Riverdale Country School for Boys - Riverdalian Yearbook (Riverdale, NY)

Text from Pages 1 - 150 of the 1929 volume:

iv! if IV mr: 1 eg' I ,, ,v JA' 1 M. 1. A Q46 . 1' L, 94 5 .ii Q A L 1: I r , ' 1 1 1 1 1 L , L A f 1 :fun if 1'-1.r.-1 an-,A 55513 mf' Ji 1 wi , 7 f if Hi, '1 . , .lf I 5 :Q 1 ,,EfL1'J Lila. y. .:i.. f Q L :if 1 eff.: b ,'3dv 1'-,. - f' 1 nf' ,am at 1 pri I Q-W 0, Y .T Z wir ' 1 ,fm 1 1 'JSF 1 ' F71 ff' ,JL 11 .4145 r 4 . , 1, -' xr K 151 nf' L ., 11, 'r '1 , iw-vfa 5 1 , ,1,'11N'j Q, '- v. H- - 1w if 14. -Q .11 . 1? - .r1--' ,-A ,, ,X 21? 4'?'uP',r.9?', .pf A-,1 A an ,R 1 , . if g. 2, -.2 1 , 1.61 1 , W 5 1 1 A MX.. :'. , ' 1, 1 11,1 1 . , , . A, , ., . - ,Q '41, X rf. K ,1 at W. In ,A xl V 1 A 4: ,zz ., 'A A K W - 1,1 11 I w 'H f. . 5- 1 ' za ' 1 1, - - 'f ,451 :lv 1Y'. , 4 35:2 . 1.1 11 gy , .f,, I wi-Y ,1aE,f.1. 1 i . .1211 liflf-T U4'7. 5151: D 5.3- . , vin 1, me i ax, i A L' S ,1 ' P 'M-l:'1 1115 Q: 'br 2, gi. H+ H 1 nc- f'41,w :Q 1' fb H. . 1 X gf -X, f-PM V sr r X HX f Xs. ,H xl 'rXf, X X -.- ,W- .I 5- 32,1 ' . V ' L f .T li 7' ' ' - X. -V '41 l ,. .Nr ,. 1 hgh X, X Ulf,- Xj 'J.- ..w, 1 6 ' , fx XL., 'X- XXQI- 'XT S , jg W X im, ja .E 'Q ,. I ' . AJ- , ' X. H ,.,.. 15 , . ' - '-r 1, 1 . -' X ' K- 'I 'it vi, , 1- . Q 4' 1 F x 5 ', .,,. X, 5-. ,, , ffvjr 5 'Q ' I . X A . ju . H 'T ag ' ' .A - ' HX ' 1 ff' ilk sf 17 1 P.. X V-5 -3 YIXFETQ, J X. ' X Q. r X + QQ: 'H-f ' 'ii X, 15, Xi' 1 ..,,- . 1 X XXX -.1 , .X, X ur4,xv:.,X. E-, 3 X ' - 4:9-,, .X Qax fa' . 1 ,jj '4,,. -X 71:11. rr - R L I Y, .qs X 155, W-,X X, , f 'V 'L K f' ,!1I'lZ X ' -5,34 , , Q , X5 if V My xr. V. , V. '1-M, A :..A QQ. 1. ' -f 53 X Q-ef' I r 5,44 ji: 'gf'-' Wg, Wg' ,if . ,l 1 X , , ?-. X -- .- -1 Y- . . uf XX. ,Nh . K, . .-.r., X, 5 N511 CW' YQ., 5 -L N X' L ' ,U ,X . ,,,X f , J ,Q ', ' 4' , 1 -' A ' 'VT .. s g. ' 1, XX . X nw L + Q 2, X 3 'ia ..:l1,: .' jrf 'LYN- f .Xy ,X 1,57 . .gl Y, -Q , 1: 1-L... f' -C, fag. ,Pi ' ' 'X-Y ' 1 V IJ, l M I ,- 11 : yn, ' . .X wr T- . ' . A . 1 fi, I: + f'?qX. gl 'JV ,ff I n 5,1 X fa' Y . , X ' Kiwi. ,Nr sy - -1 ,, M: .I-' :tQ.1,- N 5127 2 .i,' -up ,X . 52, ' 'P ' L 1, :V Q2 1. f 5 , ,Jr iff, :fi . K. Q , VFQ11 .fi . -. ' ,.' 5' - ' -. ' Q' ,Q-X-.2X'3,,, .,, . - -:Lf ,,w,X , .X W X 'Xu-'4..fx.X15N . 1' Dv'-fX .ff ' Wg , L nf' ,-uw .. f ,J 5 : -vnfi X 13,4-gn - .... A-+L' Tr H 39,13 ,-ff-Ffh, 1? H. , -X5 ff 1 A A -' ,aj 'Hifi . ,. --,jfvpf A V , . 1,,?,.f, ,X XI ' 'T 5: HM: W. H ,J ,. -W. 1 1 X-p,.1-x: ,, 3' Lag.. ii. m.z+.s:....x.f,..n... A .wr f QL, JH i '- ,rg Ls nl n f W 1' , , J 1 , 1, ,, 5 , . fpf, 'N' ,1-. F 2 Q , , , Amr'-', fi fin? fir. .. ' M:-Qi -' sn i ' ' :,,,,f,',n -4-J , , , 1 A - aw ,fig 1' gg Q . W -. - . .. '. .'vFs3g,' r , 'Z' Jffwifmf. ' WEL.. .', V .V cb 1 W? 4,,, V' 4 51 'V - if-, , fm! Y aw .fdq-'qfifi k,. W: . .,flf,aqi Q ff K '5H5Q- '.,'ef1 ' Yr 3- ggTg!'f?fa-.,f'a sl- If fb, -Q. . . --.n, V - 'vu-Ef. --as JI' 1, Q, ,yup 'Rf -.1 .' e w 3' 1 ' V.. v 1 1 ,W 113 V fu 2 Q22 X .sg .gs js r' 14316 L v., , -1'fzLfMf Q , , f,vg,.MEX1 1 . 'Fir sf ff f wgligfflf' H W LL ' 4 - -Q.. sf , . . 4 6.1.1-if .-Y gl if 5 wig.. -' ?FQy'u Q 721- J. -1 'Nw ,, f 'L+ ' 1',f 'iv ' 91- ,4'X7- MF, Q- A1 MJ , Ms,..1. , V-'H' UST? 'QA ' qi. 75,1 , , Q .,. ,, 1,9 1 , .af 5 Hy, v . Jag? fr' - Q wp 1- 'xirrbf 6 .2 - . Q , A 1 :w75 V!j:g.x '. ,fm . ln X ' F - 'a ,,, . U, , , ' P 75- ,Q f .,, , ,f , -, ,si-.. ,,, 1. 1 V 11 5, , .iv-'-.., ,A 3 , H xml. 1 'm?Q n' ' ' N-Gfij. ,, 7 U, ., fi ,- QL. .X Q' . wi I ' 1 H ' v 1' w 4 5 'Q ' 1 Af f 1 w 'S i 4 ?w ' + .A Lx 1 t , N , , W: A ' -J,wr..fM2' z , f nu'--4, JZ , . j,...k 43' 3 Y , ,N- R. 1.4 .evrwy W IX. yd-. vw . , ,. 4 ' 3, Q55 .W M3551 L , im . WH., -1 . . -a BAKER, jor-ras, HAUSAUER, mc nuzF.xLo, N. xx THE RIVERDALIAN I 9 2 9 V 'V V if H I iii? 9,22 9.3 9,29 93 9,23 916 9,5 9,26 923, 916 9,3 9.23, 9,3 9,16 915 95 934, 9455 gi I V QWQQWQQWQ r ' ' 1 Es 43? , . 'J N Q ff 424 sf '54 14 ff T51-IE qw , V sf N Q rf 43x Y El' K ig '5 qi , . 53 454 I g N v rf 455 , . 53 v v 464 , , 'J 9 V Q If 434. , V E3 432 , V af N L' , V Q A N N U A L qi 23 454 I E3 454 r . OF THE Es 452 , . E3 R V S 454 K, Q, I ERDALE CUNTRY CHCCL ., 207 494 L Rf J , V f N x Es 43? r fQ x ?3 v v 455 f r N 1 '53 V 435, f gf K 13 75 434, f gf 5. xg Q V 1 VI W f O UIIIC 22 fy '1 xr D I r N 1 E5 432 52 435 K 3 ' 5' M D C C C C X X I X ' 42 44 fl xr D Y gr N ml 75 f 1 45N UZQSOASMSMGMEONUASUNMGMSUNONMSUABONONOASUN Qt we Src ere we 'src Src we we its we Src 'arc Src we Src we :Ye Src DEDICATED LEWIS WINTHRQP CLOUGH X as a tangible demonstration of our X appreciation. From his sympathetic reactions and his constant endeavf or to guide erring boyhood there has been born a definite realizaf tion of hfe's great Problems. He has filled a great void at Riverdale oo. o'ooloo. 0 Jllllk LCDC5 O' UD' UE'GJ.!9'GJ.UC9.l9'C9.EJ'GJ C9WI9 ' 9 3 9 59 Q ' 3 Q, 9 H1 9, O IQ Q 9 3 59 9 9 9 3 6 Q is fl' .oo.oo.oa.oo. v:::':.oY:.o':' CP Of CX GI. O, ON GJ OT- CT Cz C5 OJ OJ O OJ, 'O Q fO 0 fro fC O RO fO fO fO XO U0 JD OX OYO f' 7W??1?QfdQHW? QOQ, ' QQ f 3? O Q n I 0 Of f L9 Cy 'O OJ oi I +-o G 1 QI 0 ON Of Q A QQ O G' 4 QQ 0 o-4 C' TO GJ C, KU Dx, , Q CN XO FVQVRVEVWVQVRVD gg :ga Age :ga :ga :Ja as :ga :ga as :ga nga as as as gg almwwwmwwwwwmmmwk 'J It V WJ zs as ef '- a sas 22 . 4g5 jf HE reatest da s of our lives are D 22 ' ff! f- .r 9 our carefree school days. It is P I It ' Nj E5 the aim of the RIVERDALIAN to keep sas E5 our adolescent impressions and our 435 l . , , J Q, first achievements ever vivid. D -C7 . . 42- Nothing could he dearer to River' D 'I E3 dale students than a means of conf 434 53 tinuing or refestahlishing half forf egg gf fm otten ties with their Alma Mater ., pf' . . . fgi 3' e the birth of a real a reciation gg . 4ga f- of things that formerly seemed so P 33 commonplace. GI If this book sucf iii 52 ceeds in this, its mission,we may feel ogg l . . J K, that our efforts have not been in vain. ,Q Pf 434, K e3 44 f,ZZ5 UkN5Uf5 CfDCflh5Ulh5CfJh550xN5CflEC0xN5 5yi2d at are Src we we we we are are we we :Ye are are are if X419-' WW Board Of Trustees GEORGE MCANENY ...... . President CHARLES EVANS HUGHES, JR. . VicefPresident RICHARD W. IJAWRENCE . . Treasurer HENRY GREENE HOTCHKISS . . . . Secretary ARCHIBALD DOUGLAS ANTHONY CAMPAGNA JOHN W. GRIFFIN EDWARD W. FREEMAN FRANK S. HACKETT . . Founder and Headmaster AE A-whdwrhrhrhrh rhrF.f+1rhrhrhrhAx 'E E f -E IE E E 6 JE E -6 -E 'E 'E -6 -E -E E 'E f 'E E 6 6 E E f 6 -6 rhrhrhrhrhrivfvhrhrhrhrhrhrhrh rh rh rhrhrhrh rhrhrhrhrhrhrhAwrr'Whrfxrhrhrhrhrhrlirhrh Ten ASSE ?y WKV'-PYPWWWWYVWWWWWWWWNP'-PMP'-V'4 4J'4J'4J'-V-VNV'-V'-+ i-IJVPYVNV -V41 NB if , uv, FRANK 5. HACKETT. He.1d1naster rTNrhrhr+xrhrfvfYh1'hfhfhfhrhrhrhrhrh fhrhrhrfwrhfhrhrfwrhrfxANrhrfWhrhrfwrfwrhrhrfwrfwfh1fmfx Eleven iii fhrhrhrhrhf ffwrhfiwrhr?-.rh.+mRw XE 5 E E f JE 5 'E E 4E 15 15 E -E 'E E Q 5 -E -E f AE E -E 4E -E -E E 'E -E -E -E 'E f -E 'E E l?f?hri-.rfifhrhrhrhrhrhrhfh gg :ga as :ga :Ja as :gm :gc as as an :ga :ga gg CSNQNQQQNQQWQWQWQWNQQWNQQQWS CONTENTS CLASSES ATHLETICS SCCIETIES ACTIVITIES CCNTRIBUTICNS ADVERTISEMENTS X- IAIIAIIEIE XXX X xx X wx X X f X gwxm, ,EEF ,WLM Ls eff f Ll X WW U4 N fx K 15 fy l l 3 -fVVXf N Tm 'TZ-2,1 X Wm 1 U U t5?uXg M H wwsvsvlvwww-vwwwwwwwwwsvsvwwwsvwwwwwwwwwwsvwwwsetwg DANIEL EARL GARDNER Mr. Gardner is another whose name is on the list of those who have taught at Riverdale a long while. He graduated from Calais High School in 1909 and Bowdoin College in 1913 with an A.B. degree. He has taught for some time at various schools, namely, Washington Academy, one year, Hebron Academy, two years, Tabor Academy, two years, and Wilbraf ham Academy, one year. Late in 1919 he came to Riverdale as an athletic coach and Latin teacher. This year, however, Mr. Nash sucf ceeds him as athletic director. At present, he is Assistant Head Master, teaches Latin and is a faculty advisor of Delta Phi Sigma. ROBERT C. MURRAY Mr. R, C. Murray has watched Riverdale grow now for hfteen years. He graduated from Amherst in 1910 with an A.B. degree and then from Columbia in 1912 with an A.M. degree. Riverdale is the only school at which he has taught. He came here in 1913 as Senior Master and instructor of Ancient and American His' tory which positions he holds now. He is also a faculty advisor of Theta Phi Fraternity. rhrhrhfhrhrtvfvhrhrhfhrhrhrh rhrh rh rhrhfhffwflN7hrhrhrhrhrhrhrt'i7hrhrhrhrlwrhrfvfxrtwrf x Fourteen Avhrh A-dwrhrh.4-wh As rhrF-Rh -E -E E 'E 16 16 -E -G -E E -E f -E E JE 19 E JE 'E 'E 4E 6 if G JE 15 E f 1E -6 -E E E E f f f at SPH-' WSP 'PWWWWWWWWWWW.WWWWWWWWWWLPWWWWWWWWWYWXEIXE FORREST W. COBB Mr. Cobb obtained his B.S. degree in Chemif cal Engineering from Tufts College in 1918. In 1928, Harvard gave him an Ed.D. degree. Im' mediately after his graduation from Tufts, Mr. Cobb was connected with the Waltham Watch Company as assistant chemist for four years. During the following year, he was Principal of the Pembroke, Mass., High School. The next two years he was a science teacher in Dean Academy, Franklin, Mass. He came to River' dale as Science master in 1925, teaching Chem' istry, Physics and General Science. He is also a faculty advisor of Delta Phi Sigma Fraternity. MARC L. BALDWIN Preparing for college at Broaddus Classical Institute, Mr. Baldwin graduated in 1908. From there he went to Bucknell University, receiving his A.B. degree in 1911 and an A.M. degree two years later. Then he did graduate work at Corf nell, Columbia and Munich. In 1918 Columbia University awarded him the Karl Schurz Fellow' ship. He taught for a year at Mercersburg Academy and for four years at the Hill School and was, for the same period of time, a member of the Germanic faculty of Bucknell University. In 1922 he came to Riverdale to teach Latin, German and Spanish. He is also a faculty ad' visor of Theta Phi Fraternity. rhrhrhrhrhrhdwrhrhfhfhrhf+1r+wrhrhr+srhrhrhrhdwrhrl1rhfhrhrhAwrh,4wAwrhffviwrhrl-.rhrhrhrh 9 9 9 9 9 9 9 3 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 3' 9 9 9 9- 9 9 9 9 9 9 3' 9 3i7ErhrhrhrhrhrhAwrhrhfhfhrhA-urim+1rhrhAsrh Fifteen WW WW 'WWWWWWWWWLVLPWWWWWWWWWWWNVWWWWWWWWWYWXKQ IRENE M. .GUINEY Mrs. Cuiney received her high school educaf tion at Truxton High School. From there she went to Cortland State Normal and Teachersl College and now has two degrees, a BS. and an A.M. Her previous teaching amounts to English at junior High School in Warren, Ohio, and History and Geography at Hawken High School in Cleveland, Ohio. T. DONALD MCCREARY Mr. McCreary graduated from Manual Training in Brooklyn in 1921. For two years he was at Amherst College then turned to teach' ing. He taught at Litchfield School for a year, then went abroad to Ecole Normale d'Instif tuteurs in Le Mans, France, as student and instructor in English, returning to Litchfield for another year of teaching. This is his third year at Riverdale where he is at present Head of the French department. Sixteen -E -6 5 'E PE if 'E E -E -E 'E E -E -E 1E 'E 4E E E E 6 E 'E A-rhrh 5' 5' 3' 3 5' 3- 5 5' 3' as 3 T 5' 5' 3 3' 3' 5' 7 9' 5' 5' 9' 3 3 5' 3 5' 3 3- i 5- 5 Slasfsmmmmmmmmmmasmmfhmfsmmmm PW SPH! J. WILSON MURRAY Mr. Murray's name has long been connected with Riverdale, this being his eleventh year here. In 1905 he graduated from Piqua Ohio High School and four years later from Princeton with a Litt.B. degree. He has had teaching ex' perience at Dr. Holbrook's School in Ossining, Gilman Country School, Baltimore, and Har' vard Law School. He teaches English and Latin to the first two Forms and coaches tennis. GEORGE ROBERT PRATT Mr. Pratt comes from New York having been educated in the High School of Herkimer. After he graduated from High School, he went to Union College where he received an A.B. def gree and also his letter in football. Last year he came to Riverdale for his first teaching. He taught Algebra at that time and this year he was changed to the English department. He is a faculty advisor of Theta Phi Fraternity. rhrhrhrhrhrhrhrhrhrhrhrhrhrhrhrhrh rhrlTrhrhrhrhrfwd1rfwrlxrfxrhrfWhrhrhrfwrfwrhrhrfwdwrb Seventeen rhrhfhrf-1 rhrhrhrhrhrhdwrhd-rh rhrhfhfhrhrh rhrlwrhrhrhrhf+irhr+wrhriwrhrf-sf+1AwrhfhAwHHrh Aw rf-rhrh rhr+-ml-xrh rh rhrhrhrhrhrhrhrh gldxrhrhrh WWW P VWWWWWWWWWWWLV'-V':VWWWW WW'-l4WJWNVH!kVWWNAVWWWWYP'4iE JAMES E. FRAZER Mr. Frazer graduated from Cal-:wood School in 1921 and spent the following year at Earlharn College. He graduated, three years later, from Cornell University having a B.S. degree. While at Cornell he made the crew and was a member of Alpha Zeta fraternity. Before coming to Riverdale he taught a year at Trumansburg, New York. In 1926 he came to Riverdale. He teaches English, Geography and Nature Study in the Lower School. CLIFFORD THCMAS MCAVOY Mr. McAvoy is almost a resident of River' dale having graduated from Barnard School in Fieldston. ln 1922 he graduated from Columbia University with an A.B. degree. While at Columbia, Mr. McAvoy received his letter in football. During the summer months he has been connected with the Conservetoire Amerif can in Fontainebleau, France. WS E rE LE E rhrhrhrhrhrhrh fhfhrhrhrhfhfhrhfhrh rh E E E 'E E LE +G 15 E E 6 E E E E E 'E E E SQ E E f JE E E 45 f as rhrlwrgfhfhfhrhrhrl-rhrhrhrhfhfhrhfhfhrhfhrhfhfhrhrhrhrhrhrhrhrhrhrhrh f.Nf1Nf,NflN Q Eighteen W W WW WWWWWWWWWWWWWWW GEORGE R. KERNODLE Mr. Kernodle is another new member of our faculty and is one of the few Southerners in the School. For a period of three years he attended Alabama Polytechnic Institute, then went to St. Lawrence for his Hnal year receiving a B.S. degree. From that time until he came here he has been doing postfgraduate work in the drama department of Carnegie Tech, the Graduate School of the University of Chicago, and Columbia University. He teaches Public Speakf ing, has charge of the technical end of the stage productions and is our librarian. 9 4 C MAXWELL ARTHUR HEATHER WAKELY Many need not be told of-Mr. Wakelyls reputation as a scholar and as an athlete. He graduated from Stephens High School in 1923 and went to Bates College in Maine where he graduated with an A.B. degree in 1928. He was a Cum Laude and Phi Beta Kappa man. He was Captain of his College's National Twofmile Relay Team and was the New England Quarterf mile Champion. ln this, his Hrst year here, he teaches Geography in the Lower School and is one ofthe track coaches. He is a faculty advisor of Theta Phi Fraternity. ffNfl1flNf+1flNflNflYl'XfhflWflW flWfhflW rhrh rh fhfhfhrb fb rhriwrhrfirfxrhrfwrfilvhrfxrfvlarfarfx dw rfwlw Nineteen rhrhrhrhrhrhrhrisrhrhrhfhrhd1r+xrhriwr5wrhA-irhrhAwrhAwAwfhAm+v+ir+sd-whrhrh rhrhfhfhrhdwrhrhrhrhfhrhrhrhriwd-A-wfh 3i7hrf-irfwrhrhrhrhrh HMP WV VKVWWW VWWNVWLVWYVYIWVLPWWWWWWLVWPIJWLVWWA-l'hVWWLVWW'l'EE CHARLES K. McNElL A new faculty member is Mr. McNeil, a graduate of the University of Chicago. He got his Ph.B. degree in 1925. Over a period of two years he taught lvlathematics and coached athletics at Edgewood School in Greenwich, Connecticut. He teaches Math here and is a faculty advisor of Theta Phi Fraternity. R. C. HAYES Mr. Hayes is another newcomer this year. In 1922 he received an A.B. degree from the Unif versity of Illinois and a year later an A.M. degree from the same place. He has also a certiff icate from the University of Paris. Mr. Hayes teaches Erench in the Lower School and directs all stage productions. cr fisff-fl-fhff-vhrhfhriwrfrhdwrhfhfhfhrfrhrhrhdwrfxdwdwdwrhdwrhrhrhdwdxdwdwflifiwrhrh V Twenty WE E vE E fhfhrhrhrhrhrfsfhrhdwrfwriwfh fhriw flwrhfh 46 E E 6 E 6 6 E E f 6 E 6 f f fe we 6 e ve f Q t f f f f 4 f 4 -s f O. RUSSEL LOCKE Mr. Locke is also a Southern gentleman, hailing from South Carolina. He graduated from Piedmont Academy in 1918 and attended the College of the same name where he was a member of that wellfknown College Quartet. However, he did not graduate but came to New York to teach and study music. For Eve years he taught at Bove School in the city and at Yorkville Music School for two years. He has graduated from the David Mannes Music School and studied under Ginlio Silva, Frazer Gauge and George Hotchkiss Street. It might be added that Riverdale's success and interest in music this year is due to the persistent work of Mr. Locke. as l A B. W. BARTRAM Mr. Bartram, our Manual Arts director, went to Fredonia State Normal and Rochester University, graduating from the latter with an M.A. degree. Later he did extension work at Columbia and New York Universities, spending two years at each place. Prior to his coming here, Mr. Bartram taught Manual Arts and coached athletics at Trinity School, Woodmere Academy and Bove School. Twentyfone rE?wrlwrhrhrhrlvhrhfhfhfhrfwrhfl1rl-1rhrhrhrh rhrlvhrhfhrhrhrlwrhrhrlwrhrhrhfhrhdwrlsrhfnrhmfhrtmrh rlwrhrhrhrhfhrh 3 3 3 3 3 3 2' 3' 3 3 3 3 3 3 3 3 3 3 3 3 3 3 5' 7 3 3 3 3 5 3 3 3 3 3 3 3 3 3 glasfsfwsmfhmasm W W W3-' I-VLVLVYP PWWWWWLPWWWWWWWWWWWWWWWWWWWWW WILLARD L. NASH This year a new man took over the reins of athletic director and he is Mr. Nash. In 1919, Mr. Nash graduated from Central College, Fayette, Missouri, with an A.B. degree and from Springfield College in 1923 with a B.P.E. degree. From 1919 to 1927 he was Dean at School of Physical Education at Soochow Unif versity in China. He was assistant athletic director at Lawrenceville during 19274928. DANIEL C. CAREY Mr. Carey was born in Quincy, Mass., and received his A.B. at Boston College. He was an instructor in English and History until the war. From 1917 to 1919 he served as first lieuf tenant of the Infantry from Officers' Training Camp, Fort Sheridan, Illinois, and then for a year and a half with the French Second Army and American Army of General Bullard. He came to Riverdale as registrar and business manager in 1919 and remained with us until 1925. He then resigned and in September, 1925, he was appointed treasurer of the school corporation and business manager. He is also faculty advisor of Theta Phi Fraternity. 5 -6 E -E -E E -E -E Q QE if 'E -E -E -E 'E +G -E 'E -E -E 'E -E -E -E 'E E Awrhfhd-sdwrhrhrhrhrhrhrlw fhrhrhdwdwrhhwrfxfhfhrhdwdwdwdwrhrhdsdw rhrfwflnriwrbflwllvhffwrfxfhrfwrfwffw brhlh 1f1ffwffNff3rfiffNffxrhrhr'hr5fl'xf57lNflNff1fl'NfI'NflNfl iff xrhfh Tu'ent5'ftu'0 ZH YVWSVSPNPYVWWWWLVWWWWWKPLVLPWWWW W W W W'-VSVYBYVWWNQAVWWWWKVVI-ite STERLING CALLISEN Mr. Callisen graduated from Princeton in 1920 with an A.B. degree. For two years he was at sea, commanding the collecting yacht for the New York Aquarium. In the latter part of 1921 he began teaching Mathematics in the Lake Placidflfilorida School, and then spent nearly two years in Africa. Again teaching beckoned him and he taught Mathematics for a year at the Asheville School. Last year, he came to Riverdale as head of the Mathef matics Department, which post he holds now. He is a faculty advisor of Delta Phi Sigma Fraternity. NATHAN HALE Mr. Hale graduated from Union College in 1922 with a Ph. B. degree and then did two years of post graduate work at Harvard. He taught at Mr. River's School for Boys until the fall of 1925 when he came to Riverdale where he has been teaching English and History in the Lower School. HAROLD ELLIS KLUE Mr. Klue graduated from Geneva High School in 1923 and Hobart College in 1927 with an A.B. degree. He got an M.A. degree from Columbia in the same year. At Hobart he made his letter in basketball and he is responsible for our last two Varsity basketball teams. Mr. Klue teaches English and History in the Lower School. r+RFhrhf1wrhrlxfhrhrHfhrhrhrhfhfhrhrIvhrhrhrhfivhrhrhrhrhrhrhriwrhrhrhrh rBfh fix rh Twentyfthree 6 E +G SE 46 rhrhrhrlvl-sfhdwfhrhdwrhrhfisrhrhrhrhrh rhrfwfh fhrhrhrhfhrhrhfhrfvhrhrh rhriwrhrfwriw rhrhrhrhrhrhrhrhrhrhrh KV W SVEV WWWWWWWWIWWLPWWWWWWWWLPWWWJNVWJWNHWWSVWHJNBW ETHEL ATKINS Miss Atkins is a graduate of Teachers' College. She is one of the few veterans of the School. In addition to teaching Arithmetic, she is Head of the Lower School. JOHN A. BROWN Another new master in our midst is john A. Brown, who was graduated with an A.B. degree last june from Oberlin College out in Oberlin, Ohio. Riverdale is his first experience at teaching. He teaches History in the Lower School and is a faculty advisor of Theta Phi Fraternity. RICHARD MCCLANAHAN The head of our Music School, Mr. McClanahan, was educated in the Middle West. He graduated from Rushville Indiana High School in 1912 and four years later from North' western with an A.B. degree. He then studied music under Percy Grainger, Ralph Leo' pold, M. Liszniewska, and Tobias Matthay fLondonQ. He has taught here since 1918 and privately at Steinway Hall. DALE BARTHOLOMEW Among the numerous newcomers this year is Mr. Bartholomew. He is a graduate of Ohio Wesleyan in 1927, having earned his B.A. degree, and also of the Ohio Wesleyan School of Music. Mr. Bartholomew is at present studying at the Juilliard Musical Foundaf tion, in New York, His 'lMusical Appreciation Course has recently attracted much interest. fb fhflNl'l1f'l'iffNfhthl'hf'l'Nf'hfhfl'Xf'l'Nfl1fl'1 rh fbrhr'hrfTrhrhrhrhrhfhrKrbrfTFhrlNrhrhrhrhrhr+x fhrlw Twentyffour M42 4 ar' ? 1 -1 di 'fd i s E h -L. 4-'M-4...- x A Y L 5 f?-I S.. ' X I QQ WJ? M SIXTH FQRM 'siilfklfkllWKVWSVW'-VWWWWWWW'-VNVHVEVWWLVWWWWLPWHJWWWSVWJWWWWHIW' l C G1BsoN FULLER DAILEY Gin VicefPresident Senior Class, 528329 Football Squad, '27f'28 Basketball Squad, 127328 Swimming Team, 127328 Tennis Squad, '28 Art Club, '27f'29, President, 528329 Clee Club, '27f'29, VicefPresident, 528229 Quartette, 128',2Q Review '27f'29, E:litorfinfCl1ief, l28'2Q RIVERDALIAN Board, Art Editor, 128'l2Q a Student Activities Association, ,28'l2Q Riverdalians, 527329, President, l28'l2Q Orcl1est'ra, ,27'l2Q Music School 2'7'l2Q Delta Phi Sigma, 127929 lt has been whispered about that Gihl' has been living in our neighborhood for some time. He has given us the beneht of his company for tvvo years and we wish it were more. His rise in our midst has been meteoric. He has at some time or other indulged in almost every activity, and during the past year has guided the Review through a stormy but very successful season with a master hand. He has handled the fair sex with adequate smoothness to gain him a reputation, so his record is absolutely complete, Needless to say, We wish him luck at Yale Sheffield. 3 f 3' l ? l R, 3l I it i 0 rhfhrhrhfhfh rhrhrfwrfwrhriwrhrfwflwflxrixriwrhriwrhrixdwrhrlwfhrhrhrhrhrixrhrhr+xrhrhrhrhr?wrhrixfFlg f f ti 1: 6 JE 'E E E 6 f if 6 -E firlvg 917krh'ri'wrfwrfwfhfhriwdwrhfhrfxrhdwriwfhrhdwfhrhfhrhrhrhrhrhrhfhrhrhrhrhrhrhrh rlifh rh rl-s Thwtyffour QE EPWWWWWWWWWKEPWWWWWWWWWWWWWWWWWWWWWWNJWWWWWW 3. 'E E 3' as Z A Q E 3 HARRY FRANCIS ROBY DOLAN i -Q 3 Cozy 6 9' E 9' Football Squad, '28 Q 3' Hockey Squad, 329 E 3. Tennis Team, ,ZQ E 3- E 3 E 9- E 9- E 3 E 3' 5 3 'C 9' 'E E 31 we ? E 3' , E 9 45 3' E 3' E 3 -E 3 Harry came to us from that noble town known on the maps as Boston, for which he E Q- didn't care beans Cdonlt shoot, misterll as compared with Riverdale. Always quiet and AE 9' unassuming, yet ambitious and determined, and oh, so good natured, who could help 5 3' liking him? He seems to be a tennis player, not to mention hockey, but his besetting sin is a 'E ro ensity for liver pills. f 3, P P E 3 Despite the fact that he has bean with us only one year, we have all grown to like him, f 3' and we sincerely regret that at the end of the year he must return to Cambridge to attend Q 3 that Mecca of the Learned-Harvard. E 31 E 9' 5 Q , fe 3 he at 'F 0 Cx' E 9 ie 3 j 'E 9- 'S Q' J E gl twig' f 3, 45 ? f 3 'E 3, 6 9, 'E 3 a 5 Tliirtyffve 333 WWWKPKVKVWWWWWWWW'-VLVYVKVWWWWW WWWWWYWWWWWAIJWWWWWW PHILIP SIMON DREYFUS uBARNEYv HREDqa Science Club, l28'I2Q p Soccer Squad, '28 Red is another of our foreign relations. I'Ie landed in our mist with 11 'kpineapplew in his pocket, so we knew he was from Chicago. This, douhtless, helped him, for finding him' self in ii peaceful C73 country once more, his inferiority complex went and hid in ai corner, and his true worth and sterling Caihj character hecame evident to ull. Though l'Barney has heen with us only a short time, it is ohvious that he was welcomed, for his auburn locks show none of the traces of gray which the careworn Freshman should have Lifter the heterogeneous conglomeration of puzzles to which he is subjected. So we hid him, we hope, only auf wiedersehn when he goes to Yale Sheffield. 3 I 13 rfwfkflqflTflWf'lNflNf'Wf+'Nf+xfl'Nf'l'ifl'Wf+Wfl'Nf+Wf'lWflNf'lWfhfl'NlfXf+NflNfl'Xf+WfITfINfhffNfIWflNfhf+X fgfh FIN rh Tlizrtwfsix 'E 'E +G 'S f ME E f 'E 'E 6 6 f E E -E 6 JE JE 56 'E rh rhrhrhrhrhrlNrhr'hrhrl'mr'hrhrh rhrhrhfhrhrhrhrh fhrhfhrhdsflxfhrhrh KUWWWWNPWWWWWLEVYVWWWWYVKVLVEUWWW WWWLVWWWSVWLI-AVS!-'WWWWNIJ RICHARD EDWARD ' VAN ALICANTE KAUPMANN HJAKEM HDICK., RIVERDALIAN Board, Photographic Editor l28'l2Q i 'lReviewl' Sports Editor, 126:27 Student Activities Association,'28729 Forum, l27'1Z8 Orchestra, l26'l2Q Dramatic Association, Chairman Dance Committee, D.A., 728:29 Art Club, l26'l2Q Riverdalians, l28',2Q Relief Society Chairman, 128,29 Cheer Leader, 128:29 Treasurer Senior Class, 128129 Chairman Senior Prom Committee, ,28's2Q Library Committee, 129 l Varsity Soccer, '28 C l Varsity Hockey, '26f'29 Swimming Team, '28 Fencing Squad, 129 Baseball Squad, l28'l2Q If in doubt, do a tap dance. During the past year We have been entertained at various social functions by the slapping of his feet on the floor. He has the honor of being at River' dale longer than anyone else here. During this lengthy stay, he has played baseball, hockey and the banjo. A new instrument was brought into the chapel orchestra when the il' lustrious Dick entered with a Swanee Whistle. He is chairman of the Relief Society, not to mention photo editor of this Book. For further information, peruse above voluminous list. Riverdale will be much poorer Without him, so in parting we wish him success at Yale Sheffield. Qgggefe 3' Q! as ea f 'l'Aig2ajAP a C WW 3i7lsrf-sFhrlwrfwrhfiwrlwrhfhr+wrhrhriwfhfhrl1f'hrlwrhrhrhrhrhrhrhrhrhrhrhrhrhrhrhrh rhrh rhrh Thirtyfseven rhfhrhrhrfwfhrfwrhrlxrhrhrhrhrhflwrhrhrhdwrhrhrhrhrhrhfhrhfhrhrhrhrhffv1wrbriwrhrhrhrhrhrhrfwrFlg rfwr'l'vfxr'hk-IR 3171-sdwrhrtwrhrhrhrhrhdwrhrh 8 'PW WKVWWWWWWWWWWWWKPNHSJWWWW WWWWWWWWWWNIWWWWWW JOHN HOLLAND NORRIS NSLIM--i Baseball Team, l28'l2Q Basketball Team, l28'l2Q Varsity Club, 128329 Athletic Council, 128:29 Theta Phi, l28'l2Q Football Squad, '28 Secretary Senior Class, l28'l2Q Long john is one of our most conspicuous figures. Outside of being a bit taller than the rest of us and owning a Packard and a few more autos to play around with, he packed a Wicked fast one when he pitched to us on the ball diamond. We found out too late. We suffer from the common fault of wanting to find something to slam about this not ill' natured gentleman, hut here we must he disappointed, for our most intensive researches bring us nothing. Therefore, we may only gaze up at his classic Grecian countenance lvoted the best in the schoolb and bow humbly, wishing him the sweets of life when he commits himself to Princeton. it 3 aff E. X lm'Iff17- N 3' Jie cf AsrihfhriwrhfhrhrhrhrhrhrhrhrhrhrhfhfhrhrhfhrhrhrhrhrhrhrhrhrhrhrhrhrhrFfhr+xrh Q Tliirtyfeiglit 'E vE f -E 15 E 6 6 f 6 E 6 JE 6 6 E rhrhrhrhrhriwrhrhrlwrh rhrhrh fhrhrhrhrh E E E E 6 E E 6 12 'E 6 WILLIAM GILLESPIE PEARSON ' MBILLH Varsity Soccer Team, '2 T528 Captain, '28 Clee Club, ,26'12Q, Secretary, ,27il28 Delta Phi Sigma, l26',2Q, Secretary, 126:28 Forum, '26728 Frencb Club, ,26'l28 Dramatic Association 127328, President, '28 Review Board, Managing Editor, '27f'2o Baseball Squad, 127 Swimming Squad, ,28'l2Q Sunday Cliapel Committee Secretary, 12Q Student Council, VicefPresident, l27'l28 President Fifth Form, 127:28 President Sixtli Form, 128'12Q Bill has been in our notfsoflittle circle for a number of years and has endeared himself to us so much that We almost hope he has to leave college, so he can come back again. Yet who shall dispute the judgment of the gods? As President of the noble Class of Nineteen Tvventyfnine, he has acquitted himself with honor and commanded the respect of every' one. Cne of our leading Wits, his sarcasms were frequently painful to their targets. He seems to be somewhat of a mariner, and his softlyfmodulated voice, developed through the medium of the Glee Club, has a double charm for those listening to his tales. So it is in his dealings with the weaker sex-We know. So We part with him regretfully, even though he goes to Yale. 5' 1 I, 5, QFD, in riwriwdwrhdwdwrhrhrhrhrhrhrhrtwrlwrhrhrfwrfwrhdwrlfiwdwrhdwrlwrfxfiwrliiwrixrfwrixffwrlwrfwrfwrfxdw Tliirtyfnine t as f f -e f -e as as 'E 'E f -e -s f e 'E f E 'E 'E -E f f f Q f f f fe as f we 4 f f f -e rhrlwrl-w+wr+1rhrhrhf5li rfvl-srh.4wrhff-Q rhrhdwrhdwrfadwrhrhfhrhrlwrhdwdwrhfl-mdw gl?ft-.rhrhrhrhrhrhfbrhfhfbrf-urhrhrhrhrhriwdwrhrhrhrl--A-.rhrhfhrh 33'WW W WWYVWWWWWWWWW WMV'-IJWYPWHIJW W WWWWWWWWWWWWWWWW BEVERLEY ALLEN SNYDER Bw Football Team, '28 Varsity Club, '28f'29 Glee Club, l28'l2Q Be introduced, then, to the original boy from the South. L'BeV came up here nothing but another new boy, but oh, how he has changed. He is our star football player and is not such a bad track man, either. And as for technique- he makes us Northerners get really Worried about our ability to hold on to those earthly inhabitants known as femmes. He is the Schools embryo Lindbergh, having some twentyfhve hours of solo flying to his credit. He isn't such a dumb guy either, and will graduate with about seventeen credits to his name. With a record like that, how can he help but be successful at Willianis? uf, 3' O I 3- ? 3' f l 37 uw' l rhrhrixfhrhrlvh rlwrhrlsrfwrh rhrh 6 E 'E 15 E 6 f 15 f 6 E 6 E JE E 6 wi JE E JE 4 AiFi'wr+wrhfb-fhrhfhrhrhrhrhdwfhdwdwfhrhrhdwrhdwdwrhrhrhdwrhdxrhrhrhdxrh r'5Fh rhrh Forty S iW ?fXw V W YXR XXX 7552 M VW WW, ff f fm L 5 ,f In UNDE RGQRADS ivmv , FIFTH FORL4 WW '-PEP WWWWWWWWWWWWWWWWWWWWJWWWWNJWWFVWWW'4' -Hfifxkfg COLMAN H. BENEDICT Dramatic Association, '28f'29, Science Club, '28729 GORDON BIEHN Varsity Soccer Team, '27f'28, Varsity Tennis Team, '28, Junior Varsity Basketf ball Team, '29, Science Club, '26f'29, Secretary and Treasurer, '27f'29, Riverdale Review Board, Sports Editor, '28729 GRAHAM CLAYTOR, JR. Science Club, '27f'28, President, '28f'29, Forum, '27f'28, Dramatic Association, '28f '29, Student Activity Association, '28f'29 ROBERT BRENT DANA Varsity Baseball, '28f'29, Varsity Soccer Team, Varsity Club, Review Board, '28f '29, Glee Club, '28f'29, School Quartette, '28f'29, School Octette, '29, Athletic Counf cil, Dramatic Class, '29, Dorm Council, '28, Vesper Committee, '29, Theta Phi Fraternity, '28 2Q LAURENCE B. FLINT, JR, Forum, '25f'26, Review , '27, Hockey, '25f'26, Second Football, '25f'27, Second Baseball, '27, Varsity Football, '28, Draf matic Association, '27f'28, Dorm Council, '27, Varsity Club, '28f'29, Delta Phi Sigma Fraternity, '27 28 JAMES R. FOSTER RIVERDALIAN Board, Managing Editor, '29, Review Board, '28f'29, Business Manager, '29, French Club, '27f'29, Presif dent, '28f'29, Student Activity Association, '28f'29, Secretary, '29, Glee Club, '27f'28, Tennis Team, '28f'29, Second Football Team, '28f'29,Second Basketball Team, '29, Second Baseball Team, '28f'29, Theta Phi Fraternity, '28f'29, VicefPresident, '29 HOWARD A. GOLIEB Forum, '26f'29, Secretary, '28f'29, Science Club, '27f'29, Varsity Club, '27f'29, Var' sity Football, 27f29, Varsity Baseball Squad, '27f'29, Varsity Basketball Squad, '27f'29 MINOR KEILHAUER Secretary Science Club, '26, Varsity Football, '26f'27, Varsity Basketball Squad, '27, RIVERDALIAN Board, '26f'29, Business Manager, '27f'28, Art Club, '26f'29, Round Table, '27f'28, Varsity Club, '27f '29, Riverdalians, '28-'29, Glee Club, '26f '29, CofEditor Gray Book, '28 2O,' Theta PhiFrat.,'z 7 2Q, CorrespondingSec., '28-'29 EMIL KLUGE, JR. Dramatic Association, '27f'29, Forum, '27f'29, French Club, '28f'29, Varsity Soc' cer Squad, '28, Fencing Team, '28f'29 RICHARD KOPS Second Football Team, '27f'28, Dramatic Association, '2 j '2Q, Science Club, '26f'27, Art Club, '24f'27, Glee Club, '25f'29 FRANK T. J. MOORE Varsity Football Squad, '27, Varsity Football, '28, Varsity Basketball, '26f'29, Captain, '29, Varsity Baseball, '26f'28, Captain, '28, Varsity Club, '26 2Qj Athf letic Council, '27f'28, Round Table, '27f '28, CofEditor Gray Book, '28f'29, RIVERDALIAN Board, '28f'2o, Editorfinf Chief, '29, Student Activity Association, '28f'29, Theta Phi Fraternity, '27f'29, Corresponding Secretary, '27f'28, President, '28329 PARKER M. MORRELL Jollies, '28, Percussionist in Riverdalians, '28, Second Football Team, '28 EDGAR WILSON NYE Glee Club, '2 5729, Second Football Team, '26, Captain, Second Basketball Team, '26f'27, Varsity Basketball Team, '28f'29, Forum, '26f'29, Dramatic Associaf tion, '27f'29, Student Council, '27f'28, School Quartet, '28f'29, Tennis Team, '26f '27f'29, Captain, '29, Red Cross Head, '27- Delta Phi Sigma Fraternity, '27f'29 CARL BROOKS PETERS follies, '28, Glee Club, '29, Glee Club Dance Committee, '29 BEN PLATT Dorm Council, '28, Round Table, '27f '28, Review Board, '27f'29, Varsity Soc' cer, '27f'28, Varsity Tennis, '28, Glee Club, Secretary and Treasurer, '28f'29, Fifth Form, Secretary and Treasurer, Delta Phi Sigma Fraternity, Secretary, '27f'29 JAMES SAUNDERS Relief Association, '2 5929, Assistant Football Manager, '26 27,' Football Manaf ger, '28, Science Club, '28f'29, Glee Club, '28f'29, Fencing Team, '29, Varsity Club, '28729 v STEPHEN WALTER Glee Club, '27f'28, Review Board, '27f '28, Science Club, '27f'29, Second Football Team, '27f'28,Varsity Football, '28, Varsity Club, '28 2Q, RIVIRDALIAN Board, '27f'29, Theta Phi Frat., '27f'29, Chaplain, '28 2Q rhrhrhrhrhrhrhdwrhrlsrhfhrhrhrhrhrhdwrhrlwrfwrhrl-nrhrlwr+wf4wrh eh rhfl-sfhfhrhrhrhrh rhrhrhrhrhdwfhrhrhrh rhdw fhrhfhfh rivhrhrhrhrhrh 9 3- 3- 3- 3 3- 3 3- 3 3 3 3- 3' 3 '11 3' is 3'9- 235 3' 3' 3- 3' 3' 9 5 3 3- 3 9' 3 3' 5' Bt is FUURTH FQRM Q Q Q Q Q Q Q Q E Q Q Q Q Q Q Q Q Q Q Q Q Q 'Q Q Q Q Q Q Q E Q Q Q Q .E Fourth Form The Fourth Form has been one of the leading forms of the School this year. Its representa- tion in both scholastic and athletic achievements stood out. Two men received Varsity football letters and also the same number in basketball. Student activities have been greatly aided by the representatives of the Fourth Form. Several members are in the Glee Club and others are always reaping in scholastic honors which tend to boost the class average to an unusual per oent. ' An unusual event took place in one of the Form's meetings when they decided that no officers should represent their class, except possibly a Relief collector. Thus, by comparing the activities of the Fourth Form with that of others, or even by comparing the individuals, one can readily see Why we class it as one of the leading forms of the Upper School. ALVARADO GIBSON, W. MARTIN ARMSTRONG, J. HERNANDBZ OCKBNDON BLOOMINGDALB KENNY OSDANIBL BRoNsoN LAIRD NYE CAMPAGNA LEVENTRITT PITTMANN DALTON, J. Lawis WOLFP Fouiciz Loan WROTEN Forty-five 3 31 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 glmmfhmmmmmmmmmmmmmmmmmmmfhfhmmmnxfhnafsfsmmmmmmmfhmfsfhmfhmmmfhmmmasmmfhmmmfs 5 THIRD FORM gili-'VPYP'-I-'EP WWWWWWWWWWLPWWWWWWWWWWWWWLPWWWWWWLVWLIJ Third Form The Third Form this year lived up to the excellent allfaround record that had been compiled by the class of the previous year. Its representation in the various student activif ties and in athletics was notable and its scholastic record was easily up to its usual standard. In scanning the lists of the Varsity teams, we notice that three members have received letters in football and two in basketball, not to mention those who played on the scrubs Many were members of the Glee Club and quite a few were engaged in the annual Christe mas play in some way or other. With all these accomplishments in view, one cannot help but feel that the Class of 1932 gives great promise of success in the years to come. ARENTZEN HAGGERTY PORTFOLIO ARMSTRONG, F. HALSEY, B. REID BARNET HERMAN RICHARD BARTHOLOMBW HVASS ROETHLISBERGER BRIGGS LAMARCA SCI-ILING BURTON, G. LAWLER STEERE CLARK Lol-ISE TRIMBLE FISHER, M. LOWNES WAGNER, W. Fox, D. -MANNING WARD FRAMBACH ' METZ WARNER, J. HACKETT NORRIS, A. WARNER, M. PETERS, K. Fortyfseven 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 5 3 3 3 3 3 3 3 3 3 zlwlasfsfsvsfhfhfsasmmfsfsfsfhfrva-.fsfsa.asasahfsasfsmasfsfsasmfsfsasfsmfsaafhasfhfhfsfsfhfhaaavhfhasfhmmmmmmmmmfsfs SECCND FORM W NP'-VNV WWWWKVWWWWWLPWWWWWWWWWWWWWWWWWWWWWWW Second Form This year's Second Form is truly an outstanding class in many ways. Its roster contains the names of some of the brilliant minds of the School, and never before has the Second Form had so many excellent athletes among its numbers. There are three fellows who play on various Varsity squads and almost everyone else takes an active interest in some branch of athletics. Thus, in reviewing the Second Form, we may safely say that it contains a wellfbalanced group of fellows, who are being primed to take over the reins of both the scholastic and athletic life of the School. ARNS DAY HUGHES, S. AUBRY DUEE HUTCHESON BACH DYER MACNAIR BARTRAM FISHER, E. RABENOLD BIHN Fox, J. ROBINS BRUEN FULKERSON ROCKWELL BRUNNER GIBSON, R. ROGERS CHANDLER GOODWIN TOWNLEY CLARKE HALSEY, R. WAGNER, S. CONNOLLY HAYS WILSON, C. CRANE HUGHES, C. ' WILSON, R. DALTON, W. YOUNG rhrhrhrhrhrhrhrhrhfhrhfhrhrhrhrh rh fhfhfhfhfhflNflNfh!l1flNfl'Xfl'NfivlNfhffWflNfl'NflWfh rhrhriw Fortyfnine Awrhfisd-wfhAwrFvrhAwrhrhrhrhrvil'S r+mrhf+srhrhrhrhrhrhdwrhf'l-fhrhriwrlwrhdxdwrhrhrhrhrhrhrhrhrhdwriwrlwrhrfwrhfiw glllvhrhrhrhrhrhrhrhrhrhrhrh JR 'H 'I HRS 312 EJWWWKVWJWWWWWDPWWKILEPWYVLPWKPWLVW WWWWWVPWKVWWNAVLVWWWW'-Eili' First Form The First Form mms to be composed of a rather intellectual group of fellows. Consef quently, the scholastic standing of that class has been unusually high. Athletics have been participated in by all, and, considering everything in general, one may easily see that in the present First Form there are a great many fellows of the real Riverdale caliber. BBNDHEIM HUBBARD, BLOOMINGDALE, A. HUBBARD, BOSSANGE KENNEDY BROWN Llwizzzo BURTON, G. LOFTING DUNHAM LOUGH EYVING Moss FREEMAN PATBRNO GOULD E. R. PRESTON RINGWALT TAYLOR TOMPKINS WEsTERF1ELD WHITE, R. WHITE, W. WILSON, D. WINCHELL Fifryone 4 as rE LE f f s 'S C f rhrhrhrfvhrhriw fhrhrhrhrhrh rhdwrhfhrfxrh rhrhrhffxrhrhrhrhrhrhrhrfxrhrhrhfhrh 6 it rhi rh rhrhrh rhrhrhrh sdwikfhriwrhfhfhrhrhrhrhrhdwfhrhrh dvhrlwrhrhfhdwrhrhrhrhrhdxrhrhrhdwrh rRFh rh mile 5' 1 31 151 '3i,PWWW'VWKVWWWLVWWXVWWWXVYUEVYPWWLVWWLPFP'-VYIJWkVWLVE4NJW'LPLPWW' 5 .. X- 9' yi x ,' f 5.5 . ,M W 9 K N . 1.2 4 I W- I,- 'wb-Q-5' rF.rTwfhrhrhfhrhrfiH-wrhrhrhrhrhfhrhfhfhdwfhrhrhdwrhrhrhrhdxdwrhrhrfxdxrh Ri-'PN fhrh rhrhfhrhrhrhrivhrhrhrhrh rhrhrfxrhrh 6 6 f E E E 6 E E 6 6 f E 6 E E E E 'G E E E 'E JE 6 E E E 'E E f E QE E E 1 0' 0:c:0.9' if ll' 0', 4 ,0,' l'p.o. Q-rg. .tn :Una , :i li 5 ,Q x'iK K. ' Q.C'M,, 43 007 :.o.l.'o ' Ax 5 f O hx XID' e 0. O . ' fp f i'0v' X . O ' 0 I M XQO.. it g..':' l...9 Am? .Co 'Q 0 o'..' .' ,Q Ar' C, .'o ,o.. 0..:.of tr' 'X' . .... :Q. 0.Q. O. . .X YB, LQWER SCHOOL WWWWKPWWWWWLWLVWWWWLVKVWWWWW WWWWWWWWWWNAPWWWWW Lower School In publishing this Book, we certainly ought to put in a word of praise for the Lower School. The same competitive plan that is being used in the Upper School is also in practice for the little fellows. In athletics, they did very well, beating the First Form in football and basketball. A very pleasant and original entertainment took place when the School had the opf portunity of hearing the Lower School Glee Club sing in chapel. Mr. Locke has been working faithfully to develop their voices in order that he might build up material for the future junior Glee Clubs. The plan of student government has gone forward in the Lower School with even greater success than it experienced last year. Dramatics have played an active part in the School Curriculum, and several plays have been produced, Art, also, has appealed to the younger minds, and in the Common Room of the dormitory, the young artists have busied themselves over their posters and various other tasks. Thus, taking everything into consideration, one can readily see that the Lower School has experienced a very prosperous year. fl srlNffqf'lNfl'IflNflNffNf'l af'lWflNfl'1flNfl Sfhfl'1fl'!fl'Xfhf,WI'hfhfl'XI'hfhfhfl'XffNl'lNffNfhfl'5f'lNfl'1 r'FxFlS rhrh F ifryffour X ,Q X XX x X X X 1 F X hx 1' , fn 14' A 1 X .,4' X N r Y vy ' 1 ' , - ' vf. WX! , , - -3- -Ac.-e. O 5, xxx! A-,,u 4,, , X -.:,..,, f,f'.9'a+'v1 - -M w, ,M -1-2- xx , ,,f 1, UQ ,mfff -V ATHLETICS ' ' 'HWW' VW VW'+A4AVWL4AV'VWWLVKL'WlPKV'+'W WWWWWWWWWWNfWWWWN'W-' 3 9 3+ 3 3 -1-Q :Y 'f- Alf ' Q32-TT X 1- .- Ag- 3 9 in :EE - f- :gg 9 -5 ' 35: '-'---iiffwix-' r- 'law 9 Ei: H55 Q .ZH TTI--5-.4--,-Taj--' -i-,ff-s -JSF -2 3 4 1 . L-.q..f V- , FN pi., -, 5 z i ,ev as s 3' i 4--1 ' gf -iii - ,-41:57--N X 115512 g A Q 1fP:'2'- 3 l:,iqf53Lf'!,:4--' ,L,,:.s. ll Lk ,Q aul u-.5 Q 3' 5 11'-Q if: 4- ' '-ff . -gi 9 A .5 - 5- gg 1 -f 1,74-.,'-l am... Mqw:-'- , Q- -- fm. 9 -V -, ' .- Y4m1S -Ay? 4' wa- Af! 03 ? Pfx, -. x S. .x w,4 .,.. H. -- . - tx ,T :fir if .-4, . ,Q , -X 5, x- . - - v S 1 .,,- ' '-M, 2 Q, . J -WL - 1 ,A -- ls 3' , X .- 5 -, Q- . X ,,, -yi ' -32,2 ' '-' A-4, 'v ig: 1211 9 - W 1 . 1 -A -5. 51 55 ., +- 21- 4: ' -. 'g -9.-'. , F- -I Q ' 3 .Aga-if , 7 if T P' fx?-, in 3 N'-tv 1 ' 5 i'?'T '?T51'?---'1- ff' lix L X 'e k' 'Ffa 2- if- - A E .N . I x 36' nj: A'.vk.:,A 1 I , . 5, - . Ja . fy xx 1 3 N! Fg hq. '?L,3,5Em5 ly, .5 jp I-1773 fi '5 .71 3 nigga - l il-iii!!-, i-.1 .3 i.?' 'f g 51 .33. -- 11 eh- -. --,-,J.',2w - fu A :L A- 'J 3 lgtjx.- r I-Y :Q Y N ., ' X K h 4 ' 1 ' fa' -Ti' . ?- Vu Wf -h.xfr-ua'5-,--Xa- E - 'xv 7:51-,. - - -1:-2, ' R NSW ' .. 51 H 'vb x f-lk'3',4f-l.:-- - -F-ge ,, 3 -D m ki-iv ' f f 6 f f2,i'f B'w. i T3 - I ,JI ' ,9E.,..1.1...r f -N l' ,,: 5 ,J .,, j' ,I ll! ' h ,nv vi.. ai Q 1 -'S 3 mg Q 1 .nu Mafia: 5 - .' W e - 1 vi f N 2: 9, 'f ' - -Sl 9 ' 9' E 'I Zz l 5 LTIQ: ifirf.- 'f'3 ? 4'kH L 1' , -:EVIQ ., 5 . ' , , I - ' 4. . I-' th'-U ,- gs 'I 9. E311 K NW A-:Q 1 -. A, ni 8411- ' QM' . 8 fi . s'f : -X 'My uf O .' '.--Y.-' 'lf x I: Yi 'Q 0 ? 5 R x -fd ' 'fu 1 -gf' .533-QW Q- - Q 3 I gm '. .4fa?f::' J mf Xa-S E ? L'-51 35etX-if i--12' I ' IL fx'- ' ' - wk '- is 2 Ill. 'Axtvgl-S' ' 1 'l,' . -. vqs, . ,, g 1- ,Ufxs Q Xu 1 0 I' I 'FM - -',s,:.--. .. a .f p pw M , -wx '-1 I 3 If S Q .- 53' :ff - 'Q A Q-'1'. E R Y'-xgsg - , Q lel -ffrx: 'v:, Q1s1 j' X Q -' A',f,r. '-3 .., . A i. ff-'If 'fx - 1 1 - R 'Ax 'R I -, n 1 4'..2':-.-Wa lk-K 3' Q 3 1, 1,1 -' 2'-qv -- 2 -- . .- 1- . V - :Q fm' ' 1 9- :jf M., 'f -nf r 3 9 ,nj ' .le-' ws. . .5 . . . 7-I gz I, ' -3' 3 Vg-x '- 52. 5 XX-W -.,,1 X , , M ,. -P-,nf - S- - - 5' ,Xin . y 111' - ' . f'T?'P575g s 'I-Q. W: V' x- --V., s f ,.. e. , -. w. .1 1 ng- w, . , . wg-F- .L-. -. 3 'esfqixf 71559 I ' , f ,Q--., sy? X- 5' 'Q' 25 2-1 f'i 'fx fx. . X 2 - Qlffligi if f'- -- Q 9- PP K ' Mfr' 3 'W' - -- 'ifiif' X -- L, l K - - -'TSX , N ' - 14 mi, X . 'ff-- X 5 J if f 5 X fri Ei- s wi-, -, ' 3 k3f'k: 4Q Nxt-.J N1-T -512?vKW N'1-4 3 5- 3 9' 3 9 3 V r fhrhfhrhrhrhfhdwfhrk rhrhffwfhfhfhrhfhfhfhfhfhrhfhrhfhfhrhrhrhrhrhrhfhrhrixrhrhrfxrhrhrhfhdwdwrhrhrhdwrh 4 f E 6 f f f -E WE 3P3vfwFhfFwrhrfHr+wfhrhrhfhrhrhfhrhfhr+wdwfhrfwrhrhrhrhrhrhrhrhrhrhrhrhrhrhrfx fgfhfh rh 1918- Captains FOOTBALL 1918 HERBERT MCANENY 1919-EDMUND MCARDLE 1920-ALFRED DELIAGRE, JR. 1923- 1924- THOMAS E. LOVEJOY, JR. ALFRED B. ROBY 1925-D. KENNETH SIAS 1921-KELLOGG MARVIN 1926-KENNETH GEISSLER 1922-THOMAS E. LOVEJOY, JR. 1927-JOHN A. SARGENT 1928-ARTHUR R. COWEN BASKETBALL BASEBALL MARX LOEE 1919-ALLEN K. MURRAY 19201ALFRED DELIAGRE, JR. 1921LALFRBD DELIAGRB, JR. 1923'ALFRED DELIAORE, JR. 1924-FREDERICK W. HOEES 1925 1926 1927 1928 -KENNETH C. MULLER 'WHITELAW WILSON ARTHUR R. LEWIS, JR. -ARTHUR R. LEWIS, JR 1929-FRANK T. MOORE 1918-MARX LOEB 1919-HERBERT MCANENY 1920-ALFRED DBLIAGRE, JR 1921'ALFRED DELIAGRE, JR 1922-WILLIAM FITZGERALD 1923-ALFRED B. ROEY 1924 -KENNETH C. MULLER 1925'CHARLES L. GERL1 1926'W1LLIAM ANDERSON 1927-HARRY E. BECHTEL 1928-FRANK T. MOORE 1929-ROBERT B. DANA 6 4 6 E as E we e Re e e e fs -e f le -e Je Q -e f -e f f Ie Q f f f f fe f f Re f f 4 4 ff-sr+uz+wrhrf-srhrfwrfxrhrlqg rhrhrhrhrhrhrhfhrhrhrhdwdwrhrhdwdwrhrhrhrhdwrhfhrhriwriwrivhfhrhrhrhrhrhrhrfuiwrhrkrhrhdwrhrhrhrhrhrhri-.rh 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 5.. F iftyfseven ww wiv KVWW'PWWWWWWWWWWWWWLHWWJWWHJWWJWWWWWWHJWSPX ale Varsity C lub D,-XNIEL E. GARDNER BARTHOLO 1E I' BLOORIINGDALE, L. BURTON DANA FLINT FRIED GOLIEB H.AGGERTY KEILHAUER MOORE NORRIS SHE.-x SNYDER WALTER Faculty Advisor AIS rhrhrhd-xdvhrRA-.dwfhdnrhdnrhdndvh rhrhflwrhdwrhdwdw Awrhrhdwdxdwdwdwdxdwrhrhrhdwrhdsrh 'E -E wE f 'E 6 'E f 6 6 E 6 E IE f 'E 6 ffNffNfhf+Nfhf+NlfWfiWfhf1WfhffSfhffNI'hfh rh fhrhffwrhrh fhfivh rhfhrhrfx'rK7hdxrhrhrhdwfhdw rhffvfgs, Fxftyfexght FOOTBAL L VARSITY FOOTBALL SQUAD Resume of the IQ28 Football Season To most football enthusiasts at Riverdale, the season of 1928 was somewhat of a dis' appointment and more than a few of the chronic crabbers, of which every school is well stocked, have taken it upon themselves, as members of that ilk invariably do, to make the necessary explanations. The coaches, the team itself, and the student body as a whole have all come in for their share of the abuse. There was a great deal of promising material on the eleven this year but most of it was entirely too unseasoned to be of much immediate use. Haggerty and Walter Clarke should develop into fine timber for next year, and Moore, another of last yearls second team, has already shown signs of becoming a local Gosterbaan or a Vic Hansen. Flint played a whale of a game at center all year as did Don Fried both in the line and as a ripfsnorting back- Beverley Snyder proved to be the star of the year and we shiver to think what some of the results would have been minus the efforts of this stellar halfback. Snyder was no less than eighty per cent of the teamls offensive force and a tower of strength on the def fense. His running was consistently good and at times sensational. He was equally effective at hitting the line and running the ends as well as being an adept on both ends of a forward pass. Guy Burton played a Hghting game all year and broke through on several important occasions to relieve a tense situation. Notable among these was the last game of the year when i'Beef stopped the Brunswick march at a crucial stage and thus indirectly gave Riverdale the victory. Next year, Burton, Fried, Flint, Haggerty, Clarke, Moore and Keilhauer return to form a nucleus upon which to build for 1929. The first game of the season was played with and at Adelphi. Riverdale should have emerged victorious in this stmggle by at least three touchdowns, but every time the team was in a scoring position,apparent lethargy set in and the result was a scoreless tie. It seemed that when Riverdale got within the shadows of the enemy goal posts sufficient steam was not expended to combat the stiffening of a line that was defending desperately its own line. The ball was in Adelphfs territory practically the entire game. The next game was played against Stony Brook on alien territory. In this contest, Riverf dale met a superior team and it is the general opinion of the coaches that the team was at its best on this date. Stony Brook started their second team, but a few substantial gains by Mr. Snyder convinced them that they were in error. Even against the first team the game was nipfandftuck and decided only after the blocking of a punt had resulted in a touchdown. The final score was 6 to O. Had the team been in the form they displayed this day at Adelphi, a goodly score would have been compiled. The teamls Hrst atfhome game was played with Bronxville on Memorial Field. Bronxf ville had a large but fast team and were entirely too much for us, especially after the game at Stony Brook. The score was 14 to O. The Bronxville team, though not so much larger in stature, represented a more mature group and gained almost at will. Several miscues on their part prevented a far more embarrassing total. The game with Hackley, also played here, proved to be just a repetition of what had transpired a week previously. A rangy, powerful backneld quartet headed by Day proved to be our undoing and Hackley won handily, 13 to O. Sixtyfone 9' -6 9 -e 5' ae 3 be f E 9 E 9' 6 5 fe ? as 3' E 3 6 2' as 2' f S- -e 3 JE sf f 9- 4 as f 3 -E 3 E 3- Je 3 E 9 Q 5 as ? E 3. E as 6 3 f as E 3 t 2' Us as ft 3' LE gl?-Nrl-.rhrhrhrlwrhrhfhrhfhfhrhdwfhrhrhrhfhrhrhrhrl-.A-..+-rhfl-ri-ml-if!-M-.rhrhrhrhrhAwdwrhdwrhrhfhrhrhrhrhrhrhrRRsAwAsAsdwrhftsrhrhffxdsrfg WWWWWWWWWWLE+'WXVWWWklAHWHlJWWW WWWWWWWWWKPKVWWWWWW The Storm King game was the next disaster. This marked the low ebb of the season. The team had lost three in a row, and it seemed from here, to better teams. The day was most disagreeable and the Held was wet and clammy. To make matters comparable to the weather, Storm King, at the height of their form, gave us a lathering by no less than 20 to 0. Dame Fortune was soon to smile upon us, however, for along came McBurney and the event was celebrated by the rolling up of four touchdowns, four being made by Mr. Snyder. Two of these were made by running the ball, and the other two by passes, one of which was intercepted. After Riverdale had the game well in hand, McBurney began a determined march down the field that looked certain to be productive of one touchdown and maybe to swing the ultimate result in their favor. They had taken the ball from their own twentyfyard line to Riverdale's eight. Schoening, their best back, had carried the ball on almost every play of this long march. It was Hrst down and a touchdown seemed imminent, but Moore broke through and what was originally intended to be a pass over the line was converted into an eighteenfyard deficit. The danger point was now passed and the rest of the game was devoted to the additional scoring yet to be brought about by Snyder. The final count was 25 to O. The next conflict took place at Scarsdale and our hosts treated us to the worst beating of the year, 40 to O. Scarsdale had a light team and the fastest that Riverdale was called upon to face. Their interference was perfectg so good, in fact, that a touchdown was made on a punt, every prospective tackler being taken out. The setback was unfortunate coming at such an inopportune time but it was as convincing as unfortunate. The schedule was completed by a 6 to O victory over Brunswick at Greenwich. For thrills, this game had no equal all year, as the ultimate winner was incognito until the very last minutes of play. Bobby Gibson intercepted a forward pass at midfield and Don Fried then caught a spiral from Captain Cowen and ran forty yards for a touchdown. The kickfoff following this tally nearly resulted in a safety, the carrier just barely getting across the goal line. The game ended with the ball on Brunswick's twofyard line. And while only two games were on the right side of the ledger, the team played mighty hard and deserves a lot of cerdit, for, after all, only two of the losses were in any way severe. Q ,p.p A, 6 'E 6 rh rlvl-.rlwrh rhrhrh rhrhrl'-.rlvh flxrh 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 rhfhri-.rhrhrhrhrhrhrhr1Nrhfhrhfhrhr?ifhrhrhfhrhrhrfwrhrhrhrlvhdxrhrhrhrh rfirh rhrh Sixtyftwo WWWWWWWWWKAIJWWWWWWWWWWWW WWWLVWWWWWWNAPWWWWW '-X V if'7'9fT-5 , 'Avi Second Football Team The second teamls season could not be called a success from any point of view. Two games were played, one with Scarsdale and the other with Bronxville. Both of these games we lost, the first by a score of 6 to O and the contest with Bronxville by the score of 26 to 6. The Bronxville game was distinguished by reason of the fact that Riverdale made its hrst touchdown of the seasoneSteere scoring after a march down the field had placed the ball on the twentyfyard line. In this game also, two hardffighting and capable players were discovered in Parker Morrell and Arentzen. The former was immediately utilized as a Varsity player and the latter should make one of the team's most valuable players next fall. Both tackled hard and surely, tackling to delight a coach, and with Steere so outshone their teammates that the poor and indifferent work of the other men was made even the more evident. Steere emerged in this game as a fearless linefplunger and showed latent ability in other departments of backfield play. Fouke is the only other player whose work is worthy of mention. In the Scarsdale game, we made a somewhat better showing, although with intelligent generalship we would have won by two touchdowns. In this game, Parker Morrell and Arentzen again played a stellar game while another good line prospect for next fall was disf rF-Hwrlwr'hrhrhrhrhrhr'lwrlNfhrhfhfhr'hfhrhfhrhrhfhriv-hrhflwfhrhrhrhrhrhrhrh f+iflN f+'NflW Sixtyftlwee covered in the person of Allen Norris, who, lacking experience and with a had shoulder, played his head off in the line and stopped nearly everything that came his way. Fouke and Steere again played well in the backfieldg Steere making gain after gain in the second half only to have all his good work nullified by poor generalship, costing us a touchdown. The second team's season was not a failure because we failed to win our games but because the second team failed in its principal objectives or at least what should have been its principal objectives. These are not, as might be supposed, to win games but irst to furnish spirited opposition to the Varsity and to develop material for the Varsity. The winning of games is merely incidental to these Hrst two all-important objectives. If the first two are accomplished, the third will follow as a matter of course. Except for those who were mentioned by name, spirit was poor, teamfplay nonfexistent and a general attitude of indifference, resulting in incompetence, was prevalent. As stated in an article for the Review earlier this year, a winning Varsity football team at Riverdale will never be developed until we have a hardffighting second team imbued with sufficient spirit to provide the Varsity with stiff opposition. Those who were mentioned in this Review had that spirit and found their reward either in quick promotion to the Varsity or in the warm approbation of their fellow schoolmates. Let us hope there he many more of the type of Morrell, Arentzen, Steere, Norris and Fouke when next fall rolls around. CZK? 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 -E -E 6 6 6 -E E 6 6 6 6 6 6 6 6 6 6 6 6 6 rhrhrlkrhrhrhrh rg rhrhrl-wh 6 6 6 6 6 6 6 -E 6 6 6 6 6 6 6 6 -E 6 -E 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 Leif rhfhrhrhrhrlvfirhrhrhrhrhrhrhrhrhrh rhrhrhdvhihrhrhrhrhrhAwrfW'hrfxrhdvhrhrhrhrhdw Sixtyffouv 3? WWWWWWWWWWWWWWWWWWWWJWWWWWWWWWWWWWW THIRD FOQTBALL TEAM rhrfwrhFfNrhrhrhrhdvhr1NrhrfWhdNrhriNdNrhrhrfwrhrfN Slxryffve rY-1dwrhrhfh.4wrhf+1AwrhAwA-w+mAHdNr+wr175f5 -E -E E E 45 E f E E JE E f E E 15 'E -E 6 E E Q f E E E 'E 'E E -E f f E E E E E E E E Q E 'E AE E Ai WW W WMPWWWWWLSJWWWWWMPLUBJKPWWW W WWYPWWWK-VWKVKLAPWWWWW Third Football Team The third team opened the season of 1928 handicapped by a short schedule, a new coach, and the spasmodic disablements of Captain Donald Metz. Although the team lost both its outside contests to the Bronxville thirds and The Professional Boys' Club, they managed to show a decided development by the end of the season. Much praise is due to Coach McNeil for the handling of the teams so long tutored by Mr. J. W. Murray, and we are certain that there are some potential stars for future Riverdale Varsities among them, the most outstanding being Captain Metz, Barnet, Lavezzo, Westerfield and Alfred Blooming' dale. The Linefup: HUBBARD, E. AND WARD Left Ends WARNER, J. . Left Tackle Sci-ILING Left Guard LOWNES . . Center BLOOMINGDALE, A. . Right Guard CRANE . Right Tackle DYER . . Right End Mizrz, Captain .Quarterback WESTBRFIBLD . Right Halfback DUNHAM , Left Halfback LAvEzzo, J. . . Fullback Sixty' six BASKETBALL S1xt5'fe1ght BASKETBALL TEAM HAROLD E. KLUE CHARLES MCNBIL FRANK T. MOORE DEANE K. Fox BATES HALSBY MOORE . . ARMSTRONG, J. NORRIS . BLOOMINGDALE ARMsTRoNG, F. NYE . Basketball, 19284929 OFFICERS TEAM Head Coach Assistant Coach . Captain . . Manager Assistant Manager . Left Forward . Right Forward . Center Left Guard . Right Guard . Guard K. C LE E -E -E +2 -6 E E -E QE E E -E JE E -E 'E E E E E E 'E E LE E E E E 'E E E -E -E fhfhawmfhfhmfnfhmmmmffvhmmmfhfhffmvhfsvnmmmmmfhfhfhnvhfwhmmmfnfsmfawfhfhfhfhmfhmfmdg ri-tri-srhrhrhr'f-sri'-s lFs?.'Nf'NF Nf'Nf'hf .NffWf 1fhf'NfhfhffNffNfhf'hf+Nf+HfhffNfhf'hfhf+'Xfhfhf'hfhfhfhffWfhffI rfirh rh Sixtyfnine lily WWWW'-VWWLVWWLPWWWLVWKVWWLPWWWWWWWWHJKILIJWWNAPWWWWW The Schedule Riverdale Opponents Brooklyn Friends 15 19 Staten Island . 32 23 Scarsdale . 22 29 Hackley . 28 23 Morristown , 24 26 Adelphi 32 29 Bronxville . 15 10 Storm King . 25 21 Trinity . 29 21 Lincoln . 16 8 Iona . 18 15 La Salle . 16 23 POINTS SCORED Riverdale, 272 Opponents, 247 INDIVIDUAL SCORERS Moore . . . .136 Nye . 13 Armstrong, J. . 51 Bloomingdale . . 11 Norris . . . . . 49 Armstrong, F. . . 8 Bartrarn fFuYf+N flqrhrfwfhrhrhrhf-hrhrhrhrhfhriw fhrh rh flvhrhrhrhrhrhrhrhrhrhrhrhrhrh 15 rh fh rh Seventy rhrhrhrhfhrl-srhif-mrl'-1 has 'E fe if -6 16 'E E E 6 E 6 G E E f E 'E E JE 'E 'E f Coach Klue presented the School with the best team it has had in some years. The outf look at the start of the season was clouded. Captain Condon was unable to play because of a dislocated shoulder and Art Cowen, an old veteran, left us, and so Frank Dinty Moore was the only regular from the preceding season still on the team. The Five, however, was bolstered by johnny Norris, our Hrst big center since the days of john Allen, and the two Armstrong brothers. Bloomingdale came up from the second team and played excellently, being the key man on the defense. Nye also helped the quintet, but our real star was Dinty Moore who was made Captain because of Condonls injury. Dinty totaled 136 points for the season which was exactly onefhalf the number of points the entire team tallied. He was in there every minute fighting and the team, inspired by his brilliancy, again and again outdid itself. The entire attack centered around him and at times his shooting was almost uncanny. If Frank went right, the team usually won. Unfortunately, the team got off to a poor start losing the first game to Brooklyn Friends, and then, after beating Staten Island, coming off on the short end of the score in the Scarsf dale game. After this, the Red and Grey rounded into form and were downed only once, this at the hands of the strong Morristown quintet. In this game the score seefsawed back and forth and with but three minutes to go and Morristown four points in the lead, things looked black. Moore, however, tied the score by tallying two baskets in quick succession, one being a sensational shot from midcourt. But just when it seemed as though it would be necessary to play an extra period, Bockwinkel, Morristown's left forward, dropped in a field goal which let them win by two points. This game proved to be the turning point of the season, for the team breezed through its next live games victoriously, finishing with a grand flourish. Of these, the game which deserved the most praise was the victory over Trinity. The team, remembering the manner in which they were trounced by Trinity in the previous season, keyed itself to a high pitch for this game and fairly swept Trinityls men off their feet by a dazzling offense and an airftight defense. Every man on the team played splendidly and much credit should be given to Coach Klue for whipping the team into such shape just when it seemed that they were going stale and sinking into a dis' couraged frame of mind because of the manner in which they handled themselves in the Storm King game, for although they won the game, they should have won by a much larger score and should have finished with the wraps on instead of being forced to their utmost. In the past season, the team entered the Manhattan Tourney and survived the first round by beating Iona Prep in a very exciting game. In this game, with but a minute to play and Iona leading by one point, Dinty Moore scored a beautiful field goal on a shot from the center and uShorty Norris followed immediately by dropping in another pretty basket. These baskets provided the threefpoint margin of victory and sent the team into the second round of the Tourney where they were eliminated by the strong La Salle Five, but only after a hard struggle. This ended the season, and now we are looking forward to next year. With the loss only of johnny Norris and Ed Nye, the prospects for next year are unusually bright. Moore, Bloomingdale and the Armstrong brothers should be better than ever, and Haggerty and Colieb, both out this season because of sickness, are expected to help out considerably. rhrhflwrhrhrlwrfxrlwrfxriidwrfwrlwrlwrlwrhrh rhrhrhdwrlwrhrhrhdwrfvhflwfhrhrhffirhrlwrfwrfwriw rhrlw Seventyfone as f f se as f e e as E E fe as -s f as 'E 'E 'E 5 'E as f f f fs f we f as 'E se f r f f if 4 l MAE f+irhrfwAwAwdwrhr+v'f-.fhAwrfsFlurhrlwd-arh rhrhrhrhdvhrhrhrhrhdwrhrhrh rhrhrhrhfhfhfivhrhrhrhrhrhrhrhdwdwrhrhrhdwdwrhrhdw rhrfi 'f-'gf If an iz- E+ 'o'oi 5532323- O vt N516 SECOND BASKETBALL TEAM ?5i.EPWWWWkPYVWWWl4QlJLVWWWWWYVKVWWWW WWWWWWWWWWWAPWWWWW Second Basketball Team The second basketball team had an exceptionally good season, Winning 9 out of the 13 games played. It also proved itself to be valuable as a source of material for the Varsity. Many of its members played in Varsity games throughout the season, and two became regulars, namely Frank Armstrong and Billy Bloomingdale. Under the excellent handling of Coach McNeil, a wellfbalanced quintet was molded. Gibson and Biehn, supported by Bartram, starred on the offense and Clark and Lewis provided an impenetrable defense. With practically all of the players returning next year, the prospects of another excellent second team are unusually bright. The Linefup: BARTRAM . . Forward GIBSON , , Forward BIEHN , Center CLARK Guard LEWIS ...,,. Guard Substitutes: BRONSON, Mizrz, Ruin. The Schedule: Riverdale Opponents Brooklyn Friends . . 8 15 Roger Ascham . 17 21 Scarsdale . . 25 16 Fieldston . 23 8 Lincoln . . 10 15 Bronxville , , 12 7 Lincoln . - 28 18 Fieldston . . 11 7 Roger Ascham . 21 25 Bronxville . 13 10 Trinity . - 20 19 Fieldston - 33 10 Trinity . - 29 25 Seventyftliree viii E 16 QE 6 rhrhfivhrhrhrh rh gh rhrhrhrhrhrhrhrhrhrh rhrhrhrhrhrh rhrhrhfhfhriwdwdxriwdwrhdwrh rfxfhrh rhrlwrhrhrhrhrhflwrhrhfhrhrh I .. I ...fs . ...M --r V 2 4 , l ? n-so Third Basketball Team The third basketball team had truly a remarkable season under the tutelage of Coach McNeil. Seven games were played and all seven were won and quite handily at that. Fieldston, Lincoln and Bronxville were each defeated twice, whereas Brooklyn Friends School was defeated only once. The team, however, played them only once. The only game that was really close was the last game of the season when the Riverdale thirds beat Fieldston by the score of 19 to 17. In this contest, the incomparable combination of R. Wilson, Metz and Lawler worked beautifully. R. Wilson, who was high scorer, and Metz were the outstanding players of the season. Barnet and Burton also played excellently on the defense. For the first time in the history of the school, letters were given to a third team, but this was only fitting in view of the excellent playing and spirit that was manifested throughout the season. With practically fini-whrhrhrhrhrhfh 'E TE f f E 1E if ae e 45 f 4 fe -E -E 4 -E -6 'E 'E -E 6 E E f f 6 'E 6 6 f f 6 -6 everyone returning, the prospects of a successful second team are very bright. The Linefup: WILSON, R. . , Right Forward METZ . . Left Forward LAWLER, Captain . . Center BARNET . . Right Guard BURTON . Left Guard YouNc rhrhrhrhrhrivhrhrhrhrhrhrhrhrhrh rh rfi7hrhdNfhrhrhrhrhrhrhrhrfWhrhrhrhihdwrhdw?hrhr5Tg Seventyffour V K X X BAS BALL '3ibI'WWWWWWWWWWLEPWWWWWWNJWWWWW WWWWWWLLLIJWKVQAPWWWWW Baseball, 1928 OFFICERS DANIEL E. GARDNER . . . . Head COCICPI CLIFFORD McAvoY Assistant Coach FRANK T. Moonn . . Captain Juuus FORSTMANN . . Manager QQEQJ Seventyfsix -E 1E E 'E JE -G JE f E -E JE 'S 'E 'E 5 wi 16 E dwrhrhrhrhrhrhdwdarhrhrhrixrhrh E 6 E E E E 6 E E 16 1E E JE f f 6 'E E 6 SARGENT DANA Noluus LEWIS . CAMPAGNA FRUEAUPP Moon, Captain . CONDON GOLIEB . DIMARCO COWEN FOSTER Baseball Team CAPTAIN MOORE-1928 . Catcher . Pitcher Pitcher First Base Second Base Second Base Short Stop Third Base . Left Field . . Left Field Center Field Right Field QQ is -Q ee e Q -e ee E +2 as -e as as Je -e We e e f ie he if ve as fe e as e E +2 as E Q rhrhrlwrhrhrlwfhrhrhfhrlxiwrlwrwdqlg fhfhfhrh E E E E E E E E E E 6 6 E 'E E E 6 6 E 'E E E E E E -E F QE E E 6 E E E 'E 15 'E f 6 fFrlwrl-v1wrhfhrhdwFl'wr-lwrlNrhrhrhdxrhrhrhrhrhfhrhrhrhrhrl-v+xrhrhrhrhrhrhrh f'Rf'lN rhrfm-Elle Seventyfseveri Baseball History, 1928 The baseball team, having returned from its annual jaunt to Hampton, Va., which helped immensely in giving Coach Gardner a line on its strong and weak points, got off to a rather poor start, being beaten by Adelphi by a score of 7 to 6. The team, however, that played in this game was not the regular one and this accounted largely for the defeat, for Poly Prep, who came next, was trounced by a score of 11 to 1 when the regulars took the Held, and Poly Prep was by far a better team than Adelphi. The pitching of Dana in this game was sensational, to say the least, for Bob struck out seventeen men and gave only three hits. To embarrass Poly the more,Dana pitched to their last batter with his left hand and struck him out on three pitched balls. Dana proved himself not to be a flash in the pan, for he pitched excellently for the ref mainder of the season and won almost all of his games. After Poly came Dwight and they were taken into camp by the score of 7 to 3. In the next game, however, against Morristown, the team experienced an off day and was trounced to the tune of 14 to 3. Brunswick came next and after a bitter battle they nnally triumphed. The score of this game was 3 to 2, and the issue was in doubt until the last Riverdale man was retired. After this, the team defeated Ridgefield and Hackley by the scores of 14 to 6 and 4 to 3, respectively. From that point on, they proved to be almost invincible. The outstanding players throughout the season were Cowen, who broke up many a game with his long' distance hitting, Moore, who brought the spectators to their feet with his fielding featsg and Dana and Norris, who both pitched superbly. CAPTAIN DANA-1929 AE 'E 'E LE E 'E 'E 'E E 'E 'E 'E 'E 'E 15 'E -E f 'E f 'E 'E T5 'E f E -E 'E 'E 'E -E 'E f E f f HE f asfhfsasasfhasaafhfhasfhmfhffiis 'E -E i -E 'E JE E -E E E 6 6 5 E E 4E 'E -6 -G E -E 'E -E -E 'E E E 'E E 6 'E 6 E Q E E f f 45 fh rhrhrhrhrlxrfvhrhrhfhrhrhrivhrh rh rhrhr1Nrhrhrhrhrl1rhrhrhr1xrf'i7hrhrhrhrhrhrhrlw dvlvFlg, S6'l'671Ij'6lgl1I NW U19 ' 53 ff ix 6 i - my f CN. MINOR SPORTS O ,.v 'xtgiy ,figs 255 'Sf N. fu-xx X, ' m X ,Q - 1 WA fi ,- ' , 1 k ,:?Sf55?X'?Wz M X ,344 -Xffgfbv ,673 ,W ,. V x Elghry Soccer, 1928 It is not a pleasant task to give a resume of the soccer season. The team did not make a good showing, in fact, it made quite a poor showing. It lost six games and did not succeed in winning one. However, this was not the fault of the team or of the coach, either. The members of the team played as well as they could and did their best. The simple solution remains in the fact that the teams played were superior. This was the reason for our defeats. In every case, the opposing team outweighed us and usually outplayed us, but they never outfought us. Every minute of the game the wearers of the Red and Grey were hghting hard in spite of the heavy odds. The soccer season opened unusually late this year, but it was just as well for we did not secure a coach until early November, when Mr. Lightbody came to us. He proved a most capable coach and aided us materially. The first game of the season with Staten Island was washed out by a heavy downpour. Therefore, we did not play our first game until Novemf ber 10th when we met Horace Mann on their field in Van Cortlandt Park. The game resulted in a 2 to 1 defeat for Riverdale. Against a heavy and superior team, the Red and Grey put up a game fight. The ball was continually hovering about our goal and it was due only to the good work of the two backs that Horace Mann did not win by a larger margin. Riverdale temporarily assumed the lead when Gordon Biehn scored on a pass from Platt shortly after the beginning of the game. Thereafter, Horace Mann held the upper hand. They tied the score just before the close of the Hrst half and scored again with only three minutes left to play. The following Saturday witnessed the defeat of the team at the hands of the New York Military Academy by a score of 1 to O. As the score indicates, the game was an extremely close one and the result was in doubt clear up to the final minute of play. The ball was continually traveling up and down the field with Hrst one team threatening to score and then the other. If anything, the Red and Grey aggregation held the upper hand by a slight margin. The only score of the game came shortly after the beginning of the second half. Riverdale fought desperately to score but was unable to. just before the final whistle, Ray Kenny hit the goal post with a bulletflike shot that just failed to tally. In the third game of the season, Riverdale met Poly Prep and was turned back by a 3 to O count. As before, superior teamfplay and a heavier team told the story. The hrst half of the game was scoreless and was marked by the brilliant goal tending of Will Wroten. In the second half, Poly Prep ran our team ragged and proceeded to score three goals. Our forwards threatened to score many times, but their shooting was inaccurate and weak. In the final game of the year, the Riverdale team was set back by Hackley in a fast and wellfplayed game, the score being 3 to 1. The hrst half was scoreless and very evenly played with Hackley having the edge. At the start of the second half Hackley tallied, but Riverdale knotted the count a few minutes later when Bob Dana registered one on a pretty shot. Thereafter, Hackley gained the upper hand and scored twice more before the close of the game. Two practice games were also played with the British Admiralty Club of New York, both of which were lost by the scores of 4 to 1 and 1 to O, respectively. However, the Varsity defeated the faculty in their annual game, 7 to 3. The team as a whole played well and exhibited quite a bit of teamfplay. Laird and Fox, the two fullbacks, played good, steady games, while credit should go to Frank Campbell Eightyfore 2' e 7 6 QL -e 55 E 3 E 5 E 9 E 3 6 5 -5 5' we 3' f 5 as 5' E 3 E 3+ +5 5- f 9 Q ss f sf f 9, E 3' E 3 E 9' E Q, E f ? Q 3. E 9 f 5 6 3 -E 3 E 3' f 3' -2 gf?rhrhfhrtxfhrhrhfhrhfhrhrhd-xfhd-.rhrhAwfbfhrhrhfhdwmrhrlvfwhfhrhrhAwdwr1vhrhr+wrfwrl-xdwrlwr4wrl-vhr+-whAwfhFhfh fhfhrl-.Awrl-.rhrhd-whrliig '3i,3'WWWlVWWWWWKESJWWWWWWWWWWWWWWWLPWWWWWWNAPWWWWW who played the center halfback position. Kaufmann, our regular goalie, was forced to retire in the middle of the season due to an injury, but Will Wroten proved a most capable sub' stitute. The whole forward line worked well as a unit and contained a considerable scoring threat in Dana and Kenny. The Linefup: PEARSON, Captain Outside Right BIEHN . . Inside Right DANA . . Center KENNY . Inside Left PLATT Outside Left Kwon . Right Halfback CAM PBELL Center Halfback BRONSON Left Half back Fox . Right Fullback LAmD . . Left Fullback KAUFMANN ......., Goal Keeper Substitutes: Lewis, WROTEN, Diuwvuss, BURTON CZ? rhr1vIRrhr'l'mA-.rfxrhrhrhrtxd-m rh rFvhrhr+-.fivhrh 6 6 6 6 6 6 6 6 6 6 6 rh rhrhrhrhrh rh Eiglitytwo X X WWWWWKVWWWWAVWWWWWYVYVWWWWW WWWYVWWKHFVWWYVWJ'-VWWWW'-lig HW Second Soccer Team Last fall, when the services of Mr. Lightbody were acquired, a change was made in the soccer teams. Previously, there were two groupseone, of the older boys and the team, under the regular coach, and the other of younger and lighter fellows with Mr. McCreary as instructor. This year, however, a change was made. The people in charge of such things deemed it wise to throw the two groups together because at the beginning of the year the ranks of the Varsity soccer squad had many and frequent vacancies and Mr. McCrearyis proteges were not in particular abundance. Consequently, these smaller boys developed Into the second team. This group, although they had no scheduled games, had plenty of work to do. The coach insisted on scrimmage every afternoon, with the logical intention of giving those connected with the sport a better idea and more experience in playing the game. Such scrimmages were where the sofcalled second team came in. Reinforced by one or two of the regular backs, they fought manfully against the rest of the Varsity and sometimes with surprising results. If this group of younger fellows are stimulated enough by their interest in the game to go out for it next year and if they continue to improve as rapidly as they have done so far, there is no reason why they should not develop into excellent players. In such a sport where teamwork is a large factor the longer a team plays together the better it gets. So if these boys do not become discouraged, as they have no reason to do, we can safely state that they will play a large part in the history of the sport at Riverdale. rhrbfhrhrh rlwrhrhrfwrfxrhrfwrfwfhfiwdwrhrfxrlxrfwrhrfwdwdwfhfbfhriwrhrhdwfhrhrlwrhfhrhfhfhrhrhrhrhrhfhrlwdwrh rhfhrhrhrtvrrl f i t E 't rhrhrfwrhrlwfhrhfhrfiriwrlwrhrhrhfhdvhfhrhrhrhrhrhrhrhfhrhrhrhrhrhdwrhrh f'l5f'lWfi'Nl'lNf'n-Q Eightyfthree QLVKVKP'V'PWWWLVWWQVWWWWWkVYVWQJW'4f'4J WWWWWWWWWWNAVWWWWW Tennis A new idea will he put into effect when Mr. J. W. Murray starts his tennis season. Two or three days a week will be devoted entirely to Varsity practice. The Varsity will include ten or twelve of the most promising candidates. These boys will practice twice a week under Mr. Murray's direction. New material has come to light in the shape of Brooks Peters and Beverley Snyder. The former has several minor championships to his credit, and the Southern Flash is one of the fastest men ever seen on a Riverdale court. The ranking men are Nye, Biehn, Platt, Snyder, Peters and Campbell. Thus it is that with an industrious season ahead, for ten outside matches have been arranged, the outlook is highly encouraging and promising. l glklvhfl-xrkrhrhfhrhrfirfwfhrhrhrhfhfhrhfhrhrhrhrhrhrhrhrhrhrhr1'xrhrhrhrhrhrh f'5Fh Hxrh Eightyffour Yg- Xff SOCIETIES. -'Wh i ,. D' any 4 .V av NS Y .03 'f' X, x .0 'il .fmfwis-. xv. -X-.. - O 6 -S0.gI:.0.0 0 .:., '-Q5 1,0 A o'o ' ' 'v J . f. .- -.-P.- ' 'f,-- :-:-:2: D.-' -' 1 N: -,-'Q 4 0 9 ' :,.g:g.3.0.0 0 , - - -'Q-.Q .-2010203-209' .0 0.0.0,g.0.,g20. - - - - - - - - Liu-q0,:.-.g' :-9030? 'i'39f 4 10.020209 ' P.0.4.-140.0 o -Q ' 502fZw:.0.gL0'.0. . 2. 6:02-. '2:2E2: -. -L 1 5:43-Q 0090.50 Q -, g.g's 1, f 2' 90's Q f ' , K. Q K 59.9. agp-1 . ' wg ,J b'o'o. 'EN L - NQSPK Q pqvio-222. N- -X , A. n O 5' 4' ?:'3'5-Tiiiiaiztziziztzfi . , s , 4 ,,y,..+,.,v,g, n ,Q 33.115, -,-Q r x ,EN '.. -' q,i,,f',,. QQ!-:hz 1 - ..,, 4, hm., . N 15- . -.....,.wd.,a,v,a4,ojI . A L, , , Q Q 7 ,.k.. . 0 5f.g,,g,g:,02v20.013 ' 'yr -.ff-1'---v0'+'9t ' lx 'ix 'Q 2 Q Q v N ng. g4sI1I0.g.0.0 0,020 --1,f.:.:n-:...:43:2s:.. .Q vb o '6'o'o'o TI-IETA PHI FRATERNITY Theta Phi Fraternity The Cmicron Beta Chapter Of the Theta Phi Fraternity had one Of the most successful years it has yet enjoyed at Riverdale. The Fraternity distinguished itself in athletics, student activities and scholarship. The Fraternity started the School year With but six members and closes it With thirteen. Among the School Oiiices held by members Of Theta Phi are the Captaincies Of Basketball and Baseball, Captainsfelect Of Football and Basketball, President Of the Student Activities Association, President Of the Glee Club, President Of the French Club, presiding Chairman Of the Varsity Club, as Well as the Editorship of both the RIVERDALIAN and the Gray Book. The Fraternity was most fortunate in pledging the more desirable of the younger fellows, and should, therefore, be in a position to get a good start when School opens next year. Theta Phi had eight men On the RIVERDALIAN board, two On the Review, five in the Glee Club, three in the Student Activities Association, there were seven on the football team, three on the basketball team, and four On the baseball team. The Fraternity has, to the best of its ability, entered into the various activities Of the School in a Wholefhearted, unstinted manner and hopes to continue the policy as long as it exists at Riverdale. THE ROSTER FRANK T. MOORE . . . . . President JAMES R. FOsTER . , VicefPresident WILLIAM Y. WROTEN . . Secretary DONALD S. FRIED . ..., Treasurer JOHN CAMPAGNA RAYMOND KENNY JOHN DALTON WILLIAM LEWIS ROBERT DANA JOHN NORRIS MINOR KEILHAUER THOMAS SHEA STEPHEN WALTER FACULTY MEMBERS ROBERT C. MURRAY CHARLES K. MCNEIL MARC L. BALDWIN T. DONALD MCCREARY JOHN A. BROWN GEORGE R. PRATT DANIEL C. CAREY MAXWELL A. H. WARELY fhfhrhfhrhri-ur'-Tri-rrhri-rrhfhrhr+1r+u-hd-wrhfhrhfhfhrhrhdwrhrhrhrhrhrhrhrhr-lwrhrhrhrf-mrhrhr+wrhAwfhA-.ri-xriwfhrhrl-mfhriwrh rhrhrhrhrhrh kk rhrhrhdwrhrhrivhrhrhrhrhrhrhrhrhrh rhrfifhrfxrBdwriwrhdwrhrhrhrfWhrfxrhrhrhrfwrhdwrfwriwrliflgr Eightyfseven Elghlyfelght DELTA PHI SIGMA FRATERNITY Delta Phi Sigma Fraternity Delta Phi Sigma is a local fraternity Of the School, having been conceived in the minds and effectively organized through the efforts Of Allen K. Murray, Herbert McAneny, and Ward Fenner back in 1913. From that date in the dim past to this wellfdefined present, the members Of its fraternal ranks have been continually active along various lines that have all tended tO better the School in innumerable ways. This year just past has been no exception, and although the roster has been small as compared to other years, we can safely say that the standard set so high by their predef cessors has been ably lived up to by these, the last members Of Delta Phi Sigma. This year the Captaincies of the Football, Soccer and Tennis teams were in the possession Of the Delta Phi members,not to mention the Editorship of the Review and the chief ofiices Of the two uppermost Forms. These, with the remaining activities, had rather a large representaf tion from the group, We are convinced, therefore, that considering it from all angles, this has been a successful year for Delta Phi Sigma. THE ROSTER WILLIAM PEARSON . . . . . President BENJAMIN PLATT . . Secvetafy WILLIAM BARTI-IOLOMEW . ..,. Treasurer LAURENCE FLINT EDGAR NYE JOHN ROMER GIBSON DAILEY FACULTY MEMBERS DANIEL GARDNER FORREST COBB LEWIS CLOUGH DALE BARTHOLOMEW STERLING CALLISEN O. RUSSELL LOCKE rhrhrhrhrhrhrfvhrhrhrhrfvhrhrhrhrh rhriwrhdwrhrhrhrhrtxrhrixrhrhrhrlxrhrhrhriwrlwrfwrlvh Eiglityfnine E 'E 6 6 -E E 6 E TE if 'E E TE E JE E -E E E f f -E E E E E E E t 'E E 'E E E E 6 15 +G fm.aafhasfwsavhawfhasmmasfhmmaamasasasaaaafhasmaafhfsfsfifhfhaaasfsfsfaig giivhrhrhriwrhrhrhfhrhfhrhdwrhfhrhrhrhdwdwfhrh -s f e Q f 6 -s 6 Ie 6 6 6 -s f -s ae 6 6 6 6 6 6 -e f fs f f -e f 6 Q as 4 as f as -e 'S .RE Cum Laude This Society was founded in the Year of Our Lord Nineteen Hundred and Six, by a group Of the more scholarly students at Tome. The purpose of the organization is to prof vide a stimulus for scholastic attainment. The Riverdale chapter received its charter in 1921. Those fellows who have attained the honor of Cum Laude have, for the most part, continued their brilliant records at college. Several of them have made Phi Beta Kappa, and one nearly won a Rhodes Scholarship. MEMBERSHIP FRANK S. HACKETT . . . . . President ROBERT C. MURRAY . Secretary MARC L. BALDWIN . . Treasurer FACULTY FRANK S. HACKETT MARC L. BALDWIN ROBERT C. MURRAY CHARLES H. PARSONS CHESTER D. PERRY HONCRARY HENRY G. HOTCHKISS LEOPOLD D. MANNES CAREY C. D. BRIGGS ' STUDENTS RICHARD ALLEN HACKETT BARTLETT PAIGE RICHARD LOEB ALEXANDER SAUNDBRS PHILIP BENNET FREDERICK FISHER MBLVIN NEWMAN HENRY MARK ROBERT TAYLOR ROBERT C. FULTON CHAUNCEY H. WHITNER RODNEY D. CHIP? MALCOLM O. FOSTER Aw rhrhrhrhdsdvivhrhih rl-sd-Irhrhrh -E 6 6 6 6 6 6 6 6 -E 6 6 6 6 6 'E 6 6 6 6 E 'E 6 6 6 6 6 6 6 6 6 6 6 6 rlNrhihdwrhrlvlvlv'l'1rlVhflNrhrhrhrh rh flNfhffNflNfl1flXrlNfl1ff1flNliNfHffTRXflNflNrlNfiNffNrlNHN rlvh Ninety HS X f f K Q x 52 X Q w f - X f A 3 A J A Q 4 STUDENTACTIVITIES Student Activities Association The Student Activities Association is composed of the heads of the various student activities. This year, as in others, they experienced the usual trouble in collecting ten dollars from each member of the School who participated in some activity. This ten dollars covers the cost of the RIVERDALIAN, the Review, and the dues of any activity to which one belongs. At Hrst, the Student Body failed to respond to the plea that the ten dollars be paid as soon as possible, but when it was seen that no one who had not paid his ten dollars would receive a copy of the Review, subscriptions rolled in surprisingly fast. By the end of the fall term almost every one had paid, and the Student Activities Association had sucf ceeded in its quest. BOARD DONALD S. FRIED . . . .... President GRAHAM CLAYTOR RICHARD E. KAUFMANN Gissox F. DAILEY JAMES R. FOSTER FRANK T. Moon. ffwrhrhrhrhrfvfvhrhfiwrivhrhrhrhrhdw rhrhrhdirhihdwrhrhrhdNrhrfTFlwrhrhrhrhrhrhrhrhrh Nmetyftwo 'E 1? JE Q 'E 'E -E 45 -E 'E E 'E -E E JE -E Q E -G f f E E f E f E 6 E 'E -E E E QE 6 VE 4 as.+afr.f+afisav+savismfsmmfhfhmfhfhanasfsfhmfhasfa-.fsfsaafrvisfi-.Asfwsfhfs N655 'E E 1E E 'E f 6 f f E -E E 6 JE 6 E wi Q E f 6 6 HE, '-PSP'-V'-V WWWWYVWWWWWLPWWWWWWWWYPLVWYVWJTPWWSPWWWXW'YWXEIBE 1 rm.- Art Club With the help of Mr. Coyne, who has come to us from the Lincoln School, the Art Club has finished a very successful year. There have been groups ranging from Hrst graders to sixth formers, working at drawing, printing and sculpturing. All the posters that have been seen in the Upper and Lower School corridors have been drawn or painted by the members of the Art Club. The rather modern idea of masks has been started, and many of the students have made quite attractive ones. The older branch of the Club has not been doing as much this year as it did last year, but a younger and more energetic crowd is being groomed to take its place. The Senior members are: GIBSON F. DAILEY . . . .... Presldent RICIIAIQD KAUIIMANN WILLIAM GIBSON RICHARD Kors WILLIAM LIEBMANN rhrhdwrhrhrl-vhrh rhdwrl-Irhd-wr?-Irhrhfhrhfhrl-Irh rhfhrhrhrhrhrhdwdwrlwdwdwrhdwrhfhdwdwrhrhrhrhrhrl-rhrhrhrhrhrh 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Sl?-.fwhmmfhfhfhmm Ninetyftlrree The Dramatic Association The Dramatic Association has had what a lexicographer would seriously call a good year. Two major productions and a onefact play were given, not to mention numerous internal activities such as pantomime contests and the like. At Christmas time, a modification of Ashley Miller's dramatization of Dickens' Christ mas Caroln was presented to an enthusiastic audience, while during the last term an even more ambitious attempt was successfully carried through when John Galsworthyls Loyalf ties was produced. The onefact play was Eugene O'Neill's S. S. Glencairn play, L'In the Zone, and was shown early in the fall term. - It is doubtful if any plays ever given heretofore had the technical perfection which was shown this year. This is due for the most part to the new switchboard and other electrical equipment. Mr. G. R. Kernodle had charge of this side of the work, while Mr. Robert Hayes was DirectorfinfChief. Incidentally, may we add here a word of commendation for these two men who so ably fulhlled our expectations? If it had not been for their wholef hearted effort, the results for the year might have shown much less progress. Nmetyffour WWWWWWWWWWQPWWWWWWLVYVWWWW WWWWWWWWWWAVWJWWWWWSEIE French Club Mr. McCreary took over the guidance of the French Club this year since Mr. Monges, who was last year's faculty advisor, did not return, Most of the members of the previous year returned, and since the start of the new year, its size has increased remarkably. The members are thoroughly familiar with the language and converse it freely among themf selves. Progress is handicapped by the fact that meetings are not held regularly because an activity which has precedence over the French Club meets during the same period. Preparation has been started on a play which is to be given at the end of the year. French books and plays are also furnished and these are discussed at the various meetings. And so, overcoming all the obstacles that unfortunate circumstances have thrown in its path, the French Club has managed this year to come through with flying colors. OFFICERS T. DONALD MCCREARY . . . . Faculty Advisor JAMES R. FOSTER . . . . . . . . President MEMBERS MAURICE RICHARD STEPHEN WALTER EMILE KLUGE GRAHAM CLAYTOR RICHARD PITTMANN RICHARD KoPs HOWARD GOLIEB WILLIAM GIBSON rh rhrhrhrhrhrhrhrhrhrhrhfhrhrhfhfh rhrhfhffxrhrhrhrixrlwfhrhrhrh fhrhfhrhrhrhrhrhrhdwrhrhdw fhrhrhrfwfhrlsfhrfxrlwrh rhrlwrhihrl-Irlw fiifhrhrhrhfhrhrhrhrhfhfhfhrhfhrhdwfhrhfhfhfhrhrhrfwrlwrhrhrhdwrhrhrhrh rhfh rhrh Nmetyffive if 3 M , . ' wif Q. . . A 9 RICHARD KAUFMANN The Relief Society The Relief Society is a School tradition. It was started during the World War as a means for raising money for the Red Cross and other helpful organizations and has continued ever since. The idea is that the boys give, each month, a specified amount from their own pocket money. A reserve fund is held for emergencies, the purpose being to eliminate a constant succession of petty drives. All contributions are entirely voluntary, and the pledges are fixed by the boys themselves at the beginning of the year. Some of the charities aided this year include: the Charity Organization Society, the Association for the Improvement of the Poor, and the Hundred Neediest Cases of the New 'York Times. Other worthy institutions are aided to the extent of the limited funds available. 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 f 6 f 6 6 6 6 6 6 6 6 6 6 6 6 6 6 f E 6 fha-.fhmfsfhfhfhasasfwhfhfsmfsffii rhrhrh rhrh rhrhrhrhrhrhrh 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 rhrhrhrhrhrhrfirhrhfhrhrfvhrhfhrh rh rhrfwrhrhrhrhAwrhrhrhrlxdwrlT?hrhrhr+wrhrhrhAwrhdwrVTllg Ninetyfsix Miili'il'1fY-1l'i-Jw-tj rff-fialfiflsiliffifif555Hiiifgi-35i'fQ:pE?1.E3iE511i5:f .E'j:9lf-+R 1+-r-lgjigiivie The Science Club Beginning the season with a fairly full roster, the Science Club got a good start for what has since proved to be one of the most successful seasons in years. Many changes were made in the Club. The old custom, namely, that each member give a talk on some scientific subject, Was abolished. Instead, the Club Was divided into three sections of equal number. These sections took up in turn, the building ofa model steam engine, the subject of photogf raphy and Work on an erector set, spending a term on each subject respectively. Various motion pictures Were shown and during the season several trips were taken to various places of interest. Considering all these interesting occupations, it is quite evident that the Science Club has had a very good year. ff- -'--- -'W-if----W 5 'Q Qi ' T., yu Q Nmetyfseven THE FORUM f f ' ,.: k ix PUBLICATIONS Q FW 'S' Q4 Y P lr p , X 3 O 3 4 1 AULUWWWWWWWKEHJWWWWWKVKVWWWLVW WWWKPWYUWKVWWAIJYIJWWWWW'-Eff FRANK T. MOORE JOHN CAMPAGNA Editorfinfffllief Business Manager The Riverdahan Board 1928-1929 FRANK T. MOORE . JOHN J. CAMPAGNA GEORGE R. PRATT . ROBERT B. DANA DONALD S. FRIED DONALD HAGGERTY LYMAN BLOOMINGDALE GIBSON F. DAILEY . . RICHARD E. KAUPMANN I Editorial Board Business Board . EditorfinfChief Business Manager . Faculty Advisor JAMES R. FOSTER STEPHEN WALTER MINOR KEILHAUER MAURICB RICHARD . , . , Art Editor . Photographic Editor 4 JE rhrhrhrhrhrhrh7h ffirhrfxrhrhfhrhrhfhrhfhrhrhrhrhrhrfx A-v+v+w rhrhrhrhrhrhdwrhrhrhrhrfxfh rhrhfhfhrhrhrhrhfhrhrhdwdwfhrh Hrs N2F'Fhfhrhrhfhrhrhrhrhrhfhfhrhdwrhrhfhrhrhfhfhrhri'-Irhrhrhrfvhriwrhrhriwrh r'Efh rfx rim-F.'gB One Hundred One Q 5 sz 9 -If 'Sf 5 'n xg Q ...Q 7 N'S!v'iv Y' r, i 5 . ! Z f-Y ,. I I X,- THE REVIEW BOARD Review Board The Review Board closed Volume XIV with a successful season. The main achievement was the paying off of the debt which the 19274928 Board had amassed. Several new feaf tures were introduced by the Editorial Staff, among them being: Prominent Riverdalians, The Roving Reporter, and The Outlook. Several commendable articles which appeared in the Review were highly lauded by everyone. The Review oi'Iice was a constant beehive of activity, and heelers were always seen composing their contributions zealously, aided by the more experienced members of the Board. The outlook for the Review at the beginning Of the year proved none tOo encouraging since most of the Staff were unaccustomed to their tasks, but after a little experience had been gained, things straightened themselves Out and everything progressed smoothly and rapidly and soon a state Of mechanical perfection was achieved. Thus it is that not enough praise can be given to those who helped to make the Review a success. GIBSON DAILEY WILLIAM PBARSON ROBERT DANA GORDON BIBI-IN JAMES FOSTER BATES HALSBY THE BOARD EDITORIAL STAFF BUSINESS DEPARTMENT . EdicorfinfChief Managing Editor Columnist Sports Editor Business Manager Advertising Manager 'E 6 E E E 16 E 'E E 'E QE E 45 E 'E 'E E JE JE f 'E E if 'E E E E 6 -E f LE E f Q E I f E asasasfsasfsmfhasfsasmfhfsasfsfsfhasasfservsfsasavrsfrvisasasfrsfisfsffs rhrhrhrhflwdwfiwdxrhrhfhrhdwdndwrhrhrhdwdwrhrhfiwriw rlvhfh 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 is One Hundred 'Three WW W KPWWWWWWWWWWWWLVYVWWWWW LV WWWWWWWWWWJWWWWWW FRANK T. MOORE MINOR R. KEILHAUER Gray Book The Gray Book has become a tradition at Riverdale. The last copy, Volume IV, was edited by the Messrs. Moore and Keilhauer who turned out an excellent job. All the matter, which had long since ceased to be current, was brought up to date, and it was used as a source of information by both the new and the old boys. It enables one to learn the various rules and customs of the School, its schedule and the daily routine of dormitory life. We have come to a point where we regard the Gray Book as a vital necessity, and if a person were to stop to think of the many times he has referred to it, he would soon realize that it is something which should be appreciated. And so, judging from the last volume, we know that we are leaving this precious and invaluable little book in very capable hands when we again hand it over to Frank Moore and Minor Keilhauer. ff'sfl'NffHf+N'+N Hf+'uf'Nf+Wf'fNf+Nf+NflWf+'Nv'lNfl'1f'lNflNf+'1ffNffNfht'hf'hfl1fl'!flNflNflNflNfhf'hfl'Xfh rFr'h rhrh X One Hundred Four AS fhrlwriwrhrlxrhrlxrhrfwrh rhfhrhrhrlwdwflwfhriwnwrhdxrlxdwrlwrixriwriwrfwrfiflwdwrix 'E 16 E E 'E f 6 JE E -E SE +2 JE E 4 i I lv w Q L a F K' Q' ' ' S -Mffffff ... mmm A ff 111242 fzff ip Wllllllmlhfll ? ff f W' wil as My X 1 THE GLEE CLUB Glee Club The Glee Club has had as successful a year as any Riverdale Glee Club has ever had' Entering the annual InterfPreparatory School Contest, the Club fairly outdid itself in obtaining an easy sixth place, outranking such schools as Taft, Hotchkiss, Choate and Peddie. Never before has Riverdale ranked as high in this contest, in which are entered all the leading schools of the country. Aside from this fine showing, the Club has been very active, several concerts having been given at such places as Fieldston School, where a Hne reception was given the singers, Hartley House, Hackley Schoolg Spence School, at the meeting of the Parents' Association and, above all, a joint concert with the Columbia University Glee Club. A dance followed this concert and the occasion proved to be most successful from a social as well as a musical viewpoint. It should be pointed out that a great deal of the success of the year is due to Mr. Locke, who is a newcomer to our midst. By his skillful direction,his untiring efforts and his earnestf ness, he has brought about a greater degree of cofoperation than has been achieved in many years. With only a few of the members leaving, an even more brilliant season is predicted for 1930. The officers are: DONALD S. FRIED , President GIBSON F. DAILEY . VicefP'resident BENJAMIN J. PLATT . . Secretary JAMES SAUNDERS . Manager One Hundred Seven Q Q Q Q Q IE Q Q Q 'E E Q Q Q Q fe -E -E Q 'E 'E E Q Q Q Q Q Q Q Q Q Q Q Q Q Q rt 'E r+wr'hr'hr'HfF5g: rf-IrP.Rhrh I+-IrEFhf-hfh rhrhrhrfwrf-v+1Awrf-Q rhfhrhrhrhfhfhfhdwrhrhdwrhrhfhrhrhrhriwrhdwrhdwrhdndwrhrhrhrhrhrhrhrhrhrh 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3' 3 3 3 3 3 3 3 3 3 Z3i7+wrf-Irfifh '3ilVWWWWWWWWWWWWWWWWW'Kl'WWW-'WW WWWWWWEPWWWWWWWWWW 9 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 The Riverdalians The Riverdalians have become a tradition at Riverdale. They are the School jazz Band, and as such, furnish musical interludes at rallies, plays, dances and such gatherings. The more or less advanced of the musically inclined are given the opportunity to study music Cof a sortj in its primitive forms, and it may be said that this opportunity is seized with avidity. This year, because of illness and a lack of talent, the orchestra was reduced to four mem' 3 3 3 3 3 3 3 3 3 3 3 3 3- bers, but in spite of this handicap, by dint of hard work, they managed to make themselves 5 thoroughly appreciated. 31 3 3 3 31 31 3' 3 3 3 3 Under Gibson Dailey's leadership and saxophone playing, the Messrs. Keilhauer at the piano, Morrell at the traps, and Kaufmann at the banjo, with his terpsichorean efforts, this select little group managed to conclude what might be called a highly successful season. ali rixrhrfxrhdwriwrfxfhrlxrtx dwfhrhdwrlxfhrhrlwrhrhrhrhdxfhrlwflwriwrfxdwrhrhrhdx E 6 'E E E E E 6 6 'E t E 6 E '6 f 5 QRXAHHNf'fHffNff'NflNflWfl5fl'Hfl'NflNffNfhf+Nfl'sfl'WI+wffNfhf,'Xfl'Xfl'XffNffNI+1fl'kI','XffNf'hflNfhf'l'ifl'XffM flqfhrh rh' One Hundred Ezght Rihig-,,. - , . . 7 ll. ., 2 ' . . . 2- , ,Kayak - . , X W swvzifwv gffasfizvwh 66'-mr . l',. .Q ,. , Y, ,4 1 A .ml f , X X X Lwwfl CON TRI B U TION XX YA wwwwwwwwwwwwwwlvsvwwwwwwwewwwwwsvwwwsvwww-ew The Sixth Form Bev Snyder is a lady killer, Whose ambition is to flyg His good looks and his passion Are the cause of many a sigh. Kaufmann is a doughty lad A dancer of the tapg And whene'er he makes announcements The boys are sure to clap. bl. Norris, the Schools Adonis, ls a very handsome boy. He handles that little basketball As if it were a toy. Bill Pearson is our Democrat A youth of much renown, Who, taking to his Ford of late, Is burning up the town. Fog Dolan came from Boston The home of all the beansg And now he does his grubbing With the Dean of all the Deans. Phil Dreyfus, the young prodigy, Has locks of fiery red. If you ask him about the wave therein He'll blush from toes to head. Gib Dailey, the School musician, Also edits news, And much of the School year was Aillicted with his blues. And so after another year Of friendships true and warmg Vlfe close the gates of friendship Upon one more Sixth Form. -D. F. H. rlNr'lNrl'srl1rhrl'sflvlwrhrl'NrlVhrfxrlNrlNrhrl1rhrhfhfhrhrlvlwrhrfVl'srlvlNrfWlvlNrf5lNrlNrlvhrlNrhrlN One Hundred Ten WSW ,lzt-M, ,M My ,, ,,,,..f.,f ff f f f ' ' f ' w , K 5 W X X 2 ,1 7 Y f J ggi ' f f ' :gm k i i 5 4 , , i 1 E. ff ' DONE Mosr Fun RKVBRDALE bww- B1-we-xmam. Sochm. LnoN V. Mos? APQPULAR' L J I ! 4!1V'7 m B251 ATHLETE- 'X'J'TT'EsT Y 1 iff, MOST Dv.moc.mm'c 1 Mosr lNPs.uENTsA1. , Mun- CoNsioe.vrre ' ' , , Lm.i i ..- l. f ' , f me V Hnmesomexlr MOST ENe1xa.n'rke. Bfwesv Hexv-TB'REAxel. T Mogv Cone!-WED Q 0 A , 1. A A . f . I X,-f x :Ll I IXXX Y i K K xx xx i 7 X...x 'V LJ 1 --an ' ' Y i Eb g in 5 5' , t ,Bioe.u1 LG1innaL K K ! 502f 5211-fv-as ,. . ff x Q ' - if 5 ' - - ' TV. .K tx F K K . it In , K I K U ,k,. 4 V, If ' Q X K 1' , X L ,L -L: ' I A . -1 film' 5'3 . f. f 1 J , riff - .K , , . ,-Q ,-,. ' 1-f2i3,Qg'55Q .Q V- tfk 5 9 .13 -J, Rf'-'2 + , - f X m k , f 1. .-km z, Ax .V .. bw af ' -Q , , . -Q K , x. -. X -X . ' X., . M-,,y,151ws6f vxfw'-sy wif 34-.:fxiLm,?:' L42 '- ., qv-.wx .4 ' f . ,. I X X , . ' ' ,A+ 1822- W S:'f 'i'i1i'5?'2'W a52 sf'N3 IYf P,1x519if .-zggrv 1'-MX J , Z, ' ,1 f 4 .i '?-iff 2: Ig :gg f A-77 Q -,: ,ag K-N11-wfyf me .N 55-f',gi,'.2L W, ag ff' f , Q: , .sA 4 vxiv .X -'A- . '..-: -w W Q .fylmzwfif-ae., cf QWQ NXXQXVS Ew fikyf-awfx,-,', Y 5 X, - L, .... gm , X -, ,- Qi-Vi. , , HX., 4 , M y Q.: ' m i a- Nrfk 2 NP: M E' K fx 4. , gf .1 . Lv Q 53 1 QNX, mpc .V .,v,, A .- ,. . .Y W, .,,.4 L , ,,,Q,,, ,... .,...,, ,, Won and Lost Molly Maguire was a redhead. As you have guessed she was Irish. Terry Malone was a loafer. He was Irish, too. The opening of this narrative finds Molly hard at work as a typist in one of the downtown ofiices while Terry spent most of his time, with which he was richly endowed, occupying the surface of a newspaper box which he comfortably angled against Oetter's grocery store. Occasionally, the oppression of poverty necessitated Terry fighting in one of the prelims but the rigors of any sustained training made the fight racket an impossibility as a means of permanent livelihood. Molly, though exasperated by his lack of ambition, had long held a deepfseated affection for this free lance and this was reciprocated by something of a brotherly interest on the part of Terry. For years he had been entreated by Molly to get a steady job and forsake his worthless associates who made the community corner their habitat. Terry had often been on the verge of considering such a radical proposition but had never quite arrived at the stage where it was necessary to translate thoughts into action. Fortune smiled on this child of hers, however, by handing him a double break. As an accelerator Molly contracted a suitor in the form of a Michigan Freshman. The other stroke of luck was the offer of Eddie Meade, then manager of Andy Chaney, Baltimore hilfer, and joe Lynch, bantamweight champion, to join his stable of leather pushers. Meade had liked Terryls work in a semifinal one evening and decided to give the boy a tumble. The incentive aroused by the intruder not only opened Terry's eyes to his standing with Molly but had made his course apparent. In short, he went to New York with Meade on the first train. To make things the more difficult, the collegian had not corresponded with Terry's ideas of such at all. Terry had never before seen a college man from close up but he had seen them in the pictures and had once seen Waring's Pennsylvanians. Natuf rally, he was taken somewhat aback by this joe Marek's athletic build and his seeming capability of looking after himself. Begrudgingly, Terry realized that as matters stood he was no part of the show. He must acquire fame and fortune to offset Joes handicap. Terry did not End the big city awaiting his arrival with bated breath or anything approaching it. Everyone seemed cold and uninterested. But Terry stuck closely to his knitting and added to his knowledge of givefandftake. He won his first three fights and finally got in the curtain raiser at the Garden. On this occasion he stopped his opponent with a few gestures and thereby earned other chances to display his wares. Terry had been fighting in good form since he got under the big top and before long was quite a favorite at the smaller clubs and a regular performer in the Garden prelims. Before the year was out, Rickard, on an off night, had given him a shot in the main event against Dave Shade. The Californian gave him a right smart lathering but Terry was still in the same enclosure at the hnish and perpendicularly so at that. Having gained this lofty status, Terry deemed it favorable to take a rest and go home for a furlough. How could Molly now place a mere educational upstart ahead of a man who had made a niche for himself in his chosen prof fession and one who actually commanded space in the Metropolitan Dailies? When Terry alighted from the train he found the old station as bleak as ever. Of course he hadn't really expected a brass band or anything of the sort but the fact that there were no demonstrations of good will on his return secretly nettled him. No other fighter had ever 6 6 'E 'E 'E 'E 6 'E 'E f 'E 6 'E 'E 'E 'E 6 6 'E 'E 'f 6 'E if 6 'E 'E 'E 'E 'E 6 6 'E 6 'E 'E rf f asfsavsavisfivsfsls 6 6 TE 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 dwrhrhriwfhffxrivhriarhdwdwrhrhrlwrh rh rhrhfhfh flu rhrhrh rhrhrhrhrR7hrhrhrhrhr1vh rlw rhrh One Hundred Twelve made the grade in big time from his home town. What a world, he thought, as he walked down the platform. The boys down at the corner made quite a fuss over their conquering hero and assured him that the local papers had considered his fight with Shade, at the very worst, a draw. Molly, too, was proud of him. Christmas was soon upon them, however, and with the yule came Joe, home for the holidays. Joe monopolized Molly's time to such an extent dur' ing this period that Terry was stirred to remonstrating. Joe had made his letter in football and was regarded as a likely candidate in track, and Terry wanted none of this one athlete to another stuff from his rival. Terry made his attitude felt and even went so far as to Mask Joe out on a winner take all basis. The latter sensed the inadvisability of such a move but did not dare back out. The combatants repaired to Qetter's stable to hew out their differences. To comply with the laws of such tales we bring news of the conflict to Molly, who, of course, hurries to the scene to call a halt to the proceedings. She came to find a much battered Joe and Terry in a most selffsuilicient mood. With one glance at the victor she busied herself in the conditioning of Joe's features. Terry had run out his string, won the battle, and lost the game. The following day Terry was seen boarding the American in his Rosenquest vest for New York. His campagnate cravat in no way bespoke the weight of his heart. He was as Norman Selbyl' once said, Lucky in the ring, unfortunate in love. And so it was. 'Kid McCoy. fhrhdwrhrhrhrhrhrhrhrhrhrhrhrhrhrhrhrhfhdvhrhdwriwrhr+wrhrhrfTFhrhdwrhrhdvhdwrhrh One Hundred Thirteen 46 +6 E 6 JE 'E E E E E E -E E E E 5 6 -E E -E 'E E E 6 E Q E f 'E E E 6 -E 6 f f TE -E I fkmfsmasmmmmmfsasmmfsfsasasmmmmmasmasfsfsmfhfhfsasasmfsmnsnsfhfhasfafhfhasfsasfhfsfhasasasasfo-fsasfsfsfslg ZH WW WkPWWWWWK42PWNVWWLVkVW!WK1JW'VW WWWLVWHPYE'-VWWAVYPW'-Q-'KHWQ' Modern Dancing This modern dancing, when observed by certain people who look at things differently from most, is bound to appear startling. If Columbus were to make another voyage of discovery from the time of his death right up to the present, aiming to find out how man has progressed, and what are his chances of another flood being dropped on him, the old boy, unless his compass had been corrected, would be just as liable as not to come barging into a New York night club some Saturday night and promptly run aground. His Hrst thought would be that he had completely circumnavigated the world of time, that while he had been laid up for repairs in some remote desert isle, the present civilizaf tion had undergone a setfbackg in fact, it had been wiped out altogether and this was the new one, just starting. nYep, he would be forced to admit, 'Lit certainly must be very young, for Adam and Eve started without a stitch between them and this crowd has darn little chahng gear. At least, this was the case with some. Others seemed to be pretty well covered but were not so far advanced as to handling themselves. As Chris stood in the door unnoticed through the tobacco smoke, he pondered and supposed that it had taken Adam's family a couple of generations to gain full control of its limbs,though he had never thought of it before. But then, there was a hitch in it. How could these people have multiplied so fast and still be so poorly developed? All they did was to sit around and make noise. There was a little group in the middle of the floor, but they seemed to be worse off. They were holding each other up, couldn't even stand alone, and yet there must be hundreds of them here. According to the Bible, the other civilization hadn't gotten off to such a slow start. Maybe God had made some changes in His 1929 model. But that wouldn't be. These certainly werenit improvements over the good, staid, conservative folk he had sailed away from. And on the other hand, look at this room. It was beautiful. The woodwork was far better than the excellent job he had insisted on for the old 'Santa Maria. lt would take centuries for such noisefmaking instruments as those Africans were wielding to be def veloped. Well, to put it mildly, the old navigator was stumped. Here was a people whose culture was decidedly low. And yet they had produced things that would have been worthy of the civilization that had been taking such strides forward when he sailed away. Columbus thought and pondered, all the while observing closely the incomprehensible actions of a portion of New York night life. Finally he reached a conclusion. The only solution to the problem was that this must have been the same civilization that he had sailed away from, that there had been no flood, but that while he was gone, the climax had been reached and the culture of the people had started on the decline. Their developments remained at the peak, but this civilization was going the way of the numberless ones before it. How far down it had slid, he could not tell. It could not be far, however, or the powerful things it had built up would have begun to fall. lt was just the denouement of another play by the Great Writer. P rhrhrisfhrhrhrh rhrhfhrfvh rh rf-iriwrhrlvfvhfh wi f 'E -E 6 'E JE 4 f 6 rh rhrhrhrhrfx rhfhrh rhrh fhfhfh rfsriwffwrfwffwfhrhrhrhfhfhrhrhfhfhrhrhfhfhrhrhfhrhrhrhrhrhrhrhrhrhfhrhrhFRFIN rhrh One Hundred Fourteen WWWWWWWWWLILHJWWWWWWWWWWWW WWWKIJWKVWYVW'-IAIAIJWWWWWMI-LI? Neighbors Sly Ikei' Cohen had at last made a mistake. After twenty years of successful bank' robbing and safefblowing, one little forgotten fingerfprint had proved his undoing, and he was now serving the second year of a twentyfyear term. However, he did not have the slightest intention of remaining in Atlanta for twenty years, he was merely waiting to ind a fellow convict whom he could trust. Ike had always prided himself on the fact that he never made a mistake in judging a man's character, and he had not yet found the man he wanted. One day, a new man was brought in and placed in the next cell to Ike. Ike had had many neighbors before, but he liked the looks of this one more than any of the others. After talking with him for a while, and Ending out that he also was in for a long time, Ike decided that this was his man. The new convict, Number 131313, became very attached to Ike. As they were in neighboring cells, they had a good chance to talk together in the evening, and during the day they were assigned to the same rock pile. After about two months of close friendship, Ike brought up the subject of escape. The new convict, whose name was Thomson, became very enthusiastic, and together they planned how to get away. Une day Ike managed to get a file from the toolfhouseg thus the problem of getting out of their cells was solved. Thomson, who had already become popular with the guards, expected soon to be made a trusty. After a month of anxious waiting, his expectations were fulfilled, and he mailed a letter to some friends in New York, arranging for them to be waiting outside the main entrance of the prison at 2 A. M. on August 18th. He told them the number and the posif tion of the guards there, and how best to overpower them. Throughout the week preceding August 18th, the two neighbors spent most of their nights Bling at the bars of their windows. At each meal they secreted a little butter or lard, and with the aid of this, they could work with comparative silence. August 18th finally arrived, it turned out to be an ideal nightfdark and rainygand when the two convicts climbed from their cell windows and dropped the ten feet to the muddy ground, no one saw or heard them. They made their way, undetected, to the front entrance of the prison, where they found Thomson's friends awaiting them. The guards had been completely surprised and easily overpowered, so the way to freedom was clear. :uf Pk wk wk Six months later, 'LSly Ike, who no longer had such a good opinion of himself as a judge of character, was back at the rock pile. A few days after his arrival, while still wondering who betrayed him to the police, he received a newspaper clipping and a handsomelyfbound autographed book from his former neighbor, Number 131313. The book was called Life in Prison, by Johan Thomas, the newspaper clipping, a part of the book review section of the Times said: ujohan Thomas, the famous author, tells a thrilling story of his escape from Atlanta in his new book, 'Life in Prisonf Mr. Thomas pleaded guilty to a false charge of swindling in order to get material for his book, which is easily his best work thus far. Charles Scribner E99 Sons, 52.50 rtxrhrhrhrhrhriwrhrhfhrhrhrhrhfixfhrhrhrlwdwrhrhrfwrlwfli rfNfhfT'1rhrhffNfhfhflNr?Nf1Nrhfhrhrhfi'wfiWffNffN f'l'Nfl'xfi'Nfl'XfiNf'l'xflxfi'xf+wf'i'Xfl'w f f i Y fFxfiNffNflNfiNfiNfi'Nf'fifi'1Fi1f'lNflWfiWfl Nfl'NflfNfhffNf+Nff'WffNl'l'NfiNf'l'Wf'iWfl'Nfl'Nf'l'1flNfl'NfIWffW4'l'Xf'fW rinfh r+wrhrfTE ' One Hundred Fifteen K WWWWV'PWWWWWWWWWLVWKVLVWLPK-V'4JYV WWWVPW'-VLEYPWLl4l W'bV'+'WWkP'+!.E Willie Esmond The Adventures of a Microbe The problem of vacation, from the parents' point of view, has frequently been discussed by far more able writers than myself. QThe old oil.j Nevertheless, the perennial period of whoopeefmaking has another side-that of the maker of the whoopee. Let us take our old friend Willie, better known as Willie, or sometimes Willie, as a case in point. It is September. Willie, or rather Willie, has just returned to school, fresh from his vacation, too fresh for his own good, in fact. Nevertheless and notwithstanding, he ref ceives, one fair morn, a little envelope in which is contained an invitation to a party. It is accepted with alacrity. And that ain't all, either. From then on our hero receives a heterof geneous conglomeration CI get paid for those wordsl of invitations that is fearful to behold. Finally, he has not one night of his Christmas vacation left open, so he considers himself as moderately well dated up. It is now Christmas, Mr. Scrooge. Little Willie Brokenbasin, or was it Esmond, who, for your information, is a scion of wealth, decides to give a ninefthirty party a break. He may have received another invitation for the same evening. He may even have received a copy of the Boy Scout Manual. Maybe he's a Mason. You can't tell, and I won'tg so there. However, we shall assume, for purposes of simplicity, that he has but two bids for this evening. At about halffafterfeleven Cme and Chesterheldl Lord, not cigarette, I'm too non' chalantl-Well, anyhow, at about halffpast eleven Willie, whom, as we know him better we shall call Willie, saunters nonchalantly into the ballroom with all the noise of a cater- pillar thundering across a leaf. His amiability will depend on the reliability of his boot' legger. We shall assume, for merciful reasons, that he fthe bootlegger, not Williej is trust' worthy, so the center of our story is still on his feet. He dances only with the belles of the ball, for fear of encountering a piece of fruit popularly known as an overripe lemon, and remains as far away from the wouldfbe rescuing hostesses as the ballroom will permit, Whatever else his feelings may be toward his fellow men, he has not the slightest desire to do charity work. The hostesses must remain content with the common or garden variety of animal known as sucker. Should he lose his balance, or through some other mishap of fate be roped in, however, he still has several snappy comebacks. Usually, he remembers that he has not called his mother about the progress his erring sister is making, or, should he be asked to meet some very sweet girl, he will simply reply that he has met them all. If he cannot escape any other way, he will pass on to his next party. The poor boy is tired though, and his point of view is slightly dulled, so we will represent his experiences here by the following verbose statement. That was really bluff, I had nothing to say about that party, I was out cold before he got there. A-rlwffiflwrhfhfhfhrhr-hrhrhd-.fhfhrhdwfhrhrhrhrhrhrlwdwrhrhdxrhdwrhrhffirh ffiUaNf,Nf'l'X T One Hundred Sixteen ' rh rhrlwf+xrhrhdxrhAxrhr+xrhrhAwrhrhil1r+wrfw 'E E JE 15 6 E E f 'E f E E G E E E 6 E E -E E JE E E 'E 'E JE Well, I mean well, at four or five o'clock, if he feels like a long sleep, he is carried home by a lifelong acquaintance of twenty minutes. In getting in he awakens little brother Cif he is in the right housej who undresses him to more or less of an extent, the extent def pending on whether the subject has stiff shirts which open from the front or the back. Well, or maybe I mean perhaps, the next day, if he is able, he repeats the performance, In fact, he does it every night for three weeks. At the end of that time he returns to school to rest. After three months he is almost himself again, if he is lucky. Which proves that it is all the fault of schools, anyhow. We simply must have vacations during school time and school during vacation. What could be simpler than that, except perhaps a volume of Kant. A Bowl of Goldfish The other day I was walking down the street, looking into the windows, and admiring the various luxuries when I came to a store with a sign above its door- Dog, Cat, Fish and Bird Store. I looked in through the large plate glass windows and saw an assortment of poodles, wirefhaired terriers, mice, parrots, Persian cats and sunhsh. Upon walking around the corner of another window, a large bowl of goldfish attracted my attention. It was beautiful, it was exquisite, I had never seen anything so wonderful in my life. Upon closer study of this piece of work, I discovered that it was made of glass the color of topaz, and had a myriad grained beach of what looked like little balls of fire. The goldhsh flitted and twirled around a tall fairy castle which loomed up out of the bowl into the sunlight. But the thing that interested me most of all was a little sea garden. I went inside to the owner of the store and asked him the cost of this exquisite wonder. He told me a fabulous price which I paid because I was willing to do without everything else to have this attraction in my house. In a few days the bowl arrived, and I placed it in my living room in the sun. Its sides played beautiful rays of topaz around my room, and the fairy castle shone in the sunlight as if it were made of silver. I was disappointed, however, in one thing, the pretty myriad grained beach was not as it was in the store. I regretted this terribly. The balls were there, but their phosphorescence was gone, and it gave my sea garden a look of gloominess. I called the store man on the telephone and told him that he had cheated me and had not sent the phosphorescent crystals along. He replied that they had been placed in the bowl and that he would come right up and see what had happened to them. Un his arrival, we went into the living room and looked at the bowl. He said that he could not understand why they did not shine. He reached in and brought one out, and then he gave an exclamation of delight. I grabbed the ball away from him and looked at it? wonder of wonders, it was a pearl. We looked at all the others, and they were the same+ a priceless collection. To this day I have not been able to find out how they got there. They might have been placed there by some person to hide a theft. They might have been placed there by some kind member of my family who was leaving them to me, but to me they will always have come from my fairy castle, bred on my sea garden, and brothers to my balls of hre. Q Q Q Q Q Q Q Q E Q Q Q Q Q Q Q f Q Q Q Q Q Q Q Q Q Q Q Q E Q Q Q Q Q Q mmmmmmmmag fi-srhrivhrhrhrhrlvfsrhrh F. fhrhl rhrhrhrhfbrhriwrhrhffxfhrhrhrhrhrfxrhfhrfxrhrhrh 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 gammmmmmmmmmmmmmm One Hundred Seventeen ' WW W WWWWWWYEBJWWWWWKVWEIJWWWW W '-VFPLI-'W.WWkVWWNAP'VLPWWkPK Midnight I All the nights were the same. If anyone had chanced to peek through a crack in his bolted door he would be met by the same still, peaceful scene as always prevailed through' out the long hours of winter darkness. Silence lay like a heavy blanket over everything. The snow drifted silently down into the quiet streetsg down, down, down, it came in military order, settling over roofs and trees, piling up across doorsteps, laying with quiet precision the traditional white mantle over all the low, log houses which had the appear' ance of being solid and able to withstand the blizzard that enveloped them. They were lined up evenly on both sides of the narrow street with a carefulness and cleanliness which reflected the characters of the stolid Dutch sleeping peacefully inside. Nature dominated the entire scene. What little handiwork of man there was visible seemed to coincide with the conservative job done by her. There was nothing makeshift to be seen through the semifdarkness. Over all an atmosphere of preparedness prevailed. The white flakes conf tinued to drift down and the little settlement received them silently and with a certain degree of resignation. II The theaters were just out. Mobs of New Yorkers jostled out into the turmoil of Broadway. Snow was in the air. The people barely noticed it, except when a flake or two happened to touch their faces. Taxis pushed through the mobs at the corners. Policemen blew whistles. Men and women waited impatiently for a cab to come their way. The streets were covered with dirty snow and ice that made crossing more distasteful than usual. Noise and motion were everywhere. Even the electric signs, cutting the snowffilled atmosphere on the tops of high buildings, added to the turmoil. Discordant horns blew, and sirens shrieked as noisy engines under yellow and black hoods reared in a vain attempt to push across the great white way. People of every type went in and came out of the subf way entrances. Boys and old women yelled about newspapers at the top of their lungs, but no one paid any attention to them, no one paid attention to anything. It was a human and mechanical maelstrom. Awrkffifhdwfhrhrhrhrhrhfhrhrhfhrhdvhfhfhfhfhrhrhrhrhrhrhrhrhrhrhrhrh fiifh rhrh One Hundred Eighteen f-N z, 1- .,.. ff I plfv is 7 f fl W xx , ,,!, J Qxicz, irlyzfffg, i I ' fill X X U 'U KN x rw ' MI 1 N x .4., . I X X X f 'ul l X Xx T'f1'L'P55' .. f X 5 , Uv X X10 735- ga K' zimigmsig mg 69 C .vf -.a--' N ii?-f N x X x ,fx L-,ML V 41 Q,IkVk4Ikl,lkVkpl4lx+lx+Jx,4jxyyllyljkgpyiyqjqjxpqiLijqgqjqjklfyvkpqjkyqjqJg+JL4-,kvkvq 'Mx Xfa 'Y 1' X J 5 ffm If fr I X X F . I 1 xx fp I 5 wr' 1' , ' 'L 551 IW! Q xggg f Wx: X X px X1-1. NN'-LFXNJW' is n 6, SN 1 X, x 1 i 0 4 7 3' ., 5 1 Ugg sin-iv '-'i if J A I. I Xl N r n ,. I 33+-Y .L V jf 'm -irq' , -54 x 1-:,,..-H: Fitff 3 .-ge. . .f- R ' ' 1. 1 'Q?1 '- - 4 xl f?NfiNf',Lf'fkff'Nf+Nf+'sf+'vf4'ff fhrfrf- fhff 1+ rffi- rf ffifhff rhfhrhrhrhrhrhrfxfhrf Fhrhr57hrhr1-X DVERTISING SECTION eww The firms Whose advertisements appear on the following pages have made this Book possible and have proved themselves friends of Riverdale. We thank them. Read what your friends have to say and having read- PATRQNIZE 929 ,Rl YES D9 Ll A N i H1929 1f hUUH1XlJfL1Xi3?BYifffW 121 Michael E. Paterno Builder M Rene Keilhauer Engmeevf and Contffactofr 2 An Attractive Setting for Your Country Home IVE on the Club grounds of the Westf chesterfBiltmore. Three golf courses, sixf teen tennis courts, polo fields, salt water bathing in summer, indoor swimming pool in winter, riding, archery-all sports under ideal conditions. Home owners become members in the Westf chesterfBiltmore Country Club and enjoy all privileges. For information concerning choice acreage and attractive homes, address QEEJOE0 E. B. WELLS RYE, NEW YORK Office at Rye Gate Entrance Telephone RYE 900 123 VID iii, , gf ANTHONY A. PATERNQ BUILDER 578 Madisovl Avenue NEW YORK CITY A WV? omplimems of A Friend 124 ESTABLISHED IBIS JC! cf - C-555.23 Qrntlemrng Efiqiighmg Qantas, MADISON AVENUE COR. FORTY-FOURTH STREET NEW Yorm BOSTON Nswnunv connzn or Bsnxeuav Smsn uswrom' PALM aucu X Nw- ,gf ff Y -r ' J qi if Q f -rwfg-xr .N .1 I. . fl: 1 4 f 9 , I ...ez i: Jl'l 4 'W i , - 0 ,N . --'51 '. Q-.gl ,. My JF ,Q ,-ss, it :, AQ gg, Q gg. I X13 ' ' 'r x no 'g X Eg pl 53 :E 453451 F X' rbi. 'fr 'Es if l :Eiga , WW ,ffbvf ' - 1 4 -4 I mg , l.. yr ,tn Mu 1-'Qu ,-' , A all V I,-. 53,3 44,4-I s V: , -- . ,-Aw-:. 'w'.1-1 'Timm 0 noon anomzu Apply on pfcmises OT EO BROWN, WHEELOCK, HARRIS, VOUGHT E99 Co., INC. 14 EAST 47TH STREET Vanderbilt oo3 I JOSEPH PATERNO Builder SUTTO PLACE Northwest corner 58th Street Everyone seeking a new home for imf mediate or later occupancy should inspect the 13froom roof duplex, the Sfroom corner, and the 6f and 7froom apartments in this vvellfhuilt building. Large rooms, high ceilings and tireplacesg convenient and exclusive location with a river viewg1OOU7g cofoperativeg moderf ate price and maintenance. Inspection is invited. 125 SQSQSQSQSQSQSQSQSQQSQSQQ PIGGLY WIGGLY STURES SQ AU Over the Wo1ld,' SQSQSQSQSQSQSQSQSQSQSIZSQQ SQSQSQSHSQSQSQSQSQQSQSQSQ Q CQMPLIMENTS OF A FRIEND SQ QQSQSQSQSQSQSQSQSQSQSQSQ 126 5235 EE CHAS. D. BARNEY Ei CO MEMBERS OF THE NEW YORK STOCK EXCHANGE 0 Main Office 65 BROADWAY 0 Uptown Office 654 MADISON AVENUE EQ 127 :nn-unummn-wmmnmf--una mmmum' m-gym-lvnnmuvvn-mn...wwnw.m1 nw... WALTER T. MURPHY, INC Buildevs Y 'I 326 West 27th Street NEW YORK mmnmmunwmm1-1-mumnnmmmun-mumnm-m umummm-munmnfuIffunmmmn-mmumn mum mum- nmmmnmuumunnm-:mum ARMINQ A. CAMPAGNA 5' 1 Fieldston NEW YORK 128 vm I n mm mvm4:mmmmummmmmmunmmmummnwu-unsummulmunw rnmlnmmuumummmtm I tmmvumlmnmmmlmu un mm mmuzmummnmnnvmmn-muuumummnuwuvmmul 1 Pia n 2k D '50 the Success of D THE IVERDALIAN QQQ my Compliments of DUNALD AND GILBERT HAGGERTY D 1 U U U .U v?fi3X'f05 X'fff3iwX'ffff53f 129 For eighty years We have made a constant study of the tool needs of skilled mechanics and our experience of almost forty years in equipping schools, institutions and camps throughout the United States and foreign countries is at your service. We have a special catalog covering tools and benches for class and individual instruction which you may have free by ref Ill t h Man i1.u I Training LJ fir Nu. 25-A, complete with Zh , ,,1, is ,, t.,, Ch k.L,,,,m,L.x, wh Rm, Adm H l,., K, VM quesring catalog No. 317. HAMMACHER, SCHLEMMER E99 CQ. -ith Avenue at 13th Street 57th Street, 145447 East Stuyvesant 7ooo Regent 4700 NEW YCRK, N. Y. kikikikikikikikiki LHCHAEQA.CAMPAGNA Fieldston NEW Yoiuc 130 Compliments of ANTHONY CAMPAGNA Qompliments of New Diamond Point Pen Co., Inc. 333 HUDSON STREET NEW YORK, N. Y. Puritan Garment Co INCORPORATED 35 No. 1 CARLTON AVENUE BROOKLYN, N. Y. 33 NEW TORK SHOW ROOM 1 EAST 33RD STREET K 693 T FIVEfTEAR DIARIES, will build up a record of your school days that will become a happy memory forever after. Our 'gFiVefYear Diaries are sold in all leading department stores SNXQZ KIGGINS 69' TOOKER CO. NEW YORK Gompliments Of A Friend SQQSQSZQQZQSQSSQQSQSIZSESQSIZ Compliments of HERMAN H. BUDELMAN yy f The Criterion so of Good Living , ff.5 ' IS ACHIEVED AT THE if li-sflsf' e A F HQTEL MARGUERY ooow ,Taba ,Ag V Wide, spacious rooms with lofty 4 T i ceilings face the beautiful Italian. Gardens. ' l f There are now available several suites of one to six rooms, furf nished and unfurnished, by the day, month or year. V' ff? 1 !'! 3l:.5Q'X 1 xx f 9, ig VQYCXR, I 1 K I9 heuxi: I :mil M. f f iff fmm' X ! f , AY ,g T y.f4fffr u fi 4, xii i- wg Tl w l X Q31 l ' l I' P l l ll l l L 1 l n 1 I X lr' 7 I A cf,-y i l A f M ,113 i l I ,, j 1 L W ,W gig ..., s l Y' 1 P W bf QA R T ' f ' ' HoTEL MARGUERY PARK AVENUE at 47th Street 1 New YoRK f T QQ ' w forex X if :X Elf if I Q I ,- x W , . ' 1, ,, , T y ' 1, :AA-.M ,-all-,Er T ,W llfif QM Tamil fflwll all mi? - .W 1 0 Qi, 'll',5 ,A' Af' L , f ji w ' qgf' 4' ' l T 'Q l'!,If.fgrH?l Hill ' ,lint ' I Ht? 41,52 1 133 I . . T ' phone f 5335 l' S we1' t7l.fXXXNi'Eff3tf33XK THE YONKERS TRUST COMPANY A. P. BICELCW Ei CC. CHM. GROSSKURTH, Proprietor 504 South Broadway LUMBER YONKERS, N. Y. DEALERS We invite your account Harris Avenue and Willialmm Street U LONG ISLAND CITY, N. Y. QQQQTEQQQQQQQEQE RQSARIO CANDELA Architect 578 Madison Avenue NEW YQRK CITY QQQQQQQQQYTQZQQD 134 AIVIERICANIIUBAN STEAMSHIP LINE P x IN 5' I A VP - f f a X :fi X 59 CORTLANDT S NEW YORK CITY 135 EVERY FELLOW SHOULD GO TO CAMP AMONG THE BEST AMERICAN CAMPS IS CAMP RIVERDALE in the Adirondacks GOOD TIMES PROFITABLE OCCUPATIONS Talk with Mr. Gardner or Mr. Hackett CLASS RINS AND RINGS WRIST WATCHES CHARMS i ,giM. O IEIIETH RVEQAND S2125 STO N EW YORK 6 SQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQ Qompliments of QMICRGN BETA CHAPTER 4 of the THETA PHI FRATERNITY SQSQSQSQSQSQSQSQSQSQSQSQSQSJQSQSJQSQSQSQSQSQSQ EEEEEQEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE RHTRDALECCUNTRYSCHCOL SCI-IOLARLY INTIMATE TEACHING WHCLESOME COUNTRY LIFE DAY AND BCARDING PUPILS S72 For Catalog, address: FRANK S. HACKETT, Headmaster RIVBRDALE'ON'HUDSON, N. Y. C. Telephone, Kingsbridge 3123 QQQQQQQQQQ AMERICAN NOVELTY WASH SUIT Co. INCORPORATED C0- 72 5 Broadway SQ NEW YORK CITY 275 7th Avenue NEWYORKCITY 138 x.N5w1.N3-'gyi-IKSQQ H. C. BLOOMINGDALE A my B 139 9 ---------w---w---------- ll U Q3 'ld ' th C ll A l U U ww II U ID the thought occur to you, as you turned the foregoing pages of this interesting book, that a vast amount of enerf getic effort was involved in its production? When the 1920 RIVEIKDALIAN Stiff took upon themselves this ref sponsibility, they accepted a real undertaking. There was the planning of the bookfdetermining the character ofthe opening pages, the decorative art motif, the style of cover, and many other details that go to make a book of this kind attracf tive and interesting. ll Then the financingkthe obtaining of subscriptions, the securing of advertisements, and the various steps to provide an income sulhcient to fully care for the expense necessary to carry out the formulated plans. And finally, the actual production'-the obtaining of photographs, U art work, material for the vvritefups and other reading matteref- and seeing that this material reached the engraver and printer on schedule time. Yes, it was a real jobll, especially for those to Whom such work is a new experience. We congratulate the members of the RIVERDALIAN Staff on their outstanding success and are proud to have been associated with them in this meritorious work. U BAKER, JONES, HAUSAUER, INC. H BUILDERS OF DISTINCTIVE COLLEGE ANNUALS H 45,51 CARROLL sam BUFFALo, NEW YCRK H , . . U f i f U U 211:111-1ziziizizzizziizioic 140 af 1 . 1 if 1 .r 11 4'5. 'zJ1f 1 1 11 .wif ' JY-1'i-S-'QL Af' 1 11.1 . .-1.1 -..11, '- 1,.1f11g ,1 '7,,,5,. ' , ffm'- if ff 137113151 ' mmf 1 1 .,., 1 1 nam, 5,-1, - ,,.. -4- ei - P Q ' q :fy 1 G, . 9u,1. .van M-- 135-1 ' , 1 sw , 1 , F, TWA? ,Z1 -5,112 1 - 1'if 7T2 .1 fa iii ,, 'il Xi' N ' -.1 if .n ,L 'lg -N I 111 3 , ,. '1 'sa 4, .H T ij- Q fi 1 1 Q inf! ' fm 'dev 7 5 7' .ff-'Ti5f Q ' 4 11 f -1 f 1 1 - 1 1. 1 ,Q H11 1 '3 ' ' 'f x-- 1.1.3, 1 1 1m 11. ig- -- -1-Q1 ,g K- 511.- ,nfm , P4471 , E ,. , v., J ., - -,-,, .-Q ,111 , , 13 - 33 --Y 11 1 M. 1-111:1,, 13,5 iv ,11 !'311Y- 1 -1 'wg :1 4' H .y A13 3-1 1, aft:-. 1,3111-'F 1 1, ., :Q .. 1, ,1. , , . 11-,W . 1. V 11 ' 5 i ffy? ' 1' 'r A 1 f ,E Ai.1 Q! Wl 5 Q 1 1 1 mix: 1. T-111' -, ., 1.535 5 ,Q 7.5-1-1 51 115 41 1 11 wgagk-Q f . . 1 .-' 1 1':M1iZ11.,. .1 Y g , ,H Q. 1 15- 1.' ' '11, ' , 11 An, n .. wi-,L .. 1 X Y , ,M .H 1 -. 1 ,, 1,5 H .1 J, , lY.,- k Yi f 1 -. - ,M ,Q 1-1. k 'jaw -,mi 115, 1 21 : -. . '4.,g-151551 1 , 1 11, .,,. 1 .. 1.f,--Q . - 1 fu. ,f ,,, .MH Y. ,, 1' 11? I 11 H , 1 an -1 7.1 -15.1, Vg. ,g1w 1A M 111, Q ,, 9111.111 M1 4- rv , ' 'f'?:1?P-'Fig -i? ,, hw 3, -, ' H'F1d 3 -9-52' . Y vf 1'-'f-i.: ' .ap r . 1 'M iii 11 'A w xi ,fi , , 33 ' T? ' 1 ,JM 191921 14 1 1 5,-5:1 4 plz- -' , , . 1 - . 41.1, 11 . ., , ,, ,. , L - ' '51 1 ta 1-3? .Q V' will af 1111. 1 . ix T1 F' V A51 1 nf.. 'T s S , Y' P' ,- X A ,, . Qi .V - 511 ' Ei f 7:11. 3 5 1 2421, 1 1, ' L K- 11 f gf.-1 11 -z 11... 15- .1 1 M 3' 2 I . , r , L., ,L A, 1 , . ,Q , .W .V , ,su - ,I W. .l . . -J- ws, 'wp L1 JL' :Na - M, N , - iw, X Q-' 'XJ X ' , W i 1 , w T 1-5, . ,, wg, 1 A 1 5 ,,,. -., ,W-wx f 1- .',,' Y- - . -if '.-VA w- Y 1,5 , 1 ff ' ,ff MY ' fl: ,rm U EZ .x -fff . ,QI .F .. ., + ,. , - 1 W ff .IQ 1., , , , , 4, is X - W :A ikural, w aw -s f vff 'fa ,V J 'fi -J 2 Mu .15 'T' 14,2-QL-' ':, 71. V 3' 3,221 ,, , iii: f f N14 ,f,,-1 A 'Ein ii ' fr- . Y f v , ,. ,- 1 H' 423' if P , Y ..,. Vf. lx, 'gk ' . ,K fx- - 1:1 - , my ,. ,lv ,fir . -was V' is . A ,N , 1 , 1 4 Tv' ' e , A F , 'Viz' ' V 1 1 , qw -5,2111-Vi V F A , N - Q ffl: . V 1 in. ,4 J T P I 1 fr v 14 5, ' ' 1 N ' an 'Z 5 .AWN lu , W v?. - 'Q JEL- -w.--'ww 4 , ' 4 . f,. ' 1 .Q - ,-x . . W ,EE K' -V 'Ar 4 , ,, , qi H M V , ' Q 'wif 'I , ' . t G yn in V 4m,mm1srAuw v,ffmrwiY1:LaSnlllunsnmA 4: U i fir? X 44 iff , 2 I Q , 32279: I-S , Y me QT, 4. , ' EE Srila Q, ,r .- , - PM.: x ,fs .e'. -v X I. .fix ,E... ., , U 1 , K .n , M- Q 1 MVT' 4 1- , x-fu , A q' , idk Q .1, , mf:- 1 ., 'f wwf . fi vi Q. .. if ' niaga- Af P1 1, . -' ,Q - ,1 ,. syn, 37, W , 'il dr Q .qifzff , X .. . J ,J -.-Y' '-wmv a '-rf: 'QF' -,V -ze ,tg . ,r ,,.:.- 4 ' . , ,L SF- HW, H! 1 ,. 1-, Q , I, ,. kc , ., ,hgpr ' 5 3 4 - , 'f , .. 'iff ' ,., , H 1 hw. H -- -, 2--1 1, 1. 1 W - 5, . - J 1' ' 'I W., ' 1 - - , ,J ' f, ., Jar. ' I J., ' in ' s, 1- ,, g Vg X , A X . N ' '. , 'Q 13,5 X 1 ' .Nl V.. I ,.- X 4 g .' , V- 1 -. A ,, Q . any 1, G, , Q r l, I 1 ,S W f 1 if-vu . vp,- '5' . :. f'mE ggvgu .' ff If 1+ ,. HL . ' 3 L 152Mw:', 376, 'vf,,,'f'.1,', 'ff , .. Q wx QM - ,- I, Lg . Q' sd-, 5,511 5 mgvx 3- x f.,'1t' , is-wif -Hr' 'w,wx lf:'.IL A,'i'fzA'fg n ' x- K ii ' ' 'a:'Fw5, 13, fx- 1 we 3? fr Maw-gg- 7, , .1, gf 1. nf v'-, wi :V ,YW .,, -uni. 1-qv .' , 1. 4 x ff .lf ,,. ' ,MU v Q