Proviso East High School - Provi Yearbook (Maywood, IL)
- Class of 1935
Page 1 of 166
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 166 of the 1935 volume:
“
vz... .. .. 252 '11-zigeiie S525-.. ini lem:-K A ...S '-4 '! -1 wr mn-'11 L s ,w.i,. 1, . . 'J 1 Kin! 1 . we-sf -,,, X I-! Win 51.9, ex, ,--.-3, 1 ' H 955' W' fflhlqf 55? maine .'.1-mafsag. i . .,.sf!f::-1.-f-2111-FF-1n:..m 'ie .1,wAa1::.:2-1f:si.5 :ai'xsie,:'.' 75.:E:i1:,E:'-' 5595553.---5: , :g-1:51.g:f,gwe::g:.3.--' .:::f.5Q.sg5ss:g:s:fisasug-is-11...--..-.-.f..-:---- H ..1. .i.1,1.-wf:1.f.1'u::- 1.1119m-:15e::,---mm1::r1x:u-firayaele.-1-1-. . . ..',,1 f1--- .,.,.. my .......,,..:. ...H ..,. ,.,.--..,...,5,,.,,,, .:1-..-1sn--,--a..f-lt.-z...1-.s.--am .fn-,-fi-1.----. -. ,....,5---f-,1.5.- 2152-nz- -eQS...1-.aaa'bszainElsa!5uiz5g555fg.gg!jta1a5i L -------ff--LCM mf.:-1.-z.-.ia 2zazi:mQfe..',',.'52aa.?iEf..f.:1.11.5252..... zisizaasefzsfz---sm.-5.1 ....-.1--.-.3-1. df,-ii .. .:i1e::::::q:m- -.sm-see2eae.f ,:4EEE:Zil?ii3?5?? nifheggggigglqggggigfi-.Q .. -. .... .. ,... ....1 4 ,, A---1 . - 1 lui L' X, ,.-11112135-Mi..-, L,-Qi, , 1,,3 if 4 v------:as1'-,ea--:--- ..-e....:. .' - - - --W5 'X-'FW-'fflae-zae-z-1.z-as'.s-.se-as-aezsme-,. N , ' -' , H. V --img-.?!.-sis.3ZEEi7i'51'.,aee--as-.2-1--Q-f'9-1'-'Iwo' 4 Q ,' - ----.-..z---..-..-.-.,,---1--uf-1--1.---fs..s--y i-3 ---.lm 1 .1 - H.......-.,---,a..,,..,..--.-- .,l,.,.4-..,,,,,., . . , ---s-am:-1-1-a'eg4-ug:uw-ee'..n.-.f.......4gm-me-1 mu- NI. f -fy.----w...nf--15-W.-55.M,.--Ui.,-,..,...,,.. ,M ,,, s1!E2.e2g:5aE5es21--ali.:-.!f.f.a-A-.nf ll - - v, E H ww- faeeaazzjag.j'.31saa-gas.. . - 1 1-,L , f Isa..-4--.1112-.-1--1-,--M. 4: 'ff' -g.i.!i,',,?1..- 1--------f 5 H 4 VH' .Xl'1' .H -1- -.- 0 13. Sw- 1 is . 1 -1 AB' A- we wah'-s-:.-51.f, -.1.--faz.. 5 Wfllfef- ni.1.A--....- '5-s-,1fs:tiaa11 It 311111 1 ..,. 4- aw Rigs I I nh ' !51.15Z1:. :,7z'1 .,., :I W,,,. A 3. ., ..,. ......,, . .. .. '-'L-f-mf-H H . rim'-H fEFE iz 355251251155 mil fzzli-:zee iSn'2 Tu 11: u. ul N ' le! ': :MQ 'ffm-,--.----...- www llv' .. 12:1-.H-...,.-,-me-1.-.--,553 1 Ln... ..,f..L3 yfixu 1 , miiiliin Iieasrgi 1.15- ziaaesseas-r--1'-.-.-2.M 1 s- 4 1 L 'SE ' 9 'ti' mi -s-saf.ss:1-'if..f:,.':gwgg-I um. 5 ,' .. .. . .. .. .. .. ., . -, .. .,,,....',, 'Ffh 1 -lm!! wfrfmxi 'lr , . . ,-my-,,,, .. .M 5 .wr ' x . mari' -. A f . ...,.A. fun camel- n 'H ixwfifz QEHQ .. -wee -'sing 5--.-2 .. .. .4 -: 1 1: f-1:1 1. 'mx ..:-:A 1 ::,-::':-- . .. . . ,,.,.w.... .um .... ,... 5' uf I K 1 1 .... 1..... 1... ..... .....f...,g..... ,... 4...-...fm :iff 1QQQi'!fQ?9iA5' 'E Si?25s2-- if ' ' 1LZ.4,IIZ!H ease'r..-2.5.-.,-.. 21as:.-,.. -5---...--.H aye- RA.: !':::5f:'.7fI5-'ELF 133-uyxviuixgmi - .3--.1-Q. .,..,. :.'M..--1i'- ,--s-: ..1.f -- -- -I5--j:'.l's2 -iv -5: 'milm:s1!1e:iilgeszsLs-I-:Ea-me--21:m:----!m-!'---p-mlmsmruzgznz-fur.-:Ll45:e3.:E4.z-1- 3,316-gfgqfigg-51fg1.1-:g3,155g,n:5:.q,:qn--mv 1 15: ,I-fs-HIessflmf-!15'ss52slimsuinggm-.3iff!-115555351531gimgggqgggmggpfzgg--ggsgs.Arms!! ---1--..--gum-r-21. w-v-1f3:g3gg-gge5g4i-a-1--- -5-MH1-Q-wgggxigga----51-1--1,111sqmzeeii-'gales-N.-----.J:KinW!.p--,g9-.-5g1-ng1::,uEa51334.5 .g51gggg3:5gg:gg555..5.. q.13ig5xf5,5g55g5--..- aeifiz IHtQfasrf-fffwfiflvf21:91:411f.1?f? f5N11v5211112542215v2YWi2t'Q15!imfliifvia:ei im?-5i'e::Yz2:15esfsf'fs:1e' ':::EE5uZf:5I1E1 ' .. 5,.-.i4s!!f'..as5issirazfiss?522-21z2555Yami'-'izsasaizifiiH-aims2iiX2Esf2saasg1:f'1tz::'2L::.1..5gg!1:...s...a,1.,.:::'..1'-g5.ias.a'af: . -H 1.--wa.--.-r. . ------M .I..-W-:.s.K.,..wxH.-13,-5-Hel----mum--Qq--5.--us.4--1.-.-.12-mm.....-...---:.wg-1i.,-..,-.-.1-......--W.-1.. . , --waz. -1:-rm.:.1,'-:uni :H .Q ' M.. :., .,1.......,.?1:1g.:1g:.:-Q:in1:1.'L.m:.:4.:4::1ma.h.:1:::.4:-.-.-...::..w: ..... V . . ., . .,.,-... , 2.--in-.1--fm-1-3-1-fi.ggwg.nfgw-,.-p.--5--1----11-2-m5-.eu5.--u---f----,--L.-3---mf..-1-.-..---.z,.--3.5-,Q , - .--I-.-mf. , 1'.:5-Lsiisufa.--5:5 -heMs-'Hssm:?i.91'aiEe1.312a-Sm23--52-m-rme-IF51:32-'Isis:-5-az:!f1z,'a.2!gsiff:s25555-:'52g::5g:dig3-!:a5.g,L,.:.:gg:p-1sa.-U...1 -ff ,--1.-zz...----1--1 ff --'f 1i1a 11--ls-e-effw-----rwmfs. -...Jem-.-.1-f....-.Q---.1.-1-41-'feats--s.as.H5esssF2Isg,5s:.fx:es-,ans-5.--aaa.,-.safar-ga-af-f..-name---ee-as-:ew, A-,-2-az:ae:..e.:f-'-H-s-mf---.2-.-1--1-513--'fax-sw.-1-23-3555-34..5335--1.-ai---1-155-1-54-.:-21.-mm-1--qgm..-.?.-.----H?---N-----.1--53.55--3, ,-.ig5gE5,,5533553,, 1. nf: :::'fu 1:::':1::L :::1 245112 i.:.1 151 !V'2?'E',E5',i i ' :2'Eir::5'T:-,135 Hifi!! 1 : :::' -'g'g, ' ,6'.4f':::' 'Z ' 1211: 11216i5L:1l1't:'r:' 4 4':f :.? wma: .,--:.-- .E-,-.-44...-...---Z-H 5.--,EEF ,. .31..--L f.,?.-....... ......,Q..,.,,i.?,i-..-!.-,.i.,,',-J:--si'a5!HZf?'-21?--.2-E.52-5.555-.5 J---.qq -Em .H-...I..., fi..-53.,,,f,,-.. 552115IP5Ji.Ei:if:1?1f3Zgmi:Q?'fN:if:5 alms!!-zwsssl-Haezlmsziaeaaaf:-in-s-asass.-1:ms,s.:1-mzirghsuf-,zzffxfrzsss-:-11,,za'rfsgragq-5-mxses-ifsfa-122-s.-.-p-if--a--W ' '-1-Wagga-fi-lits' :ga 1121323sxfpij-f!.w'?,z:.2, ':si7sgsfzzaaesf.zesazaggrssexfp-1zsiaggamleagsff .nun Lmfpzfkeefaei'-e-s-asf-sw-ge:'izf-fef,g.-f':g.f1aZ-',:-11.i.. -.i.q' gas-izagqgsggi - -fa, i'5i'i'?-5S!2i L--Igeass-nz!-r-1a-es-:mea:z.2:zazs.1:aaa:2:weEeme-areas?-'51az.:-'-gafwiag-1-2 sh. sf'vf'1.2f'fz'1fe :2s':1f'::s-5-512 Il:!::l-!f?e1Ef'!'1i'1l?5'5I:?!5Eli:LZEI?!H:i::.' ., :zE17.!!?:m::::A:J5g::a:- :.1.f.:..+.-,:.. :5::1'f .r.:.,1:q..r,:r'f':-:f1X3F'.:15x5:P::i:x'Hx1:!:f:if:-I::z5g'?Z:l:':Lzl' .gu,.,... ....--.,.,..,.f,....1-..........,,-- ., -sn 1---1-------w---1--.--1-A----....1.--W-1--ef-:.-1-1'-cg--w--.-..r-y-.-I--ew+- -'-- .-----f-I-L--.---M...--.e.men- Lvga.-:::.-2115.f:,::f.--.-::qy-:-.m..- -----1--.-f.-:..ff...-.P-. w--......-....-1.Q-,f-..-,.,-r-.1..-.-..,-.-..-..,., .L-M. .----------.,--. ...., ,......,.. .. -.H .- .-.L-:N-.1--.-,wh--.-4..-s--M..-,,.,,,,,.g..5.,,5.-5.g...,-,.-,,...,.u .,,.,....,.. Ui.,--H..-,--.',.--1----.-,I--Q....----.... ,mn---.5 --,.1.-,K 555,.:..H.,.,.-. zi?giEmi?ai-i51325952353521Pfff?'EEZifssYf'iii?a2sffar5f2ige5sa!a2s:Ef-E.efasf'IEZi?Q3E25a2,24.2geEe:eH5i?iEQas?h1zSYmigisit-wat!!!leans!-aefefew-212'-slzigieigil arise..5sa-anne.-z.1eses.:f--f..e:4.zua-fsas- -- -ffmsiisu - ish -11:-1 1-ffx5aa44ag12s1msaa....!e!.- -.-new-:-saireqgqgggg-fggggigw ' 'S 'J -'i''3-LaSiiiiedihizwsiafxfgiaisfmaeiisgiaai eg'-...,11 -E1--Lf .. .5 V''S2'-1-3552553531315-3'3 . -.-51: 1 2:1 .1 'Q' 1' E- .' .5ae.:.u5e72f?5zafax-2:23221f:2a12a!g-fxllsmiiwi-'Azf-5221?J.: '21-n1nesrzzza3imzfi 3f-5111f1f'??52es:aie.e2ie2a..2:52221za3'ess2sis:SEQ:jesigisgzg.-22:7---3-2112'- sm.:--slaaf5'f-------2 ---1 awkails-,-max.:--s:2..1 -' -es-.-s---s-aa'-- .. -heea-'mag'ialsaasaleeeazm--fs-xefa-1+-3-1,--4--sew--'-s-4--gf.--.s .v:5':f,: is!-51:1:f51:essaw'1'iaL5Q. 595:28 5-.ima-vnzs.1aI -5,:,-75551g::,igszeu!!.Es!-- fkiig--15-15912--' 'fi-int.. -:lg.gpWe-21.:fn1-sgzva-in-11--H-2 11-1112-s:.r'fs.zH.-...af.-ms-.-.f.i--1.-.--.----..-v -ff '.-fs::f:..-sse :ss':-z- Huff'-'f.....-112212---'----5...-4..--rn f -a-.'1-:-1:.'-- Inm.1-242.1--ireilssaztffar: i::'1'...-21:i:s.f-ff' '.... ...,,:::,.,-:. :ff:f!:sf:it'f-:alll1:e:i::1.--mifami:nm --:iss-.siezrliimh !.45':Sf'-,?'!f-:iii ---fifzmmzs--vas--'lff'--- l'f 'f' .. fn.. .11--e-f--a -sf-s -sfsa.-sms-11'use----.:-ai.:-4:-asmzaszass1'e'--12-'f-1'-'-2 Sf '1 ' e.. .. ..., ...iQ,.i.1.x.-...f.-.-Q-,iwiiipsifi'52-5-EEisigweacziiiillifIE!2915:i!i1iE!eiiESEE255S?5E49 -'Y' .na 1 yi ...min ...lwzglw1m::-.-,1--.::...:.,1..::::..:Egziifzg-:::......a..,,.:,g,.1:-,gf .,11::.i:-:gg.,f::5:u .3-Z3-.,5g,.:5i.5555. 555, x 53: 1-1: 1-rws.a:Q'-ae'f6-P':'1-'.12f1'11.s':,f-11541511' :'fa'z:-- 'f H1 1 1-f- -- -- -.----- ' ::f Z' .-I'f'1si.:ef'5e:1x:?2:13iasf.a1f2e3235-2122: .E::EE-FFL-1 1 ag 4' ,' ' ' A' ' ,, 1 'ia -:. ...-,g.m---.u.-.:..-1-1.---my-Z..--.-.31.--3-, H H U, 1 1 .. ....--, ..,---.-.--3.--V ....---11.5.,-----.--.f----- 4 J , r,, I IL 1 . 5 I ...:.,.:.i:d:i'. ,.,.:: ...L-mis:--zum!i,:w:::.:--f...:4:.1:::f:'::' 1 xm I - .r a r, u 1 -s.-:a--1f:-ew--11-'uf'-1.:::1...zffst-,'.:1-me .1-.--:.ae's'.' J f. U- - . 4 - ---.- :...,.g,.-.....,....3Egg-' gg QMS'-F1 F LQ, H 1- --. - A.- 1 . .A . i1.'1'71u:l11L17'11 ,'1Icerifi i.l5 'f,E'V'EEi'E'LFEE: f41::.'::'. I I I I Q H 5414?.Qu--,L---..-.,.1-,-.v----.iw-22--..2g!I..ee-!.:.zlq-4-1-1.44.--L-?:f.!l' H Q-13 1 H ,51 .mu YI .fu f'- -UNL - .. ....k..-. ....,.......,..rw.,.yv.,..-.1--5 rs n L 4 W , , ,J ,y X ,, --2251- twelve5135152111assieixaa-Qaeirifezmgsas-2z's:.n A-5-esp'-, r s . fu s,.1rx.--0511 - 1 gif . xg 1 ,lx U 1:1-linhnezwk-1f:,:::?::::::'g--:ivan-::::w:.g:.:i:f?:::-1-f:3::5r!ic1 L, 1,1 :M H ,K :wx E l x 4 Mr , A Kylix' - w.---snf-Vf--ff-'12-'wr-'1-'I M:-155s .if2':'y':-'f . -L ' - r :isfx'mfssanegsffssssa-maisQs51!a42P,saf.gae'5-!12'zfi?!''3''N' ' ' '14'l' ' 411'-F 1 1 4 1 f 1 ......,-,.,......,.....:......-...-.....f..,.-.-1-' 1 'f nw- Ty- I--1 ,- -, - , . ,- f...-----5...--1.-ne.--1.-5.-Em-.11.1.--.-55.--.:...-.. A ji 5. I Mg H. 1+ f rw- A T, L 1 'ffI'.. -'f:1'5z'?FHs-5,.zes':.,s:1:1 r ' .1f'i',ffgL ?: ' 1 ' '5 ' 'f - , -- 2512-1g52EEQ.QIQ?f 5fiiuiigw 123- AT ' E . . ca .- ..i..--.- --5--U -. ,--swsszagazr5'2e2:.zs1::gf :alle:Lani:::f.fE5I.?4jiEi'1ElFE44ZE1-IEIFZPESEEEE V 4 a1s,.'--salmagems--:p:s.'sz:-s-:::.ea2ffeeen.: :inf-f-5.1-sa':-.1-s..:5.:1s-gm' azszf Qesssaze- - .--fs.I---fu--efeffsfsii2.6115142411 1 .rw-ff-,--1--5. --if-if-.--L.-1.-gqgggqggg :,:....3-5-g-1 mm- uf -'::a-1::.1..? h.i1,.......,.:fvE'- mv. 111- He-:-1 -sea-:mei ze:-iam s-5:eieun'ia:z5sa:4feaiasgseggggg 512-12 -1.-l!5?11I'..E-.'. A i:L.'-511: Eliiiii .... ........u.,.,.z.q,s.,,..1.,2-....2. --5 H 1,5-.,V.,m 15..:51:,s1-:mmfm-g:.:msui:eem1::1,ma,.1-qggggq5-geqflqiziwiii-.f. .1. 553:21 'iii 1. 2----1-1'--f1 12-1'''121areaa1e1s.L2Ei1F2!Lii!--.1..f..:-.-:.- .1 ., . . .,...-.1.:1::.:,-i1m-u.,11----1..,---.------.U 1-1----H -- . . . ., , Hitt? ':iz:i:QvAilxll5X1Hlf3!111irHiErh'lm1l':::'rn:rL::::45:!..:i::Ex3:.1Lf.:'Ln::l':1:'::-f.. :: ::, 191114::7:::::q: .1 A 1 !:l1t5zl!1!':':2A111::l::v ::.z5.'::.:.1::1:1::1,5'1Jf1 t1:Hl 1::'!5.5L11::t:'t:g::::g::5,:gE:L:'x':tj:rig:5,:s.gig-:x:4x::Ee15Q5Q!. -In I H mum' H . MM 0 mm :id-av mv U MM l X N 4444 4 V My I A lm 4 I 4 I 'Hmmm ---- - - -H e-al-see wal!-'lu .:-21:.H4:1111-ff-ffl'-11ff'1'f11'-'1:'rf1-Em ff'a 22:9-4l122e11'es11s z e- H H H: 5:A'-iEiV?'5Z5lr5i5f:'E' 'a'e1'-Lf'----5-H-'-wif''141'- 4'4.'-'e1?31 i-2-121-FS .t'n11'.1ff---1i+f--dm. zefnafz ' Inwe-,:P1---:zum--f-s-12:1---1-f'4--1-I---12---M-1-.vw .- ,F--.-:--w-'.1f:'---- nw 1- we-:': J'1:1:::1':::' .4n::--f- I--mam 12-egg..--1,1535 --g-:E-gy-3353, 4222:-Siaiss?5iiiglifmiiiia-!5?e3Piasales?ehiikEiz53515iieiiiaslmzfsreels-neva!sa:zs3?g55fzae,gzasf:as1'a11ksazai.nYm? 'e!??e5-9524414111:-viisalfqgajgkpzagzzs25.33315:5aweaggi-sgggassfqiiegscagigggesiiyjyx5331ggQggglaehigg145'gsair2!1QE5agsgrksisggivgiigkwsiskmfiqegnaignglizixlsgigb?iza3ggggea1yfgags5Zgg151:53ggggeggs:.asg5aakigqffggzigggggigiheirig243535:aqzg1f2Igns!1.Qlii!1e:aeLssuff2g5ggg5-5-Egg..555gg3a5-q..-gg55-.-.- Qiia2 'f.i1v2iii.'m'f1iifi5iiflmi'atr'i2iiYiyzE.L5i?iieiiEiQ2?Ifiisiiidtiiiiti6l'iiiiil:'aMji-522'sf532545ZisitfifiirliliiiiiiiiiikiazwSiiiiaiiifii'ri.E,?2a'i,usz-1i1iz4Sg.!5i514i!1il-exskhadilszii255-.i11riszeeelfi?sf'., ma!szzfaudiiaiqsilmzilLlifagmlgfimasfilgga 2eL15ggI3535g55ggsfggQgae32g?2Q5yirrqrgljfagnilft5.gEi.5gv5Yes1g?Q2igggggizyillgma92:52gvgziaggsxignge''gas-aj-zg:Q1?'1ggf-qggxqgsynnxagsggg'3ggagggggg3ggg.5gg'1gisgggazggsslzggggaf- , P- ' 2:.--Q4425.'e32HQifflifafiiawiwfl-24-f W f P 1-:sesff-fa-m1.zfzz:sf.w:pm-axe-fs-fiszewxifwsvf2a11i11Q'1fhi'?f- 4222f-3.2-iiibskifilaWPIWW-fifffiafii .1Vf5i,i1i?iaEEE!'f amifszissxxfssfg-zai-e+a'fe1faae.fs5?+f-?f?d1ae.ea',i'fn::-.,gmf--g--P!-Hff-f-f-apAng-gzfsefffs.fffmeffsrefza-.eh-umQ--fsmzfrq-Q-955img5,ff2-+3z11!3e?-eYia:gi2f-psig-ffm gff-E-vyyrfg-f-ffzfgsff.g':s.--slim,- - A if . 'ZZiiiiiiiniQ4?iiQiiyis4aiLii!XsiGaais-fa-megfE1-----n:Ef:e1geiigga.qg?g-sgfmnwEE:.fggn355553-ggimamaigialigiglgzsfssfaielzezaimf-easw-if-eaegeggffggggfggggggggggggn?lggggpfiggmggiifsgggi-gqsze--sggaggzgzggggggegfg--Isis-g-favs:swissegaeaqxi?a-WeigfgggggggmmEggifggwwfg-.5--3.5-555.3-245.ggi--ggifgfiagggaggggg-sage-if-.535..ifawe.5.f.z:i.3-,-5.5--gg,-55155593--EW '---1 :-fEifif-1'115''i445i1'-4-'f:1-s---mv.musi-5Ef52225iia4riif:-'rfb-1Y-kfiiifii-12'tiffiidizfvsehi:'1 L' f.1ssfza'e -Ez:i5i5enaei?f+ qP415155g5ai1.1aa2wz623525:-aafaif'51125516sw22z1'.5.a.ss-i-55.152assiiifsasflszagsifilasiiswiix'sisssxalezem'mmfas-isflzasieliiwsialie2iH5ee:.H-H211522212222'zizi1-1.22252-f-sas-L.anf.5'-aasdsiiiigf:-1gi:a53 115 15355-5:2 me-.. ------.ia-flu-.EL--. X-lung..--.n-,H---1-.1-mf..-,-9.--..-...--.--4.------1.-,..,... ...W -,.1-m,:1:.,,.:5!uL...,,..:.gm., .r..v.. ..... ...,. .ma .... .,....,b..,,.m,,,,,,,,,,..hmmg,,.,.,..m,,m,,-,:,,., ..... ..... ,., .... .,,M.....,,.,.,.,,,... ...,- fl.,,,......,..,,...,,.,m.E,,.A,..,M,,,,,,...b5,,m,:.:,.,,,,-ml...,.-3,4.U . ... . V 1.I.Z.. ',':z:. -13:-ma:'aess-eus. f-aw.::f'11-rw: -nf--2-Y.:11-merf ?ffIiwsee-azieflg' '11!ss.:1' Lx WV'- ?f1'2T'ESE'i2-IgE!iii'4LEl'i:'l1i1i:!1::::::1:':!:1:'i'::i:!:E1 '?iff:135245EFF-'4r:I1i'1: i':':1:' .'--'e-a,e4:esss1e'fas: 13122:nz1siaza1's!a'fi?mah!!t H': 1sis2fs'E '!'1fa?s1!'-sa-Wie.:-ef',s-eaaezfanzxwrn-r:z-iHsessin:efze-saraeie.ae'::'f!a.5z2:2f-faz?:2?z511z:----1121-I-f'- 1 '1 '-fi :...-siEl:?Ez.a----- f?fZf??f2f22frifi:f2:-Ft5i542F???ii?2:E25?ifwS525Lzfhifl-855251if'i?iPfU'i!i2fPF5-iii:-'iiH25'f154??1?5553??i??5iW3?EiiilwiiiiiiiziiiiseifiilWihiiiviiiitiiiiiai5sixth?2531355123555125eiiiigiiiiieiiifiiiiiifiiiiEEE??a1fi!i!TfaEsi!:-Misa?sswdasaifsivuaikisaiiaaassmma...Sagam-if-Zhiss-as--Esifegam-sszzflsiiaizlssifaimsszssieusufesgqameaa-akisszizfees-esszfs-aa' 1H21-e:I4!11aw1as2s7as-'-s iq 2f1jiE5!iE'iE:5lE1 ' aI..1I.l'IZ?l1,Z'H1-El..,.LI.E.nf5 ..'..'.i.9., -..J-il.. 'iql:1Zi.Eii-Biiiii1iEEi-.EZi1Ei2139El?.E.1e-Q---1-re-:,1:EEZ:l!iIEZk:E.lfiimm 4.1 I:-.,:p.1g..--4-.fa -,,mq44-V...-gg.-..f::E:K1Zx5:hT 1r:uhrgru-lwgvjg'rggvvggfa-vzrqLgjgrgar-45,15,5.,:.,,55,:ip,g-,5,455.:f3g,L,.5fH15!13,,,g,Q-41.5.5.1r41xg:5Q113.j---..:,z,g1--:-...U-inmgg3:'r'g.:5gyxg5-51-11151f541eL5,:5:-1315sgfmgsifigfgi-mygym-1mlm-15-AM,-,.--I-:.:-g':1.:Qi-...ue-3..., n Ls.. 1,-. 1--1aimsw-2-2lfiiQi2ff?fi?EW!?i1315521695255iilflishedM3114laiaxiiiiiisaizislawSiL6siia?iz1M-??l1WEW1Y?if5?5eH!iSliS2ifii?afQ34fiiiiiwiiig?hs'i?:Egi!l?Yi34!2?iZhH!:9:454fRizs!'m3e1::iXilifttiffiibiefssfdfsn sf?--25-Pg-1'IifW-1-:E'efffiEfia5-1.62312Jesisgllszfsnzlfsseg-iszme:Busan-ref!!iaraarmmf25:22enssssitfei'Ma?4zs1?f!m-alia-eqfiifig!l'!?f!I1f?311z13 3eiqe12esege.fi' was!!!fear-Q25552221:'re2?!Qa11aeg!1szs!efilasegazs --2ff!-fa--iii--211iialiiiffiiiilijiiga-Siam-2251-cifiiif--42-2-2-4-ya.:-gifsgiggggsfgmegggs22:mzfaifeiffifiiiiaeieimisiiizfs':inisuse:-1Eeas-wig1miaas1.15:-me-zenasf-ef9-uzemisgnagjbjjiigggigegsQ32-A Mi:-11-szegesixigawfgeifiafziea.:-hasis-inistezmsi-552:11-f-ummns-an:uaQ-feggwesapeeuazfqggggiliggfegisglans?-5si-ganggsxierfgsraiigqghgifegsgff.meal-1ss.f.a.251-f--aj-sgafs.:Qseg:fsrgshsigigagggegggggig 17251 Til--I-Q--ZWiii--5'Fe 5f'e-isi f:'sEE,fi':ii f 1- . Qs. -ewes ' il!E9E5'iE::f5'4r5i'!''?L:1'?!I:? 9 :1'5'!'C5i'1'HlQ:'hEI':1!E1t, iJ ??4-IW '11 1.-'.P.'+,41ilE2i1E.ifI49:it''E' 'zsmeezselvi::s's-'cms'1' navI''iwiis-urn'zm.sexx1iu'lria.9e''sas-mraag..- 9 .sz ,s..:-e+.ef-.emuff.eva-mf' I fs.fE'ge.e.gg idj.iiiEi!.gEf55'i4E '.??'?SE .e I--5. 5.135.4- 5'-,Zii2L.'Q'-32235551iimsglgssf?551,5525--:wffgea:?15e5Sghiig?amigQxa:QQ-5532?Misra?-?su,,iff3--4pgsfit.eg-xsaufznifxzieEglkgii-isa132zfz?ffEa4'5isiass'G-e954fasiaigislffigs i,Qfi::lgaQfc.:..s.?f.siga55.521EfEdE,g5a1ifeeQ152fee?:?nfas izgilgifzufifafigaigexmsiuzeiisvwmf :gg-.FigreefSiulxggiiigngggg4.5351,5ggsgggegzsys?:aaxesgieiihnzf-25-5-J-5.n.3?ex H53 -aagggfi--a1E5e-1fs'fggE agfigggqggggi, . ,... ...X - rr-iq. ,..:-::m1.m..f..... -:-:--f.:.,..--.,'...,..,h. ....1. 'Q-Lis.----me-.-s ,- '.s:L 4'5.11'. Zz-M4451-2sa'f'..f5Q-ea.. .:e- 'wise-I-4-v --5--Q-1:1::-q -'.mLssae-3 1 ' 4iiiEEE,:'fE 2?..1': -..f-2--,sf---z., .s.-z.L-.zu-.r .m.:::.u. :.:- --L 1..rsm:n:u.-fu ..--1 .1ap-..--.- , -- -r'-2-21.-1-1-1 -:--.-fmseiszasstsiefzai 'xlfisws Hiififficizifiiiflti a'-saw -:mf-sf1':z55-E Hai' ' 5-'is' 1-il 'H 43-.,4zissi!3zf.f'e-..s.11ni ' 1- uz u--friixizmwassfa.Jas-11 '.'-vw: mfs.naasmzfsmvanzuezzverfazri 53:i?EEEEiS:EEEEE1iiE ' 1:17-22JU'!:!1'fiifs2fzEi??54 s2:'aww2wi2if??1f?1414ffti1rE+?U E'f?iff'Ei5.l'f1f5'i'?i57?574?W-?'ffi1ii'i'Kf9kff,Ei5'i5a?1irt't-PSi:f9iS !4 ?i13Yf?E119i:?3Z2E42EG ?H??5! f'Ffj?'4 ?'33 FW9312135i55f?fEifW5'3iE '?:5f :i?'fi ?'EVf'7??l5??5f'!W :I5'f'V5Ei?55E'EF15?33?fE55iVF! M571-2'-i ' if! -V151fifi'1'fi?5'fI.if.ff:5ff?'f'?i'?Eli!?IE5i!-5355512FEWEifii-55555W5:55Ef32?iE? fff fE-.' . ' A522222 111: 55 ,.........f.-:-mf.. -- ---:.--- - frfrffff.-1212 Efififl -5--P L' 1,1 M 1f...La'--.rl-1.2.,41's.L ' I i'T'7'?'Z'-fE 'f?g:F.ZlZ:Z'Ei EWR'..???.E'?::ii:..55- 'z.-2,,'111f'.z-.swirls-Erma-.Q... . . ...rin-1.--.-.....: H.,.....-5.-f-1----.1.-e..--11--1-He.-.-:...-...mu ....-1-----1.--.M-M., ...., i.,i,,.5.,,,,, 22+--2rfiii-f2?ffF33?-335f?5?i?Ei3.53534595591225Ewiiiaiiiiicix1zn4i5i!iith2iibi4ia2?iiiiieisifgfiiiihifiiiliiaiaifgieuiimsszefh532252513-252523555-SZ-Ma,Q?!ahiaallis-3-1.aaw5:4i:is.diwkfisaiieiifasrmedf2?zxze!e1EEifaaanaseaeliaaziggeajeafFriliiiaasssisaiiaa-snaezbilsi--am?esaafafaaacagpasl2155s5zfi53sg5aezi-53251s?eeaagaQ53E55-H--,ziagiegeezi-e.-5-52-am-1.1-21-i... -215-.s:.z:.-a'a:a:ss f1 -5 ...,.., ,.,.-M.. - ......zazaa: .: -4- . -mf.-..,--W-fm-.--H:-.-.-.-.1.W - -...,..l-in 5-.5,E5.,.-n,,..-..,.......--1-gf.-nm-H.....5..-.Emi..-3-,-15:-5-5.---3-.3--3...fi,-Lf,-5..,:.-iEH,i,5,5,55.,..,Em,,,,.,,,:.,5.,9- -155.-.R 1.---,ri-.--fi.,,,5-f-y-..-.--gpg---ggi5nea,'-e-1 ,-ff:1f-.-,-g,f:'.-e-- i::Qwv+fffiaa11-'ifffiiig 55552555135ff?ff1fi-5'455'?5315E5H55EfifffF5555555ling?-srgifgdtiii'-5liii45Maiii:1d'wi22f2H4N!iify-E?f55+i15 54'5?i5iawi5ae75-2235M5155 -i25:HQii142 'f1.-A-' Cm?aE11feE6Q1!1e2?fY!12f3if?'!E'5g3k:fmsaesaHapa5222?ez5?ausa4:z1a'il55s:4sh!2a:1sslzafas'-3552211-i a?!WE?friEfze1aei1iF1:2f2'-112ifiEi3v2z'e!Qg!5:e iii.: if 'waiifl '. f' 'Ty' 'f'f'5'15' 'I 1-'- . 'ff1'52s11'2:.-1sz.'1-,'-:'z' Lk- ' T723 -'gui' 1?lgI+2ir'1fff:: 'f 1ff 'f'fz151'nizfi' '.: 3f'1'1'-.rf'- '-i1'-'a:?1 ?E- ii'..- 'sie' ewes-:efefma-a'4eassaea-fee. dfifmffffiifffia Wif-'W:ffiR :e 'i2iwiiifwfi-A--54-1-eeaagn:gr:-22new'iifli-1?'iG1GH1f'3: fi'1ff'ffl'?if34ffff'lffmgif 'gj:3jj?2gg:g2:5?f'-1- 35'Ev253613124-if22jgs5+f1US54JL1'2f'fifn'Wieelvis?--53431-5'W1f?32'gjfi'3z2::z:gjI's3g?2.,43:1g::figfflggggggffe32651114-fainziiiizgiiiaaiigs:ssQewgegg2-'fEagf1f:s5g5sag1f 5195g1?.35?:gg::5gg3g7::Qg:Egg:51:53333535125152-1fezieaiiaesfe-af--.-Q ami 534-EzEz545ime-idmiss521ig4,i4Z?::fues213zaas-21121ssfiffwmf-neziifsii2' aaiwkixulaiiiifzr+!ameas?A2awe+-rea1 xfiimeszmiiamsiimtiiWhse-F1azais5e11??f+s4a-555,12 liiiieiii .5 1Eiesznilggss-epegalgggsf-an-:Q fggalzgagglu-5-1 ilqgiaa .34gg1ggf'595fi35i1gf-55l.1g5 5555-ig 55-5.-3:5 um-.5 5-37-E-E--Q4-1335 .51-yy-E:-.11f3,agqgg5g :mf-.mpg .Q--543551 553535154 I-ff--' f'f'1iffi11ifii'?fi11ff5aS1 fIfkfifa51HI:fiFi1'f-255523EEEif1if?i1fHii'?ffff H2f?iiE-552511f212fff?fiffif'4i!225f5if51-5'2 'i:Vii'!fz1'21if11a3YiiffTfiffiiiiifiiiifir-ziei5?i?!EatE1iiPHifiii:eeQsiz:i's1Z2i4f?iE-zmiiaiiiiffsifirffiizsisssanewshalezgsE5a4f5ha2S2xz?nz!?!i2dzdeaaamFJEEQQQWESQ-1:e555212215221:2aim21454:see2525211552dies-:isis-ipiesiiaa!25155?aaeiszaifsaaazfiikaaeiTzazi-srawzgalzafa-1 9222- ' 1 14'-E:.EEi1i!EEEE5liiu Ei?::?'.53ir3'i?llHH?ihiE':'l::11i:i:'5:E:rg:11::fr:!r:!i:,'iiEai::rjQ5.'dg:v,'..t:q:i'.':x:1:rizzzciiiiEJHHQEEEEs?Z5iiE?Z5i5F.Q?iii??il52iiEEiiiifiiikhiitkzlzdu-'trjzigifiixtsrsfaq FAQ:vigig:frxzzeag:.izgruz:1m:::.:g:i:g:1:':.':1gi:ir:AQ-:gzgggggjfivggzgi -----::-:- '2 '4' 'A'-H--h Q- u--------------:-2--wflf-'rr-'-' 'Lew---'---'1-:ffl W 'f-Q1 'L 12:15:11: .. -,'5..Q:,a -i u..:iieHiat'fs.53eE:en.1' 21 mia:LE-.PisaWei..'-f'.e::::5.a.f'-'fmr.- -::::1u::-fE:.e::::::i::Em:::1::::m:: rg .mu .L 1. -.::.--gmzgg-11.1.315---w::1:::.gg::. gm gem...,:5.g:::fq1::::2-11-...gin- 1-Q 5.51.55 - --HH ' evfuflssizgw-'aiwfsarvse-nu: m'ssffzfs-i9AszeaE4sai:aswe5,waa-3:meemma-nas-,gg-iauagaq-a:sn.saef1+s:asafer!-5: ..'11'i1?a4e--rgamzwgaif-es-eL-xeeev,ex:Q-z.:e:w:.+::,m4-eu- me-fmwzgienaefm1-use.ax-.awww--1,-2-141-:s,-Qfemzf.-afeznmzeremzq:--mf-r-:1-f1--fm-fzg--nm--1.1-aw.--1-11.4--4.,ilu-1-.-.Q .. 3 as 1 -. , z's-Qiifyn-:LE . fem:-5' if - W.: 'Q .Lifes vm, '- .JRE .11fff:f:fY.e1aQf1:1g,g2?:i2iig.5i5?.:s:..f2.P1a.1g2fa.,:.:,,.,..553:..HEg35gj3g3,ggg.3ggjq,f3-jggwgl5152323523 ' -f.-,555g3,-3g,-.,3333-Qggmgggggg - A-4- --1-E1-f-I1--M?'. xmwfgz-- w':11':f:mf:-faqs:-Lf-nz:-huwxgzw -f-rn:-:few 151-.--Q-----ff'-:HN . 1 ,f -1-we-.1.-mars'---:1m1mf1,:f1.wi- katie51-954-1932:54:35hg2'lFA ':?'FE.'1-----:?'- . .--f1...-:..,::f,4-ffmlf-1319 -Hmm..1.,1,,g,h,,,,,,..,,:1,,.,..4Q .hgh , .,,. A-M .,1.4 Mum ,,,,..,,,:,,.,,,-Am, ,,,,,m::-,,,:,:, ------- : r: ' d':b '5f1- iff- Fff1 ' -S-1ff::1f1'1f:1'af1a1'355i,1l'9' 'f-255921H511-51'51f'22i'f2'x'1m'hffi1Q21- -9 'm'-1N.i1'ff'H'25 f11 w'i fqffwf rfE'2ff2'1f- ''1-ww2-22421-Hfffaw f1211v12:swHf4w2f'1: 'savesi-15-142-Ean-ia12?-anEmma:-11u1f:-.wmrimfaum-.nm.1---3.1-.1.--.:..:1,. ,. ,.....------:--:awf-:.-1--- ...mmm- -------1-1---ffrfifw-fa-121.5511--f----'1---P-K1-1------Maw-.-1 ---wa. .. -----1 --e.1-zf.::mw4- M -1114w:ff-...-.'--a-11'-.-1'--..1-Jsfzf'--f-1 ...uefu ,H --2.112112-num...me-E..fgwmf-114-m--lgsma-1-eff.. ,-.-.,,., M... ...-...,......,...,, , .... ,. ,.,. , .. , A 4FE:fi'iHi?Piiifif9 :?:3f51:ffT'l'u15'5'4 '-idiiiifffiffffzdiiwf'Ei .f114:'4': '1uz?'2zwfs1:1fr'f'122i!v 'wf+122asr1.-we:ss25121424115251'a?5f4aEi 1i!vlifzisigwzhisiimsme -ew. -12fsgsmssesaefezeihazm-ae.Gf1.a?S'a.H?r'ies' miami! Elia-iazazexef--izalwazsf'4razaai.:1f'fzz:::fe:1:--- .- 112E?:ff5. Q. ???iEE1..:w-111!::::'1E:1f::-:ma 1----.W -1 fu- ,mf-rv-1.-1,-1me--f.--ff-1-----31.-1-fm-.H-ff-as-:I-. I'1.:..1me.es--.-..--,:...1.--4:1-F . . -1 ......,n....-,,gi....... -,...--. .,.. ..., ,.., ...,. .,,.,...,,,..,,.,.., -,.w.gWg.n,,,,,,.,..,m,m,,,,m.,.U,.4,,,. ' f:1E:sa! 'EW'sEf 2e?5aEes'H'1s1f1'ss'laeaff?-12522L?ffWf2E'213ei',f'h1h1+E9'7f:515?1ff' '1'11f'1S 1.1i1i:2 1?1i2':2a:E22'i'f f 'l 'a'ff'1fF':'51a ?'Melia-' 1-Pali'We-WTf?5?Q'Q2f2 ififgf25-1-Fm?f4'i'rT111'EEE!2'2f'vIt'151f15f:?3s:' reefs-M-zazisw-fa?waa.a.'fmz11a225-2141-!z'!--1-ii 'f-1-55.5,-gf .55p..g5,5,-wg-5.31.5zsegffigqgggm-1.553559:35,f-ggmggmgg-55335,,,--jgrg-5,55-5.3--f , ., g5g,gggg,,,g-,iiim QQ5Q15ma-MWQQQQ-iemai-.e-sis51iaise1z ?LE1!!FgfZgE?iI?i9iiiijfiiizmi-Exdzmflfzt ,Bef--5- -ai-ggiqgqggmjg my--1 .E:mi--mfs--.B-4fas'u+sEsa!.zf3avs-.HQ-?1i1'as-easgseiaugfssf-534-f.wFgfm55,g iifiil f! fiffqsasafaaffsg 2f:ffa4eia's -ei less:-ssa1wffH1fiff'i?f4f -f if 5 --1-2fazssaaas.-'e5eazu5a:fmaiin-aegs-.-.geiaL5a+J1.1af:w.-pea:z.2e2-Lfenmexgumef:-Q---.ni--if-egmg-1:zas:.:sa:5g,.:gm - .ay p2es.s:sgea:n.s asm--agar 54. f.h.f14:gy:FF:--.gge-sm -f-2f:e.53,,555.-5.-----3555-,gg-gi-455,-ggygfig 335. HQ, ,hc--,gliifwf-'5,. 55555,E-:EEEgggmigi.-.W.,f.:.,M 44-51555-55.5-...E -35 2211112'iiil?5.!?:ffz2'i1a'fS5az.z-z1ma':sfasf':afas-m'1.3:e1eiHQ'1if:iE1T3Eiiegfnfw''Tr'- Mmn,-'f'f1'I-2-i'E.ffPfeH2ff'eQff:sfzsi1ae:azassa.m'zs5s:. .551-'2EE!,'25j-G5-fnfgi,'I-5'!t f f '--f- A,,,.::f-.5-gm:-...gig-ge? ,...:,--4-sus--5.:.:,:,455glg5g.,gE.gg5g55gfjggg,jg5gL 41 A113353-g1g.j1,1,, 5-1,-H45-I-,g.:g.5g: :fig-3:5-51: -fw-fff'2f'f'f'3sfasaf12ff' - -fn:-1-:-w 1 -1- --:ur-1 1 -1-1-H-141:-'---4:-Q--M------4 :---------:--Q-.--- ---w::ff::1-N HH- 1ffff-'-2121-----11-W--ww -J J--..:a1.am:1:- -1.5:my:f.:aif1f21f2-af--zPlif':---:mi-. .4.. .:-.,---1.-.fc-vu----z..-.mf-m::-f.1f::.::.u.zmsnfmufl-1--1.1 11. -- :1,1-.',:.-- 1-1-1--z-.:. -1: f-11:-.rf g.1:f1-:1.fm.-111-- ' W ' mga.-.aaggn-giaasgl .aes M14 --s-g-5 sqf4'gsg-5-Eg f52g.--3--gx-g-- ----- .jgama-1 .-15555-5:5-3... N A EW: :Er -2-svsmfxi-5ggliiizfsgiseseefasfggavfaqgefizfa..ruffle?-ef.nf-mlm--1.---.1---saith-fzaamgre-J,x4:i1.:: mea-sa:aeze54n1e,reuf4gsg55ggg,g35g11e-ghfigu5351:-sgwevg'Q--.mw.im -nanmnw 1-fm--gage?-1-fgamvgmgqm-ing5-1:gpg-5555g:5Mg55,3g5gg.g3g93gg,fggqg5,ig53,xxgfWg..1::-Mfg:-imggffi-1:f.-.-,l..--:,11N---:--1-f-Qiwmpm-f:-L.-gm.H5Wi- H-1.55,g3555,g5i5E3535Y:g!5.53.g-05235,.5535-...iw-5....pgw ...-1--.,-s-as-laafigii 5:15551zea--Zsi-.g-g3.g,g-,.-4.-.iw3:.5h-,.afgaQ:-Q -333494:-:..f.--2.3 I---.2-353.1-.,.q,iEaigigtiiwgi5i5g,ii55W.w Q--xg-gageqfgggggmjif--4 fm.-1.1--2-W.-ij?--E-1-2 32I5-ikgimM5-555.513433559-55555-.Q---.1-.E.5,,.Q5-gg.-.X zg.-.-.:5f---..1- 1I--.---if:-7m.-3-!i..--- ----.-1-iq-5:.,..5 3,51 3-A W,:,5-5... -1.:. 1--nw1L is A.-.nf ',mmEfeL1--Ev-.sg-.2fe.s-sei.ig-Li.aiaEa:1g::La::..Qa5.s!-.n:-rmff-1.1.55 '.1 sm Q -- .msgg j..w1q..-..31-13.11-uwg. ,.1-,gn --.55-.75-555:-F2u5.:5,,If-...fbw:f5..:ggw1 45-Eg. .gg-,H:1g5L 33555355--.5.33-535in-EEEEEEEEEEE.,ii55?g.g531.1-nn.: .4-1,-Qffgggwqg --.-,gtg-55. -f- -- ------1-HM'-e' :'a'fi1:'zf,'fa'L2H2a'Hwfa.--11-11-1-f1r111'1-1-1zfvktaif?-515f't:Efffa'-safe'-f+-:-ze:4sm--' 1 in--:Gmail--eesf1s'.zsffas1-w42f2m H1-F1!1?'11i'11.:1-- -wmyffff .ifw...W---r-m---ez:--:v :-A-11nfv.:-s2e::ff'-------fav'--------'11-.----:N-xy,.:,,-fs1m1f:1--1--.1--.f gi.-..gg-15-11531ig-555535115Eggfgggggslzzm-----3-533-A3545 -1' .faireIf15Mi--2wf15iiiYEE21H1fH+iiim:2-f-1'ff'11f--1-if-dw'avi-512211224 ''iP5f25fi?iff?Pi5Ei2-F1'12'H1:HHi?:Hi251M5443111'-dmv!si33Fsimaf24s2znfiz?'Q'2iffEEEEEMEV'Wifmi2+iff1f??fiii?ifmfwefkrfwfvre:azz-5 :Aff:1::a2 .- Y-fhlfigigiff -5-.W , , 1,-xgggggr ' 'illlifffiiiiiiili g5?2..m-.i--:sssa -. 11-Q.--Q..-.. ----:.4fg-We ' 'm 'iEf5 .- 225252:1i??f:i?155225?f?12??iElf:,EEKEZT55 H-I-El -if-'?1'5512.11-2-ifffbfiliz f2f 'ff'i'f'1m1'-:flWi'I'3'35?i'E'if+'f'?71 ? IEEE EfEfii:-PHfi:i.E-'L4 lmidif: :Fil'35?TfE'3'fWE7f3?''ff'52:5?E Ei?i33i.i5ii:iffff5f33f121fif5LfiEEifi'f.fffluiifii552Qf5'iLiE2i-25'Q.-- Ygreiiwifi--3 - - 'X 511211WI-:1'fffif:'59P5f534i?ff5f'i WEE?GWwH'4f 3 'i 'mF'Y'i'1i9u5i'1f71:7 fm'2?Y'5:,?fff?f5'S55I i!5'f '5-4 5639 ff9fii'121Si5Lf2H-2551--41Fifuffliff-T '4'1f 1::V'r!'1 f 5:'f'uf':'T?f '?'- :FWL1-55':1fi?Esi??545'ff25fz?iiaklifmiElf?f5'H7FE52iEif'5i?'nf'3T1.i323222211312IZ.f.I' iff-33.5352?.L'5i.L'13'7gQLLL2..4 ..--my -lm--.J A-.5-Q-:Q-11----1--fa., -. . fu- 1- .-:ff-Amiesl gg- '-:tw::-:Mai kg. N-.-H1 win:1f:u:mm::::.-:m::::!w- mms:-':'-.: f11'v '1:-a1'A . 291-iw-----fr----esfff-41:11. 5-.1-sv sf-21 i'a2f4:1-...Q .--M--.--rMm-1.mf:.4---f--Mff.:--11--m.f....1:1.::::J1------1--3mmf-2.------1--2--. - Img,3,51-gigs:-qg,3.'5,iis,gqiggg5 ,ga 5:--Jm-.-.ia-5.fs-.--.ufsuwfagsvf-sms:-5-lean.,:5?1?zfme2fmm:mg4E, ...:, -Smnlffgsf-1--',:::z::1:1.mf:-4:megaum.551111..grrzaafmemEn1faf.-qezmrslgfsfgahysegnp:-2-uf:.-.. 337.53335-..-gfznfqm --fr ,.-:ggi-f -1 ...a.5g3..- 1- , 5fe-fqefipeimfiqmyiaiisg-,sew1:41efiaindfmssgfei4ieesEgs1a1rE13ize1.snr23'aaeeaaaaigggesllzigssez-eeWe gm:1-55gJgd:g1gx:saa,1.m.--:efs4:-3145131123251-S235ET45EG'1fl31iwDu-giggggggfggq----yeggzg-Hlgeagg-Lggiqpgm-2suIv-:g,gg:5:s-1vfE1'zas1sff1-, i--,-'52-sq-1-gay395efaiii'-128225555353I E,--un .1:fm.:1f:1f- , 1132412262525:agegf21g1Qs5L!a::egsaq2gza,---ze:e:s:1a:.ae-gfzlaleasgfvflf-1251111--1-H :':f1:ff-fw 1- -, ,4 1 fa-,-1...-1--s11,.f:f-1 .1 ,ws .' 4-1. fm-1.1----Q.,-e... ...r-wif . i fr H' P-.-1:--fr.-1-.122-.1-. -rf:-11--1--' '-WH' ' 'K' ww '-I '-11: rsf '. F, .J ' '.f:.2:g '2f'5:-riff'-.11 --T .E?EEl:.Ei54Ei25i5?-935552155325SUSE!:EIEWSZSEEEEEEEEGE 412:--L 2E2z.p..L11z5:L.z2r'ess'e-1. ifiaezis-ffisewmimilfiixii-4'.z3i11Z.3m-grassifamassawmieisiiiiagieilgeinfsieeleeaa2?fiEPs'iifiimf!s1m1!s4-:E iwM553iJmiiaia:5umsm?5if31ie3eva1i2'51Eai!1E1sIsl'fQ?feaaEefgr1K5?11i-fans:-mm:-12?-s!ef.n!r.!'1'efz1i,5.43'f,55w-,L-xfa?ng4-Perf?---4..1---ag-.3..-----1..,1W1..------f-E:g5.q5.3533.Eg.gg5qa431.gQ-:ggW35---I . -- -- -- -.:.-....-.,5Q---?--.- H Y-au::1.1:::.:4.m 4.:::'77'w1:f.:.ri1:::zuv...:-1 41.4,.1:.w.w:m.g,1.:u4 3:1 u - :r-wf.ww.....:....,...:Lv mf-4: Lmnnzmfazu ' ' - - u1H'!.'f'.wa..:.:.m.:.4-...' -1 -um-mrwr-4.' -- 4 L rn--':..n,5.. 1' . - al wus vu-nxgua-:1q.:1:ru:u ,-g1m'::i1m.r. r1::q:.,i.:..4,:5! 153.55543x.4,5g5.1yd5.ig5,,i:.:!...:,l,:.5,...,,,:,,w1.,,Lm,.,,,.,.:x,.y,.1.gg ,x-g:.,.,,,:,, .1,-,mm ,:-,34g,5-m-,- 7,--,-, L..------.1--H1--whh-x.-A --------f---n1f-,---.--------W- ---- -ji-----1521 Pa--mv 1-rw-M----if--1e,-it-----1-H--L-1--fiizlfhh-1 ---.--w--w-m---,,-..-1--192-ia---mmf-gazfsggj-Fdqlugl-an..:gf!?:'s'?Q-swz,-Aff--sf-me.W-Mgt.-..1.--..-5-me-.-g..m...i-.,.,. ,,., .,,. .....,...1...,,.,.., -.,...Q... .. . ....,...,-,, 15:1-5??f'-Lfbf5'Ffiff'I- ' '3543i?35 f- -liaeziieiYCFPG5?-asus-rfsirfvzaexslfrkea-rfsfsz.rQ?ss--.--12351.52--212135.511aamfu-zlmsmaeszsaaeeffzfwrfrsimg'ggprswcer'gegfsfasu.u1smeasswiss?ssemsaezlswealfeesmeezfsl-19:4H-:-1-5'-Hssfarw-frsiegmfgezgfl-ae.. 2 ' -' asa.-22.-11as'-axa--11-'w:1afs-g-1 -V5555-555535595EEggffiifieifnT-1231252-k1:iEszs55Ff.4-anaemia'Han1-wwLa-'sfffmf--H.:-:.e1:-1fee-4e1u'sre52eEs9E?gaEemis-QfT2E'3'ff4Qff'eaz5-freesfhswseeaffeeaenieg-1gg,gg3:s:anegg521512295551lufifwgisggiiigiulhgeiigg:gifaaaaegsuas--u:esze:ssfsfee...1seg-. ' .-fe.asian-mf:-:serieszsfazrleis51:53-5511222-sz: ,gg-51. sizpgzazq-aawgfii:-2,-affix--53-ig-f.-3.---:Zggfifqgqsg574-Eggiggaggaji,-51.555Lmgpggigg-2.1-5:u,.g:m-1mHkZi:3.xq.-m5:ifi:3?s:E3if.--a1..---,faggffgggfzi-555iE,g.?,g5im,,:,55E5wh.1sJ.5L ..EiiE5,3132::--7?--1515img:5f'5ui:1:ff1EF:Lg4fx..,I.. , M-3353-5332,-4-153323,., ' z'fh..'jE1'F ff. ' efsefm.. ..-1--uafeaas's','.:.Ez:'fv 1f '1--:L -::a:::..:g.i.::'sf'721:r4s1a..aa:11-a-e:.--,.--1 ---..u1:,.a-:.1.-..-+ --ew. en:z1e-ws:'fNut:'...,- .:::1g:M .mmgkfsav ggg:,,ggAf-15-552,-ggiiifgigigifgf,i5Q5.-.:.::,,m,,,,,,, My M ai-5. if-igff-31 . b . :.': .g13 141532512-1 -..'- 1.1 sf-L1f1 w '::::5'75.f-gi11r..:.:i'..:i': ...'' is 7'5f5'71Zf'1::J' 15:f ff'f1sff'21'52'f - - :f1Z fif5?--5 'f ' L WZLJEFFL-i'1: -' 'il1-- 'HiW1 f3'VH Ls 'ifI '?-.F:l.1 -we w-new 3:17'i-i E zi1i1 5:15ffa?iiigfrzilitzifiiiiizzi ---- 911-am-Q:-aeaaaaemasse?-z:'a'4'5-aa.ize:eu+eL-'re-:mm 'V' 'f '- 5i?11Pf1?i'5f FQTEHI-f5fl353TF:Yfgf?75 255355333 5-'1-T525 E?3KH'H1P31i'gi?g i1ifT.E'f liljlnaxsf-Q--f' Qf25?i12s5fi1f:EffH51 fwssesiszf-5--ameri sas.yQfe:s-e51115151-1-'wir-Eff!!!a1rJu:.:q':1.f.a2.:'ap-1 x 1.35121-21 -: . 1:3112U,5335333555523awgkgffggazeaegfsifaiaifimig ..:.5.:3.L1:.f::3'..:.s..gg.:' .'371.5I'lilifgigjizg5fg'BiQ HgE!!1h1zf1E:15aEgkIET-Eiifuc:wg:::L.:?E,,:,5.:..4..i.4f1L..-ai..,4E1u.2..,,5..-,En:..4m..,3Q,.,11.u:955Myi:i,-.3-ggifapqgggggnggfzglggii5gvggug55513.54i:.,::.,,i5,:1q-grzzf-.'-:1::::::L. 5---Ag--1,...,,n ,E5.53:i-m,55.-55-3-53:41.-sgmaazzsazzfnazagggqm, :..,-,dm 5.311 -!E.:.QEefeQnA zgiemqf-fugg+:ef.5Lsgq-fem 'gig 3 315 .35.g4,3sE15g.m:5::: F.-4i5E.5qf.q -gag-1 I K- 3.59295 - 5 ...,.. .Jun mug.: - ' 5 -. ,:. 4 .H lwma:-ua. - :mx-g:-11:1:m::::g ,fn--eg --v :yi .9::'-,giaifymgi .- :fi:g:-gffhfgggggg ga' -1-51.3 . -1 --Q.. . 52751 95:3 2. W -1 .av1.4,,. -2 -- ..a:5.,:f,.:5g.51,5y,- 45.1-gg .-155: ...E -111 7 1 ,, ...L.i'.'- 1 11:15. 5.,Ef.l.51.,gEQ.r1?5HZ. I-2 1 - if' 55153iifu.'i1j523za'giaqi'1e5fQsu. f EFEEZEFPQ 21-:ad v -15.-e Qkenela-iqnk-fsafgv-pm 555-f-M5131 Qgm-ge-ffm--w4mwqa,---- -Q.:--sm. -.g..q-.--:f.-.--- -.--5? 1 --.-1-H -U 3555575353 5:31-1-. w Mffiwi?PF-ifiii'.4-121-wiiii!ivYili+51iff1+-ilm-ff-wwe? HisAliwies-irffaaiiffgwa-mm-Wilfrif'i?:5if?F?f3iffi-i'11'f4viifW4iiiiiwbiiiff?1fd12?--I-115L??aKfQsf?aQi ffQsabQE:ggfi5'1-'Qaiay'-A-fv!4y1a'flHf41f4+i511ff?5-541-1-H1341f5ffw5PffGfr'!ifwffflgmdl-1'fff1zaaamzisfrseszieg-.r,3-nfawaszfiaga. eziafaaaewai'1ff'11'ge'1 13i'3151335gg11aj3553 g5gg5'5-'ggggj'yfg'jf532.'53gs157-Q ,--ggi 'S-fuwf-fm-S-fi P1 'Hwssf'32if'fi4L'1'fHyfgffff'-11.111151-1fE---fiWPmf! ff1sE'?Hi1'-SWK?-MyE--rn-Q2.'s'i'vs 'QslWH?-ai - 445351-A'M2411-5??a'f4fs1 f.f2-'lpfrffwuff' 'Wiwfs1ffF1g1fi-1-- Fw f? !3'EH:fi,.f.W?Y4'.Egi2 g?rZEiSSQi415fsw1b.5FEEH?15s?!f.!2zmgisksllmifgfMilf. -ss,Liii52555552522'-5:'1ffE5'f':W2!U!!2hfva'is'5efHHsf2ss'z!?t12-2312.542+5:.:2:i.f::zwgfzg-1.5415-:-1245. .3,.f1g-.-?.i-4-mf.-.,. 5:2--:.-lf-3:3 'Q''misemmm3R'5'F-23Wi2f5'Vm? 5'5YMTff'?: n lS'Liif Q51fTGfQif?if?iWfPf15i'1' HWfffm-il'?ffff?Xff1 V'-IQQEQQi1E2igiQ'12???'-i '5Q,L2fY'Qi 4 V'U f YfYfLliE5-Y5Ef5i3hi2!fIf14ff5'H11-1-fuf1'ff115 -lflwffv'-9-jiffasfaiiizigsilzgLg..a,59' 1.:5E4:..,t..QQ.55E,:5g1L.ag.1zLz.a1,:.-zizlaaira221a'fs522f2if'3fF'!'2.ia 'ff'-fa145f1-Lrpzeitgsesaaa-Ti-21-Q-.33:,::..:--........g',...5,:...'1,. .,.,., ..,3Ei.l. ska.. ::::fi:' ,,EiiEE'E'E?5-rzzii -r ' ':' 'H E15 43 'E?7EFlf-l:7fii2E..L? Hi : ' V. 'i'f+F'FEr ' H5-'-El H- 51:5 it i 'E.Zi.-:.'ii'-nf':'fEE,,.:'YE rl 'r.ii3? 5.f '.E5': 7 1 '-uwr:iii'il.:E'?i!3?'51-'ifffif' i :v1:1?:::F5..i.E:E :v?11.1:.,,::x:,,r:.,::::REi2'W'5Y'fV?? iXi,,3gY'f:gg1,,. ':,':?-.-1ugg::g:1-grig32515fi-55-f'5T2i15Ff3E:V'E'i!.LEW:-5?'?E?FEEiZV?iZ1E?irE?11li? 5fC?IE?i Ri51'11?Ei51TiE5511E E19 ,5,33L - --fm -.- 1 -A-fin-1-ReiE11s1f,...13-1?--:..f.f-fa.,--f,---1.:f-.Siwif!32.5-it-Je-'?s4:ff-.5512sin,-'S -512.435-!,fm-1:elm-2, .:.. ---.:-f+--EfE--- -1 'l1'.ssi'1-fi--mm-W--:a:mz1-mfwm ---X.-mea.-.-mmm:-:f--L----Q-,-1-...J-1.,-1,:g'-i'2f!.,-:-- 9-....:5.:,q,g.f,,:- .r.zefamf--1-1-s--L.-ff-1-H ---- -f---1-f-1--Q-W ---- - -If --.-.ff--11--.. . -. -V..-. ,H- ---'2-ZLFEI'--2--23:1lw-!---efl----iil-.-Ji-1322-th.igiamflsm...-:nn-Hilmar?.-sawiavsmszna.,J,g,3g.HEE5- -.im.:,-,--.5,,.54,i..Zg..-pi-i22:SE255511hi-fe:-'-P-Newffvi-Swv2-71ew-lfvwer--ae:-as:siseeeea'--a-.e.-L-g.1x:ese,-m--ne:--El-f:fMf11'aslf15412i11511 EA-:ff'vitvevwiraffzffffeae-sg--Q --1'ea-f-:af---mea..2-semenaiy.f-sagaga-52.1.1152115 f!.1:1z',4r2 .:... . at.. 1 ..:: eg' 1:11.-:::f'.iift.:E-.:1 - ..:1. .:::::1. .... ..' fig ::.':. zu.. ' Q '. . .. -.'iw..zL5J 112' 111.0 . . 1 'av ...n...:: rx , -1.,.::a,, Ifr- L . .. .,.. .......,.g5: ,5':rEij'5A.53:-,qi j:'::j.:.1I'::::45:1I: Ngg:gg1::,, nxvgge- :E :mxn-1.1,.:g:.1::j::i:..f':1::1g. 5'.1.wg.5:,g.ggg,.:: -jf 3.1-3.55:.:::-fg-.:5f:1:'g:g1g- :gg2,j:1'1-.--51- .-. .. -.11?1:-V.--3-1-.31--H -415-7145.--?5EQ1.51.5ff.Q-E-3.3.35-if - A TE -1. 11...Qu-ifl'1ii22'iPS f2?s iggwwfff-'---1 1Q-f--E-gm-.,-.....q. 'fa'-11:--5+-ww...- ifflgwl' .- 72111 . -aan we:..w:i.e:i..:::.1:-z f 1- .lii-21:iffi3!Fa2f??rs-ff. 5--4-Lii4:,sdi!f??'i'?d VFHWKEWE1i1?4? f 'Zi5fgffi?Wf45'151i5fi Hfiffiiiifiii- F-f?i1i:ve-lfibffigbfizfiifYfW31i2i'z2if7 'ifiiif 4134 fig?if'iiiE1Q3?!'ifji?iit?11f52fE3l?i?i- EH?fe42??B2iUi-2312223-5'i51-aiisaijz 5312.333 'Ug2??1.?'Q'5fElQ35i3eisagginessiilzasL1-g..5as'4s4ra-35ze-.szazizea-tfleaiaaslaawazas3fh1g?Ebzq:: iw.. .:z1.g2:s11'1:zk: 51:51 aaa -,-1 raizifiisigggaze use-f52E2mx,3ga5smQ.1!En,ggk55eeaves-3542-gagsgiigqgssiz: 545.19311-3 ,si gn-ig 534q5,1553,y555 WEE-2i?:?g,,3, 5355?-mfg,-5,35 j,?3Q?E5?53Eqg.5g-5 5553, mg..-F 'SEAFESEH 'asf-11 45? M512 'HW . aafrifzcz ,.t....a12af14a'5s '.' Sm:-?'.,.f...g'1i-..:g 'aa3'a2a+5ff.a- 1. H I ' g' .-aa. ' ' ... '?,:,. ,.,1-..1., ---1' L- ,.-.m-,if .ef..1:f:2z..-,1':1:. -g:qg.:5:-11:555355--H-255-L., ...,-V-5-Em,.g5:,,.,1.- f,52:3g.15g5U5.,g..555::,':.3335g.5,u553-5,-,z-gig-,mga.,,5, f,.g,g.gq3gqgg ,gg 1:-1555-13 , MSI- 1.1 4 '-V 7:ii :.'11.'E'?.i'1:1:,':' '!'.Ii 577' P? 52n::wAhlil Si 'l II' .1. 51- K'I?'1I.II'f'I1I1E 'T121Ei?E2v'i?l1,!iE?i1Ef'.iiL1?5EH lf!!! 'LI-FEH1'-' ?,'Qf' 'miwfalg' q.1.:l'iL.'.1Q' vgwli rE f1,I' 'WEN' 1 .i'i'?:. -WEE'43547r:iElf'i?L1!E.-5'?-IQWQSI A'ra:41q3,,:Q!.ig,,-ug,H?.1,jm .mi -T,A1331.,:,.,g.q5,q.5g,yv-lug-'L m:.,ig 5.' :35:::gi-5.554'2'y3g5a ghgggj-5 G':,:ggn,1:533g7H3335i53:i95,F3,i,, .-tru. ...whim xf-l.---...---.Mmd-if gsq--W.--ry:5-.M-S1-Q-fzli..1,5..4,-L-fig-.1-1ak----4:,f-wIw------4- --11-1-,I--.-.nzrzegflgif-iii g.-.5-uw -w.f5y,.1f-W.,.1-.Q-1-fi--H1111-.fra-rw 44--5. lm-.-z-1...f-.ww 18.--1-1 -: -p.:...f.- --K ---w--Jia---'!w'uw a :----11.141-T--1-1---521-KP-J41u.!w1?-5'' fv'--VMM-H.fF-T1111-.-1.-:dlwmv 12.11,-.1a.:-.-ssi-1h.--.-.fu 1,'-1.1---,-.a 2---.-f,'-Q:-f - - .--.----1--.vw ,N---1-wa -- -.11-',-'J --WT'-L --,-1 '.-.-'w'i- .Hag 41- .- 1 : ln' 'iv . m e?M. -H WYE-'f.u- 1:X'4 f ---11--1 i'f,a- . ,-....,:.,fg--,--- 5--Y-wi' -- f-L.'nr1'.-' :,wg .-.NH-s--'fw'.:s1' 226. .-V5 . gf, f'-ws Q .... ---.--.ima miii'..-.-W - ... .. --. 1. -i-552553!Z1+'3?E?l7L?3::i'uaH'W i'i'li? Eiiiiiziiiw uJ!'i4'!i5t-.W:'ii?'??:li?sii9i5U173E-. E:- TT-'55 1' 1 1- 'l!'9i' - aff!Us'fl'ffF'?Lf.ii??J'i1UQ! M.:E..4-11FE!2+bf'a1:'4 Q lv --4-we-'if'-een' He1Hj'gpPEg.'g'ii5!n,gg?' Hi. gil ,1'f1ffgE'.'Sr'. '-i.--EW i5':5i55f ,Easzififi . .. 1 .. 'wif' ,iiwiii -.mix F'.:'1 fl - '1f.'-' M: U.. - H2543 'IE' ' '-ww... 'k'1'9.J19'fi ?i?54211'i 555E - 'fi' f3'.e'i':f'- '12ZQ- Em: QQQQQQQE 53? 5!i'iff1:I.Em15?'ffm -?':QQE'E'Ef. LH4E522A7f: :3ee.ienEii4?.uxs,e1:siiifi-.Es.'E'iiE1aagE?55i:-- megsiesgasset iQg'lEf m'1YE'I1Qfg,gfag'54: -if--25-Q'niiggfqimiziaiia-255:24.iiaagfiinei--!a'?r-51n.Qa5t1QLWglg?gQ!E,Q ,5ii?.5f?5'E .WgffU,M,Eg-1,.4-tjjgiiffgggis.QE-M---,W?QygQfg7,e13-:LE-3E-.5i3,EQifgg:fm.El2 :Eff1555523g?5g5iz-Ease--swaai-gif :z.giff'1Ef5Qg12g-3333 4-fxs.-5q3?gii3hi?Ezsh25?,f9gTi-55454:-gg,g5.aufi5.35:.--Neff,-,fge-eg-'Q-wyeasegke-fe-gQgggg5,1swg4giig55gfI'S11,Q1',i'2gli.,15, MV --1,,f1-QQ?-ggi--gtgmga4gym,!,gg,5f5.sfLggf-gn-ggggQ:54g9J.H.g :..qasEai3!!!l' 3gyms-avzasziff-azesasfeessz13fei2ilS?i1!1a2f-:MM.sai1i'1s25u:fi9mi2a' faxzaassuagekeews4521... qs. ia.'53+i1'Hv5?la3snm.z:2-1945:-s?!:sf-W -ff+m5?T- f'i25ifiiiiii'1':'1'f1-ii--3113331 - 5iFPJi?f?'1?'fi1f--Fi-EW:522114154--i-'Gi 32-A E'f?ii:1.E-T113121Ld.Niuimni-?5fizitf ' 'iii1'??2ii!ii4iif! P'HEr'fiz1 lui Z4 1h+ffadau75?1-41n2 K WEQWI-14' a Lg21y1e'hf1'f115es4::e 'fm .wiusiiz-zwsvysfznims an xelaiixeirnaiiiiv?wi?aw-wiIimeafzza'z-1-sr:-311seasawvefdizfwef-z1 ef.sgy -sins!:m1Ynzev1mAaez..ee21231-s1?nziammftwiefaimeww-azn-sinus-,rs:: - fi--n.'.if.'..1s7!1tss-:ffm .mlr M5251 ai':!.2.ma.'J5-?'uvss1-515111 Qfllwlelfgffw1?'Eise.51Ei+:Ef!!'?1ga.n-.-..M- -:W .-.:, if ,--, Q- -..sf-i,-,'...gg.a..a--?-'?lsss2s111+iM-in.ya--.-akr..--an Um- gp -. Ml..-ui....I..1....--,..,i,.....i.. .. .,.....--H--,.,,,.m.,-H...ei---:,q-W-.:,-,Br:ms?!-:'yqu?,3g5--51g.-3-Q.-,,d4,,,,,,,H,,,2,,.,,,,5.,.-,,5 ....,,,g,,,5M5.-y,.f,,,-53.55-gn-Eg-1.,3535,, PWM-11isi:lesf-Eaee.-ifeffaefwiz .ree-ilfff'-Yhws.sez-::g,g3r,f!1a4K1-l,Eif! ,,!4-i-HM-,1QseiiQ ff--11'21?elfe'ad9!-we1fi2-If-19-211YW1'-la1235--if?ZWZ'h1RS4'le1'15lar mifzizia' +361-mzhnnieiiii-W5Zee?-Ania!ga51.2219I5Q-4'-+55-VifFi1wL-e-Z2'2f'i....Mfgw'S!H!5,m2-if-22Maasaiin36me-iiiv1i3s2i1'2- mm4,540-t?m.m seg-amd,3.mf:1-:.-42-5--ru-51----3gmygg-:M-3-fig-gi-.51-H-5J-41.5-,.-W -r1'-.----- -.1-.-.-me'-. 5 5351-wise-f4e,saa:'gee4z-'1Mike:-a:zg?j -!iihfywf-1is:i:Eu.-:.1..fq+-Wx: E-1111-sywgw--2.-3 51---m4-fd14gaEa+-mivfav 41121Li.4!l':h-pzz5 isIgQi!zqL 'ge1mln,J14u5h,rfe.1-,gig-geayffyg-51.5 145- Wild-Kgpggi-fain-fagn-gfgnAgfgggggggggslef-ilfilegiv!--agentasaggeegsmf-:unggeeg mygsggg.5,45-N.pu-I-g--241-1,39-5,-my-my-lg-3-fy--515.145.51.354,g.-Wi.--.-I-31.--i.gsfSe3q5gqar-..3.5gg-:fxgmqffisggm-.1 ieE1feie:.1i?sa415214312155511at235222-sLf13',Q4?iu3i2:1iizgzzsziwfig-15.54llqjiig-.SEHKiiiigliiiggiifiigfgihjfgiiibiggle li lH5HL1gi4iigHE1!h'?' , ,gf!ffjf31fg'341Qgli5pfi1qf-iiaif a:?5gris1YLg55s9gE.?12?A 5... Qls!!i!.fIE1i!aLlivsuffisggzsasza-f,H,-glqhfjirfliiiwasgangqifgiiglfgfiialsggzszgrf' --ggi52459215QQ2155293559ezgqqagwzxagmgwiizg5n3iz15213g?Qigzg,g-5:231512.gg,?:5fmg.ge.'ps.igsggelefgggjaj' lf: Q ,r ---- 1--. -2.-m....f.-fm.--.. -1-4 '- - -1 f.av.eeeL.'-'f.:. 12-11... 5' 2-.fu 2.4 v .w - 2.3-,Nha ww, fmffgiti' -'- .1. ' -.W-,iff .4-H.. , f..----,Lu ffm .. .- ,.-zuigmgf-Q , - - -4 ,,.-q,33- ,gg :g .:..',.M.:,-511112-,fi-222'H-'-:H--f-,sgfg'.,1,.,g.g. 15 81.-3 5,,,.:, ,- fl-2+x:s:2s5.2 :?Lif1s1sar5.e:zfi!fi212fff'::.aH22?5v--s1-fii-2232mE.1g-mfr-r??ykPF?5?:Pgi Efiifiiieiegwghflgiimfs.-22:5-5:221--isa!ai!ieiii1zz3ai,zasaws:-ssfxa-flaffi 25-nAG?-ifsusfqggffeasmrffiaeiwiimfrs-a2f?izf2i?'sf2z2s?f?i5rg:5?Z?af.E35E-fi?s3-inf2S211H5f2f'1f5f?1' -3 'ZSE1-fg!Kg2,ig3E,m 'TES-zimggql-zagymlzi-52:2 9-ef-Qisfeszifdnisssgiugms:E1iEe.?zzg1:JEgL.5 -126:filhSa.2iF1i-'ESPN45159if?i'f?f4f5N'5E22-122 fLibifiihfhszefs-11ft1fs'3?'1+h?iiQe3QiL-afwfifilflifiifffiffiii'--'ifimiliriiiiiiibiii 2252zL51?5f?i45i?zQlQ11a--szas-isa-MQW!ffn!!iQi4is?iEsH-Ea1FEG'Ufff?eiFf2f'5f'ff4-55?fi?E533555525as2s2i5iesz::i.11i!s15+Q-H14sezeausigiaetseatzizzizfazzaaagaiaimsin-filgyfififfgveffgaaffvizitaqz.--2-flag--sez- li:iliElii3i3i!fii'Ei!i-1235l5E!iiliE1Eii1 - -2:22f'4ff-i5iQ2siE-.-i:-ei1:if-sf5:51-54:36-545-1-iiiiiiiiif5ii-we2414f2??4iW5fi'ifi?55?Hi??'iH4Q+f'iiiw--fi-in---ga-.Q-aiaiqggkssefggfejg-'isa--1i4is1---wma-4rff22feiEf35fia--s'-4---5fx5?i2f??!ie?zf5ff-M2--f-gs-ifwe-awwgf-bgaafgglggqqM6345--wwfgewlfewff-iffgiffmg-mffWi-f'g3ii'1e.fePirwfazrgragggggigggiqgg-555533gxgggggfgfgggl533353-Qfsfgfggyv-5353.55mygggsfgif Wy: -'-- '--fzf'1'i1f'?2'fSz?fs?y21 91.253355'-1'f1f'2lf1f':rgfTg'?E:'1etf2f5'i12iG5Qa'fS-5322412421?---'igfPM'arfvE1gE'fgfii,i2wsg?gmLQztrfzizfw- .iggfQf:!a':1553132iiiffsgggigi-3-555-gi,ggqfsisi'1iiie5-555Qagzivmz:z.2g22.5'l5!2!5fzi,H:i:z?,ifgu1.:5i11i.g-111....g.,i?.:g:fxg1fQ.?:.iii-iii3,.'Ea.!:3z:2..,1?E5ig:+fe2-nas,-31551?-I-152524555551ai--azggfaugg..gi.1511.::11::1,:,5.',1::q.5.L:.g.:..-1-.Wggigfp1,f:!:t':.1gg:g,1sggg5-my- ,-all-Qi1-i5:'lEI .sf--.sss?5: -Ei.:-J-E-'i':Ti.E:.fl L',2:1S.:1i5i'.j,tE:'. '5f' .r'if'i.'i.'1E.':::.'Zl:ig:aiiiaE1eaf1'-e:f-1?'-.'-ez'-mrmm H P11121-if..1s.: .-.:'.,:' Qg'..i-'QQ ',Q ,'f,43111EL13QPf:'1Ei:1I 3,1 4.s5ifr,gHgi. 'g's ,,','.,,','u:,31,'i.f Z,j..', 2 'Y' MZ-Q.--Me-'2 -Eifziifi5552515135425-552153.1U-'IV.Eff-3-... .i?i-QQ?--21'-.E.-s1s:s-.-1.------ zilfalr-11--2-ifif-'1251221-Q2'fWf'?w7.:3:1a-21.4212255222.11511ggi:stfii-Hifi-72522:23sLe:2a2ll:12Easaeaaayfsianewazi--??11?1Lff1fHlies--M?-sf?51-Qmfaivaz13534sl2szLzu?,E1fi?F2i?iE-'E.EQ-gi..i-z-IQI2ELi1-i231-2-?-i-w--v15-5Ha-5ff-- 15'gfajyfigggg:zQgj5!Qf255I2Qg1'j Mais'msafasizzasessfsgggeaaczrs5-rsiiwzrz.'aravmsgziqaziqdieiazeamumsmhsiiraz-age-5-germs:aeQses2pSsa5ssvw4''saLe1s1!sf!1f 7'1g5-223222:5:nigrfea5flih:H1f?'fd'edraesm.HsM525zjmwxaaikiefQ2-1123332-Hg1ffiiiHE5!ii9FH??5H9E5FEiEi'QE52a1Lg52f?4 We?4i?ussaiF3QE'ii1?Qrziila. .--M 53553542531-fHi??a?5i?SfiiikEeueng!!eyehesfzeiig--1221.3545'QSM'?i'!iif?PiffPi2' '?itiEM-21f:ff!ii1-:1'-Qiiffsaiiifiileh-a2ei!!f1r1zi!EiHiiFiiizkQf51 fnfl2:wiff'if5s:fFfrzff:nf-1222625if51'ifFlt2d?iAiI5ii!22h!54!tfif1i?3-'M-i 1iii's tiigit-QQ-3i?SiIW!?!41Hak:-PE-1-asi1f-AsES1'L1'iQ?'x4ew?i11' -1 Mia! - -Lui'i5e.ia5:,fniz:sr?:zs-:asf--fue .am-ss:121-ussassse.zssff--we-ezeea--2gaqassgag 'f1e:5E1n5g,55,i5sQ'f'- :qggQ'i.i1i1aQssf:eag?1E'f.-rf3i3gxieiissF2siinzsaazasab-as:g4:3laRFa3nzi:2f15-WQE1-'5fj5t3gl3E?e3:.f1sisg se:asggggxgga53gF54:g I-s. FJ., SHME5EE22I:i':Ex:EEEESEEFEQEEFSEE?-,TE.Iufifi'21E1Lfj2!EEb:!Qg'jiE!?1ifii::Eiqilfrilggz::5.!:.o':x115'1::1:E::.:fEiEjIg:5El5!i::iEE4E.. fE?g'f4? 1525! i!i'li!:iif:3i::?'. 'l1,iigL.i5i H1f1i'l1 'ixfifQ:iL1 1g,If? lb H155 '-liihil: 717 '. 5.6. ,5QA'l!i,g.Q3'.3,iii ggi' 'I gl' Lg:-'-351-L,-ga.J,gi,Hgggrrggg--jg-5155515-gfQ9515ff1,535'3-ggggfiafgg5155513321-5i13f5,5-515 - -- ---- -fm L .-mmm.-W-. L.: -1-.-----7 ----.f-.:1-:..,1:,--f.-w-1-.f.-.:----,-.-- .1-.. . -.-.-1, ...asa-... nz, -1-1. .xm....-- .-Q-1-' -. .mf-fm-1 ---1,0-A 1 -L mmm-,:.L..-11-m-my.2123-4.-1.--.n.,.g,f -,. , . ,, . .-E55q,fg:..--1 .L --H ,a.....-..g.g-q,--f-.-w--.1--.----..--.11--. --,----.--1.--ww faiginsf--..-----Z-Q41551r.-.nm-Z2123.-:Mm.-r15eff1-mwifillaiu Lai's!s.::'i3rQdzsse.zsas.'sag-?--1e-11--Z-5:51--ig:fgg:iiif3Z+'fff-.531-'sigh''img faiffgul-+f1ee?5 uvgvrliiqgifjwixfielif:W:LsEin-Q42:133kfffxffff-iligiiiiffffldw-wifiasfifmvga-QsWi'H?1 f'f2'13?'VzSi51e..'e51fi5 -1, 15193Wf?fsffv??iz12zf?f3f?rksa3zzvI1seas5?FgH1 f3g122f.HQQMQHQ6:41122-3533811H?fr'2 z52?'2!E'Eff' I9-i2i2I2i-Sffiiiiifs-MW155-5:M---5-S-Pi4i!i?iig'fmfiy' 52 AHakim'-igriifffwf-1i2'231m:-rewwfiiasifzinew feafiwfffl1riiff-:5f5i5?'15'Hff1i-'5fl:1iM41 Wiildghfgiiii-ffff.i'hfmiiif2f32i122sir1fiFz?W2EiMziz-1:i?i522iih+EisiYii:i2L4?1bf:aS2l-Q53 Wzs5i2iii2ieg294i1-a.-4'-if..:121 332:53-iimwffzisiifeciieusr-,s.SH52z.:2f::szazrfem znwffz-5,3211Zrnzssimaqssirzsf -efrafze.-iz-2211.244Sszlfisih-529'--Qeirizl.fifzfwf Twig-1.21 - ' ',f-my-s1.2--55--,.fh-.?a,1a.Ea!.a.-1fa332f!g-was ff5.4SME-fi'-DQS-ggi--W4H146-M11.14-!.es-.img i'?1n-2.114 --H,g?-g,5.g-:.g---1gs-v:.--fi-qua.4i-Gil32z--x-is-155-221. 51qsix'fpg4ff.?2g.3q'g3.,-gggg,,5Lf:.es.gL:gms-eas.21's:imssmi. .fmzmgqdw-f+ve'z+v-1-1----fg:-21121-25-1f.ius1mga65393-e5 ?i?ff!22--132-f52s2Q'i12g.ii-15-5-2 .:?f1?fi--'W E.:1'!i.fl-ea 2x-'SEM 'E.s::'.zs,irzgm gs.alZEa.h!1..Tff films-f,ea.24511-iia:.MLz!m1L'1,g.wf:-Q-if-zfiez'-455gaL'!,!l'Ufflltifffriispag-Siwisisksilss123135-:Exim HJL- mcflivff-1-fi-akxgssiv-.Ms,Ma I.?aQ11fgee.-2 Q veizx-j1Lp'f2, H. '5-1:Jw-a,qssssr.eme.if,Ll-rmlkunf- -,-.:.,-,away-.F-1,1--.--.1m,a..m,g---:,..a:5.gQ,gg-gig,ami-QW ,g,a,,.,,,g,g.m5s-,fl MWg?my--L.-hun..-.n..1,we .-,--mg. t ' 1f1 -'X'4'f-'WF' 1!'P fm:'X 5'J ! ' VIITXYFEQ-E'!:iiE:'1'P.!iM'f:1Z5.:1V1.'L :, :.:::LP.Lzt:::::f:':: '!-iw' 5 '1'li1i'h'f53'1 L5f::HFf?'lT Q ?I'f',?'f:1'fE'lE 5:'S:: 1: mm?:LH1:aL E:i: q:.i:l:2:prE?5::::1:1.E:'i '-'WEN F'-'fj . . i 5.f19f 1Q'7f,E3'Lf'K. Hifi :'g'3f:5!-ELE!.5.:i.fg:5:l..!1Q :jg ga, :1l51jj1I'1-'U'f5.5'Qg gg,z:,:1555m55N:3:j- My ,,, ' .5125-2241g5a!s:slfissigzg gin' Msgiaisxia anim'aaigidishff?-2zrefe5g1zvz:enaes!a Fni!535EAiq..1nuazE'1gq5? 5522455-es:asg!!kE25gSia34-12amsisggg-sg frm!-azfzeagssgggiisgiiigsgg 5 Eva..-,555-5-,--5,5-:g,,g.?3W 555.3--E --.1.-gm---5,-5. -- 55121-3545 seraais-3!eEg+s'.-.a152-bmi .am-se.s1fnee2:5 sz51.5559:ifucv'15-Q-fi:amiea.5.fe:::se.sAehrn4i-EsEi55sss.11H !ix!?3i!1ng4wl :ilrlefgzi .pgsluadvif'345:nf:g:f.gggg4qgugggi:.g:igf:z:5:giggafs51 zqlifilnaiimiigugg ,df-:f gg-,.5:g:e?g-g:.' :zglzggefglgg55.4111g5g55ggf:,g5,iggfdgggggggiggq512155!'gLiv:'n,.-q-51535:i'5mh13f'1'ft'fff1lfyfifhvfi 3-H2-32711-53-ff-113125.ELQTZ 'x:1E:sE21ii:g Lzggiggaews-1: 11-afgayigfliskim?!e5232211a2afvseg5i1w,a5ea1-agffiltsgfigfgsigfggi3-'jjigggf-Egigigijggghg33.515555geazfaeipgrn-.E 1-git-fzjef1.3-:ian-2.3H11 :--.1511-11:1gzgfeq?me1q5551L535EE,i5555535953-g355552115gg:if5-35535-J-.Q:.2m5i5i:i5j:5:.551-,-- if-2 ..iE3'.. -- 9 -fi25iii -I -H-1 I -Www? i:'V::E:'4E5i,: f'Ii.Ei?5EE' 14-Ui H -fi Wig f ff'- 2iM 11f7'V'1 'H-1'--Pu-1f:?'1::i2: iii' .:1'.'Z.. :ZEF:i::.E-,Qf'E3E? .. f. .?Ei'fH7i'f'f'f 1'W: 1 'im 1f1f',:lf?1:. lU1El:v:.:-11 :':1l':Q::izf:'iii:E.Si:55fi::::4.: ::::.::::: ',. 'E11E':'f i'f'f! 5, wg 1135 ygggjjgi gp: gg:u:,: '::q:g3'5q.: Lig s,3j5'ggg5ll 51553513135.:5.5,f35q'55:5 gjljljj :lx-' 'Eiga ,ifwfv1.-ieaawgagmgssiizzzgvs::v4ef's'a2a.!1f:sa?r!'cm-mg5i'is.5fz2ixmat ami.lain.-as-'mass'maiwaaaiiiamazmiaftimwfif:fax,-s-1-?f se:-seam.Mas.. :5575a21i:szss'MSMi1'iff s:1-iftxli-i312sfiiasfsamia1341i!431114H22f'ffT?4122f2:E'2?'i2232yi512ifiiigiii5iE!fii!5EEgP5iQ??i55EiiiEEQFEEEWE-2-iii?WELifPE'41'?4x,5E1iiiiiiiii'5Qi?ff??Ef?'?f5ii1?jEi'siii??GzLa!!i2z2gE.f2ffiEf!2gPiHi2!'EiLi146:22!fE-2. wifi?--.2Ef!4'z1aE':-'W' Lfsf' EJ:'34F'7-715151475-'?!??f':TE7'i'i27?E55': ' ''mmI755:?iiiEEi.'4:55:52'f:iW'i'FiiE:l: EM: :,:E Li: f: EElE:1Ef?i51-EEIQWQQEZH'HW''13i1?fXEi?11?E izifiiiiiifYE:i'?'Q.fF'lf3Z?1'W'1f53151s.WilEE:ll?l'E-EWEE5554145Effajiifhigf'i5?6':E!+21'if'T11E'iEViEi:!:fm'-1:12-uL:1:.!1::-::5:I:- rm 'Lv311'1Sir5!i4 ::':E:?5:31:Mil5yfg:Qfg3fj1:QggQ555zg5g:.jgQ1ai-gglnhp.,.:Lvzbirigfrzfy-E..':-an :yr::':e:5::yr1q3,14f:35yfq3y1g:I-m5.?J2mgHg555 2231.....--4.-f.-.gs--.-sm... -1-:L-.fn 4...23.--:ge':52affLa1:213?f5gg!.sfE11ze:!.:.f?si?1sL's1r-ega:' -.1-f':air.fzi-.2--I --wh... -.z.,.. ...ef--11:--12,1-1.11e-ffills-Es.1z5-.,,E'f2:s2:efa..'1321525225:fs-1541:iiaiafiesfenga--If-51'2- ,.-..- --5-sa-1:1e.gefi-1:--N1:-.-...fame-f..-:masse -..z1.21123:2552-zeyesearr,-g..a..1-.mm.wif5-55-3535.-555,Em-3353533554. ,.--5555,--3-551533-.5 155,-Wgmg-xi.V,...g55H1551--.51 'sfsll-fe'1'-1::mars-:s ---11-:zza.:f'.- 'ww-512'-:2::f-Q- ' f 'f -vff- f '-21'' -ff f-'lf-'rfizff--sa':se,'ffm-2:1 fzaz-ra---.seezswsaseff-za''--al 1'af'f: 'v-'f-1-2-1 -:1:-'-11uff'f w:2 fff1'f'2'f f'1 '.if-fe 192213125.22.11--iesiazazeaeamz-1re-a'f12-5-11-2 .- fy---.---,-5.5,,-.-I-5,,-5,.-Q-wi--.33...gg-35.5.,-.,.M,..3-,L----,U-VA333.--5 ' '-ww fr-2'sz1f:u:ff:1i1ef-zf-1zf1:.2-P1-a--'-1--I--'f-fsfmwf-'lw-f1+-'f6Hw1s4'5---saravsssxs-:zanf-saW-2-eras-fzzwiztvfae-e'f. P '-f1feffQfa4-fflfwfxwlan--1'ffvuwfffff--I-122' r 5 --fggggfgg.'...:..x:E: .:1.::?51333--1-,,g3---5 -g----g.-gg...-. ' . .fx 'E'i .,.1Ma- -:s:i'--,. - 's- EEF'525255EEif:il -5'Ei2'i'?E-:?.i:Q:'f:L55::iEiE-?iSFEzEzEE!:::I '25 ' if.i?-9-i.4'fi.2YI'WE' ' '14 if 5- --. 1- 1- f 1 H - '--4::::'g.,,f M: :.:.-:mu :mc Imp' LEM..-f2Eu:.:: '::1e.:-uf,.:-: :f .:,r :fggzep-gs: 51,::::L: ' .. fps- :Jw -:.:..::m-:1.g.1-:. .zzz ,.1va.u:: p:.::4:,:1:::-1: rzmzzzggggggl :.':.g -4g,,.g--,L-gg7-,gfggzi-0,1 1 1111-154 -.gg-.-m:.g1,5gg1,5Hj 5555.qg5,Q,g,L55':3,,g, 5,535 51'2',1f5--91 -,--,-,44,,. :5.g.::g,gg. 1.57.4 ' xi:.Ql,:'.. 'l'I'g,' '::'zQf,::' ' gif fr-1-fa?1-ag:-'1Q1sfg:zie:z:45g1iz,f:s?.21.1 .cf,.::.:1111Z.?uSg.F1.,gr -ww '--azz:.Fax-fi::iQ.aazi.5zwaQus159153517.- ,.,j..g.-M.,-125,2:22223-.QQ..g,gQ.-,-1.3.3,S-' ,--1.-,g:sv-Wlg-My--v-gg:my-3p-5F,-1-----5-,gZiQ3Q5:,,g,,.pg -fi... pg--ff- j,q3.-.f4- fi 1.-1-,-.,-. -.'-ia:-rersfeazeea-I '- 1g 1z 51,-z.':23'1s:51zzf-..1'- - Y' .If-mags:gaegggqeeev--1-eexaszzl. .-A-aa.-H ---- -Q-my--f-1f---.fa-igm--- 1 ,g1:f:g3.s.qsuqgggggfgmgqggqggfgggjg5555515-1.fr.eg-y-.--155535-5.555E3153,-3.3.1 .g,55.i:-4,.gq4-145, -f-iff'-14 ' A ' .f:I:E1EIi' '171:f?E12I:1?i:1:::ur53i??lEE:E.: 4.::::,!.SM VIE T-Ffiw ?f'T-1.1 ..E12.151eZE?::.::.q4:n,::m.::1111:-1-e:::::.:::a.::.::1'ne::z:::v:::1me: .::: .:.: . .. . jf -. L,,,,, '. J? MMQJMA-f-f fffllgg- jj I WTHE PHROVI QF 19 The Editors EDITOR-IN-CHIEF Morrie Goodrich ASSOCIATE EDITORS Icme Gustafson Rex Horton Milton Ratner Adolph Zorpfel ART EDITOR Dorothy Eilenberqer O BUSINESS MANAGER Ioseph Much TI-IE PROVI I 9 W3 5 THESENIOR CLASS PROVISO TOWNSHIP HIGH SCHOOL MAYWOOD ----- ILLINOIS l955 l9IO I635 DEDICATIQN TC PROVISO TEACHERS OF YESTERDAY AND TGDAY: T l-I0 is the ldeal Teacher? Who is he That every schoolmaster should wish I to be? IIIllllIII'lII 'Tis he who labors knowledge to attain llllll mmlllll' II,nI That from that knowledge he may wisdom , IHIIIIH, 1'..lnui...:,,,..--t gm Iltttl ::,, I To answer aright the inguiring minds ot II' llll' All nII l youth .lllllllllllllllu nlllllllllllll III' tmllllll .- WHO fquegllon him with M1 tO lm the i I .11 ' trut -. ,I l-le is tne triendly soul who understands, Ili' ' ' I,,.l l Iu, When pupils come to him with their ll' demands, That they are seeking more than books can HI Imlllllllllllllllllu leqchi 'I , ll, Who helps them tind the lignt toward which 'l ' they reach. I J! tl, These be the virtues that he should possesszp A kindly spirit touched with gentleness, Patience to deal with those whose wits are slow, Who care not whether ideas come or go, Sympathy with those whose lot in lite fs marred by poverty, or toil, or strite, Tolerance broad enough to serve as guide Wnen Catholic, lew, and Gentile, side by sice, Endeavor to iind common points ot view, And work together with a courage new, lnsight that may divine the hidden gleam Which dwelQs within a guiet pupil's dream, Enthusiasm which shall kindle zest F or research, and tor Duty's stern behest, Devotion to a cause that oiscounts guite The weary hours when nothing goes just right, Vision to catch the Spirits raciant light And pass it on to Youth uncimmed and bright. This is the ldeal Teacher, this is he That every schoolmaster should wish to be. ll ' ll Y Il ' .. nlllliii::iE:l ' . IIIII!! 1 l . lllllt , -' tvlllll: :SIIIIIIIV , pl' 'IP I 1 :stun ll uv-' Ill llnu----ut--' ', A. llllllllllluuus1I :rll ' l ti llllI lw' 1 'l I tl ' 'llnliwlll IIIIII l 'l ,,,,, I -V -- --ll Ib ,rt qt 'Ei luuuullll 'Ill - Ill 1 I llL......,,l ,ALL ,llnlv lllllt III' 1IIIlI -I in 41 Illia ll' l ,u I 'Ill' l Ill' ,1 s : fff -ll r -. lllllll ' IH' :quill I Ill' I ull: Il!! nu ,.,,,,ulupyl ..',,,,:Eif' -.::t.i Jill IW' I Ir HI 'i I' iliwlllllll ll I IW lllllllll l lm I n ith.. mul lllullllll I IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIHW ' C E VV' C R D IIIIII ml HE commemoration of two outstanding educational anniversaries, the Tri-Cen- tenary of the founding ot the Boston Latin Grammar School and the Silver Anniver- sary ot the establishment ot Proviso Town- ship High School, inspired the theme and motif tor this year's Provi. A comparison ot the modern vvith the Colonial methods ot education brings a realization ot the opportunities oi today. A change in tne psychology of teaching has steadily diminisned the use ot the Grammar Master's Birch, a symbol oi unkind power, the companion and guide nas replaced the former drillmaster, treedom anc. responsi- bility have supplanted repression, nostility, and tear, and variety has superseced monotony. The restricted curriculum of the three E's has gradually been enlarged so that now Eoreign Languages, Science, Drama, lour- nalism, Creative Writing, Public Speaking, Music, Home Economics, Business Educa- tion, Manual Arts, Vocations, and Physical Education Courses are included. ln this book pictures and Words combine to dramatize tor the students ot Proviso the achievements of an earlier day, the admir- able school tacilities which they novv enjoy, and the potentialities ot the future. lt is hoped that the reading ot this volume may incite a greater appreciation ot the struggle ot the past, the attainment ot the present, and the challenge ot the tuture. III! IIIIII I II I Ill ,I 4 l l Il . 'llll Il Ill I ti . ' ....Ii1!III ii I HI I lu l ,Im Ill N' H Ilmuuun I Ill lull!! lu I I ll lun iz, it 1 mt tm I ll 1 ll ,Q fffwf 38 EE gg ,- X. ,. A ff, S M A . ffl 1-.rffg ax 3 9' i955 IQIO l635 yr fn Q. am, 4' fi YESTERDAY - - With the persuasive aid of his birch, the master in the Colonial Latin Grammar School administered large, closes of Latin, Greek, reliqion, anditt bit ot cipherinq. Gradually this narrowlclassical preparation was sup- plemented by more practical studies, including laboratory sciences such as surveying and astronomy. 4r- -Q S- 35? f I xl S 555 5333 4.4 9 Q, ai if' All I ,,,, . n M, I z I Qin 'z. ' 4 f ff fiiffawigxi 9 4-...mr Q fiisafilgfwff,-'e ,. z 5 3 2 :L 5, gil 4- ' T b 5359 e . sei gi-' --M-.J ' f 1, 1 . ,. sg 53.4 .Qs-fm f y xg ' E ,,, f 1 Q Q W f ' as K P , Y ,ff L glam' if 4 , K, z Vw' I 2 syn 9 ,Q H. H. EELKEMA Miss Elizabeth B. Oakes C. C. Taggart H. E. Carr A Review of the Administrative Work for 1934-35 ln District 209, the school year of 1934-1935 was marked by the progress of the high school under a three-point program set up by the Board of Educa- tion and the Administration: to place the finance on a sounder basis, to improve the physical plant, and to provide an educational program which would make Proviso Township High School of greater service to the students and the community. The close of the school year of 1934-1935 finds the condition of the finances of this high school district greatly improved. During the year all salaries were paid promptly in cash, all bills were discounted, and 318,000.00 in bonds was retired with an additional 325,000.00 scheduled for retirement on lune 1, 1935. This important improvement in the financial condition of the district was made in the face of a decline in the valuation of the property for each pupil enrolled in the township and despite the lag in the collection of taxes and the leisurely manner in which they were remitted to the school authorities. The current expenditures were reduced to an estimated 398.00 per pupil as compared with 3101.88 in 1934, 3119.43 in 1933, and 3168.00 in 1932. Part of the improvement in the condition of the finances of the high school district was due to the success of the Administration in finding new sources of revenue. The vocational courses were altered to meet the requirements of the Smith-Hughes Act, and new courses were added so that now, for the first time in its history, Proviso is receiving state and federal aid for this worlc. Another increased source of revenue in 1934-1935, the tuition received from pupils outside the district, is estimated at 39,200, almost double the amount received the previous year and more than four times the amount received for 1932-1933. To improve further the financial condition of the district, the Board and the Administration adopted and put into effect a detailed budget plan and accounting controls. As a result of this effort, expenditures were kept within the budget. Today Proviso Township High School is one of the few large suburban schools which are holding school for the full nine months and meeting all obligations in cash. This school year also saw great strides in the improvement of the physical plant of Proviso. A stadium, which would have cost approximately 380,000 under private contract, was erected with government aid and donations from the Classes of 1927, 1928, and 1934. The total cost of materials, exclusive of labor, was 39,306.3l, of which only 31,800.00 was allotted from local taxes. The athletic field, which was re-arranged, tiled, and re-seeded, gives promise 10 of being one of the finest outdoor athletic layouts in the Chicago area. A new quarter-mile track was built, and the whole field completely fenced, with the parking space at the rear of the new building separated from the athletic field. The installation of flood lights on sixty-foot poles is a major improve- ment that makes possible night football. lllinois Emergency Belief labor was utilized to make many repairs and improvements about the building, including the weather stripping of all the windows in the new building and the converting of unused space in the basement of the old building into a bicycle storage room with a capacity of 600 bicycles. A start was made on beautifying the inner court of the new building with relief labor and the funds left for that purpose by the Class of 1931. With the approval of the Board of Education, Superintendent H. H. Eelkema made many adminis- trative changes during the year. Supervised study within class periods, which were lengthened to sixty minutes, was introduced. By breaking up the former large home rooms into smaller groups, a closer con- tact between the home room teacher and the pupil was made possible. The student body was made cognizant of many school problems through well- organized home room discussions, to which students responded. A revised system of checking and report- ing attendance between home room and classroom teachers was worked out successfully, making it possible for the main office to find any one of the 3,500 students any period of the day. A testing pro- cedure was introduced, calling for departmental examinations at the end of each of the three report periods, as Well as at the end of each semester. More definite standards regarding the number of subjects a student may carry were established, and the requirements for the number of credits to de- termine the class ranking of students were defined. All Proviso students were rated by each classroom teacher on character traits, in addition to scholar- ship. Formerly the only record on file from which inquiries could be answered regarding the capabili- ties of students and their fitness for certain postions was their scholarship record. An expert in vocational guidance was added to the staff the second semester, and a survey was made of the vocational plans of the students and of the opportunities for employment offered in the community. An employment bureau, the aim of which is to gather complete data on all Seniors, is in the process of establishment. These steps were taken for the purpose of making the school serve both students and employers. Other administrative projects were as follows: the extension of physical education courses to comply with state requirements: the addition of new courses in English and, as a class project, the preparation of a student handbook under the supervision of Miss Eileen White: the sponsoring of conferences between the grade schools of the district and the high school: the supervision of a government adult school in which l,000 citizens beyond high school age were enrolled. The Board of Education, Superintendent Eelkema, and the faculty have all shared in helping to make this year one of great progress in the history of Proviso Township High School. ln April, Leslie l. Smith of Forest Park finished his eighth consecutive year of co-operative service as secretary. Those now serving as members of the Board are lohn M. Newcomer, a real estate broker in this community: Leslie B. Allen, manager and purchasing agent of the Richardson Company, Mel- rose Park: George Bosco, a resident of Melrose Park who graduated from Proviso in 1913: Harry Ewert, a resident of Maywood for fourteen years, and for twenty-one years connected with the Chicago Board of Trade: and Emery Parichy, the newly-elected member on the Board, President of the Parichy Roof- ing and Shingle Company, Forest Park. Leslie B. Allen Iohn M. Newcomber E. A. Parichy, Pres. Hurry W. Ewert, Sec. George Bosco tk -Q -un Q. 1- v 1 Il ' -sd.,- 1 1 V L n r 41. :rf , M E Gzfxmemwmumm mf -.. I Q, v-. :Q .1 'Hu 'W m,,X?d5Sis0LlAWH r1 J 'WIS' English. Seated - Miss Stark, Miss Reininga, Miss Harman, Miss White, Miss Scott, Miss Baldridge. Standing--Miss Hogan, M. W. Immel, Miss Trigg, Miss Otis, Miss Norman. English. Seated-Miss Gar- lough, A. T. Bolt, Miss Emge, Miss Whitfield, Miss Fancher, Miss Nelson. Standing-Miss Neal, Miss Smith, H. G. I-lolt, Miss Reid, Miss Vallo. Mathematics. Seated-I. B. Davis, Miss Hildebrandt, U. C. Foster, Miss Payne, F. W. Baer. Standing- H. E. Carr, W. A. Law, H. G. Monilaw. History. Seated - Miss Trost, Miss Barnum, Miss Wunderlich, E. W. Stubbs. Standing-Miss Gray, R. W. Marshall, Miss Honey. ENGLISH HISTORY MATHEMATICS SPersonnel ADMINISTRATION H. H. Eelkema. . .......... Superintendent, Principal Upper Iowa University, A.B. State University of Iowa, A.M., Ph.D. C. C. Taggart .... Assistant to the Principal, Science Ohio Wesleyan University, B.S. University of Chicago, graduate work H. E. Carr Dean of Boys, Mathematics Ohio State University, B.S. University, of Chicago, graduate work Elizabeth B. Oakes .................. Dean of Girls University of Michigan, A.B., A.M. Columbia University FACULTY Dewey D. Adair ........... Simpson College, A.B. Gregg College L. K. Amsden .................. University of Missouri, B.S. University of Chicago Armour Institute Stout Institute D. B. Appleton .................. Indiana University, A.B., A.M. F. W. Baer .................... Indiana University, A.B. Purdue University, M.S. Marie Baldridge ................. Kansas State Teachers' College, Northwestern University University of Chicago, A.M. Amy Barnum. ................... . University of Michigan, A.B. . . . .Stenography . . . .Manual Arts . . .... Science . . . .Mathematics .........English B.S. .........l-lisiory University of Chicago, graduate work Carl H. Bergstrom .................... Manual Arts Northern Illinois Teachers' College, B.E. Northwestern University Arthur T. Bolt ............................ English Wheaton College, A.B. University of chicago, graduate work Columbia University, graduate work Northwestern University, graduate work Otto A. Bolt .............................. Science Calvin College, A.B. University of Michigan, A.M. University of Michigan Biological Station Marine Biological Laboratory L. S. Bracewell ...................... Manual Arts Bradley Polytechnic Institute, B.S. Purdue University L. D. Brennen .............. Indiana State Normal Lewis Institute Stout Institute . . . .Manual Arts Ellsworth W. Brooks .................... Commerce Kirksville State Teachers' College, B.S. University of Iowa, A.M. Robert Adrian Bullington ........ Eureka College, B.S. Illinois State Normal University . . . .Science University of Illinois, graduate work E. F. Cameron ................ . . . ...... Commerce University of Illinois, B.S. Rockwell School of Insurance Northwestern University, graduate work Iohn Carter .................... Assistant Librarian Northwestern University, A.B. Harvard University, graduate work University of Chicago I3 oi Proviso V. G. Catlin. .................. . .......... Science University oi Chicago, Ph.B., graduate work University of Illinois Vtfestern Illinois State Teachers' College G. R. Comery ................... .... C ommerce University of Wisconsin, A.B. Northwestern University H. L. Cooper ......................... Manual Arts Lewis Institute, B.S. Armour Institute of Technology, graduat e work Eastern Illinois Teachers' College, graduate work Thomas I. Corgan ......................... Science tlftesigned at close of first sernesterl Northern State Teachers' College, Marquette. Mich.g B.S. Iowa State Teachers' College, M.S. Ioseph B. Davis ...................... Mathematics Central College, Missouri, A.B. Columbia University, A.M. University of Missouri University of California Northwestern University, M.S. Fae Duvall ....................... Home University of Illinois, B.S. University oi Chicago, graduate work Eva A. Eddy ................... Physical Battle Creek College, B.S. Kellogg School of Physical Education University of Minnesota Dorothy E. Eilers ................. Home University of Illinois, A.B. MacMurray School for Women, Illinois Economics Education Economics Mary E. Emge ............................ English Indiana University, A.B. Columbia University, A.M. University of Chicago, one year of graduate work Iulia F. Evans .............................. Latin Northwestern University, A.B. University of Chicago, A.M. University of Wisconsin W. K. Ewing ............ . ..... Ohio State University, B.S. Greer College . . .Manual Arts Clarence W. Failor .............. Commerce, History Iowa State Teachers' College, A.B. University of Iowa University of Wisconsin, Ph.M. Teachers' College, Columbia University Cleora DeVerre Fancher ................... English Ohio Wesleyan University, A.B. University of Michigan, graduate work Ohio State University, graduate work M. M. Finstad ........................ ..... C ivics St. Olaf College, A.B. University of Minnesota Chicago Seminary, B.D. U. C. Foster ................ Mathematics , Athletics University of Illinois, B.S., graduate work University of Chicago, graduate work Albert C. Fries ......................... New Mexico Normal University Universityof Illinois, B.S., M.S. Gregg College Marguerite L. Garlough ............. Columbia College of Expression Wheaton College, A.B. University of Iowa, A.M. Humbert Gentilin ........... University of Pisa, A.M. Commerce . . .English . . . .Italian ' 'wig .lx wa 4 - ex I In I 4 I 1 1 A 5 '1 -G 4 .I K7 fa is 4 I 4 t -2 1 f 4 4 F Myron B. Goodwin ................... Manual Arts Stout Institute, B.S. Northwestern University, graduate work Frances P. Gospill ............... Modern Language University of Michigan, A.B. University of Chicago, graduate work School of Languages, Middlebury, Vt.: graduate work Willa Iean .Gray .......................... History Indiana- University, A.B., A.M. University of Wisconsin, graduate work Alden Greene ............................. Science Grinnell College, A.B. University oi Chicago, M.S. Alice I. Hahn .......................... Commerce University of Chicago, B.S., graduate work Frances E. Hammitt ...................... Librarian Indiana University, A.B. University of Cincinnati Columbia University, graduate work Anna M. Harman ......................... English Indiana University, A.B. University of Colorado, graduate work University of Chicago, graduate work Purdue University, graduate work Fred I. Hatley .................... ...Athletics University of Illinois, B.S. Martha Hildebrandt ................... Mathematics University of Chicago, Ph.B., M.S. I. W. Hinds ...................... ..... S cience Eailham College, A.B. Purdue University Eastern Indiana Teachers' College Laveta A. Hobson .............. Physical Education Central College, Fayette, Mo., B.S. University of Wisconsin University of Missouri Violet Hogan. ............. ..... E nglish Lawrence College, A.B. Columbia University, A.M. H. G. Holt ....................... ..... E nglish Iames Millikin University, A.B. Iay Earle Hulet ........................... Science tliesigned at close of first semesterl Greenville College, A.B. University ot Illinois, A.M. Manley' W. Immel ................. Public Speaking University of Chicago, Ph.B., graduate work Dorothy Iackson ................ Physical Education MacMurray College for Women, Illinois, A.B. Teachers' College, Columbia University, A.M. Clara Iohnson ........................ Stenography Iowa State Teachers' College, A.B. University of Iowa, A.M. Gregg College Harvey F. Iohnson ........................ Science Ohio Wesleyan University, B.S. Ohio State University, B.S. of Agriculture University of Chicago, graduate work University of California, graduate work Charles E. Kassel. ........ ..... P hysical Education University of Illinois, B.S. E. W. Kochenderier ........................ Science State Teachers' College, Eau Claire, Wis., B.E. University of Iowa, M.S. Ruben R. Kuster .......... . . .Modern Language Beloit College, A.B. University of Illinois University of Munich, Germany University of Wisconsin Wilson A. Law ...................... -.Mathematics Missouri State Teachers' College, B.S. University of Chicago, A.M. ' Northwestern University Wilhelmina Marm ............. .... A rt Chicago Art Institute Bethany College, A.B. Chicago Academy of Fine Arts Ralph W. Marshall ........................ History University oi Illinois, A.B. University of Chicago, graduate work Helen M. Masters ................... .... L atin De Pauw University, A.B. University of Cincinnati O. H. Matte .................... Physical Education American College oi Physical Education, B.P.E. Iowa State Teachers' College M. Grace McAuley ...... . .............. Study I-Iall University of Illinois, B.S., graduate work Leland L. Medsker ...................... Commerce Missouri State Teachers' College, B.S. Northwestern University, graduate work Dora M. Mitchell ....... .... S tenography Gregg College University of Chicago University of Southern California Iacob W. Moelk ..................... . . .Science University of Wisconsin, Ph.B. University oi Iowa, graduate work H. G. Monilaw ....... . . .Mathematics, Athletics Coe College, B.S. Ruth Neal ...................... .... E nglish Northwestern University, B.S. University of Chicago Ruth G. Nelson ........................... English Northwestern University, A.B., graduate work Wallace Nelson ............................ Music Chicago Musical College, Mus.B. Westminster College Cornell University Helen Grant Norman ...................... English University of Illinois, A.B., graduate work Marie Oliver ..... ............ .... H o me Economics University of Chicago, Ph.B., graduate work R. Lee Osburn. . . . .......................... Music Columbia School of Music, Mus.B. Ottawa University Conservatory Cornell University Florence I. Otis ........ ....... .... I o urnalism Oberlin College, A.B. University of Michigan, A.M. Pulitzer School of Iournalism University of California Western Michigan. State Teachers' College Charlotte Payne ...................... Mathematics Oberlin College, A.B. University of Michigan, graduate work Margaret E. Phelan Latin Northwestern University, A.B. V University of Chicago, graduate work University oi Wisconsin, graduate work Lola Pickles ......... . ............ Home Economics University of Illinois, B.S. Columbia University, graduate work R. E. Poplett ............... , .......... Manual Arts Illinois State Normal .University, diploma Armour Institute of Technology, B.S. 14 Science. Seated - O. A. Bolt, L. W. Remley, Miss Shepard, C. C. Taggart, Miss McAuley, I-I. F. Iohn- son, I. W. Moelk. Standing -D. B. Appleton, E. W. Kochenderier, R. A. Bull- ington, V. G. Catlin, B. I. Wagner, I. W. Hinds. Language. Seated-Miss Masters, Miss Gospill, Miss Williams, Miss Evans, Miss Schlueter, R. R. Kuster. Standing-Humbert Gen- tilin, Miss Phelan, C. H. Saylor. Art. Music, Library. Seated -Wallace Nelson, Miss Marm, R. L. Osburn, Miss Harnmitt. Standing-R. I. Tallmadge, Iohn Carter. Home Economics. Seated- Miss Pickles, Miss Duvall, Miss Porch. Standing-Miss Eilers, Miss Oliver. Science. Paul Street, Alden Greene. LANGUAGE HOME ECONOMICS' MUSIC If ? Ztfqfc P4 Qfez '14,0,tg. N 4:5154 f'e-Q..-fig? 1 :fswwwmggffz I-gr:-' Q M ' .. . I t - .W , I v kai? W 'N Y 1 a u-D I I ' ' , ,V K ,M ymfd' .kg . - 'aw i , 5' fr .Avi 4 9 wwf .K ,. u 1 ' IAA. S af ' I E I Lif 1. fx- 17,5 03 Q X W, N Q, ,f ag , Q2 sw xv Q f' If E 2if'g , NB E5 gif z Lg, '.JSf'i-'NUM , 5.1- Physical Education. Seated -Miss Hobson, Miss Iack- son, Miss Wheeler, L. F. Slimmer, Miss Eddy, F. I. Hatley. Standing-C. E. Kassel, Miss Robinson, O. H. Matte. Manual Arts. Seated-C. H. Bergstrom, L. S. Brace- well, R. E. Poplett, I... D. Brennen, M. B. Goodwin. Standing-I-I. I. Stegman, H. L. Cooper, W. K. Ewing, L. K. Amsden. ' Commerce. Seated-G. R. Comery, Miss Hahn, E. F. Cameron, M. M. Finstad, C. W. Failor. Standing- A-. C. Fries, L. L. Medsker, Eg W. Brooks, O. W. Wills. Stenoqraphy. Seated! Miss Sigworth, Miss Iohn- son, O. R. Wessels, Miss Mitchell, Miss Seaver. Standing-D. D. Adair, H. W. Welsh, Miss Wolff. STENOGRAPHY PHYSICAL EDUCATION MANUAL ARTS FIRST AID COMMERCE Louise Porch ............. . ..... . .Home Economics Rockford College, B.S. University of Chicago, graduate work Emily C. Reid ..........................,.. English Eastern Illinois State Teachers' College University of Illinois, A.B. University of Michigan, A.M. University of Chicago Grace Reininga ........................... English Eastern Illinois State Teachers' College University of Chicago Columbia University, B.S., A.M. L. W. Remley ............. ...... S cience, Athletics Wabash College, A.B. University of Chicago Ohio State University University of Maine University of Iowa Helen Robinson ..................... School' Nurse West Suburban Hospital, R.N. Mozelle Roney ................ .... H istory Baylor University, A.B. ' Louisiana State University Ada Esther Ross ................ Modern Language KAbsent on leavel Iames Millikin University, A.B. University of Wisconsin Columbia University, graduate work Universite de Grenoble, France Charles Henry Saylor .....,................. Latin Iohns Hopkins University, A.B., Ph.D. Gertrude Schlueter ............ . . .Modern Language Northwestern College, A.B. University of Wisconsin, A.M. Florence H. Scott ................ .... E nglish University of Michigan, A.B. Columbia University University of Hawaii Iessie V. Seaver ................. .... S tenography Milwaukee Teachers' College University of Wisconsin, Ph.B. Gregg College Whitewater Teachers' College, graduate work Winnaired Shepard .....,............. . . .Science University of Michigan, A.B., A.M. University of Chicago University of Wisconsin Mary A. Siqworth .................... Stenography University of Iowa, A.B. University of Montana, graduate work Northwestern University, graduate work Whitewater Teachers' College, graduate work Louis F. Slimmer ............... Physical Education University of Illinois, B.S. Northwestern University Assumption College Butler University Martha Smith ............................. English Central College, Fayette, Mo.: A.B. Teachers' College, Warrensburg, Mo. Cecil Stark ....................... . ..... Dramatics University of Chicago, Ph.B. Columbia College of Expression . . .Manual Arts Harry I. Stegman ................ Stout Institute, B.S. Paul Street ..... ................ ........ S c ience Washington University - Northern Illinois State Teachers' College, B.E. E. W. Stubbs ....................... ..... H istory Ohio Wesleyan University, A.B. University of Chicago 17 I. Irving Tallmadge ................... .... M usic Northwestern University, B.S., M.S. Chicago Musical College, Mus.B. University of Minnesota, graduate work De Paul University, graduate work Grace Trigg .............................. English University of Illinois, A.B. Columbia University, graduate work University of Colorado, graduate work Frances H. Trost .................... .... . .History University of Illinois, A.B., graduate work University of Wisconsin George Peabody Teachers' College, graduate work Marie Vallo .................. .......... E nglish University of Illinois, A.B. University of Wisconsin Northwestern University Bryan I. Wagner. . . . . ............ . ........ Science Kansas State Teachers' College, B.S. University of Montana Columbia University, A.M. Harvey W. Welsh .................... Stenography Northern Illinois State Teachers' College, B.E. Columbia University, A.M. O. R. Wessels ........................ Stenography Iowa State Teachers' College, A.B. University of Iowa, A.M. Mary R. Wheeler ............... Physical Education Beloit College, B.S. University of Wisconsin, graduate work Eileen White ............................. .English University of Illinois, A.B. University of Colorado Columbia University, A.M. Ruth M. Whitfield ......................... English University of Chicago, Ph.B., graduate work Northwestern University, graduate work Florence B. Williams ............. Modern Language Coe College, A.B. University of Wisconsin, A.M, Universite de Grenoble, France O. W. Wills ............................ Commerce Michigan State Normal College, B.Pd. University of Chicago, Ph.B., graduate Work Lois H. Wolff ......................... Stenography Valley City State Teachers' College, North Dak.g A.B. University of Iowa, graduate work Frieda Wunderlich ....... History, Modern Language University of Nebraska, A.B., A.M. Cornell University University of Chicago Esther Connors. Esther Crane.. Sylvia Gollay. . Clara Groenhot Jeanette Hanson ..... Floyd Hummel. Victoria Lux. . . CLERICAL FORCE . . . ........ Attendance Clerk Switchboard-Information . ........ Office Assistant ...........Clerk . . . . .Office Assistant . . . .Attendance Officer . . . . . . . . .Secretary Leverne Olson .... ..... R egistrar Margaret Stewart .... .......... B ookkeeper Flora Schulz ..... .... A ssistant Bookkeeper M. Stewart, F. Schulz, Mrs. Olson, S. Gollay, l. Hanson, E. Crane, V. Lux, E. Connors Groenhof and Floyd Hummel Mrs. Florence Owen and Mrs. Louise Zimmerman A. l. Oiierman There are three groups whcse primary purpose is that ot rendering practical service to the school as a whole. The many students who are accommodated in the Proviso cateteria each day have witnessed the etti- cient service ot Mrs. Florence Owen and Mrs. Louise Zimmerman, who assist Mr. Eelkema in providing low-cost meals. A. l. Otterman, custodian of the building and grounds, and his corps oi workers are responsible tor the well-kept appearance oi Proviso. Floyd Hummel assists the deans in checking ir- regularities in attendance. He is also in charge ot loan books, the bicycle room, and the new student work plan. Lunch Time in the Cafeteria IS FRONT ROVV C. Moench, D. Kanara, B. Bailey, VXI. Wilcox, G. Soaazrooko, L. Boehm, Schuster, YJ. Herman, F. Orland, H. Davies, I. Cesorio, C, Ftamus, S. Schultz. MIDDLFI BOIN N. F. Fisher, M. Cashdollar, P. Sticrnlce, H. Block, T, McComb, D. Huxhold, D, Hamilton, E. Ulrich, I. Griswold, Ichnson H. Alrlvott M, Stein, Fl. Vfiiey, I. Betts, D. Lcsctiy, BACK HOW' B. Swift, IN, Vtfright, I. Novotny, M, Dadds, A. Outh, M. Anderson, I. Perkins, R. Schlupp, R. Lande, R. Campbell, N. Essig, L. Fteisz, VI. Martin, I. Penrose, M. Iacoby. FRONT ROW' I. Lang, I, Rozanski E. Stokes, A. Foleno, A. Boehm, C. Kane H. Von Cfehr, G. Lietz, K. Biddle, IN. Bheirigrover, E. I-Ianck, I. Parchrnann. MIDDLE ROW - A, Thorn, B. Bacon, C. Rocca, Fi. Vertuno, E. Xriorring F. Mirtelstead, I. Manton, A. Belluomini, Kosch- rnann. BACK ROIN E. Puscheck, D. Sager, B. ODea, H. Meier, B. Dilferac, I. Staup, H. Schwab, H. MacPhail, B. Young, C. Slcopniclc. Council The Student Council is a representative group which has at- tempted to form a co-operative government with the taculty. Its most important activity has been the annual distribution ot Thanksgiving baskets to needy Iamilies ot the township. Through the point system, the organization has tried to distribute evenly honors and extra-curricular activities. Since, under the present system ot repre- sentation the group had grown too large to act ettec- tively, a committee ot teachers and students was delegated to tormulate a plan by which the Council might enlarge its powers in order to give students greater participation in school government. In the spring, a successful ettort was made to adopt this plan tor immediate use in September. OFFICERS: SEATFD- B. Wilcox, A.Guth, F. Orland, G.Bruce, C. MONITOR CAPTAINS: SEATED D. De-Vries H Davernian Schuster. STANDINGW M. Cashdollar, I. Parchrnan, B. Young. Lalilocco, C. Hahn, G. Hansson. STANDING M Stein C Kennett M. lteda. - W , ., 1 ,J :ff A.. MyL,it,,.- .. YESTERDAY - - From time irnmemorial the diploma has been the symbol of scholastic attainment. The paths from graduation led chiefly to the college, Where a narrow preparation Was made for the ministry. There Was as yet no social philosophy which considered the education of the masses. Only the priv- ileged few were passed beyond the elementary school. Little thought was given to providing the common man with a broad, rich background for life. i L. fm.. N.. Q luklm k gf 1 S Qzg.. f' N S Q ' - : qx' 15 ' I ff . 1' ' I' Q 11 .:-Q if 'CN X'-,., X T rig.-J xx ' X191., mm vis L... ' I 5 Q gk f' W 1,5 fi To the Class of l935: You have the honor of graduating from your high school in its twenty- fifth year, and of being the twenty-fourth class to set out from the original halls of Proviso on a great adventure -for life is a great adventure. As you leave this institution, you face a new environment. You are graduating at a time when industry is not prepared to re- ceive and absorb you. The challenge before you is an unusual one, the next few years will tax your ingenuity and your patience much more than you can at present surmise. Carry with you this thought: you must continue to prepare yourself for the inevitable comeback, if you do not obtain a position, then continue to prepare yourself in the lines of your interest and in those occupations or professions which this nation will ultimately need. lf you are fortunate enough to find work, let it be your aim to give far more service than might be normally expected of you. Adjust yourself to your new enviroment, be clean in person and in habits, strive to improve yourself mentally, and the material rewards will come in due time. lt has been the purpose of the faculty to stress Service g and if you will ever keep in mind that the progress you make in life will be cor- related with the degree of service which you render to your fellowmen, then you should go far in progressing toward and attaining the goal which you plan to reach. lt is our hope that the training you have received during the four years of high school has laid a solid foundation for the career you expect to build after leaving this institution. We hope also that you will carry with you many pleasant memories of your activities, of your school life, and of your associations with faculty inembersg and may we also hope that you will return to Proviso at the various alumni gatherings to renew acauaintanceship with your classmates, with alumni groups, and with the faculty. The faculty and the administration join in sincere Wishes for your success. Cordially yours, 22 FRONT ROW-YD. Mclntyre, G. Altergott, L. Baab, VV. lohnson, Mr. Stubbs, C. Clark, G. Beay, W. O'Bourke, D. Kane. BACK BOW, - E. Schroeder, D. Huxhold, W. Thompson, B. Buck, C. Hahn, B. Wi I, H. CCIYHS, A- Edwards, l- LG ROCCO, S- RUPOPOY1 E- Emsief- President, William lohnsony vice-president, Georgine Beayy Secretary, Loretta Baabg and Treasurer, Clifford Clark. Keith Gleason Muriel Vtfeber Belford Buck Clifford Clark History of the Class of 1935 By Rex Horton Even as America has paused to reflect upon her three centuries of progress in secondary education, and even as Proviso has commemorated her quarter- century of growth, so too the members of the Class of l935 may fittingly review the vitally important intellectual and social developments which their four years within the sheltering walls of Proviso have brought to them. When, on the warm, sunny morning of Tuesday, September 8, l93l, the members of the Class of l935 first glimpsed the Proviso which was to become an integral part of their lives for the next four years, they could not but be impressed by the sight before them. Surrounded by broad velvet greenswards, broken only by trees, shrubs, and bands of white concrete, stood a long, new, stately edifice, with a mighty tower high above it, rising into the sky, symbolizing the high purposes upon which it was founded. Here stood an institution well-equipped to carry out the noble mission of enabling 576 young people four years hence to take their places in the forefront of Americas thousands of high school graduates. But, upon that first morning, the 977 Freshmen had little time for reverie and meditationy the confusion and strangeness of a first day in high school soon absorbed all of their attention. After the usual first- day scramble to get to school much sooner than necessary, they found themselves in a bewildering labyrinth of seemingly endless corridors and hall- ways. Since all of the rooms had been renumbered recently, even lofty Seniors and sympathetic teachers were unable to help the poor wanderersy an as- sembly, however, soon oriented them. Thenceforth, they were able to explore with some degree of certainty the mysterious science laboratories, the beautiful, spacious library, the congenial cafeteria, the rooms where ghosts of Caesar and Cicero and remembrances of the far-gone grandeurs of Bome were to be found: and places where the spirits of Archimedes and Pythagoras yet ruled. Their days as Proviso students were begun. Soon they discovered that all was not school work, for they found a multitude of extra-curricular activities. There were clubs, class projects, athletic endeavors, and social events in which even they could participate. lt was not long before the organization of the Class was effectedg and Keith Gleason, Belford Buck, Muriel Weber, and Clifford Clark were duly chosen and installed as the first officers of the Class of l935. By means of parties and entertainments, the Big Sisters of the Senior Guard soon made the school jack La Rocco Shirley Fine Dawn Erickson Clifford Clark lives of their little Freshman sisters much happier. The workings of a modern school were shown to the mothers and fathers as the Parent-Teacher Associa- tion started its year's activities by holding an open- house night with regular classes in session. By this time the football season was well started, and, of even more importance to the Freshies than the Varsity victories, was the winning of the Sub- urban League championship by their own Fresh- Soph team, which had met no defeat and had not been scored upon during the entire season. Among the other highlights of that first year which were of interest to the Freshmen were the presenta- tion by the juniors of an amusing comedy, The Boomerang, and the production of the great his- torical play, Nathan Hale, by the Seniors. An operetta, Carrie Comes to College, combined music and drama in an entertaining manner: and the English Cabinet's The King's English provided rollicking amusement for the student body. ln the field of miniature dramatics, the Tatterman Marion- ettes presented an enjoyable show, The Legend of the Lightning. Almost before the newcomers could realize it, fall had turned to winter, winter had passed into spring, and with spring had come the end of their first year at Proviso. After three months' rest from school-life, the mem- bers returned, eager to start upon the second year of their journey, no longer unknown and unhonored Freshmen. Once more, before they could marshal their forces, it was necessary to select four worthy leaders. Ac- cordingly, after weighty deliberation, the members decided that jack Lalllocco, Dawn Erickson, Shirley Fine, and Clifford Clark were those whom they desired to intrust with their class affairs. Along with more than five thousand other rooters, the Sophomores turned out during the football sea- son to cheer at the Atlanta, Ga.-Proviso game. ln the realm of the stage, the Sophomores found enjoyment in the fast-moving Mrs, Bumpstead- Leigh presented by the junior Class, and in the engaging English comedy, The New Lady Ban- tock, in which the Senior dramatists displayed their histrionic abilities. 'Op o' Me Thumb and the oper- etta, Oh, Doctor, were other outstanding events of the season. In March, the Sophomores presented a comedy of their own entitled, The Initiation. And the night shall be filled with music, runs a familiar quotation. And the nights and days soon were filled with music when Proviso was host to the District Band Contest, from which the local musicians emerged victorious. Many Sophomores also were included among the members of the ln-and-About Chicago High School Chorus, under the direction of R. Lee Osburn, which presented outstanding con- certs at Orchestra Hall and at A Century of Progress. As the snows of winter melted into the warm grasses of spring, three months of vacation beckoned to Provisoites, but when the doors were opened once again, the members of the Class of l935 returned to their scholastic endeavors with renewed efforts. They had gained a coveted position: they were now juniors. t To conduct their class activities, the new enviable juniors elected class officers, or to be more exact, elected William johnson to serve as president and re-elected Dawn Erickson, Shirley Fine, and Clifford Clark to perform the respective duties of vice presi- dent, secretary, and treasurer. King Football soon began his annual reign. The Varsity boys, accompanied by a bus load of loyal rooters, among whom juniors were well represented, invaded the home territory of the southern con- querors of the year before and once again Proviso went down to defeat at the hands of Atlanta. ln the field of mirth and gayety, the annual Girls' League carnival was augmented by the G. A. A. Circus, featuring freaks from all four corners of Proviso. The lmportance of Being Earnest was explained in an amusing English Cabinet play. The delightfully entertaining comedy, The Meanest Man in the World, was skillfully presented by the Senior Class, to the amusement of many Iuniors. ln the middle of the year, nine members of the Class of l935 who had excelled int journalism were chosen to work on the Pageant Staff. Since the be- ginning of the year, already two other Iuniors had been Staff members. With the coming of spring, the annual junior-Senior Prom was held for the first time outside of school in the harmonizing atmosphere of the Oak Park Club. Chosen by the vote of the faculty, ten members of the Class of l935 were inducted into the Proviso Chapter of the National Honor Society of Secondary Schools. Shirley Fine, Keawana Garman, Rex Hor- ton, Donald Leal, Hilda Mahnke, Georgine Reay, Florence Rittmueller, Erna Schroeder, Aaron Spolin, and Muriel Weber were the juniors upon whom this honor was conferred. That the Class of 1935 might be an organized group at the beginning of the Senior year, the Class officers were chosen in the spring. William Iohnson was re-elected as president. Georgine Reay and Loretta Raab were chosen as vice-president and secretary, respectively, and Clifford Clark was elected, for the fourth time, as treasurer. Thus, the activities of the lunior year were concluded. fn a few short months, the members of the Class of l935 returned to the familiar life of Proviso to enter upon the final year of their journey from entrance to commencement. They had reached in their high school life a prominence to which they long had looked forward: now they were Seniors. Football again claimed a major share of interest at the beginning of the year. By raising funds, the Senior Class helped to finance the building of the new Stadium. Floodlights were installed to make night football possible. A highlight of the season Nine Seniors who were elected to membership in the National Honor Society in their junior year: E. Schroeder, H.lVfahnke, S. Fine, R. Horton, D. Leal, M. Weber, G. Reay, K. Gar- man, H. Rittmuellery not in picture, A. Spolin. William Johnson Shirley Fine Dawn Erickson Clifford Clark was the Stadium dedicatory exercises. Speeches by prominent men, parades, stirring band music, and a game between the Chicago Cardinals and the May- wood Athletic Club team were features of the eve- ning. Later on in the year, the basketeers from Marblehead, Mass. journeyed west to be defeated by the Proviso quintet. ln the middle of the year, the l935 Provi Staff was organized. Thereafter, many hectic days and nights were spent in attempting to produce something faintly resembling an annual. That the serious business of publishing a Provi was progressing in earnest, the members of the Senior Class were soon to discover as, one by one, they were forced to sit under glaring lights to meet the cold, critical eye of a camera which was to record their countenances for posterity. An event long to be remembered was Proviso's Silver Anniversary Week. One of the features of this commemoration of especial interest to the Seniors was their presentation of lames M. Barrie's Quality Street. Starred in this romantic comedy of the period of the Napoleonic Wars were Gilbert Daudistel, Georgine Reay, and Erna Schroeder. Soon many friendly social gatherings were enjoyed by the Senior girls when the Girls' League sponsored Good Fellowship Week. Seventy-five Seniors, deemed by the faculty as outstanding in, scholarship, leadership, service, and character, were chosen for membership in the Na- tional Honor Society. A fitting climax to the social activities of the year came in the long-toebe-remembered lunior-Senior u L 'S-A.. 'Jr Prom. The rich, colorful atmosphere of the distinctive Oak Park Club furnished a colorful background for the pleasurable gathering. Under the soft glow of mellow lights, formally-dressed couples enjoyed the evening gliding to soft, dreamy waltzes, and whirling and bobbing to sizzling tangos, and titillat- ing hops. The realization that the end of their four long years of high school life was approaching all too swiftly, awakened many memories in the minds of the Seniors. The time had come to View in retrospect the accomplishments of the members of this worthy group. That the efforts of those whose commendable achievements in scholastic endeavors and in extra- curricular activities might be recognized and hon- ored, the faculty selected the names of the most outstanding Seniors to compose the following para- graphs of Who's Who in the Class of l935. At the end of their lunior year Iune Brunke, Shirley Pine, Rex Horton, Hilda Mahnke, Lora Puscheck, Leo Seren, and Aaron Spolin, by means of outstanding scholastic records earned gold medals, the highest scholastic honor awarded by Proviso. Charles Camp, Yedda Dorf, lane Gustafson, Marian Kel- strom, Ida Litke, Charlotte Popp, Georgine Reay, Florence Rittmueller, Erna Schroeder, Roger Sedg- wick, Elvena Ulrich, and Lillian Young received the same honor in their Senior year. The Music Department has selected the following as the outstanding musicians: Evangeline Buch, piano: Charles Camp, euphonium: Catherine Chron- ister, vocal: lulius Credity, Cornet: Russell Currie, clarinet: Kennerd Erase, string bass: Keawana Gar- man, violin: Prank Heil, piano, marimba: Bette Hilton, vocal: Gilbert lacobs, vocal: Donald Kane, string bass: Edna Kingdon, violin: Ethel Kingdon, cello: Melvin Korrell, violin: Clarence Kurz, tuba: Lillian Loeck, piano: leanne Nottingham, violin: Elizabeth Probasco, vocal: Roy Schultz, vocal: Charles Schuster, vocal: Harriet Shilkaitis, marimba, tympani: Herrick Van Gunten, vocal: Edwin Vodicka, vocal. Gilbert Daudistel, Georgine Reay, and Erna Schroeder were chosen for commendable work in dramatics. Dorothy Eilenberger was outstanding in art, and Ray Nelsen was named for outstanding work in the Manual Arts Department. ln secretarial service Elaine Paley, Anna Paulsen, Charlotte Popp, Myra Moscicke, and Pauline Waq- ner were named as prominent. The following five editors were selected as out- standing in publications: Marie Goodrich, Pageant, Provi: Rex Horton, Pageant, Provi: Lora Puscheck, Pageant: Adolph Zapfel, Pageant, Provi. Shirley lameson, Dorothy Klupping, Georgine Reay, and Elvena Ulrich were prominent in girls' athletics. The Boys' Athletic Department chose the following as the outstanding athletes: Carl Andersen, swim: Saverio Caruso, swim: Robert Berliner, track: Ray Conrad, baseball: William lohnson, football, baseball, basketball: Fred lantzen, football: Lester Klean, wrestling: lack LaRocco, football, wrestling: Leslie Wallace, baseball: Emerson Michael, track: Robert Mickow, track: Robert Miller, baseball: Frank Orist, baseball, football: Edward Russell, wrestling: Max Stein, track, wrestling: lohn Tiefenthal, base- ball, basketball: Adolph Urbelis, baseball, basket- ball, football: Russell Vahldick, track: Edward Wolff, swim: Sollie Zapler, track. The following Seniors had not been absent nor tardy nor excused early in four years, ending April 30, 1935: Arlene Brown, Stella Buginas, Vera Bus- boom, Richard Crabbe, Carol Freiday, Ida Litke, Virginia Treabess, and Frank Urbaytis. With undulating rhythm, long lines of Seniors in gray caps and gowns now move slowly forward to the majestic strains of Pomp and Circumstance. After four years of accomplishment the pinnacle of high school achievement has been reached, and youth marches on to face its future. But not without a backward glance of regret and not without a trace of sorrow do these solemn robed figures pass on into a new world. Life in their old world has been kind to them: their days have been filled with beauty and with enjoyment. For them, cherished remembrances alone shall re- main undimmed throughout the years: and, looking a quarter century into the future, they sing, We will see thee in our memory, shining through a golden haze. A sketch oi the gift oi the Class of 1935, a tennis court. Q .. K- Y K' i i Y J ,..A .b ii jr! nm. Mi K L K . . . i A . V. - . .. . , . 1 . 4 W.- ,,. -Q? xr fx. r . .Jfdv -' . V J- X ' . - ' i f - Mfg ' 5192297 5 Q- 5 'ff ' o ,- h 'ig sIQ,,r.,t: - a t Q .i - 1? 5 4 f f W 1, Zf'rT.7'f-, 4 ' 355157. ' 'T :L--T - fi f Irie ' T 9 '-'- .01 ' . i ' f A..v,fM.- , .-rt' :'.'Y.-' I . 517 fi, , f- V- zu- w ff. '..wQff f f' : ff' QV'-fd -323.-I ' . wil 25:17 T 1 ' - -: T 2 f ri' ' ,. .- i' 1f ' ...'.... -..i- -4, . f.m-- -was ..::::::m5 - ..EggiWiw.:ann r.:.-.sf . gif se:swy 854w?1k ?g52gg?:l?E::g'gY-ll-'+a3e?xgi, 5555 eeramnnn .,- ,ry-ug 1.-.....q'E:'f7gi:!:a'2:.funcx,,1 f'v,,a552 A , 1, 2-,V - ' , ,., an gan- 'nn 'VFX' . -- S .ck ff,-. Sv' QR, 5 .gm-1pgns.,L, .ywaflulfln In f'f,3,,ng-guzag 1-in.. .x..-..f-5g.,.,,,,,,,vqz55g.t1- iw- 4- mg- . M- gma'g.5,,.5,i gel., 551 ..,f-V Q 5gL22'F f ,x?'!3fw' iiifdiifi-jQa..54g.3-v :'33i1mnEEr35,,-3-331+-1f..g5:g3g3,,. Qgjiiiili. ,, ifvglsggagagg- 4 ,5:2,1:i,::,5ii'g43-as-dbg . -fit - fn? zfiizwsi 'f? fH' Wasil ff--' an --dase ff-f i imma ,1 -M an i i . 1- . ' ,:ig.s-235 19.511-A in fling 7 TL' L f .st-ml!! in ' il ' - ll . . - S ',. ' i- I x ' ':ii..?i'r,517 .1 , :annul , If ,,., x 1'- ,..,..,, . ...Q 1, .J t 3',LS?m::llI -be 1:22-We :ti'iiip?ua.i.n-nnlslggi U Q -- ll I 7 ' S , f YS!!! ' 'lf .. . . . - h -V .. T wr ' T . 1 ll: ' ' 5 ' . ff V' R f ' , ' I' . - 1 5 '-.- rg - - t . . 1 'L , -- .L.. . 'I' . - ,' . . f . '1 T , iiisr t i i TQ i '-'. I I - Qt? '- .Q - ' P - N:1M'i:14'g2'Y:- f- t f 1 I . S Qt- ., ,. . . ' -.-. -' . , - .. ..-r . .- v- -.iw-1 . .- t -ima , 'V W trz-'N it Av. tfis'-wif.-. 2 2--.z-F'- ii: K I 2 ' .- ' rv . . - Y ' Q T--.lf fi-r., , , - . . .. -is- K . sc ' VS' ' SX-'vii-if - : ... ' , .. -, ...U . . . . , , , , . . .... 'J--U .. .t . ,t 'L W il .4 ,qlww-H .. .Q .A M . 1. ........-..... ....- .......,... ......................-,-..... ...--f-.-... 26 Commencement Week Program MAY 26-31 SUNDAY, MAY 26, 8:00 P. M. Baccalaureate Services Processional, War March of the Priests ..................... Mendelssohn invocation ............ ....................... T he Bev. Bertram G. Swaney Hymn, Come Thou Almighty King ..... ................... D e Giardini Scripture ....................................... The Rev. Wm. L. Halfaker Anthem, As Torrents in Summer' .................................. Elgar High School Choir Prayer ....................................... The Rev. Lou Wallace Gade Anthem, O Gladness Light ...... f ......................... Arkangelsky High School Choir Address, At the End of Broadway ............. .... T he Rev. Wm. F. Buch Hymn, America, the Beautiful ...... .................... W ard Benediction ............................ ..... T he Bev. A. I. Michael Recessional, Marche aux Flambeauxu .............................. Clark TUESDAY, MAY 28, 2:00 P. M. Class Day Exercises Processional, Marche aux Elambeaux . . . ..... . Music, A Dark Night .......................... .. High School Orchestra One-Act Play, Fourteen .............................. Members of the Senior Class Mrs. Horace Pringle .............. ............. . . Characters: J Elaine, her debutante daughter... IxDunharn, the butler ............ Scene: Mrs. Prinqle's New York Residence Time: Evening Bookholder: Dorothy Schneider ,Chairman of Costumes: Lorraine Nott Chairman of Properties: Elizabeth Garrett Marimba Solo, Overture Raymond by Thomas ...... .. Interpretive Dance, Mazurka .................. ..............Glazounow Senior Members of the Dance Club ..............Clark .....I-Iorlick and Stone Alice Gerstemberg .. . . . . . . . .Sara Grinpas . . . . Florence Rittmueller . . . .Kenneth Rockefeller . . Harriet Shilkaitis Solo Waltz ........................................... .... G eorgine Reay Class Poem ....................... .... I ean Stevens Music j A Song of the Waves ................... ....... P rotheroe l Howdy Do Mis' Springtime ................... .... G uion-Andrews Senior Boys' Glee Club Axe Ceremony ......................... William Iohnson and Howard Thelin Presentation of Provi ................. ...................... M arie Goodrich Acceptance of Provi .... Miss Iulia E. Evans and Superintendent H. H. Eelkema Presentation of Class Gift ................................. William Iohnson Recessional, Senior March . . .................. . FRIDAY, MAY 31, 8:00 P. M. Graduation Exercises ...........Ascher Processional, Pomp and Circumstance ............................. Elgar Invocation ................................. The Reverend Merrell E. Boulton MuSiCj Emitte Spiritum Tuum ................................... Scheutky lPilgrims' Chorus from Tannhauser ........................ Wagner Senior Choir Address, What Price Personality? ........................ Dr. Frank D. Slutz Presentation of Diplomas ........ Emery A. Parichy, Pres. of Board ot Education Becessional, War March ot the Priests ....................... Mendelssohn 27 Ioe Francis Abate Latin Club, 2. A deep, genuine, heart-felt sincerity is a trait of true and noble manhood. Douglas L. Abbott, Ir. Latin Club, l, lunior Hi-Y, l, 2, Neo-Pythag- oreans, Sophomore Dramatic Club, Pres., English Cabinet Play, 3, Senior Hi-Y, 4, Proviso Players, 4, Senior Class Play, Bronze Scholarship Medal, National Honor Society. The part was aptly fitted and naturally performed. Fred R. Ahlers Latin Club, l, Freshman Dramatic Club, Student Council, 2, 3, lunior I-li-Y, 2, In-and-About Chicago Chorus, 2, 3, 4, Senior Hi-Y, 3, 4, Bronze Scholarship Medal, National Honor Society. Diligence is capable of effecting almost everything. Lola Mont Aiken High School, Zeigler, Ill., l, G. A. A., l. Every joy is gain and gain is gain, however small. Mario Francis Aiuppa English Cabinet Play, 3. When Duty whispers low, 'Thou must,' The youth replies, 'I can.' Henry Alderson Spanish Club, 3, Treas., 4, Iunior Varsity Foot- ball, 3, 4, Senior Hi-Y, 4, Bronze Scholarship Medal. ' University of Illinois l'll find a way or make one. Earl V. Allers German Club, l, 2, Track, 2, Senior Science Club, 4, Statesmen, 4. University of Illinois Do not take life too seriously, you will never get out of it alive anyway. Gottfried K. Altergott Varsity Club, 3, Vice-Pres., 4, Varsity Foot- ball, 3, Senior Senate, Senior Hi-Y, 4. Give me a lever long enough, a prop strong enough, and I can single-handed move the world. Hallie Virginia Amling German Club, 3, Historians, 4, Archery Award, 4. The soul selects her own society. Harvey Ancel Freshman Dramatic Club, Pres., Iunior Hi-Y, I, Pres., 2, Sophomore Dramatic Club, College Club, 3, English Cabinet Book-Review Contest, 3, English Cabinet, Pres., 4, Library Staff, 3, 4, Pageant Editorial Staff, 3, 4, Parnassus Club, 4, Provi Editorial Staff, Winner of American Legion Essay Contest, Bronze Scholarship Medal, National Honor Society. Northwestern University His pen was striking, resistless, and grand. Doris Andermann German Club, Z, Historians, 4. Full of fancy, jollity, and fun. Catherine Anders Oak Park Hospital Gentleness and repose are paramount to everything else in a woman. Carl Edward Andersen Senior Hi-Y, 3, 4, Swimming, 3, lunior Varsity Football, 4, Bronze Scholarship Medal, National Honor Society. How many times have I with a swimmer's stroke flung the billows back from my drenched hair. Lauretta Iane Anderson Latin Club, l, 2, 4, Senior Home Econ- omics Club, 3, Senior Guard, Pres., 4A, Historians, 4, Dial Club, 4. University of Wisconsin Happiness seems made to be shared. Marion Barbara Andree Providence Academy, Chicago, Ill., l, German Club, 2, 3, Senior Home Economics Club, 3. i Burroughs Business College She pursues her way, unmoved by argument. Clarence Appelt High School, Shumway, Ill., l, 2, 3, Concordia College, River Forest, Ill., 4B, Student Council, 4A. Firm of purpose. Mary Io Armstrong St. Mary's High School, Chicago, Ill., l, 2. f A lady of artistic temperament. Eleanor Edythe Arndt German Club, l, O. G. A., Bronze Schol- arship Medal. Refinement, the virtue personified, Abe Asher College Club, 2, 3, Senior Science Club, 3, Forum, 4, Historians, 4, Sports Club, 4. Without a doubt, he's one good scout. Frances Marie Augustine Italian Club, l, 2, O. G. A. Into the midst of things- Clara Helen Axen O. G. A. Mistress of common sense and of herself. Agnes Marie Bailey Student Council, l, O. G. A., Silver Scholar- ship Medal. Reason with, pleasure, and wisdom with mirth. Bernard A. Bailey Concordia College, Conover, N. C., l, Tuley High School, Chicago, Ill., 2, 3, Senior Science Club, 4, Senior Hi-Y, 4, Historians, 4. University of Illinois Let me live in a house by the side of the road and be a friend to man. Nellie Mae Baker Latin Club, l, Commercial Club, 4. Moody Bible Institute Her modest looks the cottage might adorn. Walter Balgemann l expect great things, because I am happy and I have friends. Albert Barnes Latin Club, l, Bronze Scholarship Medal. We build the ladder by which we rise. Stella Ann Baron G.A.A., 3, Hockey Manager, 4, Dancers Club, 4. All things are won by diligence. Sidney Herbert Barsky Latin Club, 1, 2, lunior Hi-Y, l, 2, Com- mercial Club, 3, Senior Science Club, 3, Sec., 4, College Club, 3, 4, Dial Club, 4, Clarinet Quartet, 4. Northwestern University There is something marvelous in music. Eleanore Nancy Bartz Burnham School of Beauty Culture Gaiety is the soul's health, Eleanor R. Beaven Latin Club, 2, Senior Home Economics Club, 4, Commercial Club, 4, O. G. A., Bronze Scholarship Medal. Imbued with beauty which we worship in a star. Edwin Becht Latin Club, l, 2, Chess and Checker Club, 3, Pres., 4. He takes time to resolve. Dorothy Iane Beck Latin Club, l, 2, Aeclile, 3A, Quaestor Primus, 4B, Consul, 4A, G. A. A., 2, Girls' League Rep., 4, 'College Club, 4, Eta Sigma Phi Medal. University of Illinois The highest graces of music flow from the feelings of the heart. Iohn I. Beck Sophomore Dramatic Club. See, how these rascals use mel They will not let my play run, And yet they steal my thunder. Irene M. A. Behrens Commercial Club, 4, Senior Home Eco- nomics Club, 4, O. G. A. Burnham School of Beauty Culture The art of pleasing consists in being pleased. Edward Bell Oak Park High School, Oak Park, Ill., l, lunior Hi-Y, l, 2, Student Council, 2, Cheerleader, 2, 3, 4, Forum, 2, 3, Treas., 4, Crusaders, 3, Sports Club, 3, 4, lunior Varsity Basket- ball Manager, 3, Varsity Basketball Manager, 4, Pageant Busi- ness Staff, 4, Varsity Club, 4, Statesmen, 4. Purdue University Born for success he seemed, With grace to win, with heart to hold. I, Abfrie D. Abbcir F. Ahlers L. Aiken M. Aiuppcr H. Alderson E. Allers G. Alterqott H. Amlinq H. Ancel D. Andermunn C. Anders C. Andersen L. Anderson M. Andree C. Appel! M. Armstrong E. Arndt 5.15-.Sher F. Augustine C. Axen ZX. Bailey B. Bailey N. Baker VJ. Bcrlqernann A. Barnes S. Ecron S. Eczrsky E. Bartz E. Eeuven Ti. Becht D. Beck I. Beck I. Behrens g 12511 T. Bell F. Belluomini W. Benedeck F. Bensen R. Berliner M. Berrncrn I. Bertolette R. Beuiel L. Bingham U. Birkiqt G. Blaschke R, Blcrsius W. Bleek I. Blumthol T. Boardman L. Boehm S. Bonfanii E. Bowen B. Brootz E. Brezincx W. Brody A. Brcmdo M. Broun W. Brosseit A. Brown I. Brunke D, Bruyn E. Buch B. Buck I. Buelens S. Buqinos E. Buist D. Bulger I- Bump I. Burk 'FW' 7 T' 'Y ' ' Thomas Bell Student Council, l, 2: Athletic Trainer: Varsity Club, 4. Boering School of Aeronautics An enterprise, when fairly once begun, Should not be left till all that ought is won. Florence Louise Belluomini G.A.A., l, 2, Swimming Manager, 3, 4, 1200-point Award: Iunior Life Saving: Commercial Club, 3: O. G. A.: Senior Home Economics Club, 4: Senior Life Saving: Bronze Scholarship Medal: National Honor Society. To her who is determined it only remains to act. Walter A. Benedeck Senior Hi-Y, 3, 4. True industry doth kindle honour's fire. Frances Margaret Bensen Latin Club, l, 2, 3, Aedile, 4B, Con- sul, 4A: Girls' League Rep., l, 2, 3, 4: French Club, 4: Senior Guard, Sec., 4A: Bronze Scholarship Medal: Eta Sigma Phi Medal: National Honor Society. University of lllinois There's nothing so kingly as kindness, and nothing so royal as truth. Robert S. Berliner Fresh-Soph Football, 1: Track, 2: Crusaders, 3: Iunior Varsity Football, 3, 4: Senior Hi-Y, 4: ln-and-About Chi- cago Chorus, 4. University of lllinois V Good qualities are the substantial riches of the mind. Mildred Irene Berman German Club, l, Z: G. A. A., l: Com- mercial Club, 2: CollegegClub, 3: Historians, 4. Alba Beauty Academy Nothing is impossible to a willing heart. lack Wakefield Bertolette The desire of leisure is much more natural than that of business or care. Ruth Colleen Beutel German Club, l, 2: Philatelic Exchange, 2: Commercial Club, 2, 3: O. G. A.: Senior Home Economics Club, 4. M Besner School of Decorating Speak boldly, and speak truly. Lila Marie Bingham Dial Club, 4. Silence is more musical than song. Ursula Elirieda Birlrigt Girls' League Rep., 2, 4: Silver Scholar- ship Medal: National Honor Society. 1: By diligence she wins her way. George H. Blaschke We never know how high we are iz Till we are called to rise. Ruth Eldora Blasius Neo-Pythagoreans: Senior Home Economics Club, 4: Senior Science Club, 4: 120-word Transcription Award: Bronze Scholarship Medal: National Honor Society. ' Marinello School of Beauty Culture A daughter of the gods, divinely tall. - William H. Block Camera Club, 2: Senior Hi-Y, 4: Pageant Edi- torial Staff, 4B: Wrestling Manager, 4. Gentleness and affability conquer at last. Iohn I. Blumthal There is no happiness without action. Thomas Boardman Arkansas Training School, Conway, Ark., l: High School, Conway, Ark., Z, 3: Proviso Players, 4: Senior Hi-Y, 4: Pageant Editorial Staff, 4A: Parnassus Club, 4: National Honor Society. Studies serve for delight, for ornament, and for ability. Louis Boehm Swimming, l, 2: Statesmen, 4: Band Soloist, 4: French Horn Section Leader, 4: Brass Sextet, 4. By music, minds an equal temper know, Nor swell too high, nor sink too low. Sam Bonianti Silence does much good and little harm. Ellen Bowen Commercial Club, Z, 3: Historians, 4: Provi Edi- torial Staff. Chicago Art Institute By words the mind is excited and the spirit elated. Bertha Louise Braatz German Club, 3, 4: Senior Home Eco- nomics Club, 3, 4. We saw her charming, but we saw not half the charms her modesty concealed. William P. Brady O. G. A. Politeness is good nature regulated by good sense. Antonette H. Branda Italian Club, l, 2, 3: Senior Home Eco- nomics Club, 3, 4: O. G. A.: Bronze Scholarship Medal. l have no parting sigh to give, So take my parting smile. Marvin William Braun Freshman Dramatic Club: Iunior Hi-Y, l, 2: Latin Club, l, 2: Civics Club, l, Vice-Pres., 2: Sophomore Dramatic Club: Proviso Players, 3, 4: College Club, 3, 4: Pageant Business Staff, 3: English Cabinet Play, 3: Forum, Pres., 4: De- bate Team, 4. University of lllinois He would stop St. Peter's roll call to ask a question. Edward Brezina Fresh-Soph Football, l, 2: Varsity Club, 4: Iunior Varsity Football, 3: Varsity Football, 4. A man's man. Winiired Charlotte Brosseit Latin Club, l, 2: Neo-Pythagoreans: Crusaders, 3: Camera Club, 4: Senior Home Economics Club, 4. Northern lllinois State Normal College My heart leaps up when I behold a rainbow in the sky. Arlene Cathern Brown Latin Club, l, 2: O. G. A.: Bronze Schol- arship Medal. For if she will, she will: you may depend upon it. Iune B. Brunke Latin Club, l, 2, Ouaestor, 3, Aedile, 4: G. A. A., l, 2: Girls' League Rep., l: Iunior Lite Saving: Student Council, 3: Gold Scholarship Medal: Eta Sigma Phi Medal: National Honor Society. University of Illinois Few things are impossible to diligence and skill. Dorothy Elizebeth Bruyn Iunior High School, Minneapolis, Minn., l: High School, Minneapolis, Minn., 2: Austin High School, Chi- cago, lll., 3B: High School, San Diego, Calif., 3A: Travelers Club, 4. A sunbeam in a winter's day. Evangeline Martha Buch Girls' League Rep., l : In-and-About Chicago Chorus, 3, 4: German Club, 4: Pageant Editorial Stait, 4: Silver Scholarship Medal: National Honor Society. Music is the universal language ot mankind. Belford Foley Buck Latin Club, l, 2: General Science Club, l: Track, 1: Cosmopolitan Club, Pres., 3, 4B: Iunior Varsity Football, 3, 4: Parnassus Club, 4: Senior Senate: Class Vice-President, l. Harvard University - Live and let live. Ieannette S. Buelens Mt. St. Mary's Academy, St. Charles, Ill., lB: French Club, 3, 4: O. G. A. Burnham School of Beauty Culture What peaceful hours I once enjoyed! ,How sweet their mem'ry still! Stella E. Buginas Senior Home Economics Club, 4: Commercial Club, 4: O. G. A. True happiness consists in making others happy. Evelyn Buist Art Club, 1: French Club, 3. Laughter is the music of conversation. Dorothy Bulger Civics Club, l: Commercial Club, 3: Historians, 4: Senior Home Economics Club, 4: Library Staff, 4: O. G. A.: Silver Scholarship Medal: National Honor Society. Nothing is denied to well-directed labor. Iean Bump High School, Boulder, Colo., l: High School, Merrill, Wis., 2: High School, Cincinnati, Ohio, 3B: High School, Green- field, Iowa, 3A. So did llaugh, sans intermission. Iohn H. Burk Latin Club, 2: Neo-Pythagoreans: Crusaders, 3: Camera Club, 3, Treas., 4: Senior Science Club, 4: ln-and-About Chicago Chorus, 4. Good nature and good sense must ever meet. Mary L. Burns French Club, 4, Dial Club, 4, O. G. A., G. A. A., 4. She leads a life of quiet worth. Vera C. Busboom Art Club, l, G. A. A., 2, Crusaders, 3, French Club, 3, 4, Historians, 4, Dial Club, 4, Bronze Scholar- ship Medal. Serious and steadfast. Nedra Button Austin High School, Chicago, Ill., l, Girls' League Rep., 2, 3, College Club, 4, Provi Art Staff, Senior Guard. Chicago Academy of Fine Arts Whatever is graceful is virtuous, and whatever is virtuous is graceful. Clara Buza Latin Club, I, 2, General Science Club, I, Senior Science Club, 3, Commercial Club, 4, Historians, 4. A docile disposition will, with application, surmount every difficulty. Frank I. Cacchione Senior Class Play. Thinks much and talks little. Mariorie Nancy Calderone Italian Club, 2, 3, O. G. A. Burnham School of Beauty Culture The force of her own merit makes her way. Charles I. Camp Student Council, 2, Iunior Hi-Y, 2, Senior Hi-Y, 4, National Sextet Winner, 3, Baritone Section Leader, 3, 4, Band Captain, 3, Band Soloist, 3, 4, Gold Scholarship Medal, National Honor Society. Purdue University His standing as a student is excelled only by his ability in music. ' Russell E. Campbell Civics Club, l, Latin Club, l, Sports Club, 1, Iunior Hi-Y, 2, Neo-Pythagoreans, Library Staff, 3B, Crusad- ers, 3, Senior Hi-Y, 3, Vice-Pres., 4, Proviso Players, 3, 4, Iunior Council, Pageant Business Staff, 3, Oak Park-Proviso Boys' Con- ference, 2nd Vice-Pres., 3, lst Vice-Pres., 4, Forum, 4, Student Council, 4, Provi Editorial Staff, Winner, Inter-Club Speech Contest, 4, Bronze Scholarship Medal. De Pauw University Better to die ten thousand deaths than wound my honor. Roy O. Carling Provi Art Staff, Silver Scholarship Medal, Na- tional Honor Society. ' A cartoonist's art requires three essentials: Good artistry, good humor, and good sense. Harvey Came Neo-Pythagoreans, Iunior Hi-Y, 2, Track, 2, His- torians, 4, Senior Hi-Y, 4, Senior Senate, Statesmen, 4, Cross Country, 4, Silver Scholarship Medal, National Honor Society. Purdue University An engineer he hopes to be, We know he has ability. Helen M. Carrier Mt. St. Mary's Academy, St. Charles, Ill., l, Student Council, 2, Bronze Scholarship Medal. Ioyousness is Nature's garb of health. Saverio Caruso Swimming, 2, 3, 4, Varsity Club, 3, 4. His diving's the kind that rates the best, I-le's the kind of fellow that's full of zest. Margaret Louise Catenacci Latin Club, I, 3, 4, College Club, 3, Forum, 3, 4, Senior Home Economics Club, 3, 4, Neo-Pythag- oreans, 3, Dial Club, 4. She's the girl that will always rate. Sylvia Cathryn Catenacci Latin Club, I, 2, 3, Aedile, 4, lunior Home Economics Club, I, 2, Neo-Pythagoreans, Student Council, ZA, Girls' League Rep., 3B, Senior Home Economics Club, 3, 4, Dial Club, 4, Silver Scholarship Medal. That Latin was no more difficile Than to a blackbird 'tis to whistle. Donald E. Chapman Oak Park High School, Oak Park, Ill., l, 2, 3. He was mild, obliging, and free. Estelle F. Chelstrom Student Council, l, Girls' League Rep., 2, German Club, 2, 3, Historians, 4, Bronze Scholarship Medal. The soul's calm sunshine and the heartfelt joy. Ruth F. Chleboun Student Council, I, Latin Club, I, lunior Horne Economics Club, l, College Club, 4, Girls' League Rep., 4. University of Illinois Zealous, yet modest. Grace E. Christensen Latin Club, I, 2, O. G. A. Mirth prolongeth life and causeth health. Adeline Ann Christian Italian Club, l, 2, 3, Camera Club, l, 2, 3. Rosary College How her fingers went when they moved by note through measures fine. Dorothy T. Christian Latin Club, l, 2, G. A. A., l, 2, 3, Camera Club, 3, 4, French Club, 4. Rosary College Such high-bred manners, such good-natured wit. Audrey Anna Christiansen Latin Club, l, 2, College Club, 4, Senior Home Economics Club, 4, Cosmopolitan Club, 4. West Suburban Hospital And where'er she met a stranger, there she left a friend. Catherine E. Chronister Latin Club, l, Iunior Home Economics Club, l, Chess and Checker Club, 2, Girls' League Rep., 2A, 3A, In-and-About Chicago Chorus, 3, 4, Dial Club, 4. Music exalts each joy, allays each grief. Clifford E. Clark Student Council, l, Fresh-Soph Baseball, 2, Lightweight Basketball, Manager, 3, Lightweight Football, Man- ager, 4, Senior Hi-Y, 3, 4, Class Treasurer, I, 2, 3, 4. Knox College His words are bonds, his oaths oracles, his heart is as far from fraud as heaven from earth. Robert E. Clark Student Council, Vice-Pres., 3, Spanish Club, 3, Pres., 4, Pageant Editorial Staff, 4, Bronze Scholarship Medal. Northwestern University Talent alone cannot make a writer, there must be a man behind the book. Otto Robert Allred Cleft In-and-About Chicago Chorus, 4. He who sings frightens away his ills. Betty Mae Cline Freshman Dramatic Club, Sophomore Dramatic Club, Latin Club, l, 2, G. A. A., I, 2, Proviso Players, 3, Pageant Business Staff, 3, Senior Home Economics Club, 4, Dial Club, 4. Rosary College ' Good humor is the health of the soul. Fannie Cognato Italian Club, 2, 3. In thy heart the dew of youth, On thy lips the smile of truth. Francis E. Collins Maryhurst Normal, Kirkwood, Mo., l, 2, 3, French Club, 3, Latin Club, Aedile, 4. A contented heart is an even sea in the midst of all storms. James Comertord Civics Club, 2, Cosmopolitan Club, 3. Sincerity and truth are the basis of every virtue. Geneva Condon Senior Home Economics Club, 4. . Oak Park Hospital I would help others, out of a fellow-feeling. Ioseph I. Conley Cosmopolitan Club, 4. Nature has given the opportunity of happiness - to all, knew they but how to use it. Francis I. Conlon Sometimes guiet is an unguiet thing. Eleanor G. Connors German Club, l, 2, Camera Club, I, 2, Sophomore Dramatic Club, College Club, 3, Spanish Club, 3, 4, Library Staff, 2, 3, 4. Northern Illinois State Normal College In every rank, both great and small, It is industry that supports us all. Ray Conrad Fresh-Soph Baseball, l, 2, Fresh-Soph Basket- ball, I, 2, Lightweight Football, 2, Iunior Varsity Basketball, 3, Varsity Baseball, 3, Varsity Club, 4, Freshmore Class Treasurer. Bradley Polytechnic Institute In that day's feats . . . He proved best man in the field. Walter Iarnes Covay Civics Club, l. The best of men have ever loved repose. M. Burns V. Busboom N, Button C. Buza F. Cacchione M. Calderone C. Camp R. Campbell R. Carling H. Carne- H. Carrier S. Caruso M. Catenacci S. Caienacci D. Chapman E. Cnelstrom R. Chleboun G. Christensen A. Christian D. Christian A. Christiansen C, Chronister C. Clark R. Clark O. Cle-if D f Y1.-U. rf. Vuuv F. Coqnato F. Collins I. Cornerford G. Condon I. Conley F. Conlon E. Connors R, Conrad W. Covay R. Crabloo W. Crane I. Credity R. Cremons R. Currie F. Dahne R. Danca W. Daniels H. Daubei' G. Daudisiel H. Daverman R. Davies H. Davis R. Davis L. De Angeles B. De Francesco D. De Vries C. De WiI'9 S. Didecli A. Diesiel N. Dodd R. Dolan R. Donnelly R. Donohue F. Doolin Y. Dorf A. Duqaw L. Dumond M. Dunk E. Dunn W. Dwoinen G. Dykhuis H. Edfors R. Edmiston V. Edmonds gpw---T-----1 --- - Y - we -- -Y 7-- -Ye -W . .Q--..-f 1 Richard A. Crabbe Oak Park High School, Oak Park, Ill., 1, 27 Senior Science Club, 47 Dial Club, 47 In-and-About Chicago Chorus, 4. He pleased you by not studying to please. Wesley M. Crane Senior Science Club, 2, 3. Science when digested is nothing but good sense and reason. Ilulius Richard Credity Latin Club, l, 27 Crusaders, 37 ln-and- About Chicago Orchestra, 37 National Brass Sextet, 2, 37 State Cornet Solo Contest, 37 National Clinic Band, 37 Cornet Section Leader, 4. University of Illinois He plays a cornet in the band, . And wins success on every hand. Russell I. Cremons 'Fresh-Soph Football, 27 Historians, 47 Cam- era Club, 47 Dial Club, 4. . University of Notre Dame Discretion of speech is more than eloquence. Russ Currie Latin Club, l, 27 Crusaders, 37 Clarinet Section Leader, 3, 47 Clarinet Quartet, 4, District and State Contest, 37 Band Captain, 37 Soloist, 4. Northwestern University Music is our Russ's aim, And therein will he reach his fame. Fredric I. Dahne Cosmopolitan Club, 37 Historians, 47 Commer- cial Club, 47 Naturalists, 47 Dial Club, 4. - ln everything he did, he considered the end. E. Richard Danca Civics Club, 1, 2, 37 Latin Club, 27 Student Council, 2. Columbia University No matter what brews, I always stay calm7 Control of yourself is trouble's best balm. Warren E. Daniels I trust and am content. 'Helen O. Dauber Latin Club, 1, 47 Dial Club, 4. f Northern lllinois State Normal College Tranquility consisteth in a steadiness of the mind. Gilbert M. Daudistel Freshman Dramatic Club7 Sophomore Dra- matic Club, Pres.7 English Cabinet Play, 37 Proviso Players, 47 Senior Class Play. Circumstances offer no restriction7 7 I do what I do with bold and firm conviction. Helen Daverman G. A. A., 17 Iunior Home Economics Club, 27 'Senior Home Economics Club, 47 Commercial Club, 4. Q Oak Park Training School for Nursing tg' .. Contented with your lot, you will live wisely. Robert W. Davies Historians, 47 Dial Club, 47 Student Coun- cil, 4. Curtis Wright Aeronautical University And why should life all labor be? ,Harold Davis Harrison Technical High School, Chicago, Ill., 1, 2, 3. Se1f-government promotes happiness. Not graduated 7, Robert A. Davis Camera Club, 3, 47 Historians, 47 Dial Club, 4. Armour Institute of Technology Modesty makes for a better friend. 1Lena De Angeles Civics Club, 17 Italian Club, 1, 27 G. A. A., 1, ,2, 3, 4, 600-point Award7 Historians, 47 O. G. A. Michael Reese Hospital 7 Her personality was Slrlklnqj i One much to our liking. Benny De Francesco Italian Club, 1. In books there is no pleasure7 l must have my bit of leisure. Donald R. De Vries Library Staff, 27 Monitor Captain, 47 Senior Hi-Y, 47 Iunior Varsity Basketball, 4. University of Alabama I would rather see a young man blush than turn pale. R. Clarence De Wire Iunior Hi-Y, 1, Vice-Pres., 27 Sophomore Council7 Library Staff, 2, 3, 47 Crusaders, 37 Pageant Editorial Staff, 3A, Assistant Editor, 4B1 Senior Hi-Y, 47 Provi Editorial Staft7 Lightweight Football, Manager, 37 Lightweight Football, 47 Winner, Inter-Club Speech Contest, 47 Bronze Scholarship Medal7 National Honor Society. Knox College Shall l go on, or have l said enough? Sylvia M. Didech Latin Club, 1, 3, 47 Senior Home Economics Club, 47 College Club, 4. Northern lllinois State Normal College A shy and quiet maiden, she Whose path is ruled with dignity. Albert L. Diestel Wrestling, 37 Camera Club, 4. Iolly, happy, carefree boy, To him the world is full of joy. Newton Dodd Historians, 47 Dial Club, 4. Curtis Wright Aeronautical University Banish care from your mind. Robert R. Dolan Student Council, 17 Fresh-Soph Football, 27 Fresh-Soph Baseball, 27 Iunior Varsity Football, 37 Varsity Foot- ball, 47 Varsity Club, 47 Senior Hi-Y, 4. There is a kind of character in thy life, that to the observer doth thy history fully unfold. Rita Berenice Donnelly Latin Club, 17 Cosmopolitan Club, 3, 47 Dial Club, 4. St. Mary's College A prim little lady with plenty of style. Robert A. Donohue General Science Club, 1. Fame is no true test of merit. Frank H. Doolin Latin Club, 17 Band Librarian, 2, 3. Life is a game: enjoy it while you can. Yedda L. Dori Civics Club, 1, 2, Sec., 37 Commercial Club, 27 Sophomore Dramatic Club7 Girls' League Rep., 27 English Cab- inet Play, 37 College Club, 3, Sec., 47 French Club, 3, 47 Forum, Sergeant-at-Arms, 4, Debate Team, 47 Gold Scholarship Medal7 National Honor Society. University of Illinois Character makes its own destiny. Andrew Thomas Dugaw Historians, 47 Dial Club, 4. What's the use of all this strife And hurrying pell-mell through life? Lois Margaret Dumond Latin Club, lj Freshman Dramatic Club, Treas.7 Sophomore Dramatic Club7 Crusaders, 37 G. A. A., 3, 47 Dancers Club, 47 Senior Home Economics Club, 47 Dial Club, 47 Girls League Rep., 47 Bronze Scholarship Medal. Good sense and good humor are never separated. Mary Elizabeth Dunk High School, Normal, Ill., 1, 27 Spanish Club, 4. 1 would make reason my guide. Elinor K. Dunn Senior Science Club, 3, 47 College Club, 4. University of lllinois An essential of a happy life is freedom from care. William W. Dwoinen Philatelic Exchange, 17 German Club, 1, 27 Chess and Checker Club, 37 Senior Science Club, 3. Care has no place in my life. Greta Iean Dykhuis Parker High School, Chicago, lll., 1, 2, 37 National Iunior Honor Society, Parker Iunior High School. Her days were given to quiet tasks of good. Harry L. Ediors High School, Los Angeles, Calif., 17 Senior Hi-Y, 4. Loyola University A contented mind is the greatest blessing a man can enjoy in this world. Rosemary Edmiston Latin Club, 1, 27 Freshman Dramatic Club7 Sophomore Dramatic Club7 Senior Home Economics Club, 47 His- torians, 4. I can be serious, but I'd rather be gay. Vivian Louise Edmonds Commercial Club, 27 French Club, 3, 47 Historians, 4. Of all the things she liked to do, She liked the most to talk to you. Arthur Edmund Edwards lunior Hi-Y, l7 Freshman Dramatic Club: Latin Club, 1, 2, Aedile, 37 Student Council, 2A, 37 Iunior Council7 Crusaders, 37 English Cabinet Play, 37 Proviso Players, 3, Treas., 47 Library Staff, 47 Senior Senateg Senior Hi-Y, 47 Pageant Editorial Staff, 4B7 Provi Editorial Staff7 Bronze Schol- arship Medal. University of Illinois Nothing can constitute good-breeding which has not good-nature for its foundation. Kai Egeberq Senior Hi-Y, 3, 4. Who saw life steadily and saw it whole. Edward A. Eggers His tongue kept secret his thoughts. Robert Eidem Latin Club, 2. Personal liberty is the paramount essential to human dignity and human happiness. Dorothy M. Eilenberqer Art Club, 17 Neo-Pythagoreans7 Camera Club, 37 French Club, 47 Provi Art Editor7 Bronze Scholarship Medal7 National Honor Society. American Academy of Art An artist in every sense of the Word. .Alice Louise Elfring Latin Club, 17 Girls' League Rep., 37 Span- ish Club, 47 Bronze Scholarship Medal. Let gentleness my strong enforcement be. Ethel E. Engel Neo-Pythagoreans7 Senior Home Economics Club, 3, 47 Commercial Club, 47 O. G. A., Emerald AWard7 Bronze Scholarship Medal. Though silent she accomplished much. Dawn Harriet Erickson Latin Club, l, 27 Sophomore Dramatic Club7 Crusaders, 37 In-and-About Chicago Chorus, 3, 47 His- torians, 47 Senior Guard, Pres., 4B7 Class Vice-President, 2, 3. University of Illinois She's sensible and quite discreet Vtfith winning ways and manners sweet. Chester Ernst Iunior Hi-Y, l, 27 Commercial Club, l, 27 Pageant Editorial Staff, 4B. University of Southern California Winning or losing, he always played fair. Evelyn Lucille Ernster lunior Home Economics Club, 17 Chess and Checker Club, l, 2, 37 Neo-Pythagoreans, Sec.-Treas., 37 Latin Club, 2, 3, 47 Library Staff, 2, 3, 4A1 Senior Senate7 Provi Business Staff7 Bronze Scholarship Medal7 National Honor So- ciety. Give me what I want with a smile and in an attractive package, and I'm yours forever. Herbert Essiq Student Council, 4. University of Notre Dame A merry heart goeth all the day. Edith Ewen Senior Home Economics Club, 37 Commercial Club, 3, 47 Bronze Scholarship Medal. 'Twas her thinking of others, made you think of her. Elaine H. Faley Latin Club, 1, 27 Senior Science Club, 37 Com- mercial Club, 2, 3, 47 Camera Club, 3, 47 Historians, 47 O. G. A. She who is good is happy. Elmer Falkenhagen Camera Club, 37 German Club, 3, 47 Senior Hi-Y, 3, 4. He was one who spoke few words. Paul Fatney Fresh-Soph Basketball, l7 Track, l7 Fresh-Soph Baseball, 27 Lightweight Basketball, 2, 37 Varsity Baseball, 3, 47 Varsity Basketball, 3, 47 All-Suburban Basketball, 3. University of Alabama He played ever a good game, steady and sure. Stanley Iol-in Feinner Carl Schurz High School, Chicago, Ill., l, 27 Camera Club, 47 Senior Science Club, 47 College Club, 47 Library Staff, 4. University of Illinois Good-nature is the beauty of the mind. Mayme Fese Italian Club, 1, 27 O. G. A. Her worth is twice her stature. Shirley Dorothy Fine Civics Club, l, 27 Girls' League Rep., 1, 27 Neo-Pythagoreans7 G.A.A., l, 2, 3, 4, 1200-point AWard7 French Club, 4j Historians, 47 Senior Guafdf Class Secretary, 2, 37 National Honor Society, 37 Gold Scholarship Medal. To make knowledge valuable, you must have the cheerfulness of wisdom. Lillian Fink German Club, 17 O. G. A. ' Ambition has a great reward for all. Theresa Fink German Club, l, 2, 3, 47 G. A. A., l, 2, 3, 4, 600-point Award7 Proviso Players, 3, Sec., 47 Library Staff, 47 O. G. A.7 Senior Class Play7 lunior Life Saving. Whenever there's Work This girl does not shirk. Virginia Edna Fippinger Freshman Dramatic Club7 Sophomore Dramatic Club7 In-and-About Chicago Chorus, 37 Student Coun- cil, 3A7 Senior Home Economics Club, 3, 47 Proviso Players, 47 O. G. A.7 Senior Class Play. I'll be merry, I'll be glad, But one thing sure, I'll not be sad. Earle W. R. Fleege Icy, not sorrow, makes for a perfect life. Ruth Martha Floerinq O. G. A.7 Bronze Scholarship Medal. To be busy at something is a modest maid's holiday. Arthur H. Foerster, Ir. He is ct man of solid acquirementsf' Edna Ruth Ford lunior Home Economics Club, 17 Latin Club, l, 27 G. A. A., l, 2, 3, Volleyball Manager, 4, 1200-point Award7 Senior Home Economics Club, 47 O. G. A.7 Provi Clerical Staff7 Bronze Scholarship Medal7 National Honor Society. The talent of success is nothing more than doing what you can do Well7 and doing Well what- ever you do, without a thought of fame. Ray Foreman An honest plain man, without pleats. Frank Ioseph Forkin Latin Club, 17 lunior Council7 College Club, 47 Senior Science Club, 47 Camera Club, 47 Brass Sextet, 4. University of Illinois His manner made him friend of all. Robert Earl Forsman Concordia College, Milwaukee, Wis., 1, 27 Latin Club, 37 English Cabinet, 4. Every branch of knowledge which a good man possesses can be applied to some good purpose. Kennerd Frase Latin Club, 1, 27 In-and-About Chicago Orches- tra, 47 National Orchestra Contest, 4. University of Illinois Silence is a virtue of the gods. Carol I. Freiday Latin Club, l7 Iunior Home Economics Club, 17 Senior Home Economics Club, 47 Commercial Club, 4. Her aims are high, her ideals true. Kennedy Frew, Ir. Riverside-Brookfield High School, Riverside, Ill., 2. Patience strengthens the spirit, sweetens the temper, , stifles anger. Mauna Loa Galbo High School, Lafayette, Ind., 17 Italian Club, 2, 3. A friend to all, a sweet young maid. Shirley Mariorie Galloway Dancers Club, 1, 27 Operetta, 27 Senior Home Economics Club, 37 Cosmopolitan Club, 37 French Club, 4. A friend of many, foe of none. L. Iane Garey Iunior Home Economics Club, l7 Latin Club, 1, 27 Commercial Club, 27 Senior Home Economics Club, 3, 47 His- torians, 47 Iunior Life Saving7 O. G. A. She made herself popular with all. Keawana Iris Garman Freshman Dramatic Club: Student Coun- cil, l7 Sophomore Dramatic Club7 Girls' League Rep., 2, 37 Senior Guard7 French Club, 47 In-and-About Chicago Orchestra, 47 String Octette, Second Violin, Div. ll, 37 String QUGfl91j State Solo Violin Contest, Div. ll, 2, 37 National Honor Society, 37 Silver Scholarship Medal. Music! Whosoever has skill in this art is of good , temperament, fitted for all things. www? QQ SwannmxsaawmmmmwmmwnfnnmmaswvrfQmtfxwffl. vpqfy-vfffaw.f-v A. Edwards K. Eqebe-rg E. Eqqers R. Eidern D. Eilenberqer I-X. Elfrinq E. Engel D. Erickson C. Ernst E. Ernster H, Essiq E. Ewen E. Paley E. Falkenhaqen P. Earns-y S. Feinner M. Fese S. Pine L. Fink T. Fink V. Fippinger E. Fleeqe R. Floering A. Foerster R. Ford R. Foreman P. Parkin R. Eorsrnan K. Erase C. Ere-iday K. Frew M. Galbo S. Galloway l. Gare-y K. Garman , F. ff isfff: Q Lg ' ..u:ug.u,.,.:L...Qg... . .. .. ..... .4 'af H . ww udindm. P. Gamowicz E. Garrett L. Gault H. Gelir N. Genqler E. Gerlcin H. Gevas M. Gibson B. Giesow P. Giuiita K. Gleason M. Goldstein A. Golz Margaret Goodrich Marie Goodrich G. Gori R. Griesbacli S. Griripas G. Griswold F. Groeiilco l. Grube F. Guaririe A. Gudqeori H. Guelsdorl C. Guiney I. Gustafson M. Gutensou A. Gutli l, Haaii R. Haas C. Haliii G, Harisori G. Hansson M. Harbacolc T. Hardy Florence Garnowicz I. Sterling Morton High School, Cicero, lll., l, Commercial Club, 3, 4, Senior Life Saving, O. G. A. Friendship above all ties does bind the heart. Elisabeth Ann Garrett Art Club, l, Latin Club, l, 2, G. A. A., 1, 4, 600-point Award, Pageant Business Staff, 2, Iunior Home Economics Club, 3, Senior Home Economics Club, 4, Historians, 4, Girls' League Rep., 4, Iunior Life Saving, Senior Life Saving, Senior Class Play. Chicago Art lnstitute Love of beauty is Taste, The creation ot beauty is Art. Louise Eileen Gault Latin Club, l, 2, Girls' League Rep., 3, French Club, 4, Spanish Club, Sec., 4, Proviso Players, 4, Senior Class Play. Wheaton College She touches nothing but she adds a charm. Hugo L. Gehr Fresh-Soph Baseball, 2, Crusaders, 3, Historians, 4, Senior Hi-Y, 4, Lightweight Basketball, 4. University ol Wisconsin Man was formed for society. Nicholas L. Gengler Fresh-Soph Football, 1, Varsity Football, 2, 3, Student Council, lA, ZB, lunior Council, Varsity Club, 2, 3, 4. At the game's end we shall see who wins. Ernest Gerkin Senior Hi-Y, 4. The superior man wishes to be slow in his words, and 'Ernest' in his conduct. Helen Gevas Harrison High School, Chicago, Ill., l, 2, McKinley High School, Chicago, lll., 3, Dancers Club, 4, Senior Class Play. A dainty maid is she, so prim, so dear, so nice. Margaret A. Gibson Neo-Pythagoreans, lA, Z, Sophomore Dra- matic Club, Senior Home Economics Club, 4. Her face betokens all things dear and good. Bernice R. Giesow O. G. A., 120-word Transcription Award, Bronze Scholarship Medal. And kind the voice and glad the eye. Philip M. Giunta Student Council, l, 2, 3, ltalian Club, l, 2, 3, Civics Club, l, 4, Treas., 2, Pres., 3, Library Stall, 2, 3, 4, Sports Club, 4, Dial Club, 4, Bronze Scholarship Medal. University of Notre Dame This lile is good. I. Keith Gleason Latin Club, l, Student Council, l, 2, Fresh- Soph Football, 2, Senior Hi-Y, 4, Class President, l. University of Illinois A good deed is never lost, He who sows courtesy, reaps friendship. Morris Ioseph Goldstein German Club, l, 2, Philatelic Exchange, l, 2, 3, Commercial Club, 3, Senior Science Club, 3, 4, College Club, 3, 4, Forum, 4, Track Manager, 4, Bronze Scholarship Medal. Northwestern University A day for toil, an hour for sport. Alvin Theodore Golz German Club, 1, Fresh-Soph Football, 2, lunior' Varsity Football, 3. Trust follows his words. Margaret Louise Goodrich Student Council, 3, Senior Home Economics Club, 4, Camera Club, 4, O. G. A. A fair woman shall not only command without authority but persuade without speaking. Marie A. Goodrich Latin Club, l, 2, Sophomore Dramatic Club, Neo-Pythagoreans, Chess and Checker Club, 2, Treas., 3B, Girls' League Rep., 3, ln-and-About Chicago Chorus, 3, Pageant Edi- torial Statt, 3A, 4, Historians, 4, Senior Guard, Iunior Life Sav- ing, Provi, Editor-in-Chief, Bronze Scholarship Medal, National Honor Society. Grinnell College Responsibility walks hand in hand with capacity and power. Gottfried Gorr Sophomore Dramatic Club, Crusaders, 3, His- torians, 4. Toil is the law oi life and its best fruit. Raymond Griesbach Chess and Checker Club, 2, 3, Dial Club, 4. For blessings ever Wait on virtuous deeds. Sara N. Grinpas Freshman Dramatic Club, Sec., Sophomore Dramatic Club, Latin Club, l, 2, Sophomore Council, Girls' League Rep., 2, Iunior Home Economics Club, 2, Pageant Busi- ness Staff, 2, 3, Civics Club, 3, College Club, 3, Senior Science Club, Sec., 3, English Cabinet Play, 3, English Cabinet Magazine Contest, 3, Historians, 4, Proviso Players, 4, Senior Guard, Girls' League Chairman of Program Committee, 4, Parnassus Club, Sec., 4, Globe Theater Essay Contest, Honorable Mention, Provi Editorial Staff, Bronze Scholarship Medal, National Honor Society. Northwestern University Here is a character impetuous as ilame!leaping to high and splendid things. George H. Griswold Chess and Checker Club, 4. Think no more, lad, laugh, be jolly. Fredrick T. Groenke Latin Club, l, 2, Iunior Hi-Y, 1, 2, Bronze Scholarship Medal. Northwestern University He is a well-made man who has a good determination. Ieanette Louise Grube Art Club, l, Latin Club, l, 2, G. A. A., l, 2, 3, 4, Camera Club, 3, 4, Historians, 4, O. G. A., Provi Art Staff, American Academy of Art lf you would create something, you must be something. Frank Guarine Italian Club, l, 2, 3. lllinois State Normal University Slow and steady wins the race. Albert G. Gudgeon Freshman Dramatic Club, Sophomore Dra- matic Club, Iunior Council. What should a man do but be merry? Henry I. Guelsdort Crusaders, 3. Modesty is the citadel of virtue. Carl F. Guiney Sophomore Dramatic Club, Proviso Players, 3, Spanish Club, 4, O. G. A. State Teachers' College, Wisconsin True politeness is perfect ease and freedom. Iane Gustafson lunior Home Economics Club, Vice-Pres., l, Commercial Club, 2, 3, 4, Senior Home Economics Club, 3, G. A. A., l, 2, 4, Volleyball Manager, 3, 1600-point Award, His- torians, 4, lunior Life Saving, O. G. A., Pageant Editorial Staff, Assistant Editor, 4B, Provi Editorial Staff, Associate Editor, Gold Scholarship Medal, National Honor Society. The true, strong, and sound mind is the mind that can embrace equally great things and small. Mariorie I. Gutenson German Club, l, 2, 3, Commercial Club, 4, Historians, 4, Senior Home Economics Club, 4, Provi Business Staff, Bronze Scholarship Medal. 'Tis good-will makes intelligence. Anne Marie Guth Providence Academy, Chicago, lll., l, Girls' League Rep., 2, College Club, 3, Senior Home Economics Club. 3, 4, Historians, 4, Student Council, Sec., 4, In-and-About Chi- cago Chorus, 4, O. G. A., Senior Class Play, National Honor Society. Vogue School A happy heart makes a blooming visage. Iacl: I. Haan Sports Club, l. l would not change my free thought for a throne. Robert Edward Haas High School, Pasadena, Calif., l, National Honor Society. The small courtesies sweeten life, the greater, enoble it. Charles I. Hahn Library Staff, 3A, Iunior Varsity Basketball, 3, 4, Senior Hi-Y, 3, 4, Senior Senate, Dial Club, 4, Provi Business Staff. University of Wisconsin lf you would rule the world, you must keep it amused. George Hanson German Club, 2, Senior Hi-Y, 4. What is becoming in behavior is honorable, and what is honorable is becoming. Hans Gunnar Hansson Cross Country, 1, 2, Senior I-li-Y, 3, Pres., 4. Oh, give us a man who sings at his work. Marie Alice Harbacek O. G. A. We are charmed by neatness. Thomas A. Hardy lunior High School, lacksonville, Fla., 1, High School, lacksonville, Fla., 2, High School, Lapeer, Mich., 3, High School, Flint, Mich., 4B. True happiness springs from moderation. La Kela I. Hartman High School, Ludlow, Ky., l, 2, 3. Your actions, in passing, pass not away, for every good work is a grain of seed for eternal life. Edna Leona Hauqh Notre Dame of Maryland, Baltimore, Md., lB, High School, Roanoke, Va., lA, Villa de Chantal, Rock lsland, Ill., 2B, Providence Academy, Chicago, lll., ZA, College Club, 4, Historians, 4, Pageant Editorial Staff, 4, Provi Clerical Staff, O. G. A., Bronze Scholarship Medal, National Honor Society. Command was service, humblest service done by willing and discerning souls was glory. Edwin Hausermann He is free who lives as he chooses. Charlotte Frances Hawkins Iunior Home Economics Club, 1, Girls' League Rep., l, 4, Chess and Checker Club, 3, Student Council, 3B, French Club, 4, O. G. A. ' There's no false modesty about you. Iohn Thomas Hawthome Foreman lunior High School, Chicago, Ill., l, Carl Schurz High School, Chicago, lll., 2. Nothing is too high for the daring of mortals. Donald R. Hedqes Senior Science Club, 2, 3, 4, Senior Hi-Y, 4. H Beloit College Burdens become light when cheerfully borne. Loretta Heidelbach Iunior Home Economics Club, l, Commercial Club, 3, Vice-Pres., 4: O. G. A., Silver Scholarship Medal, Na- tional Honor Society. An investment in knowledge pays the best interest. Frank R. Heil Latin Club, l, 2, Freshman Dramatic Club, Sophomore Dramatic Club, English Cabinet Play, 3, O. G. A., Piano, Marimba, and Bell Soloist, 2, 3, 4, Accompanist, 3, 4, Dis- trict and State Contests, 3, 4. American Conservatory of Music My friends, rules were made for slaves. Fred Henselman University of Southern California I In quietness and confidence shall be your strength. George F. Henzler I. Sterling Morton High School, Cicero, Ill., l, Historians, 4, O. G. A., Bronze Scholarship Medal, National Honor Society. An affable and courteous gentleman. WGYhe Frederick Hermann Cosmopolitan Club, 3, 4, Senior Hi-Y. 3, 4, Historians, 4, Student Council, 4. Mirth and motion prolong life. Hazel La Voy Hesterman Freshman Dramatic Club, Sophomore Dramatic Club, Latin Club, l, 2, G. A. A., l, 2, 3, Senior Science Club, 3, Senior Home Economics Club, 3, Girls' League Rep., 3, Pf0V1SO P1C1Y9fS, 3, 4: Provi Business Staff, Iunior Life Saving, Bronze Scholarship Medal, National Honor Society. H I American Academy of Fine Arts It 1S work which gives flavor to life. Walter A. Hickman Lightweight Football, 4. A willing mind makes a light foot. Gottlieb Hilqenberg German Club, l, 2. LQCIFYUUQ 1'I1CIlCeS a young man fit company for himself. F. Pershing Hill Latin Club, l, 2, Camera Club, l, 2, 3, 4, Philatelic Exchange, l, 4. , Politeness is the result of good sense and good nature. if Bette Anne Hilton Student Council, 2, Crusaders, 3, Historians, 4, ln-and-About Chicago Chorus, 4, Bronze Scholarship Medal. A little song will outlive all sermons in the memory. Donald Hitzeman Fresh-Soph Football, l. - The gods demand of us toil as the price of all good things. Dorothy Hoe Latin Club, l, French Club, 2, 3, Archery Award, 4. A good disposition is more valuable than gold. Brenadene M. Hoeck G. A. A., l, 2, 3, 4, l200-point Award, Dancers Club, 2, 3, 4, ln-and-About Chicago Chorus, 3, 4. Marinello School of Beauty Culture You have a nimble wit, l think 'twas made of ,. Atlanta's heels. Mildred Anne Hoffman Commercial Club, 3. What's beauty, but an air divine, Through which the mind's all-gentle graces shine? Lillian Dorothy Hohe Latin Club, l, 2, Commercial Club, 3, Girls' League Rep., 3, Senior Home Economics Club, 3, 4, French Club, 4, Silver Scholarship Medal. Oak Park Hospital Paradise is open to all kind hearts. Sam E. Holden Every man is valued in this world as he shows by his conduct he wishes to be valued. Dorothea Theresa Holpuch Latin Club, 2, Senior Science Club, 3, Senior Home Economics Club, 3, College Club, 4, French Club, 4, Provi Editorial Staff. University of Chicago She performed her task with a graceful and dignified simplicity and modesty. Ierome B. Hoopes Philatelic Exchange, l, Pageant Advertising Staff, 3, Band Secretary, 3, Band Award. And panting, he toiled after time in vain. Wilhelmina E. Horras Trinity High School, River Forest, lll., l, 2. Careless is she with artful care. Rexford Alden Horton lunior Hi-Y, l, 2, Latin Club, l, 2, Neo- Pythagoreans, Radio Club, l, Treas., 2, 3, 4, Student Council, 2, 3A, Harvard Club Award, 3, Senior Hi-Y, 3, 4, Pageant Editorial Staff, Associate Editor, 3, 4B, Historians, 4, Parnassus Club, 4, English Cabinet Essay Contest, First Place, 4B, Provi Editorial Staff, Associate Editor, Gold Scholarship Medal, National Honor Society, 3. University of Chicago A man with a clear head, a good heart, and an honest understanding will always write well. Mary Nh Howard f f K 'f Y Friendship improves happiness. Ethel A. Hubner lunior College, La Grange, lll., l, 2, 3. High-erected thoughts seated in the heart of courtesy. Alice E. Hull Latin Club, l, 2, 3, G. A. A., l, 2, 3, 4, Historians, 4, College Club, 4. Good humor and generosity carry the day with the popular heart all the world over. William Patrick Hullihan Cosmopolitan Club, 4A, Treas., 3A, 413: Statesmen, 4, University of Notre Dame Too much discipline destroys individuality. George C.'Hupp Dial Club, 4. A patient, humble temper gathers blessings that are marred by the peevish and overlooked by the aspiring. Eleanore C. Huppenbauer Sienna High School, Chicago, lll., l, Commercial Club, 3, O. G. A. ' The sunshine of life is made up of beams that are bright all the time. Mariorie Estelle Hurwitz Latin Club, l, Aedile, 2, Civics Club, l, 2, College Club, 4, Historians, 4, Dial Club, 4, Provi Business Staff, Silver Scholarship Medal. University of Illinois Her glossy hair was clustered o'er a brow Bright with intelligence, and fair, and smooth. Dorothea E. Huxhold German Club, l, Student Council, l, lun- ior Home Economics Club, 2, Girls' League Rep., 2, Operetta, 2, Senior Home Economics Club, 3, Iunior Council, ln-and-About Chicago Chorus, 3, Senior Senate, Inter-Church Girls' Conference, Treas., 4, Silver Scholarship Medal, National Honor Society. American Conservatory of Music The art of being able to make a good use of abilities wins esteem. Carol Alice Ingalls Latin Club, l, 2, Crusaders, 3, Historians, 4, College Club, 4, Cosmopolitan Club, 4, Senior Guard, Girls' League Chairman of Friendship Committee, 4, Statesmen, 4, Pageant Editorial Staff, 4B, Bronze Scholarship Medal, National Honor Society. To every day she brings good cheer, And so we like to have her near. L. Hartman L. Hauah E. Hausermann C. Hawkins l. Hawtliorne D, Hedges L. Heidelbacln F. Heil lf. Honselman X Cu. Henzler W. Hermann ll. Hesterman W. Hickman G. Hilqenberq P. Hill H. Hilton D. Hitzeman D. Hoe B. Hoeck lxl. Hoffman D. Hohe S. Holden D. Holpuch I. Hoopes VV. Horras R. Horton M. Howard E. Hubner A. Hull VV. Hullihan G. Hupp E. Huppenlzauer M, Hurwitz D. Huxhold C. lnqalls R. lngersoll G. lcxcolns S. lumeson V. lcimeson H. Ifxnssen F. lcrnizen V. lcrnus H. lohnson K. lohnson L. lohnson H lohnson VV. lohnson K. lones M. lones G. lorqes E. Kacllec l, Kulicinslci l. Kcunenko D. Kcxnuru D. Kane L. Kmniuk H. Kurle-n W. Kurrcis L. Kaufeldt M. Kelly M. Kelslrom L. Ke-mpski G. Kennelt D. King Edna Kinqdon Ethel Kinqdon l. Kinnilmurqld l. Kilche-os L. Klecrn A. Klein Robert K. lnqersoll Philatelic Exchange, 2, Provi Art Staff. To be an artist is a great thing, but to be an artist and not know it is the most glorious plight in the world. Gilbert Kurt Iacobs In-and-About Chicago Chorus, 3, 4. University of Illinois He lives all the days of his life. Shirley Iameson Latin Club, l, Aedile, 2, Crusaders, 3, Girls' League Rep., 3, Historians, 4, G. A. A., l, 2, Baseball Manager, 3, 4, 2000-point Award, Iunior Life Saving, Senior Life Saving, Bronze Scholarship Medal, National Honor Society. University of lllinois I-lere's an all-'round athlete: You'll find her out for every feat. Viola I. Iameson O. G. A. What is joy? A Sunbeam between two clouds. Henrietta A. Ianssen Trinity High School, River Forest, Ill., 1, 2, High School, Miami, Fla., 4B, College Club, 3, 4A, Cosmopolitan Club, 4A. University of Illinois A little bit of fun and laughter, That's what she is always after. Fred Iantzen Lightweight Basketball, 3, Lightweight Football, 3, 4. ln sports did he excel. lirginia I. Ianus I. Sterling Morton High School, Cicero, Ill., l, Spanish Club, 3, 4, College Club, 3. The most happy Woman is she Who knows happiness. Harris M. Iohnson Iunior Hi-Y, 1, Latin Club, l, 2, Sports Club, 1, 2, 3, 4, Varsity Football, Manager 4. There is always hope in a man who actually and earnestly works. Katherine Herbeth Iohnson Latin Club, 2, Historians, 4, Senior Science Club, 4, College Club, 4. Character gives splendor to youth. Lillian Iohnson Latin Club, l, 2. De Lee School of Beauty Culture Although she is a quiet lass, We miss her when she's out of class. Robert Dwight Iohnson General Science Club, l, Historians, 4, Senior Science Club, 4. Pleasure and action make the hours seem short. William M. Johnson Camera Club, l, Student Council, 2, Iunior Council, Varsity Club, 2, 3, 4, Pageant Editorial Staff, 3, Senior Senate, Senior Hi-Y, 3, 4, Fresh-Soph Basketball, l, Fresh-Soph Baseball, l, Varsity Football, 2, 3, 4, Varsity Basketball, 2, 3, 4, Varsity Baseball, 2, 3, 4, All-Suburban Football, 3, 4, All-Sub- urban Basketball, Capt., 3, Class President, 3, 4. Northwestern University The world still needs its champion as of old, and finds him still. Kathlyn Elizabeth Iones High School, Laurel, Miss., l, 2, Girls' League Rep., 4, Senior Home Economics Club, 4, Historians, 4, Dial Club, 4. A warm friend and a lovely girl. Marian L. Iones High School, Minooka, Ill., 1, 2, 3. Leisure is the reward of labor. Genevieve Iorges German Club, l, 2, Senior Home Economics C11-lb, 4- U De Lee School of Beauty Culture If you would be loved, love and be lovable. Edwin L. Kadlec, Ir. Latin Club, 1, 2. What is mind? No matter. What is matter? Never mind. Irene M. Kalicinslri Civics Club, 1, Latin Club, 1, 2, National Orchestra Contest, 2, Iunior Home Economics Club, 2, Neo-Py- thagoreans, 3, Camera Club, 3, 4, Senior Home Economics Club, 4, Historians, 4, Dial Club, 4. West Suburban Hospital A sunny heart and a sunny smile. Iohn Kamenko At least a tall man must be looked up to. David Kanara Foreman Iunior High School, Chicago, Ill., l, Latin Club, 3, 4, Senior Hi-Y, 4, Eta Sigma Phi Medal. As proper a man as one shall see in a summer's day. Donald C. Kane Student Council, l, 2, Track, 2, Senior Senate, In-and-About Chicago Orchestra, 2, 3, 4, National Orchestra Contest, 3, 4, String Octette, National Winner, Student Conductor, String Bass Solo Contest, Div. Ill, 2, Div. II, 3, Orchestra, Vice- Pres., 4, Bronze Scholarship Medal, National Honor Society. University of Chicago Music is the art of the prophets. Lena Kaniuk Each mind has its own method. Harvey M. Karlen lunior Hi-Y, l, 2, Philatelic Exchange, l, 2, Sophomore Dramatic Club, Crusaders, 3, Proviso Players, 3, 4, Senior Class Play, Bronze Scholarship Medal. University of Illinois At Learning's fountain it is sweet to drink, But 'tis a nobler privilege to think. William I. Karras St. Phillips High School, Chicago, Ill., l. Conversation is the vent of character as well as of thought. Lillian Florence Kaufeldt Commercial Club, 4, Senior Home Eco- nomics Club, 4, O. G. A., Senior Class Play, Bronze Scholarship Medal. Not much talk, but a sweet silence. Margaret M. Kelly Senior Home Economics Club, 3, 4, Histor- ians, 4. Oh, happiness! Our being's end and aiml Marion Gracile Keltrom Latin Club, 2, O. G. A., Gold Scholar- ship Medal. They that govern the most, make the least noise. Leonard A. Kempski You can never plan the future by the past. Gordon Kennett Latin Club, l, 2, Radio Club, l, Sec., 2, 3, Senior Science Club, 2, Monitor Captain, Flute Quartet, 2, 3, Flute Section Leader, 3, Woodwind Quintet, 3, National Quintet, 3, Bronze Scholarship Medal. Armour Institute of Technology No man can justly censure or condemn another, because no man truly knows another. Don King Proviso Players, 3, 4, In-and-About Chicago Chorus, 3, 4, College Club, Vice-Pres., 4, Dial Club, 4, Iunior Lite Saving. University of Chicago Character is produced in the great manufacture of daily duty. Edna Kinqdon Iunior Home Economics Club, 2, In-and-About Chicago Orchestra, 2, 3, National Trio and Octette Contest, Div. Ill, 2, Div. II, 3, String Octette, Second Violin, Div. ll, 3, First Place State Trio, 2, 3, First Place State Violin Solo, 3, Spanish Club, 3, 4, Senior Home Ecomonics Club, 3, 4, Dial Club, 4, Senior Guard, String Quartet. Oberlin College Her music is well said to be the speech of angels. Ethel Kinqdon Iunior Home Economics Club, 2, In-and-About Chicago Orchestra, 2, 3, National Trio and Octette Contest, Div. III, 2, Div. II, 3, String Octette, Cello, Div. ll, 3, String Quartet, Spanish Club, 3, 4, Senior Home Economics Club, 3, 4, Dial Club, 4, Senior Guard, Orchestra Sec.-Treas., 4. Oberlin College The one so like the other as could not be distinguished but as by names. Iames Kinniburqh Camera Club, 2, 3, 4, In-and-About Chicago Chorus, 4. Pleasure is far sweeter as a recreation than as a business. Iulian lay Kitcheos Iunior Varsity Football, 2, Varsity Football, 3, 4, Varsity Club, 4. Purdue University lt's a short, short life we live here, So I'm living while I can. Lester E. Klean Fresh--Soph Football, l, 2, Iunior Varsity Foot- ball, 3, Varsity Club, 3, 4, Wrestling, 3, 4, Cosmopolitan Club, 3, 4, Varsity Football, 4, Senior Science Club, 4. Boering School of Aeronautics A clean fire, a clean hearth, and the vigor of the game. Albert Klein Cosmopolitan Club, 3. One of the greatest pleasures in life is conversation. Emory K. Kluqe Oak Park High School, Oak Park, Ill., 3. There is no greater achievement that is not the result of patient working and waiting. Dorothy Kluppinq Latin Club, 1, 2,7 G. A. A., l, 2, 3, Basketball Manager, 4, 2000-point Award7 Iunior Life Saving7 Crusaders, 37 Senior Science Club, 37 College Club, 47 Historians, 47 Dancers Club, 47 Senior Life Saving7 Hockey Award7 Pageant Editorial Staff, 4B7 Provi Editorial Staff7 Bronze Scholarship Medal. University of Illinois ln activity we must find our joy as well as our glory. Olga May Kmet Latin Club, 37 Naturalists, 4. Augustana Hospital We strive to improve the heart and mind. Matthew Koeppel H The cares of today are seldom those of tomorrow. Mildred A. Kohoutek Latin Club, 1, 27 O. G. A. A quiet life is hers. Pearl Sophia Konigsield I. Sterling Morton High School, Cicero, Ill., 17 Freshman Dramatic Club: I1-11'1lOf l'lOIT19 ECOHOIHICS Club, 27 o. G. A. I , ,, What sunshine is to flowers. Sm1l9S GTG to l'11lI1'1CH'l1lY- Marion E. Koop O. G. A. I To a rational being, to act according to nature and according to reason is the same thing. Melvin H. Korrell Latin Club, 27 Orchestra Concert Master, 2. 3, 47 National Violin Solo Contest, Div. Il, 2, Div. IV, 3: State Violin Solo Contest, Div. I, 2, 37 National Orchestra Contest: String Octette, First Violin, Div. II, 37 Orchestra, Vice-Pres., 3, Pres., 47 String Ouartet7 In-and-About Chicago Orchestra, 4. Is there a heart that music cannot melt? Dorothy A. Kowell Historians, 4. I Stillness of person and steadiness of features are signal marks of good breeding. Frances G. Kral Latin Club, 2: C0mH'19fCiGl Club, 4: O. G. A-: Silver Scholarship Medal. She's considerate and sweet From her head to her feet. Phyllis Marie Krickl Art Club, 17 Girls' League Rep., 17 Pageant Business Staff, 27 Iunior Home Economics Club, 2: SGIHO1' HOITIG' Economics Club, 3, 47 Provi Art Staff7 Archery Award, 4. Rockford College She who is firm in will molds the world to herself. Virginia Iune Krueger Commercial Club, 27 Girls' League Rep., 3. The blushing beauty of a modest maid. Clarence A. Kurz Latin Club, lj College Club, 37 Cosmopolitan Club, 37 Radio Club, 3, 47 Historians, 47 Travelers Club, 47 States- men, 47 Pageant Editorial Staff, 47 Provi Editorial Staff7 Tuba Section Leader7 Band Soloist7 Brass Sextet, 47 Bronze Scholarship Medal. Elmhurst College Music, once admitted to the soul, becomes a sort of spirit, and never dies7 for it wanders through the memory, distinct and living. Doris Frances Kweder Latin Club, 17 Student Council, 17 Girls' League Rep., 27 G. A. A., 1, 2, 3, Tournament Manager, 4, 1200- point Award. A fun-loving lass7 see the mischief in her eyes. Mona Patricia Lambert Senior Home Economics Club, 37 Com- mercial Club, 4. Harmless mirth is the best cordial against the consumption of the spirit. Richard Harold Lande Civics Club, 1, 27 Neo-Pythagoreans7 Student Council, l, 3, 47 College Club, 37 Cosmopolitan Club, 37 Forum, Vice-Pres., 47 French Club, 47 Pageant Editorial Staff, 413, Managing Editor, 4A. Northwestern University To write Well is at once to think well and to feel right. Elizabeth Lane Crusaders, 37 Silver Scholarship Medal7 Na- tional Honor Society. So womanly, so benign, and so meek. Winniired Lant Crusaders, 37 Historians, 4. She that nothing guestioneth, nothing learneth. Marie La Plante Freshman Dramatic Club: Sophomore Dramatic Club7 O. G. A. Soft peace she brings Wherever she arrives. John Rocco Laraia Italian Club, 1, 27 O. G. A. Where judgment has wit to express it, there is the best orator. Iack A. La Rocco Italian Club, l, 2, 37 Civics Club, 27 Fresh- Soph Football, 17 Varsity Club, 2, 4, Sec.-Treas., 37 Varsity Foot- ball, 2, 3, 47 Monitor Captain7 Class President, 27 Bronze Schol- arship Medal7 National Honor Society. University of Chicago Men are polished, through act and speech, each by each7 As pebbles are smoothed on the rolling beach. Lucille L. Larsen She of friendly smiles freely gave. Seraphina La Spisa Italian Club, l, 3, Treas., 27 Iunior Home Economics Club, Sec., 27 Senior Home Economics Club, Treas., 3, 47 Naturalists, 47 Historians, 47 Senior Guard7 Bronze Scholar- ship Medal7 National Honor Society. The way to gain a good reputation is to endeavor to be what you desire to appear. Earl F. Laubly Latin Club, 1, 27 Philatelic Exchange, 1, 27 Iunior Hi-Y, 27 Senior Hi-Y, 3, 47 Historians, 47 Provi Art Staff. Ioyousness is nature's garb of health. Pearl R. Lauth Latin Club, l, 27 Freshman Dramatic Club: Sophomore Dramatic Club: G. A. A., 1, 2, 3, 4, 600-point Award7 Iunior Life Saving7 Senior Life Saving7 College Club, 37 Cru- saders, 37 In-and-About Chicago Chorus, 3, 47 Senior GUGfdj French Club, 47 Historians, 47 Provi Business Staff7 Silver Schol- arship Medal7 National Honor Society. University of Illinois The fountain of beauty is the heart, and every generous thought illustrates the walls of your chamber. Loretta H. Lawrence lt is tranquil people who accomplish much. Elizabeth L. Leake German Club, 27 Operetta, 27 Camera Club, 37 In-and-About Chicago Chorus, 2, 37 Senior Home Economics Club, 3, 47 Cosmopolitan Club, 3, 47 College Club, 47 Silver Scholarship Medal7 National Honor Society. University of Illinois Happiness is unrepented pleasure. Donald F. Leal Neo-Pythagoreans7 Radio Club, 2, 37 Senior Science Club, 2, 3, 47 Senior Hi-Y, 4j Silver Scholarship Medal7 National Honor Society, 3. Worth, courage, honor, these indeed your sustenance and birthright. Ray Lee Saxophone Quartet State Winner, 17 Saxophone Ouar- tet National Second Place, 17 Saxophone Ouartet District Win- ner, l, 27 Neo-Pythagoreans, Pres.7 Drum Major, 37 Band Cap- tain, 37 Saxophone-Section Leader, 3. ' Like the bee, we should make our industry our amusement. Iohn Lenk Nor do I call pleasures idleness, or time lost. Ioseph Leszko - Radio Club, Sec., 4. The great fact is, that life is a service. The only question is, 'Whom will we serve-?' Martin C. Lietz Dial Club, 4. lndustry makes all things easy. Robert R. Lindgren Commercial Club, 2, 3, 47 Camera Club, 37 Historians, 4. The quiet mind is richer than the crown. Francis Linneman German Club, 2. Set happiness before you as an end. Ida O. Litke Iunior Home Economics Club, 17 Iunior Council7 English Cabinet, 3, 47 Commercial Club, 47 O. G. A.7 Gold Schol- arship Medal7 National Honor Society. We persuade others by being in earnest ourselves. 'nf'9RGu'k11lH7!4u'aa -z E. Kluqe 1 D. Kluppinq 1 G. Kmet M. Koeppel M. Kohoutek P. Koniqsfeld M. Koop M. Korrell D. Kowell F. Kral P. Krickl V. Krueger C. Kurz D. Kweder M. Lambert R. Laude E. Lane W. Lani M. La Plante L Laraia I. La Rocco L. Larsen S. La Spisa E. Laubly P, Lauth L. Lawrence E. Leake- D. Leal R. Lee L Le-nk I. Leszko M. Lietz R. Lindgren F. Linneman L Litke V !,....,,.,... .. .,,,.. .,. . tv.. V, . - .. . , . , . .. . . . ., ML-uavwm -- -iumauuumf-M-'enema '- - A -- - A f'-'Aw A---nm---+ve H. Litten E. Lobdell R. Locke L. Loeck IX. Lossin B. Lowe V. Lullo E. Lurie R. Lutz W. Mach T. Madsen M. Madsen V. Maher H. Mahnke L. Marcus E. Marik Henry Marsh Howard Marsh W. Mariinson E. Maiejovsky G. McCaffrey T. McComb L McCreary E. McElroy G. McGee D. Mclniyre H. McKillip D. McLeod K. McMillan E. McNamar L. McNeill M. Meeks I. Meese L. Meiers H. Meyer ,TIFF ,H .....--... . .V..i- . v ---Y -1- -v - W , Harold Litten High School, Rock lsland, lll., l, 2, 3. A true and cheery friend. Zdward M. Lobdell Neo-Pythagoreans, German Club, 2, 3, Stu- lent Council, 3B, Historians, 4, Bronze Scholarship Medal. Depend on no man but him who can depend on himself. lobert H. Locke Student Council, l, Latin Club, l, 2, lunior li-Y, l, Serg.-at-Arms, 2, Camera Club, 2, ln-and-About Chicago Drchestra, 2, 3, Senior Hi-Y, 3, 4, Historians, 4, Dial Club, 4. Northwestern University The love of music is a sign of predestination. ,illian A. Loeck Latin Club, l, G. A. A., l, Commercial Club, 4, tenior Home Economics Club, 4. A girl with capacity for joy. lnne Marie Lossin Commercial Club, 2, 3, 4, Student Council, 3. Friendship must be accompanied by virtue, and always lodged in great and generous minds. letty Iane Lowe lunior Home Economics Club, l, Latin Club, , 2, Senior Home Economics Club, 3, 4, Girls' League Rep., 4. A cheerful air, a step both light and quick. Vincent Anthony Lullo ltalian Club, l, 2, 3, 4, Sophomore Dra- iatic Club, Crusaders, 3, Proviso Players, 4. While l live, let me live. ternadine Miriam Lurie Latin Club, l, 2, Sophomore Dramatic Ilub, Pageant Business Staff, 2, Crusaders, 3, College Club, 3, 4, EIA. A., 3, 4, 600-point award, Iunior Life Saving, Parnassus Plub, 4, French Club, 4. Northwestern University A patient and loyal girl. Lichard C. Lutz 1 Consistency was part of his plan. Vesley Mach -A Strong reasons make strong action. erm I. Madsen lunior Home Economics Club, l, 2, Girls' League .ep., 3, Senior Home Economics Club, 3, 4, Dial Club, 4. . Her smile, as sweet as it can be, Her voice, just as it ought to be. lildred Madsen Latin Club, l, 2, Iunior Home Economics Club, , 2, Commercial Club, l, 2, 4, Senior Home Economics Club, 4. 5 She has many friends, for she is friendly. 'ivian Maher Senior Home Economics Club, 4, O. G. A. O, why has happiness so short a day? lilda Marie Mahnke Freshman Dramatic Club, German Club, l, .tnior Home Economics Club, l, Pres., 2, G. A. A., l, 2, 3, 4, 600- oint Award, Senior Life Saving, English Cabinet, l, 2, 3, Student Council, 2, Girls' League Rep., 3B, Crusaders, 3, Senior Home conomics Club, 3, 4, Dial Club, 4, Historians, 4, Inter-Church lirls' Conference, Vice-Pres., 4, Senior Guard, P. E. O. Award, , 2, 3, Gold Scholarship Medal, National Honor Society, 3. Count that day lost, whose low descending sun Views from thy hand no worthy action done. ucille Marcus Latin Club, l, 2, Civics Club, 2, 3, Crusaders, 3, Yamera Club, 3, College Club, 4, Treas., 3, Cosmopolitan Club, , 4, Travelers, 4, Statesmen, 4, Library Staff, 4, Pageant Editorial taff, 4B, Provi Editorial Staff, Bronze Scholarship Medal. U University of Illinois All good things which exist are the fruits of originality. dward Marilr Radio Club, Pres., 4, Camera Club, 4, Bronze cholarship Medal, National Honor Society. Armour Institute of Technology He was straight, you could trust him. ienry O. Marsh Latin Club, 2, Neo-Pythagoreans. , University of Illinois A modest man never talks of himself. I. Howard Marsh lunior Hi-Y, l, 2, NeofPythagoreans, Commer- cial Club, 2, Senior Hi'Y, 3, 4, Bronze Scholarship Medal. A finished gentleman from top to toe. Walter Martinson Civics Club, l, 2, RadioNClub, Treas., 4. Good at work, but better at play. Evelyn A.Mateiovsky Crusaders, 3, G.A.A., 3, 4, Latin Club, 4. VVe always admire an earnest girl. George McCaffrey Latin Club, l, 2, Commercial Club, 2. St. Mary's College of California To be truly and really independent is to support ourselves by our own exertions. Thelma F. McComb Commercial Club, 2, Spanish Club, 2, Sec., 3, Student Council, 4, Senior Home Economics Club, 4, O. G. A. Burnham School of Beauty Culture She has soft and pensive grace. lrene E. McCreary Latin Club, 2, Senior Home Economics Club, 4: O. G. A. And 'tis joy that moves the world. Elvan L. McElroy Civics Club, l, 2, Pres., 3, Sophomore Dramatic Club, Crusaders, 3, Proviso Players, 3, Pres., 4, Band Captain, 3, District and State Contests, 3, Band Medal, Drum Section Leader, 3, 4, Historians, 4, Dial Club, 4, Senior Class Play. A musical man. George McGee There is no trade or employment but the young man following it may become a hero. Donald McIntyre Neo-Pythagoreans, Student Council, 2, 3, Light- weight Football, 3, Sports Club, 4, Senior Hi-Y, 4, Senior Senate. A mischievous twinkle of the eye is often a symbol of energy. Hugh A. McKillip Morgan Park Military Academy, Morgan Park, lll., l, St. Mels High School, Chicago, lll., 2, Austin High School, Chicago, lll., 3. De Paul University Nothing great was ever achieved without enthusiasm. Delbert H. McLeod Commercial Club, 3, Cosmopolitan Club, 4, Dial Club, 4. A good cause makes a strong aim. Katherine McMillan Crusaders, 3, Naturalists, 4. Ready with unfolding chatter. Ruth Eileen McNamar Oak Park High School, Oak Park, Ill., 1, 2, French Club, 4, Senior Home Economics Club, 4, Historians, 4, P'rovi Business Staff. Iowa State College Full of lively grace. Lorraine McNeill Iunior Home Economics Club, 2, Commercial Club, 2, 3, G. A. A., 3, Historians, 4. -1, of easy temper Naturally good and faithful to her word. Mary La Veta Meeks Latin Club, 2, Iunior Council, O. G. A., ln-and-About Chicago Chorus, 3. Always gay and happy With a smile that never fades. Iohn Meese Pageant Editorial Staff, 3A. I like work, it fascinates me. l can sit and look at it for hours. Lawrence Meiers Something of a person's character may be discovered by observing how he smiles. Henry William Meyer Latin Club, 1, Baseball Manager, 3, Senior Hi-Y, 3, 4, Varsity Club, 4, Senior Class Play. University of Alabama Boys like this, there are but few. .....,,c.,.,,,,,c, . . 7 ,....-W.- ....V ,,,,,,,,,.........-. Wm' Mn. Emerson W. Michael Track, 2, 3, 47 Varsity Club, 4. A jolly lad chuck full of lun: He's always nice to every one. Iames A. Michael Iunior Hi-Y, l, Z7 Track, 2, 3, 47 Cosmopolitan Club, Vice-Pres., 3, 47 Sports Club, 47 Bronze scholarship MEdGl1 National Honor Society. Forever present in the ranks of fun. Robert G. lVI.ickow Track, 2, 3, 47 Historians, 47 Naturalists, 4, Sports Club, 4. A good man possesses a kingdom. Gladys H. Mielke Girls' League Rep., l7 G. A. A., 17 lunior Home Economics Club, 27 Commercial Club, 2, 37 Senior Home Economics Club, 37 Historians, 47 O. G. A.7 120-word Transcrip- tion Award7 Bronze Scholarship Meddlf National Honor Society. Grace, charm, perfect poise are hers. Alice La Verene Miller High School, Fort Madison, lowa, 3. Today belongs to me7 Tomorrow, who can tell? Eileen I. Miller Student Council, Z7 O. G. A.7 Girls' League Rep., 3, 47 Commercial Club, 47 Historians, 47 Bronze Scholarship Medal. The great thing is not what we get out of life: lt is what we put into it. Fern Constance Miller Senior Home Economics Club, 3. What gentleness these women have. Robert George Miller Fresh-Soph Football, l, 27 Varsity Baseball, 2, 3, 47 Crusaders, 37 Wrestling, 37 Iunior Varsity Football, 37 Varsity Club, 3, 47 Varsity Football, 4. Bob's an accomplished athletep With bat or ball his joy's complete. Lillie Moench Iunior High School, Salt Lake City, Utah, l7 Neo- Pythagoreans7 French Club, 2, 37 Student Council, 37 Latin Club, 37 Bronze Scholarship Medal7 National Honor Society. University of Utah Wisdom grows in quiet places. Ernest Emil Molzan Few his words, and reserved his mien. Elaine Caroline Moore Iunior Home Economics Club, l, 27 Latin Club, l, 2, 37 Neo-Pythagoreans7 Senior Home Economics Club, 37 Bronze Scholarship Medal. Work is itself a pleasure. Iessie Moore Latin Club, lj O. G. A. A faithful and true friend is inestimable in possession. Emil F. Moreno Commercial Club, 27 Historians, 4. Bradley Polytechnic lnstitute What a spendthrift he is with his tongue. Arthur I. Moritz Spanish Club, l. Armour lnstitute of Technology He is a gentleman, because his nature is kindly affablef' Myra C. Moscicke German Club, l, 27 Commercial Club, l, 2, 3, 47 Sophomore Councilg Senior'Science Club, 37 Camera Club, 3, Sec., 47 Historians, 47 O. G. A.7 l2U-word Transcription Gold Pin. One with such dimples should smile, and smile, and smile. Ioseph D. Much Freshman Dramatic Club: Chess and Checker Club, l, 37 College Club, 37 Pageant Editorial Staff, 3, Business Manager, 47 Parnassus Club, 47 Provi Business Staff, Manager. University of Chicago lndustry is the soul of business and the keynote of prosperity. Vonceal Murphy Crusaders, 3. Howard University The heart that is to be filled to the brim with every joy must be held still. Matthias G. Musser 7 l know what pleasure is, for l have done good Work. Frank L. Narqie Italian Club, 3, 4. A man he seems of cheerful yesterdays and confident tomorrows. Dorothy Elaine Neal Latin Club, l, 27 Camera Club, 2, 4, Vice- Pres., 37 Crusaders, 37 College Club, 37 Chess and Checker Club, 37 Pageant Advertising Staff, 3, Manager, 3A, 4Bf Parnassus Club, 47 Historians, Sec.-Treas., 47 Dial Club, 47 Pageant Editorial Staff, 4A7 Bronze Scholarship Medal7 National Honor Society. Northwestern University Devise, wit7 write, pen7 for lam for whole volumes in folio. Ray Nelsen Iunior Life Saving7 Library Staff, 47 Provi Art Staff7 Bronze Scholarship Medal7 National Honor Society. New Mexico School of Mines He is a good man and true. Ralph L. Newberg Lightweight Football, 4. Parks Air College ln a word, to be a fine gentleman is to be a generous and brave man. Michael William Nicotera Italian Club, l, 2, 3. University of lllinois The just possess friendliness in its highest form. Clarence F. Nieman University of Illinois Adversity is the first path to truth. Lester G. Nordbrock A decent boldness ever meets with friends. Lorraine M. Nott Oak Park High School, Oak Park, lll., l7 French Club, 2, 3, 47 Sophomore Dramatic Club, Girls' League Rep., 2, 37 Cosmopolitan Club, 3, 47 Proviso Players, 3, 47 ln-and-About Chicago Chorus, 3, 47 Parnassus Club, 47 Pageant Editorial Staff, 4B7 Provi Editorial Staff7 National Honor Society. Rosary College Never idle a moment, but thrifty and thoughtful of others. Ieanne Evelyn Nottingham Girls' League Rep., lg Student Coun- cil, 27 ln-and-About Chicago Orchestra, 2, 3, 47 String Quartet7 String Octette, Violin, Div. ll, 37 National Solo Contest, Div. IV, 37 State Solo Contest, Div. ll, Z, Div. l, 3. Chicago Music College There's no such passion in the human soul, But finds its food in music. Charlotte L. Novak Iunior Home Economics Club, 27 Commercial Club, 2. For silence is the speech of love, ' ' The music of the spheres above. Florence I. Novotny O. G. A. A beautiful smile is to the countenance what the sunbeam is to the landscape. Elmer I. Olson ' ln aeronautics one finds new things only by looking for them. Iune Olson G. A. A., 2, 3, Vice-Pres., 4, l600-point Award. Her pleasant way has won our admiration, And her athletic ability has won her laurels. Oscar Olson The greatest truths are the simplest, And so are the greatest men. Viola Kathryn O'Neill Oak Park High School, Oak Park, Ill., 1, 2, 3, 4B. We know little of thee, but that is good. ' Frances Eileen Oostdyk How sweet and fair she seems! Frank I. Orland Student Council, l, Pres., 47 Civics Club, Pres., l, 27 Radio Club, l7 Camera Club, l, 37 Senior Science Club, 2, 3, 47 Neo-Pyihagoreans7 Crusaders, Pres., 37 Library Staff, 3, 472 Senior Hi-Y, 47 Debate Team, 47 Forum, 47 Statesmen, 47 Silver Scholarship Medal: National Honor Society. 7 Out of his mouth cometh knowledge. E. Michael I. Michael R. Mickow G. Mielke A. Miller E. Miller F. Miller G. Miller L. Moench E. Molzun E. Moore I. Moore E. More-no A. Moritz M. Moscicke l. Much V. Murphy M. Musser F. Nurqie D. Necxl R. Nelsen R. Ne-wberg M. Nicotero C. Nieman L. Nordbrock L. Nott I, Nottingham C. Novak F. Novotny E. Olson l. Olson O. Olson V. O'Neill F. Oostdyk F. Orland UV. O'Rourlce M. Ortenzl F. Oimcrshkin G. Overmeyer E. Owen E. Pcrcino O. Pcxe-th R. Pcxeiz W. Poglusch T. Pcloflino '.E.Pc1iernosier A. Paulsen W. Pcrulsen R. Pearson G. Peckcrt E. Pellmcm E. Penrose M. Perez l. Perkins M. Peters W. Peters R. Peterson W. Pe-trowich W. Petterson B. Philpot V. Piepol I. Pinter A. Pocius I. Poliio M. Polzien C. Popp T. Poshkcr I. Powell B. Prcbish W. Prestly .,.,.v Y-.. . .. ..-..,,-,V .- -v..T...,-,,:. ...,..,..,..T. .--......, A. - . . .- .. -Y-1, William Iames O'Rourke Sports Club, l, Freshman Dramatic Club, Sophomore Dramatic Club, Treas., Student Council, 3, Cos- mopolitan'Club, 3, 4, Senior Senate, Statesmen, 4, Iunior Varsity Basketball, 4, Pageant Editorial Staff, 4B, Provi Editorial Staff. University of Michigan Correct with spirit, eloquent with ease, Intent to reason, and polite to please. Marco A. Ortenzi Italian Club, 3, Every one follows the inclinations of his own nature. Iohn Otmashkin Latin Club, 2, Senior Hi-Y, 3, 4. He has lived well who has lived obscurely. Glen M. Overmeyer Student Council, l, 2, Fresh-Soph Football, 2, Iunior Varsity Football, 3, 4, Freshmore Class President. He was known by all, He played football! Edna Davidene Owen Civics Club, Sec., l, Z, Camera Club, l, 2, 3, Sophomore Dramatic Club, Girls' League, 2nd Vice-Pres., 3, Pres., 4, Senior Guard, Historians, 4, Senior Home Economics Club, 4, Suburban Girls' Conference, Vice-Pres., 4, Silver Schol- arship Medal, National Honor Society. Northwestern University The more we do, the more We can do. Emily Pacino Oak Park High School, Oak Park, Ill., I, Z, 3. Sweet is love, Or the remembrance of a generous deed. Orville W. Paeth Spanish Club, 3, 4. Every man is the architect of his own fortune. Robert E. Paetz Philatelic Exchange, I, Civics Club, l. Fit words attended on his weighty sense, And mild manners flowed in eloquence. William Franklin Paglusch Senior Hi-Y, 3, 4, Swimming Man- ager, 4, Naturalists, Treas., 4. All who would win joy, must share it, happiness was born a twin. Thomas I. Paladino Italian Club, 2, 3, Lightweight Football, 2. Our deeds determine us, as much as we determine our deeds. Evangeline Dolores Paternoster Italian Club, l, 2, 3. A spirit sliding through tranquillity. Anna Marie Paulsen Iunior Home Economics Club, l, 2, Senior Home Economics Club, 3, 4, Commercial Club, 4, O. G. A., 120- word Transcription Award, Hockey Award, Bronze Scholarship Medal, National Honor Society. The real essence of work is concentrated energy. Walter Paulsen Spanish Club, 4. Courtesy is a science of the highest importance. Rosemary Pearson Latin Club, l, Iunior Home Economics Club, l, 2, Commercial Club, 2, 3, 4, Senior Home Economics Club, 3, 4, O. G. A. True merit, like a river, the deeper it is, the less noise it makes. Gertrude Dorothea Peckat Iunior Home Economics Club, l, 2, Dial Club, 4, Hockey Award, 4. In faith, lady, you have a merry heart. Edgar N. Pellman High School, Cincinnati, Ohio, l, Latin Club, 2, Neo-Pythagoreans, Western State Normal, Kalamazoo, Mich., 3, High School, Detroit, Mich., 3, Historians, 4. The victory of success is half won when one gains the habit of work. Evelyn I. Penrose Trinity High School, River Forest, Ill., l, Sienna High School, Chicago, Ill., 2, 3, Camera Club, 4. Nine times in ten the heart governs the understanding. Margarita Perez High School, San Diego, Cal., I, 2, 3, Spanish Club, 4, University of Southern California She who sows courtesy reaps friendship, and she who plants kindness gathers love. Iune Ann Perkins Freshman Dramatic Club, Civics Club, 1, Vice- Pres., 2, G. A. A., l, 2, Iunior Home Economics Club, 2, French Club, 3, 4, Student Council, 3, 4, Historians, 4, Hockey Award, 4, Senior Class Play. De Lee School of Beauty Culture Nothing great was ever accomplished without enthusiasm. Muriel D. Peters Latin Club, I, 2, 3, G. A. A., I, 2, Iunior Life Saving, Civics Club, 2, 3, 4, Vice-Pres., 1, College Club, 3, Dial Club, 4, Northwestern University High flights and wit she had at will, And so her tongue was never still. William Peters Fenwick High School, Oak Park, lll., I, English Cabinet Play, 3, Spanish Club, 3, 4, Proviso Players, 4. The sum of behavior is to retain a man's own dignity, without intruding upon the liberty of others. Ruth Peterson Latin Club, l, Camera Club, 2, 3, Student Council, 3A, Library Staff, 3A, 4, Commercial Club, 4, Historians, 4, Naturalists, Sec., 4, O. G. A., Bronze Scholarship Medal, National Honor Society. As deep and as true as the skies above. Wallace R. Petrowich Let independence be our boast. William Petterson No sinner, nor a saint, perhaps, But just the very best of chaps. Betty Muriel Philpot G. A. A., I, 2, 3, 4, 1200-point Award, Com- mercial Club, l, Vice-Pres., 2, 3, 4, Iunior Life Saving, Senior Life Saving, Provi Art Staff, National Honor Society. The true work of art is but the shadow of divine perfection. Victor Frank Piepol Bronze Scholarship Medal. His smile is sweetened by his gravity. Irene Pinta Freshman Dramatic Club. For the good are always merry. Adolph Pocius Men of few words are the best. Ioseph Polito Italian Club, l, Z, 4, Civics Club, 2, Historians, 4. University of Notre Dame A gentleman who makes no noise. Margaret Mae Polzien High School, Aurora, Ill., l, French Club, 3, Hockey Award, 4, Historians, 4. Industry has annexed thereto the fairest fruits and the richest rewards. Charlotte T. Popp Iunior Home Economics Club, l, 2, Neo-Pythag- oreans, Girls' League Rep., 3, O. G. A., 120-word Transcription Award, Senior Home Economics Club, 4, Provi Clerical Staff, Gold Scholarship Medal, National Honor Society. Virtue and genuine graces in themselves speak what no words can utter. Tony Iarnes Poshka Sports Club, 1, Iunior Hi-Y, l, 2, Dial Club, 4, Senior Science Club, 4. Every industrious man is a useful one. lack Powell Silence is an art in itself. Ben Anthony Prabish Fresh-Soph Basketball, I, Z, Iunior Varsity Basketball, 3. Parks Air College The fun in this world is what we can least spare. William A. Prestly Deny him merit, if you can. Elizabeth C. Probasco High School, San lose, lll., lB7 District Xylophone Contest, l, 27 Historians, 47 Dial Club, 47 In-and-About Chicago Chorus, 4. A faithful and true friend is a living treasure. Marion B. Ptolemy In-and-About Chicago Chorus, 3, 47 O. G. A.7 Commercial Club, 47 Senior Home Economics Club, 47 Pageant Editorial Staff, 4A7 Bronze Scholarship Medal7 National Honor Society. Bryant and Stratton Business College An' fair was her sweet bodie, Yet fairer was her mind. Edward I. Puetz Senior Life Saving. The heart of man is of itself but little, Yet great things can fill it. Lora Puscheck German Club, 17 Iunior Home Economics Club, Treas., 27 Crusaders, 37 Senior Home Economics Club, 3, 47 Pageant Staff, Assistant Editor, 3A, Editor-in-Chief, 4B, Reportorial Editor, 4A7 Gold Scholarship Medal7 National Honor Society. Purity of mind and conduct is the first glory of a woman. Herbert Quandt High School, Marengo, lll., l, 2, 3. What will be will be well, for what is is well. Ethel Irene Quehl Sweet and self-contained. Marie Quinn Latin Club, l, 2. 'Tis only happiness can keep us young. Myrtle A. Quitsch Commercial Club, l, 2, 3, Pres., 47 G. A. A., 1, 2, 3, 4, 600-point Award7 Iunior Life Saving7 Senior Life Saving. The sweetest garland to the sweetest maid. Loretta Marie Raab Providence Academy, Chicago, Ill., 17 Iunior Life Saving7 Senior Life Saving7 College Club, 37 Senior Science Club, 37 Dancers Club, 37 Senior Senalef Senior Guard7 Historians, 47 Girls' League Chairman of Art Committee, 47 ln-and-About Chicago Chorus, 47 G. A. A., 4, 600-point Award7 O. G. A.7 Class Secretary, 4. Valparaiso University Always hC1PPY, never sad7 Full of pep, and never bad. Francis Raggio Iunior Varsity Football, 3. Constant quiet fills my peaceful breast with unmixed joy. Genevieve Ramonas Latin Club, 17 Senior Home Economics Club, 47 Commercial Club, 47 O. G. A.7 120-word Transcription Award7 Bronze Scholarship Medal. 'Tis good to be merry and wise. Robert C. Rankin Latin Club, 27 Senior Hi-Y, 4. University of Illinois A faithful friend is the medicine of life. Sydney Rapaport Student Council, 37 Crusaders, 37 Senior Sen- Ole: Commercial Club, Treas., 4. Close the door and take chairs, folks: I must tell you some rare new jokes. Milton Ratner Von Steuben Iunior High School, Chicago, Ill., 17 Roosevelt High School, Chicago, Ill., 27 Chess and Checker Club, Pres., 37 Senior Science Club, 3, 47 College Club, 3, 47 Historians, 47 Statesmen, 47 Pageant Editorial Staff, Assistant Editor, 4B: Provi Editorial Staff, Associate Editor7 Bronze Scholarship Medal7 Na- tional Honor Society. University of Chicago A nature modeled on a higher plan, Lord of himself, an inborn gentleman. Eleanore M. Rauhut Luther Institute, Chicago, Ill., 17 Carl Schurz High School, Chicago, Ill., 27 National Honor Society. So charming to every one, pleasant and true. Georgine Arline Reay Iunior Home Economics Club, 17 Latin Club, l, 27 G. A. A., l, 3, Dance Manager, 2, 4, 1600-point Award7 Dancers Club, l, 2, 3, 47 Iunior Life Saving7 P. E. O. Award, 17 Sophomore Dramatic Club, Vice-Pres.7 Student Council, 27 Com- mercial Club, 2, 37 Senior Home Economics Club, 37 Proviso Players, 3, 47 Senior Guard7 Senior Senate7 Senior Class Play7 Class Vice-President, 47 National Honor Society, 37 Gold Scholar- ship Medal. Who possesses the world's rarest gifts, including the greatest of all-the power to use them. Audrey Regan She deserves praise who does not what she may, but what she ought. Veronica Reich G. A. A., l, 2, 3, 4, 1200-point Award7 Dancers Club, 2, 3, 47 Sophomore Dramatic Club, SGC.: Proviso Players, 3, Vice-Pres., 47 Senior Home Economics Club, 3, 47 Girls' League Rep., 47 Senior Guard7 Senior Class Play, Bookholder7 Pageant Editorial Staff, 4B7 Bronze Scholarship Medal7 National Honor Society. University of Wisconsin Her gentle speech, and modest ways, Let others to accord her praise. Lester Vernon S. Richardson No victory without labor. Edward O. Richter Latin Club, l, 27 Philatelic Exchange, 2, 47 Camera Club, 3, 47 Senior Science Club, 3, 4. You know l say just what l mean, and nothing more or less. Myrtle F. Rick German Club, 4. Gentle of heart and manners mild. Marie Rigden Providence Academy, Chicago, Ill., 1, 27 Cosmo- politan Club, 3, 47 Historians, 47 Dial Club, 4. She doeth little kindnesses that most of us leave undone. Florence Rittmueller German Club, 17 Student Council, 17 G. A. A., l, 2, 3, 4, 1200-point Award7 Girls' League Rep., 27 Sopho- more Dramatic Club7 Iunior Home Economics Club, 27 Senior Home Economics Club, 3, 47 Inter-Church Girls' Conference, Alter- nate, 3, Sec., 47 Dancers Club, 37 Proviso Players, 47 Senior Guard7 Girls' League Chairman of Publicity Committee, 47 Pageant Editorial Staff, Assistant Editor, 47 O. G. A.7 National Honor Society, 37 Gold Scholarship Medal. 'Twas just her brilliance shining through That gave her hair so bright a hue. Catherine Mae Robb Freshman Dramatic Club7 Girls' League Rep., 17 G. A. A., l7 Dancers Club: Sophomore Dramatic Club7 Neo-Pythagoreans7 Operetta, 27 ln-and-About Chicago Chorus, 37 Proviso Players, 3, 47 Spanish Club, 3, 47 Senior GUQYGJ Inter- Church Girls' Conference, Key Girl, 47 Silver Scholarship Medal7 National Honor Society. University of Illinois She has a natural sincerity, a simple truthfulness7 And these have lent her dignity. Iohn Roberts Happy am 17 from care I am free. Kenneth Rockefeller Latin Club, l, 2, 3, 47 English Cabinet, 2, 3, 47 Library Staff, 2, 3, 47 Radio Club, Sec.-Treas., 37 Proviso Players, 47 Debate Team, 47 Senior Class Play7 Student Manager of Athletics7 Bronze Scholarship Medal7 Eta Sigma Phi Medal7 National Honor Society. The man of sense, of grace, of accomplishmente- the man of culture. Ianet Rodger G. A. A., 1, 2, Dance Manager, 3, Pres., 4, 1200- point Award7 Sophomore Dramatic Club: Dancers Club, '2, 3, 47 Operetta, 27 Commercial Club, 37 Chorus, Sec., 37 Senior Life Saving7 Senior Guard7 In-and-About Chicago Chorus, 47 Senior Class Play7 National Honor Society. She's little but she's Wise: She's a wonder for her size. Ruth C. Rose Foreman Iunior High School, Chicago, Ill., 17 French Club, 2, 37 O. G. A. De Lee School of Beauty Culture She was made for happy thoughts, For playful wit and laughter. Mary Sarniak Deerfield-Shields High School, Highland Park, Ill., l, 2, 37 Senior Life Saving. West Suburban Hospital Her pleasant ways have won our admiration. Ruth Louise Schaper Iunior Home Economics Club, l, 27 Senior Home Economics Club, 47 Commercial Club, 47 O. G. A. A companion who is cheerful is worth while. Henry Scherer 7 Whenever 1 have anything to say, I say it. Elvira Schmidt German Club, 3, 47 Historians, 4. Honor, faith, and a sure intent. Richard Schmidt Everybody likes and respects self-made men. Ice Schmitz French Club, 3, 47 Historians, Vice-Pres., 47 Saxo- phone Section Leader, 4. His talents were of the more silent class. Francis W. Schneider Freshman Dramatic Club. When in doubt l can always smile. E. Probasco M. Ptolemy E. Pueiz L. Puscheck H. Quandi E. Quehl M. Quinn M. Quitsch L. Rach F. Rcxgqio G. Ranionos R. Rankin S. Rczpoport M. Ratner E. Rauliut G. Reay A. Regan V. Reich L. Richardson E. Richter M. Rick M. Riqden F. Riiiinueller C. Robb l- Roberis K. Rockefeller I. Rodger R. Rose M. Scxrnicik R. Schcper H. Scherer E. Schmidt R. Sci iiii idi I. Schmitz F. Sclincider -M' ' ' -mmnlu Afaiiludia' D. Schneider A. Schreiber E. Schroeder R. Schuetz W. Schuler R. Schultz W. Schultz B. Schulz A. Schulze C. Schuster F. Schuster W. Schwcxss O. Scodius H. Sedbrooke R. Sedgwick E. Seeley O. Senger F. Senour L. Seren H. Shihley H. Shilkditis H. Silisky E. Sipchen R. Sjoberq K. Skillin E. Smeeion H. Smith W. Soclerberq G. Spurrer H. Spillmcm A. Spolin I. Sponsler G. Spurr K. Sldfford F. Stahl Dorothy Schneider Freshman Dramatic Club, German Club, 1, 2, 3, 4, G. A. A., l, 2, 3, 4, 600-point Award, Sophomore Dramatic Club, O. G. A., Proviso Players, 3, 4, Silver Scholarship Medal, National Honor Society. A smile for all, a Welcome glad, A winsome coaxing way she had. Ann F. Schreiber Freshman Dramatic Club, German Club, 1, lunior Home Economics Club, l, 2, O. G. A., Commercial Club, 3, 4, Silver Scholarship Medal, National Honor Society. lf quality be what you desire, here it is. Erna Schroeder Freshman Dramatic Club, G. A. A., 1, 2, 3, 4, 1200-point Award, Sophomore Dramatic Club, Girls' League Rep., 2, Neo-Pythagoreans, Sec., Dancers Club, 2, 3, 4, Proviso Players, 3, 4, In-and-About Chicago Chorus, 3, Senior Senate, Senior Guard, English Cabinet, Vice-Pres., 4, Senior Class Play, Na- tional Honor Society, 3, Gold Scholarship Medal. Well she acted all and every part. Robert G. Schuetz Iunior Hi-Y, 1, 2, Latin Club, l, 2. The quiet minds are most content. Wanda Gladys Schuler Latin Club, 1, O. G. A. Silver Cross School of Nursing Wise and virtuous and good is she. Roy Charles Schultz Freshman Dramatic Club, Civics Club, 1, ln-and-About Chicago Chorus, 4. 'Twas natural to please. Winilred M. Schultz Girls' League Rep., 3, Senior Home Eco- nomics Club, 4, O. G. A. , To be merry best becomes her. XBernadine Anna Schulz Latin Club, 1, G. A. A., l, 2, 3, 4, 600- Q, Xpoint Award, Chorus, Sec., l, 2, Sophomore Dramatic Club, Com- mercial Club, 3, Sec., 4, ln-and-About Chicago Chorus, 3, 4, Choir, Sec., 3, 4, Dial Club, 4, Pageant Editorial Staff, 4, 120- word Transcription Award, Bronze scholarship Medal. Northem Illinois State Normal College ' A girl with a happy smile, Who Works diligently all the while. Alma Schulze High School, Antigo, Wis., 1, 2, G. A. A., 3, 4, Proviso Players, 3, 4, Girls' League Rep., 3, ln-and-About Chicago Chorus, 3, Senior Class Play, Commercial Club, 4, Senior Guard, Sec., 4B, Girls' League Chairman of Social Committee, National Honor Society. Evangelical School of Nursing No gems, no gold she needs to wear, She shines intrinsically fair. Charles A. Schuster. Ir. Latin Club, -l, 2, Operetta, 2, In-and- About Chicago Chorus, 2, 3, 4, Crusaders, 3, 4, Dial Club, 4, Student Council, 4, Historians, 4, Choir, Pres., 4, Provi Business Staff. Lake Forest College My song is my fortune. Florence Schuster Freshman Dramatic Club, lunior Home Eco- nomics Club, l, 2, Senior Home Economics Club, 3, 4, German Club, 3, Treas., 4, Bronze Scholarship Medal. The mildest manners and the gentlest heart. Walter F. Schwass A fig for a care, a fig for a woe. Olga Ann Scodius O. G. A. Good nature without disguise. Helen Seabrooke High School, Toledo, Ohio, 1, 2B, High School, Point Place, Ohio, ZA, 3. Softness of smile indicates gentleness of character. Roger Stanley Sedgwick Latin Club, 1, Freshman Dramatic Club, Sophomore Dramatic Club, Camera Club, 3, 4, Proviso Players, 3, 4, English Cabinet Play, 3, English Cabinet, 4, Senior Class Play, Provi Art Staff, Gold Scholarship Medal, National Honor Society. Deeds are better than words. Eva I. Seeley German Club, 2, 3, Historians, 4, O. G. A. To do good rather than to be conspicuous. Orville Senger Latin Club, l, 2, Neo-Pythagoreans, Crusaders, 3, Senior Science Club, 3. Wise is he who knows himself. Florence lane Senour Latin Club, l, Senior Science Club, 3, lunior Council, French Club, 3, 4, Senior Senate, Senior Guard, Girls' League Chairman of Finance Committee, 4. Purdue University Kindness is the golden charm by which society is bound together. Leo Seren Radio Club, l, 2, 3, lunior Hi-Y, l, Treas., 2, Latin Club, 1, Aedile, 2, Senior Science Club, 2, 4, Pres., 3, Forum, 4, Debate Team, 4, Gold Scholarship Medal, National Honor S0Cl9lY. University of Chicago The study of science teaches young men to think, while study of the classics teaches them to express thought. Rena Mae Shibley ln-and-About Chicago Chorus, 2, 3, 4, O. G. A., Senior Home Economics Club, 4. Greenville College With temper calm and mild and words of soften'd tone. Harriet Lillian Shilkaitis Marimba and Bell Soloist, 2, 3, 4, Ac- companist, 2, 3, State Contest, 2, 3, Band Captain, 3, Drum Major. l am ever merry when l hear sweet music. Helen Virginia Silisky Commercial Club, 3, Senior Home Eco- nomics Club, 3, Historians, 4, Chess and Checker Club, 4, Dial Club, 4: O. G. A. That which befits us is cheerfulness and courage. Elaine M. Sipchen Civics Club, l, 2, 3, Historians, 4, Senior Class P1GY. St. Bernard College And frame your mind to mirth and merriment, which Q bars a thousand harms and lengthens life. Raymond Sioberg Commercial Club, 1, Sophomore Dramatic Club, Cheerleader, 4. And still his tongue ran on. Kenneth Leonard Skillin York High School, Elmhurst, Ill., 1, 2, 3, College Club, 4, Provi Business Staff. Oratory is his favorite pastime. Edith M. Smeeton Senior Home Economics Club, 3, Commercial Club, 3, O. G. A., Bronze Scholarship Medal. A face with gladness overspread, Soft smiles by human kindness bred. Helene Smith Spanish Club, 3, Commercial Club, 4, O. G. A., Pageant Editorial Staff, 4A, Bronze Scholarship Medal. The world delights in sunny people. William Soderberg French Club, 3, Treas., 4, District and State Band Contest, 3, Clarinet Ouartette, 4. He is a boy quite bright and gay And has a horn that he can play. Grace Mary Sparrer Providence Academy, Chicago, lll., 1, O. G. A. Begone, dull Care, thou andl shall never agree. Helen Ruth Spillrnan German Club, l. Charms strike the sight, and merit Wins the soul. Aaron H. Spolin Student Council, 1, 3, Latin Club, 1, Aedile, 2, Iunior Hi-Y, l, Sec., 2, Chess and Checker Club, l, Treas., 3, Library Staff, 2, 3, 4, Neo-Pythagoreans, College Club, 3, 4, Senior Science Club, 3, Pageant Editorial Staff, 3A, 4B, Historians, 4, Forum, 4, Provi Editorial Staff, Senior Class Play, National Honor Society, 3, Gold Scholarship Medal. University of Chicago What's a cubit or two, after all? Napoleon himself was not so tall. lane Sponsler Latin Club, l, 2, Aedile, 3, Neo-Pythagoreans, Student Council, 2, Senior Home Economics Club, 3, 4, Girls' League Rep., 3A, Senior Guard, Girls' League, First Vice-Pres., 4, Historians, 4, Provi Editorial Staff, Bronze Scholarship Medal, National Honor Society. West Suburban Hospital Lancelot would ne'er have left Elaine Had she been sweet and fair as lane. Gladys M. Spurr O. G. A. Moody Bible Institute Virtue alone outbuilds the pyramids. Keith M. Stattord lf fame is only to come after death, 1 am in no hurry for it. Frieda C. Stahl German Club, l, 2, 3, Senior Home Economics Club, 3, 4, O. G. A. And of all her wondrous gifts, Perhaps the best is happiness. ,Xt 14 -4 1 t- to ff- J x aj. J JI! T t , V x Rosemary Nancy Stahlberg Immaculata High School, Chicago, Ill., 1, 2, 3. Loyola University Good taste is the flower of good sense. Max Stein Track, 1, 2, 3, 47 Cross Country, 1, 2, 3, Captain, 47 Student Council, l, 47 Senior Hi-Y, 3, Sec., 47 Wrestling, 3, 47 Varsity Club, 47 Bronze Scholarship Medal7 National Honor Society. A pleasant lad, a friend worth while, A winner too, who runs the mile. Iean E. Stevens Latin Club, 1, 27 Art Club, 1, 27 Sophomore Dramatic Club7 Proviso Players, 47 Historians, 47 Parnassus Club, 47 Provi Editorial Staff7 Bronze Scholarship Medal7 National Honor Society. Northwestern University Surely genius' child is she, Writing prose and poetry. Frances R. Stokes I. Sterling Morton High School, Cicero, Ill., 1, 27 Crusaders, 37 French Club, 47 Dial Club, 4. Lewis Institute Cheerfulness and content are great beautifiers and are famous preservers of youth. Charlotte A. Strong Latin Club, l, 27 Iunior Home Economics Club, 1, 27 Senior Home Economics Club, 3, 47 Bronze Scholarship Medal. Like her name in character. Grace Stroschein Civics Club, 1, 27 G. A. A., l, 2, 3, 4, 1200- point AWG1'dj Iunior Life Saving7 Commercial Club, 2, 3B, 47 High School, Fort Atkinson, Wis., SA. The happy gift of being agreeable seems to consist of communicating delight. lean Stubbins Latin Club, Aedile, 27 Camera Club, 2, Treas., 37 Spanish Club, 3, 47 Pageant-Business Staff, 37 Girls' League Rep., 37 In-and-About Chicago Chorus, 3, 47 Pageant Editorial Staff, 4Bj Girls' League, Treas., 47 Senior Guard7 Choir, Treas., 47 Historians, 47 Dial Club, 47 Bronze Scholarship Medal: National Honor Society. She has a head to contrive, a tongue to persuade, and a hand to execute. Ruth Stutt G. A. A., 1, 2, 3, 4, 600-point Award7 Camera Club, 2, Sec., 37 Iunior Home Economics Club, 27 Girls' League Rep., 2, 37 Commercial Club, 3, 47 Senior Home Economics Club, 3, 47 O. G. A.7 Senior Guard7 Girls' League, Sec., 47 Senior Class Play7 Bronze Scholarship Medal7 National Honor Society. Ruth's heart is happy, gay, and kind, A truer friend would be hard to find. Eileen M. Sullivan Spanish Club, 37 Historians, 4. No padlock, bolts, or bars can secure a maiden so well as her own reserve. Betty Dolores Supei Senior Home Economics Club, 47 Historians, 47 Dial Club, 4. A little time for laughter, A little time to sing. Beverly Rae Swinehamer Student Council, l7 Latin Club, 1, 2, 4, Treas., 37 Iunior Home Economics Club, 27 Girls' League Rep., 3, 47 French Club, 47 Silver Scholarship Medal7 National Honor Society. Northern Illinois State Normal College Her fingers shame the very keys they dance so light upon. Harold William Szerbinski Conversation enriches the understanding, but solitude is the school of genius. Daniel L. Taibleson Latin Club, l, 27 Camera Club, 1, 2, 37 Freshman Dramatic Club7 Woodwind Quintet, National Orchestra Contest, 37 In-and-About Chicago Orchestra7 Woodwind Quintet, Oboe, 47 Dial Club, 4. University of Illinois Why was music ordained? To refresh the mind of man, after his studies. Maxine O. Tanner Latin Club, 17 G. A. A., 1, 2, 3, 47 Dancers Club, 3, 47 French Club, 4. University of Chicago Those move easiest who have learned to dance. Iacob B. Teclrtiel Freshman Dramatic Club: Philatelic Exchange, 17 Iunior Hi-Y, 17 Cheerleader, 2, 37 Proviso Players, 37 College Club, 3, 47 German Club, 37 Cosmopolitan Club, 3, 47 Library Staff, 47 Senior Class Play. Chicago-Kent College of Law Who so loveth instructions loveth knowledge. Gilbert H. Thiesse They can conquer who believe they can. Mildred L. Thiesse G. A. A., l, 2, 3, 4, SOO-point Award7 Iunior Home Economics Club, 27 Girls' League Rep., 27 Senior Home Economics Club, 3, 47 Commercial Club, 3, 47 O. G. A. As the flower is before the fruit, so is faith before good work. Martha Aileen Thomas Iunior High School, Rockford, lll., lj Latin Club, 2, 37 Aedile, 47 Sophomore Dramatic Club7 Historians, 4. Illinois Business College There is a vein of mirth beneath her air of dignity. William Thompson Freshman Dramatic Club7 Sophomore Dra- matic Club7 Senior Science Club, 2, 3, 47 Student Council, 37 Senior Hi-Y, 47 Senior Senate7 Bronze Scholarship Medal. Nothing is useless to a man of sense7 he turns everything to account. Iohn W. Tielenthal Fresh-Soph Baseball, lj Fresh-Soph Basket- ball, 17 Varsity Baseball, 2, 3, 47 Lightweight Basketball, 27 Senior Hi-Y, 3, 47 Varsity Club, 3, Pres., 47 Lightweight Football, 37 Varsity Basketball, 3, 4. University of Alabama Action is eloquence. Eugene Ivan Timmons Library Staff, 3, 4j Pageant Editorial Staff, 3A, 4A. True as the needle to the pole, or as the dial to the sun. Fienia May Timoshik Girls' League Rep., 17 Spanish Club, 27 Bronze Scholarship Medal. De Lee School of Beauty Culture Quiet, thoughtful, and sedate, To all of us a good school-mate. Helen Louise Todd German Club, 17 Pageant Advertising Staff, 2j Senior Home Economics Club, 3, 4. Vogue School Let mildness ever attend the tongue. Mary Eleanor Toner Providence Academy, Chicago, Ill., 17 Senior Home Economics Club, 4. Northwestern University The force of her own merit makes her way. Virginia Eleanor Treabess Commercial Club, 47 Historians, 47 Senior Home Economics Club, 4. Make the most of life you may- Life is short and wears away. Lois Frances Treybal German Club, l, 2, 3, 47 G. A. A., 3, 47 Senior Home Economics Club, 47 O. G. A.7 Historians, 4. Hail, social life! Into thy pleasing bounds I come with my share of service to taste thy comfort. Elvena Marie Ulrich Latin Club, lj Freshman Dramatic Club7 G. A. A., l, 2, 3, Treas., 4, 2000-point Award7 Iunior Life Saving7 Sophomore Dramatic Club7 Spanish Club, 27 Neo-Pythagoreans7 Dancers Club, 2, 3, 47 Qperetta, 27 Girls' League Rep., 3B7 Camera Club, 47 Historians, 47 College Club, 47 Student Council, 47 Senior Life Saving7 Gold Scholarship Medal7 National Honor S0CielY. University of Chicago She sits high in all the people's hearts. Peter Paul Umbras 1t's not for me to be overly meek, If there's something to say, I must speak! Frank C.Urbaytis Radio Club, 3, Sec., 47 Senior Science Club, 47 Historians, 4. ' Science leaves us hope for the future. Adolph Urbelis Fresh-Soph Football, 1, 27 Fresh-Soph Basket- ball, 27 Varsity Baseball, 2, 3, 47 Iunior Varsity Basketball, 37 Iunior Varsity Football, 37 Varsity Football, 47 Varsity Club, 47 Varsity Basketball, 4. , His limbs were cast in manly mould, For hardy sports or contest bold. Russell Vahldick Neo-Pythagoreans7 Track, 3, 47 Senior I-li-Y, 47 VGISUY Club. 4- University of Illinois Fleet of foot and alert in mind: It's very hard to match his kind. Ray C. Vandenbroucke In this world there's too much worry7 What's the use of fuss and flurry! Maxine Vanderhole Senior Home Economics Club, 47 O. G. A. Humor is one of the elements of genius-admirable as an adjunct. Herrick Van Gunten Operetta, 27 In-and-About Chicago Chorus, 2, 3, 47 Student Council, 37 Senior Hi-Y, 47 Statesmen, 4. De Pauw University Wilt thou have music? Hark! Apollo plays and twenty caged nightingales do sing. Lillian Audrey Vegter Historians, 47 Q. G. A. Qpportunity, sooner or later, comes to all who Work and wish. 'Ends -- 'nihnhila-'M' - ' R. Stcxhlherq M. Stein l. Stevens F. Stokes C. Strong G. Stroschein I. Stubbins R, Stull E. Sullivan B. Supej B. Swinehomer H. Szerhinski D. Tcribleson M. Tcrnnor l. Teclctlel G. Thie-sse M. Thiesse M. Thomas W. Thompson l. Tiefe-nthol E. Timmons F. Timoshik H. Todd E. Toner V. Treobess L. Trcybol E. Ulrich P. Umbros F. Urboytis A. Urbelis R. Vczhldiclc R. Vondenlorouclce- M. Vande-rhofe H. Von Gunten L. Veqtor R. Vertuuo A. Vidluxid E. Vodiclcu C. Vovelc P. Vtfctqrier n.VVui1ic1uslccS I.Wc1itlcevitz E. Walker L. XlVGllCIC6 G. Walters E. Warren E. Waschitz G.Wc1si1evich M. Weber L. Weinberg G. We-islcopf G. Wells G. Weltlei E. 'Wentlcmd D. Wertz D. We-sseii R. We-ssliriq A. Westerlioft A. Wezerelc W. Whcrrton R. Wiclc L. Wiedcler W. Wilcox A. Willicxms I. Williams G. Vtfilsou P. Winters E. Witt E. Witzke E. Wolff Russell H. Vertuno Fresh-Soph Baseball, Manager, 27 Spanish Club, 47 Senior Hi-Y, 4. Personality is before anything else. Arthur Noble Vidlund German Club, 37 In-and-About Chicago Orchestra, 3, 47 Senior Hi-Y, 47 Senior Life Saving. A poor life this, if, full of care, We have no time to stand and stare. Edwin Anthony Vodicka ln-and-About Chicago Chorus, 2, 3, 47 Operetta, 27 French Club, 3, 47 Choir, Business Manager7 His- torians, Pres., 4. University of Illinois lt pays to be conscientious. Carl Anthony Vovola Italian Club, 1, 2, 37 Lightweight Foot- ball, 4. A youth light-hearted and content. Pauline Wagner German Club, l, 27 Historians, 47 Commercial Club, 47 Pageant Business Staff, 47 O. G. A.7 Silver Scholarship Medal. And her voice was the warble of a bird, So soft, so sweet, so delicately clear. Anthony I. Wainauskas Italian Club, 1, 2, 3. Most powerful is he who has himself in his own power. Iohn G. Waitkevitz What's in my heart no one knows. Edward L. Walker Education begins the gentleman7 but reading, good company, and reflection must finish him. Leslie Wallace Fresh-Soph Baseball, 17 Varsity Baseball, 2, 3, 47 Varsity Club, 3, 4. I must be careful that no manner of harm Happens to this, my pitching arm. Grace Constance Walters German Club, 2, 37 Iunior Home Economics Club, 27 Operetta, 27 In-and-About Chicago Chorus, 3, 47 Senior Home Economics Club, 3, 4. West Suburban Hospital Quiet is she, so was our lady wrought, To tell of calm and sympathetic thought. Eugene E. Warren lt pays to be quiet7 true depth is gained by it. Elizabeth A. Waschitz Commercial Club, 47 Senior Home Eco- nomics Club, 47 Historians, 47 O. G. A.7 Hockey Award, 4. ' Write me down a student. Gustaph Wasilevich Latin Club, l, 27 Commercial Club, 4. To become his friend is the easiest thing: to remain so is a pleasure. Muriel Corinne Weber Latin Club, l, 27 Student Council, l, 27 Iunior Home Economics Club, 27 Sophomore Council7 Iunior Council7 Senior Home Economics Club, 3, Pres., 47 Senior Guardp Girls' League Chairman of Service Committee, 47 Historians, 47 Freshman Class Secretary7 National Honor Society, 37 Silver Scholarship Medal. Purdue University A good heart, benevolent feelings, and a balanced mind lie at the foundation of character. Lester Leo Weinberg Austin High School, Chicago, Ill., 17 Forum, 2, 47 Chess and Checker Club, 2, 3, Vice-Pres., SAI Senior Sci- ence Club, 3, 47 College Club, 3, 47 Statesmen, 47 Library Staff, 4. University of Chicago His own opinion was his law. Gordon W.Weiskopl Student Council, 1, 37 Cosmopolitan Club, 3. De Paul University I may do something sensational yet. Glenn Arthur Wells In-and-About Chicago Chorus, 37 Choir, Li- brarian, 4. Repose and cheerfulness are the badge of a gentleman. Gertrude Ann Weltler Senior Home Economics Club, 3, 47 O. G. A.7 Commercial Club, 47 National Honor Society. Her ways are ways of pleasantness, And all her paths are peace. Elizabeth Dorothea Wentland G. A. A., 17 Historians, 4. No mind is thoroughly well organized that is deficient in a sense of humor. Dorothy Bross Wertz German Club, 3. University of Chicago Friends has she many, enemies none. Dorothy Maria Wessen Commercial Club, 37 Historians, 4. Chicago Art Institute She portrays loveliness in more ways than by her brush. Robert I. Wessling Camera Club, 1, 2, 37 Italian Club, 1, 27 Chess and Checker Club, 27 Operetta, 27 In-and-About Chicago Chorus, 2, 3, 47 Senior Hi-Y, 4. Northwestern University All musical people seem to be happy. Anne Marie Westerbolf Senior Home Economics Club, 37 Com- mercial Club, 47 O. G. A.7 Bronze Scholarship Medal. What mischief hides within her eyes7 What fresh, new pranks will she devise? Antoinette Wezerel: Commercial Club, l, 27 German Club, 3. Sincerity is to speak as we think. Wilhelmina Marie Wharton High School, Oklahoma City, Okla., l, 27 Oak Park High School, Oak Park, Ill., 37 Latin Club, 47 Cosmopolitan Club, Sec., 47 Senior Class Play. 'Tis better to be brief than tedious7 short but sweet. Robert L. Wick A youth light-hearted and content. Louis N. Wiedder No man can climb beyond the limitations of his own character. Walter K. Wilcox Spanish Club, 2, 4, Pres., 37 Cosmopolitan Club, 37 Student Council, 3, 47 Senior Hi-Y, 4. Northwestern University Music do I hear? Ha! Ha! Keep time. Alberta Mary Williams Latin Club, 17 Senior Home Economics Club, 37 Historians, 4. Tranquil pleasures last the longest. O. Iane Williams O. G. A.7 Senior Home Economics Club, 4. To have a friend is to be one. Grethel Faustine Wilson Spanish Club, 47 Historians, 47 Dial Club, 4. Western Illinois State Teachers' College Iolly, and a friend to all. Pauline Winters Senior Home Economics Club, 3, 4. They are only truly great who are truly good. Ernest E. Witt Latin Club, l, 27 Iunior Hi-Y, 1, 27 Sophomore Council7 Iunior Council7 College Club, 37 Senior Hi-Y, 3, Treas., 47 Senior Senate7 Dial Club, 4. A man who lives up to his name. Elsie Eleanor Witzke German Club, l, 2, 3, Sec., 47 Senior Home Economics Club, 3, 47 O. G. A.7 Bronze Scholarship Medal. Silence sweeter is than speech. Edward I. Woltf St. Mels High School, Chicago, Ill., l, 27 Swim- ming, 3, 4. Worry doesn't burden him7 His heart is free from care. Delbert D. Woode And thus he bore without abuse The grand old name of gentleman. Robert R. Woolever Thou hast the gift of rest. lane Lou Wright Latin Club, I, 2, G. A. A., l, 2, 3, Sec., 4, GOO-point Award, Dancers Club, 4, Senior Guard. University of Wisconsin Always ready with a cheery smile and a helping hand. Anne Marie Yench Senior Home Economics Club, 3, 4. So brimful of this merry, vigorous life. Grace Frances Yonczis Latin Club, l, 2, 3, 4, Bronze Scholarship Medal. Northern Illinois State Normal College The most delicate, the most sensible of all pleasures, consists in promoting the pleasure of others. William Young Though modest, on his unembarrassed brow Nature had written . . . 'Gentleman'. Lillian M. Young Latin Club, Ouaestor, l, 2, Neo-Pythagoreans, Vice-Pres., Student Council, 2, Italian Club, 3, 4, College Club, Pres., 4, English Cabinet, 4, Clarinet Quartet, 4, Band Soloist, Gold Scholarship Medal, National Honor Society. The light of love, the purity of grace, The mind, the Music breathing from her face, The heart whose softness harmonized the whole. Ieanette E. Youngberq Latin Club, l, 2, Commercial Club, 4, Senior Home Economics Club, 4. You walk softly, look pretty, and say nothing. Adolph Zapfel Proviso Players, 3, 4, Pageant Editorial Staff, 3, Assistant Editor, 4, Parnassus Club, 4, Pageant Business Staff, Assistant Manager, 4, Provi Editorial Staff, Associate Editor, National Honor Society. Whose mind was an essence, compounded with art, Who ruled like a wizard the world of the heart, Whose humor was gay, whose wit was gentle. Sollie Zapler Iunior I-Ii-Y, 1, 2, Latin Club, l, 2, Fresh-Soph Football, l, Track, l, 2, 3, 4, Iunior Varsity Football, 2, In-and- About Chicago Chorus, 3, Varsity Football, 3, 4, Varsity Club, 4, Wrestling, 4. An athlete and a mighty one, Who plays the game until it's done. Hilma E. Zars German Club, 3, 4, O. G. A. Let gentleness my strong enforcement be. Geraldine R. Zawne Girls' League Rep., 3, Senior Home Eco- nomics Club, 4, O. G. A., Historians, 4. Oh, call it by some better name, For friendship sounds too cold. Seymour L. Zeinfeld lunior I-Ii-Y, l, 2, Latin Club, I, 2, College Club, 3, 4, Senior Science Club, Treas., 4, Pageant Editorial Staff, 4B, Dial Club, 4, Iunior Varsity Basketball, 4. Northwestern University For all may have, If they dare try, a glorious life. Elsie Louise Zerblis Senior Home Economics Club, 4, Histor- ians, 4. Without friends no one would choose to live. Betty M. Zito Italian Club, I, 2, 3. She has a very pleasant way, She wins a few friends every day. John C. Fioramoriti Latin Club, I, Italian Club, l,2,3,4. Northern Illinois State Teachers' College Self-trust is the essence of heroism. George K. Probst Speech both conceals and reveals the thoughts of men. The Class of l9f-35 60 D. Woode R. Woolever 1. Wrighi A. Yench G. Yonczis VV. Young L. Young I. Youngberg A. Zcxpfel S. Zopler H. Zcxrs G. Zcxwne S. Zeinfelcl E. Zerblis B. Zito I. Fioromonti G. Probsi CLASS MOTTO Tomqht We launch where shall We omchor? CLASS COLORS Ultrcxmorme blue cmd silver K.-4... A- -. . 0 sh: W 5 if X v ,X JK -ac 94' 'k 7' 1 u ,wx far 'W' 4+ 4 ,x ' ' . X B 1 m 1: a- 'F ' 4 ff -HV'-D V14 ' 4' 4k ,f 41.3 7 xl' -I' ,P M 4 'aifg' 9 5 11 4- y ,JA 4 4 ,L nf W, u -Ly, ., ' -2 'P Ju fe .p ya +' A . 4 Q jr A -I Q, 4 io P41 'YF Q5 X: -f Us 'k 4 X 4 + K ,nfl 1,3 'Zami .443 Z. i t -R f- ' in N 04' .qv a v., 4, vary 9 , :sri . , I Y L .. 2 0 94 f 1 5 5,4 iffiff F: N3- . Q bil, Q ,? 5 X ,f lim -ing l '4:'...? ?Ftv- li' gl' ii. Q -'5'3-FS.. I .af GT 4' 1- i4 -no-.f bl: P 0' PM-Q x W mix X R Q 3 , 2 'YV my 'eff' X! ' 'L TV if x r' 1 f 4 W X XF V M. Ak? 'is- lunior Officers and Hea SponsorfM. Bakewell, Stumpf, Miss Trigg, H. Th lin, M. Taylor. Iunior Council. Standing- C. Schauberger, P.. Passc Krieg, P.. Sykora, R. lohr Churchill, R. Hoogstra, Martens, S. Wispe, C. Fril man. Seated-P. Hayes, I. Eich man, M. Nielsen, D. Schu: te, M. Bakewell, H. Thelir C. Stumpf, M. Taylor, Fl Gavin, M. Crabbe, H. Bai tels, M. Lossin. The History of the Class of i936 By Yetta Slotnick and Clarence Buffer The opening of school in the fall of i934 found 687 luniors eagerly looking forward to a year of digni- fied superiority. There was a definite change in these former underclassmen, for they seemed to have a different attitude toward everything that was going on about them. No longer was there the half- frightened appearance of the young inexperienced Freshmen, nor the pretense of the high-and-mighty Sophomores. Now, however, they possessed a certain pride that caused their chests to swell and their heads to lift a trifle higher, because they were Iuniorsfupperclassmeni lt had taken them two years to attain their title, but they could now look upon the Freshmen and Sophomores with a superior air and perhaps a snicker or two in return for what they, too, had gone through. The planning of the events of the year necessitated the election of class officers to guide the luniors in their work. The first business of the year was that of electing class officers, which was accomplished through the medium of petitions during the week of November 9. These petitions required the signatures of at least seventy-five members of the class. The victors were president, Howard Theling vice-president, Marion Bakewell, secretary, May Taylor, and treas- urer, Charles Stumpf. With these able leaders to pilot them, the class made special plans for the year. Football beckoned to a large group of the masculine members of the class, who went out to compete for respective positions on the squad. Sev- eral men on each team who played well during the season were luniors. lndeed, throughout the entire athletic year, the luniors were co-operative. Many musically inclined luniors participated in the Band, Orchestra, or Choir, and thus added their share to the extra-curricular activities. With the reorganization of the Pageant Staff, at the beginning of the second semester, a number o luniors who had already taken lournalism werf chosen to serve in staff positions. To instill a joyous Yuletide spirit, the Christma party, held in the boys' gym, was deemed a succes since a large number of students attended. For thi festive occasion traditional Christmas colors wer: used felicitously. ln two assemblies, a Christmas play, Why tht Chimes Rang, was presented by members of tht Proviso Players, under the able direction of Mis Cecil Stark. The play emphasized the old legenc about Christmas time and dealt with the divine beauty of charity. The lunior members of the Provisc Players who performed so admirably were Clarence Frillman, lune Lueck, Ruby Shaw. Robert Lyncli Edna Ricker, and Lee Schneider. Many other lunior of the Choir and Orchestra also helped to make th: program impressive by their part in the presentatioi of beautiful Christmas music. lunior Pal Week, the one event of the year that i eagerly anticipated by every lunior girl, commencec the activities of the second semester. During thi week, lockers of many of the girls were adornec with packages of varied sizes and descriptions. li trying to keep their identity a secret, the girls display ed originality in both gifts and notes, which wer- written upside down, backwards, in circles, and eve: in code. Some, written in foreign languages, addec variety as well as entertainment to the daily corr munications. To climax this mysterious week, girl assembled in the auditorium and later in the Boys Old Gym for a program and party, at which timi they identified their pals and exchanged gifts. 64 rella, Marvin Pries, Ii son, A. Weinberg, 1 Who's Who in the lunior Class Iuniors elected to member- ship in the National Honor Society: C. Bludorn, E. Noffs, R. Wiley, M. Taylor, F. Hardesty, F, Leverette, E. Weiss, E. POPPV l.Ost1er. Service Band Athletics Orchestra Scholarship When the G.A.A. sponsored their vaudeville show and Neptune's Follies, a great number of luniors took part in this activity too. The whole show was put on by Proviso talent from all four classes, but the luniors can pride themselves on their share of excel- lent contributions. One of the most important social events of the year was the lunior-Senior Mixer, which was spon- sored in March to induce a closer relationship be- tween the upperclassmen. This affair left in the minds of the many students who attended pleasant recollections of an enjoyable evening, and was a fitting prelude to the lunior-Senior Prom. Statistics taken from nationality blanks disclosed the fact that among the students of this class, only fifteen were born in foreign countries. Germany heads the list with six representatives: Helmuth Grunwald, Erwin Metrineit, Paul Ewart, Hans von Gehr, Elizabeth Friedrich, and Marie Ziesemer. Canada is second with four students: namely, Robin Lenaker, Fayora lunget, William Willson, and Margaret Harmer. Stewart Pearce and Leslie Meilkle- ham came from England, William I. McMillien from Ireland, and Theodore Wentland from Russia. The foreign-born parents of the students of the lunior Class represent thirty-one countries. Germany is again in the lead with eighty-one parents, and Russia follows with fifty-one. Special recognition should be given to those stu- dents who have made some outstanding achieve- ment this year. The luniors who received silver medals in their Sophomore year are lune Ehrmann, French Hardesty, Edna Popp, LaVerne Vanek, and Eltrieda Weiss. Ursula Birkigt is also included in this group although she has completed her work and is graduating this year. Those who received their silver medals this year are Beatrice Arra, Anna Bailey, George Barker, Adeline Belluomini, Carolyn Bludorn, Gerald Bruce, George Casper, Max Cisek, Virginia Iohnson, Clarence Laskowski, Agnes O'Rourke, David Pflaum, May Taylor, and Rosemary Wiley. Election to the National Honor Society in the Iunior year, an outstanding accomplishment, was accorded to the following ten persons: Carolyn Bludorn, Iune Ehrmann, Floyd Leverette, French Hardesty, Eleanor Noff, Iames Ostler, Edna Popp, May Taylor, Elfrieda Weiss, and Rosemary Wiley. Clarence Frillman was a prominent lunior in dramatics. Six lunior girls have been chosen for their out- standing performances in sports. Each one has shown exceptional ability both in athletics and sportsmanship and deserves recognition. Those ac- cordingly honored are Beatrice Miller, Iennie Hess, Elsie Edelman, Doris Tosch, Bertha Sandro, and Adeline Belluomini. Proviso's athletic instructors have selected seven- teen lunior boys for their merit in sports during the l934-35 termy namely, lohn Patterson, Howard Thelin, lames Lawlor, Roy Sykora, Robert Haberkorn, Thomas Ieschke, Alex lustus, Christ Ginder, and Frank Griste-football. lohn Patterson, lames Lawlor, Christ Ginder, and lohn lustus-fwrestling. Howard Thelin, Robert Haberkorn, Thomas Ieschke, and Richard Gradtfbasketball. lohn Winter, Ted Mar- tens, Lawrence Bauman, Walter George, Fred Ortman, and William Sissone-swimming. Erwin Mertineit---track. Sophomore Class Officers and Head Sponsor4E. Rich- ter, A. Foleno, Miss Gar- lough, B. Caffero, C. Kane. Sophomore Home Room Chairmen. Seated-E. Roos, I. Radtke, O. Dykstra, W. Graf, j. Hulbert, V. Forgue, W. McFadden, S. Boke- rneier, E. Slotky, I. Wolff. Standing----A. Lusthoff, R. Vertuno, H. Haun, M. Fa- hey, j. Stromquist, L. Kmet, D. Davies, R. Reason, L. Campbell, V. Clement. CNot in picturel: R. Bacon, W. Benjamin. The History of the Class of l937 By Evelyn Boyd and Bruce Carson On September 4, nearly thirty-five hundred stu- dents, with the memory of three months of un- restrained enjoyment behind them, converged upon Proviso, eager for the new year of adventure ahead. Among these marching thousands, more than nine hundred and fifty Sophomores joyfully proceeded. No longer were they the timid Freshies of three months agog no longer need they cringe and falter under the haughty glances of the stately Seniors or sophisticated juniors. Now, at last, they had reached that happy state of being where they could look the world in the eye and feel secure in the consciousness of achievement. With the opening of the majestic portals of Proviso, a new world, which had been denied to them as Freshmen, stretched out before these Sophomores. School work from the very beginning took on a new and interesting aspect. The novel one-hour periods cut down greatly the home work which had been the bane of their Freshman year. New and varied courses were open to them, and thus an era of greater enjoyment and achievement began. Extra-curricular activities took on a new meaning for many of the Sophomores this year. A great number of students who had been hesitant about joining clubs their first year plunged with a will into after-school life. As a result, school has been made more interesting for them and has lost much of the drudgery so often identified with it. Band, orchestra, and chorus received a goodly share of the members, and thus was business mixed with pleasure. The newly-organized Dial Club re- ceived its quota of new members from the Sophos more Class, as did the several language clubs. Besides participating in such club activities, many students made a more sturdy, and often-times suc- cessful, attempt to win a berth on the teams. Among the many other fine organizations in Pro- viso, there are two which are purely Sophomore in membership: a mathematics club, the Neo-Pytha- goreansg and a dramatic club, the Thespians. The first important event of the year took place several weeks after Christmas. The exchanging and rattling of long white sheets of paper revealed the fact that the Sophomore election of officers was soon to take place. The petitions of candidates, which were the long white sheets of paper, were turned in to Alden Greene, a Sophomore sponsor, after the re- quired number of signatures were procured. Next come the exciting moments of the assembly of intro- duction. Short speeches of thirty seconds made known the nominees' qualifications for office. Finally the ballots were distributed in the home rooms. Then, after a few days of suspense, it was learned that a second ballot would be needed. Although it seemed like weeks, it was only a few days until the final results were obtained. The victorious candidates chosen to bear the executive powers were the follow- ing: Alvin Folino, presidentg Edward Richter, vice- president, joan Holland, secretary: and Clyde Kane, treasurer. Later it was discovered that joan Holland could not accept her position: so another ballot was cast, which made Betty Caffero, secretary. On March 28, several talented Sophomores were allowed to display their histrionic ability in two short plays, given before an interested and attentive audi- ence. The first play was Station Y-Y-Y-Y by Booth Tarkington, which was acted by members of the Thespians. The second play was Exchange, a farce by Althea Thurston, acted by students chosen from the Sophomore Class as a whole. Miss Emily C. Reid and Miss Marguerite Garlough were the directors of these well-coached plays. -H , '. . . : w .f--. fi yi... .. -A . Q 7. M ,f is-.-3.-,V a-if- z ' . 'gr' -any ,. , . --- -f . -,, if 1 - i ..., Q 4 ., We 5. , ,l . . ,,...., I, -. N. . . 5 X J ' , '17 ,s- ' at 1 L Q 3 5 41. A Lin-t g- L ., Sophomore Representa- tives. Seated-E. Roos, I. Radtke, O. Dykstra, W. Graf, I. Hulbert, V. Forgue, W. McFadden, S. Boke- rneier, E. Slotky, I. Wolff. Standingilx. Lusthoff, R. Vertuno, H. Haun, M. Fa- hey, I. Stromquist, L. Kmet, D. Davies, R. Reason, L. Campbell, V. Clement. Who's Who in the Sophomore Class Service Athletics Orchestra Scholarship Proviso, in a way, is like some vast metropolis, greatly reduced in size, but still retaining all its cosmopolitan aspect, for it has representatives from the farthest corners of the earth. By far the greatest number of foreign-born students in the Sophomore Class, however, hail Germany as der Vaterland. Lydia Wolff, Paul Nellen, Helmut Nush, Erica Iantzen, Werner Marquardt, Werner Laue, lrma Etzien, Hilda Ewert, Gerhardt Vogt, and Gerda von Gehr are Germany's contribution to our worthy student body. Although more parents were born in sunny Italy than in any other foreign coun- try, only two Sophomores, Tony Caliendo and Natalie Piancino were born there. From romantic, mysterious lndia comes Lesley McBridep and from far-off colorful Iapan, Edward Knorring. Also, We have Nick Kafka from Rumania, Raquel Arowesti from Turkey, Mary Eschbach from France, Eric Roos from Denmark, and George Alles from Greece. Doris Watkins, Thomas Ellison, and Albert Eld- ridge are the representatives of our English cousins from across the sea. Our nearest and best neighbor, Canada, is well represented by Herman Keding, Helen McPhail, Rita Marchand, William Lawrence, Walter Keillor, and Leo Conners. Thus, the Sophomore Class of Proviso has drawn students from all four corners of the earth. Only in schools such as Proviso, where students from many countries live and work together in comparative harmony, can true international relations be fostered. In recognition of outstanding attainments in scholarship or in some extra-curricular activity, ninety-two Sophomores have been chosen by the faculty for the class Who's Who. ln boys' athletics, Iames Wolff, George Stahmer, Roy Mohr, Ted Andersen, Maurice lacobs, and Gil- bert Houston are foremost among the swimmers of our class. The class football stars are Steve Mizen, Peter Sagalewich, Richard Cronin, and Arthur Neu- mann. In basketball, Peter Sagalewich, David Buck, Harold Ebelt, Arthur Neumann, Richard Cronin, and Steve Mizen have shown the greatest ability. Gar- field Hillery, Quintin Valduk, and Ned Stranahan have displayed prowess in track, as have Werner Marquardt and Peter Sagalewich in baseball. ln girls' athletics, Iune Radtke, Loretta Krause, Pearl Lembke, and Audrey Iameson have proved most outstanding. In the field of music, Dorothy Davies, violin, Elmer Tolsted, cello, Chester Brossiet, trombone, and Paul Nellen, bassoon, have shown the greatest talent. Sixty-seven Sophomores have already received their bronze medals, the greatest number of Sopho- mores ever to receive them. Eighteen of these, Marian Boeger, Luella Bohlander, Evelyn Boyd, Frances Buta, Mildred Capling, Bruce Carson, Iudith Cleland, Vernon Dodd, Arthur Holland, Gladys leschke, Ho- bart Lande, Marvel Leming, Myrtle Milles, Iohn Morthland, Lillian Petraitis, Elma Puscheck, Edward Richter, and Elmer Tolsted received their medals at the end of their Freshman year. Raquel Arowesti, Leona Behm, Frank Behrendt, Kenneth Biddle, Clar- ence Buenger, Betty Caffero, Laura Campbell, Erna Carnot, Marben Carstens, Anna Catenacci, Camilla Edbrooke, Miriam Fahey, Evelyn Forrest, Mary lane Heegn, Garfield Hillery, Carl Hutter, Ruth Kaul, Pauline Kewin, Paula Kluender, Louis Kmet, Evelyn Knaack, Loretta Krause, Evelyn Kroeger, Charlotte Kuehl, Irma Lang, Evelyn Larson, Helen Leavitt, William Litke, Ruth Marsh, Evelyn Massie, Lesley McBride, Marion Mittleman, Arthur Neumann, lean Parchmann, Carol Parker, Natalie Piancino, Iune Radtke, Catherine Rocca, Genevieve Rozanski, Frieda Scharf, Robert Schlichting, Henry Schmidt, Doris Stenersen, lames Stromquist, Arlene Vanek, Robert Voras, Myrtle Walquist, Ioseph Waschitz, and Lydia Wolff received their medals this year at the close of the first semester. IZ 'I 5iff3.T1'QP1f -2-i 'Fi EL in i4 haul.: . -' f1L...,'3r1-...',..r.... f , . -I . . -1 ..- -A ., ,, .1 . . -- y. , . V, ., .., -- -' t . - -.i ,. Freshman Class Officers Dadds. Who's Who in the Freshman Class Scholarship Service Music Athletics Debate and Class His- torians The History of the Class of l93S By Barbara Fawcett and Celestia Moench As the doors of Proviso were opened on September 4, a host of bustling and inquisitive humanity rushed in. Among these wondrous adventurers were 990 timorous Freshmen. This group was later augmented by the arrival of seventy-seven February students. September 7 was a day long to be remembered by the Freshman girls and their big sistersg it was on that day that these two groups of girls first met, the one frightened and nervous, the other gracious and helpful. The going from the sheltered, intimate grammar school into the open, impersonal life of high school had completely unnerved most of the Freshmen. Alone in a crowd are the words which expressed the feeling of most of them, alone in 11 merciless, unfriendly, carefree crowd. What could this crowd understand of the torture and the rebellion which surged within those valiant breasts when some one basely called out, Freshiel Yet there were the Senior Guard girls, casting veritable rays of sunshine into the chasms of despair, ready to give counsel and comfort. Parties were planned, clubs organized, all Within a short timefthe first weeks of school. Thus an important service of the Senior Guard was accomplished quickly and meritoriously. On September 26, the Girls' Athletic Association sponsored a picnic to Thatcher's Woods. This was given for the athletically inclined Freshman girls in order to encourage the development of bodies as well as minds. Both Freshman boys and girls have since shown their skill in a creditable manner in all fields of athletics. Many courtesies have been shown the Freshmen since their arrival at Proviso. Among these have been the library tours conducted by the English teachers during the first two weeks of school, the parties given by the Senior Guard, the clubs organ- ized with faculty assistance, and the helpful series of talks offered by Miss Elizabeth B. Oakes, Dean of Girls, and by Mr. H. E. Carr, Dean of Boys. The suggestions for these talks were given in get-to- gether meetings, the first of which was held on September 2l. The Girls' League, the only organization to which every girl in Proviso belongs, held its first assembly for girls on October 5. Through its teas and other forms of entertainment, this organization has been one of the means of changing school from the weary days of drudgery, which some had considered it, to eagerly anticipated days of activity. Cn Gctober l9, ninety Freshmen who assembled in Boom lO8, received their honor roll pins. At this meeting Superintendent l-l. l-l. Eelkema stressed the fact that scholarship should not be one's chief aim, but that outside activities should also be taken into ing in music, athletics, and other extra-curricular activities. Participation in outside activities has been no detriment to the Freshman l-lonor Group. As a matter of fact, the number of honor students has grown larger. For four consecutive grade periods the Freshmen have been at the head of the honor list. Most Freshmen greatly appreciate the interest which is taken in their general welfare and physical well-being. ldentification pictures were taken and physical examinations were required. ln most cases, these examinations have served to make the pupils watch their health, posture, and attitude more closely. By November, they were acquainted well enough to organize their class and to select their officers. No longer were they alone in a crowd , they were a part of it. On November 22, a class assembly was held in which the qualities of the candidates were given by their campaign speakers. When the final vote was counted, it was found that the following and Head Sponsor-T. Groenke, I. Credity, Miss Williams, M. Grant, M. FRONT ROWfS. LeBeau, I. Pickens, P. Wade, l. Iohn- son, D. Parker, Miss Wil- iams, C. Ford, L. Gemkow, E. Hayes, T. Barzenick, W. Vtfalterson. MIDDLE ROVJ X ---B. McCarrell, H. Fine, C. Vick, S. Seifried, V. Abrams, L. Thode, S. Bro- berg, F. Rathke, L. Tol- sted, D. Lundblad, B. Rodger. BACK ROWfB. Fawcett, H. Groenhof, C. Worger, M. Olson, R. Keat- ing, G. Huebner, D. Perring, C. Moench, H. Kubitscheck, D. Armstrong, F. Thierbach, R. Cohrs, R. Barrer. FRONT ROWiB. Walters, M. Zielke, C. Scully, E. lNagner, B. Kranz, Miss Phelan, V. Stone, M. Row- L. Hanley. MIDDLE ROW -l. Krieg, F. Heywood, B. Horton, R. Marcus, L. Hull, R. Decker, D. Hamil- ton, L. Reisz, R. Mangnall, M. Birch, M. Dadds, H. Fritzsche. BACK ROW-R. Forrest, E. Berry, G. Hus- sey, R. Schulz, A. Nedzel, R. Skallerup, M. Mullen, T. Groenke, M. Mach, R. Niko, N. Clukas, R. Boland. pupils had been elected: Theodore Groenke, presi- dent, loe Credity, vice-president, Margaret Dadds, secretary, and Mary Margaret Grant, treasurer. lt was on February l5 that the much planned-for and greatly-anticipated Valentine party was given. Among the parents of this group of beginners were found representatives from thirty-two foreign coun- tries. Approximately one-third of the total class en- rollment are descendants of foreign-born parents. Statistics show that from Germany alone came l93 parents. Second only to Germany is ltaly with l44 sons and daughters actively concerned with life in Proviso. Seventeen boys and ten girls in the class were born in countries other than the United States. Of these twenty-seven, ten boys and girls come from Germany, namely, Alfred Wuttke, Hans Guelsdorf, Eugene Cleff, Albert Schwarz, lohn Kuehn, William Osterman, Renate Ewert, Erna Bock, Gertrude Vetter, and Lisa Thode. The following pupils were born in Canada: Edith Sawusch, Elsie Mikusch, Alice Morckel, Annetta Hind, Kenneth Seeley, Iohn Volland, and Walter Mizen. Other foreign-born students are as follows: from England, Doreen Armstrong and Catherine Selkirk, from Russia, Waldemar Koop and Fred Wede, from Brazil, Carl Neuman, from the Philippine lslands, Kendall Rouse, from lreland, Mary McCabe, from Norway, Edwin Moberg, from Hungary, Philip Seibel, and from Turkey, Alexander Nedzel. A survey of the grammar schools from which the Freshmen have come is an interesting one. To the class, ninety-five grammar schools and junior high schools have made contributions. Notable for the size of the contributions were: Garfield in Maywood, ll7 or ll.U8'f, Lincoln in Maywood and Field Stevenson in Forest Park, each 77 or 7345, lrving in Maywood, 65 or 6.09f2, Emerson in Maywood, 58 or 5.43f2, and Grant White in Forest Park, 56 or 5.245 E. The parochial schools most frequently repre- sented were: St. Paul's Lutheran in Melrose Park, 36 or 3.37f'2, St. lohn's Lutheran in Forest Park, 34 or 3.l8f 2, and St. Eulalia in Maywood, 25 or 2.3fF2. The other students come from schools outside Proviso Township. As a result of scholastic achievements and partici- pation in extra-curricular activities, fifty-eight stu- dents have been chosen by the faculty as outstand- ing members of the Freshman Class. They are classi- fied as follows: scholarship, Doris Ball, Tina Barzen- ick, Elaine Berry, Mary Birch, Rosemary Boland, Ray- mond Cohrs, Nancy Clukas, Margaret Dadds, Ruth Decker, Charles Doherty, Norbert Essig, Barbara Fawcett, Charlotte Ford, Pasgual Fricano, Lillian Gemkow, Theodore Groenke, Lorraine Hanley, Eugenia Hayes, Betty Ann Horton, George Hubner, George Hussey, lnez lohnson, Robert Keating, Bobbie Kranz, lack Kreig, Herbert Kubitschek, lohn Kuehn, Doris Lundblad, Barbara Ruth Marcus, Betty lane McCarrell, Celestia Moench, Mildred Mullen, lanet Nelson, Maybelle Olson, Dorothy Parker, Dorothy Perring, Charles Ramus, Florence Rathke, Lois Reisz, Marjorie Rowley, Clover Scully, Shirley May Sei- fried, Robert Skallerup, Victor Stone, Marie Therriault, Lisa Thode, Laura Lu Tolsted, Carolyn Vick, Esther Wagner, Betty Walters, Rosemary Wiley, Bernice Zars, and Marion Zielke, music, Robert Keating, vocal, and Mary Birch, piano, orchestra, Herbert Ku- bitschek, violin, and Doris Ball, cello, band, Charles Doherty, clarinet, and lack Cotterell, tuba, boys' athletics, Gordon Seabrooke and Ioe Simmons, swim- ming, DeWitt Corbett and Norbert Essig, track, Robert Boss, Orval Grove, and lohn Stackpool, football, Robert Boss, baseball, girls' athletics, Alicedell Baker, Dorothy Davis, Harriet Fine, Charlotte Ford, and Hazel Harrison. ,gs nn- L Sx ist l '. -l 'xi I if X N fi JW Ft- E. ,g- z 1 Sig W3 K2 N Slnigip it , 1- 'S .- .'i.' I.g.,n.-A .gf lf W. MQ, Rx N A .l1 w Q X:TIf?f':f, Li, , x I FRONT ROW---A. Spolin, F. Rittmueller, G. Reay, H. Mahnlce, D. Leal, R. Horton, S. Fine, M. Weber, K. Garman, E. Schroeder. SEC- OND ROW----D. Bulger, A. Guth, C. Bludorn, E. Noffs, M. Taylor, R. Wiley, D. Eilenberger, F. Bensen, E. Weiss, E. Popp, I. Ostler. THIRD ROW-H. Carne, I. Gustafson, F. Belloumini, I. Brunke, Y. Dori, E. Buch, C. De Wire, Marie Goodrich, U. Birkigt, S. Grinpas, E. Ernster, R. Ford. FOURTH ROW- D. Abbott, H. Ancel, R. Carling, C. Camp, C. Andersen, F. Ahlers, F. Hardesty, F. Leverette, T. Boardman, R. Blasius. FRONT ROW-R. Haas, A. Paulsen, E. Marik, I. Michael, D. Kane, R. Nelson, M. Ratner, A. Zapfel, L. Heidelbach, I. La Rocco, L. Moench. SECOND ROW-- G. Henzler, B. Philpot, A. Schulze, G. Weltler, P. Lauth, M. Ptolemy, D. Huxhold, L. Se-ren, L. Puscheck, H. Hesterman, R. Peterson, E. Rauhut, M. Stein. THIRD ROW S. Iameson, R. Stutt, V. Reich, C. Popp, D. Schneider, I. Litke, I. Stevens, I. Stubbins, G. Mielke, S. La Spisa, I. Rodger, I. Sponsler, C. Ingalls. FOURTH ROW-E. Leczke, A. Schreiber, E. Lane, C. Robb, E. Owen, F. Orland, L. Nott, E. Ulrich, D. Neal, B. Swinehammer, K, Rockefeller, L. Haugh, This year seventy- five Seniors and ten Iuniors were elected into the National Honor Society of Secondary Schools, a signal honor which is the highest that a high school can confer upon its students. Students are elected for membership in the Na- tional Honor Society on the basis of their achieve- ments in scholarship, character, leadership, and service. Scholarship is the primary requisite for admittance into the Society, and only those students who rank in the upper third of their class scholas- tically, are eligible for election. In accordance with the new method of selection, which was adopted last year, those students whose names appear on the list of those scholastically eligible are voted upon by members of the faculty with whom they have come in contact during their school life. The fifteen per cent receiving the highest composite ratings are presented with a formal notice of their election. Those ten members of the Iunior Class whose scholastic standing and excellence in character, leadership, and service were such as to Warrant their election into the Society at the end of their Iunior year, are Carolyn Bludorn, Iune Ehrmann, National Honor Society Floyd Leverette, French Hardesty, Eleanor Noffs, Iames Ostler, Edna Popp, May Taylor, Elfrieda Weiss, and Rosemary Wiley. Shirley Fine, Kea- wana Garman, Rex Horton, Donald Leal, Hilda Mahnke, Georgine Reay, Florence Rittmueller, Erna Schroeder, Aaron Spolin, and Muriel Weber of the present class were selected in their Iunior year. Miss Florence I. Otis spoke to the newly-elected members on their obligations to the Society. On Wednesday, April l7, the induction ceremony was held. Arrangements were in charge of the National Honor Society Committee: C. C. Taggart, Miss Alice Hahn, Miss Florence I. Otis, and Miss Eileen White. Mr. Taggart gave a short history of the Society and its importance in the school, after which he introduced each newly-elected member. Those who took part in the impressive induction ceremony were Miss Hahn, Chairmang Georgine Reay as Character: Hilda Mahnke as the Torch of Enlightenment, symbol of the Societyp Keawana Garrnan as the Keystoneg Erna Schroeder as Leader- ship, Shirley Fine as Scholarship, and Muriel Weber as Service. Participants in the candle-lighting cere- mony, that of passing on to the incoming group the light received as Iuniors were Rex Horton, Donald Leal, Florence Rittmueller, and Aaron Spolin, l FRONT ROW- M. Meeks, E. Buch, E. Leake, B. Hoeck, R. Blasius, Mr. Osburn, E. Probasco, Marie Goodrich, F. Bensen, C. Chronister, L. Larsen. SECOND ROW- V. Maher, G. Walters, R. Shibley, F. Stahl, M. Gibson, P. Lauth, I. Wright, S. Galloway, I. Rodger, E. Q Schroeder, A. Guth, B. Hilton. THlRD ROW A. Schulze, H. Hester man, L. Nott, L. Raab, D. King, R. We-ssling, E. Vodicka, G. lacobs, L. Seren, D. Huxhold, M. Ptolemy, D. Erickson. FOURTH ROW l. Kinniburgh, O. Cleff, R. Crabbe, l. Burk, G. Daudistel, F. Ahlers, R. Clark, S. Zapler, H. Van Gunten, R. Berliner, R. Schultz. FRONT ROW- G. Dammann, H. Landa, F. Lapin, L. Siegler, G. Wells, B. Schulz, C. Schuster, l. Stubbins, E. Robertson, l. Tarrants, D. Roberts, H. MacPhail, A. Belluornini. SECOND ROW---I. Ehrmann, G. Rupietta, I. Manton, B. Hutter, R. Sievert, F. Fahr, R. Ellis, W. Slicer, E. Buchholz, A.Heinrich, E. Boyd, R.Shaw, Frances Gavin. THlRD ROW -Marvin Pries, I. Cleland, M. Boeger, R. Osburn, M. laccbs, A. Weinberg, R. Hubinek, R. Becker, H. Hallowell, H. Weiss, H. Olson, P. Swanson, C. Girider, C. Ruffer. ln the spring, a young man's fancy lightly turns to love, runs an age-old saying, but at Proviso, in the fall, the vocal students fancy turns to music. The potential Carusos and Galli Curcis join the Freshman Chorus, good work promotes them to the Senior Chorus, and finally, if they try hard and do excellent work, they may gain the coveted member- ship of the Choir. There, under the able direction of R. Lee Osburn, vocal enthusiasts are trained in the interpretation of many beautiful choral arrangements and in finer and higher points of the art of music. After reviewing numbers which were sung last year and memorizing new ones, the Choir made its first public appearance this year by singing for the Parent-Teachers' Association on October 18. On November 22, the double quartet traveled to Urbana, Ill., where they sang in the vocal clinic, under the direction of Mr. Osburn, who had charge of this department at the State High School Confer- ence. The students representing Proviso were Bette Hilton and Elizabeth Probasco, soprano, Catherine Chronister and lune Ehrmann, alto, Ralph Ellis and i Roy Shultz, tenor, Edwin Vodiclca and Russell Becker, bass, and Evangeline Buch, pianist. This year the annual Christmas concert was given i on December 20, with the assistance of the Proviso Players. To music lovers, the Choir - presented some of its most inspiring 0112 numbers in this program. After the holidays, forty-five members of the Choir were selected as the fortunate students to receive training for the ln-and-About Chicago High School Chorus of l935. This year, the concert was held at Orchestra Hall under the direction of Robert I. White. On Saturday evening, March 30, the entire Chorus, consisting of three hundred and eighty voices, sang before the ln-and-About Chicago Music Supervisors' Club and other music lovers. During the year, the Double Ouartet went to differf ent churches and schools to sing their numbers. On Sunday, March lU, the entire Choir sang before a large audience at the second of the series of band concerts. Some interesting and lively numbers were sung, including two favorites of the Choir, namely, The Sleigh and the Cossak. The annual Spring Concert was given on Thurs! day, May l6. Various choral groups presented the first part of the program, for the second part of the program consisted of the Choir's presentation of the operetta, Trial by lury, by Gilbert and Sullivan. The Choir closed another successful musical year with this last colorful event. 'x '7 L. 1 .Q LJQY . 'WW if Q 'ff' A xtslk ' .. A K , . 1 f fn if 9' : I i my ,lb I K I l f A Q1 51 . I b I N., M y: ff ' Q ., R --Q: ,gt A In V 44, V, Q Q1 0 .Q ,haw .n.f:s,.IIm WN A A 9' f I as YILAP .if :ju , l I Q, . ' Q f L 1 - . - ..g, -Q N1-h ROVISOJ h ara WF i- -P 1 ' Q' f ff ' M W N . WW L Tw '- UN - . 4 -fm- Q, . lla Q r 1.5! w'5h, EW p ., , at f- A' x xg 5 i 1 3 ff-1 v Q , 3 ,f-.-sv if 1 H jg J 1 g Q , 5 ,WQUAQY Q gg i My . , 'fvj ' 1 . s as ' 1 3 Q ..... - kuaff f f ' . fx ?m,,g,-, J, Wg? Af ' A xx A ff B d For lovers of pageantry and rhythm, Proviso's hundred march- an ing bandsmen have created many enjoyable displays, both on the football field and on the concert stage. This year, more than ever before, the High School Band, under the direc- tion of I. lrving Tallmadge, has made real contributions to the life of the communities it serves. Folotball maneuvers and parades were but a begin- ning of the strenuous year, l934-35. The benefit show at the Lido, where the entire band gave a brilliant performance of Thunder and Blazesf' Semper Fidelis, and Vanished Army, was the forerunner of a great concert season. Playing to a full house, Proviso's boys and girls of the Blue-and-White gave three Sunday afternoon programs in the auditorium: one in February, one in March, and one in April. The last of these concerts brought many of the band's former players back to the footlights. Nearly one hundred and fifty musicians played in the Alumni concert. The Band was honored at one of its rehearsals by a visit from Dr. Wesley Laviolette, one of America's outstanding modernists, who came to direct the Band in the first rehearsal of Frontier, written by Mr. Tallmadge. Soloists, quartets, and sextets from the Band furnished music at some time during the year for many civic organizations, and many of these per- formers entered the solo and ensemble contests at Cicero and at Urbana. Section leaders of the band for this year were: Dan Taibleson, oboe, Russell Currie, clarinet, Paul Nellen, bassoon, lulius Credity, cornet, Chester Brosseit, trombone, Charles Camp, baritone, Louis Boehm, French horn, Clarence Kurz, tuba, Elvan McElroy, drums, Harriet Shilkaitis, marimba, Frank Heil, bells, timpani, piano. Upholding the reputation established in former years, Qrcheslrd the Proviso Orchestra, under the direction of Wallace Nelson, received first rating at the State Orchestra Contest, April 27, thus making it eligible for the National Contest at Madison. Also, twelve first places were allotted to soloists and ensembles, a record equaled by none of the other competing high schools. Members receiving a first rating in the violin solo contest were l-larry Flachsbarth, Keawana Carman, Melvin Korrell, and leanne Nottingham. Elmer Tolsted and Doris Ball each received a first rating on the cello. Three pianists, Evangeline Buch, Dorothea l-fuxhold, and Ruby Shaw were also awarded a first place, and Donald Kane won a first rating on a string bass solo. Mae Clement, piano, received a first rating as did the woodwind quintet, the members of which are Louis Boehm, French horn, Ftobert Green- well, clarinet, Gordon Kennett, flute, Paul Nellen, bassoon, and Dan Taible- son, oboe. The orchestra was further honored at the contest when Elmer Tolsted, cello, was chosen as the outstanding soloist, and when the trio was selected as the outstanding ensemble of the entire group of entries. The Orchestra has presented five main concerts throughout the year. At the first of these, the Christmas Concert, the Orchestra, assisted by the Choir, played delightful Christmas music. ln Ianuary, the group also offered a concert including many of the best numbers written for orchestra. On April l2 and April l4, concerts were presented including many soloists and ensembles. On May 3, the final concert was presented to the students. The Orchestra, besides furthering the students' knowledge of music, pro- vides a real service to the community when its various soloists and ensem- bles furnish music for many social functions. 75 Girls' The first ofthe multitude of events which filled the Girls League calendar was the commencement of the Big Sister activities. Each of the Big Sisters, members of the Senior Guard, was assigned to a group of Freshman girls, the Little Sisters for whom she endeavored to prepare an introduction to the various school activities and extra- curricular activities of the school. One of the yearly events to which the girls look forward is Sun- shine Pal Week. For a number of years, Proviso girls have carried on the activities of Sunshine Pal Week by sending small gifts to some member of the Baptist Old Peoples' Home. At the end of the week, the girls are privileged to meet their Sunshine Pals at an evening social in the Home. The sweet, white-haired grandmothers and grandfathers have always acknowledged their appreciation for the exciting attention being heaped upon them with quiet, smiling nods and a twinkle in their eyes. The outstanding event of the fall season is the annual Girls' League Bazaarfthis year a Gypsy Fiesta. With gypies roaming the halls, confetti flying everywhere, loud calls of the barkers describing assorted side-shows, the Gypsy Fiesta provided an evening of hilarious enter- tainment for the throng of fun seekers. Waldo Heinrichs, traveler and Y.M.C.A. worker, and Dr. Regina Wes- cott-Weiman, of the faculty of the University of Chicago, were the prin- cipal speakers at the Inter-Church Girls' and Boys' Conferences. Before a joint session of boys and girls, the first in the history of the Confer- ences, Dr. Weiman talked on The Three Great Choices of Life. The Conference tours presented a panorama of historical Chicago. The Pagoda lnn, with its silk, gayly-colored lanterns, the decorated Gold-and-Black Room, and the huge golden idol awed the Chinatown visitors. The House of Correction engaged the interest of the group, and the workshops, where many commercial articles are manufactured, offered adequate demonstration of the types of prison employment. Christmas for the little men and women of the Cook County Hospital was brightened by the League's gifts which included dolls, scrapbooks, and toys of every description. The sight of bright packages tied to the lockers in the junior section, whispering girls laughing and joking, and voices teasing, Oh, j know who your pal is but l won't tell, graphically describes junior Pal Week, the purpose of which is to encourage new friendships among girls. The fun of Pal Week is looked forward to with hC1DDY anticipation by every junior and looked back upon with fond memories by every Senior. Throughout the year, the League sponsored a series of afternoon teas, at one of which Miss Alberta Brenner, a representative of the Spalding- Gorham Company, presented an illustrated lecture on The Romance of Silver. In the spring, john Mueller, proprietor and director of the Chicago Hairdressing Academy, lectured on New Styles of Coiffures. After the pattern of junior Pal Week, the Senior girls sponsored a Good Fellowship Week, which ended with a cafeteria supper. The annual Suburban Conference which was held on April 27, at Thornton High School, Harvey, lll., had as its speaker Mrs. jill Edwards, who delivered the principal address on the conference theme, You and l Now. The lnstallation Service, in the late spring, marked the culmination of the League's activities. Large bouquets of spring flowers, symboliz- ing the four-fold girl's physical, mental, social, and spiritual develop- ment, aided in making the Service a singularly beautiful one. Crgan music, pastel colors, and a multiude of flowers make this, the last offer- ing of the League, a truly inspirational climax to the year's activities. 76 T15 D19 1 I IF11 FBONT ROW4D. Schneider, G. Karner, E. Christensen, Miss Schlue ter, Mr. Kuster, M. Glos, E. Radke, B. Schutz, G. Davis. MIDDLE HOW-G. Dammann, L. Ftodenbostel, E. Kern, M. Rick, E. Dons, A. Heinrich, E. Notts, R. Shiner, P. Schuster, B, Rodger. BACK ROWM E. Friedrich, L. Buenger, H. Zars, F. Fahr, R. Gosch, l. Grenier, D. Petersen, E- FGlk9Hl'1GQ91'1, C- Gilbert, L- BIGCk91'1f9lCl9f, M- Breck- enfelder. PRoNr ROW-D. spieqei, R. Heehne, L. rfeybei, R.FSchroeder, E. witzke, F- Schuster, A- Weinberg, E. Cluuss. M. Doe-rn MIDDLE ROW---V. Mittethe-user, L. Scherer, B. Bmetz, D. McCarthy, E. Stern, E- Sormr-er, N- Hansen, D- Cramer, M- Ziesemer, L- Stover, M- Kinne, BACK ROW--L. Fritzler, R. Passarella, G. leschke, V. Tom brink, T- Flflk- E- Lghm. E- KOOP. D- TOS-Ch, R- KCIH9. E- Bullh- - Wie geht's? and Gruess D16 Deutsche Gott! are familiar greet- lugend ings known to all members of Die Deutsche lugend, the German Club. The club desires to promote a better understanding of the German language and customs. Membership in this organization is open to any student who has taken, or who is taking the first year of German. During the past year, the mem- bers have learned much of the German geography, culture, and legendary background. Opportunities to display the amount of German the members have stored in their memories were offered when games requiring quick thinking and a knowledge of German were brought into full play. These games furthered the purpose of the club by making the members recall their German in order to understand and do what was required of them. An opportunity to hear everyday German conver- sation was given when the members had the pleas- ure of witnessing plays. Folk songs and other types of German music introduced the students to the mu- sical culture of the country. They learned about the famous symphonic composers that Germany has produced in the last few hundred years, those who are known all over the world. Their works were studied because of the prominent part these German music masters have played in composing some of the greatest musical classics of the ages. At the Girls' League Fiesta, the club sponsored a booth suggestive of the Black Forest. The members, dressed in a bright array of costumes, sold German candy and cookies, which aided in making the endeavor a success. At the October meeting, the members played a novel guessing game on the current popular adver- tising slogans. lt was in the form of a baseball game, with the members scoring runs when answer- ing successfully and making outs when answering incorrectly. Der Zerbrochene Krug, a German story, was dramatized at the November meeting. An outstand- ing social event of the year was the Christmas party, at which the members sang Christmas carols in Old Heidelberg style. ln honor of St. Valentine's day, tea, cup cakes, and candy hearts were served at a social gathering of the club on February ll. At other meetings, the club enjoyed pictures show- ing the medieval castles and other picturesque scenery of the Rhineland. Sixty German students signed for membership in the club this year, which is under the sponsorship of Miss Gertrude Schlueter and Ft. R. Kuster. The members bade Auf Wiedersehen to the year's events when a gay picnic in the latter part of May climaxed the activities of Die Deutsche lugend. ll swat .. .. . .-.ew FRONT ROW -E. McNamar, M. Tanner, R. Grodsky, P. Lauth, L. Nott, Miss Williams, L. Bacall, F. Gershkowitz, A, Duchesneau, I. Perkins, E. Gault. MIDDLE ROWfP. Kewin, L. Styles, F. Malone, M. Pildes, T. Shein, A. Pocius, H. Weimer, S. Galloway, H. Leavitt, V. Edmonds, l. Buelens, A. Stert, M. Milles. BACK ROW-HE. Vo dicka, P. Hayes, P. Iacobsen, Lenaker, M. Coleman, M. Mohr, R. Knopf, F. Collins, S. Carson. V. Mueller, V. Forgue, G. Alles, R. FRONT ROWAY. Slotnick, B. Lurie, M. Elisco, B. Soderberg, M. Clement, I. Magsino, L. Vanek, Vanek. SECOND ROW-C. David, M. Mittelman, I. Hall, A. Heinrich, F. Stokes, lt Cfbfbeii. R- Schlesinger, M. Carter. THIRD ROW' -Y. Dorf, B. Swinehammer, M. Crane, D. Eilenberger, F. Bensen, V. Busboom, I. Schmitz, S. Fine, 'D. Holpuch. BACK ROW-M. Burns, L. Iaffie, I. Hulbert, E. Henderson, R. Lande, G. Longleif. A. Bennett, V- Moeller, D. Christian. Bon voyage! Bon voyage! Les amis, all aboard-an imaginary tour of France! A1laboard1 When Les Amis du Francais boarded their ves- sel at 3:30 on September 25 at Port Social Rooms, they were greeted by the ship's officers and intro- duced to their guide, Mademoiselle Ada Ross. i ln order that these travelers who had studied the French guide books for one or more years may become more familiar with the French customs, as Well as with the arts developed in that country, tours were scheduled for the third Tuesday of every month. On each journey, production of plays, dialogues, comedy skits, and other forms of entertainment in narrative style were given. The tourists participating in the social programs actually practiced speaking the language and acquired a fuller knowledge of the French people. Several times les amis sang folk tunes which the foreign children themselves sing in their own country and danced to the music of the old farandole. The deck sports, similar to those played abroad, helped to stimulate interest in talking the language and developed quick-thinking and a memory of French words. While cruising in October, the students gave a Halloween party which had become an annual custom for those on board. On their third cruise B. Hoe, l. Bollow, C. Hawkins, A. Pratt, D. Stenersen, R. Goldman, C. they Les Amis Du docked at a small port in southern France where a Gypsy Fiesta was being sponsored. These cruisers stopped long enough which proved to be a to prepare a Rue Morguenee horrible feature to the QYDsies who ventured into the spooky place. The cruisers' December entertainment consisted of a performance of a parade of the months and Par Telephone which portrayed the gratefulness of the poor. St. Nicholas, representing the Yule- tide season, climaxed Les amis regretted emoiselle Ross, who the parade. the loss of their guide, Mad- had decided to remain in Franceg however, they enjoyed the companionship of their new leader, Mademoiselle Florence Wil- liams. During February the dramatists amused the group by giving Au Clair du la Lune. These tourists were privileged to hear a former resident of France, Mademoiselle Esther Race, who had studied in French schools and had traveled extensively in that c interested in les am nautical trip in order t were greeted by the whom they united for ips... .,.. fir 11:1-,s,........,.Y.... . ..,r,...,.,,. ami.-. hr... .. . .,,. ountry. Freshmen, who were is' activities, took a special o hear Mlle. Race. When they landed on their home shores, they senors and senoritas with a picnic. FRONT BOW---P. lacono, M. Lorenzo, E. Cotugno, P. Lanzaratta, A. Lattanzio, Mr. Gentilin, B. De Franco, M. Galasso, T. Giordano, L. Butendorff, A. Arrighi. MlDDLE BOW-D. Aniici, L. Anton, V. Belmont, D. Calderone, A. Di Zonno, l. Eese, P. lmburgio, C. Gallant, L. Eranch, l. Acerra, l. Culotta. BACK BOW A. Caliendo, l, Ceserio, D. Eolli, V. Malpier, A. Augustine, M. Metti, P. Di Francesco, S. Cortopassi, l. Augustine, B. Di Verde, L. De Giuseppe, B. D'Anza. FRONT BOW--L. Rocca, Marjorie Prignano, N. Piancino, B. Spagnola, B. Arra, D. Be, Marie Prignano, M. Divita, B. Sandro, L. Young, A. Vice. MIDDLE BOWH C. Spata, B. Spignarella, L. Monaco, V. Santore, A. Pranno, V. Lullo, l. Tasso, A. Traina, L. Nunziato, C. Schillace, A. Pusateri, T. Pisano, BACK BOW-- A.Maro, l.l3olito, P. Signorella, B. Vigliani, V. Bito, A. Zwirhlis, M. Malpier, l. Villano, T. Miller, C. Pesce, G. Zitello, G. Badice, L, Orfei. - The ltalian Club strives to :li-l:C1hCl-I-1 increase the interest of the students in the language, the literature, and the arts which comprise ltalian culture, and to reveal the beauty of ltaly through the showing of films and slides. ln October, the club celebrated the birthday of Christopher Columbus. Humbert Gentilin, sponsor of the club, delivered an address in ltalian on The Discovery of America. The Life of Columbus, also in ltalian, was related by one of the members. November was literature month, and the club members were offered talks in the dialect on the lives of Dante, Petrarca, and Boccaccio. Stella Cor- topassi and Natalie Piancini presented an original dialogue, written by Mr. Gentilin, before members of the club and visiting parents when the clubs held open house. Mr. Gentilin outlined the history and general characteristics of the Golden Age, Binas- cimento. Student speakers discussed the work of Torquato Tasso, Ludovico Ariosto, Galileo Galilei, Leonardo da Vinci, Baffaello Sanzio, and Michel- angelo. The Great Modern lnventorsu was the subject of Mr. Gentilin's address at the lanuary meeting of the club. l-lis talk dealt mainly with Marconi and the radio and with the inventor of the telephone, Antonio Meucci. At the sixth meeting, Mr. Gentilin, who has been to Venice three times, delivered an illustrated lecture portraying the beauties of La Regina dell' Adriaticof' the aueen of the Adriatic. ln the early spring, the club sponsored a matinee dance featuring the music of loe Petroselli, a former member. At the April meeting, talking pictures on The Education of ltalian Youth and a lecture by ludge Louis Senese were presented in connection with a study of the ltalian school system. ludge Senese also presented travelogue films showing the wonders of Rome, Venice, and Naples. One of the high spots of the film was the excellent views of l5UU airplanes in maneuvers near Home. The second week of May took the ltalian Club to Thatchers' Woods for their annual picnic. Games, songs, and refreshments made up the afternoon's program. All students are expected to harbor a genuine in- terest in ltalian culture as well as in the activities of the club. Membership in the club requires enroll- ment in ltalian. Eirst year students must have a grade of two or better, all others, three or better. FRONT ROW E. Ricker, D. Raven, E. Larson, G. Bruce, R. Sykora, Miss Evans, D. Beck, F. Bensen, E. Lawson, B. Kranz, C. Parker. SECOND ROW M. Carstens, D. Forshall, D. Carver, B. Horton, G. Rozanski, F. Shepler, I. Fioramonti, L. Reisz, D. Lundblad, D. Iameson, D. Buik. THIRD ROW S. Catenacci, H. Haun, H. Schmidt, V. Wright, E. Breen, R. Brady, B. Popp, H, Lande, I. Brunke, C. Scully, M. Zielke. FOURTH ROW F. Collins, K. Rockefeller, I. Blackwelder, R. Osburn, G, Hillery, R. Iohnson, R. Wiley, O. Dykstra, A. Foleno, I. Wynne, Wm. Hickey. FRONT ROW I. Stubbins, C. Robb, M. Browder, E. Gault, R. Clark, Miss Gospill, O. Paeth, H. Alderson, A. Elfring, C. Olleman, R. Todd. MIDDLE ROVV E. Ricker, M. Robb, G. Wilson, R. Cramer, M. Dun k, D. Berg, B. Kramer, R, Mantel, L. Vanek, B. Armstrong. BACK ROW --Ethel Kingdon, Edna Kingdon, E. Carnot, E. Peary, G. Barker, W. Paulsen, IN. Wilcox, R. Rieck, G. Eskerson, E. Connors, G. Simonov. The Res Romana is modeled in constitution and office after The Roman State of Caesars time. This club promotes friendship and understanding among the Latin students and assists them to be- come better acquainted with Roman life, history, and literature. The chief officers are the Senior and Iunior Consuls, who served alternately as president and secretary, and the Ouaestor Primus, or treasurer. The standing committee consists of one Aedile chosen from each first and second year Latin class, and four Iuniors and two Senior Aediles from the advanced class. Many imaginary trips are made to the beautiful countries of Spain and South America by the young senors and senoritas of the Spanish Club in an attempt to learn more about the people and the customs. At the social meetings, Spanish games and songs aided the members to acquire a more facile use of the Spanish language. One of the most interesting of the plays enacted, Mr. Novio Espanol, concerned two Americans who were traveling in Spain. They had a difficult time with the language, much to the delight of the audif Gradual increase in membership has kept the club flourishing since its reorganization in l929. A wide range of entertain- ment is provided at its meetings, including plays, debates, talks, and games. The advanced class. which reads either Vergil or Cicero, annually presents a play inspired by their subject. For this, the most important activity of the year, the characters present themselves in an array of tunics and togas, the dress of that period. Res Romana . Th h i - ifZeC..C...iChZ5m,fSQZQTS SLOGHISIH Club sented at one of the meet- ings. Movies of Mexico and South .America provided interesting features for some of the meetings. The final entertainment of the year was a picnic, on which occasion the members joined with the French Club to mark the beginning of a happy vaca- tion. The annual baseball game, always looked forward to by the members of both clubs, was one of the high-lights of the day. - Quality Street, a romantic comedy Sen-lOF Cl-6-SS of the Napoleonic era, by the popular author, Sir lames Barrie, was presented as the annual Senior Class play on Friday evening, April 5. The plot of the play is woven about the interesting personalities of Phoebe Throssle and her sister, Susan, and the amusing occurrences on Quality Street. Phoebe is very much in love with a dashing young doctor, Valentine Brown. She is expecting him to offer, but the grand news he has for her proves to be the sad news that he has enlisted in the army. Heartbroken, Phoebe tucks her ringlets under an old-maid's cap, and she and her sister open a school for the children of the village. Ten years later, Valentine returns to find that Phoebe has changed and that she is no longer the sweet, young girl with the attractive ringlets. lnstead, she is now a rather prim old maid. Despairing because of his lack of interest in the new Phoebe, she changes her clothes, brings back her curls, and poses as a frivolous flirt, Livvy, her mythical niece, think- ing that Valentine will fall in love with her all over again. He and all the other young men of the village are immediately infatuated with her. Soon, however, he confesses to her that it is the old Phoebe whom he really loves. ln the last act, he discovers that Phoebe is impersonating the niece. She and the dashing Valentine confess their love for each other, and everything ends well, as desired. The entrance of three gossipy women from across the street at the most embarrassing times adds much to the humor of the play. The play was given as a part of the Silver Anniversary Celebration, and its old-fashioned plot fitted well with the occasion. Some of the parts had a double cast. Following are the characters in the order of their appearance: Miss Fanny Willoughby .,.......... ...... Miss Mary Willoughby.. Miss Susan ............. Miss Henrietta ......... Miss Phoebe .... Patty .................. The Recruiting Sergeant .... . . . Valentine Brown ........ Georgie ......., Miss Beveridge ...... . lsabella, ............. . . Arthur Wellesley Tomson .... William Smith .......... Other Children .... Charlotte Parratt ..... Ensign Blades .,.... Harriett ...,.... Lieutenant Spicer. An Old Soldier .... A Gallant .......... People at the Ball .,.... S I . . . .Elaine Sipchen .. ...Theresa Fink . . . . .Erna Schroeder . . . . . . .Iune Perkins . . S Georgine Reay I lanet Rodger . . . . . . .Eileen Gault ... . . .lacob Techtiel Gilbert Daudistel Kenneth Rockefeller . . .Frank Cacchione ........Anne Guth . . . . . .Ruth Stutt . . . . .Aaron Spolin . . . .Harvey Karlen Billie Wharton . . Lillian Kaufeldt L Helen Gevas . . . .Virginia Fippinger . . . . K Roger Sedgwick I Elvan McElroy . . .Elizabeth Garrett . . . .Douglas Abbott Kenneth Rockefeller . . . . .Elvan McElroy lanet Rodger . . . . Alma Schulze L Henry Meyer The story takes place in a quaint old English village during the Napoleonic Wars, and the atmosphere was carried out very well by the attractive and colorful scenery. The first, second, and fourth acts take place in the beautiful blue-and-white room in the little home on Quality Street. Miss Susan has a great love for this room and is rather upset by Valentine's coming into it with muddy boots, his crumpling up her immaculate chair covers, and his causing general disorder in the room. The third act is in the garden during one of the military balls at the pavillion of the barrack, and the music back stage added color to the scene. The costumes were the strikingly colorful ones prevalent during this period. 82 FRONT HOVV H. llester- man, L. Pfvitei, D. Schnei- rlrtr, T. Fink, E. McFtroy, Miss Stark V. Rrticl., A. lmlwards, G. Simonfzv, M. Nielsen, IX. Schulze. SEC- OND ROW V. Fippinaer, lf. Schroeflr-i, R. Shaw, R. Crcnner, lt. Hutter, ll. Kar- l lt, l . Mittulstctad, XX. Hein- nvtt, L, lrilltnan, l, Ste' vt-ns, E. lti-koi. ll l R D TKOVV G. lflwry, F. Ritt- ntttciller, L. Nott, VV. Peters, li. llocketetlrfr, E. Lawson, l. Lueck, D, King, F. Gaulf. S. G r i n p cr C. R o lf 11, FOURTH ROW' R. Sedg- wick, D. Altliott, T. Board- man, H. Hallowell, l. Har- ris, L. Sclinfrider, G. Daud- istvl, M. Fastcvtt, R, Camp' bc-ll, R. Lynch, A. Zaptel. Scene from Tne than in the Bowler Hat, IX. A, Milne. Miss Cecil Stark, :,iittyt't4'.r. Scene from lsle. Fuaene O'Nf2ill. - The purpose ot the PFOXIZLSO Proviso Players is to promote interest in the art ot dramatics and to bring delightful entertain' ment not only to the club members but to other audiences as well. At the tirst social meeting, an amusing play, Lady Betty's Burglar, was enacted. At the next meeting, The Man in the Bowler Hat was presented. lt was repeated at a public meeting on November 8, and was an outstanding teature at the Girls' League Gypsy Fiesta on November l9. This year the Proviso Players took a prominent place in the annual Christmas program by present- ing the well-known play, Why the Chimes Rang. Gn the evening of December 20, the play was pre- sented ior the general public, and was given again the next day tor two school assemblies. Both audi' ences, young and old, were held spellbound by the awesome beauty ot the presentation. The characters, who were carefully chosen, carried out their parts with a skill and a precision which showed conscien tious ettort and intense interest. The coloriul beautv ot the Gothic window as a background in the church scene immeasurably increased the play's loveliness and splendor. The second semester held many good things in store tor the club. Fourteen, The Table Set tor Himseltf' lle, Dreams, and His First Dress Suit, were some ot the plays presented. Then the Proviso Players closed their book ot activities for l935 with a satisfied feeling that they had accomplished their purpose. , ss Scenes from Why the Chimes Rang, Elizabeth McFadden Scenes from Why the Chimes Rang, Elizabeth MCFGdde!1 3 iii: FRONT ROVV---R. Boland, L. Reisz, C. Ford, B. Kranz, l, lohnson, Miss Vallo, A. Livingstone, L. Kennedy, I, Anderson, N. Clukas, L. Hanley. MlDDLE ROW -A. Butta, B. McCarrell, M. Haglund, A. Le-Febvre, M, Hauber, D. Wolff, VV. Lietz, L. Hull, L. Tolsted, D. Lundblad, G. Mather. BACK .ROW - B. Fawcett, R. Schulz, L. Greenwell, R. Martens, B. Schwass, A. Oliver, E. Sawusch, B. Dan- iels, R. Marsh, M. Grant, G, Hussy, D. Maloney. FRCNT ROW-M. Robb, l, Probst, R. Williams, E. Wagner, D. Roberts, H. Abbott, N. Essig, C. Wolff, M. Zielke, M. Evernden, C. Rickel. MlDDLE ROW- S. Agnew, V. Tonkin, 13. Marcus, C. Bartusch, l. Raab, W. Crowley, B. Hor- ton, H. l-lintz, M. Dadds, R. Gaus, M. Gee. BACK ROVV-B. Rowe, S. Sei- fried, C. Williams, D. Arm- strong, Wm. Riggs, M. Mullen, D. Weatherhead D. Ball, F. Tamolis, M. Strong. G M k When the announcement was read in the Teen 5-S Freshman home rooms that all first-year students with some histrionic ability could try out for Green Mask, many of the school's youngest began to rub clammy hands on handkerchiefs and trousers and to take on worried expressions. Tall, short, lanky, chubby, blonds, brunettes, and red- heads, gathered to display their ability before the judges. Then followed a hectic week before second try-outs. After this ordeal was over, the lucky chosen-few were notified of their good fortune. At the first gathering, the organization elected those who were tc take charge of the club's affairs for the year. Miss Marie Vallo was appointed the club's new sponsor. All of the young actors, designers, and managers found an outlet in Green Mask for their creative ability and ideas. The study of good plays aided the members in developing a better appreciation of good dramatic material. Then came the presentation of plays, requiring the interpretation of many types of characters. With this the fun began. There was the thrill of the sudden darkness. Excited whispering came from behind the screens as the cast waited for the tardy actor who was hurrying down the hall and into the stage door. The screens were removed, and the play was on. The main character strolled out on the stage, struggling to gain that nonchalant manner, while even the members in the last row could see the perspiration rolling down his face. His Voice wavered at first, but the leading lady fluttered in from the side, and started out weakly, My hero, you havefyou have- Panic stricken she stopped, but was saved by the hoarse, Come back, from back stage, and the rest ran smoothly. The villain, greeted with boos, completed his despicable work, the love scene was carried out, in spite of the snickers in the front row, and the play drew to a close. ln this club the Freshmen gained experience in the production of plays which prepared them for their later years of drama in Proviso. 84 2-,.,,Q.,. ,if ,.-3 --mfs A ,4,1..,g tffgwzw 1-1fv,...5 .Ai Y' M 'f 'rr'1 ' l i FRONT ROW E. Stephens, N. Piancino, P. Yates, L. Rall, A. Murnm, Miss Car- lough, E. Tolsted, S. Levin- thal, B. Avrech, H. Mace Phail, M. Thomas. MTDDLE ierc. TOP ROW- -l. Strom- quist, E. Robertson, L. Sin- clair, E. Koop, I. Grenior, N. Piskun, B. Carson, H. Buyer, l. Felt, L. Hayes, G. leschke, L. lones. Scene from Station Y-Y- Y-Y, Bcoth Tarlcington, The height oi ambition ot every dramatic- minded Sophomore is to become a member ot the Thespians, a club composed oi second-year students with ability to act. lt is here that the Sophomores receive their training in directing plays, acting, costuming, and stage-setting, thus being prepared tor later activities in drama. Thespians Since the club's purpose is to promote skill in all types ot acting, and to develop an interest in and knowledge ot plays, the members started iittingly by initiating themselves into their own club. Each oi the six groups gave clever original skits which amused every one. Two clever plays were presented during the tirst semester, namely, Betty Behaveu and Alice Blue Gown. A Christmas party was held a few days betore the vacation. Some ot the members danced or recited, atter which Miss Eileen White told ot her experiences while traveling in Europe where she saw the Pas- sion Play. Tiring ot the commonplace name, Sophomore Dramatic Club, the wise members decided to change it to a more outstanding one. A club name was voted upon at a meeting and the title, The Thespiansf' was chosen. During the second semester, other entertaining programs were given. Eager to display their talent before an outside audience, the club was delighted to accept an invitation to act beiore the Forest Park Women's Club. They presented the amusing, colorful Station Y-Y-Y-Y, by Booth Tarlcington. At a spring assembly each year, the Sophomore class has been entertained by dramatists from their own group. ln this year's assembly, the Thespians repeated the presentation ot Tarlcington's play, which had been given at the Women's Club. Toward the end of the school year, the club had a spring party, at which everybody enjoyed himselt. This event brought the club year to a close, Each member ielt that his time in play production had been worthwhile. S5 Play Scenes -if ' ' . ... . Q .. .., . f FRONT ROWWI. Morthland, R. Guerine, G. Hendricks, R. Voras, Mr. Hinds, I. Blackwelder, D. Saunders, H. Fass, I. Sabine, A. Zeinfeld. MIDDLE ROW4N. Elisco, L. Behrens, W. Vollendorf, G. Hart, P. Yates, L. Kinloch, K. Grosshauser, I. Bainbridge, T. Ellison, M. Oill. BACK ROW--R. Peterson, H. Schmidt, N. Essig, I. Felt, E. Richter, K. Hermann, R. Mayer, H. Merz, B. Kilinsky, R. Osburn, D. Owen, N. Kaplan. FRONT ROW-W. Ingalls, C. Moore, E. Hubbard, M. Garland, S. Bokemeier, Mr. Adair, R. Stebbins, B. Shapiro, C. Hollowell, W. Crowley, B. Bythell. MIDDLE ROW-V. Krefft, K. Black, N. Balkin, A. Berger, I. Marousek, R. Robinson, A. Hubsch, A. McGoveny, E. Fitzgerald, O. Dykstra, R. Swangren, B. Clark, Wm. Martin. BACK' ROW-A. Bernhardt, R. Cuthbertson, V. Forgue, R. Iohnson, W. Tiefenthal, L. Guill, C. Kane, H. Griesbach, G. Thompson, Wm. Riggs, A. Grunt. fNot in picturel-G. Hollowell, W. Swanson, A. Samuel- sohn, E. Stokes, R. Mangnall. During the past year, the The outstanding activities of Section ll, which lunior Hi-Y Iunior Hi-Y sections experi- enced a successful season. This Iunior movement was split up into two organiza- tions because of the swelling in the ranks of appli-- cants during the last two years. The purpose of these organizations is fundamen- tally the same as that of all Hi-Y groups: to create, maintain, and extend throughout the community high standards of Christian character. lt is with this purpose in mind that the club members have planned their entertaining and educational meet- ings. After Section l had lost its sponsor, through the resignation of T. V. Corgan, the organization ac- quired a new guardian angel in the person of I. W. Hinds, who took over his position at the be- ginning of the second semester and finished a suc- cessful year of activities. Besides the educational trips, which are taken every year, the most out- standing event was the sponsoring of a splash-party in conjunction with Section ll. The club also took part in the banquet, sponsored by the Senior Hi-Y. proved to be a very active organization under the able direction of D. D. Adair, were the inauguration of a successful table tennis tournament, held for its members, and the sponsoring of a social meeting at the home of one of its members. The club also sponsored a booth at the Girls' League Fiesta, took a trip to the Mars Candy Factory, and participated in the joint organization banquet. These Hi-Y groups are second only to the Varsity Club in the impressiveness and strenuousness of their initiation of new members. The initiates are really put through a strenuous ritual in order to see that they contain the right stuff to warrant mem- bership. But after this gruelling session is com- pleted, the boys are ushered into the wonders of the Hi-Y world. lt is to be remembered that this club is the basic foundation for the Senior Hi-Y, as in a few years the membership of the Senior Club will be for the most part former Iunior members. This is due to the fact that boys who are interested in this work usually wish to carry on in the advanced activities. , ,-fs it . . Mu... Mwmtmbwqwgelvvrxhvizsiuima -N I FRONT ROW-Wm. Frees, E. Falkenhagen, C. De Wire, M. Stein, R. Campbell, G. Hansson, E. Witt, H. Von Gehr, G. Hanson, G. Casper. SECOND ROW-Wm. Thompson, C. Schauberger, R. Wessling, F. Orland, R. Lynch, W. Rheingrover, H. Joslyn, R. Vertuno, R. O'Dea, Wm. Bleck. THTRD ROW-D. Leal, E. Laubly, W. Bene-deck, R. Vahldick, R. Hubinek, W. Wilcox, T. Boardman, H. Carne, A. Edwards. FOURTH ROW-D. Mclntyre, B. Bailey, R. Horton, E. Ge-rkin, F. Ahlers, C. Ca mp, F. Hardesty, H. Meyer, R. Locke, R. lohnson. FRONT ROW-R. Passarella, E. Fitzgerald, R. Rankin, C. Hahn, Mr. Medsker, C. Clark, W. Hermann, D. Abbott, H. Gehr, K. Gleason. SECOND ROW-K. Eqeberg, R. Marquette, D. Kanara, A. Vidlund, R. Hartigan, R. Berliner, H. Iohnson, I. Tiefenthal, I. Magsino, C. Propst. THIRD ROW-H. Van Gunten, E. Garrett, W. Paglusch, I. Lawlor, I. Winters, R. Lenaker, H. White, H. Alderson, D. Logan, F.Kandler, M. Fries. FOURTH ROW-AL. Scheiblein, Wm. O'Rourke, Wm. Iohnson, I. Marsh, D. Hedges, C. Andersen, R. Winders. The Senior Hi-Y came, saw, and conquered many things in the way of extra-curricular activities in Proviso this year. Leland L. Medsker again led the organization in achieving new heights in carrying out the club's purposeg namely, to create, maintain, and extend throughout the school and community, high stand- ards of Christian character. The first get-together of the year was an informal but impressive affair with the impressions being made upon the incoming brethren, who were given the proverbial works by the old members. This bit of schelloching was executed in October. At the Oak Park-Proviso Older Boys' Conference, November 23 to 25, the Proviso delegates acquired some first-hand information on the world at large from the very prominent speaker, Waldo Heinrichs. ln keeping with its long-established custom, the organization contributed Thanksgiving baskets to needy families and also helped in the distribution of them. The Damon and Pythias spirit still prevailed when Vice-president Russell Campbell and Clarence De Wire were proclaimed the final Winners over the representatives of some twenty clubs in the lntra- Club Speech Contest, thereby winning the plaque. Athletics took the limelight in the group's activ- 87 ., . u..,,i..:f1i.. ,-.Li-,Jr-f,-..-. --M.-. .. f. . ,,..,z.g.Q,g,g,,,,.s.. J., L.,-A.-muh-,,..,L,.. ties in December when a game-night and a splash- party provided the enter- tainment for two meetings. In order to secure programs that the entire club desired, Dr. Clayton Clark of Oak Park was engaged to deliver a series of lectures in March. Accompany- ing slides made Dr. Clark's points more explicit, and these frank discussions proved both interesting and helpful to the chapter. The annual joint Hi-Y banquet with Oak Park and LaGrange High Schools in the school cafeteria, March 12, was also deemed a big success. Coach Lynn Waldorf and his associates at Northwestern Uni- versity were the speakers of the evening, and they related many humorous stories. In order to replenish the treasury, a motion picture, Big News, was sponsored in March. Copies of the l935 Provi were the much-sought-after door prizes. With cash on hand, the boys were able to continue the practice of giving the annual Hi-Y dance. Each member had the honor and pleasure of escorting his best girl to the Hi-Y Hop held in the social room the latter part of April. New spring fashions seemed in vogue, and it was this joyous occasion that mark- ed the close of another successful year for the Senior Hi-Y. Senior l-li-Y FRONT ROW--H. Todd, G. Walters, R. Stutt, S. La Spisa, C. Bludorn, Miss Pickles, M. Weber, A. O'Rourke, M. Holland, L. Puscheck, A. Guth. SEC- OND ROW-L. Kaufeldt, V. Maher, M. Koeppel, l. McCreary, M. Kinne, H. Mahnke, C. Popp, R. Haeh- ne, D. Linnewek, D. Hohe, L. Loeck. THTRD ROW! M. Glos, M. Pfrang, E. Mc- Narnar, H. Hesterrnan, I. Madsen, E. Kingdon, E. Kingdon, E. Popp, D. Pe- ters. FOURTH ROW---R. Parchman, O. Olson, M. Ptolemy, B. Popp, E. Lahrn, M. Madsen, M. Heegn, K. Tones, G. Hillyer, R. Hof- mann. FRONT ROVV--B. Arra Baynes, A. Belluornini, G. Dammann, S. Buginas Bulger, M. Gutenson, I. Garey, l. Behrens, B. Braatz, ,D. ,G. A. Engbrecht. SECOND ROW -S. Didech, F. Bellu- ornini, E. Dons, C. Fuller, E. Clauss, I. Becker, I. Ehr- mann, E. Collins, G. Con- don, V. Fippinger. THTRD ROW---R. Beutel, E. Chris- tensen, l. Bollow, E. Baci- galupo, Margaret Good- rich, E. Engel, L. Dumond, l. Eichman, M. Doerr. FOURTH ROW---B. Cline, L. Fritzler, C. Gilbert, E. Garrett, R. Blasius, A. Corell, C. Freiday, E. Bea- ven, R. Ford. FRONT ROW- B. Schutz, V. Reich, E. Rickor, F. Stahl, F. Martin, P. Krickl, S. Zwirblis, M. Ziesemer, l. Sponsler, R. Shibley, I. Williams. SECOND ROW - E. Waschitz, D. Ciinino, F. Rittmueller, L. Treybal, L. Schaefer, M. Thiesse, G. Zawne, E. Weiss, M. Cul- linan, C. Strong, B. Sisson. THTRD ROW D. Tosch, G. Stronge, E. Witzko, G. Weltler, B. Sandro, F. Schuster, E. Zwerblis, G. Romonas, l. Youngborg, W. Schultz, M. Vandorhofe. FOURTH ROW ---E. Toner, V. Treabess, R. Schaper. F. Hahn, l. Kalicinski, V. Mueller, M. Metti, E. Leake, E. Owen, L. Krueger, E. Merkel. Stitch, stitch, stitch, hummed the busy Economics Club mchmes manipu- lated by the Welfare Committee as they remodeled, mended, and patched old clothes and cut, sewed, and finished new gar- ments for the unemployed. Lora Puscheck was in charge of this work, the main project of the Senior Home Economics Club this year. The officers and new members were installed at the first meeting with an impressive and solemn ceremony, in keeping with a state-wide custom of home economics clubs. Miss Lola Pickles, club spon- sor, reported onthe American Home Economics Club meeting which convened in New York in lune, l934. ln November, Miss Pickles, Hilda Mahnke, and Muriel Weber represented the club at the annual con- vention of the Illinois Home Economics Association held at Springfield, lll. Senior Home Interest in home economics was stimulated by a number of talks given throughout the year. Mrs. Wil- liam Ray, director of the Vogue School of Fashions, spoke on Design and Color in Dress and Designing as a Vocation. C. W. Curry of the American Can Company explained How to Be a Better Buyer of Canned Foods. A musicale, under the direction of the music committee, was presented at the April meeting. At the St. Patrick's Day Party, the members of the lunior Club entertained the Senior Club with a play on etiquette. An exhibition of the welfare work was given by the club members, the faculty and all girls in school were invited to see the display. All of the l5U members have taken or are taking a course in clothing, foods, home management, or home decoration. This organization seeks to broaden the girls' personalities and to enrich their knowledge of the home arts. .gf FRONT RO'W-- L. Friend A. Buta, A. Vfentland, C Karger, N. Rule, Miss Porch, E. Huppenbauer, I Penrose, I. Rossing, D Kannenberg, S. Agnew, F. Stacey. MIDDLE ROW-- M. Strong, L. Ftodenhostel l. Rankin, E. Puscheck, P Kluender, G. Zawne, F Bachilunas, A. Vvfaichunas F. Notts, L. Norton, F Ratlike, C. Wolff, H, Phil lips, A. Chelstrom, BACE ROW -N. Bartlett, B. Hux hold, G. leschke, l. Has litt, R. Marsh, C. Holer, I Worninghaus, M. Gustai son, B. Bechtelheirncr, L Stoftenhagen, l. Fisher, F Stephens, l. Baranyi. FRONT BO'W--M. Haw kins, D. Carver, l. Ander son, D. Pilgrim, E. Knaack I. Holland, M. Boeger, L Bohlander, H. Hayes, H Macphail, D. Hamilton MIDDLE ROW B. Dietz l. Davidson, F. Schart, P Zonno, L. Desens, M. Bay nos, E. Burnett, C. Slater H. Pratt, S. Barth. BACE-I ROVJ- -E. 'VVirz, D. Kinne B. Cook, B. St. lean, A Vanderbroucke, l. Hirsch L. Goodrich, L, Hayes, B Todd, A. Baron, R. Young er, H. Groenhcf, l. Betts. H. Hayes, H. Macpliail, l.ff. Beard, C. Edbrooke, A. DL The lunior Home Economics Club, patterned after its sister organization, the Senior Home Economics Club, endeavors to illustrate by practical demonstra- tion, the arts and crafts of horne-making which the class work introduces. The club started in October with an installation service for officers and new members. ln November, Miss Mildred Batz, a representative of the National Live Stock Board, was the guest speaker. She accom' panied her lecture with a practical demonstration of the New Methods of Meat Cookery. loan Holland, president of the club, was the otticial delegate to the State Home Economics Association Convention in Springfield on November 9 and lO. Before the holiday recess, all the members were busy making strips of bright calico into chubby little animal toys. lt is a custom, at Christmas time, for the club to present batches of these home-made zoo specimens to the inmates of the children's ward at the Cook County Hospital. The vacation be- Economics Club gan with a gay Christmas party in the gym when the girls donned kid costumes. The student committee consisted of Marian Boeger, Elma Puscheck, Helen McPhail, and lunior Home Helen Hayes. The lanuary meeting was devoted to the subject, Proper Etiquette. A play, Manners, written by Marian Boeger, was presented by members of the club. At a joint meeting with the Senior Club in Feb- ruary, C. W. Curry, a representative ot the Amerie can Can Company, lectured on Better Buying of Canned Foods. A MothereDaugl'1ter Tea was the fea- ture of the March activities, and a field trip was made to a large milk plant in April. The Spring Party in May closed a year of pleasant and profitable activities. Hawkins, D. Pilgrim. f. Holtand, D. Carver, l.f. Boeger I. Axderson, C. Ha'ni.tc r Krifrack FRONT ROW-E. Gyoerkoes, R. Richter, H. Woeltje, L. Loeck, A, Lossin, L. Drevs, Miss Hahn, G. Stroschein, S. Buginas, R. Peterson, A. Weltler, D. Cimino. MIDDLE ROWfN. Baker, E. Cunningham, E. Noffs, L. Schiller, M. Thiesse, C. Buza, E. Engel, L. Krueger, B. Brown, G. Engbrecht, E. Weiss, Frances Kral. BACK ROW--C. Freiday, R. Pearson, F. Martin, G. Romonas, C.lohnson, F.Dahne, R. Lindgren, E. Eahr, M. Madsen, R. Schaper, V. Lapinski, E. Beaven. FRONT ROW-R. Spagnola, B. Arra, V. Clement, L. Kaufeldt, B. Schulz, M. Ouitsch, S. Rapaport, L. Heidelbach, R. Stutt, F. Cheney, H. Smith, B. Philpot. MlDDLE ROWfA. Schulz, B. Sandro, I. Litke, M. Ptolemy, M. Moscicke, G. Weltler, I. Dahne, G. Rupietta, M. Crabbe, M. Gutenson, L. Herber, E. Stern, M. Kunzmann, E. Paley. BACK ROWfL. Ewen, E. Miller, E. Edelman, F. Garnowicz, V. Treabess, R. Schlichting, A. Paulsen, I. Youngberg, G. Vfasilevich, E. Hahn, P. Waqflef- merce, and to co-operate with business organizations and service clubs. This affiliation should work for the mutual satisfaction of both merchants who are look- ing for future desirable employees and commerce students who are anxious to make profitable business connections for employment after graduation. The object of the Commercial Club is to furnish some Commercial Club measure of vocational guidance to students and to aid them to better understand the economic organiza- tion of the complex society in which they live and in which they will earn their livelihood. One unit of credit in the Commerce Department is the prerequisite for eligibility to the club. ln order to allow the members to become better acquainted with this work-a-day world through friendly discussion with business men and women, On Lincoln's birthday, a group of members took a tour through the fifty-five acres of floor space of the new 322,000,000 Chicago Post Office, where they saw how the millions of letters are distributed to keep the wheels of business whirling. the club secured L. Crittendon, of the Kimball Piano Company, to speak on Salesmanship at the open meeting, which was held on the evening when Proviso students brought their parents to visit their clubs during Better Education Week. Other programs included a talk by Miss Marguerite Giezentanner on Encyclopedias and Commerce, and one by Miss Clara lohnson, who told of Norway's place among the nations of the world. An illustrated lecture on the transportation and irrigation of EQIYDt was given by Alden Greene. The probable reorganization of the club next year as a lunior Chamber of Commerce was discussed by E. F. Cameron at the May meeting. The plan is to try to model the club after the Chamber of Com- But all work and no play is not the maxim of this club, for several social meetings and events inter- spersed the schedule of programs of the season. In November, Miss Florence Scott told of her delightful experiences and memories of the colorful island of Hawaii. Walter Wilcox and Arlene Vanek created a realistic atmosphere with Hawaiian music and dancing. Yuletide was celebrated with a program of stories and songs from the Christmas lore of many lands. A farewell dance on May 3 climaxed a year of social and educational events. The club members and officers wish to express their appreciation for the excellent leadership and guidance which Miss Alice Hahn, club sponsor for the past six years, has given them. FRONT ROW-M. Capling, D. Parker, E. Noffs, L. Greenwell, L. Weinberg, Miss Hammitt, Mr. Carter, N. Essig, B. Fawcett, M. Taylor, F. Tamelis. MIDDLE HOW-A. Spolin, E. Ernster, I. Nelson, B. Barrer, I. Stromquist, E. Connors, f. Holland, G. Simonov, H. Lande, M. Zielke, D. Bulger, M. Therriault, I. Ostler. BACK ROW-F. Orland, M. Grant, P. Giunta, S. Feinner, E. Timmons, R. Iohnson, H. Ancel, T. Fink, I. Wynne, H. Ioslyn, L. Marcus, C. DeWire, M. Ziesmer. STUDENTS AT WORK IN LIBRARY The creak and squeak of the book cart rolling down the aisle announces that a library page is about to begin replacing books on the shelves so that students coming in during the next period will find them in some degree of order. Replacement of books is only one of the many routine duties that members of the staff perform. Their varied activities include helping prepare books for circulationg taking care of reserve shelves, magazines, fines, overdue notices, and library slipsg assisting at the circulation desk, and mending books. ln order to become a member of the Staff, a stu- dent must be recommended by a teacher and ap- proved by the librarian. Staff members must main- tain a scholastic average of three or above. These students receive valuable training in co-operation, service, and experience in library work. To lure the curious and adventurous-minded to leaf through a book on a Worthwhile or unusual hobby, a special shelf of books on subjects from toy-making to astronomy was arranged during National Book Week. Displays and posters advertised the wonders of foreign countries and intrigued many to examine the books describing them. After delving a little deeper than the first chapter, many readers discover- ed that the books were - entertaining as well as in- Llbrary formative. More than seven hundred books were added to the Proviso Library during the year. From five to six hundred books a year go to the hospital to be rebound. Many books which are mutilated by thoughtless and careless pupils must be sent to the Workshop for repairs. A library is the heart of any school because it supplies books, magazines, and pamphlets for refer- ence Work in all departments of the school. The library at Proviso is no exception. lt is one of the beauty spots of the new buildingp and since the stu- dents are coming to appreciate its importance, the at- tendance has increased steadily. ln February of l934, there was an attendance of l0,989y in the same month of 1935, the number was l3,7l8, an increase of 2,729 ln March of l935 the attendance showed an increase of 5,000 over March of the preceding year. The circulation of books for home use has in- creased proportionatelyg in February of 1935, there were l,400 more volumes taken home than in Feb- ruary of l934. 'R ' X. . - 5 few-. . .-K2 'T I ' F91 1 : 'L- ,A J- ff' - - I-In ., . . . '7 . tv s N-- . ' vi ' - fa sy Qs FRONT ROW---I. Fausset, D. Cramer, F. Buta, R. Peterson, R. Pommier, Mr. Bullington, W, Rheingrover, Wm. Faglusch, D. Re, E. Huebner, S. Levinthal. SECOND ROW-V-C. David, G. Troeger, Wm. Crowley, D. Forshall, B. Douglas, R. Kern, V. Drews, W. Stebel, R. Goldman, PI Wade, D. Buik, E. Karras, I. Castleman. THIRD ROW--H. Davis, D. Damrnann, S. Berger, C. Wyrner, V. Wright, R. Martens, C. Bill, M. Pfrang, I. Stromguist, M. Iahp, E. Dubin, I. Vtfright, L. Verkler. FOURTH ROVV--E. Watkins, I. Hirsch, M. Garland, M. Walguist, VV. Ramsay, B. Vtfilcox, F. Pochert, L. Paetz, H. Weiss, H. Skoglund, S. Zapler, G. Hendricks. tNot in picture: S. La Spisa, B. Hildebrandt, M. Leming, B. Vt7atkins.D FRONT ROW---Llialicinski, G. Stronge, W. Brosseit, I. Burk, C. Olleman, Mr. Iohnson, M. Mcscicke, E. Ulrich, E. Penrose, I. Lindgren, R. Hill. SECOND ROW- f-D. De Wolf, A. Christian, A. Arrighi, D. Cimino, I. Grube, C. McLaughlin, George Hussey, R. Schulz, E. Faley, E. Massic, D. Christian, V. Iohnson, A. Hart. THIRD ROW I. Thacker, E. Fitzgerald, M. Crossley, I. Lueck, I. Kinniburgh, M. Metti, R. Davis, E. Edelman, D. Neal, I. Hart. FOURTH ROW -A. Diestel, B. Moncrieff, Wm. Fitzgerald, E. Marik, S. Feinner, R. Iohnson, R. Cremons, M. Bakewell, R. Sedgwick, F. Forkin, R. Franzen. Last fall, under the supervision of Adrian Bullington, a group of students interested in the study of any phase of nature organized the Natural- ists Club. They strive to acquaint themselves with plants and animal life in this vicinity and to foster the conservation of such life. To increase their appre- ciation of nature, hobbies are encouraged among the members. On March 8, the Naturalists sponsored a matinee dance, the profits from which were used to meet the Camera. The clicking of cameras often heard 'round and about Rroviso makes us realize the importance of the Camera Club. At the beginning of the year, many a frightened Freshman wiped his brow after going through the terrific ordeal of having his identification picture taken. The per- sonal photographs that the club took at the Gypsy Fiesta will serve as a lasting memory of that event. An enlarger, purchased during the year, greatly increased the scope of Work for the amateur photog- raphers and provided enthusiastic members many hours of pleasure. Under the sponsorship of Harvey expenses incurred by their several trips. Among the places visited during the year were Garfield Park Conservatory, Amling's Greenhouse, and the Trailside Museum. The club made a rather extensive study of plant life, especially that found in the neighboring forest preserves, Where most of their specimens were obtained on field trips. One of the main projects of the Naturalists has been the study of tropical specimens. ln connection with this interest, the club has maintained an aquarium of tropical fish in the zoology laboratory. F. Iohnson, lectures and pictures on various phases of photography were presented. The organization paid a Worthwhile visit to the Toloff Studio in Oak Park, Where they explored the Wonders of the dark and engraving rooms. Entertaining and characteristic poses of club and play groups taken for the Provi and for general advertising purposes, kept sponsor and members working night and day. The membership of the club has steadily increased as enthusiasm in amateur photography has caught the imagination of many students. FRONT ROW---L. Hesselbarth, B. Caffero, E. Dunn, E. Larson, L. Seren, S. Zeinfeld, Mr. Kochenderfer, S. Barsky, C. Propst, C. Olleman. SECOND ROW -L. Weinberg, E. Richter, D. Leal, H. Spyrison, L. Mullen, H. Weiss, G. Washow, R. Walquist, B. Olson, W. Thompson, F. Orland, V. Krefft. THIRD ROW --V. Wright, A. Glaudin, K. Iohnson, T. Poslika, M. Pries, L. Klean, R. lohnson, F. Forkin, E. Allers, P. Iacobson, L. Renae. FOURTH ROW-R. Greenwell, M. Ratner, B. Bailey, R. Blasius, l. Burk, D, Nanninga, D. Hedges, M. Coleman, F. Urbaytis, R. Crabbe, S. Feinner, E. Witt. FRONT ROW -D. Stenersen, F. Buta, D. Wright, N. Dettmar, I. Felt, L. Campbell, Miss Payne, lvl. Boeger, E. Tolsted, E. Knorring, G. Claim, M. Peach, B. Caffero. SECOND ROW --M. Young, M, Milles, P. Kewin, D. Forshall, C. Detlefsen, S. Levinthal, l. Stromquist, l. Holland, E. Forrest, E. Puscheck, E. Larson, D. Kramer, E. Karras, M. Carstens, l. Morthland. THIRD ROW -G. Davies, I. Rozanski, H. Lande, H. Schmidt, T. Caliendo, l. Cleland, R. Voras, A. Ramsay, V. Dodd, E. Boyd, L. McBride. BACK ROW E. Richter, L. Good- rich, R. Marsh, B. Carson, I. Hulbert, F. Behrendt, F. Pochert, N. Piskem, B. Dykhuis, M. Walguist, C. Hutter, K. Biddle. The Senior Science Club, by means of demonstra- tions of scientific phenomena, desires to promote an interest in various fields of science and to stimulate scientific reading and thinking. In the meetings, the possibilities of scientific careers in the fields of physics, chemistry, and photography were dis- cussed. The scientific exhibits in the Hall of Science as well as the House of Magic in the Electrical Building at the Century of Progress were visited in October. The club also took a trip to the Edward Hines lr. Memorial Hospital, and visited the radium depart- lsosceles triangles, guadrilaterals, polygons, locii, and mean proportionals hold no terrors for the present-day followers of the ancient Greek mathema- tician, Pythagoras, who form Proviso's Neo-Pythag- orean Society. For relaxation at their meetings, these mathematicians indulge in mathematical puzzles and fallacies. An element of humor is often added to the more serious problems by the presentation of plays showing the uses and abuses of mathematics. Composed of members made eligible by virtue of their outstanding work in Freshman algebra, the Neo-Pythagoreans have completed another success- ment while there. At an assembly, the members gleaned much knowledge of the mysterious element of radium, when they heard a lecture by Luther S. W. Gable, the lone survivor of a group of chemical engineers and research men who first refined radium in America. The events of the year were climaxed by the club's joining the lllinois lunior Academy of Science, which held its annual convention at Bloomington, where a delegation was sent to represent Proviso. Senior Science Club ful ear. ln addi- .....fg.. th... New-PYWGQOFGGHS lar meetings, the members also had a party, a picnic, and a trip to the Planetarium, where the intricacies of astronomy were disclosed by a lecture. The party, taking place at Christmas time, was the gala event of the year. A hike to Thatcher's Woods, followed by a picnic, concluded the year's activities. The fact that the membership doubled during the year is indicative of the value of this organization. lp. . SEATED--H. Hollowell, W. Hullihan, W. O'Rourlce, M. Ratner, G. Callahan, Miss Barnum, R. Clement, L. Boehm, R. Churchill, C. Kurz. STANDING--M. Crotty, E. Giunta, L. Weinberg, F. Orland, H. Carne, H. Knosp, L. Mullen, L. Marcus, G. Stronge, A. Evans, C. Ingalls. SEATED-V E. Whiteway, C. Kurz, W. Hermann, D, McLeod, W. Hullihan, Miss Barnum, I. Michael, W. O'Rourlce, A. Klein, E. Fippinger. STANDING C. Ingalls, S. Galloway, P. Murphy, L. Nott, M. Elisco, A. Kunes, H. Ianssen, A. Christiansen, L. Marcus, E, Leake, M. Rigden. SEATED I. Rogers, C. Kurz, C. Kane,, B. Dykhuis, I. Mascetti, Miss Barnum, D. Ebsen, I. Tarrants, D. Buck, E. Iantzen. STANDING- T. Hodgson, D. Berg, D. Shaffer, P. Murphy, R. Mohr, R. Monson, D. BTUYH, L- Kiefllle, A- NGWSOI1, T. Sheirl- Statesmen To provide a greater oppor- tunity for the discussion of cur- rent problems in world affairs than the class period offered, the members of the class in political science last February organized the Statesmen. The membership was divided into three standing committees whose duty it was to inform themselves on foreign, national, or municipal affairs. The pro- lntent upon visiting Tre-Velerg many local places of interest, The Travelers, a club composed of early European history students, has sponsored several trips during the year so that its members might learn more about places that have made Chicago famous. The first excursion was made to the campus of the University of Chicago. Later, a trip was made to the C A succession of activities OSm0pO 1 an designed to promote a better understanding of the peoples and customs of foreign nations was enjoyed this year by the Cosmopolitan Club. Student Activities Night brought Iudge Louis Senese of Melrose Park, who presented before the grams were made up of reports by these committees followed by an open forum. In April, a program by the committee on municipal affairs included talks on the government of Forest Park by Edward Giunta and Georgiana Stronge. There was also a report by Frank Orland on Senator Gerald P. Nye's address on the munitions industry, before the Institute of World Co-operation. Adler Planetarium, where The Travelers attended a lecture. Still another tour was made to the American Historical Society Museum. At the annual party, the spectacular Hungry Five presented German music and comedy skits. Members of this entertaining ensemble are Robert Koschmann, Robert Knopf, Clarence Kurz, Stanley Mankunas, and Paul Nellen. club and guests a lecture, illustrated with several reels of films on The New Italy. Later in the year, the club was host to two young Porto Rican girls, the Misses Lijia Colon and Edith Rodriguez, from Rosary College, who related their impressions of American schools. To close a successful year, an informal party was held on May 4, in the social room. .JNT ROW-K. Tones, E. McNamar, L. Haugh, I. Gustafson, E. .' i lorson, D. Erickson. SECOND ROW S. lamescn, C. Ingalls, A. M. Hurwitz, E. Seeley, l. Garey, G. Henzler, B. Hilton, D. Klupping. gran, R. Lindgren, R. lohnson, F. Dahne, A. Dugaw, V. Busboom, Eehr, R. Locke, B. Bailey, E. Lobaeli, R. Cremcns, C. Kurz, N. FRONT ROW---E. Wentland, P, Wagner, E. Miller, G. Mielke, D. N . Moscicke. SECOND ROWfl. Sponsler, A. Spolin, E. Moreno, E. W'aschitz, G. Gorr, A. 'Williams D. Wessen. THIRD ROW' -S. A. Vidlund, E. Sullivan, M. Pries, L. Raab, L. Marcus, M. Rigden, Peterson, H. Silisky, E. Zwerbiis, M. Peters, E. 'Witt M. Ratner, E. The Historians, one of the clubs organized last fall, was formed by the students of the United States history classes for the purpose of promoting an ever- widening interest in and an understanding of history, past and present. Among the activities undertaken by the club was the care of a library bulletin-board on which were exhibited current articles and cartoons of foreign and national affairs, and sample ballots and campaign literature of the periods preceding elections. The group undertook the furnishing of a club room in the old social room. With its wicker furniture, radio, books, current periodicals, and a bulletin-board on which are posted items of interest concerning the affairs of the world, the room provides an attractive reading room to which club members are welcome at any time. During the winter, a Historian committee, headed by Edwin Vodicka, president, prepared and present- ed for public exhibition a display of historical ma- terial, which featured a collection of firearms. This 95 Bowen, Mr. Marshall, S. Grinpas, Marie Goodrich, E. Paley, L. Guth, V. Edmonds, E. Chelstrom, D. Bulger, M. Gutenson, I. Grube. THTRD ROW'--A. Hull, L. DeAngeles, E. Garrett, R. Davis, R. P. Lauth, l. Kalicinski. BACK ROW 'W. Hermann, l. Lawlor, Dodd, E. Laubly, H. Carne, R. Davies. eal, E. Vodicka, l. Schmitz, C. Schuster, E. Pellman, I. Stubbins, L. Vegter, L. McNeill, E. Owen, E. Ulrich, L. Treybal, I. Stevens, Eine, G. Zawne, M. Polzien, L. Weinberg, M. Ptolemy, E. McElroy, M. Thomas, l. Polito. BACK ROW H. Amling, H. Mahnke, R. Prcltasco, V. Treabess K. Tohnson, VV. Lant, C. Buza. drew acclaim from the students, . . the teachers, and the people of H1StOF1anS the community. ln the spring of the year, a group of members un- der the direction of Milton Ratner sponsored the exhi- bition of a collection of books, papers, pictures, and other items of interest in connection with the Twenty- Eifth Anniversary of Proviso High School, and the Tercentenary of the founding of secondary educa- tion in the United States, which was celebrated in April. At several of their meetings, the club had guest speakers, including Professor W. T. Hutchin- son of the University of Chicago, who spoke on a special phase of early American history, and Dan Thrapp, an explorer attached to the American Mu- seum of Natural History, who gave an enlightening talk on the western part of our country. He related his experiences during the period when he was ex- ploring the unpopulated wildernesses of Utah, Colo- rado, Arizona, and New Mexico. FRONT ROW-D. Berg, L. Bingham, G. Callahan, G. Cunningham, E. Cool, M. Burns, H. Davis, D. Dammann, S. Catenacci, I. Harrison, A. DiZonno. SECOND BOW-M. Carter, C, Bludorn, M. Birch, L. Dahne, C. Budd, L. Campbell, L. Barthel, M. Catenacci, M. Blair, V. Clement, W. Crowley. THIRD BOW V. Busboom, I. Bolland, L. Anderson, C. Buonauro, E. Breen, C. Chronisier, H, Dauber, B. DiVerde, T, Caliendo, S. Berger, B. Cline. BACK BOW---B. Brown, S. Bokemeier, F. Dahne, N. Dodd, B. Davies, G, Dietz, B. Cremons, S. Barsky, R. Crabbe, I. Alexander, B. Davis, I. Cleland. FRONT BOW-L. Dumond, D, King, B. Hollander, S. Kirby, Ethel Kingdon, Edna Kingdon, E. Hayes, E. Huebner, l. Kalicinski, V. Drews, M. I. Crossley. SECOND BOW---M. Kunzmann, N. Goy, H. Faraci, F. Gavin, C. Earl, M. Hurwitz, M. Knosp, L. Karns, D. Hall. THlRD BOW-L. Iones, I. Hart, O. Kamenko, L. Hayes, M. Fastert, R. Gosch, F. Fultz, A. Dugaw, R. Donaldson. BACK ROW--I. Hirsch, P. Giunta, C. Iohnson, C. Kurz, G. Hupp, R. Griesbach, L. Ioyce, C. Hahn, K. Iones. What shall be my life's work? Where are the best opportuni- ties? How shall l go about plan- ning for this work? How can l secure a position? These are but a few of the student problems the Dial Club is endeavoring to solve. From questionnaires filled out by the student body, it was strikingly ap- parent that vocational guidance was not only needed but desired. With the thought of providing such service, the Civics Club was reorganized with broader objectives, renamed the Dial Club, and placed under the sponsorship of M. M. Finstad and Clarence W. Failor of the Commerce Department. The new club held its initial meeting on February 27. A noted American once said that educated people must labor, otherwise education itself would become a positive and intolerable evil. No country can sustain in idleness more than a small per- centage of its members. The great majority must labor at something productive. Each individual must acquaint himself with the work of society, with his own fitness for certain kinds of work, and then prepare himself to do that work well. Before the age of specialization, when life was simple, the only qualifications boys and girls needed were strong bodies and intelligence. Today, life is so complex that, if they are to compete successfully in the con- test of life, they must fit themselves for the struggle. One of the major aims of school life is to help each one choose a vocation in which he will be happy. How is the student to know the vocation for which he is best fitted? Briefly stated the answer is Know thyself and know the vocation. Hence, the primary objective of the Dial Club is to enable the students to see, through others' experi- ences, the various fields of human endeavors, to engender a wholesome attitude toward all types of useful service, to enlighten them regarding the vocational facts to be considered by each individual in formulating his occupational objectives, and io provide patterns to serve as guides in the choice and formation of a life purpose. ln addition to the voca- tional objective, the club aims to inspire in its mem- bers a desire to fulfill the great aim of all education- good citizenship, social and economic as well as political, We have established our democracy upon the fundamental principle of equality and freedom. This necessitates good citizenship. The corner stone of good citizenship is ability to earn a living wage. Furthermore, the club seeks to build in each indi- vidual a sterling character, a character which will be a life-long credit to himself, to the school, and to the community. Pfam.. .Lug FRONT ROW--Y. Oliaro, V. Lapinski, H. Mahnke, D. Neal, E. Probasco, M. Peters, H. Olson, L. Petraitis, R. Much, D. Mowrer, O. Olson. SECOND ROW---A. La Rocca, D. Peters, H. Papke, R. Mueller, A. Pocius, A. O'Rourke, A. Livingstone, K. Petrakes, L. Munger, l. Penrose. THTRD ROWQI. Madsen, H. Lande, I. Miers, R. Marquette, I. Polito, V. Nedzel, G. Peckat, l. Pickens, I. Martens. BACK ROW+R. Phelps, T. Poshka, G. Newton, R. Locke, D. McLeod, F. Leverette, M. Lietz, I. McKean, R. Osburn. FRONT ROW-D. Re, D. Schulte, N. Piancino, I. Eausset, l. Hulbert, Mr. Failor, Mr. Finstad, R. Pratt, B, Schutz, L. Sinclair, L. Schaefer. SECOND ROW-W. Sager, W. Trochelman, G. Wilson, G. Rozanski, I. Stubbins, L. Verkler, E. Stern, B. Sisson, L. Schaefer, Y. Slotnick, W. Rausch, B. Stitt. THIRD ROW-D. Sager, M. Rigden, E. Ulrich, G. Yonczis, V. Tombrink, G. Vanalek, E. McElroy, H. Silisky, B. Schultz, B. Wade, L. Smith, E. Stokes. BACK ROW- -D. Taibleson, W. Ramsay, E. Witt, A. Weinberg, E. Urbaytis, C. Schuster, W. Wright, V. Silisky, R. Weber, T. Reading, W. Sisson, R. Rudd. The Dial Club's spirit of guidance is typified by its emblem which is the dial of the mariner's compass. The Words, ''Careers-Citizenship---Character,'' sur- round the sixteen-point star in a circular border with the monogram, DC, in the center. The major project of the Dial Club was a series of vocational guidance conferences at which labor- ing, business, and professional men and Women spoke on various phases of their life Work-fits joys, its problems, its compensations. ln preparation for these events, each student was requested to indicate the occupation in which he was especially interested, the assistance he had received so far, and his desire for further aid and information. On the basis of this tabulation, it was established that there is a sincere desire for guidance on the part of Proviso students, and a study of their choice of occupation proves a definite need for it. Students are planning to enter certain vocations in numbers far in excess of any existing demands for Workers in a given field, and other occupations not so crowded are virtually ignored. The gravity of this condition was one of the many things explained during these valuable con- ferences. At the bi-weekly meetings, members of the faculty and prominent counselors from the metro- politan area gave the members of the club the bene- fit of their expert knowledge and of their experiences -V-M1-2-1--uuiaxinh'- '-' ' f - in the real business of earnin - O, hvmq, q Dial Club ln the past, far too many men and Women have tried to fit themselves into posi- tions where they do not belong. They failed to realize until too late the truth of the saying, A square peg driven into a round hole makes many splinters. lt is the hope of the Dial Club to aid particularly those who have not planned seriously for the future but feel the vital need for stimulating guidance, and also, in co-operation with the school, to develop students possessed with the spirit of self- reliance, self-support, and self-respect. Brutes find out where their talents liee A bear will not attempt to fly, A foundered horse will oft debate Before he tries a five-barred gate. A dog by instinct turns aside Who sees the ditch too deep and wide. But man we find the only creature Who, led by folly, combats nature, Who, when she loudly cries forbear, With obstinacy fixes there: And where his genius least inclines Absurdly bends his whole designs. +An Old English Rhyme SEATED-M. Capling, H. Ancel, Y. Dorf, H. Olson, Mr. Street, Mr. lmmel, R. Lande, R. Campbell, R. Wiley, T. Lueck, L. Wispe. STANDING-A. Spolin, M. Catenacci, E. Buchholz, R. Pratt, T. Groenke, F. Or- land, L. Vlfeinberg, L. Ser- en, L, Bingham, C. Schil- lace. SEATED--L. Seren, F. Or- land, R. Pratt Y. Dorf, H. Qlson, Mr. lmmel, Mr. Street, R. Wiley, M. Cap- ling, G. Bruce, K. Rocke- feller, T. Groenke. SEATED --C. Kurz, C. Re rnus, E. Marik, F, Urbaytis Mr. Moelk, Mr. Appleton C. Ruffer, W. Martinson. T Iohnson, R. Oliver. STAND ING--H. Clausen, D. Mor- itz, T. White, W. Allen, E. Valenta, WL Rheinfels, R Horton, W. Keillor, C. Carl son, N. Kafka. . The click of a key, the buzz :Rad-10 of a receiverfonce more the members of the Radio Club are at work, four stories up in the cold, bleak atmosphere of Proviso's tower. Many of the mem- bers are licensed amateurs who insist on being called hams g the others, who aim to join the former group some day, have been admitted only after a stiff examination. At the regular meetings F dh Cicero and Vergil actually Orum an had little more enthusiasm Debate than the members of the Forum, a club newly cre- ated this year to promote an interest in the various forms of public speaking. The club sponsored an inter-club debating contest on What is the Typical Proviso Student? The con- test was won by the Senior Hi-Y Club, represented by Clarence DeWire and Russell Campbell. Several members of the Forum make up the debate team, and Proviso's debating group joined the Chi' cago Area Debate League. The schools included in this League are Hammond High and George Rogers Clark High of Hammond, lnd., New Trier, Morton, Von Steuben, Englewood, McKinley, Thorne ton, and Proviso. Of sixteen decisions, Proviso won twelve and lost four. Competing in the district meet at DeKalb on each Monday, the group discusses various phases of amateur radio. By sponsoring a successful matinee dance on lanuary ll, the club made enough money to build a new transmitter for sending out voice as well as code transmissions. Thus, students possessing short- wave or all-wave receivers may be pleasantly sur- prised when they hear the voices of their classmates as they actually talk to other hams in various parts of the world. March 30 were: Elgin, Mendota, Sterling, Freeport, West Aurora, Sandwich, and Proviso. There, Proviso won four and lost two decisions, tying for second place with Sandwich, Ill. As a result of these vic- tories, the team was invited to compete in the state finals held on April 29 and 30, at Urbana. Perhaps the reason the club came forth with such good results is that they had practice in non-decision dual debates with Maine, Mendota, LaGrange, Hins- dale, and Elgin. Regularly competing on the affirmative for Proviso were: Theodore Groenke, Kenneth Rockefeller, and Frank Grland: on the negative were: Gerald Bruce, Rosemary Wiley, and Leo Seren. The subject for the debates was, Resolved: that the Federal Government should adopt the policy of equalizing educational opportunities throughout the nation by annual grants to the several states for public elementary, and secondary education. N Cf' Wm ., A medieval atmosphere prevails at the meetings of the Chess and Checker Club where bold knights are constantly attempting to capture enemy castles and to subdue opposing kings. The club admits all members who show an interest in ye olde game, and shows them how to conquer their fellow oppon- ents as well as their honorable parents from whom some of them have learned the game. After each business meeting, the members compete with each other, experimenting with newly-born strategy. The Band Parents might fittingly be called the god- parents of the band, for they have contributed much to its financial well-being. Ever since its organiza- tion, a little more than two years ago, the associa- tion's objective has been to support the band in all its undertakings. lt has given its assistance in sponsoring projects to raise money for purchasing uniforms and instru- ments. One of these plans was the benefit show, Grand Canary, shown at the Lido Theater, with the ninety-piece Proviso Band furnishing the music. This was the third annual show under the Band Parents' sponsorship, and it proved quite successful. A card and dance party, held at the Maywood Armory, was another of the many projects which did much toward refilling the treasury. P45 FRONT ROW- R. Niko, G. Wittekindt, T. Honquest, E. Becht, Mr. Baer, l. Lang, A. Kapler, WK Peters, M. Har- iner. BACK ROW-T. Cali- endo, R. Keating, M. Wil- lor, L. Voigts, C. Gardner, V. Stone, A. Madiol, A. Nedzel, R. Koschniann. SEATED- R. l. Schmidt, Troas., Archie Currie, Mrs. A. T. Knopf, Sec., Mrs. C. Kurz, C. E. Hoopesy G. K. Griesbach. STANDING-4 A. I. Forgue, Vice-Prosg C. C. Erosseit, Pres., Mrs. Thos. H. Carter, B. C. Young. SEATED- Mrs. lra E. Gar- inan, Sec.: Percy G. Ford, Pros., Mrs. W. lngalls, Vice-Pres., Miss Helen Masters, Tre-as. STAND- ING-Mrs. W. T. Harden, Mrs. E. I. Chronister, H. E. Carr, Mrs. I. L. Hanley, H. H. Eelkema, Mrs. Robert Van Pelt, VV. H. Babcock, Miss Elizabcth B. Oakes, Mrs. F. C. Bulow, Mrs. Charles B. Rouse, R. E. Poplett. Near the close of the year, a tournament is and held to determine a Checker team of five outstanding players. The club members look upon these past- times as mentally stimulating and fascinating. Through playing these intellectual games of skill, they acquire such qualities as imagination, resource, foresight, observation, and ingenuity. A successful rummage Band Parentg sale and two dinners in the cafeteria for parents, students, and teachers provided funds which made possible the purchase of necessities for students, who, without such assistance, could not have remained in school. On May 2, the famous play, Counsellor at Law, was presented for the P.-T.-A. by the Maywood Players. To provide an opportunity for parents and teachers to discuss the students problems, five meetings were held, one following each grade period, and a sixth, a special meeting, was held to celebrate Proviso's Twenty-Fifth Anniversary. Outstanding speakers, in- cluding Dr. Preston Bradley, ludge Louis Senese, and C. I. Heintz, addressed the organization at these meetings. HT FRONT ROW-V. Reich, F. Rittmueller, R. Clark, L. Puscheck, Miss Otis, R. Lande, E. Buch, A. Zapfel, M. Lossin. MIDDLE ROW-I. Ostler, B. Schulz, H. Smith, Marie Goodrich, M. Ptolemy, D. Neal, A. Prine, C. Ollernan, E. Barzenick, L. Haugh, D. Cimino, E. Ricker. BACK ROW-H. Weiss, C. Laskowski, P. Schnake, F. Leverette, C. Kurz, T. Boardman, E. Osher, C. Schauberger. SEATED-L. Nott, I. Much, A. Zapfel, H. Ancel, D. Logan, Miss Otis, F. Hardesty, S. Grinpas, T. Boardman, R. Horton, D. Neal. STAND- ING-L.vVanek, I. Smith, H. Weimer, B. Lurie, P. Hayes, A. Dort on, I. Stevens, C. Bludorn. CNot in picture?-B. Buck, G. Barker. For the first time since its organi- Pagednt zation, the Pageant this year was Ed1tQF1al partly a curricular and partly an extra-curricular activity, the Staff receiving a half credit for a semesters work. Part of the Staff the second semester was made up of students from the News Writing class and part held over from the first semester's members. Two special issues of the Pageant were included in a year's subscription at no extra cost. The first was a Christmas edition, which included an extra four-page literary supplement, the second, a Silver That the members :lpa-rua-SSUS of the class in Crea- tive Writing might continue their work, the Parnassus Club was organ- ized under the supervision of Miss Florence I. Otis. Reading, writing, and criticizing original manuscripts constituted the main activities of the club. At each of the bi-weekly meetings, held at the home of one of the members, original poetry, essays, or short stories were presented for the approval of the group. A contribution of each type of writing was submitted to the Scholastic Magazine for its literary contest. Anniversary eight-page edition, which carried articles showing the growth of the school since its establishment. ln November, Evangeline Buch and Marie Good- rich, as official delegates from Proviso, attended the Illinois State High School Press Association Con- ference, held at Urbana. In May, Marion Ptolemy, lean Stevens, Thomas Boardman, Carolyn Bludorn, Helen Weimer, lames Ostler, French Hardesty, and lay Smith were chosen to represent Proviso, in Vari- ous phases of newspaper writing, at the Medill High School Press Conference at Northwestern University. On December 7, the Parnassus Club members were guests at a Christmas party in the home of Principal and Mrs. H. H. Eelkema. Kimon Friar, '29, appeared before the club, in the social rooms on the evening of March l2, in a recital of his own poetry. Former students who had been classmates of Mr. Friar, a number of faculty mem- bers, and several friends of the members were guests of the club on this occasion. On the first of April, the group was received in the home of Thomas Curtis Clark, who described personal reminiscences of present-day authors. . -MI r SEATEDA-R. Campbell, W. O'Rourke, M. Ratner, I, Gustafson, Marie Goodrich, Miss Norman, A. Zapfel, Ft. Horton, A. Edwards, H. Ancel, C. Kurz. STANDING-A. Spolin, D. Holpuch, E. Bowen, L. Marcus, L. Nott, C. Robb, C. De Wire, S. Grinpas, I. Stevens, D, Klupping, I. Sponsler. P. Krickl, B. Philpot, E. Laubly, R. Carling, D. Eilenberger, Miss Marm, E. Garrett, R. Nelsen, R. lngersoll, I. Grube, N. Button. Untiring effort and industry were characteristic of the Staff which worked in the creation of the l935 Provi. Long after the halls were empty and all was quiet except for the nocturnal excursions of the proverbial Mickey Mouse, the members of the Staff could be found hard at work writing quotations, identifying pictures, compiling statistics, verifying the spelling of names, writing club stories, and seek- ing original ideas for features. ln addition to this work, they checked over 3,500 nationality blanks for statistics used in the class histories. The murmur of conferences, the clicking of busy typewriters, and the sight of writers, with studious Planning, evolving ideas, and then trying to dis- cover creative sparks have kept the Provi artists busy numberless hours. They traveled back three hundred years when they searched files of material at the Newberry and Art lnstitute Libraries. The authenticity of certain sub- jects they wished to use in their compositions had to be established. Although much can and should be left to the imagination, a factual theme of neces- sity can scarcely be so modern that it might be termed Cubism, abstractionism, or surrealism. Many a pad of paper has been filled with curious lines and grotesque masses. Comic and serious im ' vb... .,....:x.fq-ti3LA.Lny---t,,,-,,..,....,...,....,.1.. .. ., Am -Y frowns upon their faces, Staff gotten, indicated to the casual observer that the Provi Editorial Staff was working overtime, regard- less of the N.R.A. High scholarship and plenty of time to devote to a cause were the requirements of applicants for posi- tions on the Staff. After these were explained to the Seniors at a class assembly, the candidates were chosen with utmost care by the faculty who Voted on the basis of ability, reliability, and co-operation. putting th e i r sudden inspirations d o wn on paper lest they be for- motifs intermingled. The - best were selected to PFOV1 Art add enlightenment and color throughout the volume. Pupils with cameras have trekked up and down corridors and in and out of classrooms, always try- ing to catch every one in some natural pose and habitat. Their mirth-producing slogan was, Smile and be natural. Pictures, formal and informal, by the hundreds, have been gathered during all hours. The three hundred years will have been spanned when the Art Staff puts the final brush strokes on the tail-piece of the l935 Provi. 3 S SEATED ----- L. Haugh, K. Skillin, l. Much, Mr. Law, C. Schuster, C. Hahn, P. Lauth. STANDlNG-M. Hurwitz, R. Ford, E. McNamar, C. Popp, M. Gutenson, E. Ernster. SEATED-C. Bludorn, D, Cimino, A. Zapfel, D. Logan, Mr. Comery, l. Much, B. Sandro, E, Bicker. STANDING-C. Schauberger, G. Stronge, E, Krieg, G. Barker, P. Hayes, M. Nielsen, F. Kral, T, l-lo dgson. Provi Arranging schedules for Senior pictures, selling the Provi io the student body, and ments constituted the work Staff. ln arranging schedules for pictures, it was neces- sary for the Staff to look through the five hundred and sixty programs of the Senior Class. For a period of two weeks, approximately sixty pictures were taken daily. Deluxe salesmanship had to be practiced by the procuring advertise of the Provi Business P JE B - The Pageant Busi- uslnegs ness Staff for the year l934-l935 was composed of two separate groups under two distinct heads. One, the Circulation Department, was made up of a manager, an assistant manager, and a sales force of eight students, whose work was to keep a complete financial record, to increase sales, to col- lect money for the Pageant and the season football tickets, which were sold together at a reduced price as a Booster special. Other work consisted of '7 Provi Business Staff in selling the annual to the stu- dents, who responded very nicely. ln soliciting advertising material, members of the Staff interviewed about eight hundred business men of Proviso Township, with fairly good results. After the payments for both Provi and Pageant were made in a bargain offer, which consisted of two one-dollar instalments plus twenty-five cents, this division of workers checked receipt books and delivered the yearbooks. The Provi owes much to the energy and well- directed work of the Business Staff. counting out Pageants for the next day's delivery. Another task of this Staff was to check all money and to try to make the Pageant pay for itself. The second group, known as the Advertising De- partment, was organized in much the same way as the Circulation Department, with a manager, an assistant manager, three ad takers, and a book- keeper. They canvassed the business districts in the Township for advertisements and collected for them every few weeks, theirs was also the respon- sibility of helping the Pageant pay for itself. SEATED V. lohnson, H. Ancel, Miss Hogan, Miss Norman, Miss Nelson, Miss Vallo, K. Rockefeller, E. Schroeder. STANDING- M. Clement, I. Litlce, L. Young, R. Forsnian, B. Carson, R. Sedgwick, B, Young, B. l-lutter, M. Milles. COut of picture?-R. Barth. FRONT ROVV---C. lngalls, S. Didech, D. Peters, A. Kuxxes, L. Young, Miss Barnum, Y. Dorf, D, King, M. Hurwitz, E. Dunn D. Beck. MTDDLE ROW---A,Spoliri, E.Ulrich, C. Credity, N.Button, F.Gershkowitz, L. Marcus, G,Siniinov, B.l.urie, E.Coilins, M. Ptolotf, A.Hull 2. Holpuch, BACK ROW E. Leake, M. Holland, C, Kurz, S. Feinner, D. Nanninga, Skillin, S. Heoerg, M. Ratner F. Forkin, K. lohnson, L. Hough, M. Elisco. To aid in the development of a well-rounded personality for every student, the English Cabinet has fostered an interest in worthwhile books, maga- zine articles, movies, and radio programs. Since the Cabinet's organization in l926, its main purpose has been to help students to express them- selves more clearly. This year the group has con- tinued this Work and has attempted to promote an understanding and appreciation of literature among members of the student body. The advent of National Book Week found the Cab- inet sponsoring essay and book-review contests, and staging the play, Good Medicine. An innovation this year was the election of three Four years of striving toward the attainment of an abundant life this is college. l-low to choose the best college and how to make the most of the splendid opportunities that present themselves are problems which the College Club endeavors to solve. For almost two decades, this club has en- couraged lunior and Senior students to take an interest in higher education. After the club was organized in the fall, as has been the custom for many years, talks on entrance requirements and the cost of going to college were presented by C. C. Taggart and Miss Martha Hilde- brandt, respectively. ,u.:f,a.:v M. , .. new members to com- - - pose an art commit- tee. Throughout the year, colorful and instructive posters were exhibited in the English rooms. Unusual and beautifully-bound volumes were ex- hibited in the trophy case and in the library. Auto- graphed volumes and first editions of Sandburg's Good Morning, America, and Virginia Woolf's Orlando were among the interesting books shown. The Cabinet, appreciating the need for display facilities, presented an illuminated display case to the library. On a crisp day last No- vember, the m e m b e r s made a tour of the cam- pus at the University of Chicago, which included an inspection of the interiors of the most important structures on the grounds. Early this spring, an informal talk on the new system of study routine, which has recently been instituted at Chicago, was presented by Arthur Ko- ven, '33, who is at present a Sophomore at that university. YESTERDAY - - The pioneer boy found his sport outside of school. His physical activities consisted of huntinq, wood- choppinq, and the performance of man- ual labor about the home. Later, in the early schools, calisthenics were taught With the use of Wands, Indian clubs, and dumb-bells. sk l ,,, S J rr N.. :gg ,Q be E .,.- 2 as 4 ,, HZ X., , K 'N , ' 55,3-i A 2, xx . Jw fm Development of Athletics at Proviso By William O'Bourke The progress made in athletics at Proviso during this quarter of a century has been fully as great as the advancement in other lines. Today Proviso holds an enviable position in the sports world of the secondary schools of the country. It seems al- most unbelievable that the common school-boy games of twenty-five years ago have developed into the highly specialized sports of the modern day, but this is the condition at Proviso, just as at all other schools in the land. ln the case of Proviso's growth, it appears that the pioneers or early organizers of sports in this institu- tion, who, prior to this time have been unsung heroes, deserve a major share of praise for success- fully contending with the discouragements which were theirs during the period of Proviso's infancy. Upon delving into the dust-ridden archives of his- tory, one finds that during the first year of Proviso's existence, when the scholars attended classes on the top floor of the Emerson school, a group of energetic high school lads organized teams and played a regu- lar athletic schedule with similar groups in this vicinity. During this time, which was the year 1909- 10, these youthful trail-blazers laid out a rude base- ball diamond on the site of what is now Martens Brothers' coal yard, and, through conscientious prac- tice on this poorly equipped field, won the Pentangle League championship for 1910, thus laying a founda- tion for Proviso's excellent baseball tradition. The Pentangle League, so-called because it was com- posed of five members, was the beginning of the modern Northwest Conference. Proviso has also participated in football, basketball, tennis, and track during these early years. The year 1911 brought a revolution in athletics be- cause Proviso moved into her own buildinq, the first section of the present building, at the corner of Madison Street and First Avenue. As a result of this trek to a different location, the athletes found it neces- sary to construct on Proviso's property a field which would be easily accessible to the school, and to pro- vide dressing room facilities for the team members. Many humorous tales are told of the pseudo-locker room, but the consensus of opinion leads to this con- clusion: The site of the locker room was the boiler roomy the contestants were obliged to place their clothes on the floor, as there was no locker spacey and an old piece of discarded hose served as a shower. lt must be understood that at this time there was no uniform equipment, as the players were forced to provide their own, and the team members had to furnish their own transportation to and from games because the school provided no financial assistance whatsoever to the athletic organizations. Because of this lack of finances, an athletic associa- tion was organized in 1911 to provide a fund for sports. Through subscriptions of the student body the meager activities were financed. During this year, Proviso duplicated the feat of the previous year by winning the League baseball championship. Nineteen hundred and twelve was a red-letter date in Proviso's athletic history because in this year the local school was admitted to the Suburban League. This action set the stage for one of the biggest upsets in high school football, which came that year when Proviso routed a hitherto undefeated Oak Park team by the convincing score of 26-O. This feat was especially noteworthy in view of the fact that Bob Zuppke was the mentor at Oak Park, who possessed such stars as George Trafton and Penn Carolon. Bill Minteer, Captain Nels Larsen, and Ioe Wright star- red for Proviso in this game, which originated the persistent Oak Park-Proviso rivalry. Minteer is reput- ed to have been the greatest athlete in Proviso history, winning seventeen letters in his under- graduate days. During this time, it is imperative to note that two faculty members, working without compensation, co-operated tirelessly to put Proviso on the athletic map. R. R. Brinkerhoff, a mathematics teacher, acted as counselor to the boys, and C. F. Wells served as business manager. Although base- ball and football are the only sports discussed so far, it is to be remembered that Proviso had a basketball team. This team had to play all its games away from home because of the lack of a gym. Athletics rolled along at a serene speed until 1914, when the Lettermen's Club, which was the forerun- ner of the modern Varsity Club, was formed. Another radical change took place in 1917 when an addition which provided a gymnasium was erected. After the erection of this new building, the administrative heads took an active interest in athletics, hired a paid coach, and set aside a sum of money to be used for athletics. This radical revision in the attitude to- ward athletics marks the beginning of the Modern Era. O. V. Boone, the first-hired coach, remained until 1919, when he was supplanted by B. G. Talcott. During Mr. Boone's regime, golf was added to the list of sports. ln 1919, Proviso inaugurated her policy of competing in intersectional athletic contests by traveling to Marblehead, Massachusetts, to engage the local high school on the gridiron. This intersectional athletic tradition has resulted in the following record: Football 1919-Proviso 3 Marblehead, Mass. 6. tTherel 1920-Proviso 147 Marblehead, Mass. 7. tHerel 1921-Proviso 137 Fitchburg, Mass. 6. tTherel 1922-Proviso 24: Fitchburg, Mass. 9. tHerel 1923-Proviso 75 Fitchburg, Mass. 7. CTherel 1924-Proviso 65 Fitchburg, Mass. 20. tHereJ 1928 -Proviso 13 Central High, Lima, O. 2. CTherel 1929-Proviso 32, Central High, Lima, O. 2. tl-lerel 1930-Proviso 7 Everett, Mass. 6. CThereJ 1932-Proviso 6 Tech High, Atlanta, Ga. 13. CHerel 1933--Proviso 6 Tech High, Atlanta, Ga. 13. CTherel Basketball 1935-Proviso 315 Marblehead, Mass. 15. tHere7 Talcott's regime lasted a year, and then he with- drew in favor of Grady, who was instrumental in organizing Proviso's first swimming team. The parade of coaches continued as K. G. Coutchie was engaged in 1921. He remained until 1923, when O. H. Matte, a member of the present staff, was engaged as the local mentor. Nineteen hundred and twenty-five proved to be an- other huge year in the annals of athletics. Early in 1925, the second addition, which contained a swim- ming pool, was opened for use, and Tebby Thei- bert was elevated to the position of Director of Ath- letics. The renowned Tebby was loved by every pupil in school and respected by all with whom he came in contact. lf the credit for Proviso athletics were to be centered on one man, it would undoubted- ly rest on the small shoulders of this diminutive genius who may be rightly called the Rockne of Proviso. At the time Tebby succeeded lack Vance, now of Northwestern University. ln 1925, G. D. Starn and E. G. Schultz were added to the staff. lt Was during this year that the Letter- men's Club was re-organized as the Varsity Club. In 1927, the genius of the inimitable Theibert began to be felt, and Proviso developed the best high school football team in the state. This year proved to be the Golden Era in athletics, because teams in every sport distinguished themselves by their adept- ness in the plus column. The stars during this period were Schultz, Fliego, Guy, Wrobke, and Klapdohr. L. F. Slimmer, the present Director of Athletics, be- gan his apprenticeship in 1928 as lightweight coach. When F . 1. Hailey came to Proviso in 1929, he took over the direction of the lightweights. Ninteen hundred and thirty-one proved to be a sad year in local circles because it marked the passing of the beloved 'l'ebby who left Proviso to conquer a bigger job at a nationally-known academy. Nineteen hundred and thirty-one provided two new satellites in Proviso's coaching sky in the personages of H. K. Long, who came as Director of Athletics and remained two years, and L. W. Rem- ley, who is still regarded as one of Proviso's best- liked coaches. C. E. Kassel, a local boy who made good, was added to the staff in 1932, after starring at lllinois as an All-American end. Proviso's track team, under the able direction of O. H. Matte, came within a half point of Winning the State meet and placed three men in the National in 1933, thereby putting Proviso on the map with her track exploits. Wrestling was inaugurated as a sport during this year. The Blue-and-White has been keeping up its base- ball tradition during the last few years by winning the League title regularly. D. B. Appleton, who came to Proviso in 1933, is now in charge of the squad. Wrestling also absorbs a great deal of interest at Proviso now: a very good team was developed dur- ing the last year. ln the course of this brief resume, we have re- counted and revived the athletic achievements of the school over a period of a quarter of a century. We have seen the youth-made field rearranged and tiled: We have watched the erection of a modern stadium. We call to mind that at this time Proviso possesses two gyms, whereas in former times she had none, and we have observed substantial athletic budgets in contrast to the student subscriptions ot two decades ago. With this tremendous development in mind, it would be preposterous for us to try to predict what may happen during the next twenty-five years, but it is the sincere hope of all who are con- cerned with Proviso's Well-being that the field of athletics may continue to grow and expand in order to allow the Youth of Today to become the Better Man of Tomorrow. FRONT ROW-S. Caruso, 1 L. Wallace, E. Wolff, G. l Altergott, I. Tiefenthal, Mr. I Slimmer, Mr. Remley, M Hatley, I. Winter, E. Mi- chael, C. Ginder. MIDDLE ROW-W. Sisson, R. Tans- ley, H. Thelin, F. Ortman, I. Patterson, R. Dolan, E. Brezina, I. LaRocco, C. Ruet, T. Martens. BACK ROW- -L. Bauman, L. Klean, Pt.Sykora, I, Law- lor, F. Orist, A. Urbelis, W. Iohnson, H. Meyer, R. Con- rad, S. Zapler, G. Flood, R. Vahldiclc, Fi. Miller. SEATED-U. C. Foster, O. H. Matte, L. F. Slimmer, C. E. Kassel, I. W. Moelk. STANDING-E. W. Brooks, L. W. Remley, V. G. Cat- lin, H. G. Monilaw, F. I. Hatley, D. B. Appleton. Talking over r. it - The Varsity Club is the Va-F31-ty most important athletic or- ganization for boys in the school. Since the prerequisite for membership is the earning of a major letter, the club is composed of those athletes Who, through strenuous practices and an admirable devotion to a cause, have achieved the greatest athletic honor which Proviso awards. Few extra-curricular activities in school are more popular than athletics, and it is the desire of every student participating in sports to become a member of the Varsity Club. Outstanding among the Club's social events this year have been the dances given after the Elgin and the Marblehead games. At the latter dance, mem- bers of the visiting team were guests of honor. The annual Club dance Was held in the spring. Noted for its stiff initiations, the Club is hailed throughout the school as a maker of men. One of the popular initiations of the club is the teaching of the fundamentals of the toe and tap dance, the various initiates being made to dance for the enter- tainment of the school at large. This organization under the sponsorship of L. F. Slimmer, devotes its efforts to promoting good fellow- ship among all athletes of the school and to estab- lishing a code of good sportsmanship in Proviso. Dedication of the Stadium The crowning glory of the 1935 football season was the dedication of the new 580,000 stadium, under an indigo sky, with the field and stands ablaze with the glow of 60,000 watts of incandescent light. The dream of all athletic-minded youth was realized when exciting football games, stirring mu- sic, colorful parades, and inspiring addresses offi- cially dedicated the stadium on the red-letter day of October 3, 1934. An elaborate program marked the culmination of one of the biggest undertakings in the township this fall. Prominent state, county, township, village, school, and C.W.A. officials were guests of the Board of Education on this occasion. The gala event was heralded by a long, noisy parade of automobiles from Maywood, Melrose Park, Forest Park, Berkeley, Broadview, Hillside, Bellwood, and Westchester. Previous to the big game between the Chicago Cardinals and the Maywood Athletic Club, the Pro- viso Fresh-Soph team played a game with the Light- weights for one quarter. The Varsity engaged in a similar battle with the lunior Varsity to demonstrate Proviso's ability on the athletic field. After these games, a parade led by the high school band formed at the northwest corner of the stadium and proceeded around the new field. The Proviso teams, the Board of Trade Post band, the Maywood A. C. team, and last but not least, the mighty Cardinals, made up the colorful procession. Reverend Edward Dankowski delivered the invoca- tion. Superintendent H. H. Eelkema then introduced the speaker, Dr. Preston Bradley, who warmly praised Proviso for the fine record it has made. Immediately after the address, the Red Birds and the Black-and-Whites began warming up. Many of the country's outstanding professional stars partici- pated in this event, including Paul Pardonner of Purduep Frank McNally, one of the best centers in the National League: and Mike Mikulak of Oregon. These famous players demonstrated their superior prowess as they romped over the local club to the tune of 43-0. Between the halves, brilliant martial music was provided by the famous Board of Trade band, directed by Armand Hand, former assistant to lohn Philip Sousa. An exhibition drill featured the national champion drum major. Thestadium, the project of the C. W. A., fills a real need of the community. It is 184 feet long, 49 feet wide, and 25 feet high. Not only the new sta- dium, but also an excellent lighting system and a new athletic field, were included in this work. The stadium, with a seating capacity of 2,000, will en- able many more followers of sport to attend athletic contests. The completion of an eight-lane, twenty- five-foot, quarter-mile cinder track will enable Pro- viso to bid for the honor of acting as host to the big suburban track meets. The lighting system boasts of an underground in- stallation and forty reflectors with 1500-watt bulbs. It is the only system of its kind in this area. Cinders for the track were donated by the Illinois Central Railroad, and the fill for the track by the National Malleable Company of Melrose Park. Much credit and praise should be given to Super- intendent H. H. Eelkema, who applied for the pro- ject: to the classes of '27, '28, and '34, who made financial gifts: to students, patrons, faculty, and Board of Education who co-operated in bringing this work to a successful completion. The stadium is the climax of a large-scale building program which started with the advent of the present new building. With its broad seats and its quarter- mile Cinder track, it is truly an asset to Proviso. Preparing for the Dedication umm ., ,. in 'ks RQ sim. FRONT ROW-Schwass, Stumpf, Thelin, La Rocco, Klean, Kitcheos, Maas, Miller, Kunes. ,MIDDLE ROW-Flood, Orist, Lawlor, Wm. fohnson, Alderson, Churchill, Patterson. STANDlNG- -Coach Slimrn er, Hurrell, Frantz, Budd, Brezina, Dolan, Sykora, Urbelis, Winders, Zapler, Conde-los, Burk, H. lohnson, Coach Remley. The l934 edition of Proviso's Heavyweight football team over- Heavies Football came overwhelming obstacles in its schedule to finish third in the Suburban League and to go through the season with six victories and two defeats emblazoned on its escutcheon. The first test for the Slimmer-Remley chargers was passed when York was defeated, 7-6. Cap- tain lohnson had the honor of scoring the first touch- down of the year when he tallied on lVfiller's pass. The versatile La Rocco then proceeded to boot the pigskin between the uprights. This feat later proved to be the deciding measure by which Proviso won. Continuing their victorious way, the locals infor- mally dedicated the new stadium by defeating Downers Grove, 8-7. All of Proviso's scoring took place in the first ten minutes with La Rocco and lohnson again dominating the scoring column. Playing on a rain-soaked gridiron, the Blue-and 110 1 , ..1,x:q,. -.mow , Q A li.. Alderson lohnson Sylcora Flood White aggregation won its third straight fracas, Elgin High being the victim. A dazzling aerial attack accounted for the victory. ln its first Suburban League tilt, the Varsity came near to being defeated by a Frank Merriwelln finish on the part of New Trier, but Lady Luck smiled upon the home guard and enabled Proviso to van- quish the Trierverians, 14-l3. The Heavies called a time-out in the League sched- ule, October l2, to execute Morton, 33-U. The alert Proviso organization never allowed the visitors to penetrate beyond midfield throughout the skirmish. Hit 'em hard. hit 'em low Hey. get down will you Block that kick The three varsiteers Here we ure. look us over 1-2-3-4 5 shift The winning streak was extended to six games when Proviso trounced Deerfield. Horsey Orist proved to be the man of the hour with a twenty-five yard gallop which clinched the victory. The spirit of do or die had no effect on Proviso in the Evanston game as the powerful Wildkits duplicated their performance of last year, stopping Proviso's victory march with a 14-O setback. The proverbial Battle of the Century turned out to be just another ball game as far as Oak Park was concerned. When the smoke of battle cleared, the traditional foe had inflicted a stunning 35-O defeat. FRONT ROW - - lohnson, Patterson, Zapler, Urbelis, Dolan, Lawlor, Sykora. B A C K R O W Franke, Churchill, Brezina, Stumpf, Ccndelos, Budd, Flood, 111 as ..... , .M , W-sf ww-.. . , .,,W.,,,,,,Y Mk 1 -1 1-. , FRONT ROW-Curry, Hurtt, Iustus, Haberkorn, Ginder, Ernst, Hickman, Allot. SECOND ROW- Clark, mgrg Miller, leschke, Iantzen, Capt.: Neuman, Keller, McMurrough, V. Malpier, Marquette, Mag- sino, O'Connor, DeWire, Fanning, F. I. Hatley, Coach. THIRD HOWfin- galls, asst. mgr.7 Totarolo, Smith, Balkan, Iameson, Wilson, Amici, Zuchowski, Vovola, Leone. FOURTH ROW-M. Malpier, New- berg, Mahan, Bruce, Houndy, Hendricks, Mar- tens, Page, Thomas, Gold- stein, Bender. FRONT ROW-Spenser, Theriault, Rizzo, Bulman, Crabbe. SECOND ROW-- Lennaker, mgr., Hartigan, Vandenbroucke, Swanson, Ortman, Berliner, Smith, Overmeyer, Groves, asst. mgr. THIRD ROWfO. H. Matte, Coach, Andersen, Smith, Burk, Toppen, Weis- man, Stoeckert, Adleman. FOURTH ROW-Brown, Kruger, Hank, Collins, Huebner, Marco, Franke. Qu. A l - Proviso'sf-latley Llqhtgipootbdii Ponies g a l l o p e d through another suc- cessful year under the guidance of Coach F. l. Hat- ley, winning five games, tying two, and losing one. The strong defensive work of the Lights was clearly exhibited in every game. Only two lettermen returned to the squad, Captain Iantzen and leschke. The compensating factor in this year's eleven, however, was that the recruits IV Football Proviso'sfuture ' ' heavyweights had a fair year in the win column and gleaned football knowledge which they can eventually use as members of the Varsity Squad. Leyden found the local pass defense weak in the opening encounter and eventually submerged Pro- viso, 7-U. Still unable to get off on the right foot, the Iayvees dropped a hard-fought game to Evan- ston. developed into polished material midway in the season. The '35's reached their high-water mark in the Elgin game, administering a l2-7 setback to a heavier, experienced eleven. The Lights broke even in the two games with Oak Park, dropping the first tangle, l2-7, and winning the latter, 6-O. Hatley's main sparkplugs throughout the year were the three l's : lantzen, Ieschke, and lustus. The first triumph of the year was registered against the Lockport Varsity. A last quarter rush enabled Proviso to win, l2-7. Still continuing vic- toriously, the B team rode rough-shod over Elgin, October l3. ln the first tussle with Oak Park, a lone touchdown in the last minute by the Orange-and-Blue spelled defeat for Coach O. H. Matte's boys. On November 3, lay Smith led the team to a 28-U victory over York. The final game with Oak Park was a compensation to the Provisoites, for it ended in a scoreless tie. -- ' H .-21'-'.-3.-I--fm ,,,A.,.q I A - ... This year's crop of underclass pigskin-toters piled up a record of two victories against two defeats with a tie thrown in for good measure as a fair proof of accomplishment for the year. This was a commend- able performance in view of the fact that Buck was the only numeral winner that returned. The locals won their opening game against New Trier, l3-7, and then held Morton to a 6-6 tie. On October 20, the underclassmen traveled to Deer- ln order to prepare Proviso for another successful gridiron season, L. F. Slimmer, director of athletics, held spring training for four weeks. Approximately one hundred and twenty-five po- tential gridders, from which three teams will be formed next fall, responded to the call to colors. Coach Slimmer directed the Heavyweight chargers during the period of practice. Not all of next year's eleven was present because spring sports attracted many of the athletes. The major part of the training consisted of the fundamentals of football and also the trying out of many new systems to determine their efficiency. , .Wd ...,l,,,,,,.L.3,,4,,im ,T Q . 4 ,. 1, ...M ,, 1 , , 1 . -.M V . . . Au, .,-,F,,3,'.3E..s.,,, , .. . 'V .. FRONT ROW - Mumm, Smith, Verkler, Miller, Av- rech, Schaede, Collard, lohnson, Guiney. SECOND ROW--Lavine, Boss, lame-son, B u c k, Olson, Pass, Boehm, Vogt, THIRD ROW f Marousek, Friebus, Caruso, Willson, S ta c kp o ol , Sagalewich, Stange, Grove, Corbett, Foleno, C o a c h Kassel. B A C K R O W-Shilkaitis, Hepperle, lohnson, lohn- son, Gray, Andrews, Ro- gas, Baeder. Lights out for practice. . . . All right. boys, qo after 'em .... Here qoes the leather-lemon . . . . Oh, pardon us .... Foot- ball warriors are we. . . . Rarin' to go .... The Varsity on its toes .... Here we are again. please. field and administered if stinging defeat to those hosts of the North. The Fresh-Sophs FQQtbal1 then staged an unprece- dented act by losing to Evanston, l3-O, on the local gridiron. The final game of the year was dropped to Oak Park, 20-7. Promising material for the Varsity were Sansone, Sagalewich, Buck, Boehm, Staclcpool, and Pass. Pre - dph Coach F. l. Hatley - - - supervised the Light- Sprlnq Tralnlnq weight pigslcin-toters. This aggregation had the largest number of candi- dates, for it seemed that most of the smaller fellows in school were in uniform. Many veterans weE also in the Shetland ranks. The underclassmen received their share of the leather-lemon booting under Coach C. E. Kassel. Forty Freshmen, following about the same tactics as were employed by the Varsity, went through their paces for three weeks. I N! lf.q:vtn v Y 1 . i ' .. - A .. ' 2-1 fu-u f, . , ff - ' . , f .. 1 . . ,mssi...msw- H' '-. ff '- W f f V - ' ff K ' -' ' -f - FRONT ROW-Tiefenthal, Winders, Hahn, Haber- korn, Sagalewich. MlDDLE ROW- -Urbelis, Zeinfeld, Flood, Cronin, Buck, Mizen. LAST HOW ---- Bell, mgr., Farney, lohnson, O'Bourke, Conrad, L, W. Bemley, Coach. :ALS Only cx Flood can stop Farney. . . . Here goes-right in the bucket, . . . Between quarters. Proviso's corps of basketeering warriorsexperiencedamediocre up-and-down year, as evidenced by their slump in the middle of the season. The Varsity, however, were able to come down the home stretch with a surging rush, which enabled them to compile a .500 average. Varsity Basketball At the beginning of the season, Proviso presented a team, composed of three lettermen and an All- Suburban Lightweight center, which won five con- secutive games in a seemingly easy manner. Near Christmas, the boys became imbued with a holiday spirit and dropped five straight games to Deerfield, Evanston, Hinsdale, Elgin, and Oak Park. At this time, the Sophomores began to develop, and Coach L. W. Remley began using Cronin's val- uable height to good advantage. The turning point of the slump was reached on February l, when Proviso defeated a graduation- wrecked Evanston team by the overwhelming score of 36-Zl. Farney started on the road to high scor- ing honors as a result of this game. Deerfield broke the Heavies' stride by defeating them on the north side floor by the score of 33-23. Deerfield later won the League championship. The Blue-and-White then proceeded to win four in a row over New Trier: Marblehead, Mass.: Oak Parkg and Waukegan. The Marblehead game was the high spot of the local season because it was one of the biggest intersectional games of the year. Proviso defeated their arch rivals from across the river by the convincing score of 49-20. After the regular season, the Majors participated in the District Tournament and garnered fourth place. As a result of the great amount of experience which the Sophomores derived during the current schedule, Proviso has fine prospects for a series of good years in the future. Cronin and Mizen, first stringers last season, along with Sagalewich and Buck will return next year. They, with Haberkorn, should make an aggregation hard to beat. Despite the fact that all these prospects are counted on for next year, it is to be remembered that Proviso will be deprived of the services of Tiefenthal and Flood, who completed two years of fine Major cage play, as well as Farney, the team's high scorer. Above all, however, will be missed the fine leader- ship and talented ability of Captain Bill lohnson, who earned three letters as a Varsity basketball player and was an All-Suburban choice for two years. The consensus of opinion is that all these stars will be sorely missed. --.YW ..v,.-.v-..,-V en- V Y.--N... -W. -'Www ef-W v,.-,.--.-v...-..,,.....----- ., .V, .Tl -.,9H.f FRONT ROW Guiney Conners, Heiliman, Gehr Gradt, leschke, Berger SECOND ROW e Marou shek, mgr., lohnson, Woef lin, Neuman, Cunningham Ingalls, asst. mgr., C. E Kassel, Coach. goes for two more points This just has to go in Hello up there Ah! the gume's on ice! Although winning only two out of seventeen games, the Proviso Lightweight basketball team made up in aggressiveness for what it may have lacked in technical polish. Three lettermen, Captain Iantzen, Heilemann, and Gradt, reported when the call to colors was sounded. However, lantzen was ruled ineligible at the close of the first semester and his loss was felt keenly by the entire quintet. Suburban League competition was exceptionally keen during the l934-l935 season, and as a result, Proviso's inexperienced cagers were able to grab off only one League victory. ln ushering in the basketball season, the Shetlands bowed to Riverside, 22-l5. The Blue-and-White won its first victory of the cam- paign in a stirring 28-25 victory over York in two overtime periods. Gehr put Elmhurst out of the con- test by sinking a long-range shot while Connell added a free throw to the amassed total. However, the locals again went down in defeat, this time being defeated by Maine, 26-20, in the next skirmish. The exceptional strength of the League was ex- emplified when Morton vanquished Proviso, 28-l4. A serious slump was experienced by the '35's from here on as the losing streak was extended to ten games. lt was during this series of defeats that P ' ff d 'i i . . .Ziff ZZiSLik,1ZOlZlZ Llqhiwelqhf to Hinsdale, 26-8. The Basketball smoothly working Cardi- nal attack allowed only three field goals to be made during the entire tussle. Elgin, Oak Park, Waukegan, and Evanston each dropped Proviso on the short end of the score by a margin of ten points or more in the bad era. Snapping out of their lethargy in February, Coach C. E. Kassel's boys walloped Deerfield, 25-20. The locals pulled away to a comfortable lead in the opening quarter and maintained this margin through- out the game. However, the iubilations were short- lived when Morton squelched the Provisoites, 28-18. New Trier took advantage of Proviso's crippled con- dition, administering a 42-2l thrashing. Heilemann was missing from this encounter. Losing Richie Gradt in the opening quarter via the four-foul route, spelled defeat with Oak Park, as P. T. H. S. lost, 38-19. That the Lights improved as the season progressed was shown in the final game of the season against Waukegan. ln the first encounter with the the locals had succumbed 42-255 in the second game they fought hard, only to be nosed out in the final quarter, 28-2l. a re l t l T . . i , gl SEATED-Rhode, Roundy, Keller, Iameson, Mueller, Iohnson, Hansen, Sansone, Corbett. STANDING- Dykstra, Wegner, Grove, Frantz, Ebelt, Guill, Boss, Nush, Stange, We-de, Mr. Brooks. STANDING-I. Le-nk, I. Waschitz, G. Bruce, R. Schroeder, I. Wolff, E. Huebner, M. Korrell, E. Schwerin, A. Heidorn, H. Schwerin, Mr. Foster. fu ws, - . . Sly as a Fox 1 Before the game Reaching for the sky The Fresh-Soph cage squad experienced a droughty year in victories this season, but a goodly number of Varsity prospects were grounded in the fundamentals of the court game. Although the locals ennexed only three victories during the course of the season, they were able to give all teams a good battle. The feature game of the year was against Oak Park, when Proviso sent the hostiles home with a l9-7 defeat. Proviso also defeated New Trier in a close game, 20-19. The final victory was accomplished against Fresh-Soph Basketball Local golf enthusiasts vied for the honor of representing Proviso on the links on April 6, and when the final putt had been holed, the following were chosen as suitable foundation material for the golf team: H. Schwerin, E. Schwerin, Korrell, Bruce, Huebner, A. Heidorn, Lenk, and Kindernickt. This year's team is similar to those of the past in that it is composed of one excellent golfer and three fair contemporaries. The one excellent golfer is Hank Schwerin, one of the best in the districtg however, his younger brother Ed, follows him as a close second. The remaining linksmen in order Golf of ability are Korrell, Bruce, and Huebner. Competing as a member of the Suburban League, . ,. ,, ,M , , , , N . .,,. .. . , .- J: t .,L,7.5...,.M g. . ' . .W .y.,.'-A-...rt .' , u v- viii Teeing off Ah! a score of seventy-two ffor the first nine holesl. Waukegan, in the last game of the season, by a tally of 37-26. Throughout the season, Stackpool and Ebelt kept up the scoring end for the underclassmen. The lat- ter, a very lanky lad, is considered excellent Varsity material for next year. Frantz, lohnson, and Keller distinguished themselves on this squad. lt appears that the Fresh-Soph organization itself was handi capped by the wealth of second-year men who per- l formed on the Varsity this year, however, the pur- pose of this squad is not to win championships but to provide a training for heavyweight prospects. the golf squad plays one match against each mem- ber of the League and then is entered in the League tourney which is held the final week in May. Though only a minor sport at Proviso, golf is con- sidered one of the finest activities in any athletic department because it is one of the few sports which can be utilized to provide exercise and recreation in later life. One of the few criticisms of modern inter-scho- lastic athletics is that generally many persons are required to play practically all of the games: how- ever, this is not true of golf. ln this sport, one in- dividual playing the game alone can find pleasure, although two or four persons usually make for a more interesting game. NL., v .sf-..e..:......,.v 1 Am ,,:.,,, 1'.g -I--'Mew-zstsaft-6 N..-. 1 wfw, m er- , .-if .- .ff uef:t-we S. A .. 1. 4. ...-f...ge.QW..fvzu.1.' ,, Lv 4 wan f :fri sz: rt ' X-.. .. E 1- -S -. V r- HY- Avia . J., . r.,,.,...-. ,. we--,F ,T .fl-,Q-sem, - , , ...s-hwy seem, . . .W-U, . www ww. -4 . , ww 1-sqm ,. aww. ff- 'ff N is -' 1: me 213,12 fyffzif-f-.x fff.r7'5fT-.fri,1:i'3ll5'r .iyxfmm -H- ..., .'..:'f5w' x'ts.gig--awp:-f -A-'-v :gr firm --Tir? if 22. q:1ts!2.- .rt-4, -fill 'L 'lr 1511 , .g.'-pw' -' 1 .I WH'?l'3'f',-G 'f:f,A.. 'Fax- 5:4.f,2,v-gm: :f?T , 1253-' fj'ff: i'31'mz,if:Lif.'J.'-. :'f'f:., .5Exif? -faeiqtfvl'--: ' --Q,v:'- is --11? sq C i.w.s':.' -'Q-.fI ff.'. f1:,Q-'Swag.ffs-iq3,ff?5l?w1.-11,sit 33 f-'fA. wf:.: A-X it 'ff 45 -' .lWW1Hfr.s.s--fxglfaeif'-5tfwiWwi.wf5ffe.?vgift-55: +.t'atw'f-71f.'1f.wr.:. .,:.:?Ew-iaekivfaryfgvrflilfff' irsg .tw-I - -. 5515 1- . 1 - ., ',., .r -' 4 4, x' I . .sf ,1,:,,f 1:4 N. sQ..f':. ,. -L - J I. .Wy x. fx 3 'fhmfuiri K' 1' . Zu .zga . -awe. fu' ff,-g. , ft. - ..-,awk L, a' HL- 1.12 ' swept. J' wif fivm -v 1333133 sm. it-fiiwrgs .y.,f1ff-f5'q'1i.WW f'-gf'wgSfw3'i:,'lt-1:-'fifisf-ivfmg s.,tfys,'.g31f' rw., N U.'.,w.gc1-af -Qi... 1:-it - .wi . ,1r.fgr-J-1fH'14.1135e?a t..it': fqigz1..z,51f-gs,e-fr Civmr:-'i',,,f1v,'f'p.ghye.,1.5w Lf. 3, 1- -fag., 3375. -4' ',l.:5:?e,e ttf if 2114.40 Fri :QA -: :.'.-,we 1 :y-'TL1.trfJf: 2- ,r',-+f-'-J''iaii rn. g5':G'a51fsQQLSQA.. :2.iW:'.',+f. v'f'1'!'i,-Yi r -it Lf: :ze v1f.ei-'.f:.5gZ:fvy 5.4. -1frf'.233f,-1. . yy'-swflaf.f'.:f3,1g,gnsl-3Eaf:..Argg NS QV?-wj,.,-.,Ig:.Oi7nX5.f'kLr.gg.qg 2ggQQ?vst'2t.',',7,z X - , wwf! , j,'tf'v 'Q tu.. - f -r 1 wrt.-'v' ' I V A 1 xc,wtff-lf'f'1N-we ,M -t.w-x- iw. ' K -4 LEtmA2fQi2.ffrSwG1f f ww ' tx ' 1 M! 4 tam' H-g nf 16312,-xg , 4 am! N fi 'Wu YR g234,siZsf . , .A , , nf W ef..n.,..,,.. . ,. .. . , .5.,.1...'ft. .'?...,v.t...,t. ti,i..,., . . it Wfinmilitivwf W Proviso's Senior swim team, under the able tutelage of Coach O. H. Matte, garnered fourth place in the League standings. Throughout the year, Iohn Wimpy Winter proved to be the big gun of the squad. With Sal Ca-ruso in the diving department, Winter was the only returning letterman who completely lived up to all expectations. Although Caruso was lost to the squad at the end of the first semester, he earned enough points to warrant a major letter. ln the inaugural of the League schedule, Proviso's natators swept to a 35-31 victory over Deerfield. Wimpy Winter stole the laurels by winning the 100-yard backstroke and the 40-yard free-style events. Caruso raised Proviso's stock by taking first place in diving. The other triumph of the League season was a In order to give adequate instruction in all meth- ods of saving unfortunate swimmers, the Boys' Ath- letic Department organized a class in Life Saving, two years ago. Under the direction of I. W. Moelk, students are taught the proper use of the prone pres- sure method of artificial respiration. This instruction prepares the boys for the tests given by the Amer- ican Red Cross. LIFE SAVING FRONT ROW-M a r t i n Wolqemuth, O'Dea, Crab: be, Longley, Belluornini Orr, Tonkin, Wuttke mmm. MIDDLE Row! Simmons, Hussey, Balkan Washow, Ortman, Clark Stahmer, Harmon, Vid- lund, Houston. STAND- ING-I-Iartigan, Andersen, Krause, Richard Iohnson, Vandenbroucke, Hender- son, Robert Iohnson, Oakes King, Mr. Moelk. SWIMMING TEAM FRONT ROW-R. Mohr, I. Wolff, C. Andersen, Wm Sisson, T. Martens, L. Bauman, I. Winters, F. Ortman, I. Franke. SEC- OND ROW-M. Reda, G Clark, A. Miller, O. Sea brooke, H. Von Gehr, T. Andersen, I. Simmons, W George, G. Stahmer. THIRD ROW-Mr. Matte W. Rheingrover, G. Hous- ton, Q. Valduk, M. Iacobs S. Caruso, R. Tansley, E Wolff, W. Paglusch. 1 1 F our Mermen. 41-25 win over Waukegan, S - T in the local pool. Again Wlm ea-ms Winter collaborated with his colleagues in sweeping the meet by winning the lOU-yard free-style race. Proviso's yearling brethren, the Iunior squad, eased Coach Matte's heart by proving that they were potential Senior stand-outs. R. Mohr, T. Ander- sen, and M. Iacobs were the leading Iunior swim- mers, with the former leading the trio. Bill Sisson, veteran breast-stroker, was the sole member of the squad to represent Proviso in the Suburban League finals. The Blue-and-Whites were also entered in the. State meet, which was held March l at Northwestern University. Sisson and Martens were the delegates in the breast division, while Winter was the representative in the free-style events. Ortman, Bauman, George, and Tansley made up the relay team in this session. During the required six S - weeks, the contestants are 1 e 6-Vlnq directed through a series of exercises which enable them to meet the standards set up by the American Red Cross Association. This athletic project has proved a worthwhile activity, as evidenced by the large number of award winners. SEATED-S t e i n , Page, Ginder, Patterson, Lawlor, Zapler, Klean, Russell Schmidt.. STANDING L Bleck, mgr., Asher, Hanna- ford, lustus, Pass, Buffing- ton, Collard, Wm. Willson Churchill, Seabrooke, Mc- Govney, Baumgart, l... Willson, Coach Slimmer. FRONT ROW-K u p p e r Kane, Osburn, Vahldick Campbell, Beranek, Stran- ahan, Mickow, Berliner Corbett, Hillery, Patterson Zapler. SECOND ROW- - Schauberger, Gross, Lo- gan, Von Kaenel, Pilgrim Wainauskas, W e g n e r Steinbach, Avrech, Carne Lynch, B r a d y, Fostert STANDING-Mr. Matte, E Mic h a el, San Filippo Pauls, Hanson, Ramsay Voras, Warner, E s s i q, Stein, Niko, Fanning, 1 1 l . - - Director of Athletics, L. F. Slim- Wrestllnq mer, furthered Proviso's fame throughout the surrounding area by training his wrestlers so that out of eight meets they lost only two encounters. Under Coach Slim- mer, wrestling took on the appearances of a major sport at Proviso. The first meet of the year was against Swaney High of McNaab, Illinois. The contest was a close one with Sollie Zapler deciding the issue in the final tussle. The locals cut the second notch in their big gun when Calumet was executed, 60-lO. Hammond, lndiana, Hoosier state champions, brought the first loss to the home camp. ln a return Track Led by ten veterans, the Proviso track squad enjoyed a successful season under Coach O. H. Matte, having won three meets in succession up to the time the Provi went to press. ln spite of the prevalence of poor weather condi- tions, Proviso out-ran Morton, winning, 67V2-46V2. Campbell, middle-distance runner, added five points in the half-mile run. His running mate, Logan, also registered a victory in the 220-yard low hurdles scamper. Zapler won the discus and shot-put. Ber- liner also added a first place in the lOO-yard dash, while Mickow also came home first in his 220-yard dash. 118 5 ii 3 engagement, the Blue-and-Whites defeated Ham- mond, 37-26. This time, Russell, Ginder, and Klean pinned their adversaries, while Hack, lndiana heavy- weight champ, was lucky to gain a time advantage on Churchill. Proviso mastered Morgan Park in two meets, win- ning the first, 35-ll and the latter 26V2-l5V2. All in all, the local mat-pounders proved to be or sturdy lot, as the only other loss was inflicted by the Chicago prep champions, Lindblom, 29-27. Wrestling is rapidly getting into the limelight at Pro- viso, and it is through the efforts of Coach Slimmer that in the very near future Proviso will be noted as exponents of this art. In the second contest of the year, La Grange was defeated, 79-25. The three Provisoites, Stein, Kupper, and Essig, in the mile run, for the third consecutive time took the first three places, which helped Pro- viso to defeat Austin, 79-34. Campbell, Pilgrim, and Carne again amassed nine points in the 880-yard run, while Zapler and Patterson earned laurels. Other outstanding members of the local aggregation are- Stranahan, Schauberger, E. Michael, and Vahldick. The lunior ranks were replete with promising youngsters, Kane, Hillery, Osborn, Corbitt, and Ramsey. A convincing 53-42 victory enabled the yearlings to prove their strength over La Grange. Q.-, wg-ff?5'2- 1f L'-19 -' - t .136 The Varsity pellet chasers responded with vim to Coach D. B. Appleton's call and proceeded to make preparations for the defense of the Suburban League championship, which at present resides within the portals of Proviso. ln view of the fact that this copy went to press before the season had well started, it was impos- sible to summarize the year's work, but the record up to May l is won, three games and lost, one. Prospects seem very bright because last years championship team returned intact, with the excep- tion of two members. Urbelis, by his forceful hitting, is ably performing at bat. Wallce, with his old- Winning all but one meet, Proviso's cross-country team earned itself an enviable reputation as trail- blazers in the Suburban League. lt must be taken into consideration in order to understand this sport, that the team compiling the lowest number of points is declared the winner. The first meet of the year was a stinging 19-50 victory for the Bue-and-Whites over La Grange, Pro- viso continued the victory march by defeating Maine, 2l-49. The winning streak was continued to three meets, when Austin was turned back, 22-55. ln the second La Grange meet, the first five men to cross FTRST RUN' 2 Puhiliei R. Rourldy, N. Thomas, l. Wallacf-, f. Tiefenthlrl, T Schmitz, l.l'lulbert, C. Clark NTDDLE ROW' O. Grave R. Conrfifl, F. Grist, lol. Sei del, l. Wviniei, Boss, Fl. Miller, YN. l o h n s o r.. STANDING Mr, Apple- ton, R. Vortuno lx. tier- mann, P. Sagalewiciz QT, Korrell, A. Urlielis, Vo: Ge-hr, P. Farney. FRGNT ROW' -- Culotta, Clauss, 'We-gner, Lueder Cohrs, Cook, Niko, Oill, Leinwehor, Hendricks Fritzscho, Howard, Vtforn- inghaus, Kramer. MID- DLE RCW Kupper, Kol- sey, San Filippo, Rozan- ski, Pflaum, Fink, 'Neim- berg, Casey, Hanson, Gla- senopp, Essig, Carne, Ed- wards, Tanton, Bierbrodt G Q H i 1- Y. STANDING--A Fastert, Goldstein, Scalf, Beranek, Schmidt, Madiol Steinbach, Pilgrim, Han- sen, Kano Hardesty, Lo- gan, Vtlelner, Miller, Schatz berger, Byrne Whiteway. Campbell Casper Tvrel. Mr. lvfonia I time zest, is bending the ball over the plate, while the initial sack is Ba-Seloall being handled by Seidel, a vet- eran of many seasons. A new keystone combination has been found in the persons of Tiefenthal, veteran second sacker, and Conrad, who has moved in from the outfield to take over the shortstop duties. Remaining veterans are Miller, the guardian of the hot corner, and lohnson, who holds forth in the center garden. Newcomers who have broken into the line-up are Farney and Sagalewich, outfielders: and Thomas and Marauardt, pitchers. the finish line were Pro- visoites, and as a re- CTO53'COUUlTY sult, the local harriers emerged victorious, l5-82. The only sore thumb in an otherwise brilliant season was in the Oak Park tangle. ln a closely contested affair, Proviso was defeated, 26-29. The outstanding members of the team were Stein. Kelsey, San Filippio, Kupper, Essig, Logan, and Carne. At thc end of the season, Stein was elected captain. , .Q-...vGa,6fm2,4gL,.,,t .- i.:--.,.r.v:..L4iW ...,.,.,..h,...., .. .l .hu-if 1..l,m, l . l .. . ., , ,. . G.A.A. BOARD. S. Iameson, D. Klupping, R. Ford, I. Rodger, I. Ol- son, Miss Wheeler, E. Ul- rich, I. Wright, S. Baron, F. Belluomini, G. Reay. G.A.A. AWARD GROUP SEATED-I. Olson, B. Mil- ler, V. Reich, R. Ford, E. Schroeder, F. Rittrnueller, S. Iameson, D. Klupping, G. Reay, F. Belluomini, S. Fine, I. Gustafson. STAND- ING - A. Belluomini, I. Ehrmann, A. Iameson, R. Stutt, D. Tosch, P. Lauth, E. Edelman, I. Radtke, B. Hoeck, L. De Angeles, M. Thiesse, L. Krause. LIFE SAVING. FRONT ROW4E. Watkins, A. Belluomini, V. Tonkin, I. Couse, R. Richter, L. Tolstod. SECOND ROW- - A. Arrighi, L. Sarniak, H. Fine, A. Iameson, L. Bell, M. Taylor, K. Viall, F. Hahn, P. Kewen, F. Gar- nowicz, E. Christensen, R. Guritz, P, Lauth, I. Wright, H. Mahnke, D. Klupping. THIRD ROW-L. Hayes, A. Kick, B. Fawcett, T. Ho- nomichl, B. Hunter, L. Behm, E. Edelman, M. Felt, B. Hoe, E. Garrett, E. Ulrich, I. Rodger, F. Iun- get, S. Iameson. BACK ROW--P. Steimke, S. Sei- fried, L. Hanley, L. Schaef- er, H. Stewart, I. Radtke, L. Hesselbarth, S. Null, G. Zawne, F. Belluomini, M. Coleman. G A A The G.A.A., through its varied ' ' ' and beneficial activities, has once more succeeded in maintaining its standing as one of Proviso's foremost progressive organizations. As in former years, the members introduced them- selves to the Freshman girls at the traditional picnic in Thatcher's Woods Where, after a few hours of hard play, hot dogs were roasted over huge bonfires, and a variety of songs were sung. For the first time in the history of the association, an intra-mural hockey tournament was held, and close friends became rivals for a period cf tworweeks. As a reward for their efforts, championship emblems were presented to the girls of the winning team. Although a minor sport, archery held the limelight in the fall season when the entrants of the tourna- ment learned h o W t o b e s t r a i g h t shooters in more W a y s than one. Nine girls b r a v e d the Interpretive Dancing ,,..,,.. V. K? 3, ...,...,,....,, . , ., . V. cold of winter and succeeded in passing their Senior Life Saving tests under the supervision of Miss Eva Eddy. Five Proviso girls traveled to Morton High School on October 27, to represent the G.A.A. at the annual play day Where they enjoyed numerous games and sports before dinner. A merry group of funsters gathered in the girls' gym for the Yuletide social before the Christmas holidays began. The gymnasium was transformed into a scene of festivity With a huge lighted tree, around which the girls sat to sing songs and to have a jolly good time. The cheery good spirit of the party was a pleasant farewell to the Work of school, and a Welcome to the play of vacation. More rivalry was exhibited in the snapDY series of basketball games in the intra-mural tourney. Bas- ketball, always a popular sport, this year brought out more members than ever before. Miss Iay Purvis, former national Women's ping- pong champion, demonstrated the finer points of the game to all paddle enthusiasts in the social room on Ianuary 27. She challenged several male faculty players for Whom loud cheers were raised by the crowd who wished to see them play. A tea in her honor was given by the executive board after the exhibition. Interested terpsichoreans were able to further ' Taq-s.,,:p' cf! lffif - .alfwf-1 f Q. ...M www their dancing ambitions through the efforts of Miss Dorothy Iackson, who took charge of the Dancers' Club. At the Municipal Building in Milwaukee, Wis., twelve girls demonstrated various techniques before the Mid-West Physical Education Convention on April 5. The invitation was quite an honor since only three high schools from this territory were rep- resented. Volley ball provided more competition in the in- between season of the calendar of sports. 'VV ith the first sign of spring, all baseball-minded members of the G.A.A. turned out for practice on the school dia- monds. Since baseball is one ofthe favorite sports, it was possible to forrn many teams. With the grace of professional performers, talented dancers, tumblers, singers, and swimmers brought to Proviso Township the G.A.A. vaudeville show, Three Thousand Cheer, which included the swim- ming feature, Neptune's Follies. The two nights' run found the auditorium with a large audience who later verbally applauded the splendid performance of student talent. Exhibition waltzing and toe, tap, and folk dancing were among the many acts. Se- lected groups displayed unique form in tumbling and pyramid building. Neptune's Follies presented a picturesque nov- elty in the swimming pool where, under the super- vision of Old King Neptune, fancy diving and an i l G.A.A. BY CLASSES FRONT ROW-S. Fine, H. Mahnke, L. Raab, L. Du- mond, I. Gustafson, I. Ol- son, S. Baron, B. Hoe-ck B. Lurie, R. Ford, F. Bel- luomini, M. Thiesse. BACK ROW--D. Kluppinq, G. Strcschrrifz, V. Reich, L. Treybal, G. Reay, L Wright, P. Lauth, A. Hull, V. Reesor, B. Schulz, A. Schulze, L. DeAngeles, E. Schroeder, L Rodger, M. Quitsch, S. larneson. FRONT ROWST. Hess, H. Gustafson, M. Bakewell, M. Coleman, M. Felt, E. Edelman, V. Miller. BACK ROW- R. Guritz, M. Tay- lor, B. Miller, I. Ehrmann, D. Tosch, E. Gyoerkoes, B. Sandro, A. Belluomini. FRONT ROXV-Elaine Rob- erson, L Lang, E. Wer- ninghaus, G. Cunningham, H. Lant, I. Radtke, F. Bar- sky. BACK ROW-L. Krause, L Baranyi, P. Lembke, A. lameson, M. Milles. FRONT ROW-M. Mullen, L Wynne, C. Van Pelt, S. Null, H. Stewart, B. Faw- cett, R. Herrmann, B. Moss, Eloise Robertson, L. Bar- thel, L. Glos. BACK ROW --A. Baker, D. Davis, M. Haglund, G. McCullough, V. Tonkin, H. Fine, W. Trockelrnan, P. Wade, H. Harrison, L. Worswick, M. Gee. aquatic version of the latest song hits were only a few of the high-crests of the show. By no means unprofessional were the costuming and the scenery of the spectacle, which were made by boys and girls with some assistance from instructors. Miss Dorothy Iackson supervised the vaudeville, and Miss Eva Eddy was in charge of the swimming. Since the club began the year with a picnic of greeting to the Freshman girls, it ended l935 with one of farewell to the departing Seniors. It was not, however, a day of sadness for it sent all outgoing members away with happy memories of the G.A.A. The Girls' Athletic Association gives girls un- limited opportunities in sports. Interpretive, folk, and tap dancing, cultivate gracefulness and mental alert- ness. Archery, baseball, volleyball, basketball, ping- pong, hockey, and speedball help develop not only keen- n e s s a n d skill, but also the g r o w t h o f s o u n d, h e a l t h Y m i n d s and bodies. A dancing class ?' QQ, 3 - ,.q-.-.- 1 Q, QL' Q in' II 3, -' ,dxf I x V e c , ee ee 1 .1 H 5. .,.,-,.,1-4 .1 yn 0 -B T ' my I '-gvi' 'i QL If 1 ' -1 -X -f, , .www 'kifgc .. 'T T ' X .Hp Lfiif' .- , e ' H5534 . iff',.'E.-is lf fx 'K r c or rx , -- T- ' Qi' -Z-,j'ie5. TZ-. ii . '- 7 ig, i . 4'-7 t glgwg' A 4 , . tg 54.-,.5f1.,:r -N A U :ref -ff -Zee? -5 n , T A g is Qui fiwrwwkvxvf '-' 4 ' -' af -f'7f,7Z e-p- , ff 'Q WIA- .f ' ,ff w- .ei , I.: fa of for f ef f ff , 1211+452 , -'r Jia-qf A ff , g Q Q W' 'f5?5 '?7af Salute To the educators who have blazed the trails through three centuries of educational progress. Against the golden background of our history The brave frontiersmen stand, and lean upon The long tall guns of courage. They are the trailblazersg sure of foot, Clear of eye, and with a steadfast purposep Brave in heart, and with a splendid vision Before them always. Never must defeat Bow their proud heads, or force them back a pace. The singing souls and singing strength within them, Push on to ever greater deeds. The way is made! The path is marked by bleaching bones along the dusty trail That thunders to a hundred heavy wheels You build your nation firmly, pioneer. With ever onward spirit you advance, Construct your nation slowly, step by step, Nor stop at barriers of naturey but by skill And firm determination to succeed, By building roads of hardships which you have met and conquered, By building bridges of the pain you have endured. You build a great and mighty nation- Blaze the trail and mark the way: Break through the wilderness into a new beyond And lead the weaker ones, Ever seeking, ever blazing, marking new frontiers. Of wagon trains across the prairies wide. Teachers, you too have blazed a trail Down through three hundred years, Sacrificing self to purpose, meeting hardships, bridg- ing difficulties, With books and love for weapons you toil on Toward new horizons. Leading, guiding, Loving us, you break a path into X The wilderness and send us on toward ' I Higher goals. Broadening and building X Wy X f Splendid visions, you direct us on N y f To ever wider knowledge of roads ' f x Which lead to new frontiers of learning. ,J X -Carolyn Bludorn x T T 27 ,I g, , X 7, 'X . 1 f 1 ., . f ', , Way? as ,ezffff- 2 'ff , ,.f 'aff T2 :'?Z'f '--Y? E: 'Ez Dia r 42 55955 mfifvf. ffo' QE'-ETA? T ' - til ' f i f if if fefefe eff? 4 , g f' -' -lf ' , ' 'Tl ' 7 ' f K , 'f , 4- E i A be . A51 7 'f ,- f ' ? ,if-fi 1Q idggzffx. I, 124 Three Centuries of Secondary Education By Harvey Ancel Youthful America, proud of her three-century-old struggle to provide an education for her children, in this year of 1935 celebrates the 300th anniversary of high school education in the United States. With an eye , iews the Ameridan tradition of free public secondary education. Prom its inception in the Boston Latin School, in l635, to the period of the academies, extending from the middle of the eighteenth century, to the latter part of the nineteenth, and on to the modern high school, were present in somewhat small numbers because most of the large landholders preferred private tutors, private schools, church schools, or community schools. Bc5 Tec'ondary education-vffrs Wtally influenced by the example of the grammar schools of Eng- land. The curriculum of the Colonial Latin-Grammar Schools was, in many instances, set by the colleges, since a preparation for the college entrance examina- tion was one of their chief objectives. Hence, the vfith itS SCientifi -' W ii w . Colonial grammar schools ned curriculum and build- . , L ' g A Y taught Latin, some Greek, ings-the American high -1-Qirf Q- 1 ,,f f T . f religion, and little else. school has ever advanced -- I, '-175: Y Since one of the primary along with the new social flu.:-'PAQ -K 3-L, Z - If-jj-ji-M reasons for the founding of OTCTGTS, tdkiflq its P10109 CIS - f- 7 413:-,-. these schools had been to a guiding force, as an ener- GQ ' B- Y f' prepare boys for the uni- gizing and ennobling spirit Z ' versity so that they might in the great American da E 53 . prepare for the ministry, all dream. yi-5 f 'Fei i students studied the same It was in l635 that the Qlgr ii .5 courses, whether they in- town of Boston, in the Mas- ' ,xx ' ' Zigi. ggi-, .Tj A tended to follow that profes- sachusetts Bay Colony, 6' 154: sion or not. In some cases, .',l 5, . ' si ' 1 I founded the Boston Latin -'Mc-'-N..'f.-ly -12. -au '.'L i XX ..4.L'. - the pupils were taught to School, an institution which has continued down to the present time. This school, established by a vote of the citizens at a town meeting, was originally supported by subscriptions from wealthy residents. Later, money was derived from leased town lands and from funds left by will to the school, and afterwards, when these sources proved insufficient, a town rate was levied to make up the balance for the upkeep of the building and the payment of the master's yearly salary of fifty pounds. By the close of the seventeenth century, about forty Latin grammar schools had been established in New England. Whereas the chief source of revenue for the school had formerly come from land grants and subscriptions from the wealthier citizens, the town rate now became the main source. Other secondary schools were set up in Maryland, in New Amsterdam, and in Pennsylvania, where, in Philadelphia, the William Penn Charter School has come down to the present day. The eighteenth century saw these schools opened in the remaining Colonies by legislative enactment and private initia- tive. Typical of the decrees made by northern Colonial legislatures for promoting secondary edu- cation, were the Massachusetts Law of l647 and the Connecticut Law of 1650, which required that a grammar school be maintained in every town of one hundred families or householders. However, in the southern and middle Colonies, secondary schools Boston Latin Grammar School-1635 read in English: but be- cause the grammar school teachers objected to the added burden, it was left to the elementary schools. ln choosing students, the master paid much atten- tion to their ability and social standing. The Latin- Grammar Schools served as a selective power dis- covering latent abilities and starting many youths on their way to college and higher studies. Few girls were allowed to enter these preparatory schools. Public education for the girls was limited -to the elementary school, the type which has come down as our grammar school of today, save in the case of the private schools for girls-not public education to be sure, but very important in the history of our secondary schools. With the approach of the Revolutionary Period, various social forces brought about a vital change in the attitude toward and in the conception of secondary education. Gradually, even as the spirit of democracy had slowly grown in the breasts of the elders, the indications of a new era of secondary schools in America appeared. The eighteenth century saw the influence-of such men as Bacon, Descartes, and Comenius bearing fruit in the new spirit which now animated the long- abused body of education. There had come a break- ing down of the narrow-humanistic theological de- velopments of the Reformation, and a revamping of the aims and methods of education. In America, there appeared a decided tendency toward the separation of governmental from ecclesi- astical affairs, and with the growth of sectarian dif- ferences, the Colonial Grammar School waned because it failed to meet the changing needs of that day. Consequently, it was replaced by a new type of secondary school, the American Academy. One of the most outstanding characteristics of the Academy was the wide range of studies it offered. Under the new democracy, those demands that were now to be placed on the people called for a citizenry capable of self-government and of a true social vision. The academies, with their courses in English literature and history, and in the mathematical sciences, as well as in Latin and Greek, were born of the necessity for a richer and broader educational helped cast aside the idea that secondary education should be entirely of a preparatory, rather than of a finishing nature. Also, it made more young men and women desirous of attending secondary schools. ln the early part of the nineteenth century, there were many persons urging that secondary education should be under the exclusive control of the state. Be- cause of the tuition fees connected with the academy, and because of its later disregard of the finishing function, in favor of the college preparatory phase, the middle classes voiced their belief that a new type of secondary school was needed. lust as she was the home of the first Colonial Grammar School, so now again did Boston insti- tute a new-born type of secondary education, the American High School. ln l82l, Boston established the program. Through the efforts of Benjamin Franklin, the Pub- ,If lf 4 lick Academy, one of the . i first in America, was found- ed at Philadelphia in l75l. At this academy, which is now the University of Pennsylvania, the aim was not alone to prepare the student for college, but also to serve as a link between ' K A . . K.-' .. ' -1 ,X -1 -. , j.:ggS15x,.:-1.-5... T P English Classical School to .- provide educational oppor- H tunities for those who were not going to college. This institution, which was later, in l824, called the English , High School, extended the public school system up- ward, so that it now in- cluded both the elementary and high schools. -- Since this school was I. . :,n,. 42-5: ' .v A 1 tu .3 1 ' '-1 . . N 0 ', ,MI 5 A .- 1 ' 1 , Jim qif., . J U c.f:.-E-- .ha 'W Y F i - ii 1 .tai -7. v 433 2.1 5 f-1,','1-.51 ,j if . sk' 23 0:44 T 8 . ..s- ,, , PM A 5-. , EL , -L j' 5 2 ill .31 1-G 'I fc. cr. - ,- M' K I ' If A- ',p -pf If i A Eli X X. D 21 ' P is N... H- ' 4 4 ,qv , E, 'HQ F, X f f A X the elementary school and the college, and to present the student with practical and beneficial courses which would be an end in themselves, should his education go no further. The growth of the academy as the predominant type of secondary school gained momentum in the early eighteen-hundreds. ln l787, the academies of New York were made a part of the state system of education. ln this state and in Massachusetts, the number of academies advanced beyond that of any of the other states. By the middle of the nineteenth century, there were more than six thousand of these schools in the entire United States, with 263,000 pupils and more than l2,000 teachers. Although most of the academies were for either young men or young women, there now came into being a greater number of co-educational institutions. Life at these schools was varied and stimulatingup the wholesome atmosphere provided an excellent basis for a cultural school life. Almost all of the academies were owned and ad- ministrated by private agencies. Since these schools often served large areas, they were, in many in- stances, available only to those students who were able to meet the expenses of travel and board, in ad- dition to paying the tuition fees. However, the growth of the academies had a pro- found effect on later secondary education. lt showed the importance of having well-trained teachers, and The Publick Academy, Philadelphia-1751 under public control and support after 1824, there was no tuition charge: however, strict entrance examinations were given, and only boys were admit- ted. A little later, in 1826, the Boston School for Girls was established and proved quite successful. By l840, Lowell, in Massachusetts, had an average daily attendance of fifty-seven boys and fifty girls. To Chicago, with the founding of Central High in l856, goes the honor of having the first co-educa- tional high school in the Middle West. ln the early eighteen hundreds, the academy was, of course, the dominant type of secondary school. With the rise of the public high school, the friends of the academy became strongly hostile to this new institution. By 1840, there were only about fifty high schools in America, and it was not until 1885 that the public high school came out of this struggle vic- torious, and the academy ceased to be a serious competitor. To Horace Mann and Henry Barnard, both greatly influenced by the Swiss educator, lohann Heinrich Pestalozzi, the present American system of public education owes much. Courageously idealistic and tireless, these two New England educationalists firmly implanted in the minds of the American people the concept of an educational institution, free, non-sectarian, and universal. Mann reorganized the state school system of Massachusetts, introduced new teaching methods, and educated public opinion in the doctrine of liberal taxation for public educa- tion, Barnard, who in 1867 became the first United States Commissioner of Education, began an institute for the instruction of teachers, organized school T libraries, and strove to improve the construction of the schoolhouse. T The constitutionality of the establishment of high t schools and of taxation therefor was repeatedly l attacked in the states west of New England. These contentions were settled in l872 by the Supreme Tourt of Michigan, in what is commonly known as the Kalamazoo Case. The decision in favor of the schools makes this case one of the important milestones in the establishment of the American public high school. The years following l85O found this institution growing rapidly in favor and im- these are now included in the curriculum, making possible an intelligent consideration of modern prob- lems. Creative expression has been developed by the addition of music, art, manual work, and writing courses. Eminent among modern educators who have made possible so great an expansion in the scope of sub- jects, is lohn Dewey, philosopher and interpreter of education's role in our present-day life. Since 1895, he has worked to give American education a prac- tical content, and to establish a curriculum that would impart social efficiency, particularly through a contact with modern institutions and industrial processes. No more is the teacher a drill-master and a dis- ciplinarian. The modern teacher seeks to guide portance until, by l89O, it ' rather than to compel. Hu- had become recognized as S ' man and understanding, an integral part of the state T, h fy these teachers can bring common school system sup- V V --t X I 42.1 out the best in Youth, Stimu- H 1' ,ee -VW If - TW' - '- M i ported through taxes. W7 fl LZ- tl X-' ,f late creative talent, and The public high School ' I 'Q-3? Mo broaden the student's social found a great opportunity yy i-:Ei - -sl ir, bn W A vision. More and more, the fer development in the Fftiifff T '. 'l proper 10SYChO1OQ1CC11 GD- - . 1. . W It fukin, fit proach is being used in Middle West and the West. , z - .p x gnlb ,Y , H fu Us N. Since the high school was - , g ff-Tl'Fl'E4 1 ' il , ,x leqchmq' already accepted as the , A ' hT : l '- ' Qutsjde of the educq- chief institution of sec- ondary education at the time the western states Typical Modern High School tional benefits, the modern high school is, in time of economic strife, a haven for i came of age, it was the only important secondary school to be found in the West. And today, we have the era of that great construc- tive force, the modern American high school, ever working and moulding, building and changing, in- fluencing all, and clarifying much, in our modern complex life. The high school has now become an institution where over six millions of America's youth learn to work and to play, where they are given an oppor- tunity to know life by living it correctly and fully: and where they can develop initiative and a sense of t responsibility while they plan their future careers. l That the value of a high school education has come T to be more and more appreciated is definitely brought out by the fact that during the twenty-year period from l9lO to 1930, the enrollment of the American high schools grew eight times as fast as the population. The aim of graduating the student with a head full of ideas rather than a head full of facts, underlies the curriculum of the efficient and scientifically planned high school of today. Civics and political science, vocational guidance, economics, courses in science and industry, and the older studies of his- tory, mathematics, languages, and literature-all thousands of boys and girls who would otherwise be thrown out into a faltering world, unprepared and disillusioned. Even as the high school has grown in breadth of curriculum and methods of teaching, so too have the buildings, which for three centuries have housed this institution, grown architecturally, and cast off their shabby garments, to be fitted with a dress more suited to their inner spirit. From the one-room log cabins there have come artistically-planned and commodious buildings of steel and stone, potent and influential, making a lasting impression on the American landscape. The Gothic towers bespeak the modern high school's symmetry of spirit and noble- ness of effort. What the next 300 years will bring is not for mortal man to surmise. Yet, with an eye to the future, he sees revealed with unmistakable clarity the pros- pects of still greater advances in high school educa- tion. Man, ever the searcher and ever the thinker, scales the summits of knowledge, and, having once gained his destination, invariably looks about him for higher and more promising summits to ascend- summits from which he can perhaps see still farther beyond the horizon. Proviso-1911 it Excavating for Second Addition Proviso's Twenty-Five Years of Progress By lean Stevens Twenty-five years ago, Proviso was a vague dreamy today she is a sturdy, living reality. From cr school with not even a building of her own, and with an enrollment of a mere 241, Proviso has risen to a spacious, beautiful institution, with more than 3,500 students. Throughout this growth, all that was good in the original has been retained. Courage, high ideals, vision, and service have made Proviso a symbol of what is great and fine. The school that proved to be the stepping-stone to Proviso opened in 19035 by 1006, it was the May- wood and Melrose Park High School, and was housed in five rooms on the upper floor of the old Emerson Grammar School building. The equipment was inadequate, and there were only seven teachers. Twice a week, an art teacher, who traveled from school to school, instructed the students in the simple mechanics of drawing. Several times a week, chorus instruction was given. Conditions were not very favorable for the purpose of concentration on the task at handy the small children of the Gram- Excavating for Third Addition mar School played and shouted beneath the win- dows of the High School. But despite many handi- caps, the students were eager for an education and contrived to get one, doing their best amidst unin- spiring surroundings. ln a short time, the school became so crowded that it was necessary to hold a double-session day. By the spring of 1910, the need for a new building be- came apparent, and a petition was put in circulation for a high school in Proviso Township. Some people thought the building of a township high school fool- ish and extravagant: but others who had the vision to understand that Proviso would grow far beyond her size at that time, supported the project earnestly. The young people of the town fought vigorously, making posters and cartoons, distributing bulletins, and arousing the citizens to vote for the building of the new school. Finally, election day came: the bond issue was carried, the battle was won. Proviso High School was assured. Many times during the following winter, students Laying the Foundation NNN ,v 1. -1''v:gg-e1w:ggsg'.'g:9a,g':wg:gxgg, gag-fag . 3.1 f ' T, , 1 . . . t 3 ff- ??f'5lf'lfif Itlllhii' ?Q'3i' iff?-f't'l if .s , -,'I,f'L.ffi3 g'.j1:,.f 5 1+,Q ,jqfTY,'f'f .vw-R....,e i-4: 8 ut 1 Remodeling the Auditorium and teachers came to the site of the new building and watched its progress. The laying of the corner stone took place on a bitterly cold Ianuary day, but the friends of Proviso forgot the cold in the realiza- tion that their dream had at last come true. As the Winter turned gradually to spring, and the spring to summer, the building grew rapidly, from mere framework to a nearly completed structure. Graduation exercises of the Class of 1911 were held in the new Proviso High School. Although the building was not yet finished, the boys and girls transformed the barren auditorium into a veritable arbor of loveliness. The back of the stage was bank- ed with daisies and forest greens from the nearby woods. The boys and girls had woven long chains of daisies, and the graduates marched down the aisles carrying the flower loops. ln September, l9ll, classes were held in the new school for the first time. The building provided ac- commodations for five hundred, and every one be- lieved this would be large enough for all time. ln- deed, it was magnificently vast compared with the former cramped quarters. After three years of existence, Proviso added a Proviso-1924 music department to the curriculum. The first organ- ization to grow up in this new department was an orchestra of twelve pieces, in the year 1913. Three years later, the Glee Clubs came into being as a permanent group. The years sped by, and in l9l5, to the surprise of the former skeptics, it was discovered that the en- rollment had increased to five hundred twenty-eight, thus outgrowing the capacity of the first building. By September, 1916, the addition was ready. Several class rooms, a gymnasium, a library, and an audi- torium, with a horseshoe-shaped balcony, composed the major part of the addition. During the ensuing years, the number of teachers and students grew quickly, and the spirit of Proviso tended to develop not only the mind, but also cul- tural and social graces. Numerous clubs, the first of which were an English Club called the Delphic, and the Latin Club, were organized. Athletics was de- veloped and encouraged: intersectional basketball games were played for the first time. In 1921, a band of twenty-five players made its debut. The music de- partment began to achieve outstanding success. In 1919, the Pageant was started, succeeding the s Going Up The Tower Rises A E . . :Lk 1:54, K 'KU if i . g , t 3 .1 . ' ' ,my :,, Qwfyg 2 . , .W y up Q. if Q . .- ' i - T. ig! A I., If g 1 it .stil I 1 't 1 rr r t ' , ff., I in r ' 1 t tz rt 1 1 s 571111551 -L 1 i . H15 .T-' s An Old Interior Blue-and-White, a small magazine, first published by the Maywood and Melrose Park High School. The first Provi was organized and published by the sixth graduating class, in 1916. Again, in 1922, another bond issue was carried, and the second addition was started. The new build- ing included an enlarged domestic science suite, a new and much larger auditorium, a gymnasium for girls, a swimming pool, and twenty-four recitation rooms. The ground floor of the new building was com- posed chiefly of space for a new heating and venti- lating system. Here, too, were the swimming pool, the girls' gymnasium, and several class rooms and shops for manual training. The first floor contained the enlarged auditorium, with a seating capacity of l,200, exclusive of the balcony. The stage was furnished with modern stage equipment, and was large enough to seat BOO people. Proviso had the distinction of being one of the first schools to install a pipe organ in the auditorium. Four social rooms, and several class rooms consti- tuted the remainder of the first floor. On the second floor was the auditorium balcony, large enough to seat 300. Rooms were added to the commercial, science, and English departments. By 1924, the new addition was ready for the enrollment of l,5OU. Now Proviso was aware of the increased oppor- tunities that lay ahead of her. The students and teachers co-operated in the organization of new activities and the promotion of old ones. Music festi- vals and concerts had become popular, and were attended by increasingly appreciative audiences. Various clubs were organized. Athletics grew rapid- ly in strength, and the good old Proviso spirit showeo 1 itself at the games. ln 1924, the Girls' League was founded. Teas, con- ferences, and a multitude of other activities came into great popularity. Truly, Proviso was a channel for knowledge, training, and culture. By 1929, the student body had increased to nearly 2,U0O. The capacity of the building was far too small for so many pupils, and, on lune 29, there was an almost unanimous vote in favor of the construction of another addition to the school. To extend the building eastward would have 1 meant the sacrifice of the athletic field: thus the 1 logical course was to continue it northward. How- 1 ever, the property on the north was part of the Forest 1 Preserve territory. After two and one-half years of spirited dispute with the County Board as to whether PRCDVISO A t , t .fr- the educational demands exceeded the recreational needs for which the property was intended, the School Board purchased the land extending north of the school to Washington Boulevard. The plans for the new addition included also provisions for future buildings. Because of the pros- pect of an ever-increasing enrollment, the new addi- tion was designed to simplify the future expansion of Proviso. For the convenience of students and faculty, new commodious study halls and a modern sanitary cafeteria were included as parts of the im- provements. The social rooms were added to help develop wholesome contacts among young people. The old library was hopelessly out-moded and in- adequate, the new one was planned to inspire quiet, and to produce an atmosphere conducive to study. There was a seating capacity of about two hundred and seventy-five, and shelves for 20,000 volumes were provided. A tower, one hundred feet in height, with a provi- sion for chimes, was constructed near the north end of the building. Set into the tower was a huge clock with four faces. ln future years when Proviso ex- pands to still greater dimensions, the contemplated future additions will center around the beautiful tower structure. The new building group was begun in November, 19295 part of it was ready for use at the beginning of the second semester in '30-'3l. The students and the faculty welcomed the beautiful new building, with its wide corridors, lovely rooms, and fine Wood- work. ln 1934, Proviso took advantage of the Federal Government's offer to get a stadium built as one of 1935 -- A New Interior the Civil Works Administration projects. The stadium, with a seating capacity of 2,000, was constructed on the west end of the athletic field. The field itself was enlarged and improved as part of the Work Belief program of the lllinois Emergency Belief Com- mission. Five principals have guided the development of Proviso through her years of service. The late lames Porter Adams was the first principalg his administra- tion included the years 1910-1912, when Proviso was founded. lohn E. Witmer's term of office was 1912- l917. 1. L. Thalman was installed as principal in 1917, and continued in the office for ten years. Will C. Bobb, followed Mr. Thalman, as head executive. ,W-4-'-'t ' mi WSW was iris- ati-gg f- -?1i'e.t7E7 .l'Z8t '1LW dr 7' THY RV IMTMEBLWWHFWR 55aV'1 i2'i 'W'5H'H'9im'wx.':.1 The present principal, H. H. Eelkema has been at Proviso for two years. Miss lulia F. Evans, head of the Latin Department, has been of service to Proviso for more than twenty years. R. E. Poplett, Miss Martha Hildebrandt, Hum- bert Gentilin, Miss Dora M. Mitchell, O. W. Wills, V. G. Catlin, C. C. Taggart, H. E. Carr, Miss Florence l. Otis, Miss Margaret Phelan, L. D. Brennen, Miss Anna Harman, L. K. Amsden, Miss Amy Barnum, R. Lee Csburn, Miss Florence H. Scott, and Miss lessie V. Seaver, have been at Proviso for fifteen years or longer, coming in the order named. Miss Winnafred Shepard, H. F. lohnson, F. W. Baer, Miss Fae Duvall, O. H. Matte, Miss Ruth Neal, Miss Grace Trigg, Miss Frances H. Trost, C. H. Saylor, Bryan I. Wagner, Miss Ruth M. Whitfield, and Edward W. Stubbs have taught here for ten years or more. This spring came the twenty-fifth year of Proviso, and her Silver Anniversary. Students enthusiastically co-operated with teachers and friends of the school in the attempt to make this a glorious celebration to review the colorful history of Proviso. Members of the faculty cheerfully gave many hours of their time in planning the Silver Anniversary celebration during the week of April 4-9. The anniversary program began with an open house on Thursday night, April 4, when parents came to see the wheels go round, as regular class sessions were conducted. Friday's feature was the Senior Class Play. The Girls' League gave a recep- tion for the former officers and leaders of the organ- ization on Saturday afternoon. Sunday, alumni from all parts of the country came to Proviso for their first big reunion. Asembled in the auditorium, they greeted old friends, some of Whom they had not seen for many years, and enjoyed a program of alumni talent. Principal H. H. Eelkema made the statement that if Proviso continues to grow in the same proportion the following twenty-five years, there will be approximately 8,500 high school students in the Township. The alumni then gathered for class reunions, and teachers and former students welcomed each other with tales of Remember when? Many of the former teachers and one of the original faculty, R. R. Brinkerhoff, were present. The Historians' exhibit in the social room during the week portrayed the rise of high school education in America, as well as in Proviso. Tuesday morning, a pageant, No Retreat, depicting the advancement in higher education was presented in the auditorium by the students. All the service clubs of the Township were enter- tained Monday at a banquet in the cafeteria, and were addressed by Dr. Samuel W. Grafflin, editor of the American Aristocrat. The speeches given dur- ing the celebration week were in keeping either with the Silver Anniversary of Proviso or with the 300 years of American school history. The Silver Anniversary dinner, the final event in the Week of celebration of Proviso's twenty-fifth birth- day, was attended by approximately two hundred and twenty-five teachers and educators, Tuesday evening. Blue and silver formed the color scheme of the decorations, programs, and place cards. The gayety of this last gathering dedicated to the Silver Anniversary proved a fitting climax to the Week of lubilee. And now that Proviso's twenty-fifth birthday has passed, the future years stretch before her like long waves on the sea. Although they are veiled in mys- tery, the Spirit of Proviso, ever-glowing, shines through in a silver light. Proviso's Auditorium Proviso's Grrowth From 1910 To 1935 By Adolph Zapfel As the Proviso of 1911 was being completed, people of the Township made the remark that the then little, red school house of twenty-one class- rooms would stand for all time. Little did they realize how wrong they were. ln these past twenty-five years, Proviso has grown to be one of the largest high schools in the country. lt has increased in en- rollment from 241 in 1910 to more than 3,500 in 1935. Parallel with the growth of the building and the increase in the number of students was the increase in the number of faculty members. ln 1 1910 and 1911, when adequately houses the student enrollment of more than 3500, increased the size of the building by more than one-half. A fact to be noted is that, although the student body almost doubled from 1911 to 1914, the total number of teachers increased only eight, thus bring- ing the total to twenty-six. The most interesting information relative to Pro- viso's growth has been found in the records of the years after 1924. Before this time, the enrollment had increased from 633 students and 26 teachers in 1916, to 1 the total student en- 5,9761 885 students and 43 rollment was 241, the I teachers in 19207 after teaching staff was 193'-'AB' 30 1917, the increase small in proportion, 2 7 W was far greater. 27-23 totalling a mere eighteen. Another fact of 25 I 924 1925 . . - great interest is that 'fffm in '22 ' ' 1920 - 92 the first graduatinq ,wg 199 ClGSS of tWe1'1tY-five 'W' lf . f9f7 -69 years ago consisted ,M is 1915 -68 of a grand total of M in twenty-two, While the S11 T 'f BIZ 252 present graduating 91, - fy :lass numbers ap- ' -22 proximately 575. ,s,,,,,,,,, The table on this page shows the in- crease of graduates from 1910 to 1935. Those who had GRADUATES OF PROVISO TOWNSHIP HIGH SCHOOL FROM 1910 TO 1935 said in 1911 that the small structure which housed Proviso would be adequate for all time realized more fully each succeeding year how far wrong they wereg for as the student enrollment increased from 241 to 474 in four years, the twenty-one class- rooms, which theretofore had served Proviso, no longer accommodated the school with its 233 student increase. This astonishing increase necessitated the building of an additional nine rooms, which cost S75,000. This new structure included a gymnasium, a library, an auditorium, and several classrooms. This addition, however, was not to be the lastp for the enormous student increase, year after year, necessitated more building. The 1500 students en- rolled in 1924 enjoyed new heating and ventilating systems. There were also a new gymnasium for girls, a swimming pool, and several more class- rooms. The part of Proviso known as the new building was proposed in 1929. This latest addition, which From the begin- ning, the student en- rollment up to 1925 had increased only by hundreds: after that year, it :increased not only by hundreds but by thousands: from 1,315 pupils in 1925 to 2,250, and to 3,524 pupils in 1935. With student in- crease, teachers were added to the faculty, which grew from 67 in 1925, and 94 in 1930, to 109 in 1935. Though the figures did rise in those years, it is true, however, that they also took a slight downward turn in 1917, when the enrollment dropped to 599. This decrease can no doubt be attributed to the fact that the year 1917 saw the United States enter actively into the World War, which meant that many of the students enlisted, some of whom never came back. lf a school can increase from 241 students and 13 teachers to 3,524 students and 109 teachers in a mere twenty-five years, and if it can continue at its present rate, one can imagine the size of Proviso in 1960 when she celebrates her Golden Anniver- sary. Each graduation day for the last twenty-five years has seen an ever increasing number of Seniors leave Proviso. The above table shows there has been an increase of 544 graduates from 1910 to 1935. Another interesting fact is that in the past quarter of a century, 4,640 pupils have been grad- uated from Proviso. Since 1911, each succeeding class graduating from Proviso has left some evidence of its loyalty and appreciation. There has been as wide a variety of gifts as one could imagine. From the first, which was a bust of Shakespeare, to the gift of this year's class, a tennis court, each presentation has immeasurably enriched the school in an artistic as well as in a material manner. Many of the beautiful pictures which adorn Pro- viso's walls are the contributions of former classes. Two of them are P1owing, a strong composition by Gicomi, and Katwyk, Holland by William Bitchell. Another class gift is Harvest Field by Volkmann from the Class of 1916, which group also gave a silk American flag. b 3 The Castle of the Maidens, from the series of fifteen symbolic paintings of the story of the Holy Grail, was purchased by the Class of 1914. This, with six others of the same series, hangs in the hall- way bridge. The originals decorate the Boston Public Library. The paintings show Galahad, the central figure clothed in red, as a symbol of aspiring youth working through difficulties toward perfection. An Abbey picture is ever a delight and inspiration to Proviso students. Continuing the fine precedent of giving art works as class gifts, the Class of 1915 presented to the school The Singing Boys, a plaster frieze in high relief by Luca della Robbia. Sti1le Nacht by William Wendt was the gift of the Class of 1919. The paintings, Mountain Sunshine by lohn Spelman and Springtime in the Blue Ridge by Charles Dahl- green, were left by the graduates of 1925. The charm of nature's various moods and the strength and beauty of landscapes has been brought to class- rooms and corridors by these pictures. Several of the classes have contributed towards making Proviso's athletic field one of the best equip- ped in this part of the state. The Class of 1920 present- ed to the school the drinking fountain: and the Class of 1922, the wide-arched gateway, which provides a main entrance to the athletic field on Madison Street. The latest addition to the athletic field is the sta- dium, now standing as a symbol of Proviso's great progress in the field of sport. The three classes, '27, '28, and '34, who contributed toward the stadium, held a reunion here last year after the Proviso- Evanston football game. How proud those former students must have been to see the thing they had dreamed of now a reality! Other additions in athletic equipment were the electric score-board, now in the new gymnasium, and the football telephone set. These two practical gifts were from the sports-loving Class of 1933. Senior Class Gifts An initial payment by the Class of 1923, of five thousand dollars, part of which was raised by solicit- ing in the township, made possible the pipe organ in Proviso's auditorium. Since its installation, thou- sands of seniors have marched to its majestic strains. Other gifts for the auditorium were a table used for assembly programs, the gift of the Class of 1918, and the amplifier, presented by the 1926 graduates. Through the generosity of the Class of 1930, the sunny inner court of the new building is soon to be transformed into a lovely English garden which will be an ever-changing arrangement of colors through- out the seasons. Proviso owes much of the beauty of its landscap- ing to the Class of 1924, which left a fund for the improvement and beautification of lawns and the planting of trees and shrubs. One of the most valuable gifts ever presented to this school is the hand-woven tapestry from the Class of 1929, which hangs on the large east wall of the library. For design, an old seventeenth century Arras cartoon was used by the artists at Verdure, France. lt depicts a lovely woodland scene in which mellow grayed-greens and blue-greens complement bits of rich warm colors. The material, quality of craftsmanship, and fine pattern make it an exceed- ingly precious treasure. Also in the library is the bronze bust of Charles A. Lindbergh, a gift of the 1928 graduates. F. W. Engle- mann's bust of a type of ideal American youth, famous for his daring flight over the Atlantic ocean in 1927, exemplifies the motto chosen by the Classes of 1911 and 1934: What we dare to dream of, we dare to do. The honors and awards that Proviso has received' in practically all fields of endeavor, down through the years, were given a permanent place when the Class of 1925 built the trophy cases in the south hall of the old building, but since the cases were nearly filled to capacity, the 1930 Seniors put aside a fund for another trophy case to be built in the new building. Through a fund created by the Class of 1931, melodious chimes will some day give voice to Pro- viso's stately tower, which stands as a symbol of her ideals and aspirations. Two gifts which have added much to the home like atmosphere of the constantly used social rooms are the grand piano and the well-designed wrought iron, fireplace equipment, gifts of the Class of 1932. Beautiful and useful as are these gifts to Proviso from departing classes, the richer treasure lies in the love and loyalty which prompted their giving. As they return to a school grown to proportions almost beyond recognition, the graduates of classes past may look with pride at the part they had in the building of a greater and more beautiful Proviso. Grand PianoeClass of '32 Springtime in the Blue Ridge by Charles Dahl- green Mouniain Sunshine by John SpelrnaneClass of '25 Bronze bust of Charles A. Lindbergh by F. W, En- glemann-Class of l928 l-land - Woven Tapestry from Verdure, France -- Class of 1929 The Singing Boys by Luca Della Robbia-Class of l9l5 The Pipe Organ-Class of i923 The Castle af the Maid ens by Edwin Austin Abbey-Class of l9l4 Gateway io the athleiic field--Class of l922. The Stadium-Classes of '27, '28, and '34 i ' As Dean of the School of Educa- tion of Northwest- ern University, Dr. Ernest O. Melby is able to speak with authority upon the changes in sec- ondary school education during the past quarter century. Intelli- gent, capable, and youthful in ap- pearance, Dean lVfelby's courteous manner soon revealed his genial, friendly, and understanding personality. Dean Ernest O. Melby Even the atmosphere of his cozy office was im- pregnated with the history of American education. Ancient, yet modern, it is located in the quaint Old College, built in 1855, the first building erected on the campus of Northwestern University. ln a few well-chosen words, Dean Melby com- pared and contrasted the high schools of the time of Proviso's founding with the great secondary institu- tions of today. Universal education, he pointed out, is the most distinguishing characteristic of American democracy. Unique among American educational institutions is the secondary school. Its growth during the last twenty-five years is the most dramatic social develop- ment in America. The enrollment in secondary schools has doubled every decade since l880. lf we contrast the American secondary school of today with that of a quarter-century ago, a number of very definite differences are manifest. ln the first place, explained Dean Melby, there has been a marked change in the fundamental pur- poses and ideals of secondary education. Twenty- five years ago the primary function of the high school was to prepare for college. Curriculum was relatively narrow, consisting largely of languages, mathematics, and occasionally, courses in science. Today the fundamental purpose of the high school is to educate for life. College preparatory function has become only one of the purposes of the high school. In a general way, the American high school has become the people's college. Education for citi- zenship and rich living has become the all-important objective of high school work. Equally striking are the changes in high school curriculum. Literally hundreds of different subjects are taught in the American high school. These rapid l Twenty-five Years Ago and Today By Rex Horton expansions in curriculum are the result of an effort to provide for the ever-widening range of pupil abili- ties and interests. Looking to the future, we can expect less emphasis upon such subjects as Latin and mathematics and more emphasis upon the social studies and leisure time activities. There is also a marked contrast between the methods of teaching followed twenty-five years ago and those advocated today. ln the older high school, the emphasis was placed upon memorization of facts while in the modern school more emphasis is placed upon learning by doing and upon activities pro- grams. Many of the most useful lessons learned by pupils in the modern high school come out of the so-called extra-curricular program in which pupils play parts analogous to those they will take in their communities following high school graduation. There is a popular feeling that the work in high schools twenty-five years ago was harder than that today. The question cannot be answered in a categorical fashion. The curriculum is much richer. The amount of material to be covered is much larger. Students read far more extensively than they did twenty-five years ago. They learn and know more facts. They enjoy richer experiences. They have a broader background of knowledge. They have better social insight than the high school pupils of a quarter century ago. ln addition, ther students of the modern school are better readers. They can read more material in a given time, and they read more intelligently, This is true because of improved methods in the teaching of' reading skills. Generally speaking, one would be safe in saying that the scholastic standing of the modern high school is improved over that of twenty-five years ago. There is a marked tendency in the direction of an enriched program of extra-curricular activities, which in time will cease to be thought of as extra-curricular. They will become part and parcel of the regular high school program. When this fusion of the extra-curric- ular with the curricular is accomplished, it will lead to an enriched program of activities and a greatly improved high school experience for the typical boy or girl. The noted educator summarized the problems of the present-day school by stating, Outside of the modern American secondary school, there is a rapidly changing civilization. lt constitutes the most dynamic challenge to the high school at present. How to make the American high school a living part of American life, how to make it function in prepar- ing young men and women to take their places in a rapidly changing society-these are the problems which challenge American high school pupils. teachers, and principals of today. A Quarter Century of Development By Milton Ratner A decisive, stimulating person is Dr. Charles H. Iudd, head of the Department of Education at the University of Chicago. Dr. judd's handsomely- furnished study provided a pleasant background for the lucid discourse of the distinguished educator, who is the embodiment of efficiency, dignity, and tactfulness. Seating himself opposite his interviewer, he repeated thoughtfully, ln what ways have the high schools of the United States developed during the last twenty-five years? Well, l should say that the most outstanding developments have been along three closely related lines. The first and perhaps the most important development is the increase in the student atten- dance, said Dr. judd, while settling himself down to a subject with which he was thoroughly familiar. About one million pupils were enrolled in the high schools in 19105 by 1935 this number had grown to seven million. Even more significant than these figures is the fact that today we have a seventy per cent attendance of all eligible young people. The comparatively small number of boys and girls,which our high school system has not assimilated, are con-- fronted with one of two unfortunate conditions: either they live in rural districts which lack transportation facilities or they live in states which have recently been admitted to the union and do not have the proper educational systems. Not one of the European nations has an attendance which exceeds fifteen per cent. Even this is surpassed by the colleges of our country. Your next question will probably concern the reasons for this growth. Some people base the cause on the increase in the total population of the country. This is not so, for in 1910 only one per cent of our population was attending high school, while today we have six per cent, a figure greatly exceeding that of the percentage of population increase as a whole. Since 1890, almost every decade has witnessed a doubling of the number of students in secondary schools, and we certainly can, not say as much for the growth in population, he stated with an air of conviction. The basic reason, however, is the recent change of the United States from an agricultural to an indus- trial nation. This change in economic structure pro- vides work almost exclusively for adults. Youth is no longer needed to work on farms, in factories, and in business, since adult labor, which is unquestion- ably in abundance during the present day, is pre- ferred for these positions. Growth in student atten- dance and growth in industry go hand in hand with one another. The second development of the last quarter-cen- tury concerns the school curriculum. This country 7 has witnessed very great and very fundamental changes in every feature of its na- tional life, and the secondary school has shared in these changing conditions. The gradual evolution of the new concep- tions as to the pur- pose and function of education along with the growth in the number of students has created a wider course of study. Years ago, people who went to high school went to college, and, con- sequently, their demands for the classical courses produced a limited curriculum. Since then, practical and vocational subjects have been added, as neces- sitated by the various and changing needs of the students. These new courses have occasioned an increase in educational and vocational guidance due to the greater number of elective subjects. A change in the methods of teaching is the third augmentation. Although the chief energies of educa- tors have been absorbed in an effort to provide schools and materials, real advances have been made in improving the technique of instruction. The old method was a recitation by the pupil of what he had read in his text book. Knowledge was put into the student's head through the exercise of sheer memory on his part. Today, young people are being put on their own: they are sent to libraries, offered the use of reference material, and given instruction under the methods prevalent in college. The growth of extra-curricular activities and the tremendous improvements in school equipment must not be overlooked in reviewing the developments since 1910. The school building of twenty-five years ago is a decided contrast to that of the present day. The classroom was bare save the necessities in furniture and teaching facilities: schools did not have swimming pools, athletic fields, auditoriums, fine ventilating systems, lunch rooms, etc. Today, we are embellishing the atmosphere of the classroom to stimulate an interest in the course. ln conclusion, Dr. judd summarized, There have been two marks of development in secondary schools: first, expansion which has taken place in student numbers and in material equipment: and second, the scientific trend which has influenced the curriculum and methods of teaching. Dr. Charles H. Iudd f2fexoQxeOe f 'WQ,sQQ2'6fwxMQ12QN fewgeseae QS QQQQQQ. oe QOQQOOQCQONQ Q-oeoee Kxogo we emma ok we QOSN cixoe givooive we seooxbeb 'xo Qsoee 006 gixcmsee. ex osx -ekoiwgsw .... Seq. Qu me ee M60 50 We Qwbeoxg. e0Nef,Kcix0'x'XlqQe Qxekesi' . . . UCBQOQ5 Oqygxgaxf' OOXZQQ xog -ew SAQQO ko 0589631 Noxiiooveox .... Cfxowwfw Ngxayaixeg aagosx QoQfoosc9OCQ'e we OKMQ6 xo CNQQ4 Keen xsqgocgeese, I vfiifxfi QSQQWQE 115222 fx K6 ml X005 ' O89 xes-29 wx eixfl, Nix? Qneox, . . . .ugxcz QY5 xoeoeiix 690006. . . 0503 68006 bosses. . . YYQQ 5' XX X 6'Z1Yw I D 'ex Ywv N Qbbbfgx, Uxx, SO v 4290 fx fikb 150133. VNV ' X x xooqe 6x9'ix'48 Qnesix ee Q0 X930 0 eex Ko Xo6eQx6 QSOQQ 'xox Eyfbegixoi 9045 006 C395 Gockeseooe 61-QOOKXQ eg? Ooxxxclb QOQQGQQQQQ XOQQCS, QOO6 50 ' f2'YXNo4QGeQx40QXQOgeexe .... 9064, QOXSQ9 wogeeq Koxioogibeok GSKYQQQQ C38 .... x ee H8006 NG. was 306 6009 Koyso QR Q36 ekobeo xiddbeooe, QKTL Xiiiixdixoo. xO068e .... oeew X04 Eixe i9'963K'5 OGK C56 Qexe QQ exeogo. SOSXQO 0650 xkebdpd' Ko F, Qi The 1934-35 Calendar September 4ASchool opens. H. H. Eelkema begins second year. Opening assembly. 7-Big Sisters entertain Freshman girls at a party in their honor. At the annual Freshman party Senior Guard girls meet Little Sisters. l5-First football game of the season with York a victory. l7-School dismissed early for Proviso students to attend Fair--Constitution Day. 19-Class of '35 had its picture taken out in new Stadium. 264Annual G.A.A. picnic in Thatcher Woods. 28-First Girls' League assembly this yearguldeal Proviso Girl. October 34Dedication of Proviso StadiumfCardinal game. 5-First dance of school year, by Senior Science Club. ll-Pep assembly for Morton game. l3-Fall frolic. l5, l9MSunshine Pal Week. l8-U. S. History Club-Historians. 24, 25- Grand Canary --Band benefit at Lido. 26iPep assembly CEvanstonl. 27-Senior masquerade. Grads meet in cafeteria after game. November 2eWinston O'Keefe talks to assemblies. 8-P.-T.A. meeting and extra-curricular organiza- tions hold special night meetings. 9-Pep assemblywOak Park football. 15, l6, l7e-Students see Shakespearean plays at Globe Theatre. 16M-Girls' League Bazaar Gypsy Fiesta. 17-Conference tours. l8-Arts Club exhibit. 19-Adult school opens. 2U-Carveth Wells speaks at assembly, See Amer- ica First. 2l- Good Medicine given by English Cabinet. 224Freshman Class assembly. Class candidates introduced. 23, 24, 25-Boys' Conference and Girls' Conference. 28-Thanksgiving baskets distributed. December 6-P.-TA. meeting. 7Hlunior Mixer lChristmas decorationsl. 8-Band dance Ceveningl. 15-Senior Christmas Frolic. P.-T.A. rummage sale. 16- The Messiah presented. 17-Office Girls give annual Christmas party for children of faculty. 20-Proviso Players present Why the Chimes Rang and Choir Girls give concert. ' Ke 66 Q06 O06 6:16 66 . .. 6660 . 064666 4- 66654666 66496 xo Nx 66466669554 , , ,'Qix6Koix606 641266 66666 66 66069069 . . .HSQQ ei 6XX66x6x 42666 66 ON QOSNR1. . . 66661 666 KXQQ69 .... 94-6N2iX . ,QJO66 06009 OO-QQGQ: No 66 666 6306666 66 6 00606 Q6 Q06 Rox QOe?DNoef606N3' 5x?s66 XQXXO-5 X60 S6858 X6 CQOCQ 'QGGQS 60 6 666 6666 No N26 Q C66 6QVO6cix66. . xs3eexx566xC: 06600 4614 608 .... fi xox Q x6f4S9. G61 50 666 X666 X66 69 QOGQ KOS xo4X6o 62206686 RSO fYS?O6f' Xxxixox S686-0 .' C5 ef66i9' any 624 'uw 3 f X62 xxx 23,5 tt UW , MQ 'A pu K Ad Y N594 P' , hi ' 4 TNA Y- 6 'ff 6 If Q96-Rfb! 'SN B' p 1 X 66 666 400 6 N B612 QL 66616 4666 Koa 6666 O-NGS xo 666 650666. 66 .... S9633 X66 so .... 6669 ,f-5 6616 666 660 'Xxxixos Q96 QQQGGXQS X6 600 6 s6x6c,6s66xe6 N1 .... 'XX66650 666 616 ml . . . 0666a6X6',' 6 'W666' 496 96086 6K 6:1 666Qef66co66 6 6,664 666 666 bo 4 6666 066666666 Q08 O 966 C656 e. MMP January 2-Law students visit the House of Correction. -Faculty meets Ctirst of the series ot monthly con- terencesl -Captain I. Craig speaks at assembly. 18-Miss Oakes talks to Freshman girls. -French Club holds reception for Miss Boss. -Senior Hi-Y are victors in Inter-Club discussion contest about What ls the Typical Proviso Studentu? -Pageant Staff reorganized. Proviso joins Big Twelve Debating League of Chicago Area. tAnnounced in the Pageant on this date.l -Second semester begins. -P.-T. A. holds first meeting. C. I. Heintz, of the research department of the American Can Com- pany, speaks about canning. 25-Proviso Orchestra concert presented. 27-Historians exhibit relics. 28-Supervising board for the Provi announced at an assembly. Grade school and high school English teachers meet. 30-Alberta Brenner, lecturer of the Spaulding-Gor- ham Company, speaks at Girls' League tea con- cerning Romance of Silver. 31-Iames Weldon Iohnson, negro poet and author, speaks at assembly for Iuniors and Seniors. February l-Girls' League entertains February Freshmen. 6-Miss Oakes announces that all monitors will Wear identifying emblems. Mrs. William Bay, a representative from the Vogue School of Fashion in Chicago, speaks to Sr. Home Ec. Club and other girls about Costume Designing as a Vocation. 7-Freshman Honor assembly. Provi Staff an- nounced in Pageant. 8-Iunior Pal Party. University of Chicago tilrn shown to Iuniors and Seniors. Betty Caffero elected as Secretary ot Sophomore Class. ll-Intra-mural volley ball tournament begins. Seniors begin having pictures taken by Gibson studios. l2-Commercial Club tours Chicago Post Ottice. 13-Proviso High School and grade school teachers meet at Proviso. 14-Girls' League Valentine tea. Assembly tor stu- dents concerning Provi plans. 15-Freshmen frolic at Valentine party. Senior Class play, Quality Street, by I. M. Barrie, an- nounced in Pageant. 16-P.-T. A. sponsors bake sale. Class ot l925 gath- ered at Medinah Club in Chicago. . 17-Band concert. WX 55505 V 005 X, Qi Yxekeobeie p1,oooc5,X06q , od QQ OX, we QX666 .... Qkeexf we edx6f i4,X we ecixb .... Klogoxjxci 03 QOX GCSXOQQ. xg, xo5Qfe0c,Q. . QKQQOQXQ-o. 'x SON V206 We Q Q me 400 QQXOQX Qkieef, Gxixf 2- xxlecmes .... X5 . Woe QOYQO X9 QQQXQQ 'QXCEGQKQ K4 X. ex 05x xe x QQ. . Nx 300 x hoo QS No Qoxm xo' Q fxdixoxl , Sxofixofz X0 Q0 Oo-ew CQVQOQ xocix .... Wwe Kobe ofbe-cixoi .... Soxliixocia E56 49- P- ?-9991 XX Q? X' M 2 vwknx, Oo, My X f . Nu 1, 0, if .X wi ww 'ixol-Q4 'Y uw-w 'Y 96 X, Db Q .Wi Sm Q xxloogx P9 W -x lk X 4966 9 Cc-ANC M15 if X, Q-vw Z Nxxq Qggixqcixg gixgpx Q ookox 20. 'ixxleokxlfweklecp xv Qxewaee- ,.,. Secixose- XNQQQ QOQXQ goeaeosegowxe xglvm, , ,QXKYXOQ Qeek .,.. Qxoxikeo Kcibee 0 we-K cow so 60 eKo6eoKQ ,... Xfogi- C9 Q06 H506 eogoe 91686 .... K N e Me? 18-English teachers meet in conference with graae school principals and teachers. Pep assemblies staged. l9AMarblehead entertained by Varsity Club. 21-Seniors vote on class gift and colors. Orchestra dance. 23-Band parents sponsor annual card party. 26-Adult education students give La-ze Ranch. Oliver Twist sound motion picture shown. March 1-Girls' League tea. 7-P.-T A. meeting-cafeteria supper-C. H. Berg- strom talks. 8-Naturalists dance. 10--Second of the series of band concerts presented. 12-Hi-Y banquet tOak Park, La Grange, and Pro- visol. 13-Girls' League tea-Iohn Mueller speaks. Iunior-Senior assembly. 14--Faculty tea. 15-New members taken into Varsity Club. 16-G.A.A. vaudeville given. 18-Dan Thrapp speaks to Historians. 20-Iunior Home Economics tea tor mothers. Films shown by athletic department. 22-Iunior-Senior Mixer. 23-Leaders go to Northwestern University. 28-Sophornores present Station YYYY. 30-In-an-About High School Concert. April 2-Girls' League tea. 4-Dancers go to Milwaukee. 5- Quality Street presented. 6-Girls' League reception. 7-Banquet to honor first football coach. 8-Dr. Samuel Grafflin speaks at honor assembly. 9--Anniversary Pageant, No Retreat, given. 3-9-Anniversary Week. 12-14-Orchestra concert. 17-Cameron Beck speaks at assembly. National Honor Society Induction. 22-26-Senior Fellowship Week. 26-Howard H. Cleaves speaks on Wild Life. May l-Girls' League Election. Girls' League tea dance. 2-State band contest CUrbanal. P.-T. A. meeting. 3-State band contest. Commercial Club dance Ceveningl. 9-Girls' League Installation. 10--Prom. ll-Sophomore Class dance. 17--Choral concert and operetta. 23-Senior Examinations. 26-Baccalaureate. 28-Examinations and Senior Class Day. 31-Commencement exercises. Poetic Meditations By Carolyn Bludorn IN A CONVENT GARDEN White hands, that in the twilight Count those beads, How long have you been praying, Slim and pale? How long have you been old? Have you never been in Youth? Never torn at the night With eager young fingers? Never blindly grasped for love? Never flung back with impatience The black, enshrouding veil? Or have you always been, as now, Watching the flying years go by As beads slip under your fingers? MORNING AFTER Short while ago, I swore by all above That for another chance to prove my worth And cause your lips to smile again, my dear, All elements of heaven and the earth Could not stand in my way, or cause me fear. I'd go through fire and water for your love. I thought that I could gaily go through Hell ' Nor yet forget the beauty of your smile. I thought that trial by fire I could endure, To have your kiss, and know I was worthwhile. And now that you are mine-I'm sudden sure That I could do without you, just as well. CLASSICS AND THE scHooLBoY The face that launched a thousand ships is Of any beauty that might please this boy. For ten years, battles rage-he does not care! In vain he sees the windy Walls of Troy. He does not heed the frenzied armies' cries Or sorrow at the tents of Rhesus, white On Trojan plains, but frowns a bit and sighs Because he has some studying tonight. He does not sicken at the savage lust Both sides display. Achilles leaves his tent- bare And Hector, slain, is dragged through conquered dust. The boy looks up, his patience nearly spent. Troy perishes!-her greatest heroes-dead- The boy puts up his book and goes to bed. OPPORTUNITY A princess with a ring of golden keys Walked down a hall of jewel-studded doors: Opened each one, and closed it quick in scorn, Leaving the key Within the glowing roomy Until but one lone door remained, Most beautiful of all. Eager, she flung it wide and gazed upon The cold, bleakgray of World. PORTRAIT IN SCARLET Like scarlet women of the world the tall trees stand Frowned upon by their conservative green sisters. Under a clean and wind-swept sky, With only little clouds remainingy Against a backdrop haze of purple hills and autumn water. While older trees, far past the flame of youth, Blush faintly for the scarlet Wantons' sins. ROSES OF AMBER By George Barker A cottage far away over the summer hills With a garden: Amaryllis and phlox, White lilies in sapphire water, A massive elm, A fragrance of sweet marjoram: A solitary figure lying silently in mossy shadows, Dreams. Roses of amber on emerald stems. Tranquillity: Beauty: loy- Esctasy. Roses of amber on emerald stems. No worries, ' No cares, no responsibilities: Nothing but pleasure from dawn to dawn. All beauty is revealed: None is hidden, none is concealed, None is mysterious: Mysterious beauty with its charm and inspiration is gone. Ioy is unrestricted: There is no place for sad remembrances. There are no new delights to search for: There are none to hope for: There are none to strive for. There is nothing to live for,- Except unlimited beauty and joy. Roses quite withered on thin, waxy stalks. WONDERING By Beverly Popp I often wonder as I sit lust Where I'd like to be, Perhaps the desert or the sea To thrill and to enchant me. Yet when I wonder as I sit I find that home's the best for me. LAUGHING AND LIVING By lean Corbett What's the use of living If you never laugh? If you can see the funny side, You've seen far more than half. If you walk with eyes wide open, You're sure to see the sun, So forget about the shadows, And you'l1 have a lot more fun. G-OD'S MASTERPIECE By Margaret Kelly O Master Painter, who but Thou Can paint the scene Thou paintest now. What art of man can match the grace Of fleecy clouds of snowy lace? O shadows, stay! Come not yet night The banks of pearly clouds piled high: Leave yet awhile the golden ray- God's blessing at the close of day. Now gone are white and matchless blue And in their place a scarlet hue. O lovely clouds, your beauty fades, As o'er the sky creep evening shades. But oh! What mortal's pen can write The glory of the world's last light? O hCIpDY World! O world thrice blest! That in such way is laid to rest. SILVERY DREAM By Margaret Kelly Last night I found the moonbeams, All tangled in my tree. I played with them and loved them, Till dawning set them free. A TINY ROSE By Beverly Popp A burst of color: Petals soft as the velvet Gracing milady's ivory throat: An essence so fresh, so sweet, Slips forth from 'neath its dainty, Enchanting glow of magic hue. This my inspiration, my joy- All found in one tiny rose. A TIN ROOF By Ellen Bowen A tin roof Is an old piano With yellow keys For the rain's fingers To play upon. MY RIVER By Ellen Bowen I'd like to have a river lust for my very own: But what would The ocean do If people started Taking rivers home? MUSIN GS By Iean Stevens I People thought she hid a broken heart, But she really hadn't any, For he had taken her heart away, As he had done with many. II He brought her his heart, As she said he'd never dare. But when he took it away To make her want it rnore, She tossed her pretty head, And said, Why should I care? III I've read many and many a poem, Of horrors, and wars, and angels above: But the only ones I can understand Are those that are written of love. IV I kissed you and I told you, I'll love you, dear, forever. But that was all so long ago: Do I think of you now-oh neverl V Your heart was cold and cruel and old, And mine was young and gay. But when you left me, my heart, too, Was cold and hard and gray. WISE! By lean Stevens Her friends were windows- She could see right through them, In spite of all the fuss they made. But when their turn came, She calmly pulled the shade. THE CHOICE By lean Stevens The poppies were clad in scarlet dress, Flaunting their gaudy charm: The lilies bent their heads and prayed, Father, forgive them-they mean no harm. Bearing the pure white banner of God, There were the lilies, righteous and proud, While the poppies danced their scarlet dance, Living joyfully, heads unbowed. Gaily a young girl walked down the path, Loving the colorful garden there, But she passed the stately lilies by, And placed a poppy in her hair. WIND'S SONG By Ellen Bowen The wind Last night, Sang me a song. It made me forget You had stayed Away So long. DARE By Patricia Hayes An inert, clay-like lump Now in my hand does lie, Come, be brave, and have a piece Of my first attempted pie! WHY? By Patricia Hayes Once I gave my heart to you- Alive, and young, and red, Why When you returned it, Was it shriveled, old, and dead? THE OPENING OF THE DOOR By Iean Stevens She feared the opening of the door- She found her life too sweet To feel the need of transient grief. EPISODE By Patricia Hayes Determinedly- She dried her eyes and vowed she would not care If he loved another who seemed to him more fair. Gaily- She dressed in her brightest costume, And every one gasped when she entered the room. Sparkling- She flirted with all, and her exotic eyes Seemed more luminous than the star-studded skies. Proudly- She smiled and tossed her shining head, Inwardly wishing she might be dead. Merrily- She danced and gaily laughed in his face, And carried her proud head with Grecian grace. Sadly'- She found all was in vain, and to her grief Learned he had found her damp handkerchief. 1 ,Y f 'Y I 'er -' v , Y ffw V L-i,lgY,4:ni-fn-' T l?-iss, - ' 1? 'Al' '- ' Q, ,,.,,f , ' , v 'f?,A..,e4,-. r, A 1---i- ..- '-.,lH .fl 1 I 51. -I . : 'I iii'-1'ff5: '2g1JZ'5Ti-''1?':!lI.'EI,x:?,4':I:c 1 1' 1 xv- . , 1 trl'1ufa!f'45g-9-A T16 I' I g5. ?.5iN'rtz't:Ie'1,:5?13Q:ggF1'2:Bs1I .ssiafag ' -l 'ffl' U-Fafiissl-,4 ffirft'fnftkncvlg-2152-11-1',2 . . ' 1 -i-xtigib,-af--I .,--f-'-'s.If----6-f-I- 7- . -,I--.I1f,I '- 's?dmsmgd4f5?stn I 9 It .. ff .,,.. 5 -Ifgrm-a4I::re5e :I . Fw1.-E:-:Q,is.fitf:'f-'lgyeygwzfffgaalpfh ' ' T -4f'I1gj:5gqgff.i 5.,, ' , , V- yy y y I I ll Q '-I UI I 'M I 'eff ir ' r i so 'Tv-1' 'll' 'iaffivf' ' I A I I. ' I-' .. . A BROOK'S PHILOSOPHY .Q ki' g ' 5' iii-if-if: L 1.a.-Hfst'-,-.' 1' 'f 'L' r, Lau ' 1 ' I ITT T?I?'c+',25T..4Agsp.?i1--ffrrf 1 -- By Ioseph Much I Y' ' . ' - . . -I. ',-,.:'-',f.1.. -. . 'if :-. ...... I 1: Iw ,vff:f:ifiq,54-F255 fy ' 1- , ,--1 -L -fsf 'G I :ff I I . . I jJg.Q.grq1:iir , I threw Wide my arms to the perfumed night, , :f Inhaling its sweetness in great deep breaths: f I L' .I Ti' XI Then I turned my steps toward a brook, '11 , A. ' X 4- Drawn thither by its rippling melody, , an if - For a brook is a companionable thing, ?t - ' 5 Full of Wise counsel and friendly adrnonitions, I I 1 - ' -'-1 9' HI' :'2.'Qf7?1i,t.a.' , ..- - ', I ,-if If one but have ears to hear withal. ,- H ..,'3., .,-. .. ..1:u-. . I .5-Q, 'af Z! , I, l -'lp It speaks of many things grave and gay, It I, Delivering itself of observations upon humans, I, I' Comparing them very unfavorably With: -X U The godlike dignity of trees, II' Il .- . . .5-2 3.-, 6-Q Lx- .-mf-.1-'lzj-'si' ' I I I . .qa3'g.,g4fg'fv-4nN,'Xf1-I ,-'5,.z,:y5g-I-.-f The immutability of mountains, ' 77---y'G:,?ffjf'-iz? 1' Z'-:'::.1:F'-' I - 'I .L,'.f3,,tg1g,,4,,,g.afuQg53.1 The profound philosophy of rivers. I ' I -----1 Indeed, it Waxes most eloquent upon this theme, 1 l Caustic, but with a ripple, ' ...lu Like the wise old philosopher it is. I '-'g1127 !I5'fZF3:'..'- ' I f- -.f.ezf.':-f-431---.--3 I -s'- 1..,'.--I:-Az ng? I I -:ff :If - I Hark to the brook: fl .IWW :-.Q-mfw '-if 5' , . . . . I I ,,i 5 f,.g:,'Q'lP l Tis Written, that man is dominant over ally T I Sjiffhiiiftfifiift 3515-Ifl'7-fit? 5:5705 il Yet to what end is man born- I H-:sf --. ...i ' I . . 'gg '-yj 5,-5:1141 ,I , To Work, beget his kind, and die? -1 ak.-I -,Z-'xszli :g'!,'J--a.Q:3Q1'jzQ1L5j ' 5- . , l rd H 3, , O man! lift up your dull-sighted eyes- , I f I ,Q Behold the wonders of the world, Q ,Q .1 : -f. .- , - hz. s-'.:-- -1... i.. . . . . , K . Egs?fj,j?5j-zffnf ,V And the 1nf1n1te universe about you. l '1 c ., ' , fn? '7,2t'3 1, . . . . , viral See your own imperfections and failings, I j if ' If And your stupendous littleness. lx -2:-Iwizflxflzff' E air- - '-a I --II f-it '51-2211-fr:-'z-A I v .L I . I I '-. ' ' l 'IM l .- IJL:,:,..,.. K- , , , , . - , I' an Was made for the World, I ggg?gEG ' ., X ogy! fd I - . ' Not the World for man! 44' 'F f X I . A ,Il Man is a leaf in the forest- I I X I I. 6' I A grain of dust borne upon the Wind, I ---l :.f f,,, 'Il Q. R X 7 Q , - -' A l And when the wind fails, I - W'-e, , I-, -QL, L A I. , , QQ 'I fl l I,,,I,,fI .' Dust unto dust returns. l I I 3 ' 'e x xi. -1. I I 6 A Q H E U 1 ,ld v .if . -fl ,M t h H f b V 1 I .VV P I' I i-II ' an ses imse ar a ove me I . 'I I f 59:1-: Z'Qx rr- vp , ' '. , .V I- A- In I -- Who am only a rivulet of watery 4 ltql 55,,jfjQ-T.-'iz x'w:7I1jI,' Yet, when man is but dusty bones, N - 'zflg-'f,3ff,Q'-':gI7'f ai ffyjfj X r in I shall still be here, liiijlgfj ,.5q'i2if5Qi1IiQA5if12-24-2-j35,'.jig'3,2-jf:'f'EE f' TQQQAT, . ' H I Singing to myself in the sun, 4 H '-.,:-g:.' I' .5-qI'2'f'-,fi-X-' 5:.:-'.'.:.,'...Q1.-1--r,-5' 11- :'? l-fl , I , ,, ,H l 1?-F Or talking to some poor human fool in the dark. I, 'rikll It ri-Efzf 3119 l.Iff,1i3f51-I 1 jfgggvrgisrggigff-I I is -t..r:'?i TQf3f1gff?3eE.I iriii' ' I E5 Lgirgr. fill QF? gi? . i rT::'r fri? ..2.11'jj1-I-'fi l1ifZiT- fmilegjf ,,,,Zi,1T 41' ,jl ,nl 'iv ,-. '17,-, Y Lf rr. f' g fr f :l'gf5i'g siilegiifiif -I lf,if'??fl'li- iiieiigri 5-e!i'E?e2f'f5if?iF '41 ii'-ii...-fslwis--1 N I -1 'v i V - -- A '-L4 'AQ' I E- il'-f'ff?'-Y 147 S' os gt.c,,, kxvt t A FallkThat's All By Rex I-Iorton and lean Stevens Being a short story of an incident that might have occurred in the social life of any high school. A strange, bewildering panorama, which at first sight appeared to be a combination of a fancy dress ball, a street parade, several side shows, a few world's fairs, several dozens of Carnivals, and a crepe-paper-hanging contest-all sounding like an exciting football game, an oratorical contest, a radio exhibition, and a howling mob-that was the annual carnival sponsored by the Girls' Association of North High School some two hours before opening time. In a short while, ecstatically care-free throngs would find the halls of their familiar school a scene of gaiety and mirth with myriad-colored pennants, banners, and streamers hanging from the ceiling and chandeliers, brightly decorated booths on all sides, and barkers armed with megaphones and loudspeaker systems crying out the features of their respective attractions of freaks, soothsayers, clowns, minstrel shows, crystal gazers, and similar pur- veyors of frivolity. But at present, hundreds of students, boys and Qur Firing By Aaron Question: What Is Your Favorite Expression? Time: Always. Place: There. Sidney Rapoport: For the Senior Class gift, I'm in favor of tennis courts-on the level. Bill O'Rourke: Take it easy. I-Iarold Litten: Yes, and then again no. Mr. Street: Well, we might accidentally lose this debate. Iulius Credity: My answer is not fit to print. Kenneth Skillin: What's it to you? Grace Yonczis: There are two periods in my life, before and after the Prom. girls, from Seniors to Freshmen, were busily engaged in slashing up miles of crepe paper, tacking on yards of streamers, struggling with unwieldly signs and posters, transforming bare tables, borrowed from history rooms, into gayly-covered supports for hundreds of pounds of candy and typical carnival knickknacks of every description: dashing here, there, and everywhere in search of this, that, and the other thing, and lifting and dragging, in endless processions, tables, chairs, and stepladders. Even the local fire department was represented, its equipment consisting of one of the football tearn's stalwart tackles seated on a chair being pushed up and down the halls at top speed by a local track star, who also furnished a vocal warning siren. But isn't Don coming around to help us with these decorations? queried Carolyn, a blue-eyed, blonde-haired junior, as she tacked some crepe paper around the edge of a table which was to form an important part of the G.A.A. home-made candy booth. The affairs of Mr. Donald Campbell are of no concern to me, icily replied Marian, a pretty, slim, brown-haired, brown-eyed Senior who was standing on top of the table gluing bright streamers to a thin framework above. You don't mean to tell me that you two love- birds have had a falling out, do you? Well, Don makes me so disgusted. This morning when I asked him to help us, he replied, 'I just have to help the I-Ii-Y boys build their cave for the Dismal Wizards of Obscurity, possessing knowledge of all that has happened, does happen, and will happen, who will pour forth warning and advice to all who consult the wisdom of Allah.' I'd like to give him a piece of my wisdom. I think he's selfish, and thoughtless, and .... Further comments were drowned out as a barker for the freak show next door began practicing his lines over a particularly vociferous loudspeaker. I-Ier attention attracted by the noise, Marian Reporter Spolin Dorothy Klupping: That's just what I think. Marvin Braun: They'Ve named a new rifle after me. It's a good bore. Ernest Witt: My runabout runs about a mile and quits. Carl Andersen: Adam should have died with all his ribs. Bob Wessling: Girls are all right if you treat them right. Walter Schwass: Girls are all right if you treat them right but don't treat them too often. Aaron Spolin: I work a funny wayfwriting jokes. glanced in that direction, and her heart missed sev- eral beats. Not more than ten feet away stood a tall, handsome, wavy-haired fellow, with the duck- iest mustache, contemplating the erection of a huge canvas sign advertising, The World's Greatest FreakseAdmission lUc, over the door next to her booth. lsn't he the perfect Adonis! said Marian to herself. In fact, she felt complimented when he asked her to hold up the nearer end of the sign while he mounted a stepladder and tacked the more distant corner to the molding. While engaged in this oper- ation, Marian cautiously observed Don slowly walk- ing by, apparently taking note of the situation. Serves him right. Maybe some day he'll learn that he isn't the only boy in this school, she re- flected, her mouth full of thumbtacks. How should l cut these streamers? shouted the somewhat helpless helper, Carolyn, rousing Marian from her reveries. When she had finished assisting Carolyn, Marian glanced up, to find the be-mus- tached portion of the freak show on top of the step- ladder, almost directly above her head, fastening up the remaining end of the sign. lsn't he agile and graceful? she reflected. The sound of her scissors crashing on the floor brought her out of her meditation, and she crawled under the table to retrieve them. Suddenly, a chorus of shrill screams cut the air as a heavy thud shook the table. Scrambling out, Marian found, reposing in a box of fudge on her formerly neatly-arranged table, a struggling figure, entirely covered by a piece of canvas reading, The World's Greatest Freaks with the last letter concealed in a fold. Above, from the loudspeaker, came the words of the announcer inside the room, blissfully unaware of the excitement without, Step right up this way, folks. You will never again have the opportunity to witness such laugh-provoking sights as these. And the crowd did step right up with plenty of celerity. Uncovering the fallen figure, Marian found him I tenderly nursing a small scratch on his arm, which he had acquired in his sudden descent. He was certainly making enough fuss about such a little thing, she thought. About a minute later, Carolyn arrived with a bottle of iodine from the nurse's office. Noi No! Don't put that on. lt'll be all right, Whimperingly protested the be-mustached Adonis. Paying no attention to his pleadings, Marian pro- ceeded liberally to apply the brown antiseptic. The terrific howl of anguish which he let out completed Marian's change of mind. She certainly couldn't see now why she had ever been even at all impressed by the sight of this sissy. Also, she realized that perhaps she had been too hasty and selfish in con- demning Don's probably necessary absence. ln fact, she felt very relieved when Don barged into the scene and smilingly said, Madam chair- man, l move that this meeting be adjourned for an hour while two persons make a dash for the nearest soda fountain. I second the motion, happily replied Marian as she ordered Carolyn to tend to the booth and threw a withering look toward a still slightly mussed-up figure whose ducky little mustache appeared to have lost much of its would-be impressiveness. Things We Can't lmaqine By Aaron Spolin Edward Bell sitting in the bleachers during a football game. Elizabeth Leake in a deep and pensive mood. Lucille Marcus on time. Muriel Peters auiet. Walter Wilcox forgetting how to dance. Roger Sedgwick using profane language. Russell Campbell booing himself. Shirley lameson looking down on her friends. Eleanor Connors not behind the library desk. Eugene Timmons not reading sports pages. lane Gustafson painting the town red. Bill l-lullihan criticizing the lrish. Vincent Lullo afraid of mice. Martha Thomas talking like Noah Beery. Robert Forsman in a fit of temper. Billie Wharton impersonating Kate Smith. Frank Orland saying, Unaccustomed as l am to public speaking .... Charlotte Popp forgetting how to type. Charles Camp carrying his baritone horn in his vest pocket. Roy Carling not drawing cartoons. lune Brunke being sent to the dean for excessive talking. ' Provi readers being amused by things like this. 71 fa fi X4 MW fftr gf ' .. 5550! 0, of . X ly, T' :Z 'A V: ,AEA VA M J 51:1-I 44-f ,AIU I uhm n , 'Aka 'll , 'V-bp4 Ill 1 LIT . O .' f f a .1 F , as ., Li S f f ,iff 0 ,r , ,, a , ...- Kg Q ' i f 5-' I , 5 3 X it 1 ' 0 :g ' -T 5' - A -X X I tty! 3 f Q ' 4 XX .. r ,Q 0 -1 N v ... , X I 1 ,,- -,I O Fiji, , ' ? ' ' ' ,.,,, l 4.1 Fi? 4' - E K I . i'.',gg:-2::1:r full r ', Q-, - .. ,,1:::::: - fffi, '- I 4- I 'Ill - .f - . 12-'i'i 1-.agff VY' W., f J y, 'fI' .?QZZf:4.1--iajfq' , ' , fgn g'?.'m1:lrf - 1.11 ff ' ,ia I 1 : .fgtfw 7,5-,gxgf ' -1. .--.'1'ul'5 1 slh- n, my I 1 I --4 Z A T f ll fi -1.- -i' ' Lo ': Un fp ,. K0 .gz,2iL24 35f'5,g' 2,2.32,5 5355 fggg T 'Tis midnight in the haunted house, And all around about, Are heard the trampings of a mouse- The clumsy little lout! Dreadful tales are told tonight About this awful place: Oh, there's a fearful, thrilling sound, And there's a leering face. All of ProViso's Senior Class Are gathered here within- That's the reason for the shouts And the awful, dreadful din. Of course the maddest in the house, ls lohnson, Bill, our president. He lost his mind from working hard, So to the bughouse he was sent. Peering out from behind the door, There's Marie, the Goodrich girly With this year's Provi in her hand, Positively her brain's a -whirl. And there, Harvey Ancel jabbers away, Quoting his encyclopedias dear. He knows them all by heart now- CP. S. That's why he's herej Georgine Reay is the bughouse star, Tapping and dancing to show That she'd be a famous dancer, lf she got out, you know. Harvey Carne is the madhouse gigolo, He gets a new girl every day, But soon they'll all be used up, And then what will he say? Adolph Zapfel's our curly-haired blonde, At times he's awfully funny. He chuckles, he's iolly, and oh, tee hee! His remarks are very punny. Boom-boom! Ta-ta-ta-tum! Why the noise and who's the cause? lt's Elvan McElroy beating his drum, On and on without a pause. There in a corner is Herrick Van Gunten Singing and warbling, I-love-you-so. Like all the rest he has his notions, He thinks he's the great Caruso. Cliff Clark collects the money, If there's any to be had. He's had to beg so often, That he's a trifle C?D mad. Russ Campbell is yeaing and booing, A trait from his Paqeant days. Soon all the inmates are booing, Too bad, they've got the craze. Aaron Spolin crawls on hands and knees, Thinking he's Mickey Mouse- Squeaking and squealing he eats some cheese, He belongs in our house. They have the silliest people here, Lorraine Nott talks and talks all day. Her head is filled with lightest thoughts: lt won't be long till she floats away. There is a Winchell column ln the Bughouse Daily News. So Dot Neal writes the gossip, The funniest she can choose. Here is the saddest case of all- Iean Stubbins, famed for her laughter, She had a breakdown one fine day: She's been solemn ever after. What a shame such talent is so wasted, Sara Grinpas would be a success In acting--if she were let loose, But such would be a risk, l confess. Now let us meet another girl, Veronica Reich, the maiden demurey But first let me warn you, for insanity She believes she has a cure. There is a funny squeaky noise, I guess it's a violin. Yes, Melvin Korrell says it's imported, But we think it's made of tin. 1 xr Y xx 'MFII Y F . - fr- i e ,.. - i f' - ff ti A I 19 -f 14 -' 1 1 e i N - I ul It If I Na - gy i f 2 SSW' - J M ' , .n 3. -- - ' ' - ,, , f 1 . - -- . .1 ,z 40:4 2 3' -' o - ' - figwxz: ,. D Agvi . ob 'J 'mf 1 n Bl:-asfizgia' - 45' i ' ' 'T' - ln' -..1 - fx' 'fu!f . .' iii tif. .- oo ,- -U asf.. Eff! wr-xv -- ua Lfvz.. , - ' 72 .,. - -:fy Lift - lu .yay I nf, In i -- 'Q Lbzgg: e. Whlvm i .sul -u':l'lf,'u, rfll W- ZS' -- Q 'Zigi r? ' E 1' 1 94 pw' Affvm's '5' f 'nf2p.N .Sl'r5w.fEfV.S Em Clarence DeWire, the bright-eyed boy, Should be a radio guy. He keeps shouting for Mike! Mikel A microphone he wants to buy. Rex Horton tried writing pages of poems, About twilight and sunset and snow, Beautiful, lily-white, pure-white, and so, Every one said, To the bughouse, go! Loretta Raab can imitate All kinds and types of men: From little boys to teachers high, Her mockeries equal ten. A sports reporter haunts the field Where bughouse athletes play- lt's Bill O'Rourke, so tall and slimy Perhaps he'll be great some day. Here's an artist, a pretty one too, And Ieanette Grube is her name. Her skill with paint and brush Should some day bring her fame. Pearl Lauth-she's another talker- All day long she only gabs and gabsp But that is nothing against her, For we all hold the same confabs. At the table is a crazy mang Belford Buck, who had a moustachep But he shaved it off, because, he said, lt interferes with eating hash. We have a pair of famous twins, Edna and Ethel, you know. They're awfully hard to tell apart, Everywhere they go. Don Kane is another well-known boy: He plays a big bass viol. He'll be on the radio some day, To hear him we'll turn the dial. Ianet Rodger, the tiny girl, Who's cute and quite petite- At dancing she is very good, And she is awfully sweet. 151 Here's Adolph Urbelis, an athlete, Who goes in for plenty of sports. When he is on the football field, lust watch how he cavorts. Lora Puscheck rushes hither and yon: She edits the asylum's paper. And seems rather solemn at first, But boy! My, how she can caper! Erna Schroeder is an all-right girly She'd make a very fine actress, Too bad, she's so weary each day, She falls asleep on her mattress. Here's another pretty girl In the bughouse beauty show, Lauretta Anderson, as real as life: A girl every one should know. With coal-black hair, and sparkling eyes, lack LaRocco smiles his smile. He spends some time with sports, and then Some time with the girls, awhile. Deah me, who is the bally fellow Who talks with cheerios! lt's Bob Clark, without a monocle, For him no tearios. For Milton Ratner, we do weep- His is such a sad case. He went mad over statistics, Now he thinks he's a piece of lace. One boy frequents the beauty salon, At least that's what is said, Else how could Dick Lande keep his hair curled, Though he's not been detected. Then we have Leona Haugh Who tried to type this mess, But now her mind is in a fog, She belongs here we confess. From typing and checking Senior statistics Ruth Ford's mind went into a loop. Now she finds misspelled words In every bowl of alphabet soup. Tonight We Launch: Where Shall We By Rex Horton Sink ? CA three-act Gilbert and Sullivan operetta in one act not written by either Gilbert or Sullivan.l Stage directions: The scene is laid in Proviso's athletic field at night. Clf it were laid in the waste basket before it saw the light of day things would be better for all concerned? On the west side may be seen the stadium and bleachers, thronged with Proviso students. To the east is the broad, shimmering expanse of the mighty Desplaines. tNote to director: Be sure to have the PWA, the CWA, the CWES, the HOLC, and the NERTZ widen the river to a width of at least one mile, provide a 50 acre con- crete boat landing, '999 five-thousand-watt floodlights, and one can of deodorizer before even attempting this play.7 On the waters of the formerly muddy but now mighty river, floats a giant steamer. lts broad, gala-decorated deck is crowded with Proviso's teachers, administrators, and the spirit of lose-ph Goose. CThe latter may be omitted if desired, since he doesn't belong here anyway.J The faculty members are leaving for their summer vacation aboard the good steamship Proviso, and the students have come especially to bid them bon voyage-that is, all but two seniors who were coming over anyway to get some hot dogs at Wimpy's fplease leave payment for advertisement in Room l39l. - Forming a backdrop behind all of this, the deep ethereal blue of the starry vault of heaven spreads its celestial curtain of tran- quility. CNote to director: A blue bed sheet with ct few holes in it will do if you can't find anything better.l The play starts as the massed for perhaps by this time messed! chorus of teachers raise their voices in unison, and out into the clear night air floats the following: We are the teachers who are saying goodby: We leave you with many a tear and a sigh. In three months we'll be back again, For another long season to remain. But to enjoy with pleasure, Our new-found leisure, We have this to get off our chest, And then for the summer we'll aim to rest. Now the entire problem's explanation, We give you without procrastination. So we introduce our chief, Who has a speech that is brief. flfnter Mr. Eelkemaj Dear friends: lt is with great pleasure, Explainable in large measure, That upon this momentous occasion, We speak for your edification. You who are students should know, That your teachers are full of woe. Their complaints they will now reveal, To tell you just how they feel. fThe teachers of each department now step forward in tum and sing a chorus.J Oh, we are the teachers of history. What you learn in our courses is a mystery. We give many a learned discourse, But then we are met with remorse. After you study, read, write, and delve, You ask, When was the War of l8l2'? Oh, we are the teachers of science, And we form a deadly alliance. We haunt you with HQSO4, Atomic weights, and theories of Bohr. But still you dream of spring days, Or write about cosmetic rays. Oh, we are the teachers of mathematics, Who put your brains through mental gymnastics. We explain many a theorem and many an equation. We plead with you and use much persuasion. To make algebra, geometry, and trigonometry inter- esting, we arrange: as tiff, X -- t','f :T . fltzxvo 2 : X 'l A45 T I f f .W X cf A 5 if rt .5 M 12 its t if f Lf 'ft it ' ' ' '- Wt f ZW IZQMMIIZI' 'fy in L-n-Q -A-1 -by-A ,gli 'ig ....-A 1 -7 1 Vw f I ft i f ff Z, fx -Zxvfz Q Q L fc, :flft ll ae edge? ore. -X el ' But still you think Euclid an Oak Park telephone exchange. Oh, we are the teachers of steno and typeg From our eyes many a tear we shall wipe. ln shorthand you make such queer little marks, lf we could decipher them, we'd all be sharks. ln type we give you a test for speed and for accu- racy. You make ten words per minute, ten errors, and a grade of Oh, we are the teachers of manual arts, We let you use presses, lathes, and auto parts. We try to teach you some drawing, machine and mechanical, If we ask you to work, you think we are tryannical. We show you how to design houses in drawing, architectural. Our protest that your house has no chimney is in- effectual. Oh we, oh we, are the teachers of home economics, And we feel likeishowing some angry histrionics. Oh, we are the teachers of many a commercial sub- ject, But all of our hard work, you just simply reject. Oh, we are the teachers of physical ed.: ln gym you look as if you belonged in bed. Oh, we are the teachers of many, many tonguesp We can ask and we can shout at the top of our lungs, ln French, German, Spanish, Latin, and Italian. For our efforts we should get a gold medallion, But if you write to Caesar, like a novice, You address the letter to the dead-letter office. Oh, I am the only teacher of arty l explain and show with all my heart, Hoping to stimulate some appreciation, Or to inspire an artistic creation. l could talk for hours, for years, or for an age, But still you'd make drawings like you see on this page. Oh, we are the teachers of the English of the king, And polysyllabic words we fling. We teach literature, dramatics, and writingvjourna- listic and creative, Public speaking and others: but if this's at all indi- cative, Our teaching must have gone far, far amiss, lf our students produce things like this. fThe entire group again sieps forwardj Oh, we are the teachers you know so well. Oh, we are the teachers who sound your knell. Oh, we are your teachers and your faults we point out, So for your own good, you may know what it's about. Stage directions: This concludes the teachers' chorus, and, from the stadium, come the voices ot the students. Dear teachers, dear teachers, teachers dear, we are sad, To learn that as scholars we have been so bad. But next year we'll try to be better, By carrying out your wishes to a letter. Yet for what we've done we are sad, boo hoo, Boo hoo, boo hoo, boo hoo, boo hoo, boo hoo. Stage directions: The great outpouring of tears causes so much excess moisture that the entire field is soon under water. A great wave then comes up, capsizing the ship, and all of the athletic field and all of the school except the tower disappear beneath the water. Only the clock, with tears streaming down its face, remains visible. The lights now go out, leaving the stage in the dark fthe audience alsol. With that, the curtain falls, the fire alarm goes off, the audi- ence wakes up, looks disgusted, arises, puts on his hat and coat, and goes home. , t 59, -Q t . a s if e Z , . Liv! 'Z it xlf ' a..L . E7 I , A l Z l W Wfigl glii ' WW ' 4 . 0 X , f .7 Q xg sl 1 Sri - he Zig? ?Q 4 ii 1-2 , T Ti TYYQT 'jg Q-L E - W yn-n S333 WJ' 'l f i T T., is 'Q 4 A r fii a -, ' ui - 1: C2 ce i i 7 f ' ' Y The world has gone streamlined. Along with our modern mania for getting nowhere fast has come an equal madness for cutting down the time spent in getting there. Mother Nature probably started the whole thing way back millions of years ago when she stream- lined her fishes. Man eventually followed and did the same thing with his boats and airplanes. Now, practically nothing is safe from our modern cut- down-the-wind-resistance'' demons. Our good old cars used to be able to transport us occasionally to our destinations, but now the auto manufacturers have decided that they pushed back entirely too much air in the course of their journeys. Therefore, the makers have started to turn out the queer doodlebugs which whiz along our streets to- day, and which, strangely enough, resemble the turtle, a fellow who has never been known to break any speed records. These airflow vehicles may represent a forward step in motoring, but pity the poor pedestrian, who, when he crosses the street, has to figure out first whether the steel turtle is coming or going. By the time he has completed his decision, he will probably have found himself zooming over the top of it with- out even locating a bolt head to grab onto. But then again, maybe we shouldn't feel sorry for him, since nowadays we have such nice streamlined hearses to speed up the last ride. Where the ancient iron horses used to puff and chug along in their laborious old-fashioned way, graceful, blunt-nosed, taper-tailed, aluminum streaks now whiz over the same rails with the greatest of ease. Their miniature reproductions, guided by the little son at the transformer, are to be found all over this land of ours, shooting past the feet of startled fathers and mothers. Even the children's wagons, scooters, and tricycles must have coverings over their wheels to keep down that dreaded bogy man, wind resistance. Now that our modern designers have succeeded in thus improving all of our means of transportation, leading architects are claiming that our buildings should be streamlined to cut down the amount of Streamlined Extremes By Rex Horton strain caused by the wind. lust imagine what would happen if mother tried to hang up the Christmas wreath outside the front door of the streamlined family domicile. Father would probably stop her by explaining that the wreath and the nail to hang it on would cause an additional .OUOUOUO3528 pounds per square inch of wind resistance, which might upset the entire structural calculations of the designers. Even our writers are following the trend of remov- ing obstructions. A group of our modern poets follow the theory that anything which might impede progress should be smoothed over or omitted entire- ly. Hence, whenever they wish to leave out some words, they proceed to do so, without providing any indication, except the confused impression which the reader receives, that anything is missing. Do they let foolish things like punctuation and capital- ization bother them? They do not! They simply let their mental winds sweep away all such obstacles, leaving their great works in all their unpunctuated, uncapitalized glory. Also, since attempting to find meanings is tiresome to most readers, these stream- line poets solve the problem by simply not having any meanings to their works. Thus their rhymeless, rhythmless, reasonless masterpieces may be slipped into the minds of the readers with practically no effort. The only disadvantage, however, is that they slip out just as easily, leaving the poor, unsuspect- ing reader slightly annoyed by the fact that he just cannot seem to figure out what modern life is coming tO. Gertrude Stein, however, seems to be just the opposite. Indeed, after one has read a few sentences C?j of her works, he will be out of wind and his listeners will have developed plenty of resistance. Man seems to be about the only moving object left out in the streamline craze. Whenever we poor hu- mans attempt to walk against a really good wind, we soon discover our antiquated excess frontal area. ln fact, some of us are more aware of it than others. What can we do about it? We can shed some tears if we want to, because scientists tell us that a freely falling tear drop assumes the ideal streamline shape. Or again, we might telephone for a stream- lined ambulance to streamline us past a multitude of streamlined cars until we arrive at a streamlined asylum where We can spend the rest of our days cutting out streamlined paper dolls. Acknowledgments The Provi Staff of 1935 expresses its sincere ap- preciation to all who have assisted in the produc- tion of this annual. Upon Miss Helen Grant Norman of the English Department rested the responsibility of supervising the editorial sections and assembling all the ma- terial which has gone into this book. It was Miss Wilhelmina Marm, head of the Art Department, who inspired and guided the staff art- ists in their interpretation of the theme of this book. Wilson A. Law of the Mathematics Department managed all the business and the circulation, as well as picture schedules. Miss Florence I. Otis of the English Department helped by supervising literature of the feature section. Harvey F. Iohnson of the Science Department assisted by taking and developing some of the group pictures and snapshots. The Staff wish also to acknowledge with grati- tude the assistance given by Miss Eileen White and Miss Marie Baldridge of the English Department in criticising copy and reading proof: and by Miss Ruth Whitfield and Miss Florence H. Scott of the same department for proof-reading and helping in the preparation of copy. I Lora Puscheck, Editor-in-Chief of the Pageant for the first semester, contributed valuable aid in proof- reading. The l935 Provi Patrons The editors deeply appreciate the co-operation of the patrons and business men of Proviso Township who have so generously supported this year's annual. Mr. and Mrs. Morris Arowesty Mr. and Mrs. A. I. Busscher Mrs. Irene Edmiston Mr. and Mrs. I. Fine Forest Park Arrows A. C. Mr. and Mrs. I. A. Gutenson Mr. and Mrs. C. Hahn Mrs. H. Helliwell Mr. andMrs. H. G. Hesterman Mr. and Mrs. L. L. Hurwitz Mr. and Mrs. E. W. Kleinschmidt Mr. and Mrs. Henry Meyer Dr. and Mrs. Harold E. Smith Dr. Charles Weinberg Forest Park North-Side Boosters' Club . Wi ISS North Avenue A. F. AMLING COMPANY THE LIL THEATRE FLOWERS GALORE 7347 Madison Street Melrose Park 770 Phone Forest 140 Forest Park Phone Maywood 5657 BEN'S EXPRESS GENERAL I-IAULING-MOVING THE LIDO PHARMACY Guy R. Hendricks, R.Ph. 600 South Fifth Avenue, Corner Wash. Blvd. C O A L St. Chfmes Rd. QI 12th Maywood Phooo Maywood 5018 Moywooo Compliments BORMANN, INCORPORATED of FUNERAL DIRECTORS NIAYWOOD MOTOR COMPANY 22 ' M cl 115 Broadway P k Melrose Park 714-715 Gndyigiifj Focigvvxgs Melrose Gr 400 Lake Street Phone Maywood 281 Phones Lincoln 1495-1496 Telephone Maywood 6262 DEPPE BAKING COMPANY M1LDRED'S BEAUTY SHOP Established 1867 PRICES THAT ARE RIGHT F Deppe Ir 1015-27 Wviuow Street Chicago 1246 South 15th Avenue Corner of 15th and Adams ELLIS STYLE SHOPPE Compliments of F. Elisco, Proprietor NATEIS SHOE SHOP COATS :-: SUITS :-: DRESSES 144 Broadway 901 South 5th Avenue Phone Maywood 2714 Melrose Park Melrose 2312 MAYWOOD FINANCE CORPORATION MCBREEN HOME UTILITIES Friendly Dollars 156 Broadway Melrose Park 17 North 5th Avenue C- N- FREES. HARDWARE PHILLIPS 66 SERVICE STATION R. W. Lyman Maywood Phone Maywood 331 lst Avenue and Madison Street NORGE REFRIGERATORS ' Phone 366 MaYWood Phones: Office Melrose Park 6930 Residence Melrose Park 2322 DR. NICHOLAS 1. GRUNT PETER D. PAULS, DO. OSTEOPATHIC PHYSICIAN 201 South 3rd Avenue Maywood D E N T I S T Telephone Maywood 4100 106 Broadway Melrose Park Phone Maywood 4640 ALBERT HEY SIDS SERVICE STATION SAY IT WITH FLOWERS Sidney Cross' prop, 701 South Sih Avenue Sinclair Gas and Oils Phone Maywood 6600 TRY US OUT , 1118 St. Charles Rd. Maywooa A. IUSTUS of SON R, H, REMUS 119 South 14th MOVERS QUALITY FOODS ' Meats and Groceries Maywood 1852 Phone Maywood 8660 302-304 North 5th Avenue Local and Long Distance 156 REICH 61 BECKER AGENCY WEISSENBORN IHC' DRY Goons co. REAL ESTATE 4 MORTGAGE LOANS .wi-empunq Merchandise I N S U R A N C E Tempting Prices Phone Forest 10 7421 Madison Street 103,105 Broadway Mehose Park RUN DIRT RUN THE SUPREME CLEANER At Your Dealers or Phone Maywood 2456 state 6077-6078 WILLIAM C. KIRBY ci CO. Certified Public Accountants 105 West Monroe Street, Chicago Earle R. Seely, C.P.A., Member American Inst. of Accountants Telephone Maywood 509 IOS. I-I. STRUTZEL df SONS . Compliments Men's Clothing and Furnishings Featuring Quality and Style 606 South 5th Avenue Lido Theatre Building Maywood of Melrose Park 9756 Elmhurst 293-I E. A. SCHUMACHER . WELDING AND BOILER REPAIRING Boilers Retubed - - - Sections Re-paired 1105 Lake Street Melrose Park Try Sloan's Bread Today .... Iust Like Mother Used to Make IOHN A. SLOAN, INC. 3012 Montrose Avenue Phone Irving 7499 Chicago coAL Maywood 5400 PLASTER Ca STANDARD MATERIAL COMPANY 1321 South 4th Avenue Maywood ROOFING CONCRETE CARL FISCI-IER, INC. Kimball Building CHICAGO Supply You with Everything Music, Musical Instruments and Accessories Phone Melrose 707-708 We Deliver The Best of Everything For The Table TRENKLER'S GROCERY 6 MARKET 1 01 Broadway W Tfellklef Melrose Park REFINERS PRIDE A Super ANTI-KNOCK GASOLINE Refinery Direct to Your Car TWO STATIONS Ist Ave. at Aurora Elgin R. R. Tracks One block south of Madison St. MAYWOOD Thatcher Ave. at St. Paul R. R. Tracks One block north of Grand Ave. RIVER GROVE PRIMAS BROTHERS 1 c E c R E A M Phone Villa 4316 Maywood 1158 47 S. Villa Ave Villa Park FIRST AVE. SWEET SHOP Home Made Ice Cream-Lunches SCHOOL SUPPLIES 101 'West Madison Street Maywood 1898 UNITED STUDIOS AND MUSIC STORES INSTRUMENTS - SUPPLIES - LESSONS We carry a full line of latest sheet music 319 Madison Street Maywood 369 BY Special Appointment The Excellence of the Provi depends largely upon PHOTOGRAPHERS The Excellence ot Its Engravings For Their Majesties The Class of l935 The Pontiac Engraving Gibson Studios Company GARLAND BUILDING, CHICAGO bums out the best in every picture Sittings by Appointment Special Rates to Pupils For Twenty-Five Years Telephone Central 3982 Specialists in Annuals COVERS BY Molloy is a guarantee of the Most Artistic and Durable Dress printed this an Annual May Wear. Linden The first thing you notice about your annual is its cover. You'll always be proud of a P R 0 V I MOLLOY-MADE and many other annuals ff , From a Outstanding Quality, including the All-American - Provi of 1934 LINDEN PRINTING COMPANY 517 S. Iefferson Street CHICAGO Pop lones 158 Index To 1935 Provi Page OPENING PAGES Dedication ...... . . . 5 Foreword .................... . . . 6 ADMINISTRATION Review of Administrative Work ........ 10-11 Personnel of Proviso .......... 12-18 Student Council .............. .... 1 9 SENIORS Principal's Message ........... ..... 2 2 History of Class of 1935 ....... 23-26 Commencement Week Program ........... 27 Senior Pictures and Statistics. . . 28-61 Senior Class en Masse ........ 60-61 CLASSES Freshman ............ 68569 Sophomore .... 66-67 Iunior ........... 64-65 ORGANIZATIONS Band .......... 74-75 Band Parents' .......... . . .99 Camera Club ............. .... 9 2 Chess and Checker Club ..... .... 9 9 Choir .................... .... 7 3 College Club .... ........ . ..l03 Commerce Club ....... .... 9 0 Cosmopolitan Club .... .... 9 4 Debate Club ........ .... 9 8 Dial Club .......... 96-97 English Cabinet . . . . . .103 French Club ..... . . .79 Forum .......... .... 9 8 German Club .... ...... 7 8 Girls' League .... 76-77 Green Mask .... .... 8 4 Historians ..... .... 9 5 Italian Club ................ . . . 80 Iunior Hi-Y ..................... .... 8 6 Iunior Home Economics Club ..... .... 8 9 Latin Club ................... .... 8 1 Library Staff ............... .... 9 1 National Honor Society .... .... 7 2 Naturalists .............. .... 9 2 Neo-Pythagoreans ..... .... 9 3 Orchestra ................. 74-75 Pageant Business Staff .... . . . 102 Pageant Editorial Staff ..... . . . 100 P.-T.A. ................ . . .99 Parnassus Club . . . . . . 100 Provi Art Staff ....... Provi Business Staff .... Provi Editorial Staff ..... Proviso Players ...... Radio Club ....... Senior Class Play . . . Senior Hi-Y ....... .....l0l .....102 .....101 ...83 ....98 ...82 ....87 Senior Home Economics Club .... ..... 8 8 Senior Science Club .......... ..... 9 3 Spanish Club .............. ..... 8 1 Statesmen . . . . . . . .94 Thespians . . . . . . .85 Travelers .... ..... 9 4 V. ATHLETICS Baseball .... .... l 19 Coaches ........ .... 1 O8 Cross Country ...... .... 1 19 Dancers .............. .... 1 21 Fresh-Soph Basketball . . . . . . .116 Fresh-Soph Football ..... .... 1 13 G. A. A. Award Group ..... .... 1 20 G. A. A. Board ......... .... l 20 G. A. A. ............... .... 1 21 Golf ..................... .... 1 16 Heavyweight Basketball .... ....... 1 14 Heavyweight Football ..... .... 1 10-1 1 1 History of Athletics ...... .... 1 06-107 Iunior Varsity ..... ..... 1 12 Life Saving-Boys ...... .... 1 17 Life Saving-Girls ....... .... 1 20 Lightweight Basketball .... .... 1 15 Lightweight Football .... .... 1 12 Spring Training ........ .... 1 13 Stadium Dedication .... .... l 09 Swimming-Boys .... .... 1 17 Swimming--Girls .... .... 1 20 Track .......... . . . 118 Varsity Club . . . . . . .108 Wrestling .... .... 1 18 VI. FEATURES Salute ....................... .... 1 24 Three Centuries oi Secondary Education ........................ 125-127 Proviso's Twenty-five Years of Progress 128-132 Proviso's Growth from 1910 to 1935 ...... 133 Senior Class Gifts ................... 134-135 Today and Twenty-five Years Ago ....... 136 A Quarter Century of Development ....... 137 Calendar ot Events .................. 138-143 Poetic Meditations ..................... 144 Poetry .............. .... 1 45 Poetry ................ .... l 46 A Brook's Philosophy .... ..... l 47 A Fall-That's All ...... .... 1 48-149 Our Firing Reporter ........ ..... 1 48 Things We Can't Imagine ............... 149 Bughouse Blues land White? .......... 150-151 Tonight We Launch: Where Shall We Sink? ............................ 152-153 Streamlined Extremes .................. 154 Acknowledgments and Patrons .......... 155 Advertisements . . . 4 ................. 156-158 Index ........................ ..... 1 59 ,. i .. A 160
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
