R J Reynolds High School - Black and Gold Yearbook (Winston Salem, NC)

Text from Pages 1 - 194 of the 1931 volume:

+ 1 AX x--- -Eb X f xzgl ' fF-W fx 5 JC' ' Q I ,Q-egg WJNUJ HOIH 4 L 4'95ZlPf7,y 'W MZ 4-lg-fg u 1 X 5 44 -3 + 53 XV i h WX! 35 Z' Q QQ 3' 3 f f Qyff- 'Z W 4 W U s-zgfmll lk! 2 A X 'L' ,. '-ezffj X ri f ' ,I x X v , M qu i Qlus ' W' ' t'l1WmQi fl F W7 fy . X I I 4W1- ag :.-.gpg gf yen NW Emmy IIE A X . - .. ,1 X-. - , I i QPU- -v I - U 5 F. ls 4,--l 1' 2' ' ' .xfpsx 7 ,Q ' - 1' 1 if 'W . A' .,, I 4 1. rv '-, fm, 9 Q' A x if ' eo I 1 4 ' 4' 5 , 1195! hd Aa LE-NX Pura I x fPho!ns by Mn!thews5 , ,C AND , egelllllaec y sailing. 5- ' V 2 .g Ei d A , Q 45 :1 THE FINE ARTS FOUNDATION MR. HENRY R. DWIRE, Sponsor Speakers for tlae year 193 0-1931 and their subjects: Dr. Charles E. Jeiferson The Commonwealth Dr. Will Durant Is Progress Real William L. Finley Camera Hunting on the Continental Divide Dr. Henry Turner Bailey Curves Cameron Beck Trademark of Life Sir Hubert Wilkins Travels to the North Pole . Admiral Richard E. Byrd Little America CUnder auspices of American Legion.j IT THEMED TCD USG- 'H QNE GF THE STAE EQ Tl-NET WCIDDQEU KINDA F NICE TO TAKE Af 'f 2 JOURNEY CFOIZCED ' CQ QTHEQWEEQW kj , . WHEN 0Un'6uP12LM E 532 55 ,, fJN1' f,f if from HAD AT -1- -f A le, . me Home -1. Q Q 1 I-me Lwo L YV J wk mo wxw D- uh 7 ST Avm-2AmsDf Av ,,E f 'fi. CLINCI-X Q Q SQQP e f J? Esy a' QL :L 13 ZH'--' 2 ? 1 ' ,- xy 'kj L I 'H Xu f flg ff, 7 3 ,,fla.gKQ ?5'i Maggy Z 5 0 62 !l 'f le i :Il Rh Q , X M f' ff' f, 1 C, K. 16' A fy N 4 17' 1 5 JD 5 Xl B 2 TW WE? Al M522 E if V- ' f' -. W- 0 W? E f f Q ' gg V 1 r ' WI V- 'V' - ,lf ,053 f W ff. M29 1 T' Miss MAUDE MILLER Because of her long career of service to her community and this school in the profession of instructiong and because, owing to unforeseen circumstances, she was forced to relinquish her position in our High School as instructor, and sponsor of the 1930 Senior Class, to render greater service elsewhere--it is with a sincere feeling of respect, admiration and gratitude, that we, the January and June Graduating Classes of 1931, dedicate the 1931 Black and Gold, to Miss Maude Miller. it,L9.655S'C. ........ ... . , , L6 CJRAUDG' Efvsawecea, ,.,. 1 Q N.......-vs... E ' .' . ' Tl! I 23' Q iw: 3 PREYENT5 THE CJREQTEST CJALMY. or vmor-zmawcfg evevx. 5 gbgXYl1f5iiYY'li 5 THB 6C,ENE:XXA NAI- 6CAOOL--. 'lx sr ss-safaris-vi OOHSYER OF CER090l7lE62+1- XY065R. FACULTY . .. .. ,. il .--.1 A FOUR GCS CQUEDY ORBPOR 'ORC19Uk267'XON6 + ,. ,. ,. . 'THE ORXCJIIYBL 'NMBLER6 S -x -r 1 -x as wr -ns THE M097 TALKEYJ -O0 TAB LEAU BEER GPPLGUOEO UNDER 06 PER LOXIF R61 'FEATORE6 T Q6 R605 OF'PROC1RE5S?'P1DV6'?sT1ZFMENTf Q lfx 4 7 WW Pedagogue E MR. ROWLAND HILL LATHAM Superintendent Winston-Salem Public Schools MR. JOHN WATSON MOORE Principal Richard J. Reynolds High School 5' Q L WWW 1 MW FACULTY OF THE RICHARD J. REYNOLDS HIGH SCHOOL, 1930-1931 'R c ff .. K ex HB X fBlAIKa :Gaus s 35 FACULTY ADMINISTRATION OFFICERS ROWLAND HILL LATHAM, A.B., A.M., Slljreriulernlzvzt of Ihr' Cily Svbooli University of Virginia JOHN WATSON MOORE, A.B., Principal of Rirbard I. Reynolds High Svbool Davidson College GLADYS E. MOORE, A.B., Voculiomzl and Erluvaliorml Advisor University of Minnesota DEPARTMENT OF ENGLISH MARY C. WILEY, A.B. North Carolina College for Women THELMA ALBRIGHT, A.B. Greensboro College for Women MARGARET BAILEY, A.B. Winthrop College FLORA BEAMAN, A.B. University of Chattanooga INEZ BROOKS, A.B. University of Georgia LUCILLE EDWARDS, A.B. Greenville Woman's College MARY LOU FULLER, A.B. North Carolina College for Women MERLE HENDRICKS, A.B. Winthrop College liALPH.LEWIS, A.B. University of South Carolina WINNIE MURPHY, A.B. North Carolina College for Women AGNES ADGER MANSFIELD, A.B. Converse College W. D. PERRY, A.B. University of North Carolina Columbia University HAZEL STEPHENSON, A.B., A.M. , Salem College Columbia University RUTH TROUTMAN, A.B. Lenoir-Rhyne Columbia MARGARET VAUGI-IN, A.B. Salem College EVE YOUNG. A.B. Shorter College DEPARTMENT OF SOCIAL SCIENCE GLADYS E. MOORE, A.B. University of Minnesota Harvard University ROBERT T. ALLEN, JR., A.B. Tusculum College ANNIE HOBBS ANDERSON, B.S. Radford Teachers College WALKER BARNETTE, A.B., A.M. University of North Carolina H. C. HARSON, A.B. Lenoir-Rhyne CHARLOTTE E. HUNTER. A.B. Agnes Scott College IRENE JONES, B.S. Greenville Woman's College MARGARET LUMPKIN, A.B. Georgia State College for Women GERTRUDE REID SMITH, A.B., A.M. Duke University University of Chicago J. R. WELLS, A.B. University of North Carolina DEPARTMENT OF HOME ECONOMICS KATHERINE MATHER, B.B. DOROTHY FORSYTI-IE, B.S. Michigan State Normal College Peabody College HELEN CLAYTON, B.S. RUTH HELMICK, B.S. North Carolina College for Women Salem College ELIZABETH RAGIN, B.S. Winthrop College Page tm gi f , Q ,, f N0 .s ' D , ig Bl.Al:lQa g ,gfGlll,lJj. . 5 ,- V 4 a f? S, S Q11 Q 3 DEPARTMENT OF MATHEMATICS CLAUDE REUBEN JOYNER, A.B. University of North Carolina ANNIE BOYD BULLOCK, A.B. University of North Carolina EARL E. CRAWFORD, A.B. University of North Carolina MYRTLE DOBBINS, B.S. Radford Teachers College SARAH MINOR GWYNN, B.S. North Carolina College for Women W. H. LEGGETT, A Davidson College .B. RUTH MCCOLLUM, B.S. Guilford College KENNETH M. PETERS Emory and Henry College KATHERINE ROGERS Winthrop College , A.B. , A.B. LAURA WILL SMITH, B.S. Georgia State College for Women SARAH OLIVE SMITH, B.S. Guilford College DEPARTMENT OF LANGUAGE ANNIE PRESTON HEILIG, A.B. North Carolina College for Women MINOR BARKLEY, A.B. University of North Carolina S. M. EDDLEMAN, A.B., A.M. University of North Carolina MARTHA LOGAN, A.B. Agnes Scott College FAYE MARTIN, A.B. North Carolina College for Women Touraine University, France JESSIE RICHARDSON, A.B. Flora McDonald College University of North Carolina PAULINE LOIS WHITLEY, A.B. Oxford College Touraine University, France DEPARTMENT OF SCIENCE R. S. HALTIWANGER, B.S. Davidson College Graduate Work at University of North Carolina and Duke University RYLAND M. WARREN, B.S., M.S. University of Virginia University of Iowa John Hopkins AVA LEE ANDREWS, A.B. North Carolina College for Women W. S. BUCHANAN, B.S. Davidson College Duke University FRANCES HUGHES, B.S. Harrisonburg State Teachers College CARL C. KNOX, A.B. Trinity College FLOSSIE MARTIN, A.B., B.S. Salem College Columbia University University of North Carolina COMMERCIAL DEPARTMENT ANNA LULA DOBSON, B.C.S. Eastman College North Carolina College for Women Palmer School RUTH A. FORD B.C.S. Bowling Green Business University Louisiana State Teachers College GRACE L. FOSTER Ward -Belmont MARY HUGGINS, B.S. Bowling Green Business University BESS IVEY, A.B. Salem College Eastman College Page eleven GARNETT KELLY North Carolina College for Women Roanoke National Business College HARRIET MAJOR, B.S. University of Virginia GERTRUDE PRINCE, A.B., A.A. Bowling Green Business University HESSIE WATTS, A.B., M.A. Duke University DONNYE WORLEY Peabody College Palmer School Zaner Bloser Q , ' f Ano ' as gmyk ., I 530, A n I ,f a , 4 3- I , .. ...B --.uct fs. 5 ,I CAFETERIA DEPARTMENT ROSA TINDER, B.S. Harrisonburg State Teachers College DEPARTMENT OF ART EVERETT LOWERY, Ph.B. MARION LEIGER, B.S. University of Chicago Syracuse University DEPARTMENT OF MUSIC NILS BOSON ARTHUR L. HUFF, A.B. Northwestern University Denison University New England Conservatory of Music ALICE BOBBIT, B.M. C. D. KUTSCHINSKI Greensboro College for Women Columbia School of Music DEPARTMENT OF PHYSICAL EDUCATION L. W. CROWELL RALPH F. W. BRIMLEY, B.S. Springfield College North Carolina State College EVELYN BOWERS WILMOT DOAN, B.S. Harrisonburg State Teachers College Harrisonburg State Teachers College REGINA TUPPER. A.B. n Winthrop College DEPARTMENT OF INDUSTRIAL ARTS J. WARREN SMITH, B.S. F. L. HALVERSON Miami University Stout Institute ALMON CARR MILLARD JACKSON, Diploma in Manual Arts Stout Institute Eastern Illinois State Teachers College FREDERICK ELRICK, B.S. FRANK W. SWART, B.S. Kansas State Teachers College Stout Institute INTRODUCTORY HIGH SCHOOL NORA LEE SYDNOR Fredericksburg State Teachers College - LIBRARIANS LUCILE NIX, A.B., lA.B. in Library Sciencel NANCY DAY, A.B. Greenville Woman's College Greenville Woi11an's College Library School, Emory University DORA RUTH PARKS, A.B. North Carolina College for Women OFFICE ADIVIINISTRATORS HELEN CRADDOCK RUTH COOKE KIGER Secretary Clerical JOSEPHINE BAILEY Clerical Page twrl ur I.. I Q2 IA 1 5 'M' 'fm 2.0 f' 1' ' I H Campus Scene - AN NN B ng 4' Q9 Jr., xg 0 ,, ELL ?f.g+,,. ', , f ,,Q,,f,, gQS- K B, Q ,Fi -f 'H Page tbirlcen 5 4 f AND 1 T X N B A 4 R 5 sz., fgf ,LAIKZ . ' W i -'-w if-' K6-L. E ASE- 3Nsg,Ff X' 4,l 5 93? I y. Yi 5 -: X171 fi f a 'SHO-r F5+T1 QN QVA-PEI-L1 - .- -x , , v rv.. ' ' z - 1 V' , , I ' x xxmr, - f I' :,, , - ' , Effggl ' - , qi-f: 5 sail , i if , I XAI7He :F APPLE TREF. ln , V A f- Y' .1 fm You, Page fou rlcm 5 f AND X T LZ? Q4 , D AN 8.2, Y , vi 1 ,' r. ' , - V ax - ,Y ui f 2 ff-: -- :L K Q' ,QB L. 1? 'ff ' 1 U S' ffhxz' A L 'H ,Va :4k , Lk, ' x if I L, XA 'Al li' f : u 5 . gg f . I WATCH THE LHTTE BxRDlE ug 7 vm Mgr fiflucvl 2 Q N M ,r 6 f AND ,f , N , gf f B K Q, D N I3 f ,QQ L I Q A X 1 ' -L ' ?'f , ' . C - - ax 3 ,, ' 5 ill '2sL-za,- ' 4 v ii, ixgimviigkxigi' .H --.T ew we 4 , m., ,ANI i . X h :ag 1 w X 1 , . V. .. l Z , iv -f,, I .., , gyfiiiz-gi?5f , mr,-g1,,.,f V , m . ,f, , , . x '-2 f ' -a-1+ W eww an au - , 'ev y, - . ' 'T N I , LJ! 'I 1 I 3 1 ON, M+ f QfP9EPV5EVf 5ff W5 E42 i f V N ' g ,A ff' w 1, ,,'- ' 'rl A. .Lair- 52.1 rw ' ,,,,- W, , ,, . W U H, ' ,' 1' , .' V .111 , ' V '-, . ., ., k, --. .- 2 .ae-J 'A aaa' ' Pugu six! wif 5 Readin', Ritin', Rithmeticu ob A --. Hff F, 67 W G ,A ft-3 ,f is , 2 C E55 w R95 f A I 'Q iw-wi' F 'lil' 292 1' 0 if l L 2 X f XX' , I lx fe --4 2 we 'U Q Z ? BI-MR K' CARROL HART wil-SON Class of January COLORS: Gold and Blue it FLOXVER2 Yellow Rose MOTTO: Climb though the rocks be rugged. OFFICERS Charles Blair . . . . . . President Harold Carroll Vice-President Martha Hart . . Secretary Thomas Wfilson ....... . Treasurer CLASS DAY OFFICERS Isabelle Denny ....... . Historian Routh Nash . . . Poet Sarah Clancy . . Testafor Esther Roush . Prophet Page xc ver t 1 iii' ww' 1 .., 4 QQ- .1- HA ' v .E I ELMA LOUISE BARBEE COMMERCIAL Called Chicken Likes Dancing Pen Art Club 11, 21, Spanish Club 131, Dra- matic Club 131, Glee Club 111. EVELYN ESTHER BINKLEY COMMERCIAL Called Evelyn Likes Milky Ways Pen Art Club 111, Dramatic Club 141, Type- writing Team 141, Stenographic Club 141, Nickname Club 141. PANSY INEZ BISHOP COMMERCIAL Called Pat Likes Cbomlr1te Cherries Ollice Page 111, Pen Art Club 111, Dixie Lore Club 131, Stenographic Club 141, Cast Child- hood of Hiawatha 121. CHARLES BLAIR Gxswiznnr. Called Chupe Likes Math Boys Quartet 13, 41, Boys Glee Club 12, 3, 41, Mixed Chorus 12, 3, 41, President of Sopho- more Class, Vice President of junior Class, Pres- ident of Senior Class, I-li-Y 131, Mixed Quar- tet 13, 41, Dramatic Club 131, Ushers Club 141, House of Representatives 131. ALBERT ISAAC BLUMENTHAL SCIENTIFIC Called Al Likes Music Orchestra 11, 2, 3, 41, String Quartet 141, Winner of lst prize in State Violin Contest 141. VIRGIL FLAKE BODENHEIMER SCIENTIFIC Called Little One Likes Studying Page eighteen JESSE G. BOWEN, JR. LATIN Called jess Likes Playing the Piano Hi-Y Club 12, 3, 45, Latin Club 11, 2, 35, Aeronautics Club 13, 45, Glee Club 125, Ush- ers Club 12, 35, Library Page 125, Radio Club 135, School Representative in Aeroplane Con- test in Detroit 1929 135. MAE KATHERINE BOSTIC COMMERCIAL Called Macy Likes Traveling Pen Art Club 115, Class Baseball 12, 3, 45, Class Basketball 12, 3, 45, Class Hockey 12, 35, Varsity Swimming 11, 2, 3, 45, Varsity Basket- ball 13, 45, Varsity Hockey 13, 45, Monogram Club 145, Student Council 12, 35, Cashiers Club 13, 45. MARY ELIZABETH BURKE LATIN Called Lib Likes House Pariirsn Girls Athletic Association 11, 2, 35, English Club 11, 25, Dramatic Club 11, 2, 3, 45, Dcbaters Club 11, 25, Magazine Club 125, French Club 135, Latin Club 125, Dixie Lore Club 115, College Club 135. SARAH MACON CLANCY LATIN Called Sarah Likes Drawing Latin Club 13, 45, Spanish Club 145, French Club 135, House of Representatives 125, Na- tional Honor Society 145. HAROLD CARROLL GENERAL Called Bantam Likes Dalcs,' Cashiers Club 11, 25, Student Council 125, Literary Society 135, Vice Pres. Senior Class 445. ELLA WHITE COTTINGHAM GENERAL Called Ella White Likes Rainy Days Latin Club-Vice President 11, 25, French Club 135, Trcas. of 10B Class 135. Page nineteen an . , , 1, ii , V' of faseiiihligffitgatrfiw ' ff 1.1 2 if 3 1.f..:i'fi,te,5-V J 'wi 1 ...x MILDRED DAVIS COMMERCIAL Called Mildred Likes to cal GARVEY DALTON CROTTS GENERAL Called Garvey Likes Harding Stenographic Club 141, Band 12, 31, Class Baseball 12, 3, 41. ISABELLE LAWRENCE DENNY SCIENTIFIC Called Issy Likes F1irfing Girls Athletic Association 11, 2, 3, 41, Class Baseball 121, Varsity Baseball 13, 41, Class Track 121, Class Basketball 131, Class Hockey 121, Class Soccer 131, Varsity Track 121, House of Representatives 121, National Honor Society 141, Cashiers Club 141, Girls Metric Science Club-Pres. 141, Class Tennis 131. LINCOLN NAPOLEON DONEVANT GENERAL Called Lincoln Likes Work LECTOR IRENE DILLON Momaiw LANGUAGE Called Pete Likes anything rcspeclablcf' Spanish Club 11, 21, May Day 12, 31, Fresh- men Glee Club 111, G. A. Ass'n 11, 21, Hia- watha Operetta 111. RACHEL LEE DUNNAGAN GENERAL Called Rachel Likes Wriiing to sfrange people Varsity Baseball 131, Varsity Hockey 131, Class Soccer 11, 21, Dramatic Club 13, 41, Class Hockey 11, 21, Cast Finger of God 131, Girls Athletic Association 11, 3, 41, Pine Whispers Staif 141, Latin Club 11, 21, Black 81 Gold Staff 141, Class Basketball 11, 2, 31, Girl Reserve Club 11, 21, Student-Y 13, 41, Treasurer 141. Page twenty MILDRED ELOISE EAGLE GENERAL Called Galiah Likes Reading Girl Scouts 11, 22, English Club 112, Cafe- terias 132, Spanish Club 12, 32, Dramatic Club 122, House of Representatives 12, 32, Vice President of Class 112, Salesmanship Club 132, Civics Club 112, Home Economics 12, 32, Wide Awake Club 142, Boosters Club 142. BESSIE ARETHA GARWOOD HOUSEHOLD ARTS Called Bess Likes Good Manners May Day 122, National Honor Society 142, Cafeteria Club 13, 42, Class Hockey 132, Girls Metric Science Club 142. FRANCES REBEKAH GARWOOD HOUSEHOLD ARTS Called Lonnie Likes Star Gazing Cafeteria Club 11, 2, 32, Home Economics 112, Science Club 112. LILY MOREHEAD GILLIE MooERN LANGUAGE Called Lily Likes Cra11king ilu' Vic'lrola Cafeteria Club 132, Glce Club 132. FRANCES ELEANOR GRONER MODERN LANGUAGE Called Fannie', Likes Singing English Club 112, Mixed Chorus 12, 42, Glee Club 132, Girls Athletic Association 112. JAMES JOHN HARDIE, JR. GENERAL Called Hardrock Likes Acting Football Squad 13, 42, Cast of Iolanthe 112, Cast of Once in a Blue Moon 132, Cast of Death Comes to Sonia 142, Dramatic Club 11, 2, 3, 42, House of Representatives 13, 42, Winston-Hi Players 13, 42, Chorus 122, Glee Club 122, Spanish Club 132, Basketball Squad 132, Literary Society 12, 32. Page twenty-one uf' RAY HARTLEY COMMERCIAL Called Ray Likes Cauliflower GLADYS HAUSER Momzim LANGUAGE Called Glad Likes Walking Spanish Club 11, 21, Cafeteria 11, 3, 41, Vice President of Class 121, Girls Athletic Associa- tion 131. MARTHA WASHINGTON HART MODERN LANGUAGE Called Margie Likes Ealing House of Representatives 141, Vice President Boosters Club 141, Secretary Class 141, Cash- ier's Club 13, 41, Dramatic Club 131, Greens- boro 12, 31. BLAKE HENRY GENERAL Called Blake Likes NLlff'Ydf1lfL'n Soccer 12, 41, Art Club 12, 3, 41, Monogram Club 12, 3, 41. JANE ELIZABETH HOPKINS LATIN Called Betty Likes Ice Cream French Club 13, 41, Latin Club 11, 21. MARGARET BYNUM HUFFMAN GENERAL Called Hui - Likes Pluying Paper Dolls Class Hockey 12, 31, Varsity Hockey 141, Class Basketball 141, Class Baseball 141, Var- sity Baseball 141, Girls Metric Science Club 141. Page iwenly-Iwo HELEN HUGHES GENERAL Called Helen Likes Sewing Latin Club 11, 21, Cast of Childhood of Hiawatha 121. HELEN H. HURST COMMERCIAL Called Shorty', Likes Washing Disbrsn Pen Art Club 11, 21, Dramatic Club 11, 21, Glce Club 11, 21, Nickname Club 141. LUCILLE JACKSON COMMERCIAL Called Lucille Q Likes Tennis Glee Club 12, 3, 41, Cashiers Club 141, French Club 111. MARY ELIZABETH JAHNKE COMMERCIAL Called Lib Likes Swimming Pen Art Club 111, Art Club 12, 31, Wide Awake Girls Club 13, 41, Home Economics Club 121. MABEL LUCILLE JAMES LATIN Called Mabel Likes Changing Gears Cafeteria Club 121, Latin Club 12, 3, 41, Library Page 121, Sec. Latin Club 131. VERMONT JARVIS COMMERCIAL Called Vermont Likes to Sleep Page twenty-three 1: 'Y DOROTHY MILHOLLAND JOHNSON GENERAL Called Dot Likes Going Plans French Club 11, 21, Spanish Club 131, Art Club 141. GENEVA INEZ JONES MODERN LANGUAGE Called Coscy Likrx Cora Coins Spanish Club 11, 21, Freshman Glce Club 111, Sec. Class 111, Girls Athletic Ass'n 11, 21. MYRLE MEMORY KEATON LA1'lN Called Myrle Likvs R1'azliug ilu Dirlionaryn Latin Club 12, 31, Spanish Club 13, 41. RACHEL TUCKER KIMEL GENERAL Called Rachel Like: Fishing Vice Pres. Latin Club 11, 21, Spanish Club 141, Library Page 13, 41, French Club 131. ROBERT MONROE KING COMMERCIAL Called Bob Lilzvx Slc'vpiug Hi-Y 12, 3, 41, Band 11, 2, 31, Salesmanship 131, French Club 111. DOROTHY E. KNOTT SCIENTIFIC Called Dot Likes Baseball bats Varsity Baseball 11, 2, 3, 41, Varsity Basketball 141, Varsity Hockey 12, 3, 41, Varsity Track 141, Class Basketball 11, 21, Class Hockey 111, Class Track 11, 21, Class Soccer 11, 2, 3, 41, Cheerleader 141. Page twvnly-four VIRGINIA LOVE LAMBE HOUSEHOLD ARTS Called Lamb Lilzrx Movies Cashiers Club 115, Home Economic Club 125, Wide Awake Girls Club 135, Girls Metric Science Club 145, Oflice Page 115. GILBERT R. LAWRENCE GENERAL Called Gib Likrx Good Enix Cashier Club 11, 35, House of Representatives 12, 3, 45, Stcnographic Club 145, Secretary and Treasurer Art Club 125. ESTI-IER EVELYN LAWSON SCIENTIFIC Called Fatima Likes Dill Pifklf-s Varsity Track 115, Class Hockey 11, 25, Class Soccer 11, 2, 35, Class Basketball 135, Class Baseball 125, House of Representatives 145, Varsity Hockey 12, 3, 45, Varsity Baseball 12, 3, 45, National Honor Society 145, Secre- tary and Treasurer of Girls Metric Science Club 145, Athletic Association 11, 2, 3, 45. ANDREW BRUCE LEWIS, JR. SCIENTIFIC Called Dude Likes To Do Nothing Freshman Glee Club 115, Literary Society 13, 45, Booster's Club 135. CHARLES IZDMUND LONGWORTI-I GENERAL Called Shrimp Lilzrx Earth Worms Stenographic Club 145. CHARLES NORMAN MARTIN SCIENTIFIC Called Charlie Likes Girls Page lwenly-fi ve i VIRGINIA FELIXITA MASSER SCIENTIFIC Called Shacty Likes Tennis English Club 13, 41, Girls' Metric Science Club 141, Playwriters' Club 141. CHARLES THOMAS MATHEWS GENERAL Called Charlie Likes Tourb:lowns Calvin I-I. Wfilcy Literary 12, 31. LILLIAN LEE MAYNARD SCIENTIFIC Called Lou Likes Open Firt'1:1aces Girls' Athletic Ass'n 11, 2, 3, 41, Class Baseball 121, Varsity Baseball 13, 41, Class Track 11, 21, Varsity Track 121, Class Hockey 121, Class Soccer 12, 31, Cashier 121, Girls' Metric Science Club 141, Vice President 141, Class Tennis 131, Class Swimming 11, 21, Basket- ball 131, National Honor Society 141. RAY MCCALL - GENERAL Called Sheik Like: N0llfiSl7l7IL'lll', Class Baseball 13, 41, Varsity Soccer 13, 41, Capt. 141, Monogram Club 13, 41, House of Representatives 141. RUTH ALYCE MCGEE COMMERCIAL Called Boots Likes Love Stories Pen Art Club 131, House of Representatives 121. NICHOLAS WORTH MITCHELL GENERAL Called Nick , Likes Women Class Soccer 11, 21, Class Baseball 111, Class Basketball 111, Calvin H. Wiley Literary So- ciety 11, 2, 31, Metric Science Club 14, 51, Varsity Football Squad 141, Cast of Captain Appleiackn 151, Cast of Hiawatha 121. Page iweniy-six RICHARD CALVIN MOORE COMMERCIAL Called Gircly Likes Creeks Pen Art Club 111, Stenographic Club 141. AUDREY VIRGINIA DOUGLES MORRIS COMMERCIAL Called Peggy Likes Going Plates Cast Childhood of Hiawatha 111, Library Page 121, House of Representatives 121, Steno- graphic Club 141, National Honor Society 141, Student-Y Club 141. FRANCES HUBERT MORRIS GENERAL Called Wild Man Likcx Talking Cross Country 12, 3, 41, Capt. 12, 31, lst Place State, 2nd Place Horn Solo Contest 131. JUNE ESTELLE MORRIS GENERAL Called June Likes Dogx Latin Club 11, 21, Pres. 121, French Club 131, G. A. A. 11, 2, 31, Library Page 121. MARY DUGGINS MOTT MODERN LANGUAGE Called Mary Likcx Moonlight Nighlsn Cast Once in a Blue Moon 121, Mixed Chorus 12, 3, 41, French Club 141, Literary Club 121. MARY EMILY MYERS LATIN Called Emily Likcx SI1ulying Latin Club 1l, 2, 31, French Club 141, Span- ish Club 13, 41, Dramatic Club 111, G. A. A. qzy. Page twenty-seven I TI-IELMA NALE COMMERCIAL ' i7 lu Called Thelma 5 Likes Yo Yoing VMJ ' Y V., 1 if J 'TI ROUTH DOLORES NASH GENERAL Called Ruth Like: People Exchange Editor of Pine Whispers 131, Man- aging Editor of Black and Gold 141, Associate Editor of Pine Whispers 141, Playwritet's Club 133- DORIS NICHOLS COMMERCIAL Called Doris Likes Cicero MARY PAULINE PERRY GENERAL Called Pauline Likes Flowers Latin Club 111, Sec'y Spanish Club 131, Class Hockey 131, National Honor Society 141. BRONA MAE NIFONG LATIN Called Brona Mae Likes Horseback Riding English Club 111, Latin Club 12, 3, 41, Sec- retary 131, Library Page 121, Cast Hiawatha 111. MARY MAURINE PERRYMAN LATIN Called M:Iurine Likes Playing Violin Latin Club 12, 3, 41, President 13, 41, Library Page 11, 21, Orchestra 12, 3, 41, State Music Contest 12, 31. Page iwenty-eight ERNEST PETREE SCIENCE Called Chap Likes Anylbing Varsity Soccer 13, 45, Monogram Club 13, 45, Class Football 115. CLARA LUCITTU RAPER COMMERCIAL Called Shorty Likes Scouting Varsity Baseball 13, 45, Varsity Soccer 12, 3, 45, Class Baseball 125, Class Hockey 11, 2, 3, 45, Class Soccer 125, Varsity Track 125, Class Track 125, Cashier Club 11, 2, 35, Col- lege Club 125, French Club 135, Cafeteria Club 145. DANIEL FLOYD REDDING GENERAL Called Tumsy Likes Rumble Seals Class Baseball 13, 45. WALTER REAVES GENERAL Called Walt Likes Anything M1'cbunirul MARY LOUISE ROTHROCK GENERAL Called Lou Likes Riding in lbw Rain Girl Scouts 11, 25, Girl Reserves 125, Spanish Club 135, Class Tennis 115, Orchestra 13, 45, Student-Y Club 13, 45. ESTHER ROUSH COMMERCML Called Esther Likrs Bm1uly G.A.A. 11, 2, 3, 45, Dramatic Club 13, , Playwriters Club 13, 45, Class Hockey 115, Varsity Track 115, Library Page 125, Office Page 125, English Club 11, 25, Orchestra 11, 2, 3, 45. Page twenty-nine .ix .N 1 N . W Ill ' C 'ia 1 1, . warf- i ,.'., HOWARD AUSTON SAPP Atvrs ' Called Sap Likes Hauling MARGARET ELIZABETH SCHWARZE LATIN Called Peggy Likes Her Violin Orchestra 12, 3, 41, State Music Contest 13, 41, Latin Club 11, 2, 3, 41, President 131, Re- porter 131, Reporter 141, Library Page 131, House of Representatives 13, 41, Sec. Class 121, Cashiers Club 141. FERN ANGELY SHELTON GENERAL Called Fern Likes Cooking LILLIAN CLARK SHELTON HOME Economics Called Lili Likes Horses Home Economics Club 13, 41, Metric Science 141, Wide Awake Girls 13, 41. ALLENE C. SIDES MODERN LANGUAGE Called Lene Likes Dancing Orchestra 111, Cafeteria Club 111, House of Representatives 121, Spanish Club 11, 21, Cast Hiawatha 111. VIRGINIA SIMPSON GENERAL Called Virginia Likes Nothing Sjn'c'iul Latin Club 11, 21, Spanish Club 131. Page tbirly BROCTOR CAMERON SISSEL SCIENCE Called Brock Likes Books Track 111, Orchestra 11, 2, 3, 41, All-State Orchestra 131, House of Representatives 131, Cashiers Club 141, String Quartet 141. VIRGINIA LOUISE STEWART COMMERCIAL Called Dimples Likes lVrifi11g Lelfcrsn Pen Art Club 111, Cast Hiawatha 111, Cash- ier's Club 121, Dixie Lore Club 121, Class Committee 13, 41, Class Baseball 141, Class Hockey 141, Stenographic Club 141, Type- writing Team 141, Typewriting Medals 13, 41, Representative to State Typewriting Contest 131, Pine Wlmispers Staff 141, Black and Gold Staff 141, Student-Y 141, Member of Order of Gregg Artists 141, Shorthand Award 141, National Honor Society 141. CHARLES COLEMAN STYRON SCIENTIFIC Called Chuck Likes Ealing Varsity Soccer 13, 41, Class Football 111, Monogram Club 13, 41, Boxing Squad 121. VIRGIL D. SWAIM GENERAL Called Bud Likes Af1plcs', Boys Literary Society 12, 31, Boys Glee Club 441. ANNA LAURA THOMAS GENERAL Called Anna Laura Likes Dancing Spring Hope High School 111, English 12, 31, Dramatic 131. SUSAN REBECCA THOMAS GENERAL Called Becky Likes Travelling Girl Scouts 111 Dixie Lore Club 111, Math Club 121, Tar Heel Club 121, Wide Awake Girls Club 141, Salesmanship Club 131, Or- chestra 1l, 2, 3, 41, Book Lovers Club 131. Page thirty-one an P .N ., ANNA ELIZABETH THOMPSON COMMERCIAL Called Lib Likes Grapes Class Baseball 113, Class Basketball 113, Class Soccer 113, Class Hockey 113, Class Track 113, Pen Art Club 113, Library Page 123, Wide Awake Girls Club 143. MILDRED VIRGINIA TILLEY COMMERCIAL Called Til Likes Dancing Pen Art Club 113, Class Track 113, Class Hockey 113, Class Basketball 113, Class Soccer 113, Library Page 123, Wide Awake Girls' Club 13, 43, Shorthand Award 143. ELLA MAE TUTTEROW COMMERCIAL Called Jeroy Likes Sleeping Class Hockey 11, 2, 33, Class Baseball 11, 2, 3, 43, Dramatic Club 11, 33, Pine Whispers Staff 13, 43, Stenographic 1Vice Prcs.3 113, President of Nickname Club 143, Class Basket- ball 1l, 2, 3, 43, Pen Art Club 113, National Honor Society 143. HENON URBAND GENERAL Called Ikey Likes fo play fha' Clarinet Band 12, 3, 43, Orchestra 13, 43, Math. Club 133- VIRGINIA MAY WEATHERMAN GENERAL Called Virginia Likes Loving WILLIAM HOWARD WEST GENERAL Called Howard Likes Carrying Pap:-rs Page thirty-two DOROTHY PAYGE XVHITE COMMERCIAL Called Peggy Likes Dancing Pen Art Club 111, Spanish Club 13, 41, Dra- matic 13, 41. WEETA GAYE WHITE COMMERCIAL Called Skippy Likes Everything Des Moines, Iowa, High School 111, Varsity Hockey 141, Class Baseball 141, G. A. A. 13, 41, Girls Wide Awake Club 141, English 13, 41, Dramatic 13, 41, Boosters 141. THOMAS JOHNSTON WILSON LATIN Called Tom Likes Football Class Soccer 11, 21, C. H. Wiley Literary So- ciety 11, 2, 31, Latin Club 13, 41, Trcas. of Senior Class 141, Cast of Hiawatha 121, Trcas. Latin Club 151, Track 131. SOPI-IIE WLODINGER COMMERCIAL Called Major Likes Reading Typewriting Team 141, Tar Heel Club 11, 21, Pen Art Club 111, Dramatic Club 12, 31, Student-Y 141, Library Page 121, Office Page 121- Pagc thirty-three ,jl .z:'-5, l ' ' JL? I Q . fr , EH. 'lh..4,,v1'l, ' ,131 '.':'1T'Qi . qi . 5.11, 1 WILLIAM H. REICH COMMERCIAL Called William Like: Big Words W. R. WRIGHT GENERAL Called WilIian1 Likcs Milky Ways RUBY EDRIE XVYATT COMMERCIAL Called 12drie Likes Cake Page lbirly-four AND R 4 fx ' U5 ' , 5 I 4,4 , 56815 A E325 3- ' 'J 4 ' + n Q. ' 1 3' 9' h 4 C Q W xv. L 5 44. ,,, f 1 ,,,., 0 W. X 1 .5 ,: L dC - . ,w N L0 2 -' Mar F' gh .1- fix , i Gf 7 .? x-'QW ?'1ff3...Z V ' 51351 iggfig . f U ff? a!234 '5iff'V- f . 'L 1 ' X f ' A I f-. Sf Sf . T' l 5 8 nu '- -'fv 5 A .Ti -. .f ' ' Y U ' H 2? 1 T ' ,. Sw L51 f . Wi FN 5 ' A .3 1 - 1 D 5 5 E 13. ,I .324 T- ' -fluif ,M A Xa- .nf ' ' fig: f gl . , awk ,rwiiiff I 4 x ' I ' ' A RT '. 'fri 1 L f f' - 11. ' 1 Jw-fx. '-:g ,. -,4 , ,cv 6 - 'K ' 'rj lf . .iq . , I, gg: I A ' F M, Q1 L 1 ,Mil 5 -A 1 . fzziff-T: L 5, .G 'HGYQZ 'Q . A f H A' ' : -I A' if yr . x ' H? L -P 4n'FH Vi -.c ,- . . 1 M ,- -- ,-..' 1' cg A 1 'Q Q up wha- 1 15,143 ' --1 , H x-Ar' 1, T, 4' l .mi-,D JF? Pugn lbirfy-jf ue 2 v 4 AND ' -Z 55. 'P ' X 539' GRADUATION Marching figures Heads held proudly high. Music soft but clear Breaking the deep hush In the still dark room. So suddenly and queerly unfamiliar Like a vast cathedral. Sitting high-side by side to friends Grown unusually dear. Hearing vaguely-as if at a distance. A man speaking. A voice connected intimately With things of the past. Memories of tasks-of teachersg Of joys-of sorrows, shared. Memories that yesterday were actualities That tonight are merely memories. We feel suddenly timid and frightened. But as quickly expectant, hopeful. We are losing, but gaining, too! We are stopping, but only to start again! We are on the threshold of another battlefield. But in our hand We hold a Weapon A similar roll of parchment-inscribed Graduated from Richard J. Reynolds High School January twenty-third, nineteen hundred and thirty-one. -Roufb N ash. Page thirty W . L Ano E c ' N . , 4 4, 1 'lj I 4 ii ' ui iw .ii glib V --- ' 4 Q 'T . ec ,zo-'-, A 33, 1-V -- Q x x Q X HISTORY CLASS OF JANUARY, 1931 M, HE DAY WAS DARK, cold, and dreary and the sleet lay heavily upon the Q7 ground. The lights that were given off from a stately building were thrown like 117 soft ribbons through the mist across the sky. The hurry and scurry of feet told 6. the small, inquisitive, and interested audience that nearly two hundred students 7- iff: s.i were about to join the student body of the Richard I. Reynolds High School. i ' I. Fear? Before this time there had been no such thing as our pounding hearts now knew. DwightvLinville, who was then the president of the student body, made a lasting impression upon the newcomers in his welcome in behalf of the entire school, Your best is enough! With this ringing anew in our ears we struggled, as all Freshmen do, through the first of those four glorious years of youth. Has it not always been said that the Sophomore class is the most unpopular class of the four? They simply do not seem to fit in. Poor Sophomores! This class was lcd by Charles Blair as the president and Mrs. Anderson its sponsor. As the third year rolled around, M. L. Mott, Jr., was elected president of the class and Miss Louise Sykes was the sponsor. The tide turned and with grim determination written on each -Iunior's face, it was known throughout the school that a better under- standing had been taken, by the faculty, of this phase of our life. It was decided by the oilicials of the school board that each month there should be four boys selected by the principal and his faculty to attend the regular weekly meetings of the local Rotary Club. Those who participated in this honor chosen during the junior and senior years were: Hubert Morris, Albert Blumenthal, Jesse Bowen, Thomas Wilson, Edmund Long- worth, Ross Kerr and Charles Blair. At this time as was the custom, the junior A's', gave the senior A's a party and as entertainment presented a Christmas play. In athletics Fern Shelton made a promising manager of the girl's hockey team and Dorothy Knott was manager of the girl's baseball team. As for the boys Hubert Morris became a star track man and a few of the junior boys made up this team and the boys' baseball team. Charles Blair became the president of the senior class and Miss Sarah Gwynn its sponsor. This last year things began to happen and they happened so rapidly that there was hardly time to record them. As has been said for years past and will probably be said for years to come, Where are those longed-for, envied senior privileges? It has been the custom for many years to have a May Day Festival. This year the honor of May Queen was bestowed upon Ella White Cottingham and her court consisted of Margaret Schwarze, Rachel Dunnagan, Mary Duggins Mott, and Isabelle Denny. These maids were from the senior Bn class. One morning there took place a very solemn ceremony which initiated Pauline Perry, Audrey Morris, Bessie Garwood, Esther Lawson, Louise Stewart, and Isabelle Denny as new members of the National Honor Society. There was one other ceremony which initiated Routh Nash as a member of the Quill and Scroll Society. Esther Roush is to be congratulated on her splendid and victorious tragedy, Death Comes to Sonia. For the first time in three years, the Gregg-Transcription test was won at 60 words a minute for the school by Audrey Morris. No class has yet been better represented in the orchestra, this is revealed by the fact that Mr. Kutschinski has not been able to do without them even for graduation. Albert Blumenthal won Hrst place in the music contest held in Greensboro. Page thirty-seven E' I AND X N ' N - 9 , 1 Qi BLAIKL T sgnln Q D35 ' J - 1. 'Q sg .I , ig, Elia-ei 'e-f -26 me Ai1i x .e, Xia ,XYZ During the last year there were several who portrayed remarkable ability along the dramatic line. The only ones who are really celebrities of the stage are Routh Nash, Rachel Dunnagan and James Hardie. Fern Shelton was again manager of the girl's hockey team. David Holton was cap- tain of the Black Demons of which he and Horse Isley were the senior constituents. The events came thick and fast as the end of the year was approaching. There was a party given to this class by the January Class of 1932. This was followed by Class Day and soon Graduation! As the climax of four hard Working years, it was announced that our Class had won the cup offered by the local chapter of our National Honor Society for the class having the highest scholarship average. Looking back over the four years of hard work and interesting activity, it seems that we have accomplished some part of that which we had planned, Climb though the rocks be rugged. Can it possibly be that those years of work, learning, fun and frolic are over? Yes, they are over but only that we may begin more strenuous years which give promise of being filled with interest with the continuation of learning, and with health and happiness. -ISABELLE LAXVRENCE DENNY, Historian. Pugr Ilzirly-vigbl ' ff E I 6 AND c x x Q .- I 'T - ageiltic easing 151' 1 - . - .I ' , N X , , LV ei jar. A if W- - ,FIL E WORLD WIDE NEWS REEL SEES ALL, HEARS ALL, KNGWS ALL SEPTEMBER 17, 1937 New York, N. Y.-Waving a gay farewell to their admirers, the only mixed Ameri- can football team, sets sail for Europe aboard the Mauretania to compete for the in- ternational football championship. The team is composed of: Thomas Wilson, Captain, Dorothy Knott, Charles Matthews, Albert Blumenthal, Isabelle Denny, William Reich, Dorothy Fitz, Henon Urband, Ross Kerr, Lillian Maynard and Lincoln Donevant. Charleston, S. C.-Five men haters-Evelyn Binkley, Pansy Bishop, Elizabeth Burke, Betty Hopkins and Helen Hurst-caught by the camera in the act of dragging their victim to the altar. Hollywood, Cal.-Easily, Audrey Morris, Myrtle Keaton, Esther Lawson, Emily Myers, and june Morris swayed the emotions of the theatre going world, but in their new pic- ture She Saw A Mouse, we see them being swayed by the words of their director, Virgil Swaim. Iuneau, Alaska-In this land of ice, fish and cold, the World Wide News camera men came just in time to snap Richard Moore, Austin Sapp, Rachel Kimel, Charles Styron, and Howard West in the act of wishing they had arms long enough and breath enough to give the size of the fish they caught. Bombay, India-Lector Dillon, Gladys Hauser, Geneva Jones and Allene Sides are suc- cessfully frightening the natives with the far-famed Feather Foor Fanny. Quebec, Canada-A strange sleeping malady which slowly descended upon Mary Mott, Daniel Redding, and Ella Mae Tutterow, six months ago, is puzzling the world's greatest scientists and doctors. Ml. Vesuvius, Italy-In this lava flooded place we see Elizabeth Thompson, Clara Raper, and Mildred Tilley doing a good deed by attempting to persuade Mount Vesuvius to be- come a good scout and not erupt again. Paris, France-Cocktails greeted the first efforts of Routh Nash and Hubert Morris to show the French how the fine art of becoming one is done. Dallas, Texas-Much of the success of a distinctly novel road-house which serves only water and dog biscuits, owned by William Wright, is due to entertainers Virginia Weath- erman, Annie Laurie Thomas, Thelma Nale, Doris Nichols and Lucille jackson. Geneva, Swifzerlanal-The most far-famed students the world has ever known, Maurine Perryman and Virgil Bodenhamer, are caught in their studio as they are striving to un- ravel the great mystery of why fairy stories never unhappily end. Atlantic City, N. I.-Here we see Mildred Davis, William McClenahan, Edrie Wyatt, Vermont Jarvis and Elma Barbee as they are preparing for their mad venture of at- tempting to swim the Atlantic Ocean. Page lbirly-nine 5 , AND ii ' - 8 Q. . E'1 +a ' it Q Q Q' QQ ,Ei 'S' I A, Berlin, Ger-many-Charles Blair, millionaire, is having a building erected in which Fern Shelton will be the only cook, Helen Hughes the sole seamstress and all mechanical de- vices will be installed and cared for by Ray Hartley and R. G. Tuttle. Algiers, Africa-One of the rare pictures taken of Ella White Cottingham and Louise Rothrock, rain fiends, as they walk, hatless, coatless and rubberless, gleefully through the torrents of rain while the inhabitants stare with amazed eyes at them. Philadelphia, Pa.-Reading as numbered, Margaret Schwarze, Blake Henry, Sophie Wlodinger, Broctor Sissell and Brona Mae Nifong, famous librarians, are here seen taking notes on a lecture being given by the eminent psychologist Harry Fishel, on 'The Psy- chology of the Wolf. Kalamazoo, Michigan-Harold Carroll, Sarah Clancy, Rachel Dunnagan, Elwood Isley, Virginia Masser, Charlie Martin, Pauline Perry and Virginia Simpson are shocking and amazing the inhabitants with their freak circus in which two of the features are The Laughing Lady, alias Weeta White, and The Loafer, alias Jennings Warner. Arizona-The new freak piano which laughs, talks and makes milk shakes, invented by jesse Bowen, is being shown as Louise Stewart, Payge White, Mabel James, and Frances Groner are trying it out. 1 Chicago, Illinois-Seven world-famous archaelogists, fright to leftj Bessie Garwood, Rebecca Thomas, Lillian Shelton, Ruth McGee, Virginia Lambe, Mae Bostic and Fran- ces Garwood, meet for the Hrst time in years to discuss plans for a search for the re- mains of once notorious gangsters. Orlando, Florida-Beginning the year right. Reading from the center as the clock goes around-James Hardie, Nick Mitchell, Eloise Eagle, David Holton, Margaret Huffman, Bruce Lewis, Martha Hart, Edmund Longworth, Dorothy Johnson, Robert King, Nan Madison, Ernest Petree, Lily Gillie, Garvey Crotts, Elizabeth Johnke, Gilbert Lawrence and Ray McCall,-participants in the first grapefruit eating contest ever held. -ESTHE11 RoUsH, Prophet. Page forty R 1 AND f x ' at elm. .T genus s. is 9 A vo QCD 1.1. x Ni X r?' 1 fl 'Z' 61 . ' ', ii Na Q, ' .1 , I --ft: ,V-Ez' ,, . - ,,,-, li' ' .+L L., - ,. fi LAST WILL AND TESTAMENT CLASS OF JANUARY, 1931 .Q gf E, THE MID-TERM CLASS of Ianuary, 1931, being of sound mind and mem- ory, in fall possession of sziperbuman izztelligenee, and therefore an exagger- JCL 5 atea' opinion of ourselves, do hereby make and publish fbis, our las! will and lp, 4 5,3 testament, in order that we may distribute our many falenfs and virtues. .,- ,. 0' 4 l I Ld ITEM 1: We give and bequeath to the dear members of our faculty, who have been our seers, a sweet and unbroken succession of peaceful nights and days, free from the horrors of our English compositions and mathematical problems. ITEM 2: We bequeath to the IIB class all of our students whose immature minds would not let them chew gum with as rapid steps in the mastery of Encyclopedia facts as ours did. May they excel in History problems, not forgetting that outlines are al- ways due on Friday. ITEM 3: We bequeath to the whole school that life-saver, the fire drill, which is always such a Welcome interruption to boring lectures by well meaning faculty members. ITEM 4: To everybody, we leave fon rainy daysj the pleasure of going to chapel through the nice bright tunnel. ITEM 5: We bequeath Ross Kerr's ability to argue, which always has the power to infuriate his teachers and get their minds off the lesson, to Margaret Cochrane. ITEM 6: We bequeath Nick Mitchell's talkativeness to Melrose Hendrix, the most silent student in school, hoping that, at the same time, she will not spoil her record by inheriting any of Nick's laziness. ITEM 7: We bequeath Sophie Wlodinger's curiosity to Roy I-Iaberkern, in order that he may learn more about what is going on around him. ITEM 8: To everybody, we bequeath the pleasure of wasting time in the library and getting away with it, by admiring the displays in the glass case. All the rest and residue of our property whatsoever and wheresover, of what n2lturC, kind and quality soever, it may be and not herein before disposed of, we give and be- queath to our Principal for the benefit of the future classes. So we do constitute and appoint this said Principal sole executor of our last will and testament. , In witness whereof, we, the Class of January, 1931, have to this our will, set our hands and seal this, the 23rd day of January, 1931. -SARAH CLANCY, Tesfafor. Page forty-one 9 ' N ' .S AND 4 ' B A ,Z GX A xx f in er SGW iii at . Q,,'. .9 Hilti . if FRIENDS AND OTHERWISE Easiest Teacher . . Hardest Teacher .... Most Freckled Friend ,.....,.,,, Most Accommodnting Hall Monitor .. Favorite Bootleggcr' . . , E Most Useful Friend .. . My Dearly Beloved ,,,...... Most Resourceful Malefactor Bitterest Enemy , . . . . My Secret Passion .. Nuttiest Acquaintance , , . Most Priceless . . . Goatiest . . , . . . , Biggest Monkey in School My Ideal . . . Lousiest ...-..... . My Greatest Benefactor . . . Most Piriful .... My Inferior D. My Annoyer . . Most Incoherent . . My Inspiration . My Depresser . . . Page forty-Iwo I'zE DE I PRE5'DEN'F f A Q ole, D Z PM , f I 5 Zfffiffel- 4' ' 1-iii:-v ' . fx Q ' J. - 1' f T'V 'W 0 in f' SEM.. 'f i'Pf'41ia Q 4 ogg, . f 5213131 slt BY:-4 om BROWN TOHNSON BAHNSON ' Class of june 1931 l and White Morro: To seek, to Hn Brooks Bynum Harold Brown . Margaret Johnson . Agnew Bahnson Helen Davis . Isabella Hanson FLOWER: Daisy COLORS! Yel ow d, to conquer, and not to yield. OFFICERS . . . . . President . Vice-President . Secretary . . . . . . . . Treasurer CLASS DAY OFFICERS . . . . . . . Historian . . Poet . Testator . Stiztisticimi Gilbert Tillitt . L. C. Bruce . Pugv forty-three MARGARET FRANCES ACKERMAN COMMERCIAL Called Biddy Likes Baseball Hiking Mgr. 131, Girl's Athletic Association 12, 3, 4, 51, Wide Awake Girl's Club 151, Student-Y 141, Captain Hockey 14, 51, Man- ager Basketball 151, V. Basketball 13, 4, 51, V. Baseball 14, S1, V. Track 131, V. Hockey H, 4, 51. LOUISE THELMA ALLRED COMMERCIAL Called Lou Likes Camping Varsity Track 11, 21, Class Baseball 11, 41, Varsity Baseball 141, Varsity Soccer 12, 31, Class Soccer 121, Girl's Wide Awake Club 141, Pen Art Club 111, Girl's Athletic Ass'n 1l1. HENRY CLAY AUSTIN COMMERCIAL Called Jake Likes Collecii11g Old Money Soccer Team 13, 41, Monogram Club 13, 41, Track Team 13, 41, Salesmnnship Club 131, House Representatives 13, 41, Class Baseball 121. MARGARET LAURA BAGBY GENERAL Called Galli Curchi Likes Music Dramatic Club 13, 41, Cast Captain Apple- iack' 141, Cast Once In A Blue Moon 131, Spanish Club 11, 21, Girl's Glee Club 12, 3, 41, Girl's Quartet 12, 3, 41, Mixed Quartet 12, 3, 41, Mixed Chorus 12, 3, 41. AGNEW H. BAHNSON, JR. LATIN 1 Called Agnew Likes Fishing Hi-Y Club 11, 2, 3, 41, Treas. 121, Debater's Club 111, Literary Society 11, 21, House of Representatives 121, Cashier Club 12, 31, Quill and Scroll 141, Business Staff Pine Whispers 131, Business Manager 141, Class Treas. 141, Metric Science Club 131, Usher's Club 141, Cheer Leader 141, Winston Hi Players 141, Rotary Luncheon 131. HELEN BAILEY GENERAL Called Jobie Likes Skiing Cashier's Club 11, 2, 31, Home Economics Club 131, Wide Awake Girl's Club 131, Dramatic Club 131, Gir1's Athletic Ass'n 11, 2, 3, 41, Baseball Team 13, 41, Magazine Club--Pres. 131, English Club 11, 21, House of Represen- tatives 12, 31. Page forty-four PAUL LINWOOD BARNES SCIENTIFIC Called Barnes Likes Reading Metric Science Club 131, Scc'y 141, Hi-Y 141, Ushers Club 141. LYLE JOHNSTON BENBOW GENERAL Called Pat Likes Moloring Band 11, 2, 31, Cashiers 12, 31, Hi-Y 13, 41. AGNES BENNETT GENERAL Called Aggie Likes Pic'ture Shows Wide Awake Club 141, English Club 131. nv HENRY CASPER BERGER SCIENTIFIC Called Henry Likes Building Models Metric Science 12, 41, Aeroplane Club 11, 21. DORCAS ELIZABETH BLEDSOE MODERN LANGUAGE Called Dorcas Likes Dumplings,' English Club 111, Freshman Glee Club 111, House of Representatives 121, Girl Scout 111, Magazine Club 131, Girls Wide Awake Club 443. DESETTA BOESSIER COMMERCIAL Called Serta Likes Swimming Scholarships 11, 2, 31, Montreal High 131, Shorthand Club 141. Page forty-fue r . A 4 'if 'N , .Q 1 I +1 - 3 2' I' RILEY GORDON BOYLES GENERAL Called l'Gordon Likes Carioonery Art Club 133, Radio Club 143, Literary So- ciety 123, Advanced Chorus 143, jr. Orchestra 143. SAMUEL JULIAN BOYLES SCIENTIFIC Called jew-Baby ALikI's nAlll0llI0biIl'Jn Metric Science 13, 43, President 143, Hi-Y Club 13, 43, Literary Society 143. ALBERT W. BOUDEN SCIENCE Called Ab Likes Baseball Boys Literary Society 11, 23. LULA RUTH BRASWELL LATIN Called Ruth Likes MllxiI ' Debaters Club 1I3, English Club 123, Girl Scouts 13, 43, Class Basketball 133, Dramatic Club 133, Varsity Baseball 133, French Club 143, Varsity Soccer 143. HENRY SHELTON BRENDLE COMMERCIAL Called Gab Likes Strolling Through the Woods Stcnographic 143. I DOROTHY ALLEGRA BREWER COMMERCIAL Called Dot Likes Going in Show Tar Heel Club 113, Wide Awake Club 143 Page forly-six NORMAN EDWARD BREWER GENERAL ' Called Mike Likes Music Track 12, 3, 45, Cross Country 13, 45, Mono- gram 12, 3, 45, Literary Society 11, 2, 3, 45, Class Baseball 11, 2, 3, 45, Soccer 13, 45, Class Basketball 13, 45, Band 11, 2, 3, 45, Orchestra 11, 2, 3, 45, Cast Seventeen 125. WADE HAMPTON BRITT SCIENTIFIC Called Burion Likes Hunling Pioneer Club 135, Varsity Boxing 11, 25, Mon- ogram Club 12, 3, 45, Metric Science 13, 45, President 145, Sgt. at Arms House of Repre- sentatives 145, Delta Theta Phi Club 145, Sgt. at Arms 145. O. C. BRITTON, JR. GENERAL Called Ossie Likes Model Aeroplane BuiIr1'ing Member of Hi-Y 13, 45, Monogram Club 145, Scrub Football 135, Varsity Football 145, Track 135, Band 11, 2, 3, 45, Orchestra 11, 2, 3, 45, 2nd Place State Chemistry Contest 135, Junior Rotarian 135, Brass Quartet 135, Dcbaters Club 145, Latin Club 115, Aeronau- tics Club JAMES WOMACK BROWN GENERAL Called Jimmie Likes Ice Skufingv Pres. of History Class 145, Secretary of History Class 145. WADE HAROLD BROWN SCIENTIFIC Called Brownie Likes Motor Vehicles Freshman Debating Club 115, House of Rep- resentatives 145, Metric Science 13, 45, Treas- urer 145, Hi-Y 13, 45, Extra Curricular Ac- tivity Comm. 135, Rotary Luncheon 145, Vice Pres. of Senior Class 145. LUTHER C. BRUCE, JR. LATIN Called L. C. Likes Arguing Secretary of Freshman Class 115, President of Freshman Debaters Club 115, Freshman-Senior Debate 115, Freshman Triangular Debating Team 115, Student Council 11, 3, 45, Calvin H. Wiley Literary Society 12, 35, Junior Hi-Y 13, 45, Senior Hi-Y 13, 45, Rotary Luncheon 135, Secretary of Student Body 135, Pres. of Student Body 145, National Honor Society 145, Quill and ScQoll 145, Black and Gold Staff 13, 45, Business Manager 145, Cheer- leader 145, Dramatic Club 145, Rotary Decla- mation Contest 11, 25, Ushers Club 13, 45. Page fa rty-seifm jgfiffffsf X U06 .ff D '-Af. 1. s, I' ., lfiiyxi 1. 'f 11 I '. A V.. , . , u- fl l r l A CLARA WHITE BRYAN GENERAL Called Clara Likes lo Play Rook Freshman Glee Club 111, Class Soccer 11, 21, Class Basketball 12, 3, 41, Varsity Soccer 131, Varsity Hockey 141, Varsity Baseball 131, Tar Heel English Club 121, Magazine Club 131, Cafeteria Club 131, Girls Glee Club 121, Mixed Chorus 12, 31, Class Hockey 11, 2, 31, G. A. A. 12, 1, 41. CHARLES BURCHETTE GENERAL Called Charlie Likes Music Boy's Literary Society 11, 2, 41, Dramatic Club 1l, 2, 41, Boy's Glee Club 12, 3, 41, Mixed Chorus 12, 3, 41, Orchestra 111, Cast Once in a Blue Moon 121, Cast Wind Mills of Holland 111. DAISY ELIZABETH BURCHETTE LATIN Called Elizabeth Likes Swimming G. A. A. qs, 41, Latin Club 149. VENUS LOUISE BURGE COMMERCIAL Called Red Lilzrs Eating Debaters Club 111, Athletic Association 11, 41. REBA KATHRYN BURTON COMMERCIAL Called Reba Likes Swimming Orchestra 11, 2, 3, 41, Tar Hccl English Club 11, 21, President 121, Cafeteria Club 141, Home Economics Club 131, President 141, G. A. A. 12, 3, 41, Track Team 12, 31, Swimming 14, 51, Cashier Club 131, Repre- sentative of Home Economics Club at State Conference 141, Class Baseball 12, 3, 41, Class Basketball 12, 3, 41, Class Swimming 131, Hockey 11, 2, 31. ALVIN BROOKS BYNUM GENERAL Called B. B. Lilu-s Baseball President of Class 141, Student Council 131, Winston Hi Players 141, President 141, Treas- urer 141, Cast of Captain Applejaclth 141, Cast of the Poor Nut 131, Junior Hi-Y 11, 21, Secretary 121, Senior Hi-Y 13, 41, Ushers Club 141, Calvin H. Wiley Literary Society 12, 31, Winner Rotary Dcclamation Contest 131, Junior Rotarian 131. Page forty-eight SALLIE CAHILL GENEIIAI. Called Sallie Likcs Girl Scouting Monogram Club 11, 2, 3, 41, Varsity Base ball 12, 3, 41, Class Basketball 11, 21, Man- ager 111, Varsity Soccer 13, 41, Hiking Club 11, 2, 3, 41, Class Swimming 11, 41, Class Tennis 121, Cafeteria Club 13, 41, Vice Pres 141, G-Hi 12, 3, 41, Girl Scouts 12, 3, 41 G. A. A. 11, 2, 3, 41, Debaters Club 11, 21, Library Page 141, Freshman Girls Glee Club 111, Girl Reserves 11, 21, Pine Wliispers Re- porter 131. LEIGHTON AUBREY CAIN GENERAL Called Lightning Likes Playing Salesmanship Club 121, Track 121. WILLIAM L. CADMAN, Jn. GENERAL Called Bill Likes Golf Track 141, Basket Ball Squad 141, Monogram Club 141. JEAN SMITH CANTRELL LATIN Called Jean Likes Reading English Club 41, 21, G. A. A. 41, 2, 3, 41, Varsity Hockey 141, Varsity Tennis 13, 41, Class Basketball 11, 2, 3, 41, Class Hockey 131, G-Hi 12, 3, 41, National Honor Society 141, Treas. 141, Pine Whispers Staff 131, Managing Editor 141, Black and Gold Staff 13, 41, Play Writers 13, 41, Quill and Scroll- Vice Pres. 141, Cashiers Club 13, 41, Girl Scouts 11, 2, 3, 41, Debaters Club 111, Glee Club 111. HALA SYMANTHA CARMICHAEL COMMERCIAL Called Grouchy', Likes Basketball National Honor Society 141, Shorthand Team 131, Shorthand Club 131, Pen Art Club 11, 21, Dramatic Club 131, Girl's Athletic Associa- tion 1l, 2, 3, 41, Cafeteria Club 131, junior Play Chorus 131. CLYDE HUSSIE CARROLL SCIENTIFIC Called Napoleon Likes Club Meetings Sec'y of Class 111, Pres. of Class 131. Page forty-nine A-.tw...:J:f.. EL... AALL4 JJ-n COLUMBUS ELDRIDGE CARTER GENERAL Called Oswald Likes Dancing Greensboro Contest. MARY LOUISE CARTER GENERAL Called Bobby Likes Horseback Riding Pen Art Club 141, Girls Athletic Association U, 41. JOSEPH ROSCOE CARTER GENERAL Called Jacko Likes Boxing Captain Baseball Team HJ, Monogram Club -President UI. VIRGINIA LOIS CAUDLE Comusncur. Called Virginia Likes Singing Glee Club fl, 2, 3, 41, Mixed Chorus 12, 31. Girl's Wide Awake Club HJ. WILLIAM F. CHAMBERS SCIENTIFIC Called Bill Likes Mechanical Refrigerators Latin Club QZJ, Dramatic Club UQ, Metric Science Club Q-U. FAITH NORINE CHARLES Mc-mann LANGUAGE Called Faith Likes Dancing French Club 122, Glee Club UQ, Girl Scouts KU, English Club QZJ, Wide Awake Club UD. Page filly VIRGINIA VICTORIA CHATMAN COMMERCIAL Called Dixie Likes Shing Music Wide Awake Club 141. VIRGINIA G. CI-IRYSSON COMMERCIAL Called jinks Likes Reading Shorthand Club 141, Orchestra 141, Girl's Athletic Association 12, 3, 41, Soccer Team 13, 41, Art Club 131, Home Economics Club 121, Vice President 121, Tennis Team 111, English Club 111, Dramatic Club 131, Cast of Poor Nut 131. v FORREST EDWARD CHURCH COMMERCIAL Called Forrest Likes Cherkc'r.v Member House Representatives 141, Capt. Track 141, H-Y Club 141, Boys' Glee Club 131, Calvin H. Wiley Literary Society 1 Dramatic Club 131, Mixed Chorus 141, Southern Music Conference at 'Asheville 131. Student Council 1inactive member1 141, Mon- ogram Club 13, 41, Boys' Quartet 121, Foot- ball 12, 31, Track 13, 41. 21, All WILLIAM FRANCIS CLINGMAN, JR. SCIENTIFIC Called Frank Likes Radio Ushcr's Club 141, Metric Science Club 15, 41, Officer 141, Aeronautics Club 121, Hi-Y Club 13, 41. ROLAND DANIEL CLODFELTER GENERAL Called Cloddie Likes Baseball Student Council 121, Baseball 11, 2, 3, 41, Monogram Club 1l, 2, 3, 41, Glec Club 11, 2, 3, 41, Cashier's Club 11, 2, 31, Vice President Club 121, Arts Club 11, 21. JOHN 0. COAN LATIN Called Jack Likes Radio Hi-Y Club 11, 2, 3, 41, House of Represen- tatives 121. Page fifty-one in vfarf., JJ-011-Ln 'fy M4437 nv Q FRED COGGINS Commnncuu. Called Annie Likes sleeping Monogram Club 121, Winston Hi Players 141. Boxing 11, 21, Football Team 12, 3, 41, Cast Captain Applejackn 141, Track 12, 3, 41, Class Soccer 11, 21. MARY GH. CONRAD LATIN Called Mary Gil Likes Travel English Club 11, 21, Magazine Club 131, Junior French Club 131, Senior French Club 141, G-Hi 141, Girls' Athletic Association 121- B. O. CORNELIUS SCIENTIFIC Called B, O. Likes Football Football 12, 41, Basketball 13, 41, Capt. Bas- ketball Team 141, Baseball 13, 41, Literary Society 121, Monogram Club 13, 41. MARGARET CORRELIQ COMls1ERCIAL Called Teenie Likvs Hr1zi'i11g Fun Class Soccer 13, 41, Class Hockey 121, Stu- dent-Y 13, 41, Girls Athletic Association 131. Glee Club 111, English Club 121. FRANCES COX LATIN Called AsHcIity Likes Uke Varsity Track 11, 21, Dramatic Club 121, Debaters' Club 111, English Club 131, Senior French Club 141, Cast Poor Nut 131. CLYDE WESLEY CRUTCHFIELD Scuzwrmxc Called Crutch Likes Arcln'ry Metric Science Club 13, 41, Manager Cross Country 141, Monogram Club 141, Track 141. Page fifty-Iwo RUTH CUMBIE MODERN LANGUAGE Called Ruth Likes Picture Shows Page Club 111, English Club 12, 31, Orches- tra 11, 2, 3, 41, Dramatic Club 131, Glee Club 131, Mixed Chorus 131, Cashier's Club 141. HARRY GORE DAUERNHEIM SCIENCE Called Harry Likes Games Varsity Basketball 141, Varsity Baseball 141. HELEN DAVIS LATIN Called Helen Likes Latin Freshmen Debating Team 111, Triangle Debat- ing Team 12, 3, 41, Girl Scouts 11, 21, G-Hi 12, 3, 41, Boosters Club Reporter 141, Stu- dent-Y 13, 41, President 141, National Honor Society-Secretary 141, Girls' Athletic Asso- ciation 141, Business Staff Black and Gold 141, Freshman Glee Club 111, Debater's Club 111. HUGH MILTON DAVIS LATIN Called Hugh Likes Eating Debater's Club 111, Band 12, 3, 41, Orches- tra 13, 41, Football 131, Cross Country 131, Basketball 131, Metric Science Club 13, 41, Treasurer 141, Tennis 131, Hi-Y 12, 3, 41. JOSEPHINE DAVIS MODERN LANGUAGE Called joe Likes a Good Orclocsfnf' Freshman Glee Club 111, Class Soccer Team 11, 21, Varsity Swimming Team 12, 31, Mag- azine Club 131, Wide Awake Girls 141. BARBARA DEE GENERAL Called Duck Likes Driving a Car Debater's Club 11, 21, Dramatic Club 1.31, Pine Whispers Staff 13, 41, Class Basketball 11, 21, Athletic Association 131, Student-Y Club 11, 21, Senior Marshal 131, Class Tennis 111, Class Hockey 111, Girls' Metric Science Club 141. Page fifty-ibree ,. P- faf ' vw- was csv' 'A 5 of x A lslas - igggfakf ,. J EDYTHE DENNY COMMERCIAL Called Eau Likes Fun Class Track 113, Pen Art Club 113, Baseball 133, Class Soccer 143, Wide Awake Club 143. ERNEST DISHER COMMERCIAL Called Dish Likes Swimming Band 1l, 2, 43. ETHEL ESTELLE DIXON MODERN LANGUAGE Called Stellc Lilies Dancing English Club 12, 33, Secretary and Treasurer 12, 53. HELEN THOMAS DIXSON GENERAL Called Tommy Likes Vi:iling CHARLES ROYALL DUNNAGAN Scnsrzce , Il Called Charles t N Like: Raul Heads Literary Society 11, 2, 3, 53, Baseball 123, Assistant Manager 123, Scrub Football 14, 53, Swimming 1l, 2, 3, 4, 53, Track 14, S3, Cast Seventeen 143, Finger of God 143. DOROTHY EARLY GENERAL Called Dot Likes Reading Freshman Glee Club 113, Latin Club 153, Dra- matic Club 133, Wide Awake Girls Club 143, Metric Science 143, Typing Team 143. Page fifty-four EDWIN HOLMAN EARLY GENERAL A Called Ed Likes Skaling M Glee Club 12, 3, 45, Once in 21 Blue oon 435. JOHN SMITH EAST LATIN Called John Likes Ba:kcfball', Scrub Football 145, Varsity Football 155, Baseball 145, Captain 155. JAMES LAFAYETTE EDGE, JR. GENERAL Called Jimmy Likes Sleeping Columbia Hi 11, 25, Scrub Football 135, Booster's Club 145, Monogram Club 145, Soc- cer 145, Cast of Poor Nut 135, Literary Society 145. ELSIE N. EVANS GENERAL Called Elsie Likes Tennis Girl Scouts 115, Cafeteria Club 125, Dramatic 135- CEDELMA MAE FANT COMMERCIAL Called Cedamu Likes C0oking,' English 115, Penmanship 115, Shorthand 145. STUART SARANTON FAUST GENERAL Called Studio Likes Movies Cashier's Club 11, 2, 35, Scrub Football 135, Class Basketball 125, Class Tennis 12, 35, Salesmanship Club 125, Class Soccer 135, Class Baseball 12, 35. Page ffly-five ,jywfvkfgif as 'VY' III I 'i . , ', , . 1, I 1 .' , 1 .fl , ZA ,ar- ffl MA! I. .1' lavl, '1fM ' I .V -, liar-vi ' 1. rf? MMM yMj:Ki,2o5i5' W 1 VM! ,deli EDNA M. FETTER MODERN LANGUAGE Called Ed. U Likes Dogs Girls' Glee Club 111, Girl Scouts 11, 2, 3, 41 Soccer-Varsity 12, 41, Class Hockey 11, 3, 411 Class Basketball 13, 41, Class Swimming 141, Cafeteria Club 13, 41, College Club 131, G. A. A. 41, 2, 3, 41. JIM B. FINLAYSON SCIENTIFIC Called jim Likes Anything Hi-Y 13, 41, Calvin H. Wiley Literary So- ciety 111. GEORGE WILLIAM FLYNT GENERAL Called Bill Likes Radio Hi-Y 131, Calvin H. Wiley Literary Society 141- MILDRED FOY COMMERCIAL Called Mill Likes SociaIs', Salesmanship Club 131, Student-Y 141. MARY THERESA FOY GENERAL Called Dick Likes Her Cat Girl Scouts 11, 21, Cafeteria Club 141, Metric Science Club 141, Literary Society 141, Class Baseball 131, Class Basketball 141, G. A. A. 121, Hiking Club 121, English Club 121, Girl Reserves 131, Glee Club 11, 21, Class Soccer 111, French Club 131, Magazine Club 131, Cashier 11, 21, Art Club 121. LOUISE FULTON GENERAL Called Louise Likes A!lJlelics Varsity Basketball 12, 3, 4, 51, Varsity Swim- ming 12, 3, 4, 51, Varsity Hockey 12, 3, 4, 51, Varsity Baseball 14, 51, Athletic Ass'n. 11, 2, 3, 4, 51, Asst. Secretary 141, Vice Pres. 151, Class Baseball 111, Class Hockey 111, Class Swimming 151, Class Basketball 111, Class Track 11, 2, 3, 4, 51, Class Tennis 11, 2, 3, 4, 51, Class Soccer 11, 2, 3, 4, 51, Monogram Club 13, 4, 51, Cashier's Club 11, 21, Debat- er's Club 11, 21, Dramatic Club 141, Literary Society 151, Student-Y 141, Mixed Chorus 121, Girls Glee Club 121, State Music Contest 121, Spanish Club 141, Home Economics Club 131, Pine Wliispers Staff 141, Hiking Club 13, 41, Athletic Council 151. Page fifly-six LOUISE GAITHER LATIN Called Louise Likes Food Freshman Glee Club 111, G-Hi 13, 41, Tar Heel English Club 111, Book Lovers Club 121, Girl Scouts 11, 2, 3, 41, G. A. A. 11, 2, 31. Student-Y 141, National Honor Society 141. JOHN SHOCKLEY GEORGE LATIN Called John Like: Hunting Indian Relirsn EVELYN GERTRUDE GIBSON COMMERCIAL Called Gib Likes Hockey House of Representatives 131, Girls Athletic Association 141, Class Hockey 121, Class Soc- cer 131, Varsity Hockey 141, Class Basket- ball 141. HAZEL GILBERT GENERAL Called Gid Likes Chewing Gum Griilith High 11, 21, House of Representatives 131, Dramatic Club 131, Home Economics Club 131, Varsity Baseball 131, Varsity Soc- cer 141, W. A. G. Club 141, Baseball-Van sity 141. JUNIUS BLAKE GOSLEN, jr.. SCIENTIFIC Called J, B. Likes Girls junior Hi-Y Club 11, 21, Senior Hi-Y Club 13, 41, Varsity Track 13, 41, Metric Science Club 13, 41, Class Treasurer 121. RUBY LEE GOUGH COMMERCIAL Called Gough Likes Sl:ows,' Art Club 131. Page fifty-seven . foo Y ,QW 5 - WMM WW' ELIZABETH HUSKE GRAY LATIN Called Lib Likes Paperwork Tar Heel Club 111, President 111, Freshman Glee Club 111, Cashier's Club 111, Girls' Ath- letic Association 11, 2, 3, 41, Girl Scouts 11, 2, 3, 41, G-Hi 12, 3, 41, Pine Whispers Staff 13, 41, Editor-in-Chief 141, Black and Gold 131, Quill and Scroll 141, President 141, National Honor Society 141, Vice President 141, Girls Monogram Club 13, 41, Play Writ- ers Club 141, Class Tennis 111, Class Basket- ball 12, 3, 41, Class Soccer 131, Varsity Hockey 141. ,GLADYS GREGORY GENERAL Called Bo Peep Likes Dating Soccer Team 11, 21, Hockey 121, Baseball 11, 21, Pen Art Club 121, Athletic Asso- ciation 11, 21. JACQUE GWYN GENERAL Called Jacque Likes To Sing Girls Glee Club 13, 41, Mixed Chorus 13, 41, Class Hockey 111, Play Writers Club 13, 41, Dramatic Club 13, 41, Cast of Patsy 131, Cast of Poor Nut 131. JAMES B. HAMNER GENERAL Called jim Likes To read nzmfir' magazines Hi-Y Club 11, 2, 3, 41, Calvin H. Wiley Liter- ary Society 12, 31, Ushers Club 141. JULIA HALL GENERAL Called Dizzy Likes Reading Class Baseball 121, Class Tennis 121, Class Basketball 131, Class Baseball 131, Dramatic Club 131, Metric Science Club 141, Class Basketball 141, Class Tennis 141. ANNIE MAE HAM COMMERCIAL Called Tonk Likes Skali11gf' Pen Arr Club 111, Class Hockey 111, Class Basketball 111, Class Baseball 111, English Club 121,- Class Baseball 121, Class Basketball 121, Dramatic Club 131, Varsity Baseball 13, 41, Wide Awake Club 141, Class Soccer 141. Page fifty-eight ISABELLA G. HANSON GENERAL Called Izzie Likes Anything Interesling Spanish Club 121, Dramatic Club 13, 41, Play- writer's Club 13, 41, Quill and Scroll Society- Secretary 141, State short story prize 131, Author Gratitude 131, Co-author East Wind's Spell 141, Pine Whispers Staff 13, 41, Black and Gold-Editor-in-Chief 141, National Honor Society 141, Cast of Death Comes to Sonia 131, Class Tennis 141, Class Baseball 141, House of Representatives 131. SLADE HARDEE MODERN LANGUAGE Called Slade Likes Slrak Sandwiches Varsity Football 13, 4, 51, Varsity Track 131, Debating Team 14, 51, Winston Hi Players- President 151, Monogram Club 13, 4, 51, Pine Whispers Staff 13, 41, Managing Editor 141, Black and Gold Staff Sports Editor 14, 51, De- baters Club-President 131, De Pheta Phi Jasper 151. 151, Boosters 151, Cast Seve n 141,- Gratitude 141, De h Come ' 1 N 114.4 GLADYS S. H -Lg HOME EcoN ,sc Called Red Q Likes Sewing Debater's Club 111, Cafeteria Club 141, et- ric Science Club 141, Library Society 141, Class Basketball 11, 2, 31, Class Baseball 111. GLENN E. HENDRIX MODERN LANGUAGE Called Glenn Likes Walking French Club 121, Scrub Football 141, Varsity Track 13, 41, Aeronautics Club 131, Hi-Y Club 141, Literary Club 121, Class Track 131, Ushers Club 131, F-Y Club 131, Class Base- ball 121, Latin Club 141, Orchestra 131. MARY HERRING COMMERCIAL Called Mary Likes Radio French Club 12, 31, Dramatic Club 131, Girls Athletic Association 11, 2, 31, Class Soccer 111, Class Hockey 111, Debaters Club 111. EDNA LEAH HIGGINS LATIN Called Edna Likes Swimming Debaters Club 111, Book Lovers Club 121, French Club 141, G-Hi 141, Mixed Chorus 12, 31, Freshman Glee Club 111, All South- ern Chorus-Girls Glee Club 12, 3, 41, Class Hockey 141, Athletic Association 141, Stu- dent-Y 141, National Honor Society 141. Page fifty-nine LL-,L. V L- as We -G 1 kv , ' f , f'- A 4 , if' kk, ii tk' mb, 'US' 'M N' , V. 1 jf-sv 'CKLS1 lab .K as f E. fx .1 1 5- fq, . ,alfa 54 N T , 1 'I - ' Q 1 Ji is .12 Cl, THOMAS IRA HINES GENERAL Called Tom Likes Wriling Burlington, N. C., 111, Venice, Fla., 121, Monogram Club 131, Baseball Club 131, Bas- ketball 141, Cross Country 141, Track 141. ELEANOR Honns GENERAL Called Eleanor Likes Candy Girls Athletic Ass'n 11, 2, 3, 41, Class Hockey 11, 21, Class Soccer 11, 2, 3, 41, Class Basket- ball 11, 21, Class Track 11, 21, Class Baseball 11, 21, English Club 11, 21, Latin Club 111, French Club 12, 31, Class Tennis 13, 41, Var- sity Hockey 13, 41, Varsity Basketball 13, 41, Varsity Basketball-Captain Varsity Track 131, Varsity Baseball 131, Dramatic Club 131, Hiking Club 131, Metric Science Club 141, Wide Awake Girls Club 141, Monogram Club 141- HELEN HOBBS COMMERCIAL Called Helen Likes Piano Cafeteria Club 11, 21, Class Basketball 111, Class Baseball 111, Class Soccer 111, Pen Art Club 121, English Club 121, Class Swimming Q21- RUSSELL JAMES HOLT GENERAL Called Russ Likes Camping Scrub Football 121, Comrade's Club 13, 41, Football 12,'31, Basketball 13, 41, Monogram 13, 41, Literary Club 11, 41, Tennis 13, 41, Cashier 1419 STEPHEN HONEY GENERAL Called Steve Likes Science Cashiers Club 11, 21, Metric Science Club 141. HELEN MARIE HUBER GENERAL Called Helen Likes Collecting Pvunanlsn Cashier 131, Student Council 141, House of Representatiqcs 121, French Club 121, Pen Art Club 111, Girls Athletic Ass'n 11, 2, 3, 41, Girls Athletic Council 13, 41, Class Hockey 11, 2, 3, 41, Class Basketball 11, 2, 3, 41, Class Baseball 11, 2, 31. Page sixty JAMES E. HUTCHERSON COMMERCIAL Called j. E. Like: Bowling,' Salesmanship Club 125, Tennis 13, 45, Scrub Football 135, Class Basketball 125, Class Soccer 125, Class Tennis 11, 25. ALICE HUTCHINS LATIN Called Alice Likes To Make Good Grades Latin Club 145, G-Hi 135, Cashicr's Club 125, Debater's Club 135. META HUTCHIQSON GENERAL Called Tilda Likex Reading Freshman Debater's Club 115, Girl Scouts 11, 25, English Club 135, Latin Club 135, Cashier's Club 145, Class Basketball 13, 45, Varsity Hockey 135, Dramatic Club 135, Girl's Athletic Association 13, 45. MARY FRANCES HYRE GENERAL Called Specs Likes Beads Library Page 135. MATTIE PAULINE IRVIN GENERAL Called Mat Likes Magazines Art Club 115, Cashier's Club 125, Magazine Club 135, Wide Awake Girl's Club 145, Pen Art Club 145. DAVID FRANKLIN JARVIS SCIENTIFIC Called Dave Likes Aeronautics Literary Society 115, Manager Soccer Team 155, Cashier's Club 15, 65, Aeronautics Club 145, Glee Club 15, 65, Monogram Club 15, 65, Mixed Chorus 155. Page sixiy-one -W x' -A E t 1' O ff ,xi 1 ,ly H ,I 4-hs NJA N it I,u: 'f i' 'N l vi, bf 0 if X ai , a. ELIZABETH CAROLYN JENKINS GENERAL Called Lib Likes Art The Poor Nut 431, Sec. Art Club 43, 41, second prize Poster Contest 431, G. A. A. 42, 3, 41, Debater's Club 421, Spanish Club 421, Sec. Art Club 421, Member Art Club 431, Dramatic Club 43, 41. MARGARET SEXTON JOHNSON LATIN Called Margaret Likes Studying People Greensboro High School 4l1, Class Basketball 431, Senior Marshal 431, Book Lovers Club 421, Girl scouts 42, 3, 41, G-Hi 42, 3, 41, Sec. of Senior Class 441, National Honor So- ciety 441, Staff of Pine Whispers 43, 41, Cashier's Club 43, 41, Girls Athletic Associa- tion 431. EVELYN JOYCE GENERAL Called Constancef' Lilac: Horseback Dcbaters Club 411, Girls Glee Clyb 411, Tar Heel Club 42, 31, Vice Pres. 431, Class Bas- ketball 431, Dramatic Club 431, Girl Scouts 41, 2, 31, G-Hi 441, Pine Whispers Staff 441, Winston Hi Players 441. WORTHY KLUTZ KEENER GENERAL Called Woofy Likes Shows BEULAH KIEGER GENERAL Called Beulah Like: Dancing Pen Art Club 41, 2, 31, Art Club 42, 31, Glee Club 42, 3, 41, Orchestra 41, 2, 3, 41, Wide Awake Club 441, Once in a Blue Moon 421, Dramatic Club 42, 31, Class Baseball 411, Class Hockey 421, Varsity Track 421, Var- sity Soccer 4l, 21, Class Track 411, Girls Ath- letic Association 41, 21. FRANCES CHRISTINA KELMAN GENERAL Called Frans Likes Chatting Honor Society 441, Shorthand Club 441, Soc- cer Team 42, 41, Pen Art Club 421, House of Representatives 421, Class Basketball 421, Sales- manship Club 421, French Club 431, Dra- matic Club 431, Shorthand Team 431. Page sixly-two EMMA KIMBALL COMMERCIAL Called Red Likes Camping Class Hockey 11, 21, Class Soccer 11, 21, Class Baseball 11, 21, Track 11, 21, Class Bas- ketball 121, Athletic Ass'n 11, 2, 31, Pen Arts Club 11, 21, Cashier's Club 11, 2, 41. FENTON KIMBALL COMMERCIAL Called Fenton Likes Dramnliex Scrub Football 12, 3, 41, Scrub Baseball 13, 41, Play Poor Nut 131, Captain Applejackn 141, Band 12, 3, 41, Orchestra 131. HALL MONROE KIRKMAN LATIN Called Hatty Likes Collerling Indian Relirrv Band 1l, 2,'3, 41, Orchestra 11, 2, 31, Hi-Y 11, 2, 3, 41, Literary Society 12, 31, Ushers Club 13, 41, House of Representatives 131, Delta Theta Phi 141. KATHRYNE BEARCHARD KNIGHT GENERAL Called Kitty Likes Ire Creamy' Glce Club 121, Dramatic 121, Orchestra 11, 2, 31. ETHEL KOLODONY COMMERCIAL Called l'Etty Likes Piuno', Dramatic Club 131, Athletic Assin 141, Short- hand Club 141, Cashicr's Club 141. GENOLA VIRGINIA KOONTZ MODERN LANGUAGE Called Jenny Likes Talking Page sixty-llaree 5 4 I x 5 2 5 E 'f. . LA. .97 l.f4j..,,.N-A, . w . . I . ff'- L,-1.f4 ' QM4.. 4.7 4 , 1 ,rt 4 -' 1 r I J.-.ac 7 7 and fav .ML ,HMO-fjiu ff' ftf ,.- , ilff lr 'V ALLIE HAMILTON KRITES INDUSTRIAL Aus Called Al Likes Skrlling Aeronautics Club 11, 2, 35. MILDRED STELLA KRITES LATIN Called Bibby Likes Ska!ing Tar Heel Club 12, 35, Book Lovers Club 145, Girl Scouts 11, 2, 3, 45, Dramatic Club 135, G-Hi Club 13, 45. RUTH WHARTON KUYKENDALL Momsim LANGUAGE Called K Likes Hisfory Glee Club 115, Dramatic Club 135. MARY ALICE LAUGHTER GENERAL '- Called Mary Alice Like: Hadley Girl Reserves 135, Dramatic Club 135, French Club FRED LAWRENCE Commencmr. Called Fossils Likes Fossils Aeronautics Club 125, Class Baseball 135, Boys Glee Club 145, Salesmanship Club 125, Base- ball 145, Dramatic Club 145, Cast, The Poor Nur 135. NANCY JUANITA LAWRENCE COMMERCIAL Called Nita Likes Going Plans Magazine Club 12, 35, Athletic Ass'n 115, Home Economics Club 135, Girls Wide Awake Club 135, Casl1ier's Club 135. Page sixty-four JUANITA EDNA LAWSGN GENERAL Called Nita Likcx Cooking GAITHER LEWIS GENERAL Called Gaithcr,' Likes Boxing Salesmanship Club 133, Spring Football 143, Cross Country 133. ALLEN BOWEN LITTLE SCIENTIFIC Called Scum Likes rrSWi7I177lillg,, MARGARET E. LONG LATIN Called Martlong Likes Wriiing English Club 11, 23, Glee Club 113, Class Bas- ketball '11, 2, 33, Varsity Basketball 143, Var- sity Hockey 143, Pine Whispers Staff 13, 43, Black and Gold Staff-Ass. Editor 13, 43, Playwriters Club 143, G. A. A. 13, 43, Quill and Scroll 143, Treasurer G-Hi 143, Dramatic Club 12, 33, Class Tennis 133, Class Soccer 143, Varsity Track 113. FRANCES LEE LUTHER GENERAL Called Baby Likes Driving Varsity Soccer 12, 33, Varsity Hockey 143, Class Hockey 11, 2, 33, Varsity Track 123, Senior Marshal 133, G. A. A. 12, 3, 43, Dra- matic Club 133, Book Lovcr's Club 11, 23. CARRIE ELIZABETH MANUEL GENERAL Called Carrie Likes Swimming Girls Wide Awake Club 143, Cashier's Club 113, G. A. A. 113, Glee Club 11, 23, House of Representatives 133. Page sixty-Jive f 1 1 l L mi' ' MALPHUS MARTIN Sc1EN'rlFxc Called Malphus Likes A uiatiorf' Aeronautics Club 141. REUBEN MATTHEWS GENERAL Called Reuben Likes Movies C. A. MCCOLLUM Scuzncn Called C. A. Likes Talking House of Representatives UD, Literary Society Us 27- JOHN CAMBELL MCPHAIL GENERAL Called Jack Likes Riding JEANNETTE LINDSAY MEINUNG GENERAL Called Jean Likes Pirfurc Shows G-Hi U, 41, English CZ, SQ, French Club MJ, Glec Club QU, Student-Y 131. MARJORIE BROWN MENDENHALL GENERAL Called Miss Brown Likes Art Orchestra OJ, Glec Club UD, Mixed Chorus KZQ, All Southern Chorus OJ. Page sixty-six PAUL MICKEY LATIN Called Paul Likes H1mting', Debating Team 111, Band 11, 2, 3, 41, Or- chestra 1l, 2, 31, Literary Society 12, 31, Hi-Y 11, 2, 3, 41, Ushers Club 141, Black and Gold Staff 141, Honor Society 141. PAULINE E. MILLS GENERAL Called Polly Likvs Ska!ing May Day 121. SARA ELIZABETH MITCHELL GENERAL Called Lib Likes Dam'ing,' LAURA MARION MITCHELL LATIN called f2onnie', Likvs Rv:z1iug English Club 121, Latin Club 131, French Club 131. RICHARD MOESTER COMMERCIAL Called Ricks Likv: Baskz'fbu1l ELEANOR KATHERINE MONAGHAN GENERAL Called Red Likcx Movies Page xixly-seven A l cd 97' I 1 ' ' 5,1 44,410.1 41 . I infu-iff,-1. 54,15 IQQQQQOJJLQ ,val -A-241-a 14,94-, -:A.A4 - ,J A, .4 'L4.l U Af 1 5,4-l., VM . Aff...--...AI 4, ya- be-ff . lv 9 .,,.v C-I v ,MJ I ,. -ri.. rf' Y , I In. uf 1, Lil' 5- Lf-suxg, Q I xx rv X iii! W .nt- I.-.p. Y fjlxyi-if 1,41 I ROY CLIFTON MONTGOMERY COMMERCIAL Called Roy Likes Stamps Boys Glee Club 11, 21. HERMON LESTER MORRIS SCIENTIFIC Called Kid Koonie Likes Soda Icrkingn Literary Society 13, 41, Senior Hi-Y 13, 41, Vice Pres. 141, Class Soccer 11, 21, Baseball 11, 2, 31, Ushers Club 141, Chairman Senior Program Committee 141. LINDSAY MORRIS GENERAL Called Lindsay Likes Riding Hi-Y 11, 2, 3, 41, Manager of Football 141, Monogram Club 141, Boosters Club 141. PAULINE REID MOSER GENERAL Called Polly Likes Talking Kannapolis High School 11, 21, Girls Wide Awake Club 141. WILLIE BREWER MYERS GENERAL Called Willie Likes Shows French Club 13, 41, Latin Club 11, 21, Dra- matic Club 131, G-Hi Club 121, Girls Chorus 141, Glee Club 111, Tar Heel Club 121, Math- ematics Club 121, Class Hockey 111. HENRY NANCE SCIENTIFIC Called Speed Demon Likes Radio Radio Club 13, 41. Page sixly-eight KATHERINE NEMER GENERAL Called Kitty Likes Tennis E Deb:1ter's Club 111, Class Track 111, Ath- letic Association 111, Varsity Track 121, Var- sity Soccer 121, Cafeteria Club 131, Class Ten- nis, Class Basketball, Class Baseball 121. HARRY NEWSOME GENERAL Called Slim Likes Singing Glee Club 12, 3, 41, Mixed Chorus 121. DENA NEWTON GENERAL Called Dena Likes Swimming Varsity Soccer 12, 31, Latin Club 11, 21, Girls Glee Club 141, College Club 131. JAY THELBERT NICHOLSON SCIENTIFIC Called Nick Likes Chemistry Metric Science 13, 41, Reporter 141, Rotary Club 141. CHARLES BYNUM NIFONG SCIENTIFIC Called Outz ' Likes Fun Debater's Club 111, Aeronautics Club 121, Metric Science 141. MARY CARTER NOOE GENERAL Called Mary Carter Likes Driuing,' President Tar Heel Club 131, Secretary House of Representatives 131, Dramatic Club 131, Cafeteria Club 141, Girls Metric Science Club 141, Secretary 141. Page sixty-nine 2 5 x. 1 L 'vsp r A E I N Q I I I . I , 1 .furf QM X 'i L , . , ,1 fl .Ill-5,,frif,1 I- , li N' iv 1 YJ , J If 'I ww ' 0 , V I fr I A , if I If 'X f I 'em 'wi-'L,I. ff ' ,Of J, a, U: - 4 I-' , -I S.-.Q u .Jkn 4 A 1.2.-A1 AI '11 'fl so - ' , if , 5 -A '. U' RAYMOND OVERBY MANUAL ARTS Called Raymond Likes Sports Varsity Soccer 12, 3, 41, Monogram Club 42, 3, 41, House of Representatives fl, 21. CHARLES WASHINGTON OWENS GENERAL Called Charlie Likes Golf Raleigh High QI1, Library Page C31, Literary Society 131. WOODROW OWEN GENERAL Called Woody Likes Athletics Baseball C41, Football 441, Boys Monogram Club 141, Boosters Club 141, Dramatic Club 131, Cashiers Club Q31. OPAL PAGE COMMERCIAL Called Opall' Likex f'DUHl'i7lg', Pen Art Club Cl, 21, Cashier fl, 21, Girls Wide Awake Club Q41. THOMAS BAIRD PATTERSON SCIENTIFIC Called Pat Likes C'umj1ing Ushers Club C31. DOROTHY ELIZABETH PEDERSEN GENERAL Called Dot Likes Dam'ing Cast of Captain Applejack 141. Page seventy KATHLEEN VIRGINIA PHILLIPS HOME ECONOMICS Called Kat Likes Swimming THELINIA MAGDALINE PI'IlLI.,IPS COMMERCIAL Called Tannie Likvx HorXz'bzu'k Riding CARL PLASTER SCIENTIFIC Called Cathy Likes Fuolbali EVELYN HALEY POOLE GENERAL Called Tip Likes Co1lc'rling Old Books Cashiers Club 141, Ecole Internationale 131, Class Soccer 11, 21, Track 11. 21, G. A. A. 11, 2, 41, G-Hi 141, Latin Club 11, 21. BEULAH BEATRICE POORE COMMERCIAL Called Billie Likes Dancing Soccer Team 111, Track Team 11, 21, English Club 111, Pen Art Club 111, Class Basketball 121, Girls Wide Awake Club 141, Booster's Club 141, Girls Glee Club 131, Mixed Chorus 133- EUGENE PRATT GENERAL Called Gene Likes Dramaiirs Dramatic Club 15, 41, Oldtown High School 11, 21, Debating Team 11, 21, Boosters Club- Presidcnt 141, Orchestra 13, 41, Band 131, Cast, Finger of God 131, Cast, Death Comes to Sonia 131, Cast, Captain Applejackn 141, Cast, Circus Phantom 141, Cast Minstrel 141, Cashier's Club 141, Cheer Leader 1l, 2, 3, 41. Page seventy-one N-. imc WWML L 'L17-Vai 6-JL-yn, I I l.ff0N:,Q., .ft LW J-4...4,isM.1.. G....Q.1u.4.A- wJ.:-M fo-1 0.0,-,,,,,,,Qq114a--1. C...,,e,XWQw-l.... ' o I vi fly! SJ-f I3 's J, yi.r'k k fx 4,l4,fL!lA,-9 ug,-ffl- HARRY LEZATTE QUINN GENERAL Called Harry Likes Dramutics Capt. Applejackn 141, Cast of Jasper 141, Hi-Y 141, Dramatics Club 141. WILLIAM ELBERT RANDLEMAN INDUSTRIAL ARTS Called StiiTy Likes Mom'y', Orchestra 11, 21, Cashiers' Club 11, 2, 31, House of Representatives 141, Mixed Chorus 12, 3, 41, All State Orchestra 131, Boys' Glee Club 12, 3, 41. OWEN REEVES COMMERCIAL Called Owen Likes Soda Ilrrkingn Salesmanship Club 121, Dramatic Club 141, House of Representatives 141. WILLIAM T. REID, JR. GENERAL Called Bill Likes Atbleiics Hi-Y Club 11, 2, 3, 41, Tennis 131, Scrub Football 131, Monogram Club 13, 41. MARY ISABELLE RICHARDSON GENERAL Called Isabelle Likes Reading Debatcr's Club 131, Class Hockey 141, Senior French Club 141, Girls' Athletic Association ca, 41. MAYE ROBERSON COMMERCIAL Called Bill Likes Danfing Wide Awake Girls' Club 141, Pen Art Club 11, 21, Art Club 11, 21, Varsity Track 12, 31, Class Baseball 1l, 21, Class Tennis 1l, 21, Class Swimming 11, 21, Girls' Athletics 12, 3, 41, Magazine Club 111, Class Basketball 11, 21, Dixie Lore Club 121. Page sevcnly-Iwo MARGARET LYNCH ROSS GENERAL Called Margaret Likes Canoeing Girls Glce Club 111, Freshman Debators Club 111, English Club 121, Girl Scouts 11, Z, 3, 41, Latin Club 131, Dramatic Club 131, Girls Ath- letic Association 12, 3, 41. HOWARD WESLEY ROTHROCK GENERAL Called Skinney Like: Dancing Literary Society 11, 2, 31, Speaker of House 141, Captain of Track Team 131, All State Team 141, Football 13, 41, Basketball 12, 41, Scrub Football 111. LEE ROY SALMONS, jk. GENERAL Called Lee Likes Golf CARL SAUNDERS SCIENCE Called Carl Likes W1ifi1xg,' Band 12, 3, 4, 51, Orchestra 13, 4, 51, Avi- ators Club 141. WILLIE EDWIN SAYLOR GENERAL Called Bill Likes Movies Aeronautics 131, All American Minstrel 141. ROBERT PFOHL COMMERCIAL Called Scott Likes Barberue Cashiers Club 141. Page sevmly-three 47 lu Y! it PAUL G. SHEETS SCIENCE Called Paul Likes Model Making Literary Society 111, Aeronautics Club 121, Metric Science Club 141. FREDRICK SHEETZ, Jn. LATIN Called Fred Likes Money President Freshman Class 111, House of Rep- resentatives 11, 21, Debaters Club 121, Track 12, 3, 41, Manager Track 13, 41, President junior Class 131, Cross Country 131, Pine Whispers Staff 13, 41, Sports Editor 141, Met- ric Science Club 13, 41, Sec. 131, junior Ro- tarian 131, Monogram Club 13, 41, Student Council 141, National Honor Society 1Pres.1 141, Quill and Scroll 141, Hi-Y 11, 2, 3, 41, Pres. 13, 41, Auditorium Club 141. ANNELLE SHELLINGTON LATIN Called Dolly Likes RMr1irIg Tar Heel English Club 111, Magazine Club 131, Book Lovers Club 121, G-Hi Club 141. WILHELMINA SHOUSE COMMERCIAL Called Willie Lilzes Radios ' Cafeteria Club 141, Tar Heel English Club 12, 31, Athletic Association 111, Class Hockey 121, Class Soccer 121. JOHN D. SIEWERS GENERAL Called John Likes CumfJing Hi-Y 11, 2, 3, 41, Scrub Football 131, Varsity Football 141, Class Treasurer 11, 21, Cast The Poor Nut 131, Dramatic Club 141, Literary Society 13, 41, House of Representatives 131. ELMA ROSA SIMMONS GENERAL Called Elma Likes Cab Page seventy-four FRANCES SHARRON SIMPSON GENERAL Called Frank Likes Dancing Dramatic Club 1 2 3 S anish Club fs , ii P 12,31- Debators Club 121, English Club 131, French Club 131. RUBY MADGE SMITH COMMERCIAL Called Ruby Likes Movies Class Basketball 11, 2, 3, 41, Class Baseball 11, 2, 3, 41, Class Swimming 111, Varsity Swimming 12, 3, 41, Hiking Club 121, Dra- matic Club 121, Athletic Association 12, 3, 41, Monogram Club 13, 41, Home Economics Club 131, Wide Awake Club 141. REBECCA DONREITH SMOTHERS GENERAL Called Donnie Lilzfx M1lXif',, Mixed Chorus 12, 31, Girls Glee Club 12, 31. GEORGE DEO SMOTHERS COMMERCIAL Called Muffin Likes Fishing House of Representatives 111, Scrub Football 111, Varsity Football 12, 3, 41, Class See. 121, Baseball 13, 41, Basketball Mgr. 141, Mono- gram Club 13, 41, Cashiers Club 121. EVELYN SOSNIK COMMERCIAL Called l-Ieckyn Likes Mower Debatcrs Club 111, Tar Heel Club 11, 21, Girls Athletic Asso. 12, 3, 41, Shorthand Club-President 141, Shorthand Team 131, Varsity Soccer 131, Class Hockey 121, Class. Baseball 131, National Honor Society 141. HILDA SOUTHERN COMMERCIAL Called Bill Likes nDdlIl'illgH Magazine Club 11 21, Dixie Lore Club 11 i 1, Vice Pres. 121, Wide Awake Girls Club- Treasurer 111, Vice Pres. 121. Page seventy-five ,V 2-1 .. 1 V 4 I, - .a lt 'f1:m1' . 511.4 If T 1 Q- gf 'N pls C' . W' kk. - V' X A 7? l 1111 A, fv ' L 11 L, N' .1 It . 1' -ina,--vvhq .....--1.5.4 ff- ef' ,. L40 it , ,. TL ,,A,,,a-'f L fmfw.. -' -o If . ,- .Jv- ,fi I .L I +5 V . WILLIAM LEONARD SOUTHERN SCIENTIFIC Called Bill Likes Model Airfzlanesu Dramatic Club 131, Literary Society 121. ALTON SPAINHOUR COMMERCIAL Called Alton Likes Golf Cashier Club 12, 3, 41, Pen Art 111, Aero- nautics 121. HAZEL BURWELL SPAUGH GENERAL Called Hazel Like: Hazel N nfs Glce Club 111, Tar Heel English Club 131, G-Hi 13, 41, Pres. 141, Student-Y 12, 31, Cashier's Club 11, 31, Girl Scouts 1l, 21. MAZIE SPINKS LATIN Called Mamie Like: AllJlefics Class Hockey 11, 2, 31, Vice Pres. of Class 111, Debatcrs Club 111, Book Lovers Club 121, Class Basketball 12, 3, 41, Class Tennis 121, Glee Club 111, Varsity Tennis 131, Varsity Hockey 141, Athletic Association 11, 2, 3, 41, Pres. 141, Pine Whispers staff 13, 41, Black and Gold Staff 141, G-Hi Club 12, 3, 41, Girls Monogram Club 13, 41, Girl Scouts 11, 2, 3, 41, National Honor Society 141, Playwriters Club 141, Class Track 121, Class Baseball 121. CLEO CATHERINE STACK GENERAL Called Co-Co Lilac: Cooking Glee Club 111, Typing Team 12, 31, Dramatic Club 121, Shorthand Club, Secretary 13, 41. MARY STITH GENERAL Called Mary Likes Dragon Flies Girls Glee Club 11, 41, Class Hockey 11, 2, 31, Class Basketball 11, 2, 31, Class Soccer 11, 21, Varsity Hockey 131, G-Hi 13, 41, English Club Page :evenly-:ix lx -, SARAH STONESTREET LATIN Called Sarah Likes Traveling Debaters Club 111, English Club 121, French Club 13, 41, G. H. 141, Class Baseball 131, Class Hockey 141, Class Tennis 13, 41. DOROTHY LEE STUART GENERAL Called Dot Lee Likes Dr1m'ing Magazine Club 131, Pres. 131, Art Club 141, Pres. 141, Girl Scouts 131, Student-Y 13, 41, Dramatic Club 131. JULIET SUTTON GENERAL Called julliet', Likes Dra1nalics Once in a Blue Moon 121, Patsy 131, Gratitude 131, Death Comes to Sonia 131. AUDREY SWAIM COMMERCIAL Called Audrie Likes Music Pen Art 111, Girls Wide Awake 141, Girls Glee Club 131, Mixed Chorus 131, Science Club 141, Orchestra 121. MARGARET SWAIN COMMERCIAL Called Margaret Likes Picture Shows Pen Art 111, G. A. A. 11, 2, 3, 41, Student-Y 13, 41, Baseball 12, 31, Class Basketball 131, English Club 111. GEORGE COLON SWAIN GENERAL Called Racehorse Likes S1eeping', Capt. Track 121. Page seventy-seven vvf .y- ' '11 ' C .K I I kd J I 4 i -. I A fr,-'pf ,ef V d ,A I .Lf-f' ' I ' .19 ff J- I of '.i .'q' .2 f, ,-' x . Ii V KATIE SUE TAYLOR GENERAL Called Katie Sue Likes Musk Tar Heel Club 111, Class Track 111, Book Lover's Club 121, G-Hi 12, 3, 41, Girl Scouts 11, 2, 31, All Southern Chorus 121, Athletic Association 11, 2, 3, 41. SARA ELIZABETH TAYLOR COMMERCIAL Called Granny Likes Chewing Gum Debating Club 111, Pen Art Club 111, Dra- matic Club 131. OTHOR MONROE TEAGUE, jk. GENERAL Called Ogio Likes Arrowhemis Literary Society 141, Dramatic Club 131, Aer- onautics Club 11, 21. INEZ FRANCES TEMPLEMAN LATIN Called Inez Likes Looking at People-'s General Ap1u'urum'r Tar Heel Club 111, Girls Athletic Association 12, 31, Latin Club 131, Class Soccer 141, Class Basketball 131. ANNIE PAULINE TESI-I COMMERCIAL Called Polly Likes Radios Freshmen Glee Club 111, Debater's Club 111, Book Lover's Club 111, Girls Wide Awake Club 141, Dramatic Club 131. RAY NORMAN TESH COMMERCIAL Called Fatty Likes Singing Scrub Football 141, Mixed Chorus 141, Boys Glce Club 141. Page seventy-eight GILBERT TILLITT SCIENTIFIC Called Gila Likes Everything Football 141, Basketball 131, Baseball 121, Dramatics 121, Cast Poor Nut 131, Capt. Applejackn 141, Jasper 141, East Wind's Spell 141, Twelve Pound Looki' 141, Pres. Cashier's Club 141, Winston-Hi Players 13, 41, Monogram Club 141, Pen Art Club 121, Ush- ers Club 131. TURNER l1flARSHALL THORPE, JR. LATIN Called T. M. Likes Skufi11g Hi-Y 12, 3, 41, Calvin Wiley Literary Society 131, Boosters Club 141. RUTH TOWNSEND GENERAL ' Called Ruth Likes Driving ELIZABETH ANNE TRENT COMMERCIAL Called Pat', Likes Swimming Dramatic Club 111, Debater's Club 121, Sales- manship Club 131, Wide Awake Girls Club 141, English Club 121. ADELAIDE TROTTER GENERAL Called Adelaide Likes Horseback Riding Girl Scouts 12, 1, 31, G-Hi 12, 3, 41, Secretary X ,J-' junior Class 131, Debater's Club 111, English Club 121, Girls Glee Club 111. , V ' J ls BENJAMIN TROTTER LATIN Called Ben Likes Spark Sec. Freshman Class 111, Debater's Club 111, Freshman Debating Team 111, Literary So- ciety 121, Hi-Y11, 2, 3, 41, Sec.Hi-Y11, 41, Cashier's Club 11, 3, 41, Metric Science Club 12, 31, Sec. Metric Science Club 121 , Vice Pres. Sophomore Class 121, Ushers Club 141. Page seventy-nine 2?-'f' .Q-sf' E ' l r' JA J ' r fr, A rg ,- ' , .. ,4 gg. - -KI Zi ,. . . ,. IDABELLE TUNNO COMMERCIAL Called Idabelle Likes NSl'1Ui1lgn Pen Art Club 115, Mathematics Club 125, Cafeteria Club 13, 45, Shorthand Team 135, Honor Society 145. DORTHY ELLIOTT TUTT LATIN Called Dot Likes Dogs Tar Heel English Club 115, Book Lovers Club 125, G-Hi 12, 3, 45, Girl Scouts 11, 25, Class Hockey 125, Athletic Association 115, Orchestra 13, 45, National Honor Society 145. MINA MAUD UNDERWOOD COMMERCIAL Called Mina 'Likes Music Tar Heel Club 11, 2, 35, Winner of Thrift Essay Contest 135, G-Hi 13, 45, Class Hockey 12, 3, 45, Cafeteria Club 13, 45, Varsity Hockey 135, Class Soccer 125, Class Basketball 12, 35, Manager 135, Monogram Club 13, 45, Class Baseball 12, 35, Class Track 135, Girls Athletic Association 12, 3, 45, Library Page 12 5- LAHOMA UPCHURCH COMMERCIAL Called Red Likes Dancing Wide Awake Girls Club 145, English Club 115. ANNE LINDSAY VAUGHN LATIN Called Anne Likes Girl Scouting Black and Gold Staff 135, Pine Whispers Staff 145, Tar Heel Club 11, 25, Winston Hi Play- ers 135, G-Hi Club 13, 45, Class Soccer 115, Class Tennis 115, Class Swimming 115, Ath- letic Association 11, 25, Girl Scouts 11, 2, 45, Magazine Club 135, Pres. 135. THOMAS GORDON VEST COMMERCIAL Called Gordon Likes Work Home Room President 145. Page eighty HELEN VOSS COMMERCIAL Called Helen Likes Ealing', Book Lover's Club 121, Class Hockey 111, Class Soccer 121, Debater's Club 111, Typcwriting Medal 141, Typewriting Team 13, 41, Sales- manship Club 121, Shorthand Club 141. HENRIETTA MARIE WACK COMMERCIAL Called Henry Likes Ioyridi11g Class Baseball 12, 31, Varsity Baseball 141, Class Soccer 11, 2, 31, Varsity Soccer 141, Class Track 11, 21, Varsity Track 131, Fresh- man Glcc Club 111, Home Economics Club 121, Girls Wide Awake Club 141, Class Hock- ey 12, 31, Student-Y' 141, Girls Athletic As- sociation 121. INA MARIE WAGONER LATIN Called Sis Likes Rabbils Dramatic Club 131, 4-H Club 111, Vice Pres. of Latin Club 131, Latin Club 141. FRANK WALLSLAGER SCIENTIFIC Called Wooly Likes Suffer Literary 111. ELIZABETH EUGENIA WALKER GENEITAI. Called Lib Likes Traveling Debatcrs Club 111, Nature Study Club 121, Girl Scouts 131, Cafeteria Club 13, 41, Class Hockey 141, Class Basketball 141. VIRGINIA WALKER LATIN Called Virginia Likes Tennis English Club 121, French Club 131, Class Bas- ketball 131, Treasurer of Student Council 131, Pine Wliispers Staff 141. Page eigbfy-one 61 43 I '51 fl 113-V' ' . gf 7 ,1 ,Vi viz .., 4?4L.? L-X HUBERT WARREN GENERAL Called Hugh Likes Swimming Hi-Y 131, Metric Science Club 13, 41, Vice President 141, Cafeteria Club 121, Math. Club 111, Latin Club 131, Aeronautics Club 121. CLARENCE JAMES WATSON COMMERCIAL . Called Watt Likes Baskrlball Cross Country 12, 3, 41, Track 121, Mono- gram Club 12, 3, 41, President Sophomore Class 121, Boosters Club 141, Glee Club 131, Class Basketball 11, 21. in ALMA VIRGINIA WELCH COMMERCIAL called Alma Likes Reading Dixie Lore Club 121. JOSEPH THOMAS WEST COMMERCIAL Called Joe Likes Stamj1 Collecting Aeronautics Club 11, 21. DOROTHY JOSEPHINE WHITE COMMERCIAL Called Dot Likes Reading Home Economics Club 12, 31, Freshman Glee Club 111, Debaters Club 111, Cafeteria Club 12, 3, 41, Casl1ier's Club 11, 21, Class Baseball 111, Class Soccer 111, Class Hockey 131. EDYTHE ELOISE WHITE GENERAL Called Eloise Likes Sports Cashiers Club 12, 3, 41, Dramatic Club 12, 31, Band 12, 3, 4, 51, Orchestra 11, 2, 3, 41, Glce Club 131, Girls Athletic Ass'n 111, Boosters Club 141, Black and Gold Staff 131, Pine Whispers Staff 13, 41, Book Lover's Club 111, Public Speaking Club 131, Literary Crusaders Club 141. Page eighty-I wa ILA EVELYN WHITE GENERAL Called Kitty Likes Skating Pres. Home Economics Club 133, Science Club 143, Pen Art Club 113, Dramatic Club 133, Home Economics Club 133. FRANCES LOUISE WHITLOWE LATIN Called Frank Likes Acting Pres. Latin Club 133, Latin Club 143, Glee Club 143, Student-Y 143, Junior-Hi. 123. FRANCIS FRIES WILLINGHAM SCIENCE Called Colonel Likes A!lJIcliz's Senior Hi-Y 13, 43, Cafeteria Club 113, Met- ric Science Club 13, 43, Vice President Science Club 13, 43, Student Council 13, 43, House of Representatives 143, Rotary Club 143. IDA WLODINGER COMMERCIAL Called Ida Likes Pianos Class Basketball 113, Class Soccer 123, Class Hockey 13, 43, Shorthand Club 13, 43, Library Page 133, English Club 123, Student-Y 143, Girl's Athletic Association 12, 33. EMLA BOYD WRAY GENERAL Called Emla Likes A Black Club Athletic Association 143, Spanish Club 123, French Club 13, 43, English Club 113, Class Hockey 143, National Honor Society 143, Freshman Glec Club 113. Page eighly-lbrce v H ,Nr P 1 A W' 'C V1.1 ,Y Qi ll! f- A, 4. 1, I 1'-s a 'Z 1 ar' J '. E , ' G AND ' Q X B K 3' nA -,QLD Qi sa ' mf 4 it Page cigbty-fan r f R f 6 AND ff, . N g 1 -Qi 4 it TQ Q' X X L l' EESgX's1XSeig'-,9x,,3 za7f1 2. I IF THIS BE TREASON I I I I Should find it so necessary E To become tearfully sentimental g Over a rather insigniicant E Step in the process of I Growing Up. I Strange that a people I I li Strange, too, the long speeches : Upon the many trials I Which we young hopefuls Are supposed to encounter E After leaving this stage. I I I Is it not inevitable- E The Passage of Time I And the advent of Tomorrow? Why, then, regret, or Say we are sorry to leave Simply because it is The Fashion? Are we dumb sheep : Or sane-thinking individuals? I I I And these long words . Of warning and wisdom- E Why tell us what we ' Already know? We do not face the Unknown- We have met every unpleasant E Situation in this oddly I Vain pursuit of a Conglomeration 5 Of Facts. I I I E Or think of Yesterday's I Date-but never, Tomorrow. 2 That has become Today E And so holds nothing of I Strangeness. I I I I I I I I I shall sleep thru the speeches Poems are written for those Who would fool themselves XVith a vision. Thoughts, for those Who would scorn The crowded path of tradition. Would you weep for a Party at which you danced Yesterday-simply because It is Past? Or regret A moment of grief Because it will never Return? -A laugh or a tear of The Past is as dead As the moon. That is why, having finished These four years of High School adventures, A person elected to sing The usual heart-broken ballad Chooses to say to the worldg You've fought that, and will Carry its scars forever. Therefore, unless you wish To be hacked and pounded To pieces Remember only those things Necessary to avoid being Wounded again. The sweet and the happy Things have left you Nothing of value, Save a fatal resolve To be stung for the sake Of the honey. LISABELLA I-IANSON. Page righly-fire my I - 4 AND , X S 123 , -ff JB .' .- D' If f 454 . :.fGillDQ Ib 1: , , - f , . V, C , . M J nf- N w - , Y HISTORY CLASS OF JUNE, 1931 .5 C. E STAND HERE in the wind-gazing past commencement, visualizing our I J future-impatiently treading the path of the scholar-stretching forth eager 0 4 reach the threshold of life and knock at the jeweled door-past of the world- ,,,,. the adventures we experienced and the things we accomplished during high school will rush back, vivid in their petty significance. Of course, we all have to be freshmen-green or otherwise, and there was a time when even we were quite impossible in the eyes of those august upper-classmen. Not- withstanding all this, as freshmen, the class of '31 had the distinction of being one of the most outstanding classes to enter R. J. R. Hi. With Fred Sheetz holding the reins, we galloped tempestuously over the thorny road of our first year. The seniors were vanquished by a hard-working debating team, composed of L. C. Bruce and Helen Davis, who carried the decision of the judges unanimously. Later, in the spring of the year, the same two, together with Paul Mickey and Ben Trotter, participated and conquered in the first freshman triangular debate to be held in R. J. R. Geometry! ! Oh, what that one word embodies to us. Awful-the trials and tribu- lations that seemed to have found their' way amongst we poor struggling sophs-who were supposed to be terribly sophisticated. We know now why Sophomores never do anything. Geometry makes temporary imbeciles of them. Clarence Watson showed us the way out-as good presidents do. Be a junior! Ranking first in scholarship, our class sailed along under the guidance of capable Fred Sheetz once more. It was here we began to find out what it was all about. Four of our number took parts in the contest play Death Comes to Sonia. Ruth Cumbie took first place in a state piano contest, as Isabella Hanson did in the State Short Story Division of a National Contest. At this time we knew our way about, and had realized that teachers were human. We began to join creative oranizations-and also-more or less-to date. Our Junior class play, The Poor Nut, We decided a success. In our very last year, however, we became the much envied leaders, as we had so long desired to be. L. C. Bruce was elected president of the Student Body, and Brooks Bynum president of the Senior Class. Over half a score of our number became National Honor Society members, and eight of us were admitted to the National Quill and Scroll Society for High School Journalists. Elizabeth Grey became the editor-in-chief of Pine Whispers, and Isabella Hanson the editor of Black and Gold. Fred Sheetz won a scholarship, and Isabella Hanson was a co-author of the contest play winner, East Wind's Spell. The varsity debating team of this year was com- posed entirely of seniors, and both negative, Slade Hardee and Brooks Bynum, and af- firmative, Helen Davis and L. C. Bruce, won the triangular elimination debates. Our ship of state, at last entered port triumphantly, carrying the class of '31, its colors at full mast. There had been rough wind and fair, calm times and thrilling. And here we are--on the eve of departure. Our grips are packed-our tickets are al- ready purchased. It remains with us as individuals, whether we shall be the masters of our fate. K hands for the unknown. Our history hasn't been like that of the Knights of Old, but when we ' atm. '5 --HELEN Davis, Historian. Page eighty-six , ,,, E 6 AND ' W . f .. .e X , -eg BLAIR. A601115 ef STATISTICIAN,S REPORT TATISTICS about themselves are probably the most interesting memoriam xx' the Seniors could leave behind, for in this matter-of-fact age, we refuse to believe anything until they show us. The following compilations are as accurate as is possible to obtain, in view of the first fact that many Seniors - 1, . i have a sense of humor and contribute outlandish answers. . '-I - The average age of the senior class is seventeen, the oldest being twenty- one and the youngest fourteen. The total number of years is 2,463. The weight of the senior class is over ten tons, 20,749 pounds to be exact. The average weight is 144 pounds, the heaviest member of the class is 185 pounds and the lightest member weighs only 70 pounds. Eleven thousand two hundred and sixty-eight inches is the height of the senior class or nine hundred and thirty-nine feet to be exact. The Empire State building hasn't much on the class of 1931. Either the Seniors are very undecided or want to know a little bit of every thing, for 62 of them take a General Course while those ambitious young stenographers come next with 36 for Commercial! . Industrial Arts isn't so popular for it hasn't but 1. It looks like there aren't any cooks or house-wives coming from the senior class this year because only two are taking Home Economics! Woman suffrage? Some very frank and husky person states that he wears a shoe No. ten! We are inclined to doubt that, while the statement that anyone wears a 2M is beyond belief. Usually they are truthful though, and average around 6 or 8. It seems as if the Seniors tie in the dates of their birthdays. The 11th and the 12th are the most popular days, the 3rd, 9th, and 16th, 19th, 23rd, 28th, and 29th for third. Every day some person has a birthdayg but most days three or four become a year older. Blue eyes lead among the Seniors. Big blue eyes, dark blue eyes, baby blue and blue green. Next comes brown. Then green and gray, and last and least, hazel, with 5. One Senior declares she for hej has just cat eyes and still another zane gray while one seems quite undecided with gray green and brown mixedf' Kitty, and Dot are the foremost nicknames. Of course there are Fattys and Skins, and now and then a Baby, but the most characteristic we find to be Half Pint. What an ambitious group of Seniors. Over one-half of them walk to school. Others drive, they don't say what. One Senior was enigmatic enough to claim the 7c taxi as his constant means of transportation. Thirty-three members have selected the Ford as their favorite car. Now who's going to make fun of the little tin lizzie? Next to the Ford they have chosen the Chrysler, and then comes the Buick. One tried to pretend he liked the Rolls Royce, but we ask him, where's lac seen one? Many are the favorites when it comes to popular songs! Someone says his Hurt,' to Whom it May Concern and then adds What's the Usef, Many declare 'Tm yoursn and You'se de One I care For. A few are Minding My Business but others are interested in the Sweet Mystery of Life. One mournful person proclaims his fav- orite to be the Funeral March! Zut,', Mamma! , My Cow,', these are the favorite sayings of the dear little Seniors. Then some of 'em like to say Dry up and blow away, l'Do it like a dog, Hot pups,', Squirt-toot. One seems to be very humble, for his favorite saying is, Well I'1l be a monkey! . L0 SY u .B iih: :Mau V Y Page eighty-xr van Q' ' , c ' 6 AND - N ' e ns b ' A . 1 919 s. rm Who doesnit believe High School kids are love sick, especially the Seniors? Over twenty-five per cent of them confessed enjoying a love novel more than any other type of book. And after the love scenes they will read adventure and mystery. One intellec- tual Senior actually admitted reading and enjoying Shakespearian books! They seem to be divided between three sports: football, swimming, and tennis. Then of course there's one per cent of the class favoring skating, and two voting on soc- cer. Soc-her-girls! There are 33 different phases of school life that the Seniors prefer. Lunch comes first. CIS that why they weigh 10 tons?j Then others prefer study halls, club work, home-room programs and of course, sports. Some enjoy the dreaming part-and others closing time. Would you believe it? The favorite author of the class is Shakespeare! Richard Halliburton holds a great interest among them too, while Poe, Dickens and Zane Grey are close competitors. As to the matter of favorite subjects, you will, indeed, be surprised to learn that History takes the lead with 29 Votes, while English comes close behind with 23. Typing was the next highest and received 16 votes. The Deserted Village, If, Trees, When Earth's Last Picture Is Painted, are the most popular poems. Who says the youth of the land is going to the dogs? Not with these poems in their hearts! But speaking of classics, exactly one-half of one per cent of the group voted on Little Boy Blue as their favorite! We just dare someone to accuse the Seniors of not appreciating refined architec- ture! Their favorite hangouts are the Shakespearian Garden, the Amphitheater, and- Hanes Field! The others-more nature minded, of course, chose the Pines. Next to people, they like reading-that is, the largest per cent. Next comes danc- ing, football, and music. The boys seem intent on camping, listening to radios, and finding arrow heads. The girls read, go to the movies, and-believe it or not, cook! The favorite animals would make a zoo-and what a zoo! There is everything from a cat to an elephant! The dog is the favorite domestic pet, while among the wilder species comes the monkey. One vows the June Bug is his favorite animal! Qlt must have made him buggy for authorities say a bug is an insect!j Another stated a zoozoolove to be his favorite, poor thing, does he believe in evolution too! The favorite fruit seems to be the orange with the banana and apple running a close race for second. One Senior actually likes onions better than anything else. We wonder if he reads the Listerine ads? Strange indeed are the favorite amusements, but true to life perhaps, for necking, flunking, arguing, dating, and new crushes lead the list. Some are more learned and prefer typing, parties, music, radio, and ladies. The most logical, perhaps, is eating. Deary me! Who would ever have thought it? Forty-three different teachers are the favorites. You could never guess so I'll cell you the highest-Miss Margaret Lumpkin was perferred by ten and Miss Mary Wiley and Mrs. Beaman by eight. And it is also safe to be deduced that many of these senior girls are going to be in a bit of a Hx later, when only two have studied home economics. The instinct has become a science now, and must be studied! And the Seniors have been well trained, assuredly. There is nothing either frivolous or crude in the poems they choose as favorites, and their choice of subjects, History which is usually proclaimed driest of all, shows one the serious minded side of the aver- age student. -L. C. BRUCE, Statistician. Page rigbfy-rigb! gg G AND A I its in r LC VI ' 4 I Dsi- I , , ' M ,e ga. EF .. L , e , is .5 5 LAST WILL AND TESTAMENT CLASS OF JUNE, 1931 Q3 ic, E, THE CLASS of Nineteen Hundred am! Thirty-one, wishing fo express our r I appreciation to those who hate so diligenfly worked with us and taught us, and who have been asvouaferl wzfh ut do 'solemnly bequeath the following: K M . ' . ,ig I , K ' , A , , I 5 I if. . FIRST: To our dear Alma Mater we leave our love, gratitude, and appre- Q,f'7 ,,F ciation of the years we have spent here. SECOND: To Mr. Moore and the other members of the faculty, who have worked with us, and pleaded with us during the four years of our High School career, we offer our most sincere devotion and gratitude. THIRD: The Senior Class wishes to leave to the Junior Class the pleasure of trying to use their Library Passes for Hall Passes. FOURTH: To the June Class of '32 we will the center rows in Chapel, that they may have the pleasure of being near Mr. Kutschinski's Jazz Orchestra. FIFTH: The June Class leaves to the on-coming Seniors the task of persuading Mr. Haltiwanger to buy a cow, so that in the future there will be no falsehood uttered on that subject. SIXTH: To Louis Shaffner, Fred Sheetz bequeaths his scholarly ability. SEVENTH: Upon Louise Taylor, Sarah Taylor bestows her most unusual Sweetness, EIGHTH: Horse Isley wills to anyone who has the desire to possess them his crutches and fuzz, NINTH: Frances Sim son wills to Laura Crim her ueenish Looks, Wishin that P g Laura will care for them as she has. TENTH: To Henry Wimbish, Slade Hardee leaves his good looks, and his ability to be well dressed, in order that Henry may carry on as the High School sheik. ELEVENTH: Dena Newton bequeaths to Beulah Saunders her winning ways, hop- ing that she will get her many wants. We do hereby appoint Miss Ruth A. Ford as administrator of our estate. This appointment is made in consideration of the excellent management she has given us throughout our last semester and our graduation. In witness whereof, we, the Class of Nineteen Hundred and Thirty-one, do set our seal, this, the day of june fourth. fSignedj GILBERT TILLITT, Testator. Page eighly-nine fcQ'B AND Q x Ay Ai Q. Q E A c ' N . I Y ei LAUQL i Ulug h A I V :i?'Ei1r.: 4' Qc I., S. -4-- , X MY PERSONAL SCHOLASTIC RECORD English ..,.... Public Speaking Latin ....,.... French ........ Spanish ....... F rvsb. Sojzb. I 11 uior Senior Algebra .,,............... Plane and Solid Geometry .,.. Trigonometry . . Arithmetic ,... Civics ........ Ancient History Modern History U. S. History .. American Prob. General Science Biology ...,... Chemistry ..... Physics ..... Bookkeeping , . . Com. Law . . . Shorthand . . . Typewriting . . . Office Practice . Cooking ..,... Sewing ......, Dressmaking . . . Millinery . . . Vocal Music , . 4 Instrumental . . History of Music Harniony ..,..... Physical Ed. . . . Woodwork . . Metal Work , . . Auto Repair . . . Mechanical Draw. Printing ,........ Art ......,... Band ......... Business Methods Citizenship .... Fountain Service Home Crafts .. Journalism .. Orchestra ,.... Salesmanship . . . Theory ..... 'V ff AND Q- QVLL ix A Q I 3 IZBPG Page ninely-one 12APG 553414 'Wifi' U ' ' .. yqdfwy :naw 'w 1 . NI SENIOR CLASS-11B SECTION JUNIOR CLASS-10A SECTION if x SOPHOMORE CLASS-9A SECTION R 4 ' N I AND ,A ' . .- if 1 414 .4 I , BAG0x-D Q. ff- f 'fyao cf - , bfi. X ' All ff ff fl. Alf' i mK ,N - 2 92- - ., B'Z Z' 22 N5 B ' 8'2'? JUNIOR CLASS-10BL1-10BL2 SECTIONS 5'-'39 mn ww SOPHOMORE CLASS-9B SECTION P g 1zinr'ly-fire , ANU N' 4 IJ fs' 4 A A gig FRESHMAN CLASS-8B SECTION MY HALL OF FAME fAz1iograpb page limited to fresbnzmz friends alormj Puge ninety 1 N , UV 'ffm' 'og 4' WF Labor A Wi Z AN 0 XM' C g W' ffw .2 , f H 6'f,f'W',V - V f. l f ,f pf K' E f,f.J4f5cf. Kf 4 4' aq e fnxkfumo MN f 0030 SEQ? f 'LJ f'j':'p9L I' 1 71 uiggwx, 7, 9 se' lg x ff'W I E.. 1, 551-:gi l x ,, , 447221 V lilw ,g ,,,3 :GJ 1 .N : Ll 1 Eg i fiiff M iaafiw Ti lgi' ' J TZ 5 If A 451 f fl '-i '13 f - 13 i i i if -.. ,gg-N Pgc STUDENT COUNCIL B. , ATIVES SENT E HOUSE GF REPR 'U E on Q 2 -. : 11 -. KF E. oi. .. -. WWAWV ,ff 02, jE7f-M24 XV MELA Q All WY' ,.uf55?'94'4!f A -f- -1-JG g M A BLACK AND GOLD STAFF P g eiy-n R Isabella Hanson Dorothy Clay Margaret Long . , e lla I' ll l 1 C49 5' S. fr. , 1 ' I 6 fl. ,- ' -H ii.: . .ET-:5f4f.T. 9.f' 'Q . fc ,L,, L, se- x-. A .G ,,, ,552 BLACK AND GOLD STAFF Mazie Spinks and W. G. Jerome . . Dorothy Clay and Wellington Dunford . Slade Hardcc and Elizabeth Jerome . . L. C. Bruce . Mr. W. D. Perry Mr. C. R. Joyner Miss Bess Ivey Cowriunurons or Tms YEAR: SHORT STORIES . Edilor-in-Chief . Managing Edilor . . Class Ediiof Organiznfion Editors . Feature Editors . . Spark Editors . Business Manager . Liicrary Adviser . Business Adviser . Business Adviser Dorothy Clay, Hope Best, Freida Blumenthal, Isabella Hanson, Foster Dowdy. Margaret Johnson, Mary Louise McClung, Ruth White, Margaret Long, Jean Cantrell, Wellington Dunforcl, Russell Holt. ESSAYS. SKETCHES, AND ARTICLES Elizabeth White, Voit Gilmore, Feronia Prodremos, Elizabeth Steadman, Adelaide Trotter, Dorothy Lashmit, Elizabeth Jerome, Betty Hopkins, Carol Glenn, Janet Grey, Elizabeth Sheetz, Wellington Dunford, Elizabeth Grey, Beverly Milloway, Louise Blum, Slade I-Iardee, Isabella Hanson, Fred Sheetz, Evelyn Poole. POETRY Roscoe Wall, Dorothy Clay, Isabella Hanson, Sara Ingram, Routh Nash, Wilda Stack, Ruth Ausband, Charles Eaton. ART Joe King, Gilbert Lee, Marjorie Mendenhall, Gilbert Tillct, Foster Dowdy. PLAYS, INTERVIEWS, DEBATES, ETC. Jean Cantrell, I., W. G. Jerome, I., Joe King, P., Charles Eaton, D., Ruth Ausband, D. ummm:nnnmmumnimn Elizabeth Gray Jean Cantrell Margaret Long Fred Sheetz . Mary Garber Mazie Spinks . W. G. Jerome . Agnew Bah nson . munnnmnunIannunIIun1nmnmmnununu PINE WI-IISPERS STAFF EDITORIAL STAFF BUSINESS STAFF REPORTING STAFF ni IIInumunIIIuIuIuunnavufiIinmlmumm1niimr-ninIiiniIiInnIInnn.unnmnmm .mnnmmnnmluII1luuwnmmmmlmmini . Edilor-in-Chief . Managing Ezlilor . Assorialc' Edilor . Sjiorfs Editor . Exrloange Editor . Alumni Editor Ojmu Forum Editor . Business Manager Elizabeth Jerome, Emily Lee Linclenbergcr, Margaret Johnson, Elizabeth Stcadman, Dorothy Clay, Virginia Wimbish, Wellington Dunford, Isabella Hanson, Evelyn Joyce, Routh Nash, Barbara Dee, Rachel Dunnagan, Helen Bailey, Nancy Skinner, Roscoe Wall, Virginia Walker, Eloise White. Ju mon STAFF Ruth White, Ruth Ausband, Mary Lou Weeks, Mary Anna Ross, Billy Woodruff, Charles Eaton. Tvmsrs Esther Roush, Ida Wlodiiiger, Beulah Poorc, Louise Stewart, Ella Mae Tuttcrow, Doris Nichols, J. E. Hutchinson. CARTOONIST Foster Dowdy. Anvexvrrsmc SALES STAFF Charles Blair, Anne Vaughn, Dorothy Tutt, Francis Willingham, Louis Shaffner, Mazie Spinks, David Holton. Page one bumlred M Bl S LD 4 1' ff 4 AG Q I lf- :I fi Lo LL ' -ff a SQ Q X IT 3421 92154 ,-4,1 ff - 2 1421... Q, X xmas ,x iw? A '53 N Aj M ANN 3 ff If i -5 ff? m'1X 'KN iff-'R Qi Q yLjJ pm M88 lu ' him y R Agp! D , ,, ,'q N F Wlxrk N ' 0 ma? - ,ff W '-x .5!,Lkw-,'? Pg 1,111 PINE WHISPERS STAFF nu. fi G ' N . x M, f AND P L? , 454 B'-ADV j ,, .QGm-Dix ' . Q,,', nil'- K ..- , r-. ff 49 1 g P -.::!' I-Jig 5 ' - eLnuL A Q 9.22.52 f , iz ar FIM' ' 'fa 0 7 1-,.-- Q ' lr., Y I -U -- gf, Q +z- 3' .. , U 1 , , :Aw-..l. -16,45 , .!.'ffy -- jilhy ftvllfgr ,L TQLW 'I . , ' 1.1 , . -. I ii '93 :Alt 'H 5-721 241, fm-Ls, .,' -1. -,w 'n.: .. , '1 -'. 1,..T ' '!. ' - x. - -H - QUILL AND SCRGLL' NATIONAL I-IONORARY SOCIETY Page one bmm'rml Iwo ff n 6 A U 3 N X if Q Bll-WL mum Q ,. C . J ,.- -' Q S Q 'if 7:4 9 Q ' pg, .5 -f 9 X4 Q Ann- ..4-r -3:53521 fl '94 Ng, 'Q k, xx KN X 5 X 4' fiy 94,0 jr- Qi2SX,b,A.m-QSX , NATIONAL HONOR SOCIETY Prgc one hundred lbrce I5 f 6 Ano ' e I A ie, 5 -xg BLAIIQL A ,QGlllDj. 4 J gg-I rif e. A Q Nix ,513 VARSITY TEAM AFFIRMATIVE NEGATIVE Helen Davis Slade I-Iardee L. C. Bruce Brooks Bynum COACH-MF. Ralph Lewis QUERY: Resolved That: the Philippine Islands Should Be Granted Immediate Independence. Page one hundred four .arf u s I Ano N . , 1' ,L - , LQ' '-I Gn u I 1 51, , CALVIN H. WILEY LITERARY SOCIETY LIBRARY PAGES PQ lrldfi vgs pmcpuuq auo 28:14 .1, s -' J fl.-25: ff ,- . .,.,, 9' l. , V 45'-,ff fy-- ,-Q! .4- . 4,J'f- ',.-' - 1 1 4 , . Af' , ,wwf X .-cl. 5 HIGH SCHOOL BAND HIGH SCHOOL ORCHESTRA fi J5 1i f' --1 -, -- - . - -Q -fm... , , , ,,-. :,., ff 4: -5 Q94 dfQf,-X.-f efsfi, aff ff? 1 ' fwfr MIXED CHORUS E f 6 ANU f ' ' 4 A is 5 14- 223,-. f 5 -f 2 QQ. 125- 35 A - N Q' X? L fl! 'LB' . , M., , ,-,gf .viiy Q, - , v - .a up- q -'v' f ga' ,-Q .,-V . f:-5 1 - 4 wa ' - nuniw' I My fs 5:3 4 ' fv- zx , SI-IORTHAND TEAM Pg had TYPING TEAM -f f Ano 4251: 4 1' X Du - V .Sb y 43 Quay!! ' '44 - . PLAYWRITERS' CLUB rl frh E ' 6 AND ' Q' f 1 BLA Gillu ul 1, Q4 A A K4 , X B X 4, A .1 fy 6 , I , ,- , 241. J, -fC f C - ,ai 3 Xb .ahh ' 'f'g.39,.ff, fp A-,sf pzwxiil-wissiixx 4-mir QQUTH iNAC.5H - LlLA MAQY MQRR16 5-lADDY'6lLDLI2TTlX.LUT 4 KNXWX .M 155: fri? . ' Fw D 2? Y N 1 1 n 22 HENRY 5-5512? ,Ll 2' 7 A, Q 1' 4 532 1: Pg ldll THE EAST WIND'S SPELL WIM , AN ' D - 53:5 1 .. .sf or AWAVN X WINSTON HI PLAYERS Only those who had shown interest in dramatics by aiding in play-production were eligible for membership in the Winston Hi Players this year. The Club adopted a constitution and candidates are put up for membership at any time during the school year by members. Captain Applejackf' the first play of the season, a blood-thirsty and thoroughly picturesque three-act drama, revealed new talent in the dramatic field. The Circus Phantom was an original one-act romantic thriller, blessed with an all but perfect cast. It would be superfluous to discuss Death Comes to Sonia. The play had Sl good press agent, and it took Sonia a long time to die. Jasper was a scintillating and brisk comedy, also original and one-act. The East Wind's Spell is the first of its type the Players have attempted to pro- duce. A one-act fantasie, with three negro characters. It was coached by the Player's sponsor, Miss Hessie Watts, and Mr. W. D. Perry, and won state championship over Asheville in March. OFFICERS Fon THIS YEAR WERE! FIRST SEMESTER SECOND SEMESTER Slade Hardee . . President . . . Brooks Bynum Charles Dunnagan . Vice President . . Jacque Gwynn Reid Nunn . . Secretary . . . Isabella Hanson Brooks Bynum . . Treasurer . . Slade I-Iardee Page one hundred twelve R , ,ag , f L 1 , -4 AND Y x , , ln, b I5 , Q4 I-MK S60 A 1315 4 .f 6 ' , A . 9 B22--f- L-f - 4:6 ga .P ix .X A x Q xiii M533 ., .A-1. 1 1. I ...l,- .......,.. , E A SENIOR BOOSTERS 3 6 W!fI? l ni- -T I lad A ' plush Je' Ig 111111 FRESHMAN BOOSTERS ' f ' Vf'354'-Bk ' ,,35'f'N 1 f , QM r . - . 5,-Q. . ' , SENIOR HI-Y E I 4 AND ' N N Av f 4 s L 3-5 I -Z, ,A Dj. er' . , . J .in fi x a t S are gl- X3 THE HI-Y OFFICERS Fred Sheetz . .... . . President Lester Morris . . Vice Prcsidcnf Ben Trotter . . . Srrrelury Julian Boyles . . . Treasurer Mr. C. J. May . .... Leader Mr. Ralph Brimley ............ Facully Advisor Mr. R. M. Warren ............ Faculty Advisor Once more the Senior Hi-Y brought to a close a most successful year. Each Thurs- day evening the members met together for dinner at the Y. M. C. A. where the boys of the club were brought closer together in beneficial fellowship. The policy of the organ- ization this year has been to secure an outstanding man of the community to speak at each meeting. Many activities have been undertaken by the Hi-Y, one of the most important being the raising of funds for the extension of Christian work in China. Eight of the members were sent as delegates to the Older Boys' Conference held in Statesville, North Carolina, on December 5, 6, 7, 1930. With the club as sponsor a successful Sunday afternoon mass meeting was held on February 22, 1931, for the young people of the community and brought together about four hundred boys and girls. Dr. S. D. Gordon, of New York City, was the speaker for the occasion. The social phase of the club was effectively carried out by two enjoyable parties, one at I-Iallowe'en and the other in March. The principal event, however, was the annual Christmas banquet held at the Reynolds Grill on December 29, and the climax of the season was reached with the yearly hay ride in June. SENIOR WIDE-AWAKE GIRLS' CLUB Page one bnmlrccl fifteen 55 ANU I ., ,. N f 4 '9 . ' I A x eree I C LEC 5 ? R l . . JUNIOR HI-Y CLUB FIRST SEMESTER OFFICERS John Johnson, President Bill Womble, Vice President John Wiggins, Secretary Jimmy Coan, Treasurer Bill Hylton, Sergeant-at-Arms Ellis Ashburn Crist Blackyvell Albert Butler George Bynum jimmy Conn Wallace DunII Richard Flynr Jimmy Glenn Robert Helm, jr. Bill Hylton Delma Johnson Sponsor- John Johnson Walter Johnson Ashley Little Charles Mickey T. A. Apple Bobby Brown Jack Clayton Joe Currin Carl Dull Bob Edwards K. O. Frazier SECOND SEMESTER OFFICERS Clarence Speight, President Bob Edwards, Vice Presirlent Robert Helm, Jr., Seeretary jimmy Glenn, Treasurer Gene Vogler, Sergeant-at-Arms Mr. Ralph Lewis ROLL Henry Stokes Andrew Sutton Voir Gilmore joe Martin Baxter Moore john Ogburn Allen Pcrryman Harold Plaster Tyler Port Lawrence Reid Bill Roberson Clarence Spcight Joe Tolley, Jr. Oscar Tyree Gene Vogler Folger Watson john Wiggins Bill Womblc Henry Nading john Simpson Page one bumlred sixleeu 1 E 4 AND ' I , R i- ' . 3 ' -i . M - ec ir. A affi ART CLUB The Art Club has done much for our school and deserves much praise. Elizabeth Jenkins won second place in the Dramatic Club state poster contest Joe King took first place and Elizabeth Jenkins second in the book week poster contest The club meets on the second and fourth Thursdays and study famous painters, architecture, and drawing. An important annual activity of the club is the Parent's Night Art Exhibit. At this time the parents of the students are enterta' d b .lk me y ta s on art, sketches and art work, This work is done by members of the club. The club has made numerous posters advertising the plays and other entertainments given this year. OFFICERS FIRST SEMESTER SECOND SEMESTER Dorothy Lee Stewart . . . Presidenf . . . . Ann Blanton Elizabeth jenkins . . Secrciary a-m1 Treasurer . . Elizabeth Jenkins Miss Marion Leiger, Sponsor Pagr om' hllmlrerl SC'L'l'1lf!'l'll 'Iii 1 R AND 4' ' GK y E. 'E t 5124 i n Efe E ,-Fr: 3 ' -C315-:T ' A Ab.- asv? rilaiia!Q? .1 JUNIOR WIDE AWAKE GIRLS' CLUB Fiusr SEMESTER Celeste Brewer . Jean Patterson . Flossic Shelton . Gladys Shore . Isabella Vaughn Jean Patterson Helen Diehl Katharyn Keiger Celeste Brewer Mary Lois Moser Ruth Lee Bessie Lineback Eloise Baynes Mildred Barnes Mozelle Spainhour OFFICERS . . Prcsidcnf . . Vice-President . . Secretary . . Treasurer . . . . Reporter . . . Sponsor-Miss Garnett Kelly Ernestine Martin Wilda Stack Rowena Tesh Catherine Brandon Gladys Shore Grace Payne Margaret Bennet Mildred Jones Margaret Vick Ruby Disher SECOND SEMESTER . Oreon Adams . Mary Lois Moser . Bessie Linelmck Mary Enid Boyles . . Ruth Lee Alma Cline Oreon Adams Mary Enid Boyles Flossie Shelton Annie Sue jones Lillian Loggins Carrie Lee Loggins Bernice Mclver Edith Thomas Bessie Mayc Burns Page om' bllflllffd rigblrul AND , Q ' 2 nm li ,Q my , S QL 5 E325 2 L 111- Qfo C I 71 .N , A-fix 'Y .L Hagar 1 lf' N 13 G-HI F MVS4' -'rf'!SrD1'2-1s ff-ff-'ef A R- ' - if , L .-4. jf: ., . ., V ' P '11 -, , ,-vw T, 9 1-fx JUL' . ',l fL f., 1, H ' , s 'L. ' 1- ,--iuk'1:1mA ,Q:: , 'N .mf Page one bumlrml 11im'1ec'n CAFETERIA CLUB 1 f AND ICCZEXL Q 1 'ro-my 5 PECIAL GIRLS' METRIC SCIENCE CLUB K ME'I'eR faoa GR , x C'-We ' '9 75: h' sfevf' '000 fvfzafqsrf 'WGRW BOXIS' METRIC SCIENCE CLUB Page mu' bumlrcrl humly AND A GX a a a i n Q es C141-f-,RL ' . e g Q. fi ORGANIZED APRIL, 1928 METRIC ' SCIENCE UN U79 FALL OFFICERS Julian Boyles, Presidemf F. Willingham, Vice President CLUB Paul Barnes, Secretary Harold Brown, Trcuuzrer F. Clingman, Reporfer Wade Britt, Srrgeunf-af-Arlzls SPRING OFFICERS Wade Britt, PTl'Sil1C'77f Bob Lindsay, Vive Prc'5ia'c11f W. G. Jerome, Jr., Sc'crf'iary Hugh Davis, Treasurer Thelbert Nicholson, Reporfm' B. C. Hall, Scfrgmnf-az'-Aruzs Purpose I-To create an interest in science as a profession. II-To give opportunity for expressing scientific facts. III-To spread throughout the school and community a benevolent appreciation of science and the Metric system of weights and measurement. GROUP I from two? 1-W. Hollingsworth Caplain 2-Harvey Barnes 3-F. Clingman 4-joe Ferguson S-Huge Hamilton 6-Gaither johnson 7-Louis Scliaffner 8-Robert Eisenberg 9-Braxton Younts I0-Edgar Britt MENIBERSHIP R GROUP II fron' lbrcel I-Bynum Nifong Captain 2-Garland Bost 3-Allan Little 4-Seth Muse 5-Williani Tuttle 6-D. Whiteheart 7-Billy Woodruff 8-john Fulton 9-Ashley Little 10-George Stoney G OUP III frow fonrj 1-Harold Brown 2-James Cofer 3-James Diehl 4-Ed Guerrant S-William Vinson 6-J. B. Goslin, Jr. 7-Fred Sheetz 8-Paul Sheets 9-Francis XVilIingham I0-Roscoe Wall, Cuplain GROUP IV Krozu j'iz'c'J I-Robert Bradford Capluin 2-Clyde Crutchfield 3-Paul Barnes 4-Harvey Dixon 5-Henry Berger 6-Wm. Chambers 7-Hubert Warren 8-T. D. Williams 9-julian Boyles I0-Harry Roush R. M. Warren, Sponsor ' GIRLS, Q E METRIC 'I-'l 'l 'k SCIENCE CLUB Isabel Denny, President . Meta Hutchison, Treasurer Julia Hall, Vice President Gfgalllled June Williams, Reporter Mary Carter Nooe, Sefrtffary Feb. Martha Nance, Scwgvani-uf-Arms '31 CHARTER MEMBERS GROUP I I GROUP II GROUP III GROUP IV 1-Lottie Mae Brewer I-Martha Nance l-Bertha Mae Weeks l-Cleve Wharton Capfuin Capfain Caplain Captain 2-Jeannette Kelly 5-Naomi Bodenheimer 4-Vera Fetter S-Grace Moore 6-Margaret Ross 7-Matro Moore 8-Katherine Reavis 9-Ruth Davis I0-Olivia Kearns 2-Marguerite Charles 3-Bessie Mae Burns 4-Martha Britton 5-Grace Hart 6-Althac Johnson 7-Dorothy Early 8-Mary Brendle 9-Winnie Swain 10-Margaret Vick 2-Ruth Williams 3-Mildred Chambers 4-Evelyn Cobb S-Gwendyln Hyatt 6-Florence Kilgore 7-Gaynell Yarborough S 9 10 Ava Lee Andrews Page om' bnndrczl iwrnly-one '-Ila White --Elizabeth Sampson -Nellie Caudle , Sponsor 2-Doris Morris 3-Lillian Crater 4-Betty Alspaugh 5-Catherine Smith 6-Pattie Stipe 7-Marguerite Ferebee 8-Francis Sharpe 9-Alma Cline IO-Mary Anderson Q L fs I 4 , L L , ff gk Q6 ,gi z.L K t ,ff fy cc h A Q '- 'T .. f ,1 ' k - - N B , 14:5 V':2L- ,-- -- J. Alf' il f Yi. Ti. -1 1 ---1 ----...::'--1---m E-347212: TI 1-':.'::-.eil ' ' - -.-.1......... D ..... -...-. Milf LITERARY AND DRAMATIC CLUB USHERS' CLUB pg 1,111 'J' 5' B C AND 5 ' L. 3? 91 L 0 K 45 - 4' I i mf' : l S i Z J.-Q2 'ii'-, 1. . FORUM The Latin Club, or Forum, organized in 1925, has an enrollment for 1930-31 of twenty-five. During the first semester, Maurine Perryman served as president, Ina Wagner as vice-president, Baxter Moore as secretary, James Hutchins as treasurer, Mar- garet Schwarze as reporter, and Mabel James as chairman of the program committee. The officers for the second semester were James Hutchins president, Baxter Moore vice- president, Mary Lucile Pegram secretary, Naomi Clarke treasurer, Alin Perryman critic, and Maurine Perryman reporter. The vice-president served as chairman of the program committee. At the first meeting of the Club it was suggested that the members hand into the chairman of the program committee topics in which they were interested. As a result of this most of the programs for this school term have centered around Roman life and customs. As one purpose of the Club is to gain a more thorough knowledge of the Latin language, and a better understanding of the cultural and practical value of Latin, a few programs were devoted to a discussion of the spread of the Latin Language, and how it is of value in practical life today. Page om' bumlrnl lufcnfy-lbrvr' E 4 AND f x ' - BLA sill . I A - 5? ,Q gk 5 DQ 1:35, .1 M 1 Q 1- giaitzkz. -f ,,,2 fl. HE 2-Pas? 'mea BEANS FAR'-BY-VU'FR'AI'lZAY? U mn-Eg MERQX Qfag VOYI wEE J WEE! 5'1Lv . ,g- Af ,-.H-4-4573415 -main-I-A Y 5' Y , :fALap-'fs'-A - : e...-5:Lt-.-M.. , ,y 4 , A y.,,.v,,, , , Q , X ,. , -I-gg. . -, , ,. A . , , . ' -' . ' ' ' 1 -if Y J - ' : ,4 ' . . ' 4. A .f ' . , . 5, 4-aw.,-' , ,4 1, I 1 . Y fn - . b ' x. A '54 -,L Q--gs' , J K . , ,Y D - X F , --' FRENCH CLUBS f x f CHEERLEADERS P gc our bumlrrn' lxwnly-four 5. ' D3 'F' Zu What Price Glory? 3 I Wfinston-Salem Winston-Salem Wilmston-Salem Winston-Salem Winstoxx-Salem BOYS' SPORTS AND SCORES . 03 Barium Springs . . 0 . 19, Lexington . . 25, High Point.. . 0 . 12: Gastonia . . 0: Charlotte . FOOTBALL XVinSton-Salem . . 9 Xvinston-Salem XVinston-Salem . . . 7 Winston-Salenm . . . 0 Winston-Salem 46 32 28 0 26 Spencer . . 7 Mt. Airy . . 0 Asheville . . 6 Greensboro . . . 2 Salisbury .... 0 TEAM: Rothrock, Carter, Chris, Owen, Hardee, Voss, Sicwers, O. Smothers, G. Britton, D. Holton, W. Holton, Isley, Cornelius, East, Plaster, Raper. Allen, Hawn, Moore, Coarhcsg Morris, Blair, Managers, Leggett, Haltiwanger, Srrnlu Coaches, 16 22 20 31 16 25 24 36 32 Voss, Holton, Coaches. ' BASKETBALL Winston-Salon: . 16: Rural Hall . . 20 Vlfinston-Salem W'inston-Salem. . 8, Gastonia . . . Z2 Vlfinston-Salem XVinston-Salem . 32: High Point . . 18 Winstoix-Salem Winston-Salenm . 19: Gastonia . . 29 Wfinston-Salem Wfinston-Salem . 14: Greensboro . . 13 W'inston-Salem Winston-Salem . 30: High Point . . 28 Winston-Saleiix Winston-Salena . 14, Charlotte . . . 44 Winston-Salem Winston-Salem . 243 Yadkinville . . . 30 XVinston-Salem Winston-Salem . 12, Greensboro . . . 17 Wiiaston-Salem SQUAD: Captain, Cornelius, Atkinson, Holt, Brunt, Daurenheim, Allen: Manager, Smothers, BASEBALL Winston-Saler11 . 14: Boonville . . 8 Winston-Salem Winston-Salem . 295 Thomasville . . . 2 Winston-Saleiwm XVinston-Salem . 5: Mount Airy . . . 0 NWinston-Salem . 4 . 10 6, Smothcrs, johnson, Sapp. Buchanan, Wells, Midge! Lexington . . 20 King . . . 26 Yadkinvillc . . 22 Salisbury . . 17 Charlotte . . 47 Salisbury . . 19 Mt. Airy . . 29 Germanton . . . 14 Welcoine .... 24 Snead, Lineback. Courh, Mount Airy . . . 9 Carolina Freshmen . l7 Yadkinville . . . 5 GAMES TO BE PLAYED: Reidsville, East Bend, Greensboro, Charlotte, Gastonia, High Point, King, Wallburg, Yadkinville, Boonville. TEAM: Carter, Voss, Holton, Tise, Hayes, East, Daurenheim, Cornelius, Reid, George, Atkinson, Scarlette, Newsome, Tuttle. Coach, Joyner, Managers, Haberkern, Frazier. TRACK Wiimston-Salem . 47: Greensboro . . . 60 Winston-Saler11 . 68, Hickory . . . 40 Winston-Salem . 100, Burlington . . . 15 WTHSIOH-S3lC111 . 8 5: Salisbury . . . 31 DAVIDSON STATE MEET-Winston-Salem third place. GAMES TO BE PLAYED! Roanoke, High Point, County Champions, North Wfilkcsboro, Civitan State Meet. Rothrock, Church, Wimbish, Goslin, Pagby, Patterson, Chris, Carlman, Hines, Robinson, Lanier, Kinney, Hines, Sandafur, Houck, jones, Dunnagan, Humphries, Montgomery, Smothers, Roscoe, Thornton, Pike, Allan, Patterson, Austin, Pratt, SHPP, Reid, Highsmith, Hollingsworth. Coafhvs, Brimley, Barkley, Leggett, Managers, Tesh and Sheetz. TEAM: TENNIS Mt. Airy . 5: Winstoia-Salem . . . . 4 Carolina Freshmen . 9: Xvinston-Salem . 0 TEAM: Dixon, Turner, Gerner, Tennille, Hutchinson, Siewers, Cofer. Crmrb, Barnett, Manager, Salmons. .YQ CROSS COUNTRY SCORES: Charlotte High, 15-455 Davidson Freshmen, 23-32, Elon Freshmen, 20-37: Guilford Fresh- men, 20-353 Mount Ulla High, 20-35: Elon Freshmen, 18-37: State Meet, First Place. TEAM: Morris, Kinney, Sandefur, Hines, Lineback, jones, Venablc, Hines, Jerome, Pratt, jones. Coufla Brimley: Manager, Crutchfield. GOLF GAMEs PLAYED: Winston-Salexma 66 - Greensboro 12 Winston-Salem 1223 - High Point SM Winston-Salenm 65 - Greensboro 13 GAMES T0 BE PLAYED: NVinston-Salem -- Charlotte: XVinston-Salem - N. C. Freshmen XVinston-Salem -- Salisbury TEAM: Perry, Wall, Valk, Brownlow, Nunn. Coach, Barnette. SOCCER Wfinston-Salem . 2: High Point . . 0 Winston-Salenl . 1: Catawba College . . 0 Winston-Salci11 . 3: Old Town . . 0 Winston-Sale111 . 25 Kernersville . . . 1 WTDSEOH-S3lCl11 . 3: Sedge Garden . . 1 Winston-Salem . 4: Clemmons . . 1 Winston-Saleni . 6, Union Cross . 0 Winston-Salen1 . 45 Vlfalkcrtown . . 0 Winston-Salenm . 7: Griffith . . . 0 Winston-Saleni . 9: Rural Hall .... 0 XVinston-Salem . 9: Vienna ..... 0 Winston-Salenl . 4, Old Richmond . . . 0 XVinston-Salem . 4, Lewisville .... 0 Winston-Salenx . 5: Mineral Springs . . 0 Winston-Salcima . 2, High Point ..,. 0 TEAM: McCall, Capt.: Petrie, Hicks, Austin, Styron, Farrell, Garwood, Byrd, Headen, McGraw, Hauck, Overby, McNeil, Allred, Burns, Wriglit, Robertson, Edge. Managers, Holland, Conor, Coach, ' Crowell. Page our bunrlred lzucnty-five -...-.- iq -5 L ,WM-I. .fi .' - ' A- , ....,,-..-.,, BOYS' MCNOGRAM CLUB Kiihnbli . f 6 AND N 'C L am AAATAA MA A W? Q A D325 Q , D A E. , 4 1 3 . 'iii Vg 0 C ' QQ: 5 iq Nl X L M- .L f -f ...fiif .. Af : C. GIRLS, ATHLETIC COUNCIL T' E? GIRLS' BASKETBALL TEAM P Q I I I I I3 cn 1 AND V, 1 Q N l fx 13325 Zff lv KL: SGQ DS X EP. ., ' ff - 1 .' 3 g 3 ' -i':4'1-Q.: ,A 1- ke. 9 5' 13' T Q x' Q 5121: 1 1- i NNN ff Mmmasfm uowlk ,Y in dv - ,CAAVLOF .lim Ckmu. '3 , If QAZQLSP S Q,S',If255 5 mem Base sm 3091. BP6EBtm.. em 8P-S,-wffiv-LL :::::'::r CNW :amass , lllllli J 2 ,,,.,-- ul' W . . A ' 4 '11 K I A I Q - Af? 4' I , Q y Nmine swans TE MGR- or TENNIS 7 Page our bzlmlrvzl flL'l'l1lj'-K' igbl R if 4.- c AND f N s , B 9 ns Lo ax V Q H- X f1 ,,, , q,,, A , gre .55 f I I, ,sz ,B fi ATHLETIC COUNCIL Mazie Spinks-Prrxiilwll All1lc'fir' Axsorialinll Louiic Fulton-Vin' Prznviilmll, jerry SPll'lliS'-Sl'l'l'C'lillYJ' Eleanor Hobbs-Asxixhull Sz'rrulary HEADS OF SPORTS Q Fern Shelton-Hm'kz'y Mnzic Spinks-Tfnnis Helen I'Iuber-Sm'1'z'r Pauline Davis-Hiking Margaret Ackerman-Bzlskrlllali Lucilc Davis-Training Sallie Cahill-Busvlnlll HOCKEY l'r1r1rl1: Miss Donn lfcrn Shelton. Mgr. A lu rplzt ret ,-Xrkwinati. Cu 111. Marguerite llolder, Mgr. Elm-amor llobbs Marry Ilairtness Mile liostil: lloliby llrztver M:irgui'ct Swztim llclen Huber. Mgr. Dorothy Flay, Cajll. Nunvy Skinner liniily Linclunherg Clztru Rnpcl' I.illinn Iluher Al:irgnrct Ackerman. Mgr lil:-zinoi' Hobbs. Capr. Marry Iizirtncss Allll'llllCI'llC lloldcr Saillic Cahill. Mgr. Mu rgzi rut A clacrinu n, Capt. Dorothy Aclnms Nell Blum ,loun llrookliunk 3l:ui'gzu'et t'h:n'les Munir- Sliinks. Mgr. Hill ll:irtn'css, Cujrt. Marguerite llolcler Carrol Strauss Suuzxnne Weeks Pugc um' bumlrrzf lfouist' l Dorothy ulton Knott M at ry li rn-ndle ,luirc Vl'iIli:nns I'Ia1r:L liryztn list her I ,ai wson Wuetn W Iiilc ,lerry Spinks SOCCER C'fu11'l1: Miss Tuppt Sallie Cahill Edna Fcttcr Marry Sue Eaton Betty Hopkins lfrzinces Luther .-Xnnc Simpson Allll'KZll'Cl, Huffnlz ,lcznn filllllffill Elizuheth Gray Cornelia Mzlslin .I- Ylfgilllll Fhryson Sue Yuss lll Kaltic Sue Tztylor Blanche Hutchins Mary Carter Henrietta Wuck Nlztc Short l r'um'c's Kehnun llzi. Davis I-'rzuiccs Slmrpe BASKETBALL f:lI1IC1l.' Miss Bowers Marry Czirtcr Mary lin-mlle Mai ry Lucille Pegrzxm lin C1n'neliu Mas BASEBALL C on ch : ililllil Currin Pauline Davis Lucille Davis Miss D0 Mat ry Sue Hatton liclnu Fetter Louise Fulton Katie Suu Tziylor Lucille Davis Mzwgnrct Dixon Mzwgarct Long an Ida Mae Griffin Anne Man: Hain Florence Kilgore Puulinc Lztxton Mac Short Mary Nell Stonestreet TENNIS Cmiclz : Miss Tu pper Ruth Hill Nurnni Clark Murgztrct Dixon jerry Spinks Mzn'gnret Cochrane HORSEBACK Murium Sanus Nancy Powell f1l'f'llfJ'-llilll' Rachel Aids Evelyn Gibson Mazic Spinks Mztrgarct Long Gene Carlton' Betty .Xlspuugh Lilliun Critter Ruth Hruswell lxlill'gll1'Cl Fhzirles Margaret Dixon Wilnnr Martin' jerry Spinl-as livelyn liihson Paiulinc lmris Mercecle Stryon Blanche Wuggoncr Stuart Rolpli Dorothy Clay Hilclrcth tiilliaiin Lucy Gray Snrithcrs a I 5 f AND 64,8 ll . , Q4 lA nl A 535 1 ,,, 4 'f .A SA-Q, , -' ' ' ' C ' Af' z N x ' Q'by,..2 Q. -il. IQ? 'QQ -- 'R 'lE .X GIRLS' SOCCER TE AM BOYS' SOCCER TEAM lg lllllly Y f K 4 Y in B is , Qs Blhtlsc Q scillnf. 21 - 4 -'- ' 4 . , ec Lin l-, -X i x Q Ml'E.L'?IS.l .E.'S-5 '9?'ff? 'F V V ' fl BOYS' BASKETBALL TEAM ' .. TZ' FA' -'Wu rx' 45.152, . 'F' :I'ff'T'3 '11i+12 , 1 - .- z. Q- ' 1.-117 f.-e1:'-Mfi1.,l.b.' Lf-fl-.a1sQ...gy,4-Q.: 1-'14 L'-4f,.'. ': -H' -H .. '1 , A I ,A :ew 543' we mfs iff? Wi 4 li? GIRLS, HOCKEY TEAM Page om' 1 rf d fl I3 I p I ffl! A a n A BASEBALL TEAM R Bll-T K In Q W Q x .T if lb N .M 4 V . ., Q x .7 f 5, I .f:'.,'f. bs A .5 ' I ' 1' vs ,, , I f 4 Y n 1 -- X A Q . , ng' fly ' 4' L o C - 2' af' Qi X: N Q Q , A 3 -QAM ' ,44z:Q:-.54 V , fe Qzilu., I' SV XA- Q-N5 X, 4 ' . GIRLS' TENNIS TEAM Q A 'il --I IIQQEPSHY IH fu -,yi-,, V ,E , BOYS' TENNIS TEAM P g l I rd Ihirly-four 1 4, f Ano ,L N 'Z' T , LKKL ' ' j'-'A ei ll 4 . Q5 vi' Y 'fy LC x xi X 5 L1 Tata: E-- 5 4 - 2 :Ja-'-. I S., X Axes 'RQ :if B t 3 n o ,o o BOYS' TRACK TEAM x x .NX P g 1 11' lmn GIRLS, BASEBALL TEAM flrcrl thirty-five Q I AND S fe: BLAIR, signin Q. is . f ii i:-Q- ' if A - ec fe. -s - A -Q 'Jiri LQ , l I I I ' vnu.. rv I BOYS' CROSS-CGUNTRY TEAM mm.1II.nnI1IIIIIIini1-IIiInnnun-um-num Pres. of the Student Body .... Speaker of the House ..... President, Senior Class , Editor, Pine Whispers .. . Editor, Black and Gold ....... Managing Editor, Pine Whispers Managing Editor, Black and Gold Captain, Football Varsity ...,. The Janitress ............. Dot Dix's Grandmaw Phebe Kornish ........ Captain, Basketball Team The General ........., MomnPop . . . .1Inn1I1-IIn1IiInw,1iinnIniII1n1inInIuinnmnuummmm BIG PEOPLE Page om' bumlrml thirty-six y ' 1 l Feature this- r r E H IE' afwd. , A 09 xl? HM!! N 016 1 .30 , ff fm afar? 4 . fa-g!Xw Q Q 5 C X - V 1 My .I , Iwiflbzzu ' 33 I I V I n 'U : Mgmt J 0 4 V Tglarkiv ani! CEUIIHP STAFF IN. B. Nm' Their C0flIlIll',Yi0Il!j EDITOR-IN-CPIII'1F'AmC1i3 Maude Castaway ASSOCIATE EDITOR-Percival Augustus AssoCmTE ASSOCIATII EDITOR-'ljllflft Hay ASSOCIATE ASSOCIATE ASSOCIATE EDITOIK-MCIH Seixns AssT. EDITOR-IN-CHIEF-Agony Bunsen AssT. ASSOCIATE EDITOR-Elsie Brutcs ASST. ASSOCIATE ASSOCIATE EDITOR'- ISl1,I Handsome ASST. ASSOCIATE ASSOCIATE ASSOCIATE EDITOR-Duke of Wellington fCopyrifc - Feb. 58, Anno Oblifoj 22 SHALOPSKIES PER ANNUIVI Page one bnmfrrd lbirly-srvcn lil-X ff! r ig.. 1 - N 015 A js ' A 2:60 ZZ? r' A A M J, , T ' I Q' Si PQ i V .',91'v Eu ,J : -: i T' -4 i5 i' Q Q5 -nn Ee L FACULTY HALL T. XWANGER, A.B.C.g D.E.F.g G.H.I.g J.K.L.g M.N.O.g P.Q.R.g S.T,U. V.W.X.g Y.Z.-Professor of Phonetics. IMA Bloc MANN, B.I.G.g B.U.M.-Head of the Dunker's Association of America and Professor of Advanced Cracker-Crumbling. O. Wo'r'r.x Giuvn, F.O.B.g R.F.D.g C.O.D.-Professor of Farm Relief and Prohi- bition. DARWIN WAZZ VVRIGHT, U.S.A.-Professor of Anthology and Ancestor XVorship. CLASSPOENI Across the pale parabola of Joy, The hyperbola of the sadness Of our leaving blots out The grayish yellow of The blue horizon- -Aufc' Vermin, Clnsx Povl. Page one l7ll7l!lfL'll tbirly-riglil ' LFC' IE' WML ,-5, sXa 'Bitte SENIDR CLASS 'fi Samui SMULCH TY! , Gai- 22 May Queeng Class Beauty fl, 2, 3. 4j. i lg? Sadie has been with us for some time now, and has had only Q 4 dates-one each with the freshman, sophomore, junior 4 . , ' and senior classes. W f GABRIEI, QUINCY MUGG . dad X Varsity Football fl, 2, 3, 4, Captain, Cohn' .if Cl, 2, 3, 43 50,335 a . . il rg ' Here's a man! He licked Charlotte, Greensboro, Asheville Bri... ' C54 , . . 'fg J X, f and Barium Springs single handed and without mussing - ak his hair, he tenderly uprooted the goal posts and gently EQ? draped them over the library show ease. 5111 !JlHemnriam MAY Rua Smips-Died of exhaustion trying to say something to Elsie Brutes. WEIGIIIQD BRYT-Perished while undergoing one of Mrs. Beamrufs Exams. KNOTTS O. HOTTI2-NlCE with an unidentified person who didn't use listerine. Gluzrlz A. Goisuo-Died on the Held of action while performing as hall monitor. Jlisslcn BONE-Who inadvertently broke a rule by studying in Study Hall. Page om' bnmlreil lbirly-nine WW at . xiii! WX N OIB CLASS HISTQRY FRESHMAN: Open season for snipes! Annual snipe hunt begins led by the year's Sophomore class. Alistair Sourdough-Bates dies from heart failure when told to wash behind his ears at the initiation. SOPI-IOMORE: Initiation much fun. Death of Sourdough-Bates proves helpful hint. Seven froshes dead, three in critical condition. Sophomore picnic on Friday 13th. Ants ate all food except the vinegar, which we drank with great gusto. JUNIOR: Annual Junior-Senior Banquet held. Soup served. Constantine dc Courcy drowns. Six of our number still freshmen. Spy the thimble stars enter training. Starve to death. SENIOR: Two dead from injuries received in lunch line. Great uproar-Reginald- Lindbergh-Coste-Bellonte remembers to bring home-work to school. Dies from lack of air receiving congratulations. Diplomas advertised as sheepskin, are found to be ermine. Faculty murdered. Good Work. -HENRY JONES, I , , -JOHN SMITH, I Hlstormm. CN.B.Q The Historians lately died of old age, prohibiting their graduation. -The Etlifor. LAST WILL AND TESTAMENT Being of temporarily unsound mind, and appreciating the full worth to the school of our leaving, we, the graduating class, hereby do release all things mentioned below as directed. SECTION 1-We leave to the incoming seniors the rare senior privilege of eating their ish spread with jam. SECTION 2-We leave to the Freshmen the delightful treat of shooting at the fac- ulty and putting poison in their soup. SECTION 3-We leave to the Sophomores a cache of nitroglycerine which will be found directly under the office, with the reservation that they blow up the school with part of it not later than next week. The rest may be fed to freshmen, who will be dropped from the highest point available. SECTION 4-We bequeath to the Juniors the most exhilarating feat of reorganizing the Goldie and Blackie Staffe, with the suggestion that the applicants should wear armor and be surrounded by a heavy guard. SECTION 5-We leave to Perigrine Winkleton the distinction of being head pencil sharpener of the class. SECTION 6-In a spirit of sympathy, we disclose the whereabouts of a box of rattle- snakes, which are to be used in a necessity. Look in the ventilator in the center of the ceiling of the auditorium. To which we set our handkerchief and Christmas seals. -MITE E. WEEK, Q T I f 1ATHLETE ARMSTllONG,l- Ss 'I om' Tomme Foote lwifrzcsscs Oler Loose 3 CN.B.j ,Soon after this was published, the testatots died of heart failure on seeing a mob approaching. fSuch is fate-they were lower classmen rushing to express their undying gratitude.j-The Editor. Page one lmmlml farfy ' Xjkc' IE amd' ,-5, ll W wwf f ii rXe 152: E SENIOR DISTINCTIONS Sadie Smulcla Gabriel Mugg least intellectual worst looking P I: . Q least popular 'ff ,7 1 i worst sports 4 ,F least cute 4' ff l t thlet'c Z f eas a 1 ' M least witty least dignified worst all round CN. B.j Since the above comprised all the graduating class, use your own imagination-The Edifor. AUTOGRAPHS fSign on the dotted line, if you can Hnd it. This puts you under no obligation whatsoever.-The Ediforxj Page one bumlrcd forty-one QQ, x ll?anui , XYZ 0 0165 ORGANIZATIGNS ff? If 5,201 THE BUGOLOGY CLUB -- Irkie Irksomc Irk Irksome A Secretary - Irk Irkie ,gggfiif I President ' f Vice-President - Treasurer - Irksomc Irk lg 1. , ,f XX '4-- f in-X 1 NN i . i 24 :X 3 -i M, ,J , . i ,' .-... , -.-gg' . 1 Q, C, , X X ? . - -u.ff ' Members - Irkie Irksomc Irk Z 2. CHEER LEADERS CLUB 2 2- Flowcr: 4 Egg--ll Z Z The Poppy Q , Motto: pn 13525. I., .fSleep while you can -Q 4- .,.:,:.,,5ia -..--.35 Q sv- 'f:'-'T-'F 4:-:fs-zzs' A L ,B-W - Y Y Li 3 , V U f .M f -f 'SJ-Hvfimj if-1, ,- 3 :fs . ' ' 30005 W SfA!1.'NW-f Fe' U f If if 55526 'Ugg 6552- FATQEQTCIQTI ' I W Ali. - X N 7-'A-:X I , Z - 1 T..- Nmlngf giys Qs' 5 A Jig I T m f ! -L:.E-qS- Qs.. h 1 DRAMATIC CLUB fC2lUgl'lC while preparing for- The East Wind's Spcllj Page one bumlrra' forly-I1 ' C' IE' wud' -4. f WM? t is 00 Q .,. i. 1 r' ' 515.5 W e , , 444 Q I zhfgl f Q Nfl ' v ' ' K- 1 X Z' 0 Q- , YE EMBROIDERY SOCIETY Organized for the prevention of cruelty to embroidery needles and thread WHAT-TCD-DO-NV1TH-A-DIPLOMA-CLUB Corous: Fiery Red Conzposnl of flu' IlIt'I1Il7l'l'.Y of ffw gfllllllllfillg class. Morro: Uses of a diploma Ti1iu:1a lDOPUl.Ali USl'.S,, Un' One- 1. Lay out on a flat surface. 2. Procure a pot of glue and spread thickly over surface of parchment. 3. Allow this to dry and then place anywhere that flies gather. Use Two- l. Lock diploma in safe place. 2. Go to drug store and procure a large bottle of alcohol. 3. Place diploma in bottle and cork tightly. Uxr' Tlmw- 1. Stretch diploma on a wooden frame. 2. Deluge with strong solution of some patent hair restorer. 3. Allow to grow n few days, then place on doorstep. Rage our blllIlfl'l'll forly-Ibrve ., . VT' IE' Eu V ,f ag ATHLETICS T'-TQ T W if iy FA 2.2-f--Q0 ' Q 5 fgri f 17 0 p Tglwjmgfii-as X I QIFX K 3 :EXE T RING--AROUND- -THE-ROSY TEAM: Defeated Charlotte to win the Championship! Elsie Brutes--Capfain jessica Bone-Assf. Captain Doan-Coach if -4lF'fQ'ln 5 vii. w Q55 Ms on .Lg 111 ,Za ' 4 I I 3 f M4 A -- - F-ne ,f 5. 1 - .5A '! .: i' z- 54 lie f 2 F 'U ,T-7 W? ' f -. f- -fu T W ' Qfgxffg ...,:l:75 ,V ? f - -.. . - ,V . lb1 3 fl , , :- r -, ,fb ?Hq if ' 1425 5 x : . -- ?-f 'If ! wg L J- ' - 51 511' i f Y 2: ,- W ' L - ' f 'E , Q 2-f tp- , . V 4 . Q 11 Y A i' 'L MOST ILLUSTRIOUS TIDDLEDY WINKS TEAM: Tidd L. E. Wfink-Caplain Lotta Kale-Assisfanl Capfain Crowell-Coach , , , '1 Fig in fr: Tf7eQ:f7E2,i, ,. -E-rx. f f-J - E ' - l ang' i w. 1 v X Zigi - tg , A .-f-1 aa 4, 3 ' ' A ' 'FEEL' Q .. I -,s-' Q'-, iy ' f ig: q Q, g i n V -1' .V LWT2-7' 5 1-E-S l I L LUNCH LINE PLUNGERS' TEAM Noah N. Zark-Cupfaiu Amos Nandy-Assf. Caplaiu- Johnnie Smoore-Coavb P ge one bundrrd forly-four Q I , Q IE' afvwl- ? W XS-5 if f' 4011.1 FEATURES Intimate study of the Editor of the Blackie H22-7xxiiQ6l0 W---K5 hh and Goldie A24 3 X gathering original Q4 5m4ffm?'.' . material for Q 3 5 W THE IDEAL CLASSROOM F-i -92 rw: we -fr 51 ,. 22' T fc 0-f S-fi' Nl -E 'flaffssag-5 ' t if 2' DE KH 5 f PROFES soR'5 llT'fU +4 COT Architect's plans for 21 class- vcnt to school and who knows! Page Um' bIll1iIl'!'Kl' forly-jizz' room in 21 new school being built by n man who on c H N IE' anti X Cb V To ll-I ,fi f I E ADVERTISEMENTS D0 YCDU CDFTEN SPILL IT? ls your mouth too small? The famous Spill-None-Funnel - It Drinks lWhe1'e You Hold It Read Our Testimonies S b S ill-None-Funnel I have not lost a dro -L C B' Y S Y P P It just fits my mouth -Frank jones I could not do without it -Isabella Hanson The SpillfNonefFunnel Company O. C. BRI'fTON'1CGlllP1lS Rz'pr'vsc1z1'aiiv0. FREE Mosuc LESSONS PoR SALE OD- f1fCH'NS'f' - xl EX, mme -me KEYS The ff ,Q Q ollll ' 4 N U Campus fl! S E Ag3TfW1fTfI3SOn 675525 Page our burnlrwl forty-s ! w 1 N' ' nl I 1 .3', l . . O Sh I , 4' H 1 J 0449: 6 K It Pays to- ' 1- all O +5++I+fX+-1+':+f.'++:++z'+:-+:+-1++x++:H:+fz+':++:+f:+'zw:'+:+':++z++z+-101+f:++:f+z+':-+:+-M-+zf+z+f:+-:++:++I-+2':++:+f.'+-x+':++z+-:+':+f:'+x+':f+x+f:++z+f:+'.'+'z--I--1+-:Q 51 V .g. :g 't' v? 3' of 'ez if P I T ill 132 o'o + .24 5:4 Uil 5:Q of ,EQ N 04 '24 viv .,. Q .5 if If alt' AY S Q. 9 ft. Q, 5:4 iz. O4 .Q Ig uv D ,4 If: E SEEK THE BUSINESS of con- If: 3 . . , 3 If Cerns who are mterested 111 havmg QI UO 1 ' I ' ' 9+Q 131 then' 2ldV91'US111g matter, produce Certam +'4 Q 4 If: de-slred sales results and we have ample 3 . . . , - 'S' If f?1C111tl9S for both the preparatlon and If 0.4 ' . .Q 121 complete producuon of such prmted matter. 1? 31 3' Otf pg 5:9 :Q fgf RQ 7:4 V34 Q- School Annuals Igi 54 -5. Catalogs Ig V60 . I QQ ff I nw tations Q. if I l . -Z. Vzsztmg Cards Iii 90 N if Announcements Q. 530 QQ -2- Programs 3. qv its v? fi. 9:4 V14 ata 444 45+ vs. 32 112 0:4 ,Q via 5? PQ Q 5:4 30 3. 3. 3. 3. .i. ZZ. If .fl V4 o'4 3 3. 121 3. Fil Og! If o 0 5: Barber Pram mag Co. Ig, 3 3 gg INCORPORATED 33 3. ,C 2, 2' Phone 5149 Ig I9 OO Q c 1. 221-223-225 North Trade Street Q '4 so z WINSTON-SALEM, NORTH CAROLINA jg I4 9.4 V V .fl 31 z Q. 0,0 344202402401444944:0+!oZQ+:4+Z4Qnoxnvzovzevxn-4:4-axeo!4oXou:+v:ooI4-024-v!4+:4+I+o!4+X+oXo+xQ+Io41ooI4o:44z4+!o+!ooyazfvzoogsza-014+2+10vIo:+v:4o:4ax0Xoo:Qoxsozooiv-invicta: l ' 'ja ,Y-f -wif... f, 8 A 5.1 lllhum- . A INCOMPARABLE X PHOT0'ENGRAvlNe COMEAPQYNC 'NC0 i M, . W1 NSfP11?n':eS3552 vv vvvvvvvvvvvvvvvvvvifvvovvovvvvvvvvovvvQvvvvvvvvvvvvvvvvvv o.++,+o1Q+xo+.++.4o,++4vs4+54-+.4+.++54+44-+4++,++44-+44+,++4++4++.++,4+,++,4+5-+,4+4++,o-+44544.03+,++,o+,o-+44+,+5++4++,4-4,4+,+o,++4++,+5++,o+,++,n44+,4+,+o,o+A04e+,+o,++,sve Q? 45 '34 Certified By State Board Of Education 'xt PQ +4 3 . . 2 31 The Vital Qztestfzon? 1:1 64 fi Wh W'll Y D Af G d ' 7 .5 at 1 ou o ter ra uation. .3 C31 We Offer The Highest Standard Business Training Curriculum ffl :ij In The South. Inquire About Our SECRETARIAL SCIENCE 151 3: Course. Also Courses In 3 'Q' O4 ' ' ' V4 g Higher Accounting Business 3 fWaltonl Administration 4 Law fForN.C. Bar? Finance +'4 Salesmanship Stn-notypy .ff 632 W. 4 st. Wmswn-salt-m Phone 2-0121 -ff +4 u'4 24+14+Xe+I4+24+I4+Z4+2414-QB+!4+2+I4+!4+z4+zQ+:4+I4-+24+:v+!++I4-+!4+X4+fo+:e+:4+:4+z4+:++I4+Io+14+14+I++Zo+!Q+IoX4+fo+:v+!v+Io+!4+!o+2442+!4+I++Io+Io+:Q+Io+fo+zo+I4+14+:4+:++f+ AGONY The Auditorium was dark, except for the stage, which was brilliantly lighted. A boy arose, and spoke a few words. A little gasp of pleasurable anticipation ran thru the audience as a well-known member of the student body began to read from a sheaf of papers. The audience was thrilled, leaning forward to catch every golden word. They were reading the Constitution. +14ozv+:++:4+2+14-+1442aresxnxnozeuxnzogoozozuzo+14-4:40:4414-+Xo+:++1++z++1++14az+oIQ+I++I4+:4+:Qszoo:++:4-+14-+Io+I4+:40:4+z++z4+Io+14+:o+z++1++xo+:4+X++I4+:4+I++X4+Io+X4+I++? 34 +4 3 I rg: rg O6 'PQ 31 ALEM c i.l.E E 15, ' S O G ' OO +6 1 . . 4 jg A class A college for women, with courses leading to the jj degrees of B. A., B. S., and B. Mus. 50 O4 I 2 :Si Efficient deliartmcnt. of 'l't-at-her Training and Business Education 3 ff: Combining the culture and refinement of 150 years' service with mod- ff: 5+ ern methods of education. +5- 94 GO 3. 3. . . . . g 'ij For information write H. E. Rondthaler, President jg If 3. ,fi 5. 4 oIo+XQ+X4 +:4+Z4+z4+I4+Xo+!4+:o+:4 +14 +!Q+Iv+I4 42444-414 +24 oX4+:++I4-+14-+:4+:++!4+!4 +Ie4!++ZQ9!o+Xo+:v+:4+Xe+B+X4+X4+!4-+14 +14-+21 +14 +X++Io+!o+Io +14 opozozo QQ +14-+zo+!4+Z4-+1443 VCX POPULI, VOX DEI Softly the door opens and a dignihed-looking person enters. Thirty-two heads twist towards the back of the room-thirty-two mouths drop open-and thirty-three hearts sink! I say thirty-three for the teacher is going through the painful process of turning several shades of pink-also a deep scarlet. The head of the department has just entered! +14 Qvoxeoxooxoozo +14 oxozovze +Io+!+ +14-414010-+14-vzoqouze-+14-4:4 +14-+:++I++Z4 axe-+14-+14-+z++XQ+:++:+o:++X+a:obzouzo axe +14 oxen? +14 +2 +ZQ vxv v:++!+ +10 vxs +2442 +:o +24 are ,Iv +24 ,Io via aio B 9 V +24 +34 31 122 s. .f. at lo z' A : 34 , as +34 +14 2. P Pr' 5 af 34 P +34 to +5 +4 4,4 so . 0 . . +'4 it Attractive gyfts for graduation 3: 1. 3. fi. .f. Igl 506 W. Fourth si. Phone No. 2-1253 Ig 31 III 930 A 3. 1 +14 Q14 QXQQIHXQ +!+o!o+:o +!4+:4 +:4+I++Zo+Zo+IoQfo+:4+zQ +io +Io+!4 +24-+!4+!o +14 +XQ+f4 +1441-+14 +X++f1+? +14 +2444+:4+:4o!Q+!o+!o+:4+X4-+I++:o +X+ +24 +24 +14 ofa +14 414 +24 +14-+24 Q4oX+oXo+zo +14 9iiibviikikiiik+4?k+k+49?4kk??++i+9644696kkiikikiwbbiwwwiiwn All Facts Considered KELVI ATOR is the MOST PRACTICAL, DEPENDABLE and the most EFFICIENT ELECTRIC REFRIGERATOR on the Market Today. ,si Think of an electric refrigerator that combines for the first time a refrigeration plant, an Icemaking plant, and a cold storage plant-all in one beautiful, compact unit. Imagine this three-fold service delivered automatically -without control or regulation on your part-and you will have some conception of what Kelvinator offers in its great new SUPER-AUTOMATIC line of refrigerators. Taking all points into consideration: the beauty of the cabinet, the quality of workmanship and materials, the dependability of the manufacturer, and the complete- ness of the service it renders, KELVINATOR is the best buy on the market toclayf' is.-. Visit our Showrooms and See the 1931 Kelvinators on Display Southern Public Utilities Co. Phone 7151 'bi+++++4++++++4?+4++4?46+6+946+65Qiiiibiiibiiiiiiikbiiiwif vvv vvvvv ovovvvvvvvvvvvvvvvvvv vvv vvvvv v vv vv v v v -o.o4.+o.esXe+.+0.0-uggrvfQz4oIvo'44-5454-u,+0,0o.0,9,0,0.4o40.4o4+o,+o4++4e5044+504-he4404014-u40,+o.0:04n.+v.+4tQ5401043ox+oI+v:+v.o+44vx4-v44-u4+vX+oX+04+0lo+.4-oX+bzQ o 15' .fi Ig WHERE WOMEN OF DISCRIMINATION FIND APPAREL UF jj DISTINCTION if 3. 32 Q? Fan-Tan Hosiery Sold Exclusively :ff YY I ,TY 1? Style-Right Lingerie A L llnusually Low Prices VY A U24 :iz ' 12: 'tl' 9:0 tinge 5 'TQ 5:0 3. 3. +24 DIAL 8223 STORES EVERYWHERE 7 WEST FOURTH ST. fi' rf: :fr f!'+I+'Z++!'+!'+!+'Z+'!+'!'+Z'+X++!++!'+!+'!'+!++!'+Z+'Z++X+'!'+I'+I'+20X0ZH!0I02020Z0X0X'-'Z014+I+'Z0I0IHX'+X+'!'+Z+'X'+Z0Z+'Z++I++!'+!+f! !+'!'+Z+'X'+!'+X'+I'+!++!+ 10AC1's I-IOMEROOM PROGRAM TEACHER: The reason we don't ever have decent programs is because no one will get up his part. Members ci1n't even pray or say the Scripture from memory. The only alibi you have is that you forgot it. Now, I ask you bl:ih-blnh-blnh- etc. CLASS PRESIDENT! Do you have the report from our sick member. TEACHER: I forgot to visit her! ! l an vvvvov 1 vv vovvguvvvovvvvvvvvvvvvvvvvvvvvvvv ovlyvvvvvovvvvovv +,+o,4+,o+,+u4oo.+oX0.+o:+9,+o,+oX4-QQ, .0504 40445 ,4o,n,o,ov,+o44-4.450.0.0Ao,Qo,+o,+o,+o44+A++4+v,+v4oo,++,oo,+oI++,++, Q0,Q-54-54+.4-v,4-u,4+,n.4-v.+5+o,4+44o4o- 4 94 If 34 52 Do You Dance? gg O34 . 1 - . 4 Q. Just suppose you are having a fine time dancing to the tune of your fi. :Q favorite orchestra and start out for an intermission party and final a IQ Ii: flat tire or that your ear is out of gas, don't forget We are open all 4. night and give quick road service in the middle of the night as well +20 fi: the middle of the clay. Iv? ff It: 31 3. .5. The Downtown Garage .g. 3: U. S. Tires, Delco Batteries, Gas and Oils, Washing, Lubrication Dial 8177-8178--8179 Geo. L. Irwin, Jr., Mgr. 04 '44 4 +!++!o+:4+Io+I4-rx:are+!+vX49!4o!++:4+IQ+14+1024+11-Q14-o:4+!4+!++!4+Xo+I4+14-up-s:4+Io+1+vf+oX++zo+Xov14rzo!+Qo+f4+f4o!4oz4-ozfvfovxoUIQ0:0102+Z++!wXo-0:4+!+vXo-vxovfoozeofoozeoxo LIFE'S MINOR l RAGEDIES ' Mr. joyner's cuts. Gym clothes. Report cards. I-lull Guards. Short chapel programs. Visits from Department heads. Tests. Themes. I-Iomework. 51-0: :oozevxoxnxevxozeu:4u:4v:4g4oZ4o:ov:4vI+ .Q .4044-fxofxoozwgeazovxe414414424-QQvxeozevxbvznzvvxovxo0:40:4-0:4s:+v:+Q4vxoaxo-uIo+Xo+2-0:4-uI4q+Q24-vzoazouzsva-ozoozeozvoz: DQ 5Y 5:Y VTY 3 ' 3 P4 54 1 - . 3 54 l VO is The Charm of Childhood '23 59 5 3, . . ' Caught by the camera, these glimpses of your child- :ij ren will be treasured through the years. Igi Dial 8542 for an appointment 5.0 QQ .+. 4' - a. 3 z ,gi f 5 Iii .,. nnrr 5 1111 IH 53 54 vi- 405 N. Cherry st. is no VO 0:4 31 Gif A Ovl 4 Y YYY YYYY YYYYY YYYYY YYYY Y Y YYYY Y YY YYYY Y +I.5014+.o-obootoofoszego-v,ov.o+.4oIo+!s4,4+4044o4-u,o!Qv,o+,++,+50,4ay504+4,+c40f++!4+,4-aX4-r,ooI+vXoI4+4o,+v5+,+i+v!4+,oX+v!+u24via-v,+u,o!o+X4-u!o+,o.4+,4+40!454 47, 1 , l' ,,- ,- Z0' ' '+'X I '4 X X+'!+'X ! Z0!4+X X'+X'+X'+'4+1'+X+'.+'X'-'19 4'+! ! X'+Z'+!'+I X X+'! Z !'+I'+X+ 4+'X ' A '4'+X'+Z'4'+'4+X 'r+!'+9+!+'! 4 . Z4+X'+. -'X04 . 4 +I4'X'+!+'X'+X+'! !+'! A fx' kia, 55,2552 sag? gym :S Q. H3 0... cu ,ff-CD Q Hmmgv-h 25' ...Z Q93 nsgamoe 4fD3Em :eff he 5. mQ.o 1,'Ii.'1 fp N'-' ---oqpjo U' 0 '1-- '4 v-g2.Fg'f-'J-:D 'OUJg.: fbi b Foflmffb 'Q-H532 gm '1 C CDR 15552: 5253453 5,5302-3 Z gg -:ffm OE., 'g N550 'UU ggw sw-+3.75 55035 Sf F7 5555562 gggmw 902.232 'D :Li mg: gh: so cn 'U 'J O 'G fD o... UQ. 22515530 giggsrn MECQ Q fl E116-sd' ff IL..-. OEF :bca E' C1 mga-'SEQ-2 62532 'if-25 ro ro EP' E H- s : o Yana: sa: o 1-1--2+-s .v1 ... - s rn ' 5 QW 05260 D-Hi' MQQFSEZ ?i'g,EQf s 2-255 X Q --X UQOmCD.: ,..,:-xl CD lldo U ifrgfi Q, ggoggg gg fp V U, CD-. m 'Ugg gd: maQ5f H. '-SQQ. D N' O:'f1+-img 'E'-SE :Lim HL' , 'FU 'vfiwz :Q-'fs 0:40 W' 5-cn?'47? i k:w H1010 D' u-:cn S Vwom soc -- 5 -bangle? t.,.CD,-,Gm :D 'D' Q-1. 'fgmr-4 v'3':m 5 '5 moi- O m 1-+'j:m5JS 532+-25' :vga '-4 FB 22 H ' 51+ Z' 522mm 57:3 mmf? Q I Hb f-11:2 gc PJ 2,2 5 Q ydzvig mmm? :ow C W ffgrgigw. gmgjw cv-662 D' H, rimmmf.. v-:5T f5 in-1' Q9 6, gg' :ww Qbwes: glzhnc- 1 5-csv' 5525: :Oc Q. . . '-:ro'.D!D .-.nC 14 .'...K ... ,' ' up 1 Qi 1 WI ff ,COWC Z Fl 2 UP 23 Um W o F4 U3 Sz: P1 4 P1 75 43 22:0 :Q U3 o z vii? L? Q5 :Sz if ,S 212 E 'z- 3: 323 E 3 fi: 5: 53 2 ii !++!'+Z+'!++I+'!+'!+'!0Z Z+'X+'!'+. ' Q4 1 ,Q ofnozoopvzo-axe-0144. 0344+ +!'+Z'+I+'!'+!'+!++!0X'+!++Z0Z+'X++I !'+Z'+Z'+X'+X0! Z'+!+fZ+'Z+'X I'+I++!'+!'+!++I++I++'kX4+!w2++! o v v v v v v Q v 1 a,4+,v+,4o:4+!4+,o+:oo.044o,0.0,n+,4+2-v!+o:0X4+X40:4-Q4-4. 3 tr 35 :E gi' fi ?f if ?l :E 'sf If If! 1? 'X' 'Z' +:+ 0'4 03+ 03+ 0'+ 0:4 0 05+ 0:+ 00+ 01+ 0'+ .f. 01+ 01+ 05+ 02+ 00+ 02+ 05+ 0 + 5:4 :iz Q 0:+ 0:+0Z+ 01+ 01+ 01+ 0:+ 0X+ 0:4 0I+0!+ Q4 01+-0:+ 0Z+0:+ 0z+0:+0I+ 0:+ 01+ 0:+0X+0I+0X+0:+0:+ 0:+0I+ 0202+ 0:4 0:4 01+ 01+ 0I+0I+0X+0z+0X4 0201+ 01+ 01+ 02+ 01+ 0:+ 01+ 0:+ 0101+ 0901+ 01+ 0I+0:+01+ 0X+0!+ CAMEL CITY COACHES For Special Trips Any Time Anywhere REGULAR SCHEDULES ALL THE TIME CAMEL CITY COACH COIVIPAN Winston-Salem, N. C. 09 I 3: Q. 0:4 04+ 0'4 3. 0 0:4 0:4 0I+ 0'+ Q. 0t+ 5+ 0'+ Q. 0.4 0'+ 0:4 A 01+ 0:4 04 0040400 0v0+0+ +4v04v0+000+v++000000+4+0v0444004v vvvvvvv 0,40442+0.4054050.403044044014050,404+5+04+-5+0:+04+0,+0,+0,+0,+0,+0,+0,+0,+0,+0,+0,+04+-0504+050,4540304+-0,+-0,404+0,+0,+0,+0.+0.+-0,+0.+050,4050A+0I+0,40,+0A40,40,+0,+5 THE PERFECT ORCHESTRA It is 1:47 P. M. in the orchestra room. There arises a dizzy hum of musical instru- ments-varied tunes and pitches-some flat-some sharp-some neutral and others in- different. In one part of the room, Louise Taylor is crooning the latest jazz hit,- far -05+0I+0:+0:+0Z+01+0I+0:+01+0:+0I+f0I+0I+0I+0:+0I+0X+0:4-02+-0:+0:+0:+0z+01+0I+0z+0X+0:+0z401+0:+0X+0I+0:+01+0I+0X+0:+01+0!+0:+0X+0Z+-0:4-0I+0z+0X+0X+0X+0z+0z+01+-0X+0X+0I+0I+0I+0I40:+0? U34 7:0 O si 32 .f. Q. VQQ 9.0 02+ . ., . 0:4 0t+ 01+ . v yu , HSl7.01I1J'IIIfj Center of Wzwustozz-SaIenz. 0'+ 04 3 I .. . . . 0. 3. Replete wlth all the new things that make Spring 4. 0'+ . 0'4 3. Sl10DD1I1g' a pleasure 3. 03+ 054 0'+ ,. 04 Q. -3- Q. PQ 54' 3 7 y - q I 4 jg We Have rz Cfmrluatlon Oltlfll for You 5: O 1 01+ 04+ 0'+ 0'4 3+0I+0I40I40Z+0!+0!401+-4201+011-02+-0:+0:+f0I+-02+0:40240I+0f+-0I+0I40f+0f+0Z+0!+0X+0:+0I+0Z+0I+0I+0I+0I+0I40I+0I+0I+0I+02+02+02+02+0I+0:+0:+0:+0X+0I+0z+0z+0!+0X+-01+0101+02401+ '+0g 'A over in the first violin section, Signor Spaghetti, better known as Al Blumenthal, is soar- ing away on the wings of well known strains from Beethovenis Fifth Symphony. Footsteps approach! ! A hush sweeps over the entire personnel!-Mr. K. steps to the conductor's stand. Complete silence CPPPJI! He has the undivided attention of every musician QQ I! Acquired-The Perfect Orchestra! ! ! 0X40Z+0X+0X+0:+0z+0Z+0I+0:+0:+0Z+01+01+0X+0I40I+0I+01+0I+0I+0I+0X40X+020140141014-0:+0I+-01+0z+0I+0I+0!+-0z+0:+0z40:+0:40:+10:+0:+0z+0X+0X+0:+0x+0Z+0x+0:+01+02+0z+0I+0:+0z+0I+0X+0I+0X+ V4 fo 13. 4. 4, 03+ ,Eg 0:4 0,4 0t4 ' - . . . '0' Reach, Wright and Dltson athletic equipment 3: ISI 5. 3 , . . if .if Une Lot of Baseball Equipment at one-half price. One ff. ,0, D ' .E+ lot at one-fourth oft. See the big bargains before you buy. jg :gi .g. Q, 3+ 3, 0+ A BROW - ROGERS - DIXSON -2 ,g, v 1 .g. :ij The best place to get lt' -for 50 years jg 3, A -E+01+01+0I40Z+01+0I+0140z+0:+0I+0:+0z+0:+0X40:+0Z+0I+0!+0I+0I40I+0f+0101+0:1-0:+0!+0:+0X+f0!+0f+0X40X+0z40Q-H+02+0z+0I+0X++:+0Z+0!+0I+0I+0I+0:401401+0:+0!+0:+0:+0I+0t+0:40I+0Z+3+ 0 6 2'l+'!+'X !+'X X X0X+'X'+!+'X'4'h 'Z'h'+'X'+X+'X X0! X+'!'+X X+'X X'5W'1 'Z0! 'X f+'! X X I X'hVmW'I I0X X+4''Z''I Z+'I X+'!+'X 'X+'X'H? I+'X+'!+'X+ f'! !+'Z'5: :ii 3 Ig f . . 4 H M ' Q I2 3. -F' ff ' 3. 5: - i. , J. 3. Hi 1 I 1- V 'f - 5' ff: ' . 48, .QI . Q l - rg 3: I W ' oe 2 r N if I is 4 v ar tg N f :zz 'K H . .z 4 7 K . .. 5, ' .gi 5 31 'Q Iii 32' 5? e f 5 if 151 22 ' Ei E95 Q 0 3. 221 Q .g. :fi if 4 V+ E22 ANY way you figure it, P.A. is better tobacco. It Take fragrance, for instance. Your well- N y W 3,3 known olfactory organ will tell you. And fi: 3, taste-who can describe that? And mildness 8 is -you couldn't ask for anything milder. lqjmlgimiwmil 12? o . . 1 I I ' ,, .2 Yes, Sir, P. A. is cool and comfortable Nliillllnlnyi IIIIIIU4 y W 3: and mellow and mild. Long-burning, with ly l If: a good clean ash. You never tire of P. A. i '.,y f Nl .fr jf: It's always the same old friendly smoke. Q ff y If: Ii' Get yourself a tidy red tin and check l ! Inu. ,I:..V'n1I l' 'f' ff , , , Ag m.sim!.mIHIu9 HW it i 3' If: everything I m telling you! 'L 2?3+l55Ea'?5GT 'iflfzaqlll If: Ir. A '23 ft' T h e o e y 0 u 3 O knownhbbut lo- 'g Y baccos, the nzoge ft: you appreciate P. . I -no other tobacco is like it! I Iii Zz' giS?.L?.?.E:.?''tJf.5::rsLf:.T1h'?fef gi '2+'X+'X+'4 'l X '+ +X 1t'o '4 'i+'X X'+I+'X''1'+I'+X'+X 1'+I 4'+'X'+X+'X I X+i'+I+509'X X I'+X'+X'+. +!''! X X+'X I I 1 X+'X+'It'I'+X X'+I X F'Z 'X Y X''X !'+X'+!0S+ +5414-014ozvuze4ZovZ0!4u:4o:40:4-+I4v:4foZ4f4:4-4:4-0:44144:02bin:0:0:4o!4'oX4-+14-+X+oX4v:ovX4+:+vX+vI+oI+QI4014-uz4-44014-vz4foz4vz4o:4vI4vI4vx4 vxo + 4 4 ag 34 ft: The House of Friemllinessv 3: 34 34 34 +34 og A 434 123 T09 QT' Ol 98 HC. if g. 9 .g. ff: III sz. WHOLESALE ONLY sg. 34 E4 v 4 v 4 'i' F ' P d P ' ' 'i' 1:1 TLLIIS, T0 UC9, . TO'UlS L0 TLS 1:1 .3. s. 94 34 34 44 Q4 414 vvvvvvvvvv vvvv vvvvovvvvvvvvvovvvvvvvvvvvvvvvvvvvvvvvvv vvv 0,40.4545454044545454-0,49:443545+9.4uX++44o,o+po4vv,+v.4-54v++o.4o+eo44o44o,4-o,+o,4v.ev.oo.4o.4+.4+,4+.0.4v.4o,4+.4v44a,eo445454545454-v.4v.+944u,4v,4o,4o!4c.4o,4vA4- O SXVEETEST OF ALL SOUNDS All praise to thee, O sweetest of all sounds, the ringing of the fire drill! O most beloved of all our friends, accept this humble praise from us. You have saved us fbut for oh, how brief a timej from the terrible eloquence of the mighty Cicero, from the -3402444-v:491444-Q4o:4o!+ox4-o24vX4+:+o:4v:4u!4oXoo:4o:4oz4+:4424410+:4o:+vX4-+14-+14-+'4vZ40:4o:4+X4+:4f+z+Q444914oxropvzevzovzovI4o:+vI4+I4oIovI4QooI4oI4-cI4+x4+:o0:04444-4:4R If 3. .gr Ig E. J. ANGELO CO. :iz Iii ,, . . ,, ISI 5. Quality Groceries Cheaper Q. 121 :ff I? FRESH MEAT DRESSED POULTRY FISH OYSTERS fi: 131 COMPLETE LINE OF VEGETABLES Q32 -2: IMPORTED GROCERIES AND CHEESE 'f' 3. :ff 'Z' 121 BURKE ST. PHONE- 61441 '5 31 :Sf 4 vvvvvvvvvvvvoooovvvwvvvvvvoovvv vvvvv vvvvvvvvvvvvvvvvvvvvvv +045450,4544,454a,4+,4v,4+.4v,4+,4v,4a,4v44v44a44v44u,4+,4v,+o,4v,4o,4o,w44+,4-o,4+,4o.4+X4+,4v.+o,+o,40,4-vX4o,4545444454044544440.4o,4a,4-u.4v.4+.4-u,4f44+44aA4o,4a,4v,4o.+ soul racking equations of terrible algebra, from the torturing parlez-vous's', and s'il vous plaitlsn of France, and from dreaded nouns, gerunds, and participles. We, the stu- dents, shall forget much when we go out for all time from this, our alma mater, but never, I say never, shall the sweet sound of thy bell cease to bring il thrill of joy to our souls. vvvvvvvvvvvvvvvvvvvvvvvvvv v vvvvvvvvvvvv 4vvvvv4vvv vvvvvvv 545454-545454545+0.40,4-v,4-5454954-+.e54544.4-+44v4,4a.4+,4o.4fA4v,+o,4-vxe-54-014Q44-0.4-v4e+f+,+r,4f+,oo,4b,4o,+o41-444+1434-0,434v.4v.4u4,4-v.4-0,454-o,4f+X4+44v,4a.+f,4a,4v,4v,4 32 3. ' 0 ' III 4. A Complete Printing Sei-'vice 122 251 -Q. CATALOGS - BOOKS - COMMERCIAL FORMS - LETTERHEADS -Q. BOOKLETS - DISPLAY CARDS 111 0,4 424 Iii Copy - Layout - Artwork - Dir-eetMai1Campaigns - Dgrribijinp, - Mailing 152 .gi PIENRY-AITCI-IISON PRINTING CO. 530 ftf A . 4. +13 15 West 5th St. Dial 8694 5. ff Vffffff ffffffffffff V if V 'Y Q' 'VYYW VVVQVWVVY 'V 91 +54 v,4o14o,4+,4o,v+,4v.4+.4 +04 Q4 4.45454 544.4 544.454 +,4o,4+,4+,+v14+,oZ4+,4o,4+!4-0,4414 4X4-54-5+vX4+,4+,4+Z4-nie-r,4+,4r,4o.4-0,4-v5o,4-54 54 v,++,4+,4 4,4-54 +,4a!4+44v.4+14f,4+,4 'Z'+X0Z+m X+'!+'!'+! ! Z'+X+'X'+X+4 !'-'!'+X+'X'+X+'X++X'+!'+X+'X+'X'+!''X++!++X++!+'INK''X0I'+X''I+'I'+!+'! X+'Z !+'I'+X+'Z+'!''I'+!+'X+'X X0X'+! X+'X'+!+'X+'Z+'Zz 4? v Q 3. 3. 4 Q 2. QUALITY ABOVE ALL Ig! hte 4 . 152 .g. ' 3: 3: 53 2: - 2. A 7:9 il rg: In 04 I C O PA I 4 :if 3 if O 11: gr , :fr it 94 vo is Designers and Manufacturers of 133 2. 11: 31 OtQ 111 :az :it I :ft 3 School and Co lege :iz 'E Jewelry 3. 5: rio 724 as 3 1? 2: ri 5' :iz 32 3 ,C 32 13: 2? rs: OFFICIAL JEWELERS TO gf .g. RICHARD J. REYNOLDS HIGH SCHOOL If 3. 3. 3. 34 Q o Q Q. .Q o 4 0 Ii' 'f' 31 Dil' +4 54 v v Q vpgaoxeoxfofe c!a+!4Qo+Sv:o14ufwfofo+Xoo2a2+!oc2ofa ofa vfoxofafeofevfozevfvvfeofo +1014 +X0:4+X4+!4 sXo.o+!4+.4a!oXo of nie-qv-ax: 401924 fyfxnznxugq pp Q, 32 V34 31 O24 3. 32 2 0:4 32 3 C21 3. +14 +14 +1+ +14 +'4 2 +14 +14 ++++v4 4v44++v+++vv44+4+v++4+4444+v4++++4vvv++++o+4+v ++++v +1014+14-+14+14+14+14+14+14+14+14+14+14+14+14-+14+14+14+14+14+14+14+14-+14+.4+14+14f+14+14+14+14+14+14+14+14+14+14+14+14+14+14+14+1454+14+14+14+14+14+14+14+14+14-+14+14+14+14+14+e +24 It had to be good to get where it is DRINK C6 I IN BOTTLES +14+14+14+14+14+14+14+B+14+14-+14+14+14+14-+14+14+14+14+14+14+14+14+14+14+14+14+1++14+14+14+14+14-+14+14+14+14+14-+14+14+14+14+14+14+14+14+14+14+14414+14+14+14+14+14+14+14+14+14+14+14- MR. ALLEN'S 5 TH PERIOD HISTORY CLASS Mn. ALLEN: In 1492i + 4 +14 +14 +14 .g. +14 +34 +14 +14 +14 +14 +14 +14 +'4 +14 +14 +14 Q. +14 +14 +14 OU'I'SIlJIEZ Sailing, sailing, over the bounding m11in!', coming from several somewhat decrepit ukuleles. Ten minutes later- MR. ALLEN: Wfhy did Napoleon divorce Josephine in- +14 +14 +'4 +14 +14 +14 +14 3. .3. +14 +14 .f. +14 .f. +14 +14 +14 .g. +14 +14 +14 +14 .g. 4+4+++v4++v++v++ vvvvvvvvvvov+4vvvvvvvvvvvvvvvvvovvvvvvvvv4 +14+14+14+14+14+14+14-+,4+14+14+14+14+14+,4+14+14+14+,4+14+14+14+14+14+14+14+14+14+14+,4+14+14+14+14+14+14+14+14-+14-+14+14+14+1454+14+14+14+14+14+14+14f+14-+1014+,4+14+14+14+14+14 HIGH LUN The Place That lpeeializes In andwiehes Curb Service HIGH LUNCH AND CONFECTIONERY 837 Reynolda Road in Front of Hanes Park WE FEED THE HIGH SCHOOL PHONE 9932 +14 +14 +14 .f. .1. .g. 4. .g. 4. 4. +14 +'4 +14 +14 +14 +14 3. .3. +14 +14 +14 +14 .g..1..g..g..g..g..1..g..g..g..g..g..g..g..g..g..g..g..g..g..g..g..g..g..3..g..g.4..g..g..g..g..g..g..g..1..g..1..g..g..g..g..g..g..g..g..g..g..g..g..g..g..1..g..g..1..g..g..g..1. OUTSIDE: I-Ieart-uclues! Heart-zlchesn came the erooning voice of a freshman tenor. Two minutes before the bell- Mu. AI.I.IiNZ Wliat did Cleopatra say to Mark Anthony when-P OUTSIDE: I am only what you make me, come take me I'm yours! Mu. ALLEN! Class adjourned! ! ! .g..g..g..g..g.q.q..g.4..g..g..g..g..g..g..g..1..g..1..g..g..g.4..g..g.4.4..1..g..g..g..g..g.+g..g..g..g..g..g..g..g..g..g..g..g..1..g.q..g..g..g..g.+g..g..g..g.q..1..g..g. +'4 +14 3. .3. +14 +14 'ff AUTOLINE OILS KOOLMOTOR OILS 'I' +'4 1 +14 60 9,4 ff- HOOD TIRES '1- +14 +14 +14 +14 +14 +14 .. .,. S: XX 2lSIlIlIg and Cruising Ig 151 51 3. 3. 73' UGBUR -HILL TIRE CO +'4 ' +14 ' +'4 3: Cherry and 6th .f. +14 +'4 3 3 +14 +14 +14+14+14+14+14 +14 +14+14+14+14+14+14+14- +14+14+14+14+14 +14 +14 +14+14 +14 +14 +14 +14 +14+14 +14 +14 +14+14 +14 +14+14 +14 +14 +14+14 +2 +1+ +14 +14+14 +14+14 +14 +14 +14+14-+14 +14+14+14 +14+14 +14 +14+14 +14 +Z+n 'X+'X X'+B+X+'X0X''!'+I ! !0X l Z+'Z+n'+'X'+X+'Z''!0X X'+X I+4+'! X X+'X'+X+'X 20X+'Z0!++!+'Z X'+X0X++!''Z0I0!+'X++X I Z+'I+'X+'X0!+'Z''!+'Z+'Z X''Z' rlen a eterla 5: F ' dl C f ' 5' :S Where 2 li. Quality, Economy and Service fi: Of V41 :Zz combine to Characterize Winston's Newest and Best Eating Place :II 3. 3 vi: -0- og 0 Ot! If Every Meal A Pleasant Memory Iii I' 111 W. Fourth Street N 3. O 0:4 vp vin 'B'X'+X !+'X'+. '! !0Z X'+X !0!0X'+Z'+X'+!'+!'+X''X !0!+'!'+!''!+s +!++Z'+!'6+'!'+X I !0!''!f+!'+X Z+'X'+X'+Z'+Z Z'+!'n'+'!+'Z'+!''!+b+!'+!'+2 !''Z'+X'+!+'X 2' EDITORS PARADISE Jean Cantrell, managing editor of the Pine Whispers, leaned comfortably back in the new arm chair, munchcd at a juicy apple Qsupplied by Mr. Perryj , sipped tentatively at il dainty bottle of coco-cola Qdonated by Summit Street Pharmncyj and continued to read the latest Movie Magazine. just at a tense moment of the story, the door opened, and Elizabeth Grey, editor +X'+X++l+'I+'I'+X+'Z''!+'l+'I+'Z+'Z X+'X'+X I'-'X+'I+'X+'X+'Z+'X+'!+'X''X+'!'+Z+i+'X++I+'t'0X X Z0Z+'!''X'+X+'Z0X+'!'+X+'Z'8+'!'K X 1'+X+s +Z+'!'+X'+X'+X''I Z'4+'X+'X+ 151 22 Compliments of 3: 3. 4. C51 S h D ' ' C52 sz out ern alrles v v 9-0:0 5+ v 9 .040 wxf-x0'.+w+-x+.:+-x++z-+ BP 0 3 U - S-H -A fb :r U m ie 5 2 'Q 2' -3 U1 2 D' EP. S 5, E 'D 0 D 'P 'D D- : g 3 3 g F C ru UQ D- Q g fs H N ,., B S' CD Q. ri' Y '!'+Z'+!+'Z+'!+'! !'+Z'+?+!+f!'+ 'B+?f'! X+'Z++!'+3'X+'Z Z'+X++Z Z'+X4+Z'+X'+Z'+!0Z'+X''Z''!'+X+'X'+X X0!'+X0X'+Z'+X++!'+X4+! X++!'+X'401'+I++X+'Z''Z Z ! X+a'+'!'+!'+!'+20X Z++!'+!'+!+4!'+I !0!+ of the paper walked leisurely in. Guess what, Jean, she said with n yawn, our rc- porters have so much news that we're having n ten page paper this week, and another thingg Wellington Dunford made the paper up for us, has sent it to the press, proof read it and- That's nice. Have a seat and push the button on your left. Miss Tinderlll bring you some refreshments. P 6 2 v 3' 5 1-up ,Q X'+X'+Z Z X+'I I X+'4 4'i+'X'i Z X I'4 ! ' e 3' GT it W uh C U2 F' ff XX 2 2 W 2' 5 E Tl 3 ' Q 'fn 2 .5 A rt 2 -H U i- U '1 O 'Q a' '21 fs? 3' Q13 S1 1 Q eil D' 2- 5 5 Q E 5 ga 5 af Q gr 3 O 3 tn O f , F-7 a ' fs HQ, P loex Z i Q X ff I I I+'I'+Z I Z+'! I X'+X X X+ 4 X'+X I'+X ye it Iii 5' Q5 i fl: ii a 4 if '5' 'A' +14 vie UIQ 024 J '5 'f 55 v Q. axe 0:4 exe 251 -if QQ 'X' 0:4 vin v u v 'I' Q 0:0 sg. 'X' ofa s 31 -fs .g. .30 ' .+ i if S if 3 1? Ii if 53 3' E 31 2 If if o'+Q+ it-v9 o'4 3444-Q4v:4o'4+'4+Xo +'o+'4+:e0:4-v:+v:+c:+c1+vX+v'ooX+ oI+o'+o:+v'0'++'ov'4+'0'0'Q+'+ u'oo'+v'+v'+4'1-o'o+'0'Q4'0'++'0'0'ou'o 91 v'Q-W4-o'Q+I4-o'4-011-u'Qv'4-u'4-v'4 U4 4 0 4 6 4 4 4 6 4 4 0 4 4 4 5 0 4 4 0 4 4 O 4 4 4 6 4 0 4 0 4 O O 0 O 4 Q 4 4 4 A At v'v on 534- 420 4. . DO O4 3. 3. : z ' I 'I-IE BAHNSON COMPA Y 3' 3. If! -- If . . . . Manufacturers of Bahnson Humldifiers for furnlshlng 3' . . . . . . 3' :ij moisture in knitting, cotton and silk mills, toboceo fac- +0 - - n 1 1 e Q 64 tories, printing plants and other lndustrlal buildings. F4 Ig! 1 fzj Business and Sales Offices: Reynolds Building, Winston-Salem, N. C. 12: 3+ New York Office: 93 Worth Street 'S' U34 34 4 0 Q02vzofoxa4102++203v:++X++X++X+u:o+:4-4++X4+X+oZo:w1++z+vI++!4-51014QZQvzwzofozaze401014+I+oXo+Xo2o:of++XoX++X++I4-vfozeozooxeoxa-via-Qoio'14-nzsozoozoozaxo Qc OVERHEARD IN A TYPING CLASS Class, I'm not going to cell you anymore to put your name, date, etc., at the top of your papers--I'm just going to start taking off if you donlt. I hate to keep telling you over and over-I'm not just an old grouch, but you must go by these rules. And v'oo'v+'1 4:4axeo'+uzQo!1-lvvzeszf-42440v:0'0'u'0'+o:4up-o'+az+ozaa'++'oaislePoif401+vzawieoxoQQ-uzoaxovxo0:0-o'+a'++'4-o:+q+o:+414-uzovxo-vI+sIov:o-nga-4:1-u'4-a'4+'+o'0'o'4o'4 544 A o 4 +4oo 4 4+ 54+ ooo e+++4e4 .gl is SHIELD sz Youn mm +4 3: REAL ESTATE E INSURANCE rg: an of gig , REM. ESTATE -. 'Y- COST L 065 N WRITE gg 44 ' ' :iz WITHOUT is INSUEIQQNCE IT sz .V - .. 12: 121 PEONE 2w3iil f mfgin: l'vxglskLgERTY st 122 3- inston- a em. . . +5 Ig0:4+1014+1442-oxovzfvxvozfoxv-rxooxo4:4014+11-4:4-vzevxovznwzeoze+14+14-up-v:+v:o+!4-414414-0:4-u:+v:4vzoazovxwzoxozafoaxe414414-024-4:0-uxo-vxevzo-sfoaxe-vino:4v:4+:4o:4v:4+Zo+z4+Io3:- another thing you all are careless about checking errors. I-low many times must I tell you that it means a 65 for that cl:ay's grade? Charles, how could you be so impolite as to type while I'm talking? Remember that this is the last day to get back assignments ' ,I in -etc. olevzvaxo0:40:40:40101+514-sI0:+u:+v:+vXvvX+v:+v:+vI+o:0z+axe-414-4:4-ux++:4+:4-vxeozevzevzuzonznzoxooznxnzeblazefzovxozozuxoxazoozoozoofwzazozoxoxovxoaxevxnwxvazoozs 34 94 3. 3. vie 0:4 54 v'4 5. .5. .,. .,. 9, v ,g. THAT WELCOME DIPLOMAS Iii +44 +20 ff: For on th1S notable day you want to look your best. And here is O A 5: the store that is ready to outfit you with every thing that's worth :ZZ . . while at value giving prices. fi: Q. 5. 121 --f.-,LEW .... ...owl gg RANK-Dv STITH coff- 1.1 I un n. usnuv --A un w. rlrm 2 O39 DAO of Q14 vvovvovvvvvvvvvvvvvvvvvvvvvvvvvv vvvvvvv vvvvvvvvvvvv vv evo 5+o,ov.ov.oo,++,o,o,++,4v4++.4+,o,o,44.44,450,4afvtonovi50,450,4gonov,+5+5v+,4oX+o,o+,0,0,4o,+a.4v.++X4a4Qv,fv,4+,4o.45954544.454u.45+o:4v44vA4uXou,4o,454 'Z X'4 X X' 'X ! Z+'Z''Z Z !'+!''X+'X+'X'+!'+X'Q?'Z++! X+'X'+X+'X X X X+'I++!'+X'+!'+Z Z ! ! ! Z'+Z++X++!''X X+'I X+'Z+'X+'X' '!0X+4++Z+fB'!+'X'+Z+'X+6 X+'l' sg zz: o exe S St M Haberdashery Shop 55 A .Q '51 3' ' , . 3: , Exclusive Young Men's Store ri: 2: iz fi' 431 N. Liberty st. gg 55: of 3. Ii giiiiiiiii4iiiiiiiiiiiiiiiwiiiiiiiiQW94i9?Q49W44+?+4446?Q4+i ' BRINGING IN THE- SHEAVES Mr. Elrick, we found that debating story and we just have to have that in. Take out thc class meeting story and cramp story 11 so you can get it in the front page. just as you say. Thanks, Mr. Elrickf' Don't mention it. 'X+'I'+X+'I0X+'X X'+!++!'+X0X I+'B+X+4'n'+'X'+X0! IWW'X+'Z X+4+'!'+X l I'w?4'+X'+X' 'X X X''X''X'+I+'Z'+X++Z+'X+'Z+'!+'! !+'X 1+'X X''2 X++!+'X'fX+'X+'X+'!''I+ 'X' 53 'ij .2 3 PIEDMONT-MUTUAL BUILDING 81 LOAN ASSN. 5' so 'X' 5 Assets 31,2203 79.81 .. fi Ig OFFICERS AND DIRECTORS I fi. A. C. Stuart, President N. Mitchell, Secretary Sz '1'1'easurer ii ff: C. F. Benbow, Vice President B. C. Booe, Attorney 5. 'Q B. C. Clinard Oscar O. Efird C. C. Smithcleal .iz 3: J. M. Brown K. E. Shore If 1? 5: 'g+X I'4 ! ! !' '! ! Z 'X' 'X' '!'+B'1 X' 'X' 'X X X X ! X+'!'+X X X' 'X+'X X+'X ! X !+'! X X' 401' 'I' 'X' 'XHXWI' 'X' 'I' 'I' 'I' 'X' 'XMI' 'F 'WX' 'X' 'Z' 'Z' 'X' 'Fi I went to the door. That story hasn't got a head, I said, my hand on the knob. I'll write one. -And I think I dropped some sheets in the hall. I'll send a boy after them. Thanks very much, Mr. Elrickf' 'D0n't mention it, sir. ' 'si 'F 401' 'X Z 1 X ! X+'+ 'X'i X+'I' '!+'Z+'l !+'X+'X+'X' 'Z'+X+'I' 401' i++l0!+'X0X' 'X' 'X 'X I' 'X0! 1 X' 'I' 'I' 'Iwi' 'E4' 'X' 'Z' '! X Z X' 'IWW' 'Z' 401' 'E' 3. Ii gf: o 133 po ln oo s :iz 44 ' Q' g. GE Refrlgerators -33 0:4 5:5 2 if BOCOCK-STROUD COMPANY if 431 Trade St. ff: O 4 3 O 4 4 '!H! ! Iw9'I++!0X'+X'+. +!+'Z04'+i !+'X !'4XH!'+!'+X 240?+Z'+Z'+X++Z X'+! X0Z'4+'Z'+X ! !''X+'X X'+3'! I++X Z X Z+'X' 'X X+'!' '2 ! !'+!'+X++X' flviwff 504 oovvvvvvvvvvvowovrvvvvvvvvvvvvvvvvovvvvvvvvvvvvvvvvvvvv vvv 4.454v,+u,+o,4-34-u44+4+v.4o,+o,o+44-5,4444v,0,04o-ofuA+5+Q4++,o9.4504450,4of-o4+n,n,++.+n,o+,+o,4-5,4-v4eo,o+,o-up-uA044-o.o+4o50.4v,+o.0.+o,o,+o,+s,o.oo,o254uAo40X4 A +I' 1? Mothproofs Fabrics by a Iii fzj N E treatment which renders 1? them inedible to the hungry If moth vvorm. .Konate offers you three years of complete :ij protection against Moth damage. 122 :gf Advertised In the May Issue of ft: 53 GOOD HOUSEKEEPING DELINEATOR 323 For lll'l!llI4.'!I Inj? f1'1 llllffllll Call gg Quallty Cleaners, Inc. Iii gg Dial 6108 it Burke st. Dial Gros Ig ,:. 5. vvovvoov ovvvvvvv ovvvvvvvovvvvov vvv vvvvvoovvv v vw 0 Y. one0,4-n4Qv,o+4Qo,o-no4,4411-v,v+A+v,4-54+54-v.4+.Q-obdfvxoof-rAQ+,4+,+uA4-5.4+44-v,oo.o+,e+,o4,4-utegognaxe-0,4-of-044-oz4+,+a44oAb+,++44of-0.0-545+o.o+:4+.4o!4+!oo4+444+!4o.o+X4+X4-clog G-HI PROBLEM And furthermore, young ladies, continued the excited voice, this serious prob- lem now rests upon your shoulders. Action must be made effective immediately to overcome this drastic situation, The ant must be relieved of its dreadful burden! It 4' cannot, it must not be allowed to dm crumbs twice its size! 23. 5+upoI+vX+v:++1+oIe+1+vX++14+14-oX+v:Q-uX+oI+o1+v1+u:++I+vX+az:-01++14vxq-+X+42++1Q-u:+o:+vX4+1++:++X+o!+oX+Q+oX+oX+oX+vXovX4+X++:++X4-Q4401+ozazozoznxwxazeoxoxozozax +? 50 F OQQ ig 121 Mmmlt Ufeet Cl1'1nClCy 'E' S ' S Ph 'f' OO OO 2 , , , 3 If: Foot Summzt Street Hzll 132 +4 W4 I I O4 - O4 'E+ Plenty of parking space for curb service and a nice, cool, spacious 'if V4 94 ff' place inside store to meet your friends. See us make our ice cream fi' if 0+ +f+ right at the counter. 'if 534' if of , +14 3+ For Prompt Delivery 3+ OO 64' Phone 2-114-11 5? O4 64- oio 3+ 01024 4441024 aio+14aio+24+14+24+14+1014+14+202401014v:e+1+4Io+Z++1o+Io+:4 axe+14azozafofozozozwfsfic-514414-c!++Xv+Z4-ofoofoy0102014+Ieo1Q+:4-freeze-oI0I+o!Q-vin40:4 FAMGUS LAST WORDS I was there-I forgot to sign up. I'll call you tonight. - Got a slip? - What d'yn say?,' Let me see your Algebru - I gotta have four points by next period - Going to town? - V VVVV VVVVV V VVVQYVVVVVVVYVVVVVVVVVW 'YYY VVVYVW ff!! VV +10,+o:u44a,+o,+o4o14sXo,o50,450,4014++4+1+o,+a44-f,w44+4++44+,o+Ao+,eo,+o.+v4+444-noqw5+44044-v,++,++,+ofsp-o1o,+o,+vA+v4+oXo-u,+v,+o,+v,w,a,+v1e+405-s,+v,oX++,+qQ v' Ili .5 Oi! Q, 221 Say it with flowers 121 0:0 9:4 31 32 g:Q 5:4 .g. W LKER FLORIST .g. PQ . ft' lil Plants, Cut Flowers, Funeral Destgns. 121 C12 . If! Corsages A Speczalty 32 'fl Phone 7422 115 N. Poplar St. Eg if 5: Q4 'Vp ole +14 +I4oI0:4+!0:4+!4o:4 vxaznvzoxnvzwxo vzf oxoxuzevzwzoxnxvvzn ozovxa 9!0:0X+ ozeoxoze 499Q+4'B 4++B'3+9'B'?4'i'i09+'Z+4'+?+i+'b4'4'4+'F4 3+4'+'340?+?4 Z+'Z' 'l X+'l+'Z'+X+'X+'X X'+! !0!+'X+ . , 151 SELECT YOUR GRADUATING GIFT FROM HINE-BAGBY COMPANY F3 .4010 IP C3 E. ,ACD SZ 53 9-6- :B NCD 55 3 33 32 951 4-Elm 59331 CDE' 35 CD o EI O 5 I+'X . HINE-BAGBY COMPANY, Inc. If '-I I rn Z O U rn L-' O '11 E O rn 2. P-1 B F? 'U S- -'Zxrn :ri nSmZ2 OI Q 9'-i ,EQTS N movq O '.3 '4ml r-1 Haag-. mi-.C-3 :s-Pg-'-1 fi...-,533 'Og .. va-L m gr E-Z PS. UGS S: QE nga Q3 S! L94 -, 2:-s-. M ga an 0.0 :r' EQ ...H ru BT' HU- Uqfb no 091 S: :Tp :UT 5 'EHS 2 99' ' 03 -5 EIU' E '10 Q. 2 52. E Ph E., 3 o C E F1 I 2. W o. f' E ff :r- '4 2 .fs H 3 .... 'A- x: 2 Q 2 i 55 i -x+-x--i- r' 4030! i F3 H f gs H .5 Q25 gig aug cu . 3 ml 'F , bvigmm E S3552- ilomgmio spzmqi-U ECA - Oar 9' KIDO? rizyf rw ia 911+-ir F Sfllnfmli ff: ?EU2cEO mcgmwgglsl Emgig Em Si ' U25 igwggoiglg gi-9 235511 ... 0 EHS C11 1? '55 wzofwl' ag mf!-jgmo ef M UEUOZQ rf i-HESM 2 22 33 EMM! .+'X0X I+4ku.X'+!' Well now, th:4t's sweet, I understand perfectly. You just run along now, and don't bother about your classes today. I'll see your teachers myself. Here, here's a quar- ter to get you a sundae at the drug store! Oh, Slade! Your poor little finger! Let me give you a sick slip. You ncedn't come back this week, because you must rest up, and give your wound a chance to re- cuperatef' Wi A l 5' ll' '72 ' was 2251? its Q55 W' fs -455 mv' Emi 1515 535 rn rs 4 as Soi CD2 c-Q 555712 Z 2 E -uw api? U13 5113? 2 gf 2? +X'+!'+Z I'+X'+!'+!'+X'+. X+f. +.'+'X'+!'+Z+'I'+X0X+'!+'Z X' '! l'+X+'X0X'+X !+'! !'+Zw'0Z'+X++X'+X+'Z++X+'!0X'iwVi+B+B+3i+'?4+i'+Biw Pi+'F'?4+'?4uWbuHV?+B40?n940b9+3nVP+?++'IHXHX' +E4+I4+I4+I4+z4-+2414+I4+Z4+I4-oI4+I4+Z4+:4+14+14-+I4+I4+:44:4+!4-4:4414-+I4+I4-+I4vI44z4-4:4+:4+24-44414+14-+z44Z4+:4+I4+I4+X4-44424+:4-+:4-+I44:4Q4-+I4-+X4+X4+:4+X4-+2+:4-+14oxo-+2-+14-+X++I: +4 :gr .5 DO 44 2 3. 131 GIFTS FUR GRADUATION .g. 31 32 3. 3. 3 . . . 3 C31 We have assembled a fme assortment of g1ftS that wlll 131 +4 . I , H +4 3+ be ab l'8C12llZQd bv tim .wrzfvt url 1 raduatv. '- ,f. - - - 3. +54 +24 rg: rg 44 44 4. THE IDEAL Ig 44 Qi. Tim Iwsl plum' Io :elmp ujlvr ull 34 41- :Q .f. If. 44414 +14 4!4+I44!4+:4 414 4:4 +X4+:4+:4 +14+14-+!4+I4+I4414+X4+I44z4+I4 +I4+X4+14 +24 +14 +24 4:4 +14-+14 +I4+:4+14-+14+14+24-+1442+24+24+I4+X4+Z4+f4-+f4+14+14+Z4+X4+!4+X4+!4+!4+:4+:4+I4-K4+z4+24 SPEECH We of the journalism classes feel that we have fallen clown ii' li' ' ii' uhem ri' tl 3' 2' no, I mean accomplished nothing of note. W'ell, Kids, I am mixed up, but I'm trying to tell you that we've clone right sorry work this year. 54 +14 +14+x4 +z4+z4+X4 +1444-+24-+:4+Z4 vI4+I4+:4+I4+:4-4:4+:4+:4 4:4 4X4+:4 4:4+:4+:44:4+Z4 Q4+:4+14+14+14+!4+14+:4+14-4:4-+:4+x4+:4+:44:4+144:4414+1444-+:4+!+4I4+I4oI4+Z4-4:4+I4+:4+Z4+:4+? v 4 + 4 Q. Q. 4:4 4 4 4 4 4:4 2. u c ens es n rug ore 3. .2. Q. 'Q' T ' l P . . - 'f Ig: Ol et 1917611 lltlons Ig: .i. 3. .. 3. +24 I +24 -,. Best Sodas and Sandwlches .5 + 4 + 4 3. 3 H l ars an I are CS rescrl IOHS N 3 C ' d C ' tt P ' ti 5 4:4 +24 +34 4:4 :tl Cor. 4th Sz Burke Dial 4302 ft: Q. +f. 444 +14 4:44:4414-+144:4424+24+14-+Z4+I4+X4+Z4+I4+:4+24+X4o144I4+:4+X4+f4+I4+14+1014+1024+f44:4+!4-+X4+:4+z4+Z4+14+24-+!4+I4-+X4+z4+!4+X4v!4+z4+I4oz4+z4+I4o!4424414-+:4+I4+z4+X44:4+!4+I4-+!4+:4 FAMOUS QUOTATIONS Miss Nix: Not another word, Hnrryf, Mus. BROOKS: Come in, shut the door, and sit down. MRS. LOGAN! Be sure and get ll slip before you go out of the room. Miss GWYN: You got it now? Miss WrlI'l'L1iY: When I was on my trip abroad- MR. ALLEN: And coming back to to-clny's lecture! ay 4..'..'..'.a.a..'.a.a.4..'.,g..'.+'..'..'..'..'..'..g..g..g..g. .g..g..g..g..g..g..g..v..'..'..'..'..'..'..g..'..'..'..'..'.,'..'..1..g. .g..g..g..'..1..g..1..'..g..g..g..'..1. 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 +54 +54 121 III 4:4 6:4 4:9 9:4 33 lnzen Ol' aun 0. fi 'E' Z' cl f L dry C '5' 4i4 931 EI fi: 3. DRY CLEANERS RUG CLEANERS .:. 2 ,. Iii rf: 31 . ISI Q. Phone 5178 - Cleans Up Everything - Phone 5178 Q. :iz :iz 3. -4,4 +24-+:4+!44I4+z4 +14+14+14+14+14+I4+14+1024+:4+Z4+:4+!4-+I4+I4+14 +z4+:4+:4+!4+I4+X4 +24 +:4+:4+!4-+f4+:44Z4-+Z4+X4+X4+!4+I4+!4+24+X44I4+X4+X4 +14-+I4+:4+X4+X4 +:4+!4+:4 +24 +14 +1014 444:41 QW4W?M ?MHWW+aWMV' ' ' ' WWWwWM mMk?+++46W SECURITY LIFE AND TRUST COMPANY ' Home Office-Winston-Salem, North Carolina LIFE INSURANCE AND THRIFT Mighty is the power of time and compound interest. In 1853, 78 years ago, Ehrhardt V. Franz, having made 597,768 in the grocery business, left it in trust. A Federal Court reports that it now amounts to 5S10,000,000.00. Save money and it will save you. POVERTY is SLAVERY. The man without a dollar must do what the man with a dollar tells him to do. So get your dollar. Life Insurance is one of the best means of savings and the only gua- I 3. rantee of an estate. at 'X'+X'+!+'X''X'+!+'b+!+'!++X+'!+'!'-'!'+X++X'+Z'4sWX+Bi+'b+B+B'B+3'P+k'XnW60B4+4+mVFaVk3nWdH+ZmW+F40Pk+5K'd+i+b+'X++X+4b'Z'+Z'i X+ HOW THEY THINK IT HAPPENS MR. PERRY: We are gathered together this morning for the supreme purpose of selecting the most prominent members of the student body and faculty to be mentioned in the space between the ads. This is a very much sought-after honor, so beware of suggesting or writing about anyone who is not an outstanding person. CLASS: Is Mr. Joyner prominent enough? MR. PERRY: What does the class think? 2+I 1'+!'+X' '+'l+'l+n +X+'I+'X0X0Z+'X'h VmW4+4+4'vF+I+'! X X'+X+4WVh9'!+98'!+'I'4 Fi B'4+5 l+'X'+!' E2 5 Q . , 3: an 5 . 3. The Carolinas' Finest StyIe,Quality, Satisfaction, Economy and Service Conveniently arranged under one roof. '!0X+'!'+X'+I'+I+'X+'I' 34?i9'X+'X 9i+'l+hW'X+hVX I'-'X X+'X'+I0X+'X0I+hW+?+X X'+X0I I''I F'X+'I'+X0X+'!'+X+'X+n +!0l+h '!0X' CLASS: Well, nearly every student knows him after they have been in High School a week. MR. PERRY: Well, he will do. AND HOW IT REALLY HAPPENS MR. PERRIY: As usual, we have forgotten that we need anything to go between the ads. Get busy and write something original before you leave today! ?4+h VH03i4Q+MKWks'+mWsWwWM+HW+WB6i++!'+!'+I ! !'+!+'X'+!'+!+'!0!'+!'-'l'+. +!'+! !'4+ 4 Winston-Salem Battery Co., Inc. ' AUTHORIZED SERVICE Starters, Generators, Speedometers, Shock Absorbers, Radiators and Batteries United Motor Service Willard Batteries ' Phone 6252 121 N. Main St. MWWKWPFMWWMHBFMVMWWWMWMWWMWWWYFWFMMWMWM +'4 : 44 ,, +34 3, +34 I 3. ft. 3, lf ,iq 4:4 I ,, .. 3, 3 1 44 ,, 3. 1 3 +4 +34 3, 44 3 3 +14 4:4 I , ,f 'S' 4:4 4:4 Q 1 ' i- ,, 44 3, 3 4:4 ,ff soon ron urs: 3 Q +4 4:4 3, fc. i, 'if 4:4 'C' +14 44 4. 4,4 44 vw vvvv+vv4oov+vv44v 4044 vv+++++ ov vv v+o++ +4454-+z4+44+.4+!4-4,4444-4.44.4-+44+,4+A4+A44.4+,4+,4-+.4-+,4-+444.4+.4+,44I4+,4+,4+,4-54424-4.4+04+,4-4.4-+,4-4.44,4+!4+!4444-4.4-+X4-+!4-+Z4+I44,4-4,4-4X4-435444.4-+.4+.4+,44!445-+14-4:4+:4+t4-4:4 PENCILESS CLASS Monday in journalism. MR. PERRY: Everybody rake out pencil and- CLASS: We left our pencils in our lockers. Mu. PERRY: From now on l'm giving Zeros to all those who don't bring themf, Tuesday-ditto. Wcdnesdaly-ditto. Thursday-ditto. Friday--ditto. vvvvvvvvvvvvvvvvvvvvvfvvvvvvvv vvv4vvvvvv+vv vvvvvvvvvvvvv E44,4+,4-4.4+444.4-+.4-4.44.4-+4443+54+,4f+,4+.4-+,44,4+.4-+44++4+.4+.4+,4-4,4435444445444454454,++44+,4444+,4-+44-4A4+,4+,4-+44-4,4-+,4-4,4f4X4+14-+,4-+44-+4++,4+,4-+,44,4+.4+,4+,4+.4+44+.4 +4 if If k X Ig! Zn of letting . . our children Pla where HoME HZVLISHED LAUNDRYH . . . is taken! Laundry sent away to be done in tenements or private homes not subject to any sanitary precautions, is not safe for you and your children to wear! Why risk disease? Our hygienic methods and super-clean plant are always open to inspection. Send us your clothes and benefit by this pro- tection-1et us start this week. DUNN'S LAUNDRY PHONES 8153'8154 'z 3. 4:4 ,I :if feb cf: 523 4 4 3. 3. 4:4 'i' + 4 +34 4:4 434 4 4 3. 424 5? 4 4 ,3 .21 4 31 42. 4:4 4:4 34 434 +,4 4'4 42. +34 4 32 5. .IZ ft! +24 9 O 3. O 9 O Q. 4 4 Q. ft? 4:4 If 3. Og! 9 O 5:4 3. 3. ,g. + 4 +34 3. +t4 5:4 7:4 0:9 3. 3. 3. 34 3. 9:4 0:4 6:4 3. 4:4 3. it? 9:4 +24 +24 4:4 +14 +I44'44'4+'4+Z4-+'4 +X4+z4+:4+'4+'4+'4+'4+'44'4 +'4f+'4-+'44'4-+Z4+'44'4+'++'++'4-+'4-Q4-+'4-+'4+X4f+I4+'4-up-+x4+X4+'4+'44'++'4+'4-+'4+'4-+X4-4'4+'4+:4+z4+:44'4-4'4+'4+!4 '4+'4 +534-+'4-+'4-+14 444 4 4444444444 444444 44 4 4444444 44 444 '444444 I 1 ww? 5 35 E? g 'ii 5 35 5 'X' 55 5 'f 5 ww? ww'-+:w' 5' Z 33? 71 QQ Oz: P1 mE 4 993: m 52-S no 933 '4 GRI Egg 'U n-:mg P Zara -Q oi? U Zn-U P :NYJ v--Q Q WS? 2: 3 C+ O XA N .'-M-+:+f'.+'x0z+fz'+x++x THE HOOD SYSTEM INDUSTRIAL BANK ' 18 West Third Street 5 2 Z 5 Z5 5 ? 5 if 5 Q5 hw 'Tl :D Z o c: CD fo c: o +-1 aa :I o 2 CIJ ZZ!!! EGWFG VDU1' Ch '11 l Zua Cgmo-I r-1OC3Oh'I n-Zrnwf ms-Ernm 7571-5--Z --Un AV! .us ,510 Q0 :HZ :n,,-,WZ 2032-52 Primo 02's me :r'D E.O 'S-Wag' 'T D ,-wr-1 .lnkq 5-u 1-1 ' if Sai onli' ua,,O gd 2 Q I ra : EI C3 0'-2 o I3 F1 :r 0 5-3 :s VI 2 0 'S U7 '-1 ' '4' +'I4+!+ .. g 555555 A E 'wQQ' UU s i EE Zfgfm f 5 UU 5 31 m xg 33 , 2:23 oo m Q of wg O 522945: 3 F' Q IFJ Q ,ga W 3 miaaifn 7: m F- ' - N cn g?a.,w.::Q 2 . -2 y-.4 .. reg'-fn Q U3 53 W -A is 0222213 rf ua 'f ' 1, 3 3 0 E ' PE 5 S 3205 w 7- 2 3 wi U :sa5'?,O r' E- 4 FH vi' C: Cn A5 m 5+ gg w ' Pm B Q 7, 4 34 ada- 1 55 C5 5 I2 91 -1 fa Q ig za :D -U 3? m 'A 2 ' 21 0 Sf Z U1 .f 0 Q Us zz Q 2 Z' 75 51 : W C13 so 5 sf FT, 5 0 9: f S, CD , was m Cn Q o , r . CD 5 3. in 4 5 : ? ' rf Y Q: Q15 I ' 5 2 if Q z fs +'I X+fX+ . ' ' 'X0Z+'I'+X+ ' !'+Z+'X+'X'+Z'8 Z+'I'+X 2'+X l'+Z' 4' U3 O U' U' Fl Q F5 'L M 'U 5' Q 3 Q O 'Q r-'!'+X X ! REYNOLDS BUILDING Winston-Salem, N. C. Dial 5189 0 0 8 . 'I'+! Z++!+'I'+!+f!+'!'+!''X'-'X''!H!0I'+Z+n9+X !'a'4+Z0!+'X+nW+X+'X'+K+'I'+! !'+! I+a +X+'!'+!'+!+'X !'+!'+. +I'+! X+'!'+!+6'+!'+!01'f!' .g+.g..g..g0g..g..g.403.,1034.4.,g..g..g.,g..g..g..1..g.4+.g..g..g..g..g..g.,g..g..g.+g+.g..g..1..g..g+.g..g..g..g..1+.g+.g..g..g0g..1.,g..g..g..g..g..g..g..g+.g..g..g..9 Q Y 31 31 7:4 fc! 53 ln Another Year Q H e gr How different that boy or girl of yours will lcokn but :fi if ' X if 34 photographs of children never grow up. :ij 54' f3Q .S Let us help you keep a picture record of their childhood. .f. Telephone today for an appointment. h :iz :gn Ben V 0 Matt evvs :fn Ig! 317 W. 4th st. If qwfwjonj.0:4+Z++X01+vIo+14vjoxwfoxoupvieQ4+24+2014-fX4-'14+Z0!o!++X+v2++:o+j.+I++:4vfofaze+14o1oI4+14+I4+I4ajojnfe-n!0zo+!4+14+1uZo+1014ufaznxufojwjwlozoQ4 JOURNALISM CLASS I think that l shall never see A class with so much energy, A class that sits and chews its pens While Mr. Perry sits :md grins. :Ionic-ozevxsoxovzvuxovzovzn-+3014-4:4424-02014011up01+vxoozevzevzozsozeazovzeaxealazovzoozovzozoxevieuxn-Q4-axe-uxooxn-0:4szovhozovzoaxe:Ioozoozouzeozev1QolQvIo+X+v:ov:4o:+v:ov? O4 gg '24 524 9:4 34 O'H ' V4 J. 'f an on S ru g tore 3. 3. 5. Q. V4 lv The store you know Q. DQ ' yy 43+ 3. of , ' .14 YOU SAVE WITH SAFETY WHEN YOU TRADE 'Q' of :zo 3+ WITH US -:Q 0.4 0'4- +'v so .5 3, 3+ Phone 7-168 Phone 7-168 -5+ 00 if '34 ff. V V 9 V V W V V 0 Q O 0 O 1 1 Y Y V V V Y 1 Q V Q Y V V W Y V V V O V 9 V V V V 9 V V 1 V O V O V V V O Y V 9 V 9 1 v v +554 +3 stun +44 +5 50,05 50,4 of o,o,n4o+,o,o o.Q+,+,+.oo,so,4o.4+,++4n v4o-0.0.4-v,4o4o,+v,ov,4 4.05454 +,o+,4oAQv,o.o+,o +44 of ofvf s.4+,o+AQo4o+,o+,o+.n,o 4.0.4 0,4 +3 PASS PLEASE STUDENT: Going to the nurse. MONITOR: Sorry, we don't have a nurse in high school nowf' l mean l was going to Miss Dobson's office. P,xss1-Ess' THE SANIIH MCHNITOIKZ Good try, but she's gone to the bank. AGAIN! I give up, take my name, it's Josephus Isaiah Pokohuntosf' 1 I j+WM+'b++i+i+44d6+WM Wi4+4XWi?i+?FMW+MYWM4mWW?WW?9B . L.. 5ii- H ,?x' , 4 if if T s ' X : : 2 go s f N: 5 4 T' 4 ' I 'i ff' T-il' 17 IT!: 1ff'- l i -Ep 3 ,., - 3: 6 '26 - G - + ll ff m f fl: R In: n llg ++02f5?iL1 ?? +'f3 sniaf ss 3 L - fo G gf uf-2 5 ' ml 2 QE ll ll W S - : I l l iilffil ll li W 111 liiii II . - ilil, ' 4 - , - I fi.-43-S': . - 5 -'fi . 'f,'- -, .. .2 f f 1 .- ' ' :-il i-ii L lf 'h 'fW ?f'. 'X E'Gi2lMg1A. Ym - ' V .fee , 4 T - T ' is ,'-,Q 'X , V ,- W 7.--.5 ta u!-lx XX .,,:.,..,Sx , Eff fmllkm '- x xxvN?1X? 3'X U5 ' ti: In Our New Home We Are In Position To Give You Better Service. E Our lines are most complete in School Supplies, Art Supplies, Janitor Supplies, School Seating, etc. Q L GRAY sl CREECH, INC. , WINSTON-SALEM, N. C. 3: :S Carolinas' Best And Largest Paper House ,. +1f+. +w-+1-1-+z+-1-+1-+.'++.'-+1-+. . '0x++.'4+.'+fx+-. . 'f+z+'x++x++:0xf'x-+x-+x++x-+x+fx+fx0.'f+.'++z- 5:+'z'+x-'x-+x- ' wwwqewawewwvmwwwwwweww-wwmemwwwwwwvw-was Looking Ahead When school days are over, and your helpmate chooses 3. A Home to Furnish ' 21 Remember , 32 , ORRIS-EARLY Kc Co., Inc. if 's+:++:+M++. W+MwMWw M ' 'wx-'a+-1+-xf Ig wwmwwwemwmwwwmnwmwwwwwwaewvwww-eywgf REMEMBER IT TAKES LONG VVEARING SHOES l DOWN THE LONG ROAD OE LIFE 3- 'S' ' H I N E 'S WEST FOURTH STREET . +.'f'!01+'X+'I+'!+'X'4'+l+'X'+X'-'I' ' +6wVki+K+4+K'i'+F4+4+6 Bi+4+'bB4'40ki++4+4'+F4+'kn94++4+40b6+. ., 'I L 'I' K' Jr A ' V wgq . 4 rv . , L. 1 W ,,. 1 1 l W l can I Q vf 1 , 1 - f in . M1 PM . i- , . f. .4 A A iff VL!! ,1...-ifwvfi f -jL42'74,.,cZf -41 f ' , Zi L xi - 'J-f y. .47 ,Af . , k 47- ' ,- W fx r , - :'Q..-V ..,,1,..,.-'xC,,f. '11-J fri: 82546651-7.L,!1Af,7, ,Q ,VA 5' M71 if if ' fl Af-fzfzdgg, e f f f ' fn A in ki NALL-f,cf,1,?J,'f f ,,f'e,,.vl -04,52 , w--E,,f7f?f759,,7L,- A, , if g . fi? pf N 3 7 51 -,V xC ,..QfJ 41,1 19-fLQf--wif th 151455 ,.Qf,,,i,,x?,f A .F Ly ' ff If ' f ' If , N - 1 K J' fk f'Mfff wif gm K fe W' ., ,A , 4.7 ,Wy 4--,.-LL.,- I ATT? Y N ' A,.,- 7 - ff' FL-q 55- -f,f1' 1,,5x Q fi 4. , 3 X P I 1 , - V7 X! ' X ,Qf,.z4Av-ff-Af 1 X90 E. I ff ,AIZV X J ii 14,6-J I I. . i u V P, IL lv' I K , 4 A.. '. ' 'fn w W 1 1 4 I 1 x 1 1 r. 1 ,N 1 I . i ian. ?..bB3.n.':. 1 . Vfsk'-2 . ,in 1 , r 5,1 . bv., .Vx - w - X 1 4, A -. Q .4 I, Q I xl'-3 -, ,J . ,tl 7 .4 K a ' ra- 'as ,--,qw 2- ff 5. ii' ' i:V..,,, T. Ein-f-rv ?-A , . V . ... ' fm - V I FZ' ?g'5::VS:.V,u5 , V I . F TD 7 fx NTT' , A , E ,.f-,:- ix Vg.g3g,1R '- .gin .,,. ff 1 f 'ze if - V - wi-'QQ'-' ' fw.1...,1 . . ' 1 :f - ,. ,. F. ,X A. .. , VV ff ,--,r. ' ,- WW' , u' 4. blfphi if- ,-. .JA 1 -. 1-P 1. N Y'w-, H' 'eq-SE'-Y -'.-. V' -.. V Alf' '1-V Q., W- 3 .V 1 1 X., -V. V::,, ' ' I 1 -.. J'-Q! wa wg, ,J . : V 1.6 ' 1: . --1 'N 'A ' .x ,mfr Vvfl, , 'M' -Q .-+.. ' , V F- 5-P: , - V Q.x'.,iI'02V-, , L+' V- -- J f '.'Ta,L ' X '- , ' W I. ',,..n,T.rI-,Ht in I . . . ' A-:EF if , VV J - V . 4- ' '--113-:VV 9 -in .. Q .' kfix Ziff: . ' f , - 'yi M .5 ':',5.f.TV.v, .I , 'V ' h , f yy, ,ru ,, . ,V gg- gp , .J l , , -' . - 1 z'? . - ' 'N 2 A N' Xiu' V:-GL n-fm -Q ' 435,-r 0 Q A, , Q xx if V245 - 'X :A , Wg, waw+ ff :Bea m X- ' 'V.. -A - , . ,K-o..f,,a,. 'X 5' 4 QZQGHTQPMQA, MV A , VV V V 4, A , ,AZ Y, ' V . -V- e -, X' gf 1 , -Jn-.,iJ,' 'Vx -, ' ,--'ifrgfqf' j-,T'3?a. 1 :gy -My 1 M vu 335.3 ' uf .V ' .M ,-f'T7,m QV.. 15 . ' '.I ff .QV- ' Vu ' ' Y V -..Nr:.,-P .. mg: nn' HRX L . 1.4-V L21 ' f , - .Q ' A Lf, P ' r' Mun:-VV: LL ,i.:- 5' Al. : -M 'aw VW V ,N H - -. - - ' V- --: ' Aw ' -A-.f, fq ., f fs .1-Vn1f,waSVf. ' -,- , gb A - , , ' 1' . - 1,-V -.., , .X 1,1 Eqzgi if 'A V yyv ,kin-Q VV H J' fu . ' .' ' 4, ., x 515: 'K , fwf 'L ' QM f'fs ', ., Q.,-'X 45 5 0 55:1-,yi ' 1 X113 5 - ' f3'fr51f'f,3 A .L -fN,:.'fE-+5331 ff ji, L- 3 . 'd'S'f'2b1 j.,.55' W- V, ,ik , ' 1 v V '?- -.xi-:v-L5 ' 'W ' , 1 - 4 . , U6 , I .zip N: A 1. 4 2, : ' 'TLT . V I . ' ', -- H ' :f i st - 93113 I , . Q -.V-51 -, is .wif ' V ,- '- 'M .-. .. 'Jf'r :Y-Li, ', V , In 1 , ' 3:53654 1 , . I- L ., . H Q' . .. l ' 5 5, lf- .. n 93519 S4-au. A 1 3, H 1 1 ' 1 , ...,... '-Q .Wg ., ' . f 'dn M- mil... .v 'H . '+R , V xl . H 1, Ir.--V ,, -X . A , V 'V A ' L ' t -V - V , ...f- nf- V , ' 'W A ul , , '11 -f , '-1,5 I A 1..f.', - '1- ,, ' V R ' I -I,, 3 .,p:. .i31?f3kT . ' I -, -1 , Vgqkw -.,-ring-g.w,L.uf'N '.7'niTfV:X'xf,'2Z1g-sv-1.55 47-'-,,7V'f'w,:ZI 'fT,?l ' X .T'zfligfn-':. -4,-fb'- ,?'f,e:h:1f'5,4-equi' , V , -v- 't'f 3'-Z-ffff 'L -f-iv. ' ,J ' . ,- - - '- ' 1 -11' 2d! :ri f5 '3?g',br? l A ,:ln4r-- v 1 ff 5- ..,,- 4- 3,3-.V .pq-, ,av it-. AL ,,...-,.-,ff V.. L A ms- gl. T -.M ,.4....' N