Manufacturing GO. HIGH GRADE CABINET WORK Specializing in a general line of Store Fixtures, Counters, Shelving, Etc. Special Office Fixtures, Partitions, Desks, etc. High Grade Interior Finish and Special Furniture for residences Radio Cabinets and Library Tables We do not carry manufactured stock. Everything made to order Manufacturers of all movable and Exed furniture in the Thomas Welton Stanford Library 6Of80 RAUSCH STREET Between 7th and 8th, Howard and Folsom I Rubber Stamps METAL AND GLASS SIGNS MEMORIAL TABLETS MOISEKLINKNER GO. TemifZ:eFgQSgfE2858 369 Market St. SAN FRANCISCO .W g -L riggal 4, ex ,L Pyro-Action Spark Plugs Defy Spark Plug Paralysis The Famous Bosch Horn DELTA CHI , ES, I Gmvmnmg .-I Clears the f'- Road M Original BOSCH WINDSHIELD WIPERS, MAGNETOS, BATTERY IGNITIGN Delta Chi pledges are being instructed in the Hne art of excavating. There is a rumor afloat that two of the nuggets were taken out into the hills and forced to dig a tunnel Or a well or something, and the poor dears got their hands all calloused and nearly broke down from the strain. Floating the rumor further, the energetic pair almost decided to cast loose from the establishment, and it is to their everlasting dis' credit that they thought better of it. SYSTEMS som av DISTRIBUTED BY Agard Electric Co. Furrer SL Uster, Inc. Palo Alto San Francisco Van C mp CIGARS F. PATEK, PRESIDENT L. G. ECKLON, Vice-Pres. J. B. BUTTLAR, Sec'y PATEK f EGKLGN GG. INCORPORATED WHOLESALE AND JOBBING I0 Sr l 5c Straight Butchels 3 l:0I' 2 5 C 934944 Larkin Street SAN FRANCISCO, CAL. Between Geary and Post Streets 470 l I I I I CHECKS CASHED From 8.00 A. M. to 6.00 P. M. UNION BARBER SHOP Old Union J I M I The Best Place to Dine! CITY RESTAURANT 166 University Ave. PALO ALTO QJQ POPULAR FOODS AT POPULAR PRICES CHINESE DISHES STAGE woe x5 ME! DOOR, . fs ALPHA TAU OMEGA All Tuckered Out. It Seems that committees can't get a house anywhere these days. The closed corporation in dramatics opened up this year and fell like a house of cards. But there is still the Sus' pendered Wiggin, who is trying to sell something for a song, we hear. The A. T. O.'s are selffstyled members of the inf telligentsia, and anyone who says otherwise is prob' ably right. PALO ALTO DAIRY M ilk and Cream Ice Cveam Wholesale and Retail Whitman's' Chocolates Soda Fountain ' 314 UNIVERSITY Phon 621 O ' ' 1 f I LAWSON EROS. con E Sf RAVEN. Incorporated Cleaners P. A. 635 U , Opposite Post Office Jlm Lawson 25 PALO ALTO 471 Wesley E. Angel THE AUTO TOP SHOP OF PERSONAL SERVICE Auto Tops f Cwrtains Painting f Body Work NN Q25 Alma Street PALO ALTO, CALIF. Phone Palo Alto 2139. ARNEST'S MALTED MILK A MEAL IN ITSELFM TradefMark Reg. U. S. Patent Office Copyright 1928 by A. M. M. S. A RN E S T ' S THE ORIGINAL MALTED MILK SHOPS ALL OVER CALIFORNIA X X ' l l l I ax -Q 5 A ak- P bbw QIIL Q, aaa l ' SN E' Q EB E 93 E3 , Xxx Q O in - :sa lil ' Q GBC! . .. ,,, Ill I ' F - T ' THETA XI BREAKERS This big, pretentious white house isn't nearly as good as it looks. The brothers are trying to live down their reputation of being a bunch of engineers, but somehow they never quite succeed. They are making frantic efforts to enter all sorts of activities, and, well, they are making frantic efforts. The boys pledged their star athlete before he entered school, and then watched with pride as he took three firsts in intramural and then rolled out, zero minus fifteen, setting a record that will prob' ably never be equalled. Even after this upset, they still have a corner on all the athletes and campus politicians. They are great and prominent men one and all, but even great men must have their little fun, and the Breaker boys do so enjoy throw' ing buns at the Quad photographer and at one another. Perhaps this exchange of buns fosters democracy-who knows? P. O. BOX 789 Phone MENLO PARK 2285 Peralta Pigeon F arm DRESSED SQUABS FOR ALL OCCASIONS Also Dressed Poultry of All Kinds Sent by mail anywhere On the State Highway M. A. DENTON MENLO PARK, CAL. .W l Co-Ed Shoppe Ladies' Apparel and Millinery MRS. MOCOY, Prop. 417 University Ave. Palo Alto, Calif. ll 472 a 5? if 3 K KL sa -- fp fr M - gk PALO ALTO on , mx ES, Q cf 5 wt 0 5 7 Nzwrou smnxos h 1 5 -Shaw? .V 5 Ep ,. lt' -. Jw ,.. ,Y 9 ' ff, - seal wfmlw in 5 wx ffl, ii HQ' If--gl - ,O fe X r. ,. .Lfj-R 'rig Q.. A. if - 5, , aging Llr- .Alfa Z, .gs N ,5,,1g,, , . vera, I S' fu 2 F -752 ..--X- Ps pwl, 422' - Miw' WIFE? g.2iS11r5Ql2N- -A, LQ' rf- f7 VYZTSQQQZ Distinctive, Artistic PQRTRAIT PHGTCDGRAPHY Awarded National Salon Honors for excellence of Portraits Studio, S35 Ramona Street PALO ALTO, CALIFORNIA Telephone Palo Alto 89 473 the last ...REQ , Iliad-j C f- After the curtain has fallen on the dramatic finale of the play, what a comfort to know that home and bed are only across the street. Almost opposite San Franf cisco's two leading theatres is the Hotel Fielding, offering all the little comforts of life--beds of pil' lowy ease-mirrors that tell the truth about lipstick -bathrooms like ads in a magazine. Room 69' Bath 52.50 53.50 HOTELFIELDING ARY AT MAS G E N ' W lt SL S I . p San Francisco 3 ers, dw ,Zed On' HC U T1 DODGE Bnormsns DEALERS amousf 07' C0mLjlb7 435-437 Alma street Phones Palo Alto 2820 and 2821 - ' 'You use but little Salt 0' A 'f'l ?,,7 mg 6 v- 0 Let that little be the Best . l g r -ras or , W lk L lk EL CAMPO LesliefCalifornia Salt Co. 155Montgomery St. z461Hunter St. San Francisco Los Angeles The outstanding thing about El Campo is the soup. The boys stand outside when it is being served, which is no worse than the soup. The picture above is not a true representative of the El Campo type, as no member has ever worn a necktie, and no girl like that ever risked her life at their table. It was drawn by a member of El Campo, whom We suspect of malicious intent to defraud, and he ought to be spanked. They now have the editor of the Daily. It looks like a bad year for the Greeks. V l 474 Evening and Fancy Dresses Made to Order Wigs, Play Books, Makefup, Etc. OFFICIAL COSTUMERS Fox PRINCIPAL PACIFIC COAST THEATERS Established I863 Goldstein SL Co. THEATRICAL and MASQUERADE HINKS USiuce 1572 College Women PX 49' are known to appreciate - il the service as well as values offered by a store. A It is this fact that makes ,X it such a pleasure to serve them well! Hinks have been dealing with college people since 1872. J. F. Hink SL Son of PALO ALTO fe far I If ILE fl Ili COSTUMERS SUCCESSOT IO 989 Market Street Phone CARFIELD 5150 jyfe-ndenhall CO- 6 , MEADOWBROOK BLDG. SAN FRANCISCO, CALIF. 4 i- EL TORO Nothing but a herd of runfdown athletes and ex' Euphronia president emerituses. They spend all their time pitching horse shoes, but remain about the unluckiest eating club of the bunch. Every afternoon the boys burst out in their shirt sleeves, looking very virile indeed, and play at barnyard golf. And that's about all one can say about them without becoming incoherent. Geo. M. BERNHARD THE PALACE HOTEL BARBER SHOP M anicufing 20 Barbers 9 Manicurists Phones: Sutter 8915 Kearny 8600 SAN FRANCISCO, CAI.. C H A RT I E R' The Place 'You Heafr So Much About 5O'CENT LUNCHEON 551.00 DINNER DE Luxia - 'Try it Today Highway and Santa Inez SAN MATEO Phone San Mateo 2565 5 f you 'QQ vo1e!3fTec2rz-lmzru, Now FeLLAs,oF wvozs' 7' 0 X, me 0 1: mruou HASTE- N our WE, E - LOOKEUY I F000 ronmeamrzsfg 5 2 Y ,-ii7':f3,w?1g ,I-4,2 F 37 . ' , ff X G D! YQ gg? Q X X' m,,,53 , I ZGXJQZWZ7 ' TfwQ3g3gf,f.QWi95,w-VM U f- 'f X gr '- X W 'V i -'Y' 1 ww ,As , r- - . ,ij XS Llgi Q TW WW .2-1 xr-fxfxffida-J JLVALUANT fmamvr an rmrzlsve +66 AXE' U72 - Irs -roun OWN vnuur ff .GMM ,.,..,-A mga'-O ALTO HO5Df7-44 1J5vcHoD,ATmc ' X Q CG' QL, A Q XQVA Q D T 41.fi 4 J 5., l ff - T ,, h, , -..j- 1 .., W 01JQlVE LIME HELL, f5l1.L, THE7ffvE Four-up A STAN Fomp swvm AT A Gmini Pnoooqgnonlf 4PM -0- ax m'fEZLJ gy 'nn lluz-was 'wvn WDHE 1iDu 51251125 New GETWFJ-1 HALLW-15 Ff2ATsu214ggG4nPsn6N1'I5,THoDS fQEQjg,ggwWQf1ms1 Re-5 375' , Lum 'H fXi5 5353 . is M haw ? th? ,'l.vP' Q fy? cmnem., Eu-Img AfN'r.NAT.9n'srzAND ,M 'Y 'LKPTZOTAIZY ,f 2 1 I 5-1' HAPFJA KLIMI-Sal 'gin- ,H 'XQ3'5'1f'n3u'NHA'1 'f f 305,700 M L' J sm: Hd .fa 2 'f.-7:2 1' .ez ,K 3 . Q I I , i sem Munn Q 0 QE IAA I' 697 . SPV! 1 W 1 f 5,-1, GAMMA GOLF aem.i. + mv' ' 'C I A 0 Mlgfpsa re wed 1 i I ZJZILTXHLEIPSIQEFSY wiv V my L I 3 E115lLo TR u. A ' abcd+i ' ,xv A ,Hhs DF y ffkgggffgavf Fr2ATz12mT54 AJ E?-S55 U E O fx- ',-. , .'4'., 11 nv b LGHATSON6 DAT: r-I6 'T' 232232 OMEGA Trl! C' A D D , xy .gl ,-1,1 KAUZM, ,,m,u, 'Legg' ' 9 .. 6 n W V H F :sr Qgrsif 55535-6H A mmf. Mya ,WM-gi WW f-weWMLa?x:fff2z2i2:z?m 9' p , I ,mon , 60,19 , T0 Posmo mf swf-'aug DAILY! 'fmlffvkx-llwkwlxgmwllwwwxlmfw lfEIk22llQ,?fz??-M? -Eff' ' 'wfff .21PiI!IwPl1??12! w1y1w,Eliifmgrlgnmmyg W- fm M 5523 ,mlgmmw E21 lZm'..gIt1m 17.441 IM Mug! QSM fm M M1 Rm i IEIlQCLi??lE-9121 ,,,, 2' J' J' GN melWI1cE1Ll'EQ,Isfffj,fggl2 liqwnf I5 img? 0 M9301 'KHCSM 4-KG? Mff? 1 M , fm- mlV:?'l2VE: law. bills l 'Am E93 ' XM A355 ggi, MQ +1 4x- ,Sl ...,A , -V-fsf - 3 . - I 'A , LE' ' ikXI' X f 1+or M 05' ' 'A f M 5: KW? W M .W ' N w 1 Helm- M- 1 fm W M fag xml Pggl-gglgfg csgy FULFDLLINCQ ljs gywea Dwngaou Dscbonlznaurs 5 476 '-4, ,yn-AN, , , ,N X , fg ,ff X fkqg kw , ' an sl 1 . r W -fglmm-4. Us mmmnmf . ' N ' mlnrmnnuiii gpm Q., r .. 'S , . A Sentinel osver Emi 5? :.- 'E v . , - - K - - an I I 1 . . I , . 1 , , f A lx: - T inf , , ' 1 f,r'ff7 ' ,I ...... . ki A- 'jj!E17f?3 fl ' HP D- ':1L:5 X 1-'-Hffrz - ,.v A 1 .w'l s , 1. MXH? 2. rv X 3 is fl up X x f 'nf-4' K X fl LTI 3 X ,. A: :I 'gimp E m L NH. ffglilau: w ill . -I: mimi H' Im :mm ,Ill I llllnuuull -JH:- ' IIUIIUHI 1 q I num, 1I,ll nlll I u un u HH I mrlhu f'P f ..1.i I1 il Hm I xx A ' .fl Mgr: Ill li il Him ' F I HH ' 'WUI' JET? it H' W Juli!! '1 H Wlmm mm 'Ill 'Nitin uulli :H : mm. .I 1, ,M kan :I :gi rum ,ll I, M I I ' mmm: ni n 1 n pn, III' I IH IW' ,M -rr lj I, :1' . I H11 luigilirmuf 'J gil. W 1 'WT all 'nl' TI X Ir 1,1 1 , r I fo 'HW X Iilmiu' rf g Q - n ' w fl F 4 - 2 . A , ':f 1 w A ' iigggii s rfr:-:unsEsi11...rll!3g153p5WMU? ' ,f 1 I., . 1: HAL 5,4 IIDIIIA f ' M., iv- X , 5? f H X' L 45 ff m! Z def . 7 ff Rf rr' f f f !,,f fgfff ,f San Franciscds Beauty HGTEL MARK HUPKINS GEO. D. SMITH Managing Director Like the New Tork Ambassador and the Drake of Chicagou .... Where the color and life of the great city is eprtof rnized ....... Here Chef and Maitre cl'hotel cater to every taste and Anson Weeks' Orchestra provides the entertairlrnerzt you seek. 477 Telephone Sutter 1607 DANIEL W. BURBANK 309 ATTORNEYfATfLAw om.- Alexander Building SAN FRANCISCO, CAL. Telephone Sutter 752 RICHARD W. BARRETT 704 A BARRETT E? BARRETT AttOrneysfatfLaw Q-0-0 502505 Humboldt Bank Building SAN FRANCISCO COMPLIMENTS OF FREDERICK L. BERRY ,QQ ATTORNEYfATfLAw Malcolm and David M, Attorneys 206 Sansome Street NORMAN E. MALCOLM, '95 lst National Bank Bldg. SAN FRANCISCO, CALIFORNIA LEON T. DAVID, '24 Palo Alto, Calif. Telephone Davenport 180 Charles K. Sumner JOHN K. BRANNER ,OQ ARCHITECT ATC l1ifCCf 760 University Ave. 57 Post Street PALO ALTO SAN FRANCISCO A Shreve Bldg' SAN FRANCISCO, CALIF. BIRGE M. CLARK Architect Nw WILLIAM H. CRIM, JR. 510 University Ave. Architect PALO ALTO 425 Kearny SAN FRANCISCO 478 A., 1 ,..,t, ,g,.:f1l il Y Y , xii' ,4 1: 'V i,,,i,fi 7 , 7 ii- 4'i ii' ir ..V . - 7 I BAKEWELL SL WEIHE ARTHUR BROWN, JR. II Architects A Architect 7.51 KEARNY SAN FRANCISCO , ' 251 KBARNY SAN FRANCISCO l l lg ':. 1' Wai 2 ff '1 +42 - ' , 5 le f- '11:, 4 if -1-f:: T. B. HUNTER, '04 R. A. HUDSON, '06 E99 H. S. TITTLE COMPANY Consulting Engmeen Electrical Engineers and Contractors Mechanical and Electrical Equipment of Buildings 85 Coluglggl Square Q.- SAN FRANCISCO Room 718 Chancery Building 41 Sutter Street , Phone Sutter 1414 SAN FRANCISCO I . 4 A A fee A I IL E-, 1 E- .. A A:A In - 9 LEONARD N. SCI-IWARTZ ADOLPIHI C. WOLF I A I ALL LINES OF INSURANCE WOLF SL COMPANY Rwlwls Special Attention Paid 4 to Stanford Business 34 Sutter St. Phone Sutter 6195 , SAN FRANCISCO , , 333, PINE SAN FRANCISCO ii 'iii 'f-i2f11 i2 --' --A - 'W ' f-'lf f 'fs Y 3- , lgliii li ' ' 4-- I 'T Y 7 Y v - V777 Y 11 7 i,7 J. W. STACEY, Incorporated I , HallfGloCkler 59' P1Z'0SlZ MEDICAL AND SCIENTIFIC BOOKS l 228 Flood Building SAN FRANCISCO, CALIFORNIA Telephone Garfield 838 l - Business Furniture CLEMCO DES KS I TAYLOR CHAIRS l MACEY FILES, BOOKCASES AND SAFBS ....- ' I If fs a Medica' Book we 'me it l Il 4ZlilSFg1R1Oli1CI? ST 1708i-FRCAASIZLIN - I 1 . or can procure xt for you Gameld 3030 Oakland 2484 t 1 li 479 1 x -V .L Y hN4v Xx 4., ti, '- TXKNX 'ajzh -1-S0 A Activities, Student ....., Administration ,...,,, Advertising ........ Advertising Index. . . Allen, Warren D.. . . Alpha Chi Sigma .... Alpha Delta Phi ........ Alpha Kappa Lambda .... Alpha Omicron Pi ..,. Alpha Phi ..,...... Alpha Sigma Phi ..., Alpha Tau Omega .... A. I. E. E. ......,. . A. S. C. E. .,,,.. . A. S. M. E. ...,.., . Andrews, California. . . Athletics Men .... , ..,. . Women .... .... B Baker, Frank .....,..... Baker, Gertrude ,.,... Band ........... Barnett, Blanch ..,.. Baseball ......,.. Freshman. , . . . Varsity .,.. Basketball .... Freshman .... Season ..... Varsity ..,........ Women ..,........,. Baumgarten, Robert E.. . . . Beemer, H. Lawrence .... Bentley, Lucie ........ Berg, Harry ....,... Beta Theta Pi .,,... Biaggini, Albert .,... Big Game ........ Big Game Gaieties ,.., ..... Big Meet .............,.. Biography of a Rooting Stunt Blake, Andrew C. .,....., . Board of Athletic Control. . . Board of Trustees ....,.,. Bodle, George .......... Bowers, Fred ........, Boxing ............... Brandsten, Ernst M.. . . , Branner Club ..,.,.,. Branner Hall ....... Breakers .........,. Brown, Buford Otis. . . Bryant, Byron ............ Bunting, Helen Masters .... 229-282 .......27-38 480 401- . ..., 399 ....267 357 307 310 341 338 308 294 358 359 360 243 107-190 191-200 . . . 241 . . . 268 270-271 . . . 248 159-164 . . . 164 . , . 160 141-148 . . . 148 143 . . . 142 193 330 .. 248 259 146 297 145 125- 134 , ,.,.. 126 156 155- 138 . ..,. 244 . ,... 140 34 277 145 178 174 326-3 27 322 315 240 . ..., 145 .... 192 258 Burns, Sarah Margaret ........... . . . ByfLaws Revision Committee ........ 236 C Cap and Gown ,..,,..., Cavalero, Philip ..... Cecil, Robert. ...,. . . Champlin, Lucia ,....... Chaparral .,...,.,.,..... Chinese Students' Club .... Chi Nu Kappa. ....... . . Chi Omega ......,... Chi Psi ..,.......,. Circle S Society. . . . . Clark, William .....,. Classes .......... . Coe, Henry ..... 361 . . 278 234 .. 243 251 312 384 342 298 181 144 ....47-106 .... 155 INDEX Combellack, Fred ...,....... ..... Concert Series ..... Conn, Claude C. ..... . Cook, Alexander J.. . . . Cosmopolitan Club .... Craig, Homer T., . . . Crocker, George .,... Culver, George Bliss. . Curtis, Sue ........ D Davidson, Eleanor ....... Davidson, Horace Hodge, . . Davis, Burt Lincoln ....... Davis, Gordon Arthur. . . Davis, Harold M. .... . Debate Varsity ...... Women's. . . Dedication ...... Delta Chi ........ Delta Delta Delta .... Delta Epsilon ...... Delta Gamma ....... . Delta Kappa Epsilon .... Delta Sigma Rho .... Delta Tau Delta ..... Delta Theta Phi. . . . . Delta Upsilon ..... . De Molay ..,... .... Denny, Wallace ....... Departmental Changes. . . Desjardins, Pete ......... Dobson, George ....... Dormitory System ....... Dramatics ....,.......... Caesar and Cleopatra . . Expressing Willie ..... . Lady of the Rose ...... . Romantic Young Lad So This is London . . . . . South Seas Preferred . . . Draper, Murray ....... it ti . E Eating Clubs .... . . . El Campo ..... El Capitan .... E1Cuadro ...... .... El Tigre ........,.... El Toro ......... . .... . . Emerson, James Gordon. . Encina Club ,... ...... Encina Hall ......... Encina Sponsors ..... . . Endowments and Gifts. . , English Club ......... English Singers ........ Euphronia ............. Executive Committee .... F Fencing ........... ..... Fleishhacker, Herbert ..... Football ............. Big Game ........ Coaches ........... Freshman Squad ,.... Fresno State ...... Grays, Stanford. . . Little Big Game. . . Manager ..... y 268 .51 276 -269 241 1 24 275 383 248 276 36 248 237 114 244 257 166 -278 279 7 304 340 385 337 302 280 296 362 300 363 137 31 187 147 322-3 23 255-266 262 260 259 261 258 263 234 314 317 319 318 320 316 275 330-331 111- 323 331 31 364 269 281 235 180 118 137 125-133 113 135-136 114 137 136 113 Nevada .,...... Olympic Club ,.... Oregon .,....... Oregon State .... Pittsburgh .... Santa Clara ..... , Season-1927 ..... Southern California. . . St. Mary's ........ Varsity-1927 ..... Washington ..... Forker, Paul ,.... Fraternities ...,..... Freeman, Chris ........ Frentrup, Ralph Lud, , . Freshman Class ....., Friedman, lgnaz .... G Gamma Phi Beta ..... ....... Garnier, Dorothy .......,... Geological and Mining Society ..... German Club ................ Gigli, Beniamino ............ Glee Club ..... Golf Freshman ..... Varsity ..,.... ..... . . Government ............,. Guggenhime, Richard E.. . . . Gym Team ............. H Hammer and Coiiin. . . Harder, Theo.. . . . . Hartwell, Anne ...... Heinecke, Walter ..... Heiser, Pete ....... Herrington, Alan. . . Hertz, Alfred.. . . Hill, Donald K. . . . . Hoffman, Clifford ..... Honor Societies ...... Hoover, Herbert ..... . Hume, Robert A ..... Hunt, Ernest Paul ...... Hyland, Richard W.. . . . I Illustrated Review .... In Memoriam .... ....,. Interclass Sports ......... lnterfraternity Council, . . Intramural Sports ....... I Japanese Student Association.. jordan, David Starr ..,,.... Junior Class ............ junior Opera .......... junipero Serra Club .... journalism .....,.... K Kappa Alpha ........... Kappa Alpha Theta ,.... Kappa Kappa Gamma, . . Kappa Sigma .... .,,.. Keyes, Henry E.. . . Kiler, Leslie ,... ii7 122 272 2 116 114 121 120 134 124 113 119 115 112 123 327 286 133 124 105 269 339 262 365 383 269 -273 183 179 33-238 251 101 101, 136, 180 250 115 345 134 135 167 269 120 130 356 7 277 142 133 249 9 184 287 185 313 33 102 263 384 240 299 334 335 301 275 257 Nurses .,........ King, Robert W. ......,. . . . . . Kirkpatrick, Leonard .,... ..,,... Krenz, Eric .......,,. L La Barba, Fidel .,....., Larson, Norman Grant. . ....151 Le Cercle Francais ....,., . . . Levit, William .,.......,. . . . Lewis, Frank MacBoyle. Lewis, Lawrence ........ . . . Literary Magazine .,... Living Groups Men ........ Women ...,..,. Los Arcos ..,...... Lowry, Richard S. .,.. . M McCreery, J. Harold. . . McDovt zll, John Ezra ,... ...... McElvenny, Ralph T.. , ...,.33 50 276 154 186 256 385 326 243 116 252 283-331 2-352 . . .,., McLeod, Norman ...... . . . . . , McNamara, Thad ..,.....,. . . . Maloney, Henry Wilfred ..... ..., Martin, Ernest Whitney Masonic Club .,.......,,., . . . Masquers .,,......... Men's Council .,.. Minor Sports ...,... Coaching Staff, . . , Mitchell, john Pearce. . Morgan, Francis K., . , . Mott, George F... . . . Muller, Donald . . . . Music. ........,,. , . Muzio, Claudio ..,..., N . fffQi7i Norman, Winston. . . , . . . . Northrop, Burr D. .... . Nu Sigma Nu .... . . . O Olsen, Margaret ..,... . . . . . , Omega Upsilon Phi ..., P Panhellenic .,........... . , . Phi Alpha Delta ,... . . , Phi Beta Kappa .... Phi Chi ...,... '. . . Phi Delta Phi ..,. Phi Delta Theta ..,.. Phi Gamma Delta .,., Phi Kappa Psi ....,, . Phi Kappa Sigma ..,... Phi Lambda Upsilon .... Phi Rho Sigma.. . . . . Phi Sigma Kappa .... Pi Beta Phi .....,.. Pike, Thomas P. .... . Polo ,...,.. .... , , . Post, Seraphim Fred .... Preface ....,........, Press Building ..... ,...,. . . . Preston, John Beverly .,.. . , . Price, Anna May .... . . Murphy, Michael M. ..., .... . ' 267- 321 113 113 249 168 105 105 176 271 366 266 236 -187 173 37 328 252 114 122 274 268 251 103 100 367 252 368 333 371 374 369 372 289 292 290 306 373 570 311 336 330 177 134 6 240 123 256 IN D E X - Continued Publications ...,.,.... . . .239-254 Publications Council .... .... 2 53 fl Quad-Volume 35 ....... .... 2 43-247 Volume 36 .,... , .... 248 Quad Board .....,,.. , .... 246 Quadrangle Club ...., .... , . 375 Quad Staff ...,......, ,... 2 46-247 R Rally Committee ........ . . . 139 Ram's Head ......,...,... . . . 264 Research Dr. Franklin's Experiment ......,.. 42 Engineering Shops .......,......, Food Research Institute .,...,...,. Guggenheim Aeronautics Laboratory 41 Hoover War Library ...,...,.,... 45 Hopkins Marine Station .... ......, 4 4 ' 44 40 43 Lane Hospital ...... .........,... Professor Slonaker's Experiment .,.. 41 Psychological Research. ........... 43 Ryan Laboratory ....,.,.,..,.... 40 Seismological Station. . , . . . 42 Reynolds, Herbert K. ..... . . . 243 Richards, Dowell ,...,.. . . . 144 Rifle Club ..... ..,.. . . . , . . . 377 Robesky, Donald A. .... ,,.. . . , 119 Roble Club ......... .... 3 45-352 Roble Hall ...,.... .,.. 3 44 Roble Sponsors ..,,.,. . . . 345 Ross, Alexander T. .,... .,.. 3 25 R. O. T. C. ...,.., . , . 188-190 Roth, Almon E. ..,.,, .... 3 7 Rothert, Harlow ..... . , . 143 S Scabbard and Blade ..... . , . 190 Scalpers ,,....,..,..... ....., 3 78 Seasons, The .,...,....... .... 2 03-228 Sellarcls, John Armstrong. . . . . . . . 38 Sellman, Roland ......... , . . . 121 Senior Class Class Officers ..,. , .50-53 Class History ..,. . .54-55 Class Roll ..... . .56-99 Sequoia Club ..,,.,,, 328-329 Sequoia Hall, ......... . . . 323 Shallenberger, Gordon .... . . , 278 Shoup, jack Wilson ..... . . . 244 Sigma Alpha Epsilon .... . . . 295 Sigma Chi .......... . . , 293 Sigma Delta Chi .,,, . . . 254 Sigma Delta Pi ..,., . . . 376 Sigma Kappa ..... . . . . . 343 Sigma Nu .......,., , . . 291 Sims, Robert Floyd ..... . , , 117 Skull and Snakes. ...., . , . 379 Smalling, Charles ..... . . . 144 Smith, Dan T. ..,....,. . . . 271 Smith, Everett Wallace. . . . . 240 Sobieski, John ..,.. . . , . . . 277 Soccer Freshman ..,. , . . 183 Varsity ..... , . . 176 Societies ....., 353-386 Sophomore Class. . . 103-104 Sororities ............ 332-343 Speers, Frederic W. ,... . . . 241 Spencer, Emerson .... . . . 151 Stanford Daily ..... 241-242 Stanford Grays, . . .. 137 Stanford journalists' Club. . . Stanford National Board, . Stearns, Mary H. ....., . Steinbeck, Stanford .,... Stewart, Jean ...... Sword and Sandals .... Swimming Freshman .... Varsity ...... Women ....... Sypher, Clarence. . . 'T Taylor, Frank J .... ...... Tennis ..,..........,. Freshman. . . . Varsity ,,.., Women ..., .... Theta Chi ..,,. .. . . . Theta Delta Chi ..... Theta Sigma Phi ...., Theta Xi ....... ...... Thompson, james G.. , . , Toyon Club .....,... Toyon Hall .... Track ....... Freshman. . Varsity ...., Women ....... Truman, John .... . . A V Vincenti, Louis Rudolph. W Waite, Russell S, .... , . . Warner, Glenn Scobey. . . Water Polo Freshman .......,. Varsity ....... Wenig, Herbert ..... West, Clarence ....... Wheatley, john B ...., Whitaker. Virgil. .,., , Wilbur, Elizabeth ..... Wilbur, Ray Lyman. . . Willits, john M.. . , . Wilton, Frank ........ Woerner, Edna Ellen.. . , . Wolter, Harry M. .... . Women Athletics ......... Athletic Association. . Conference .... ..... Council ......... Debate, . ..,. . . Glee Club ..... . . . S Society ..... . . . . Worden, Richard ...... 'T Yell Leaders .... ..... Yost, Mary ..,. . Y.M.C. Y. W. C. A .... . . . . , Z Zeta Psi .......,,... Zombro, Fred .... . Zoology Club ..... 253 35 344 103 345 265 182 174 194 161 249 150 Templeton, Robert Lyman. . . . . . . 165-170 170 166 195 309 303 254 305 143 24-325 322 149-158 158 115 ....101, 150 196 276 143 329 112 182 175 277 153 167 278 258 32 271 131 244 160 191-200 198 237 238 279 274 199 324 139 36 380 382 288 153 381 CONCLUSION EcoRD1NG the events of the university year in this volume was a task that necessif tated the cofoperation of a large number of people. When we began work on the 1928 Quad we had only a nebulous idea of the book which finally evolved, and as the work progressed the advice and assistance of many others refined and brought to a successful consummation the plans we made at the beginning of the year. Hubert J. Langton of the Sterling Engraving Company has supervised the design and engraving of this, his fifth Quad. Whatever is fine about this book is largely the result of his efforts. To Mrs. Mabel Langton we are very grateful for her many kindnesses. Mr. Dregge and Mr. Wessel of the Sterling Engraving Company have been exceedingly pleasant to work with, and we wish to thank Mr. Wessel especially for his care in super' vising the engraving of every cut in the book. The printing was done by the Sunset Press. Mr. Ed Kreiss personally supervised the progress of the book through their plant, Mr. Irving Johnston contributed valuable advice on typography and layouts, Mr. Paul Thompson was of material assistance in budgeting the book, and Mr, Ryan, Mr. Becker and Mr. jochner maintained a high quality of printing, even though somewhat rushed for time. To Mr. Bowman we wish to express our sincere appreciation of his almost uncanny knowledge of composition and his always inf telligent and cheerful cofoperation. The paper was furnished by the Zellerbach Paper Company, and we thank Mr. T. C. MacCormack for persuading us to choose a paper which has proved satisfactory in every respect. All of the individual and group photographs in the book were taken by the Fisher Studios. Mr. H. C. Fisher was a delight to work with and rendered us hundreds of extra favors that were not mentioned in the contract. Mr. Dougherty took all the individual photographs and must have set a new world's record in doing so. The covers were made by the WeberfMcCrea Company of Los Angeles, and credit for them must go to Mr. Babcock of that company, for he went to a great many pains to secure for us a cover that was entirely satisfactory. Mr. Leopold Krumel designed all the borders, the frontispiece, and the cover. He was a very pleasant man to work with and a most obliging one. Mr. W. F. Rauschnabel exe' cuted the woodcut openers, and the striking beauty of his work speaks for itself. The view photographs in the beginning of the book were taken by Vincent Dolfi Orlando, and we wish to thank him for his kindness in making several trips down from San Francisco for this purpose, as well as for the unusual beauty of his results. The members of the upper staff and the tryoutees have worked splendidly on this book. At no time did anyone fail to come through at the proper time. Were we to begin giving each contributor his or her just due, the list would ultimately embrace the entire staff. To Stanley Milne, William Robinson, Helen Smith and Ruth Patterson of the editorial assisf tants we wish to express our profound appreciation of their wonderful spirit throughout the year. An editor could not ask for a hner group of assistants. To Hildur Richardson, Frances Yeazell, Adele Gist, Boyd MacNaughton, George Richards, james Roantree, and Douglas McCormack of the managerial assistants we express our gratitude for their help in the uninspiring business of collecting advertising and selling books. Miss Stevens and Miss Aten of the Students' Organization Fund office have done a great deal to assist with the finances of the book. Their cheerful cofoperation was greatly appreciated. To Mr. Arthur W. Towne, Mr. Fred Keast, Mr. Bud Collischom, and Mr. McElwain we wish to express our appreciation of the many courtesies they ex' tended to us at the beginning of the year. To Andrew Blake, California Andrews, and Ellen Woerner of the upper managerial staff, we are indebted for their help in making the book a financial success. To Lucia Champlin, Jack Shoup, Helen Stanford, and Hallie Keating the editor is greatly indebted for their invaluable assistance in solving many problems which arose during the year's work. HERBERT REYNOLDS F. MAoBoYLE LEWIS 3 -3Q'3' Ni x K 1 1 , A , w ,-,gt W -- H, .1 f A Yi.,.-L. A-: H - . , . 1 1- A:-Y-9.--f-pf

”

Suggestions in the Stanford University - Quad Yearbook (Palo Alto, CA) collection:

Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1925 Edition, Page 1

1925

 Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1926 Edition, Page 1

1926

 Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1927 Edition, Page 1

1927

 Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1929 Edition, Page 1

1929

 Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1930 Edition, Page 1

1930

 Stanford University - Quad Yearbook (Palo Alto, CA) online collection, 1931 Edition, Page 1

1931

Searching for more yearbooks in California?
Try looking in the e-Yearbook.com online California yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
 E-Yearbook Home  Quick Search  Advanced Search  Quick Browse