Portsmouth High School - Trojan Yearbook (Portsmouth, OH)

Text from Pages 1 - 190 of the 1928 volume:

V 'P r K me L xg,-, A4 'A t mm wma WM , :mw,gmm' 1 'P6X IxIB ...A -,uf -1- X N 'spy' , X 1 T Jr J 1 -, x.. -' 1 20: 30: . I T 1 71 v v w nl A 'L5'13iKv? i1?vxmvvf vfM,g:-f-awffw ' ' - -V V v . -Q H M S v F... -.-. -.e S. ,- - -..cms T' -'12 .4-QA CRUSADER LQ, N n ----V.-. ' v . Y-' , . ' . ,, 1, I U ' I fi K1 ik Qi! F9 Uh ' A ' l 1 X Q 4 I. I - . 2, J ' A GRAYBEARD SPEAKS 3 i ' The years are greedy bargainersj he knows well . W ho long has chaffered in their crowded rnart. K Prone are they to exact for what they sell A pound of the buyer's flesh, cut next his heart. ' Deal sharply with thenig doit for doit deinand, N ' Nor play the prodigal with your young treasure 1 ' , Of brain and brawn and beauty. Understand V , 1 Your coffers will they heap with goodly measure i 6 If so they must. Those were unworthy inen 5 ' - Who gave their all for little strings of beads ,' A birthright once was lightly bartered when A iuess of pottage filled a M'l07'1l6?1'lf,S needs. Store nieniory, conscience, soul, against the day When pulsebeats slacken, and bright hair turns gray. p y -BERT LEACH t l : U tm a 2 II L , N i I O - Q i 'gn 3 U , sr l M V a 1 I of 'H X vt V L ' J ii T'Ti'vT Three Four Five PORTSMOUTH, GHIO Uh. to he in l'ortsmouth, now that .Xpril's herefwith apologies to Mr. llrown- ing. Spring is here and oh, the hills are green and fresh and the red hud out so lair. lint now let us turn our minds from this pleasant scene and go hack to the early history ot' l'ortsmouth, watching as we go the wonderful development as the years roll along. lluring the time of pioneers, l'ortsmouth was half forest and half swamp, with no roads. or lmridges, no stores or taverns, and no physicians, it was just an unin- halmited place. ln tXpril NOS, llenrv Klassie liled the plat of the town ol l'ortsmouth. which was destined to lmecome the principal city of Scioto County. 'l'o encourage settle- ment in this town, Klassie olfered to convey to each lreeholder in .Xlexandria ta town, which was directly across the river from l'ortsmouth,J the same numher of lots in Portsmouth as such a person owned in .Xlexandria, providing that he moved to l'ortsmouth or huild a residence there. 'Iohn XYood made a voyage clown the Ohio River in l8l9 and stopped at l'orts- tnouth on .Xugust twenty-eighth. 'l'hese are some of the comments he made: Nt noon we reached the town of l'ortsmouth. at the mouth of Big Scioto. l'ortsmouth is an improving place, containing a court house, a hank, several good taverns and stores, with more than one hundred houses, many of them are hrickf' .X very great event took place l7eeemher, 1832 when the canal, which had one terminus at l'ortsmouth, was opened. Six To point ont l'ortstm I tnth's rlevelo intent from this titne to the present clay. we wlll eonsnler the tztctories which sprang np, the churches :tml schools. One o .. . . , lirst t:tctor1es w:ts the Ci:txlo1fl lxolltng present site of York l'ltLc Ih ' :tml Chillicothe Streets. ' : e lortstnonth XYoolen Mills ocenpiecl lfonrth The Cllcl linrlfess Mill in the XYest lfml w:ts :t fine l:tcto1'v 5 lint it w:ts lztter rlestrovetl hy fire. Other fztctories were: The Scioto Stove l :tc tot' :tml llistillery. ln the progress ol y, Ihe -lohnson llnlm :tml Spoke l'l:tctory :tml Geo. l5:tvis :tml fo., Scioto Klills llortsntonth there h:tve heen four lligelow Churches three of which h:tve lmeen :lestroyefl lint the lonrth still stztmls on the corner of liilth :tml l l ' th NY:tshington Streets. ' ' ie llolv lxecleenter Chnrclt which w:ts sitnzttecl on Six Street hetween liimllzty :tml tizty is still st:tmling lint now it is occnpierl luv :tn imloor m:trket. The t llcl Secoml where the Kl:tssie School w:ts torn flown :thont the y Street School llnilrling w:ts hnilt in N50 :tml w:ts sitnzttecl liniltling now st:tmls. The Scioto County Court llonse e:tr ol l926 :tml now :t new one h:ts been lnnlt in its plztce. Some of the prominent men of the eighteen hnmlrecls were: -los. Ci. Reecl, XV. ' ' ' I 'g ' Cht X Nl lltn ' lu XX. Reilly, L ol. . ohn H. llt XYhy :tre we proml of l' ntztnnlrtctnring plztnts :tre ntnsic:tl, civic, soei:tl, econon this sontething for which t known n:ttion wirle ln' the Sotne other lllillllll.ZI.L'lllI'lllQ fztctnring fo.: N. K XY. R cztn .'Xirpl:tne fo.: lixcelsi tlnet Co.: l.eet l.ll1lllJC1' Co ggins, :s. , . . . : i:tr1n, Col. .john Tnr ortsnionth torlzty? liec:tnse its growth is :tni:tzing, its ntnnerons, its popnl:ttion h:ts rztpiclly incre:tsetl, its tie :tml politicztl progress h:ts heen womlerfnl. lsn't o he proncl? The Sellmy Shoe fo., h:ts 1llZlflC l'ortsmouth :tclvertising of their proclnet, .Xreh l'reserver Shoes. plztnts :n'e: XYheeling Steel C'orpor:ttiong lireece Munn- :tilw:ty Shops: Ynlc:tn l.:tst Log Vnle:tn tiolf Co.: Vul- or Shoe Co.: llrew Shoe fo.: l'ortsntonth Solv:ty l'ro- .: :tml Many others. St-ren s f thc ' ' ' ff Mills which stoocl on Iiront Street, on tht Pg 4 rf Llf L. if qi! , l J' lf . . xi - ii P I ' I r 1 - Musicallg the city has developed rapidly recently. In the winter of 1927 The Civic Music Organization an American-wide club was organized. 'Mr. Elmer Ende a great musician has helped wonderfully in the advancement of Portsmouth along musical lines. Mr. Ende was appointed by Governor Donahey to go to France the summer of 1928 to study music under some of the great World known muscicians. Some prominent men of today in this city are: Albert Nlarting Dan Conroy Irving Drew lj. L. Marting VV. VV. Anderson George Kricker and ohn Il. Breece. The population of Portsmouth is now about 65 OOO. There are approximatelv forty churches and twentv beautiful schools. Someday Portsmouth will have nation wide recognition as a great manufactur- ing center and a great airport. The citizens of Portsmouth will be proud of you O great city. -Al BIQRTA YFACITR '28, ns ,-vw Y- I IWFIYFIWPIWPIWFIQFIWFI I'-fliflifliflffIQPINVIQFIQPIQFIV Iii U l 25 ' - i if W lg 0 iw 1 iyl q l ' U at li , l 5, tg ' l l i ' i M, ' fl il f A ry C , t ll v 4 - V U 1 J ' 3 n l S . C y d S 4 , T PI Q , W Q' 4 4 1 11 It ,' HL 1 1' ' lg ' Ul T esp' ' can g c .l Eight WQ . gg Q ,Lf Wi few' X -'K IOM Z NPN X V? .W 'EKG 1 N f ,x Y f Q D 'Sql .3-C5 5 ? fx A 'v I Z2 1 x 10:Q 'I ' 'a 14:4 I 'f Iu Pf:.bY.l t VD D -Szff 'dwg Q' 1111: I X U v ri P' :ya Ulit, 'A A J I Q 5 avg? Q ld g 'pf ow 9 ' Ns :if 371, Q fl' f '2+!r23 ' .. MJJHV' W '-f nJ't!'JMlq?1w j ' f 4 -I Q ' D 1 S Q -I X 'S j J K x X I' I n ,, 'L , I ,ln '45 f5:prp' 4 NJ If ,an In f WW nl Q A ?V . 45 A, . I ' A. 'fi 'T K ' V 95Q 5 x E al 4 K' Vex - X 2 . ' .rc - V' 5-, fn -- 1 1 N , Q 'Q 9 Q x v - C ff' 1 X 'H E gf' N 1 1 'I' tx l , f .' f Q , fy ., A , qglgho I 1 fr' dc' QW 75. f ' 1, Q. . f I 4 5 -X , gh: 'full 'A V ' f i N X f 1 K1 I Y x A 1 J Q gi, Y . A Q 4 -L 1 fe:-'1 H K X L GW rw-x ss,--pf: 2 x V I 1. '-111: -1-.J -'ff ' ' , L5 r pn' 'v it L Y '1:'N 5 ! .I 'S.- A ' -9' l lil' s ?7f , 'vga !e'3 L J 'g.',. f xy lfx 'V I A 1 ' 3 fu, xy ' 1 -.. , X 5J?5Lb.:Sg'55tv'v?2f-'L:Q-Eli, 'x Nj ' 6? E f Q ' I zvv'0l1 14'?f ,,9 ?vdl MX , 6 ,- Q W .f--Q .2 A... up , fs -fi,j3?'f,,g,E 555 5,-44'i:f-P5 QQ ! :air f,i! :-L P47 J, Y 4 . 1 M ., 75.5 IJ1 IJH'.X'l'I'I1 'ro H1 lx I xx l I.'I'Y ,X IFYISURS Ninn' bv .A a .A. ,U 3, ,,, ',. 1 ,,, N I., P gn ,.g' w, , , . .H iv. v iw' ' Q dx. H .HMV M., Ac, wg i ,.,, A .,. A lg M- Q 1 1-' kk jf-'X fum 16 X X x Eleven RANK ,XI'PlzI,, Slff7C'1'l-IIYUIII Twelve 654 Ci 62 N .J sf: ..f-f?Z'111Q- ' ' 'H' Y L. .. b . foie. : C R U S A Il li R IQ I ?2?EMBEf.1?i. Q- ' O . g . . -jf A j Q, g , ' - 53 T l .. L l PAUL ARMSTRONG ' , ' B. S., Marysville College l Pa js , Science Q-X3 HW . 'wp . 1 W I !x CHARLOTTE BELL E . Ohio Wesleyan . 1' l Sargent School Physical Training ,I J ! y BERNICE AUCH 1, ' B. A., Ohio Wesleyan b Columbia Teacher's College . Modern History 5 . . T l ' do L FRIEDA BELTZ i A. B. Marietta College Ohio State University 3 Mathematics J G. T X , . I G. F. BAKKER 3 f l Ph. B., Alfred University l ll Latin f ' fl 1 4 A A 1 ll 1 W 1 . l f ll .Q y DOROTHY BRIGGS ' I if . I B. S., in Agriculture f 5 Ohio State University 5 Home Economics , ' , 1 ' V f f I ' ' gs- h 3 ff ' -y ' . I , 1 i H T MARGARET BALL , . -3 Ph. B., Education . ' 'tg A Dennison University is Latin , ' I . K A A X I E. S. BROWN 1 ' J B. S., Kansas Teacher's College 5? Mechanical Drawing - do w ' l 5 1 fi.. cl Y. S to gwg , X xl ' l Q 5 A . T f 'iii iigfgqfw-. RPL !-A7 171 v . N f .O Fourteen .A , , CRUSADPR N LOUISE CANNING B S Ohio State University MARY FLOWE DAUGHERTY B. A., Wooster College Ohio University Librarian ANNA CARQUEVILLE A B Ohio Wesleyan W. L. DIEHL L. L. B., B. S. in Ohio University EMMA CRAMER JOSEPH DEAN DIXON B. S., Monmouth College Science LILLIAN COLLEY Ohio State University A B Wisconsin University ELMER ENDE Western Reserve University American Conservatory of Music Harvard University New England Con of Music Music ISPI' Fifteen ff, ,,:: UH -- , . .-.,.-,Q,, f H C R U s A D E 3 hi.. i u Q - 1 v I l 1 GLADYS BERYL FINNEY fi U O A ' B. S., Miami University ' 3 , 1 Home Economics N 1.1 'ly 5 fifty 2 yf' 3 11 . , 5 5 3 1 'bf' : 4 l ' RICHARD E- HOPKINS Q 1 Miami University 1 Coach 1 . i 4? 'ff 1 JOHN RUSSELL FREELAND ' B. S., in Education l Ohio State University . History and Economics l ,s 1 EDITH MAE JOHNSTON B. S. in Education L l f ohio University 1 A. M. University of Chicago In English ' LUCILLE GRAHAM rx A. B. Goucher College 4 University of Wisconsin ' English XL ' ' 1 KATHERINE KAUFFMAN 1 .A.B.A.B.- Ohio State University 1 1 , French 1 MARY RUTH GORSUCH I V 1 Ohio University 1 Algebra . JOSEPH KEGLEY B. A. Milligan College Commercial sf? A A fir M lv v u-va' Tnsgqnra n ovevnvs I I 3 Q 'V iv 1+ . . 1 1 Iw J 1 N ' . 1 l 9 X 1 I 1 can X .r I N Y R I E T' 5- 1 1 S! .af , 1 af 1 - Q I 1 1 i I' T1 1 I wwf 2 , 1 X5 I 1 1 1 N I 1 1 ii 1 1 E 1 1 M , , S, iii 4 ' W 5 I 1 Ill 1 1 ' 1, 11. 1 1 ,N ff I Ai 1 fl 1 ' B. A., Ohio State University 'I 1 1 +' 1 X , , 1 H 1 ' FQ 1 V 1 , ll' aw 1 1 1 - - - 3 U ., 1 1 1. 0251 i 1 A ' 1'2 1- 1 ' . N' I U R o ' .bg Q --M-M Wv+ O ' 1 1k 3 gli. W-- ' ' 1 if . ' .nz Sixteen 8 ax N ' - l i F 'N CRUSAIJHR X-A Q I Q - '1 .- Q. . :,.. ,,,, 2 s ' 1 Y WT. . A-. -4 -W. I , i E , l 3 P, BERT LEACH 1 if 5 Stenography 3 E K Ji N . w 1 . , F. B. MCCOMB , 4.,f I . 1 l ll? University of Michigan i 4 Physical Director ' g 1 , J ' 2 M l 5 it ' CAROLINE MACKOY ' I ' A. B., Randolph-Macon Womcn's College 1 1 . 1 , E B. S., in Education f i 5 f Ohio University 5 , .LQ 1 Mass. Institute of Technology , ' Ml ,f , 1 Algebra 1 Q if x v , .i A. L. MONRAD 5 , ,g ,H l f School of Technology 1 i f It l g I. C. S., Scranton, Pa. l 5 WI I g , Mechanical Drawing and 1 i I 5. Q ' Machine Shop ' i g .i 4 9 i l J D E 5 W . o 1 1 i 1 f 3 I EDGAR MASSIE ' 4 5 if B. S., Dennison University ' I if ' , 1 Ohio State University ' ' I , Chemistry. ' 1 , I L I , 1 ' I 3 ' I 1 3 , Qi l N l I it 2 , I , , VIRGINIA PAULSELL B. A., Marysville College 5 if University of Michigan . 1 , ' English ' I i, . ' I I4 14: I H ff , C. A. MARTIN , th gl ' 5 Bradley Polytechnic Institute .ii y' , ' University of Illinois if University of Michigan ff: Manual Training X . . It Ji . I 1 j Hi I I W I A J W i W 3 ka 1 E I HAZEL .IOANN PFAU U1 Virginia Intermont College ch I A. B., Ohio State University W, Q' English ' V5 ' o . 1 1 I ,Q f N f ' ' If I i , , .5 1 l. . , . . ,,.,,,,,,, i -e v .L -fri' T r '.. 'TQ fl - I Seventeen 4- ...--1-T Ali - .Q CRUSADER AMES RAY Ohio University History IRENE SLATTERY Clerk MARGARET RICKER Algebra L F1 iw i B. T. SHAFFER B. S., Ohio University Smience '- , ,cg 4, .fy 1 4'r ' MARIAN ROBERTS A. B., Ohio Wesleyan Typing ! Q . I N' C. D. WALDEN i A. B., Miami University 1 University of Cincinnati ' University of Wisconsin V Q Physics 1 'M w 4 . j Q ' 1 RUTH ROSS A 4 Ohio University ' XFX.. .L.. Chicago University ' 1 Commercial ' s v A. K. WHEELER 7 B. S., Dennison University 3 Mathematics Eighteen ...i- 'i Y 44 1: Y fi ,... -..... 1.1.- -1 4 --1: A -A- f E -A 3 1 :i E Y N: 15 Y il 'K i 5 S' F if 5 +2 Li ,L 5' P: 1 s f. 4 xi r 2 Lv 1 J f, Ll 5 5 as 4 SS- i- S ' S CRUSADER Q nv... 1 . .Ql..........y I 4 A I it if if 5 'lf f I X is Nh 4 s 1 L 1 r l l SENIOR CL1 9 W LAFAYETTE VFAYLUR . . . . . President I X CHARLES SCHIRRMANN lf'iee-President ill RUTH STAPLES . . Seeretary 2 tl CHALLEN IJAUGHERTY . Treaxurer 5 1 l . -W sq. E E n 5 . CLASS OF 28 I ' 'L llfe .vhall lav aside our lzoolex and jveneils, 2 Q For our rare ix nearly rzln. Q Looking o'er the eour.ve fue'zfe taken, - l?le.s'.vea' with sorrow and with fun. MQ . l it lVe rezfzefu' the years Que .yfvent together, , ,3 Side hy .vide 1Ue'z'e worked our way. M O'er our lessons, in tlze halls, l Q1 Year by year, day by day. IQ gl lVe started our taxis where others started, i r l'l e'z'e sailed the eozfrse that lnany sail. ' Some Flllllft' through rejoieing, cheering, Q Some could not weather the gale. . Q P4 Eafh shall choose his separate way, 4 r For here is the frarting of the road. ll'hat for eaeh one the future holds, lf No one ran guess, for no one knows. N Q ig llfhen only our lzappy 'lI1l'lll0l'lf'5 gi Reeall to us our High Sehool days, 1 g Often we shall think of our dearest friends, VT Ana' the part in life that eaelz one plays. lllay our name .vtand high forever, Rezfereal hy many, to many great. llflay tale of deeds, and praixe, and glory ff Rewara' our Class of '28. 't -LYMAN PYLES, '28 u I 1 L ,. f S , , l ' f ' 'l IV'V ' Nineteen 7- A . - 5 .Ms R UKS-AyDy E RY Agp ,- NELLIE AILLS ' N ell .P 5 ' ' K The Specter Bridegroom C153 Class Debate C253 s Varsity Debate C3, 45 3 Varsity P. C3, 45 3 Boosters C35 3 Latin Club C3, 45 3 Girls' Athletic C3, 453 Chemistry H Club C453 Debate Club C3, 453 .Pen and Brush Club C453 Echo Staff C353 Annual Staff C453 Seventh 5 . Heaven C45 3 National Honor Society C3, 45 3 Revelers I C3, 45 3 Girls' League C253 Adam and Eva C45. 7- ? Always willing and ready to do, no matter how hard the task: A Always pro es sincere and true and loyal to the last. 0 w JOHN ALBRECHT ' A Albrite 3 Echo Staff C353 Arts Club C3, 453 O. G. A. C3, 45. l Happiness is cheaper than worry, ' So why pay the higher price? 4 I-I v I I il A fWALTER ARNOLD I Pius The best men always prove the wisest, too. 4 A MARIE ARTHUR French Club C45. ' V Her eyestwere large and full of light, Arid on her lips there played a smile. H .U ' Ji J ' i J 3 , I H ,CJ . Mir THELMA ASHWORTH 'I lf 3, Bill H' Spanish Club C453 O. G. A. C53 If a good face is a letter of recommendation, Q A good heart is a letter of credit. ll l A. I is I iff: 6 , i fi 'I O B I A E '+. ian N 'Y N A vw 5' 3 L , J A .avsvu svuvavavlvaigiyqf Hifi-T5?QijrnirTii 1rnnrmra -nrpv f Twenty I I h.mmmia.mE+t...i,N., 1 si L 4 if i-,f t x , 1 w ,Jap CCCRUSADER A. a 1 0 A4 59 1 . fl LEWIS BAKER Ill E-. l Qs A rrL0uVie1: Q !e I , Y Specter Bridegroom C113 Booster's Club CZ, 313 ' A French Club C3, 413 Chemistry C413 Class Basketball A C11 3 Varsity Basketball Cl, Z, 3, 41 3 Varsity Tennis CZ, N 3, 41 3 Varsity P C3, 41 3 Class Secretary C11 3 Christmas i 0 Chapel C41. 0 1 Not too serious, not too gay3 Q But a rare good fellow when it comes to play? ' 0 .ff VERNON DONAQLD BARTON 0 Q,fg,:, 'A' 9 ' Revelers C3, 41 QFl'CljCl'l'Cll1b C3'f1C'Booster's Club ' if C313 The Brat fill Annual Staff ,C41-3--GlzejClub: T: H. Seventh Heaven 4 ff? 4'Q?plain ' ' jac C413 3 5 'giickles' C41 3 Arts Clgb C'lf' , K m and Eva 5 Q Honest, sincere, persevering, If, A friend tried and true. 3, l l l T 5- ANNA BENDER 9 0 0 . . A fame 1 3 .6 Echo Staff C313 O. G. A.3 Christmas Chapel C413 6 ll Captain Applejacld' C413 Girls' Leagueg Revelers. it v A maid she is of arltless grace, I Gentle of form and fan' of face. l HOWARD BERNDT . ty . Addie'f 0 fl 3 Revelers C2, 3, 413 Arts Club CZ, 3, 413 French Club C41 3 Echo Staff C31 3, Annual Staff C41: Pot Boilers . My wh ,iql Welcomed where'er he went, . lx And valued for himself. tl 'T F rl' if-u it t ' , CHARLES BICKETT . Z Al ' l ' KlBicklJ X 1 'A ' Varsity Basketball C3, 41 3 Boosters Club C31 3 Varsity uf P C3, 41 3 Track C3, 413 Revelers C41 3 The Brat C31 3 Pot Boilers 3 Adam and Eva -I Always merry, never gloomy, . N- Makes a bright and cheerful friend. Li 5 1 i I 5, V W V .. X -- ' L J -r,'.l1rlvaVlvlvlVlVlSfl1ll I' '!J '! l 'l'7l'V 'V 'V'l 'lV Twenty-one Ji Zia 'nxi' 45 A U 9 1 U I ,U f. I . 46. C R U s A D EMR ij . CATHERINE BLAKE Blakie Track C359 Chemistry Club MD. Quick and lively, happy and gay. A smile for all who come her way. LOTTIE BOWEN The joys of today are the toils of tomorrow. Varsity Basketball CZ, 3, 4Jg Varsity P C3, 453 Booster's Club C313 Girls' Athletic 13, 47g Girls' !n U Q ul 'A . 5 I. I . o n: V l M Q ' GENEVA BRADEN 6 ' Quiet but studious I X I 5 CHARLES BUSCH . if . Bushie Spring Football f3j 3 Boy Scouts. J He is not so energetic that we fear for his good health, 1 But by his broad and sunny nature he does good for us by L' stealth. F 'A lf Ag 4 1 E V o 'A 1 . . TY P 'll 4 GEORGE RAY CARSON Annual Staff C413 O. G. A. 4-Sw H N A47 U I ,Q YYW Vffe J V X Q L' J .vu1rovaVsvlvavl1rlvo1rlVl' TlWflii'I'!fl!l'l!Pl'lFl!7lNPl!Fl'lPlS7. Twenty-two l T. ........ .Ax CRUSADER .7i, il sk AVONELL CARR 'Varsity Basketball C2, 3, 45 g Latin Club C3, 45 3 Girls' Athletic C355 Pen and Brush Club C453 Nature Club Annual Staff C455 Girl Scouts C355 Varsity P. The paths she treads are made great highways of happiness For she paves them with deeds of kindness. MILDRED CARR ffMid11 ,wi , Class Basketball Cl5p Girls' Athletic C352 Pen and Brush C453 Nature Club C355 Girl Scouts C35. Nowhere so sweet a girl as she there isg Nor seems she any sweeter than she is. CATHERINE CHAPMAN Right noble is her merit. PHYLLIS CLARK lfphilll Girls' League C253 Girls' Athletic C455 Revelers C3, 4 'Glee Club 4 'Mai n he Mid 3 ' ish- 7, CD, dadt dyC5,W ing Well C255 Pickles C455 Pen and Brush C45. She is tender, wise and kind, And in her eyes there is a beauty born of truth. SYLVIA CLARK Pen and Brush Club C455 French Club C452 Chemis- try Club C45. No work is too trifling to be well done. liravqfpiraifgirgiflifqiflifl' 'l1f 'lfl!fl'!FI!l'l'lF'lQ7INI'l'l!t'lPIV Twenty-three 1Sfgw:f'.7:f af as 1 ' ,,,.1..-.. ,... . . , - C C U A x-i CRUSQDER jak f 3-' .1 . . . .. . Q I 5 t z l I 1 5 1 t t : ', rf Fe Qi L?- HAZEL COLE up Varsity Basketball C455 Varsity P C453 Booster's . To C35iJEcho Staff C353 The Brat C35g Girls' Athletic ' 0 , . V ' . A charm attends her everywhere, ' . ii And a hard heart loves her unaware. 5, I . 9. r ft ,rg if I N 'q MABEL COTTLE N . 9 S Latin C45 g Chemistry Club C45 5 National Honor H 'T OClCty . I. ii So modest, loving and kind, lil t With a very clever mind. ,'ffg41,.f.1f,Q', if w?TQf,.Z,g,, 1 - I fi , ll. 0 5 WILBUR CRABTREE 0 I Crabbie iq National Honor Society C353 Class Officer C35 3 French Club C45 3 Glee Club C453 Chemistry Club C455 1 Specter Bridegroom C15 5 Christmas Chapel C455 , Echo Staff C35. It's good to be merry and wise. I li ' 5 5 3 Q n n ,Q I GRACE CRISWELL j ' by Where there's a will there's a way. 4: , 1 4' w ii A tl V' f' it E, jr . N. ,X 9, g 4 C' CARLETON CUBBAGE Tv 51 ffDann LC QT Track 43, 45 3 Class Basketball 415. ii, They're only great who are truly good. M ch 7 . L. I 1 .r viii ' ' 'iv L J rvlvavsvlvuvovlgifiiifiif qiFvi,?Fi?E?F i5Q3T'iLiTiF9 i7T:'l?ii7-T'Tr' Twenty-four , ' .gist-'1 -ff if ,-,,.,,,-,, ,Amp-Llgg CRUSADER Hn L I ,4 . 4. ' ' ui VX QP! I 1 19 i 1 LEMONNE CULLUM Girls' Glee Club 145 9 Pen and Brush Club 145. L- 5 Search far and near and o'er the sea Il Q Q No better friend you'1l find than she. 'l .E V 5 fl 'I i E I ' LOUISE CUPPET ' ' ' Only a sweet and virtuous soul, like seasoned timber, never L T gives. I 1 k I f -, , 1 1 v QA 1 1 A ,I . y' RUTH CYFERS ' y I . ff-Ruthieu LAL, 1, 4 Latin Club 13, 45 5 Orchestra 145. ' She is always hard at work, never wavers never shirks. T ELMER DANNER I 4 U 3 l Track 13, 45 5 Hi-Yg Varsity Football 145 Q Class X X I Basketball 13, 45. N So much to do, but still so little done. ml A 5 ii' . Ml, I O ' N. MARGARET DAVIS ' Latin Club 13, 453 Chemistry Club 145. ' She is the acme of things accomplished. 1 ' ih ' ll 4 l . gf .V u V w L J ve F6mF1'3r1iF ?ii 'i1favggrn' iifuyovavsvnwrniivuvavnv Twenty-five 4 I s- , up J T PLRUSLSUO'-'LR A. . I R1 ' 1143 my ,K LOUISE DEITCHEL 5 French Club C3, 453 Pen and Brush Club C453 De- A 'fn' bate C453 Chemistry Club'C453 Revelers C45. ' :Fl A merry heart goes all the day. ll 0 o W 1 9 MARY DOBBINS if I have in my heart room for every joy. li W 'I '1 jl WAYNE DONALDSON O HDOCJI o National Honor Society C353 Class Officer C153 Or- i chestra Cl, 2, 3, 45 3 Revelers C45 3 Boosters C35 3 Varsity 0, P C353 Echo Staff C3, 453 Annual Staff C453 Nature Club C351 Spanish Club C3, 453 Chemistry Club C453 1 Debate C2, 35g Pickles C45 3 Seventh Heaven C45. I His life is gentle, and the elements so fixed in him, i That nature might stand up and say, 'This is a man.' l Cl gq EDITH DOPPS 5 Vg ffEdyJ7 lf Nature Club C35 3 Booster's Club C2, 35 3 Class 'M fs' Officer C25 3 Latin Club C25 3 Spanish Club C3, 45 3 L LJ. Cheer Leader C45. L, To know her is to love her. L 1.4 J +L, A HALLE DAUG ERTY M., ft Glee Club C3, 453 Orchestra C453 Seventh Heaven K, li C453 Class Officer C453 Revelers C453 Pickles C453 3. if Hi-Y C3, 453 Spanish Club C3, 453 Latin Club C253 I Chemistry Club C45 3 Boosters Club C35 3 Football C53 Manager C453 Echo Staff C353 Annual Staff C45. :aa He had a head to contrive, a tongue to persuade and a hand L to execute, L 31 1 I a vl nvlvevlvavlvlvevlvi' ii?Eiiffl1l'li?l1Yl!'lNFl1PI'lP'l!l Twenty-six 4 A -vCRUSADER 5,5 in .1 MARY JO DRAKE B -fpoiyff !1'P Girls' Glee Club C2, 3, 455 Revelers CZ, 3, 455 Girls' , League C151 Maid and Middy C259 Wishing Well A C353 Pickles C453 Seventh Heaven C453 Pen and 5' . Brush Club C45. i Quick and lively, happy and gay, A smile for all who come her way. L ' U47-A ll ll HELEN ELBERFIELD , - Elbie 0 3 Chemistry Club C453 O. G. A. C353 Pickles C45. ii v 5 There is a garden in her face where roses and lilies grow. P .ln I if el 5 5 1 if 9 l f FRANK FEARIS 2 I Hello Boy A HI Q The Specter Bridegroomn C153 Class Basketball Q ' C25 5 Varsity Basketball C3, 45 5 Seventh Heaven C45 3 5 4 A I A fine fellow, a good sport, and a staunch friend. 54 E is 5 l I l BOYD FELTY il Who could be more mischievous? . lv ll C 5 J I J: ., 4 Ml I ' ' I ' iii it p, 4 5 WALTER FERGUSON ki There is a gift beyond the reach Of being eloquently silent. I . , L '25 'fi' l l gt' u I 'CW X ' WL ' J , .VI1FlQlli'lNPl1flQ'lQfl5flQfl l' 'l1fIRfl'lflWfllfl'll'l!flNfl1fl'lPl!f. Twenty-seven I g,,.- ' it - Q- 464- c R U s A D 1:,R Q, I Q Q , A n 2 A Sf! W2 5 D VIOLA FIELDS A, C ' To have a friend is to be one F ' ,e a A Y , 5 5 n 5 , , , I Q 3 ' , i. I t ' ' RUTH FORD ' A ' How fading are the joys we dote upon. Q V , ' I 1 l Q ' . fl a. I ' CHARLES FRANCK X f ' V I Charlie ' I - ' Class Basketball Cl, 2, 3, 453 Chemistry Club C453 ' 1 Glee Club? Echo Staff C353 Kaliko Kat C15. 1 I Nothing endures but personal qualities. CHARLES FUGITT IfTubD . i Hi-Y Club C2, 3, 45: Booster's Club C355 Varsity P ' l C3, 45 3 Freshman Football, Varsity Football CZ, 3, 453 , l Basketball Manager C3, 455 Class Basketball C3, 45. Cheerfulness is an offshoot of goodness and wisdom. : I ' ' T HARLEY GLASS X ' 1 Beaver ' lj School, Bluefield, W. Va.g Track C2, A I 355 Footb ,C15g Varsity Football C255 Glee Clubg l Chenjtistry 7th C451 Christmas Chapel C45. , ,A 'J My honor is my life, . U ' , ' If Both grow in one: , , 1 1 ,Take honor from me H N .N . Q ,f And my life is done. M ft' 4 I, VW I Y . ' V-4 x ' K, L J .va l lvl ' nVav ava1rWiirrQii7 ':ai5lii3?jQij?ii3i? Tyzenty-eight - -at . ' f -f' C A ' '14 if Q - 1. -f-1 ' -1 ,. .g-e-,.1- . 5. 't.,, .4-'-f y, f'i ' Eaasi..uoin.Em.t.'v.,f. - . , Lf-1 ,.. fRf,'.-frat. kazaaza.ir':,,,.J3. Lmwatof.4-.aa,:a,aL.m:'z5if,r15t,e2. .J fatattaatnuzvrma-sf .. V . VIKFINFIVIWFIWFIIFIWPIWVQWFIWVI , -.1-ti.-., T. .As CRUSADER 3164 ROY GORDON - Varsity Football 145 ' Varsity P 145 5 Boosters Club In action faithful and in honor clear. MARTHA GRICE Marthy Girl Scouts' Glee Club' French Club 145' Pickles 145 ' O. G. A.' Class Basketball 145 ' Nature Club 135 5 Pen and Brush Club 145 ' Girls Athletic 145. A delightful personality seasoned with the delectable, spice of humor' eyes that draw hair raven in 'ts blackness. PAUL HAMER 'Hamer' Basketball 11 2 35' Football 11 25' Glee Clubg Revelers' Boosters Club' Christmas Chapel 145' Class Officer 135' Wishing Vlfell 135' Pickles 1459 Captain A le'ack 4 ' Annual Staff 145' French Never over-serious not too serious but a jolly good fellow MARY CATHERINE HARTMAN Billie Spector Bridegroom 115' Chemistry Club 145. She speaks behaves and acts just as she thinks. WILLIAM HARTSHORN Bi Class Basketball' Class Football 115' Glee Club 13, 45' French Club 145' Wishing Well 125 ' Pickles That inexhaustible good nature keeping the mind smooth, equable in the roughest weather. I I1 al 'i U 7 Y li ' .. ,, l O ll I! O 1 , l I 44 . I mi J 4 J. ' . Club 145. 'Fl . A, J Jr td I M KI ll!! ! Y Ju .. , U I H u I L L - Yin v: Twenty-nine r. . .. r ., , - frm!!-taurus 'fnhs-fm I - -w .Mm C R UnS.A QE R Agn ' o L-s :mg sf? LOUISE HAWS , Spanish Club C3, 4.5 A . And her modest manners, and graceful air Show her wise and good as she is fair. U Ii 5 I o P CHRISTINE HEER 0 5 4 Chris 2 French Club mg Glcc Club C3, 45 9 ,Girl Scouts 41, 0 '- 2, 3, 45g,'Gir1s' Athletic qs, 45g Girls' League C253 r Y 4 Wishing Well C25 5 Basketball Manager C45 g 4 I Pickles C45g Chemistry Club C451 Varsity P C45g ' I Pen and Brush C45. I .1 , , .. Y 'l She liked whate'er she looked upon, 6' 15- ' And her looks went everywhere. ,Z, l ' 1 ': ' - Q L1 ,U ,' o f .L 4 KEITH HEMPHILL I 40 ii The joys of today are the toils of tomorrow. N I 4 x 4 1 A ' 5 RALPH HOBSTETTER 3 w Howie I r J Annual Staff C45g Hi-Y Club C45g Revelers C3, 455 QA Q Echo Staff C3, 45 3 Latin Club C3, 45 3 The Brat C35 3 ,' Q Nature Club C353 Manager Seventh Heaven C45. U ' True as the needle to the pole or as the dial to the sun. X . 1, 1 i lr' 5- r ' 0 . 4x , EDWIN HUNT .N r If-Ed!! N Varsity Football C3, 45. gg-3 Gentle but not dull, ' ' U ,- 1 r Strong without rage. 24. ' 5 I .x v G' -F r I .N L X x A J ' . nV4vavl rlvovlvl' 'jfffifjifliflffl'lflQ7lNFl1Pl'll'IS7. I . . Thirty r ., Q ss,,L.,bsaz'H'.rM .J ,Mg CRUSADER O 4 A. C C I rx' ,g .ai ,Q . ' x W! ' lllq QQ! Q19 ,, MARGARET INGLES Q. OM Pure is her purpose and strong is her strife. . I ' 0 Il 137 0 yy, ' WILBUR JONES ' O ,, If Bear 3. it Spanish Clubg Glee Clubg Chemistry Club C45. I A good-natured fellow whom everybody likes. l 1: Q is 9 0 W IGI 'GI l l M li: fl o .', .'. o A ALFRED KAGEALS 4 0 ', Class Basketballg Basketball C455 Varsity Football 0 4 fl C453 Track 43, 45. I., I The greatest truths are the simplest, N I l So are the greatest men. JAMES KEEVER ' T . rrlimzl 4 . M, ' 4 Varsity Basketball 42, 3, 455 Varsity Tennis 42, 355 4 Q ll 4 Freshman Footballg Class Officer C253 Orchestra Cl, ky 41 253 Glee Club Cl, Z, 35g French Club C453 Chemistry CL, Club C453 Boosters Club 42, spa Varsity P. 1,1 J' Wit is an unexpected explosion of thought. L l .J M .J A 'L4 r ' ' l '4 GRACE KEIFER VT My lfGr ' if M' 1 I ac1e gl Spanish Club C25 g Nature Club C35 3 Revelers C45 g 1 , Girls' Athletic C453 Pen and Brush Club C45. M '25 She is a bit of gentleness that cancels the roughg I fe The bit of tenderness that obliterates the harsh. a I J l K I, J '.l!l'lW.FIQfl1Fl'l,l'l1FlNFll.l'Fl!Il17l' 'I IHFIWFIWFIQPIQPIQVINPINPIWPI Thirty-one T. f-,-A- 'H'-' i' W RV -.- AGA C R U sa DCE R333 in I KATHRYN KELSO Katie Echo Staff C35 3 Kaliko Kat Staff C15 3 Annual Staff C45 3 The Specter Bridegroomn C15 3 Girls' League 0 C253 Girl Scouts Cl, 253 Glee Club C153 Girls' Ath- ' letic C3, 453 French Club C3, 453 Pen and Brush Club 9 C453 Seventh Heaven C453 The Brat C353 Maid and the Middy C25 3 Nature Club C35. She thinks without confusion surely, Loves her fellowmen sincerely. if . 6 .I Q4 'V' ' MARGARET KELSO W Q , Margie r T Pen and Brush Club C453 Latin Club C3, 453 Girl Q Scouts Cl, 2, 3, 453 Seventh Heaven C453 Annual ' Staff C453 Girls' Athletic C45. A strength of mind and a goodness of heart make her capable ' of steady friendship and lasting love. 14 ' . in v ,X 'A 5. o . L t EMMA KIRSH Q ' O. G. A. N ' Blest with that charm, the certainty to please. f n l 5 , BURLYNN LATHAM A+ ' Girl Scouts Cl, 2, 353 Pen and Brush C453 Revelers 3 C453 Girls' Track C453 Seventh Heaven C453 Maid if and M1ddy C253 Nature Club C353 Class Basketball 15 in l fx ll '. . F tl A A' Cl, 25 3 Girls' League C25 3 O. G. A. D Charm strides the sight and merit wins the soul. 1' P 4 H' A' all .1 ' f.. 4' s. ROY LEWIS 'S 1 , Nothing is so becoming as mild behaving behavior. u 3 t . n ' l 1 Q is I Vw X L J .vmrmn ' I ,vnvavagglgig 7iiiiii5'Q fi'rsnra suravavawrlv. Thirty-two I ai i ELMO LILLY Qi!! Nick I Glee Club Cl, 2, 3, 453 Revelers CZ, 3, 453 Nature 3 ., Club C35 3 Kaliko Kat Staff ,CI53 Varsity P3 Booster's Clubg Cheerleader Cl, 3, 453 Track Cl, 253 Annual 5 Staff C453 Once in a Blue Moon C153 Maid and ,C ' M1ddy C253 Wishing Well C351 The Brat C353 il! Captain Applepack C453 Adam and Eva C45. I Witty, original, good-natured-a sure cure for the blues. A 3 A ALMA LOWE i , Strong in will and rich in wisdom. ' I ,Af CRUSADER - flew., i 'Ci ' r Y I C Ax 5 'I' .u., f F ' 1 .5 L L.. ' NORMA MACOMBER 35 Girls' League C253 Chemistry Club C453 O. G. A.3 Revelers C35 3 Girls' Athletic C45 3 Girls' Art Club C45 3 V Mr i ' Junior Chapel C35 3 Christmas Chapel C455 Typing Con- , test C25. A sweet attractive kind of grace, A full assurance given by looks. 3 ff Q EARL MASON A The deepest rivers flow with t ds. ' A , 3 Ml T ,A 1 l ' 3 NORMA MASSIE 'f Varsity Basketball C453 Varsity P C2, 453 Boosts-:r's Q Club CZ, 351 Glee Club Cl, 2, 3, 453 Girls' Athletic CS, 453 Girls' League C353 Echo Staff C353 O. G. A.3 J Revelers C45 3 The Brat C353 Nature Club C353 ee, Latin Club C453 Chemistry Club C45. i Lively sweetness is the noblest power of woman u j . ......i..............-..---- 1 ,hu x . b IIE ipb I I f 9 'J I 0 9 l, if I l, ia 44 I -3 'ft li it if ' 1 M ls., ' is L I ' '.visr vn ivivivivcS'ffifif gif-iifivi iviirinrovivanriv Thirty-three iv!! Qi A l 0 D 9 T s F 1 I A I u 5 G 1- at '- f - .Mm CRUSADEB 'EAL . PAULINE MCLAUGHLIN Silence is the greatest art of diplomacy. WILLIAM MEIXNER Bill Orchestra Cl, Z, 3, 455 Band Cl, Z, 3, 455 Revelers C45 5 Cheer Leader C45 5 Seventh Heaven C45 3 Wish- ing Well C355 The Maid and Middy C255 Pickles C455 Annual Staff C455 Class Officer C352 Booster's Club C355 Glee Club C455 Captain Applejack C455 Adam and- Eva C45. A man to whom one feels free to talkg To dislike him is impossible. O PAUL MELVIN Class Basketball Cl, 2, 3, 455 Chemistry Club C455 Glee Club C45. Liked by all who meet him, unliked by none, For he is a friend of everyone. us 5 nl I O 0 0 5 . if it , ALFRED MILLER H- ' Where true fortitude dwells, loyalty and fidelity may be found. YH H ll' All A' 'L 5 'Tx M '-N, P, ' PAT MITCHELL ,g rg Varsity Football C1, 2, 3, 45 5 Captain C451 Track CZ, 'M 1, 3, 455 Echo Staff C355 Annual Staff C455 Varsity P N Q CZ, 3, 45 5 Boosters Club CZ, 35 5 O. G. A. O, Captain! My Captain! Your athletic work is done. t. 425 Your teams have weathered every wrackg U The prize you sought is won. N A U I te If W J X V w L J .vmrmr 'V 1 5 wulirlviigsng-I-A' iiiiiii-v1fFi?Fl7'a1rs-nrmrmrnruv . of.. Thirty-four +1L-mt - ,Af CRUSADER - 'lah U I .J A 611 nw ill! !'iD x A EDWIN MORITZ A Of a cheerful spirit and a willingness to take the world upon Q his shoulder. . ' l I 1 o D ROBERT NEWMAN X 0 Bob Y Arts Club Cl, Z, 3, 453 Boosters Club: The Brat ' Q C353 Pot Boilers f4J5 Seventh Heaven f4jg T Captain A le'ack 4 Annual Staff 4 ' Revelers 1 7 1 pp .J C 72 C J, y Q QZ, 3, 45 3 Christmas Chapel. ' I l. Honor and fame from no condition riseg Q Act well your part, there all the honor lies 0 i ' Q I: ' 1:5 l l LL ,fy 1 A .-, 1 ,I GERALD O'LEARY 4 It 0 'X A man of cheerful yesterdays fl And confident tomorrowsf' el 0 I 3 GERTRUDE ORIN ' U , ' o.G.A. E . 4 8 'With malice toward none, VV ' L I N in ld' With charity toward all.' V lg, .if L ' 'f - Al 1 J 0 l Q M' B., J CLEO PAYNE 1 5 ' Chemistry Club C4J. ' A face with gladness overspread, U Soit smiles by human kindness bred. fl 'N fem I :Ev , ll I i ' l tg vp L J . -'0YI!.l'l1Fl'lfl'lFl1Pl1Fl'5Fl'lflQfl'lQ ip-ggggfvvlvivlvlurlvlvuirisz Thirty-tive I ,... if u 1 f y 'Q U Q! I A ll S tl air 4 A 4 J ,U M. J .1 'Ai A , -lik- T, , l ii- A .AGA c R Us AVI5'P.R g 5, ff SUSAN PEEBLES C ji, frsuery Glee Club Cl, 2, 3, 45 5 Revelers C45 3 Pen and Brush i Club C45g French Club C3, 45, Wishing Well C355 Pickles , Echo Staff C35g Class Basketball C45g Adam and Eva C453 Chemistry Club C45. . Kindness begets kindness, and truth and trust Will bear a rich harvest of truth and trust. I 15 fl 55 ASTON PORTIS Class Basketball Cl, 2, 359 The Brat C353 Junior 1 Chapel? Christmas Chapel, The Maid and Middy g Wishing Well g Arts Club C453 Spanish Club CZ, 35 3 Chemistry Club C45 3 Girls' Athletic C3, 45. l A little red-headed aristocrat ' Whom everybody loves. 55 1 VIRGINIA PRAY , 2 Ginny it ' Gleevlub CZ,,3,'q45g Revelers C2, 3, 45, Pickles C aid a Q1Middy Wishing Well The C4 ' ' 9 , 9 Q. t 5 Pen and ush Club C455 Girl Scouts C459 H ' irls' League C259 Class Basketball C453 Chemistry Club C45g Annual Staff C45. A sweet heartvliiting cheerfulness Like springtime of the year . I I ul LYMAN PYLES if Pyle.rie l Echo Staff C353 Annual Staff C45g Football C355 Class Basketball C459 Track Manager C35g Varsity Pg Hi-Y Secy. Seems ever on her step to wait. 'w Life in its myrial form has come to him, lr, But he has remained a jolly good fellow. ,L l . 'T' '+. I 'M HARRY RAPP C fi' si , Cheerleader C45. 5 'Taint his hair-'Taint his smiles, 'Taint his eyes-'Taint his wiles, V -J 'Taint his silvery voice, you say, , U eb Tell you what-it's just his way. :ge ll 91 Q I I -i 'fx' f ioffa '- A .vinruvavovsvu'vvnnrunmwrgggr' ?EgTiij5ra-nrTnTi1rmr,y-.gp,-.pm Thirty-six ' messes ?, I L- K 1 V- Am- MCRUSADER 'lyk 4 l l P Qi fat 611 QR 1 GENEVIEVE RAMBO 'Q 5 ' Nature Club C2, 355 Latin Club 145g Revelers C3, A 455 Chemistry Club 1453 Girls' Athletic C453 Class A 1 Basketball C45. i I Little people are to be loved and big people admired. . L 4 ll ll 4 l NELLIE RESSINGER l 'v I find earth not gray-but rosy. - 0 ' 4 a fill X X, 5 I 6 A i. A .4 ll GEORGE REINHARD ln l H A little nonsense now and then it ll Is relished by the best of men. if . . , I l E i 9 JAMES RHIEL , 5 3 , ' 3 frjimxx ll? Latin Club 'C3, 45 3 Chemistry Club C45. , P The kindest person, the best-conditioned and unwearied spirit. MJ l ily 1 1 5 , ELINOR RUGGLES , A 'jk ' KrRug1r l IAM 1 ' Revelers 1455 French Club C3, 453 Pen and Brush v Chemistry C453 Class Basketball C45g Pickles :ga She has an eye of great quickness and vivacity, with a lurking f do waggery of expression that is irresistible. 36- I I 1, 'ff' J L ' J -U .mrn'u'mrmrs1ra1rl1nnre'lrl'vl 'l'0j6T1rrlrn1rn1ru sv'n1ro9lrlsr. s...l ' ' - Thirty-seven l ,qi :ii Qj! I -fu x w 35.7 - p ' -Qs. , .MA CRUSADER j p 3 .... Y-sk i . . 3 HELENE SECREST ffjudyu Basketball Manager C3, 45 3 Class Basketball C45 3 girls' athletic C45 3 Varsity P C45 3 Boosters' Club C45 3 I F9 K A J A day of toil, an hour for sport, l But for a friend is life too short. it 'TC Wx . 0 AUGUSTA SCHIRRMANN ll' ' Gussie A irl Scouts CZ, 3, 453 Latin Club C3, 453 Spanish l! k ub C453 Pen and Brush C453 Annual Staff C453 I lass Basketball C45. H Happy thou art3 as if every day thou hadst picked up a W' af horse-shoe. J if 0 I CHARLES SCHIRRMANN 9 X I Charlie l ll Once in a Blue Moon C153 Orchestra Cl, 2, 3, 451 l ' French Club C3, 45 3 Echo Staff C35 3 Annual Staff C45 3 Q 4 Class Officer C45 3 Christmas Chapelg Band. None but himself can be his parallel. , lg ls li 4 Q 14 5' s HAROLD SCHNEIDER ' Christmas Chapel. ' ll' It seems that the kindliest battles fought I P' Are fought in the silentest ways. l 1 H 9 Pl lil ' MARGARET SCHWARTZ Chemistry Club C453 Pickles C453 O. G. A. Life is but a span. I enjoy every inch of it. frb rg: . 0 4 'RJ' I, l I. ' . J M' Wflillfiflillifl' 'avv vvavnnrnvunruvnvuuruv Thirty-eight S? ad... I if Q: l . l J f 1 ,,,...,l1---- L . 463' CRUSADER 'UAL KATHRYN SHOEMAKER n Katie Spanish Club f4J Q Pen and Brush Club C43 g Chemis- try Club C4D. at She is of worth and worthy estimation, Andlnot without deserts so well reputed. JOHN SMITH O. G. A. An affable and courteous gentleman. EDWARD SPROUSE Right noble is his merit. I O I B Illg iff? I I ll l Q WALTER STAHLER 9 i Walt W ' X Thine was the sunniest nature that ever drew the air. I F 5 J ' A l 4 4' L Ag lu, .1 . 1., y, ' RUTH STAPLES tn J' Stapler 'N ' Glee Club C413 Annual Staff f4J1 Echo Staff HB5 ' Latin Club C3, 43 3 Class Officer f4J. J She does not need music to charm her way in this world, yet '- 'S she has it. fs' 1' ll . I I La vu J vw L J ,Vi'1Il1.Pl'lfl!p'1'.Qpg1fl lfl'lFIiFl' 'l'j,fl'lflW.l'l!Pl1F'l!f'lNfllFl1PlS7, Thirty-nine ,,,q.1-,.., K ,. .. ,A ' Ki.- .A CRUSADER '35, . -. - 9- . . M--:H . . . V . i Q r I 0 I H.- .Q '- PAULINE STEAHLY I9 X Ifpollyll . I . Revelers C3, 45: Nature Club C333 Once in a Blue ' Moon CD3 Maid and Middy CZDQ Class Basketball 0 CU- ' ., , N Rare compound of quality noble and true, 'l With plenty of sense and good humor too. L C 'SU LAFAYETTE TAYLOR Z, uLafev 0 Glee Club CZ, 3, 42 5 Band C3D 3 Wishing Well CSD 5 0 If Pickles C41 3 Revelers Cl, 2, 3, 4213 The Trystmg 1 5 Place C23 3 French Club C3, 41,3 Seventh Heaven 7 1 C413 Class Officer C4Jg Boosters Club Cfllg Debate 6 I gp, 1?3nnEalbSHafg4g4Jg Echo Staff mg H1-Y qs, 455 Y .32 S ass as et a . - 4 E Be strong! We are not here to play, to dream, to driftg 1, I lfVe have hard work to do, and loads to lift, I Ei 3 Q I' ,.. 0, RUTH TAYLOR ig Class Basketball CZDQ Girls' League CZD. 'Z I 0' It is always good to know a charming human being. fs 1 Il I A ' T is ti Q 44' SHIRLEY THOMPSON ' lf, ui' Gentle mien and quiet ways, Lt hi, He's there with the goods on school days. 48 1 f , tl' I li' T ii I ' 'A C 'w ' . J' FRED-TOBIWVX I M , 1 , -d 1, - 1 A fffmaie' 1 'M 4 ' - . 1 French Club 43, 45 guoiegcshbt 445. - Keen judgment and steadfast in purpose, C53 This man will do what is right and honorable. av H ,Q ' g -I .17l'1l'l!FlQfl1Fl1l'I1Fl .65iflii?i? 3lifv'wfii5P'fiij1i2'i3Ffii4ii'FTf5Fi:F'ffr: A Forty ,V .' ' fl Y-: fmt e.':r-.ffm-: ,N .JM CRUSADER ,Q- 9. 1. al M ., r 'Lag CARL TUCKER Tuck The Specter Brideroom C113 The Trysting Place C213 The Brat C313 Seventh Heaven C413 Revelers C1, 2, 3, 413 Glee Club C3, 41 3 Latin Club C3, .E 1251. ab A +1 413 French Club C2, 3. 413 Band C313 Echo Staff C313 ,il Debate CZ, 3, 41 3 Chemistry C41 3 Varsity P C31 3 L , Booster's C3, 412 Class Basketball C41. A Ah, why should life all labor be? G ll 9 . . DONATI WAKEFIELD Natty Glee Club C112 Nature Club C313 Echo Staff C31. A comrade blithe and full of glee, Who dares to laugh out loud and free. e o h HARRY WALKER B O. G. A.3 Stage Manager C41. 3 i V There's nothing ill can dwell in such a temple. i ! 1 , FLORENCE WARSAW ' LywMf 'W'- 3 Fl0ssie ? ' ' ' Revelers CZ, 3, 413 Pen and Brush Club C413 Girls' 1, League C21 3 Nature Club C31 3 Once in a Blue Moon 1 ,' C113 Maid and Middy C213 Wishing Well C313 Pickles C41 3 The Brat C31 3 Seventh Heaven ' C41 3 Captain Applejack C412 Echo Staff C31 3 44 D A4r3nual Staff C41 3 Christmas Chapelg Adam and Eva , X . A Ji A smile for all, a greeting glad, A , A lovable jolly way she had ,l 'l F ,J 4 ' KATHERINE WEAR 'ff +4 fr-Kattjjxf i Maid and Middy C213 Christmas Chapel C413 Girl Scouts. .. She never found fault with you, C, Never implied your wrong with her right. .L u , I I: v q J ww L ' J lll l!IlQfl Pl1PlQPlQPl lQflQ'l' EQQ OWIIKPIQPIQVIQVINPIQPI V Forty-one 4 - Ae -- --1 'F Ckusguapk '35 I Gi F Ligf' i 4 fr fl., Nw GRANDVILLE WEBB -C Granny . ' A iff Spanish Club Cl, 25. - Q1 I hate nobodyg I am in charity with the world. I I 5: 13 , ll 'YV BENARD WIEGERS XN ffBenJl ' ,, Chemistry Club C453 Boosters Club C353 Varsity Pg Q. Christmas Chapel C453 Kaliko Kat Staff C153 Revelers 'Q C3, 45 5 O. G. A.g Cheer Leaderg Seventh Heaven C45 3 l 1 Captain Applejack C455 Adama and Eva C45. I '. He that is of a merry nature hath a continual feast. 3. 1 5. ' 9 . C X HELEN WHARFF Q 5 Of G. A. A Witty and happyg a pleasing personality. ll I LENA WIDDIG ' ? ff 0. G. A. fi F3 Genius works sometimes: hard work always. W: M .41 44' L 'll ft .4 N, .4 i '-A lf' N DORTHEA WILSON r 053 Gentle of speechg beneficient of mind. , :ED ll , ll L5 1' L5 Us w w L J .vn avaVevuvovnvlvo1gavl' 1iii'irTigFnVaQFT1rn1rav'uvwmv. Forty-two N i ,Am gg CRUSADER ANL V , , , 5 I w g A G :IJ . , .-, L1 ? . 1 , 'Ili- i 1 s I 1 io .' LENA WYANT Latin Club C3, 41. l + . Highly erected thoughts seated in a heart of courtesy. , I ll ll ALBERTA YEAGER , IKBertJJ 4. Latin Club C3, 41 5 Revelers C41 Q Glee Club C41 3 Echo Staff C41 3 Seventh Heaven C41 g Pickles C419 H f Adam and Eva C41. I l Your smiIe's just like the sung l 'n We count on you when we're looking for fun. 5-, ., 1 1 fi 1 Q O 1 - ' n 4 MARIAN YEAGER Q I lfyeagll K 0 ii f3VZS'sity Basketball C3, 415 Captain C41g Varsity P 0 A . One doer is worth one hundred dreamersf' ' 5' 9 i ml CLARA ZEUNE i r r N Girls' League C21g Chemistry Club C413 Band C41. - , ll' it We are rich only through what we give. U 1 , A' L J . lf, 14' ' 0 I RUTH ZOELLNER S, 54' . rrzu . tm ff' - Girl Scouts C2, 41 g Glee Club CZ, 3, 41 3 Class Basket- iM 4 ball C41 g Pen and Brush Club C41 5 Varsity P C31 3 De- i bate C3, 41 3 Revelers C41 g The Brat C31 5 Class Track C2, 31 5 Pickles C41 3 Wishing Well C312 Maid and , :jx Middy C213 Chemistry Club C41g Girls' Athletic C41g ,. Seventh Heaven C41. ' , U Quietness, gentleness, marked her grace g , Unmarked beauty shown in her face. l ,fx . l L J Yfliflillifl liflffliflifiill l' 'INPIWFIWPIQPIQPIWFIQVIWPIRPIHPI Forty-three p I '-1 -fzzz i Q Q .As c R U s A DF R -Agn? A I f pn lll gf ROBERT ZUCKER ! . , Q9 1 'Bob' - A I Glee Clubg Revelers C4lg Chemistry .Club C419 Class A , Basketball Cl, 219 Nature Club C315 Wishing Well H li C335 Once in a. Blue4Moon C179 The Brat C379 , It 0 Annual Staff C4Dg Seventh Heaven C4J. 01 Q Very fine looking, ambitious and true 1' K As a friend to all, and a real friend, too. l l X, ' A I I ' ' i i , 1 . I 1 POEM I ' C Four years ago we entered high school as the freshmen filled with fear,' Four years ago we learned to live within those halls so dear. Y A Four years ago we started on the lessons others knew , And strove to place our names among those other names so few. ' ' But when at last our work and trials are o'er, , And we stand waiting on the threshold of life's door- I know that since those days have drifted by I can but turn the pages of life's book and sigh. I B I wish, with sighs, that I could live those hours that I once knew ' ' So filled with laughter, song and tears so dear, nor were they few it But with a sigh and aching heart I turn and pass the door To live that mystic futures not the happy days of Y ore. ' 314' I- it A. u I lp . 45' ' C-Mahi N few ' ll ll ii U . gl UN l VY L J .VIQII IQIIWFIVIWIIQIIRFQQIIQFF l'AliflSfEiEiiii?l'l'l!VlWI'l!Pl'lfIV Forty-four - - A A 5 - .R me A x- C R U S A 11 R R '35 C .... M' . . ff Q .1 if II11 zilllemnriam 1 44339. l DAN PACKARD V RE O 9 A ' W- W I 13. l Q 'B : fl I ,E A i 1 j . r' CRQSSING THE BAR l Q Sunset and e've1z'ing star, l Ana' one clear fall for me! Q5 a Ami may tlzerfc be 110 11z0a1zing of tlze bar l 9 Wlzen I put out to sea. M? For flzouglz from out our bourne of time and place E The flood may bear me far, ii I hope to see my Pilot fare to face AR' Wlzefz I have crossed the bar. F Q L L l. H A . T ' 4' 1 V Forty-live Forty-six 5.1 fff fp fi! f X 0-WKYON -'29 MM--M M cxgusgioax g Wi - D . . . . . i . . 9 l TUNIOR CLASS OFFICERS PAUL HARTIIEY' . President IJONALD CRoss . . Secretary JANIE SMAL1,wooD Vice-President JOE COLVIN . . . Treasurer CLASS OF 29 Freshies, keep up your spirits. We were just about as verdant as you are three years ago. Did we get lost? Well I guess. However for all our troubles we started early in the year and elected as president Richard Marting' vice-presi- dent Reese Lloyd' secretary Dick Tay lor' treasurer Virginia Nye' and Miss Charlotte Bell faculty advisor. These people piloted our ship skillfully through the green waters. Sophomores attention! Take this from your elders! VVe thought we were just as smart as anyone of vou do. Someone said I believe Fools are the ones whom experience teaches nothin . Well we learned by experience that we weren t so bright. Under the leadership of Arthur DeVoss as president Harold Whitlatch as vice-president Ruby ohnson secretary and Russell Saxby treasurer we again reached the top. Looking forward to the time when we should feed the hungry Seniors we gave a dance and a play. These two functions helped our bank account quite a lot. IXow we are Juniors. MV but we have grown. Really we are rather intelli- gent looking. Our first work o'f this year was to elect these officers: president Paul Hartley' vice-president Janie Smallwood' secretary Donald Cross' treasurer joe Colvin' and Miss Pfau assistant faculty advisor. During this year we took over the Echo gave a play and a I eap Year Dance. After the example that the Seniors have given us we sincerely hope to keep up the good work. 1 I C T s 1 s r V U Y 7 7 ! T V C 1 , ' L T , c n , '- 1 v O, as J b 1 I , J . , , , C , c L 1 T r , r r r 1' 1 v , , , v s 4 s y 1 v C 1 , c , c 1 J r s I I In I a lCI'!Il'!fl'll!l'1l'l'lPl!!l1li avi' 'lvuvsvsvs vuvu a Forty-seven , r 1. - ': vw '-gifs.: ,, , ,, , . . .Q , . , x - . v R..-4.QQl, lf. . W , as4p,uxzm,24r1x.:a-mmmex:2n'Yo'f wmwr:'r2i1::'1rr:f:x1:.' fx-s-uae'.,,e.x,5.f7Z233Si-ff' , - LA: ?.'f..m b.4 ia..41im... L:dL.1lhLdb,...1.r5 L.. 4. .. f 1: kr' 'AA Forty-eight IOR CLASS I Forty-nine Fifty Z 2 WA I lm ' . .... Q RN 4 W x Q I l X 1 . IM Q wif? 1713.223 www! WW mmmwmilflbneawn y ' H f V V K VMITCNELL HPEQEKJ in Mmlrzlnlqvg , AGA? CRUSADER C lib li - L l . I so if T 41 - f' Q1 a K rf? 1' Q K 'x A A H . . i i 0 0 Il l l SOPHOMORE CLASS OFFICERS VAL HEISEI, . . Presidmzt I GEORGE VVHEELER Vice-Prc.vidm1.t lj HOWARD GR1ssoM . Secretary 'S' HELEN JORDAN . . 'l'1'mx11rcr l L- o l 0 1. 10 ' CLASS OF '30 A Two years ago, we the class of '30 entered P. H. S. At that time we were over two hundred strong. To begin the year and our class career in the right way, we elected Mr. Leach for our capable and efficient faculty advisor. Q For our first year the officers were as follows: President, George Wheelerg 3 ,J ' Vice-President, Val Heiselg Secretary, Esther Gablemang Treasurer, Pauline L., ' Grimes. ll y The class of '30 is the first class in the history of this school to have its own ix if class song. This song was composed by Mr. Leach and the music by Miss Anna 'N .4 Cramer. L f For the most part of our freshman year several of our enterprising members 14' ' edited and published a class paper under the name of Gab. 'N 'fi Soon after our second year started, we elected Mr. Armstrong for our co- if' faculty advisor. 'M Our officers for the second year are as follows: President, Val Heiselg Vice- Ni President, George Wheelerg Secretary, Howard Grissomg Treasurer Helen Jordan. A 'Q' -H. W. G., Sec'y. I l gl jf X W3 n. 4 , lfl1l'I1FlQfI1FI'll'li'l1FlW.flY,Fl l' 'lYfi.fl1flQ7l1Pl1'lQfl1fl!Fl1PI5ll Y Fifty-one , SOPHOMORE CLASS Fifty-three ,, -sk-, , ' xW X l'f ?,' ', ' - g ' . ., ... ,. M-M A Nvlmw s1.a,.:.m+'.Zm-fx, 14, 4 wwf' , , 25' Q5 '1 Ag.anL4h,Jn., ,Aw fi.. Fifty-frxtlr Cf? W 521 f'NS,.f:1ff ZX 3 fa Karr! .z w,f.Mj4 FRESHMAN CLASS OFFICERS mv lXII'I'L'lllCLI, ..,... l'rvx14lw1i . ,U -xm IDoNAl.1m5c . .Sm'1'vf111'v-I 'vcrxzfwa' FRESHMAN STUDENT COUNCIL FRESHMAN CLASS MIDSEMESTER FRESHMEN Fiftyfight 1 r 1 ,, Q Je AH 1 ,M W 131- ww ra If wx, w M 'I F iff ,LM T N ' sr ., ., , H. J w Nw M- K, , , I 5 , VY,, Y K t Y. , N. .. .,!' Y X. .- W. -I - V- - : ' A . Q W Lf lu- 5, ' I ' 1' f M, W I Q j A ' f W. A f V. fi 5' A X fr 'flff' , Q , W , ,4g?3 E ' , 1 5 :::i: x 1 X5 ' fl' ' X - If n 3 Xu- , I' 7 ' V. ffif 4 ff' ' . , . :1 +f K f , D I f R . 'I ' f f ci N . 7 . I X 3 ' f 545 M nl . g Q Q X, f V 3, 1 X-,N - T2,,'.'Ii,v-' .4...,X M ,gg f 1 f e4 Y 32'Zf1' f X is A 5 KV ' 'x' - , , A ,, I V ' f Q X X ,Z . e : ., :xx-. xv, .1 ,Q -1, .. 1, 1 1 NN gym' 4. .4 ff 'Qfw f fi ' N 5 M f' 'f QU 1 2!'f'2'N -.N Q-PGP W ' - 135' xx 1 I , M . I l ,A 1 N4 ' ' 'I ' A 'mtl ff-'I Y ' 1 , s . '- ,J ,3- K f C7 'Q-,'y' Hn I ! . V N Q-'Q ',: N -5- J f g . KN L55 -L 1 ' 'Q Wi- v w f,, f- ...N s 'fa 1 -45' 3w!.12: f XS., ' f YM Q . , m if I 1' 1' X'-'lf-s : Nw' Sw.-I CTL i 'r ' igiii lk , 'I N'L, P ' +1-' :mm 'If , 'W ' U 'if'1 ' gafwwfwl '94W4'f'P?5gg,79'jf'4-1 5- QU . . ',1?a! ffm 'M Q f ' i'w ' V.: . , I.. QM ' afV'Tlf?i1!, qf1l,Qm.1fffAn? ifii ffl! LQEW , ,Q .wif v My ZW' 1-5' W ag! .WN , Amis , N , U- 3534jlf'a1m:45Q , - -Y' -t .fm . 1 I Mum iA , qw- e R U S A ID if. R M - ' Q Q . . . . . 0 I , l I , I 1 l l fill l .ki .V I CJ 2' 2 l Q l ll if 4 V. lfs l ff? l 9,3 t- ,g H Y l, , CHEMISTRY CLUB ' ki The Chemistry Club was organized in l9Z2 by Mr. Massie, who is the present 1 .- , advisor. 'l'he purpose of the club is to create an interest and stncly in Chemistry. , The members visit manufacturing plants anfl stncly chemical processes. Member- 1 ship is cleterininecl by scholarship. l i f NVAYNE DoNA1.nsoN . , Prvsidvazf l l BEN XN'12IrnzRs . . l'z'z'r-Prcsiflvazz' l jixmizs Runci, . Sm'rvz'ary-T1'mxzn'c'1' C J l MR. NIASSIE ........ Sponsor 4:19 Nellie Aills, Charles liiekett, Catherine lllake, Orville linren, Sylvia Clark, Mabel Cottle, VVilbnr Crabtree, Margaret Davis, Louise lleitehel, XVayne Donald- if son, Helen lilberfielcl, Charles Franck, Harley Glass, Mary Hartman, james M, Keever, Norma Maeoniber, Norma Massie, l'anl Melvin, Sue Peebles, Aston f' Purtis, Virginia Pray, Genevieve Rainbo, james Rhiel, lilinnr Ruggles, Margaret J SCllWZl.l'l.Z,,'Xl'll1l1l' Vogel, lien XVeigers, Ruth Zoellner, Robert Zucker and Marie V Arthur. ,J ,1 ll A -is Q - X i 'V LJ rl 255 5 seigiii .K isis' l l S SY 33 li i '2 Q -3 nnuumr 51- -X-X 4 Q, it , Eiaii sg. 3 s . -l f Q i - e- ,, . EQEEIIC . -- H fin-. -we rj 5 0 1' ,. 0 1- ' 4. i l a4l,Q ',.-lill., .l, 'l'l'l1fl5fl1'l TA -T' IV! l il Fifty-nine FRENCH CLUB Kim cTI'l'filU lfnzizrzzzirj The French Club was also organized under the direction of Mrs. Kyle. Last year it was taken over by Miss Kauffman who has made a very capable leader. Its purpose is to create an interest in French and make a practical use of it. This club holcls its meetings on the first XYeclnesclay of each month. KA'r1l12luNE KE1,so ....... I'1'cxv1'flc1zt XYILIZUR CRAl5'l'Rlili . . I'irc-P1'vs1'flc1zf l,lx1frc 'l'.xx'l.oa . . .blt't'I't'llIl'VX' and TI't'lIX1!l't'l' Pmfi, HA MER . . . SFl'gl'tIllf-tif-xlVIIIS M Iss KAL'1f1fMAN ....... Sfwmol' Marie .'Xrthur, l,ouis liaker, Vernon llarton, Howard liernclt, XVilbur Crab- tree, Sylvia Clark, Louise lfleitchel, lietty lloclcls, l'aul Hamer, XYilliam Hartshoru, Mary Hazelbeck, james Keever. Katherine Kelso, Dorothy Kohley, Robert Kyle, Marianne Moore, Sue Peebles, Frances Rickey, lilinor Ruggles, Charles Schirr- man, llarriet Schuler, XYalter Stahler, Lale Taylor, Frecl Tobias, and Carl Tucker. . X i V,-.. t,f-. ssfm r sg' Sixty J' u,T,:wf:rgQ.::::1r::.-vHw.-,. .. .. -Q W A.,- n Q, - '2 t' H 1' gl A tm :Q 1,3 --W 1, if 'H ....,..,,., -...... .. -,m ,,,, ,,,.,.,, , MM-wt SPANISH CLUB This elulr was hegnn hy Mrs. Kyle, ancl, clne to her cleath, Miss Canning has taken it nnrler her supervision. The purpose of this elnh is to stimulate interest in Spanish and to make more practical use of it. The memhereship in this elnh is olmtainecl lay those who have eompletecl one semester of Spanish successfully. NORMAN V1Xl,lllJlN . . lIl'l'.Ylfil'lIf li.x'ritRx'N SIIUICM A141214 IYITU-l,l't'.YIilIt'lIf l.ot'1stc Cox . . SFt j ,lTI't'tI.S'. Miss CANNINQQ . . ..... Sfw1z.mr lflomer .'Xlhreeltt, l.onise Cox, XYayne llonalclson, Dick liowler, Lllaurle tllass, lirnele llarrigan, I,onise llaws, Nellie llolsinger, XYilhnr jones, Dorothy Kirhy, Kathryn Krall,lCn1ery Martin, Mabel Meflinnis, l.neille Motion, .lean Nonrse, .Xston l'ortis, lcla l'riee, .Xngnsta Sehirrmann, Katherine Shoemaker. llnhert Sommers, Naomi Throekmtarton, Hazel Toney, Norman Valorlin, ancl Granclville Vllehh. ' T. - 'l3'f:i40, 5 5j51f,,,,l.f'.,3,.,:1 ' 4 itm.ii,,flls..gfdh4,.,iMLil.L'..4fr,..3.4iI x.lA' 'QPR malt-1a.gL..+ , 's-,,mh'4Atw Sixty -one N F ,lik I ::, .1T....,., ,,,k, My- i -ly A oi':i's.ixsnisi-a ja- D . , A v 1l---Y-.-an--Q fvvi H ,lm '- f ' ' it . - I l r 573 2. 'Lu el P K i 'Kel Jr B n X! 55 l , lj 1 S fi ll Y i ' S Q25 Nellie Kills, Violet Briggs, .Xvonel Carr, Mabel Cottle, Qloycl Qovert, Ruth Cyfers, Rlargaret Davis, Marguerite Dehuer, .Xrthur UeV0ss, ,Xlhert lighert, Mar- tha lfrerlerick, Helen Gilbert, Mary l.ih Hall, Paul Hartley, Mary Hazleheek, Ralph Hohstetter, Margaret Kelso. Howard Larcaiup, jean Leach, Virginia Nye, Genevieve RZL111lJU,,lZl1llCS Rhiel, Frances Rickey, 'l'helma Rickey, Phyllis Russ, Rosalie Robinson, Russel Saxhy, Augusta Schirrman, Ruth Sims, Ruth Staples, Carl 'l'ucker, Paul Tlioiiipsoii, Harold XVhitlatch, Lena Xllyaut, and Alberta Yeager, .. K 1 - V l X sk SX-fir. i l Q E, g S 7-jf, S A 7 in ,li wa.-'za f Q Y K' ff-Lf'I:T 'l 'i i ' 'A-'Q'-1-4 4'-- - A Aplig ,ass-...,.,.'.,1'i...1e' ' ' ' i'ifijN - Wvi ,,f,,'f'e1'fr-f 'R if , - AA Sixty-two exC il!,i:ERnsAo1-'R ix ' T1 , - - , ss ---is--M M - -m,,,,,e W-,,,,,,,,,,,,, l asa - .. M- -m d . - . . . . . . l l 2 ll l I K i'ffs-,H 'L , V '- . 1 i l Q X .. ,l E .- 'lx . A' i K 1 l 1 t i , E 1 5 il!! in A 5, ....................... 5 .A 4 - 4 l t 417 'lv' 'lil H lf l l 1 A . ll ' ,, , l E ,' K' A , gl u l . . VI . O E1 '7 , . . , - 1.:At.iiw4.v Am.1:Mx1'f.,-Vino-'xEft',v ,,.L tiffgc.-2,'-,. ,-.,. -. Q ,tam t - l 51. 4 nr VERSE MAKERS A . A.. Ex My. hut the talents of these l'. H. S. students are varied. XYe have the very hest musicians, singers, artists. actors and even writers and poets. Miss Graham or- ' Q gamzed the Verse Makers that some ol this talent of poetry might he allowed to X , Q develop. .Xt each meeting the memlwers study poetry and then present some work I 5 of then' own. XYe are not all hlessed with such almility, hut we can appreciate and . Q enjoy the talent of others. 1 l IJAITI, HAR'1'1,14:Y . . I-,l'I'SllI'l'lIf , 5 Cl.ox'n Coviiwl' I'1'z'z'-l'1'z'sif1'c11t fy? l lklmzmm lliuamiclt . Sl'l'I'l'I'tIl'V l ' r 1 v 1 i ,IUANNIC lhmwl' .... l1'va.vz1rm' Howmtn Cllzlssorxi C'1z.s'f0zIz'r111 of Mrz11z1.vrrijvt.r rlg Miss Glmnlx A1 ........ Sf70lIA'0I' '4 5 . i . A- Lyda Anderson, lforrest llerry, Helen liradney, -loanne lirant, Mariam lire- J mer, Vernon llurkhart, floyd Covert, Oscar Dempsey, llonald lflwell, XVnnlred P' Fitch, john Glass, llarriet Gilmore, Howard Grissom, Mitchell Hager, l'aul ,J Hartley, Helen jordan, lfrances lirauze, Doris l,ee Marshall, Mildred Klulter, ,.f, Anna Grace Spenser, james Thomas, and Howard XYehh. fx 1' l , l ,ff 4, 'f l af x - gt' W . l 1 N A 5- A A x 'x I l .3 1 t I U I l r xg' QI I ,, . . I , vw... l 'w ifil ffii i f i ilif vi W ' 'f I W Sixty-three I 1 . va!,-.- 1- 1 al- in M A,.. -,- MLC., ' fxf CRUSAU1-tk '33 C ,LL L L ' L m 'L' ' ' .- - ,,. - - ' L 0 W' L ii l . 5 i i l, V 1.3 1 F Cxfg l cl l l L' l , I l : f - Q f l J, ' l X l ' 1 Q I i ii, E ' Y' 2 Y' i' ll sf . Q l I lt ' 1 V, E A. i 5 f' ir si VARSITY P i LL L This organization is made up of all the students who have won a letter and are A still in school. Membership in this organization is honorary and is automatically l , 4 bestowed on the pupil. To obtain a letter it takes either a lot of muscle or brain l l y work or both, combined with long and strenuous work. Q i I, The members are: l f Elmo Lilly, James Keever, Bill Miers, Charles Bickett, Howard Doll, John l Fugitt. Count McConnell, Murray Smith, George Harker, Pat Mitchell, Art DeVoss, Spencer Sprague, Dave VVilliams, Dick Taylor, Christine Heer, VVayne Donaldson, l l, 4 Nellie Aills, Ruth Zoellner, Carl Tucker, Dick Marting, Lyman Pyles, Glen U, , Marshall, George Reinhard, Paul Hartley, Avonell Carr, Gladys Baker, Nell Gable- 1 f' ' man, Marian Yeager, Frances Rickey, Obb Boring, Roy Gordon, joe Colvin, Charles Fugitt, Alfred Kaegles, Carlton Cubbafge, james Richardson, Don Cross, lb Pj ' Harley Glass, Martha Dixon, lvery VVheeler, Cloyd Covert, Stanley Vllhite, Louise W -1 ' Dietchel, May Lunnon, james Thomas, Mary Hazelbeck, Drusella Lykens, Ernest ly. , Covert, Harold VVl1itlatch and Late Taylor. 'Q m. l , , .5 l ltr ' , fr, , f T1 L, pl Q: 1 I 7 V N l l 1 ill N ffi Q xX ' X ' 1 ly ' l e fy ' 2 f'i My ' l ,rf-fa :lla 0 if-L 1' ' O i i u l ii nl.. ,E S l ' ' gi i!!'!5i3 ' N' ' L f f Sixty-four v ,F , 4 HI-Y CLUB lzclwzml .-Xrlzuns, Irxwng' lllumc. 4 Jlmlm limx-11, XX :lyme C lurk, C luyrl C flX'Cl'I, Iilmu zumcr. Ruy llrcsslcr, Q'l1:u'lcs l'il1Qill,.lHIll1 lfugilt, I'zmI Ilnrtlcy, Ralph llulmslcltu licvcrly Ilu1'1', RL-csc Lluyrl, RiL'l11ll'tl M:11'ti11jf, Lylllflll Pylcs, ilcrzllml Rcvjf, Russ N N Szlxlmy, Qhzlrlcs Shczm, 5lil'IlL'l'l' 5p1':1g'11c, lnswls 51111. XX1ll1:m1 Slum: I.:lIv 'lily mml Richzml 'l':Lylm'. Im 3, 'I- ' ' -' - , , -7 5 9 1 .5 g-l.4 ' P '- -:. 0 V Y'-----H . ,U :- 1 I C ' 1 -Ti, .24 . ..V I - f , ... - - - d ' 0: H5 '-eil: azz? ,J .1'lu---nuff.. 'o, J'-.. -f'F 9' -:- f 4, Og -ll . .... , ,- ' - : ...... ,,,,-, Q L 5 3 , '-1'-' - ,,- 9 :g V-- --- -Q : -:g 4 - I -. ,.-.- P -' I - -1 1 . - -- ' ij' - 4 g -5' -1 hi: .1-... , -V My : - Q i I A.-.?i 13 ' 1 ' . '- af:-..... 1 : ..': I 1- -f 4. - ,i ' - og o Q, 'IL : 'Li' .- ,,.:,' Q '- ' 5 .-.Liz-1-f 'Ii' - 'Inu ' ns , f-:S- : 'I' 11' .1-T3- .3.5 up X ...- ik- ' LL -..i-L. . ::' ...-1, 51,-ll.-.3 if-' I Sixtyilxw' . -- - Y , , Aklv b M c R U S A U ENB Ao N ,,,,,,,, -N Y-V W AVA, 'W V YV l l I I l 5 1 1 1 I l l l Q l 5 l l l S l NATIONAL I-ICNOR SOCIETY Nellie Aills, Mabel Cottle, VVilbur Crabtree, VVay11e Donaldson, Alfred , Keagles, Grace Kiefer, Charles Schirrman, Ruth Staples, Alberta Yeager, Albert , Egbert, Paul Hartley, lvery NVheeler, Cloyd Covert, Elizabeth Dunn, Richard l . , , , , I Marting, Russell baxby, Alzuue bmallwood, and Harold VVh1tlatch. l l I i l , ..Y, Q ,ar ..- .-L rg if :li .:- it ,ei ,Q l zii: 2'-15 15 5 E5 57 C -'Q T' Y ' I -E 3 A33 jg 5 ig fr-E. ' E 5 5' i s 422-i-E ' ,,,,,,h,,Q,4p,Qq,,Tf,f Y r .l. .lWlI. .l' 'l U'l1fl ' I I ' ' I7' Y I T Y fmi ffllgfijif L ffl'i C ' Sixty-six if ,....a.......... - pf CRUSAUER Q, -, c-jf, E C . . . J ,,' 0 - ki 'l T ' 'fl T DEBATE 5 This vcar P. H. S. has been blessed with two debate teams. XYC were entered I ' in the sotitlurn division of Ohio sponsored by Ohio State University. The one question that was debated was Resolved: That the jury system of trial should be ' abolished . The affirmative team that debated this question was Stanley XVhite, Louise Deitchel May Lunnon 'ind james T homas alternate. The negative team ' was Mary Hazelbeck Drusella l ykins Carl fucker 'md lirnest Covert alternate. The question that was debated in the Ohio State circle was Resolved: That the direct primarv system of nomitrltion should be abolished. These teams did not have very mam debates because of the difficulty of 'irrmqing debates with other A y schools. The affirmative team was lNellie Aills Ruth 7oellner 'md Lafe Taylor. Y The negative was Clovd Covert Tvery VVheeler 'md Paul Hartley. The debaters . who will be back next year arc: lvery Wheeler Cloyd Covert llrusella l.ykins, Lrncst Covert Mary Hazclbcck ' es Tl omas Nl' ry l unnon, and Stanley T White. Sixty-seven PEN AND BRUSH CLUB l'. H. S. boasted a fine boys' art club, so tlie girls decided that they would vie with the boys by also producing composition of beautiful art work. Under Miss K21lIff1llZl1l'S able direction many girls joined and progressed very rapidly. liven the boy have taken an interest in the work of this club so you know it niust be fine. RVTII Zoic1,1.NER ....... Pmxrizlczzt N1zi,1.11a AI1.Ls . Srrrcfary T1'va.ru1'cr Miss KAL'if1fix1AN ....... Sponsor Nellie .-Xills. Mary Louise Berndt, liinily Hush, Mary Coe, Avonell Carr, Mildred Carr, l.elXIonne Cullum, l'liillis Clark, Mary jo Drake, Madeline Doerr, Louise lleiteliel, Martha liredrick, Margaret Crizuninon, Mzirtlia Grice, Helen Gil- bert, Christine Heer, Mary l,ib Hull, Ruby hlolinson, Grace Kiefer, lXlZl1'g'Zll'Ct Kelso, Kzuberine Kelso, liurlynn Lzitlizun, ,lean Leach, Xorniu lllzieoinber, liernice lXl2l.l'llll, Virginia Nye, :'Xs'ton Portis, Virginia Pray, Sue Peebles, lfrances Rickey, Phyllis Russ, lilinor Rugless, Katherine Slioeniziker, Augusta Scliirrman, .Ianie Sinallwood, Nell Stewart, Helen Tobias, Florence NYarsaW, and Ruth Zoellner. OS 'S x R Sixty-eight - 1 ARTS CLUB The lioys' Art Club was organized under the capable guidance of Mr. l.each. They have studied art which could not he secured in their regular courses in lligh School. During many of the art exhibitions held in high school, we realized that the work of this club was not in vain. They have proved capable at all times and we are proud of them. hloux glxl.l5RECll'I' . . . lJI't'Sl.lit'lIf Suuu,Ev TIIUMPSON . Ilift'-1J1'l'.YI'll't'I7f SPENCER SPRAGVI2 . Sz'r1'vtr11'y-T1'm.v111'rl' MR. LEACII ........ Sfmzixoz' llomer .'Xllmrecht, .Iohn .Xllmrecht, lfranlq Allen, XYayne Clark, Jack Davis, Rich- ard liowler, Mitchell Hager, Ralph Micldethwaite, liordon Saunders, Russell Sax- lry, Spencer Sprague, Richard Taylor, Shirley Thompson, Stanley XN'hite, lilvay XVhitehouse, 'lohn Glass, l'aul Arthur, and Gordon lfessler. s ffl vii?--f T J ,llf T eg,f,,Vi lf Ci Sixtg-nine THE GLEE CLUBS XYe have some excellent singers-fund they can sing any song you may desire. They entertain in chapel and each year, The Boys' and Girls' Glee Club present a musical comedy. The proceeds of which are used to buy instruments for the orchestra. lidith Bellamy, Violet Briggs, Phyllis Clark, Mary Coe, Helen Costigan, LeMonne Cullum, Alice Denton, Martha Dixon, Madeline Doerr, Mariam Donald- son, Mary jo Drake, Harriet Gilmore, Martha Grice, Mary Lib Hall, Mary Hazle- beck, Christine Heer, june Hollenbeck, Mabel Kuhn, Sue Peebles, Virginia Pray, ,lanie Sinallwood, Marie Smith, Ruth Staples, june Stetzinger, Edna Sutton, Vir- ginia Tracy, Martha XYhite, 'lean Wlyney, Alberta Yeager, Ruth Zoellner. Vernon Barton, XYilbur Crabtree, Challen Daugherty, .Xrthur DeVoss, Her- nian Doll, Donald lilwell, Harley Glass ,l'aul Hainer, lfarl Halstead, XVilliam Hart- shorn, lleverly Horr, Vtfilbur Jones, Alan Jordan, lilnio l,illy, Orin Lykins, Howard Miller, XYilliam Meixner, Robert Robinson, Ylvalter Stahler, Lafe Taylor, Paul Thompson, Carl Tucker, Harold XYhitlatch, and Robert Zucker. mm... Z , 5. fl 2 is 5 M Seventy fi it W . -c lf' 11 . Gt: In qk h v Q R-ll s A 11 11: R Nj ,-Qmwwmkc A , 9 Q... ...Q 9 THE ORCHESTRA The orchestr'1h'1s 'tlwuys been '1 xery vtluwble 'tsset to the extrw curricul'tr 'ictivities of our school. Under Mr. l1nde's c'tp'tble direction this group of t'tlented llll1SlCl'1ll5l1'lS ste1dilyincre'1sed until it his secured thirty-nine members. Once each month 'ill the students of l'. l-I. S. 'ire delihhtfully entertained with 'L concert. Mr. linde pl'1ns 'L very fine concert for the public e'tch ye'u'. l his Ol',, llllZ'lll0l1 his indeed instilled 'i love 'ind 'tpprecrttion for better music in our heirts. . 'l'uls'tl3'1ssler Riclrtrd lieody llugene liiesleyy louise liutler Hurry Connor son lloan Hernrtn Doll VX uyne llonuldson hl't1nes Frostick Robert Foltz Vir 'ini'L Grit' Clnrles H't'1s V'1l Heisel .X l't llelt 'llll 't r 'Horr lI'trl lW:l1g5lLl'll'1ll lfdw' 'l N'lcC'1ll Byron Nlcfov XVilli'1ni Meixner XN'lli'un Nlicrs lhilip Miller lhillip lllitchell lldwin Moritz l'1ul lllosley Xlwlluce Murphy junes lXlCll'1l'ilS01l Wil- li'un Rogers Russell Frtxby Clrtrles Schirrnrtun Allen Slwttery H'trold Stone ean liI llK,l' Clrtrles V'1ndcrxort 'IllClSl'll1lC,5 XN'l1itc.. vvf' I P1 I lt Ai t l i Qi i, i y Q I . 3 l i U U: la Sit al l l l i , l I I C C K K C yi YC I, C C K 1 ' 4 1 ' ' , U 4 C K. L 1 X C l C L lr I K 'I .. , . ' ,'pi'1-,, ,. , . Mztrgaret Cox, Hurry Cowdrey, Ruth Cyfers, Chztllen llzuigherty, 'lack Davis, Nel- , 1 , T 1 , 1. ' , 1 , g 1 ., . pc. -, nm 1,'d.1l A Y A 1 1 l , ' , '. . , H 1 ,l. ' . , ' I 1 ' , ' L , 1 J c , s 1 , 1 , Ml ll l 1 J 'K l , r 1 - - . 5 ' X 'F IA' f1.l fl I em L 2152- ---- M f Seventy-unc W ,, THE BAND There have heen many attempts to organize a hancl for l'. H. S. The hand has lmccn clirecterl hy lllr. Schnalml this year. This organization was especially appreci- atecl at the football games. Vharlcs Vanrlervort, XVayne llonalflson, Herbert XYenclelken, Phillip Mitchell, bl. li. l rostick, Charles llaas, Nelson lloan, Allen Slattery, Vliilliam Meixner, Harry Cuwclrey, junior Hnrr, Herman Dull, blames Richarclson, XYilson Ainherg, Vvlllllllll Miers, liyron Mcfoy, XYill Rogers, Russell Saxlmy, Eclwarcl McCall, Charles Schirrniann, Challen Daugherty, .lack Davis. . u a 'vs I L 'flAA',..,tf1 I W Seventy -two V-M--M-- -' Q'U ,l,i5,g,.1,,,,, it , - .. , i Q - Q- ,1 I ' L R ' f ti k L4 -1 - Q N 9 Q Q n Q . o 1 ' ily t tl l' l W . U ,Tl i 'l :fs l ilg I 4 t Q 1' ' l l U Srl l 'QW ' N liz' ' 'L 'Q ,N , 6 0 - 1 li t t H .', 1 3 V ' - 4 2. i J Y ' 5 . 5 f . 2' ' 'f E 't 1 ' 1 x t Q gn L 4 t a ,Ein e .4 ,, - ,QL '1 5 PICKLES t i A - - . - - I I M L lic-ln'ti:1i'y Zotli is mat :t vc-ry cmiiiumi clzttvl iwitlwi' was tlit' lirilliztitt uint-i1ttt't if L, l' l'1cl4lcs VVlllCll was pix-we-i1tt'fl l clw1'11:u'y Zfltli :mtl Klztrcli lst liy tlic film- Chills :mtl .A ,X Orcltcstrzt umlci' Mr. limlc. 'l'l1c spztrlqliitg' mcluclics :mtl riutuus lmmui' vztrictl with ,, 1llySlCl'y will lcztvc ll plcztszuit 1ll4'lllHl'5' with llllllly. Vcry iiitpwssivc :tlsu was tltt 1-iitlllisiztstic trcsllitcss tlmt tlw tztlvntcil Cust Kl0llltbllSll'Illi'Cl lllftlllglltblll. C.A.1S,l, Ilnus Klztici' . , llrtmltl XYltitl:ltcli 2 l.HlllSZl, Il wztitross hlzuiic Smztllwuml Qi , Vztptztin liillski , llc'i'lw1't lxtviut' T ii r f llumslci . . Xxvlllllllll ll!ll'lSlltbl'll l - L H? I liumski , . . XX'ill1t11' -lmivs I Q l l bl. .lc-imistm .lfmcs . . . Vcrttsm liZll'lHll ' ! ! bligo, ll gypsy clticltniii l':1t1l 'l'l1m11pstm J' ' lltmft, Il gypfy girl . . . . ' . . Viulvt Ilriggs X ,4 ' .'XI'llllll' Q rt-ttmt, zm .XIllCl'lL'Zlll .Xrttst .Xrtlmr IJQX mass if x. J 1 hluiiv Ikwiitiiigtuii, :mtl .XIllCl'lCZlll lit-in-ss lI:u'1'ict tiilmurc l i 4 if 'ltlIlIlS llwiiiiiigtmi .... XYilliztm AlL'lXllCl' A ' l.zuly Vivizm llc-lzmcy .Xllwcrtzt Ycngcr I ' ,A ,tw L, M -at 4 l in , ' , K em gt l ' ,J Aw ' hulk-LL-L f i i. fi 1 M nf ' Y i i 1.5.4. Suvcuty-tllrt-u w REVELERS The Revelers Club was organized by the class ol' '22. lt has always been one of the finest and largest clubs in the school. Under the guidance of Miss Fleming the club advanced rapidly and presented some of the best plays ever given. Then this year Miss Paulsell, who is a very capable coach, Caine into our midst and the club has continued to progress. Captain Applejacku upheld the honor and fame and let us hope that this club will never die out. The Round Table group gives an opportunity to all members who wish to study stage settings, make-up, Costumes, and plays. lCI.Mo l.Il,l.Y . . IJ1'!'Sillt'1If ISERNICE lXlARTIN . I'if'v-P1'0.s'1'dc11f MARY l.oUlsI2 HERNDT . S0m'c'frz1'y Rl'Tn Zo1iLLNI2R . T1'm1xz11'm' LVLl7L7lvLViA71YAQQVAVAT A? U 4 W 5 Q P 4 - ll i , - lllllll IIIIAII A7107 1unr4vAvAmv.1n.vav.vss.vauP3ik Seventy-Your Nm l CAPTAIN APPLEIACK llll l'vln'11zu'x' IIJ :mcl ll, ilu' licvclcrs plxfsc-111ml Xlzllln-1' llzlclu-It s L npl un llc-j:u'lQ , Sm-114' ul' ll'lL' lmcsl zmctfmrs in sclmul mule part ill this p1'ml11L'Iim1 111ml 11 s lmlll il fl1':l1n:1liu :mfl llllILllClIll sllcccss. l,llSl1 . . . liulmcrt Nvwmzm l'uppy lfznin' . l lm'clu'c XYz11's:lxv Xllllnmsc' .Xpplm-julm , . XYCVIIHII l5:l1'lm1 Klrs. .Xgzltllzl XX'l1:m-mlllmc . hlzmiv SllI1lllVVHUll .Xmm Yzllcslxu . . . liluisc Nlllfllll Mrs. l'c11g:u'1l . . Axllllll llcmlcr llf:1':u'4- l'c-ugzml llv11:u'rl XYim'g1-rs lx':u1 liurulslq' , lilmn l,illy lla-111101 . licvsc' l,luycl hllilllllll' -lawn: . . liuhscll Szlxlly l'llx'. l'l'lf.S' liicllzml 'lflylm' ,luck llzlvis lll'Yt'l'lj' llurl' ,lznm-f rllllfllllllh ll0lAlNZlll llnll llzmvlrl Xlllillnlclu Slzullvy Xllllitcl Xllllllillll Klcixm-1' N xnuly ilu' 44 SEVENTH HEAVEN Un November -l zincl 5, the Senior Clziss presented Seventh llezlven in ie illlUl'illlll. ll was one ol tlie lmesl plays ever proclneerl in l'. ll. S. Cliico . . Ili:-ne . 'lilie R211 . llonl . llolmin ,Xrlette Nanci . lleczin llrisszic liloncle . Vere Clievillon Police Sergeant l,zunp Lighter Mr, Xfllllllll' Mrs. Vnlinir Mary Llo Drake . . . . . . Vernon lizirton Iiurlynn l,z1tlizun XYillizun Meixner . Carl Tucker . llonzilcl l'orrer Florence XVZITSZLW . Nellie Aills llolm Newnizin llerliert Levine lienurcl VX'eigers . Lzile Taylor George Rveinharcl , lf'rzmk lfearis . . . NYz1yne Donzilclson . . .Xllierta Yeager IVOJIEN Ruth Zoellner Margaret Kelso Seventy-six THE BRAT 1.:1s1 sc1111111 year, 11111 1:1te t11 go 111 the 11111111211 of '27, the present SC111111 C rss 11rese11te11 ll three act c11111e11y e11t1t1e11 '1'11e 11l'Zl.1.H This was ll great success 11111 111 s11re11 zz w111111erfu1 112111111161 for the Seniors that year. THE CAAIST Mrs. 1 111'1'est1-1' . 11e1' 51111, K1z11'B1i11:u1 . . Stephen, her y111111ge1' s1111 11is1111p NX':1re, her 11r11t11e1' Mrs. XY:1.1'e, his wife . .lame 1Je1'ew, :1 sl1i11s1e1' . ,-X11ge111 Sl11f'111C, ll 11e1111tz111te '1'1111s1111, the 111111Cl' . . The 111111 . . K1:1rg11t, 1lU11SC1iCCl1Cl' . 1115111111 XX'z1re's l1Il.l1g1l1Cl' SL'VCl11j'-SEVEN . 1'1:1ze1 C'111e vvCl'l1011 11?l1'1011 . 15111111 1,i11x' L111Zll'1L'S liieketl Vi1'g111i:1 1'rz1y ,xllllil 11e111le1' . Kate Kelso . Curl '11llC1iCl' 1'i1Hl'Cl1CC X'1':1rs:1w NlJ1'Il1Zl 111218510 .Xst1111 1111rtis Iilsie Benedict Sally Boyd . Miss Curtis Miss Hays Muriel . Ethel jean . Lillian . . Madge . . Twiusgjim and David Mclieuzie Homer .lolms George Boyd Austin lievius CHARM SCHOOL . Betty Dodd Nell Galmleman jauie Smallwood . Mary Coe Martha Frederick Ruby Johnson Pearl Hazlelnecker . Emily Bush . Helen Tolnias Tim . Russell Saxlmy, David Vklilliams S nty-eight Paul Tliompsou Harold VVhitlatch . Beverly Horr Art DeV0ss vm ..-i...., .lf l.7A WA mi 0 L.......- L............. e L.............. l i 4 1 I ? X . 22 I SOCK AND BUSKIN CLUB -V Mrztsqzzc' of C0l1lCdj and Iragcdy Miss Rickey 'ind Mr. I each realized that all the capable dramatists and actors in school did not have 'tn opportunity for portraying, their ability. ,lhis was especially true of the lower classinen. So there was orgtnized 'L very fine club called the Sock and Ruskin which as you know has a verx oppropriate nieaning that of comedy and traeedv. 'l he club is so large and the members have such varied ability that they 'ire orbanizecl in five groups. Mr. l each 't writer and poet of remarkable ability has the sole responsibility of training, 'ind coaching these young students. lhey have presented excellent plays in school 'md m'r5 their in- fluence always remain. HEI IIN JORDAN . Prcsz'dcuf L1 OISE Cov1:R'r . l'Yll'I'-P1'CSidL1lf l1s'roI EN1: VVIDDIC . .Si!f'l'Ffl1fl'y KINI ocK Nhat sow . . I rczixzmv' MR. LEACH . . Sfvomnr . A jifi xg! I Y IIPIWFIWFIQPIQPIQPISPI lifl' 'IQPIWFIQPI I T Y l T Seventy-nin - 1 i l. I l l' l f , 1 1 l 1 i i r 'p lf ' r 'I T k- H5313 m-1' i Slw ti :jim A O 1-Z -.4 X ' K Wi- U - 'grub p .5511 s ' Amwg 1. l , i . i. Q A I- 'K N 1 r u 3 L . s 1 , . 7 '-'ve A - - I A P4 I -V g . A ,4 f-Q ' r n v t , 5 - ' r y Vi f I ' , ,i A 3 C,X N N - -, K X A A . A 5 ' 7 I' -1 'K 1 XXX- H f- ! F51 W ' 4 F H , . ' 4 ' ,- r . fi l A F 7 1, Z .- i'f A I ' :l 2 P srl 5 lt , A l El V+-'il Al 4, . 'QAM' M' U--A iv- 15-.iQ,L3.,c 4' r f ff' r E rjfwz rg, L -'if-2' '14 Tl M N vi ,,: f , ., A cfm- LW VMKCRQSAIJ My .,, 1 F U , . Y:-Q N . h an-N JH 3 . 2 kg i r Q . W L it J L i GIRL SCOUTS i Christine Heer Illizabetli ,'NCi'llUS Mury Cole Mwrtha Dixon Mirgjuerite Goetz Mar,:j'1ret Brig' 'S Ausustw Schirrniinn Ixuth Yoellner Mwbel Kuhn fmily Q Bush XNyilcl11'e1g'uson Ixuth Putney Rein Menefee Virginiw Pr'1y Mwry c f , Dr'1l'e Miss Finney M'u'th1 Green I 'inline Grimes kite Conroy Illimhetli I eh- i nmn Ni'1l',. 11'Cf Kelso Gl'1dysH'11'rin,Qer 'l.11CiiXI'l1'j0l'5 Tillis. ' ' 1 ,mann ' 0' 'uvuurovuvn uvava ' re nt e H'f' -111Q,., iffffm '-'wi f Eighty V,-.NL V, 'L:'.,, 33.-.,:.. ::.:L::L ?.T4: 1-flea Q J 5x .frm ff' , . , , N- K rl,1Qu2,T1,'l,, 1 l-5 1. Fw ll l. 2' Ldgljt Wifi' W Q 'H A 'Q - g ' ' . ' M M T , N ' H' I''l'3'4ll l l1lPWEHWEQFLLl,91f'lpa,4'nllllli,lr11'-lil l BOY SCOUTS CTROOP 7? This troop of Hoy Scouts was organized under Mr. Leach, but is now in charge of Mr. Kegley, who is making a very capable leader. This troop has been doing things about which you have never heard. lt helped decorate the auditorium for this year's Senior chapel and it has assisted many other clubs in their work. This troop is divided into two patrols, the Lindbergh Patrol and the llilly Coat l'atrol. MR. Klcorm' .... Smut ,lla.m'r XVALTER XY12sT fzmior r'lS.S'l.Yll1'lIf S4'0Zlll7IfI.N'lt'I' ARTHUR Voczltl, . LlillfllH'I'fjll Patrol l,0r1rlvr OSCAR Dm1PsI2x' Billy Goof Patrol Lmrlcr HOWARD fQRISSUM . Senior Patrol l.m1zlcr SAM KENNvoN ...... S 'frilm rum' 7'rr'a.rzu'fr Arthur Vogel, Sam Kennyon, hlames Thomas, Roy Manuel, XYallace Murphy, lfred Thomas, Oscar Dempsey, Howard Grissom, XValter XVest, Carlous Suter, XVilliam Rogers, Mitchell Hager. and Ray Suter. f mm N Will' Q if-I I lllll gille .N T rig -Ars ' W Q Q is fer-'S -'M Q xi Jfi - . .,1, X 1' L -'- l Y- uvlg f ai. A L R , E xx T- ' 7 -M'-'f' -' '- 'haf'-f 'f' ' 'Q' 5.5, L, , ., X, 4, , , , X lm! f v T W hid rn-.,..Jft,ini-...1z'l..huu...fudh1'il,l'.1.,.mzva4.v,,, W4 liighty-one 4. a i. eff' ii -'- - o QILZK YIHY C R U s A U E R ' ,.,.. 'H' ' ,----- ' w ill ' ' ' ' 0' ' W-M-'Q ,e W 5 i y l 1 l IQ lj f. 3 , Q , l - Q l ' 5151 3 .4 1 ' i uf . ,F 1 2' l 1 if 1 , is 5 lil 4 1 T 1 r y l 5 1 ll' l i f 1 I? Q ll F i if f 3 E ANNUAL STAFF i I ' la The Annual Staff was chosen in the closing part ot our junior year. Mr. 7 i Queener, who is now a professor in Marysville College, Marysyille, Tenn., was then our faculty advisor, and he supervised the election. ln Mr. Queener's absence We A l elected Miss Horst as our sponsor. She has worked hard with us to make this AQ Q animal a good one. lj I l Remembering the highest ideals of the Crusaders of old, we have, in naming this hook The Crusader, planned to keep uppermost in your minds those ideals. Q f L. M N s. , U Y' 'es..,, ' , ' 5 a ag , ig ix ., W Z :Mi if 2 W F A I q B S' ins ' ii Q , 'I' l ! 1 l L J ? uk. ,,,e,r -- M , -ss ,,eo , , iflilb'-? ' i'fl'. e ' ' 'A - Tq f tf Eigthy-two .AAT CRUSADER in I 0 Q :FQ 65 in Il 9 1 9 Q I. ANNUAL STAFF NELLIE AILLS .....A . - . . Editor WAYNE DONALDSON, HOWARD BERNDT . . Asst. Editors PAT MITCHELL ..... Business Manager LYMAN PYLES .... Asst. Business Manager CHARLES SCHIRRMANN WILLIAM MEIXNER CHALLEN DAUGHERTY ROBERT ZUCKER . . . Asst. E l 2 VERNON BARTON, Ros VIRGINIA PRAY . AUGUSTA SCHIRRMAN RT lNLWMAN . Music Editor Circulation Manager Advertising Manager Advertising Manager . Art Editors Snap Shot Editor . Alurnni Editor l AvoNELL CARR . Girls' Athletics L' PAUL HAMER . Boys' Athletics Q RALPH HOBSTETTER . . Organizations I RUTH STAPLES . . Literary Editor MARGARET KELSO . Asst. Literary Editor ' KATHERINE KELSO . . Calendar FLORENCE WARSAW . . . . Society ELMO LILLY . . Joke Editor LAFE TAYLOR . . Drainatics RAY CARSON .... . . Accountant We are further indebted to a number of persons not on the staff whose help Q was quite invaluable in the production of the Crusader. p Mr. Bert Leach, Mr. Freeland, Mitchell Hager, Boys' Arts Club, Norma Macomber, Sue Peebles, Alberta Yeager, Aston Portis, Lena Widdig, Helen M Vllharff, Lewis Baker, and Mr. Diehl who handled the money for the production. , We also thank those who helped, if in no other way, by being prompt and co- ll' operative in having pictures taken and other little things of like nature. T ,J- V l 'T 4. ir: P J-. L A J , .vsvav avn-riFuvlirui7fiifirF ii-ifliffI'ji'l'ii'lWil'l'l!7l I!Pl'lFIll 'liipzhty-three - . -fr-x , . Q . i .' . .f.-'X f. , ,. H Y. 1 'xv '.. , ., W 1.-A . 7fh7E Jx.1,.nAu MH WWA -MBU' A vig THE ECHO The licho had its first production hy the Class ol '28, They made a great financial success of it and in this way secured funds for the .lunior-Senior. In their senior year they decided that the Echo should always he under the manage- ment ol' the junior Class. The Class of '27 has been very successful and has always edited a fine newspaperfaone that every student should want to keep as a memory of his high school days. Rtissizm, SAXBY . Editor-in-Cliicf Dixvnn VV11.1.1AMs . . Managiizg Editor PAUL THOMPSON . . Bzzdizcss Manager Miss BEL1, AND Miss PFAU ..... Spoizisors XYayne Donaldson, john Glass, Harold XVhitlatch, Howard Grissom, james Thomas, Miriam Donaldson, Stanley XYhite, liernice Martin, Kathleen Conroy. lictty Dodd, Pauline Grimes, Alberta Yeager. jean l,each, Art l7eVoss, Virginia Tracy, Irving Blume, Beverly Horr, Ivery XVheeler, Ruhy johnson, Janie Small- wood, Doris Reinfrank, Cloyd Covert, Ralph Holrstetter, Ruth Staples, Martha ' lfrcdrick. C V, 6 I7 ' K ix S ' l H nv H EECHO 4 iff g ig! -il 4Q.i mL .: 55 f i Pt I T4 x - - f - Q - 1: 252 + .. -42-'Q' 6-, : W QL W : N W sb 1+ 'f,, an :!n,...+tT,i! ZS Eigthy-four f.: 1if4EQnil.i.7il .Qf, f' ' v u b 4A,A Q16 f ci if li A rm li Iv: XY ? 5,9 -W 7 l 2 jf! girl, , I lxvvj A l l- . , it W ' l 'Nl 3 -fl ii W rl 1, l W 'l . il l il GIRLS' ATHLETIC CLUB fix. Nellie Aills, Dolly Algers, Cilzulys linker, Mary Louise liernrlt, Callierine ' lilzlke, .Xvonell Carr, Milclrecl Carr, Phyllis Clark, Mary Coe, Hazel Cole, jenn Crnll, Martha Freclriek, Nell Clalmleinzin, Helen Gillmert, Christine Heer, Grace Kiefer, Kate Kelso, lilizulmetli l.elnnz1n, Norma Maeoinlmer, Norma Mzlssie, Muri- zmne Moore, Virginia Nye, Aston l'o1'tis. Genevieve llznnlmo, Frances Rickey, Helene Seerest, and Virginia Tracy. ix 3, +, ll , lsr. , 111- Q i ,ll rl ,lk ..,,,1.,,g.imM,,1.4.ias,4,,iia.l,,4'ff,1QQ111..4LQ,:g..4 'gg 'l i fffij'ffQ'f ' f ' lfiglxty-live V TUNIOR-SENIOR BANQUET One of the most delightful affairs in our school life is the Junior-Senior Banquet. The occasion was appropriately observed, paying tribute to the latest hero, Lindbergh. From the center of the ceiling an airplane was suspended and all the decorations carried out the motif and the flight to Paris. The following menu was served to the guests who formed a merry company on this happy occasion. THE LINDBERGII LUNCH PAIL A HERO'S MAP IN A NUT SHELL AN OCEAN IN A FOG THE BRITISH TSLES GASOLINE MOBILE-B THIRTY-THREE HOUR SALAD HIs DREAM fParis at Lastj Un Verre de Vin PROGRAM MISS EMMA CRAMER . . . . . Toafstniaster Successful Aviators . . . . William M eixnei' Is This Paris? ...... Williaiii Young Things Encountered on the Way . M iss Marguerite Fleniing Other Flights ..... V erton M. Quecncr The Music was Fnrnislzcd by the Jllerrv Makers Orclicstifa Eigthy-six ft l D a N25 QQ U n ' ll 7' . AGA- CRUSADER 35. t THE PRGPHECY Like Lowell, Iim striving Parnassus to climb, With a bale full of prophecies tied together with rime. So comrades please stop by the crystal so clear, While I look for the fates of each one thru' the years. Nellie Aills will take dramatics for the stage, And as a well known actress she will be the rage. Lyman Pyles will as a dental surgeon attain, A place in life and glory in the hall of fame. lffin A 1 v ' I o il 5 5+ Gertrude Orin will then as a typist pound, And as a steno' in an office will be found. 6 Avonell Carr will be a teacher strict and stern, 1 And with her guidance pupils all will learn. ' . . . . l While Mildred Carr a business course will take, f And in an office will her future make. i Bill Meixner an architect will design many a home, q But the one he'll like best will be one all his own. ,Q H Norma Massie a house wife as neat as a pin, it Will do all her house work with plenty of vim. ' p A .i in I Charles Schirrman with music his glory will crown, J And win a high seat in the world of renown. ik, if Paul Hamer a professor of science will be, ji And will study all flowers and all bugs he will see. in My I 4 Grace Kiefer will be an interior decorator, ' And of all new designs she will be the creator. 05, ll Carl Tucker will then be admitted to the bar, H ,js And there as a lawyer he'll shine like a star. L J ,viva uveurnsrqvivlvevlvs' glvggfvvavnvavusrovnvnvnv. g Eighty-seven K -......... .. , , AGA- CRUSADER flag W Ruth Staples will take up the medicinal line, A And help all her patients regardless of time. Q Ginney Pray on journalism will start, f And her friends will all be glad of her art. Pat Mitchell will reign as an athlete supreme, In the hearts of the girls and the hearts of his team. is . l fn M . I Dorothea Wilson and Alma Lowe, LA To school each morning with their pupils will go. 1' 5 Vernon Barton a wonderful actor will be, G ,gil And all of his art work we'll be proud to see. V Cleo Payne as a manicurist in a beauty shop, Will work where the rich men and women will shop. , 3 James Keever will own a big circus, by heckg 3 'li Where his clowns will bring laughter and fun by the peck. ix' -- '4' Bob Zucker will embark on the medicinal sea: XG' At the end of his name will be placed an M. D. I Ralph Hobstetter as a banker will be safe and sound, , '1 And own a large bank that's the finest around. 5 0 n ' it Walter Ferguson at State will his M. D. attain, il ' And help all his friends that are suffering with pain. i Elinor Ruggles, I think, will be happy at last, t When she welcomes each one of her kindergarten class. il ' Bill Hartshorn as a druggist will all his friends please, 1 7 ki i And fill their prescriptions with swiftness and ease. . A i M if john Albrecht a columnist will be, sure as fate, i 'fp At his jokes all will laugh till their very sides ache. H ll ' 5 14 George Reinhard will be an athlete bold, 'nl - And with his tackles he'll knock 'em all cold. l 'f ,J 5 M, A, ' Ruth Cyfers we know will be quite a musician, ' ,N tl P And with all her talents secure recognition. .s I Ben Weigers will be a pro-golfer, y0u'll see, 4 And teach every pupil his clubs and his tee. Q 021 l' 'S' ll Alberta Yeager will sing before many crowds, li fi And all their applause will be increasingly loud. I l pit. L i J .vu1raQrnVl1ruvavlv ifjiifgf? H35u1r'iiif',iF7'fiPi3iTFii7 Ti:5?iPT17 Eighty-eight l I ff 'i ' ' 'M r-Ns' am- CRUSADER Nah, Harry Walker as usual will be a good talker, And just for that reason he'll be a floor-walker. a gl Harold Schneider will come back to us as a preacher, 'gg And I think all in all that he'll be a good teacher. aj! Donati and Kate left the lessons they carried, H A And with Phil and Tom they eloped and got married. . F . It Gus Schirrmann will hang out a big Antique sign, l l And there in her shop she will spend all her time. l l J Genevieve Rambo, who is so small and so sweet. Will reign as a queen in a merchant's home neat. i Ig Mary jo Drake who is happy and gay, l Will be a Society belle all of the day. ' I Hazel Cole will to school go away, And star on the basket ball team, so they say. I Louise Dietchel will teach or be married, ' And down life's stream she will sweetly be carried. 1 1 ' .J Helen Wharf f will work with sweet smiles, . And dress every window with smart Paris styles. , l Katherine Wear a seamstress will be, ii Making beautiful dresses for afternoon tea. Louise Haws will run a millinery shop . Where people admiring her things there will stop. l Ed. Moritz will develop a newspaper tradeg p Q By being a writer his fame will be made. B w I . ' Bob Newman will be quite an artist by name, U And with his great paintings secure lots of fame. 2, ti r it Flossie Warsaw as the heroine of plays soon will shine. 1, And her name as an actress will live thru all time. i if i ' . . . . . . i N Ap Christine Heer with her basket ball girls will use tactics. e I l H And train all her girls in the art of gymnastics. F' J N Q Ruth Zoellner as a Home Economic instructor will plan, p i i To teach her pupils all the housework she can. W il' Elmo Lilly will aim for that one word Success, ll- ,,',, ' And our wishes to him will be only the best. J., L J vi mrTQiT1FVirc'lrTim-nrnrmrl' 'jjlgjl'ira'nrl'nro'U'0'lrunrs1ru vlrav. Eighty-nine 1 46' CIC R U s lg D E R 'lah Burlynn Latham as Diane will show all her skill, 5 And her place in some other Seventh Heaven will fill. I Fx 5 . james Rhiel as a preacher will his colors unfurl, , And bring peace and comfort to all the world. nw H1 . . W Marie Arthur will marry a very rich man, l And travel thru China and all of Japan. t 5 0 Catherine Blake, a pianist, will. give music lessons, p il And teach every pupil the beats for a second. 9 A Walt Arnold, good looking, has been quite the rageg 0 E if I But I hear that he's going to--well he's engaged! ll T i C' Lewis Baker will play tennis with many a star, 3 And much of his fame will be heard near and far. , hi T i 3 Howard Berndt to Oxford most likely will be goin'g T W QB Then take a position in the Building and Loan. Q Q '9' Charles Bickett will someday go on with his tapping, 'Q' .i And while on the stage he will always be happy. Ll O 9 Paul Melvin will someday a printer be found, Q 0 I And known to people all over the town. A 0 ', a Lemonne Cullum as a bookkeeper will be quite a treat, i l ' And in her own home she will be very neat. ' l li Keith Hemphill, Charles Busch, and Harley Glass in the future so dear, Q Will all take their life work as an Electrical Engineer. I Y A Margaret Davis, Kathryn Shoemaker and Martha Grice will teach school, ' . And their pupils will study that old Golden Rule. . A 'gg Catherine Chapman is quiet as quiet can beg N if But the best telephone girl that you ever will see. W 4A V W ' Phyllis Clark as a nurse will surely be fine, 'M For she'll give without fail every pill just on time. 'V ,J ' K W ' George Carson is as bashful as a person could beg 0 M, . But he will be famous, just you wait and see. ,M ' ' Mabel Cottle is going to teach grade school, too, 'i ' I'll bet all her troubles will be very few. 65,1 . . . . ' ll Wilbur Crabtree will in a grocery be head, ' p 9, ' And know all the prices from candy to bread. ' l ' l Q, J L I J .viirovuvlvlvlvlvlvuyljgygf 'gVi'ivf'iifs'nron?aura-nFov'mrwmv. Ninety I , 4 ' V .,,,l.:..L.Ll Pi CgCRUSADER A., Helene Secrest will be married and, furthermore, l 1 Will have all her needs in her own furniture store. u Lafe Taylor will furnish many men a last home, For his business on earth will be dealing with stone. F9 Clara Zuene and Alfred Miller should both be together 'N For they stick to the farm, makes no difference the weather. A , Emma Kirsh will sell candy when the weather is damp, ii But when it is clear she'll go out seeking stamps. Marg. Kelso will ride in her Packard we hope, V il And be all bundled up in her heavy fur coat. A Edith Dopps as a jewelry collector will be, And collect all the rings and frat pins she'll see. 0 r l Wayne Donaldson will try like the chemists of old, T l And maybe succeed in turning all things to gold. l 'il Norma Macomber a dancer will be fi' 1 sl Till she marries a radio bug whom she'll see. Q2 ' L5 ' 1 Charles Fugitt, the coach of a basket ball team, f A Will someday become what he always has dreamed. l G li ll V Frank Fearis a soda fountain will run, ' Where each of his friends will have plenty of fun. ' Challen D. and Charles Franck both doctors will be, And take care of sick folks--perhaps you or me. Sylvia Clark in the Glee Club sings for old Portsmouth Highg ' In the future some day she will sing a lullaby. . Fa if' l ig' Harry Rapp will finally in politics be mixed, H J Nor will his elections be unfair or fixed. 5 W ' . 3 Sue Peebles at college by no small majority lg J Will be taken at once into some great sorority. .LM if u Ed Hunt and Lena Widdig will drift down life's river, Q jk' ,-4 N . And take all their children for rides in their flivver. Q T f-4' . V N Anna Bender will find it her pleasure and duty, . To play as Madonna because of her beauty. g J , L Ruth Taylor never will stop, nor will tarry, ' For e'er time has fled she's decided to marry. ' .4-w I. , J ...1ll1l'l'!Il'lflRPI1l'lWflilliflillifl' 'l'flF l'lflQ7lWPINPIRVINPIUPIWFIV- Ninety-one chaff 65 M I II - D i , I I Af, fji'T1. A 4,5 CRUSAQER IAQ, -K If N vw! John Smith, a brave soul, as the rest of his clan, VV ill probably wind up a drugstore man. Altho' Thelma Ashworth is quiet but smart, I think in this world she will have a fine start. Aston Portis with dancing has made a good start, And we know that she'll win a great place in each heart. Fred Tobias, I think it would be nice to mention, Will at the end of this year graduate from detention. Alfred Keagles is a popular athlete so far, And I think he'll continue to be a great star. Since there're a few that we have missed, we won't put this in verse, but wish the best of success to Helen Elberfeld, Mary Catherine Hartman, Polly McLaugh- lin, Margaret Schwartz, and Geneva Braden. And tho' among our halls of fame There are some pupils we don't name, We predict for them as good a start Since of this school they are a part. I I Polly Steahly as a poetess of such great skill, Will seek inspiration and her classmates' good will. -PAULINE STEAHLY w' 'I 0 fhma, ,, . inn?-0935 650074 , , :'r29n52E?'4s9Wf 5' , it -at--eta, za eiftlgga-A, 5 Q I I I I I I I I I I I 0 K :Inge .N QD I I I I I I I I I I I I f 031 II ' II ie ' I 'fiw I. ' Vx, J , 5 .0 VI. ' .IvIvIvIvIVIvIvInrIvF ?IfI1FI-ii'i51iiI'i,-Ti rnsrnn r I-:mv il' Ninety-two I , ,. sf ..,, '. .,f I... .ni Quang: 4 S1 Q F. i 1 e U O l ,Gy cRusApaR Xxl J I , 4 , 1 X , f ' Y g f Q vw t l 2 l q' I :L i n. ra 1 l . l il , 'lx :. l 7 fi 4 l . lla it if ui 0 i l l 3 l r . ,ly f Q 1 -I l-U 2. i l? l fi GIRLS' BASKETBALL SQUAD Q ' I fi if The Portsmouth High Girls' Basketball team has won all their games this sea- 1 i j l ,-T son, making a record of five consecutive playing seasons without a single loss. A 9 i Although there was only one letter winner left, there was suitable material to 5 , it fill the remaining five places. Our total score was 309 to our opponents' 108. wr l How's that for a score? We must not forget the courtesy and good sportsmanship l' ' of the girls of P. H. S. ' i 1 r , ' l I ' 1 ' 4 l Coach Charlotte Bell has been with the Portsmouth High School for six years. ' lv She was able to find suitable players to fill the five positions left vacant last year. llj Of course, the success of the team was due to her knowledge of basketball coaching Q i p and value of co-operation. at l iii L H' january 7 Wellston l 13 Wellstoii l nl AJ 20 VVest Union , 28 Piketon . . I lg 4. February 3 Manchester l r 5 3 1 11 VVaverly . . 75 7 l lj y is west Union 27 12 p, l, 24 Gallipolis 26 5 l gli l ' March 2 Circleville 19 18 I M 309' 108 E 1 W g ' l N l A iif ll 5 Q l Ig l ' ' l 7 ' , 'I ,fl p l l i----'fQ:-..- M .. v - ...l , --2-in A - H D V .,...4:::t,f, , l ' -2 ' 4- T a -,.i, ,., . . ff ' 2 , .2 if f Q .,. .f Q I - fi l 15-A-3 Ninety-three 4. 1 ai egg , ' gil 2 Captain-Norma Massie has been on the Varsity sextet for three A years, winning three letters. She 0 has proved herself capable of being ll l captain by the way in which she led the girls to victory. Massie will 1 be missed greatly next year. 9 if 4. A. T l 1 . 1 . ls' E ' v ' 4 1 1 31 S .fi f 4. A A Q el . 239 5 L mvwww 'L' Yi 3 nl l V, , , . ll I if . .1 1 l Marion Yeager has been on the girls' Varsity squad for two years. Q She filled the position of center re- fl , markably well, winning one letter. . i i4 This is Yeager's last year with P. X7 H H. S. Varsity squad. She was elect- . ed captain for the last semester. H e -i if 4 HT ,J U 1 0 I 4 O32 421 - I I 1 I X l I 1 5 ' J ' . 'J NIL' liflillillfiillifl' 'lvlvovnvlvlvlvnvavalrnv Ninety-four ' ' if CRUSADER f QL yu l I 8 ij? Nell Gableman has filled the posi- tion of forward on Varsity for three years and has won one letter. Nell was chief point-maker for the girls this year and great things are expected of her in the future. She belongs to the class of '29. Hazel Cole, playing the position of center guard, has been on the Varsity squad for two years, win- ning one letter. Cole filled the position of center remarkably well and has proven herself skillful. nvnvnvevavavavuvqvlvn nvlvovuwrnlruvsvavu s l I sb gf yr 1 il l ll il lil U o i l vl U . l I 5 02' l . X. I Ninety-five f i F S ' dv CRUSADER Wah A n 9 I is HQ W . l Frances Rickey, guard on the 'gl girls' Varsity squad for two years, l has won one letter. When it comes ,, to breaking up passes Rickey is , right there. She is also a member l of the class of '29. 0 Q gr I 173 l. A 0 0 Martha Dixon has been on the lassies' basketball squad for one year. She filled the vacancy left by . Cole very satisfactorily and has ll won one letter. Dixon will rep- ' resent P. H. S. again next year. 'N in L 0 is A 'N ' N S 'N 'lflif Vlifl I ,IIFIQFINFIWFIYFI lWl'l'll'l'9fl1fl!fI'lPlQVlNfl1Pl Iwi X Ninety six ..-.-.......-.Y , , l,,,,,,M ' .1 V' causlxnaie A . 9 . . . . . . 3 l ' ' ' 'I y l l E y l l., i f. aff, E a e i W jean Crull was also a sub this t 1 year for center. Although this was 5 her first year on the squad she was . right there when she was needed. 5 l Q Jean has done great things but greater things are expected of her fi' next year. She belongs to the class Z y 5 1 9 of '3O. . P 1 Q 1 ,. If n I 3 1 .r. .:.'. . 4, 1 1 4 I 1 R ll o ,' i 0 ' M ir 1 s vi oi ' ii Ii is i 4 l l. . W l i 1 , I i . fl N ,,, l i il 'lg X l , li- Lola' Prayther was a substitute ll A this year for guard. She showed -G sy , her skill in the Circleville game. 3 1 U She plays a good game and will Q represent the girls again next year. f A .1 JA -1 tl A ,V 1 ll 14 ' to ll ,1 J I 023, 5'2 l lf' I i l' , .al . tw I i f A Y f V i l wiv'-'rg ' T '1 S' E Ninety-seven in A r . Ill 414, .M S CRUSADEB A SAL ' W I a ll in g Avonell Carr as a guard on the Varsity, certainly was a wow, She, too, knew her stuff when it came to breaking up passes made by ' the-opposite team. This is Carr's last year in old P. H. S. and the team will greatly miss her. She has placed herself among the letter- . ! ll 1 f Winners of P. H. S. by winning a 1' letter this year. S if I cf I 0 Ji 0 l Gladys Baker, although this is Q ' her first year on the Varsity squad, 3 ly , was a dandy little player and a J rl A Whiz when it came to swift pass fl -4 f work. She will be with P. H. s, 'M J next year. L ig 1,1 A ls fl i lf , 9 1 A N X, A l M 1 . J . '25 fi' ll ll L U Lg Uv vgw J 'L J .vain ' ' IWPJQFIQFIHEINFIYI' 7'iii'iiii7nvlnrsvovvvnsrnvpv. Ninety-eight Q 1117 1 l A-G5 CRUSADER ' y Qu i ug , ' tiki Q9 A A . . q . 1 Lgli , A I i Fla Prayther, first substitute for 0 A forward, has been on the girls' team A 0 for one year. She has always play- 0 4 I . 0 ed a clean game and although she will not receive a letter this ear y , l she is to represent the lassies next p year. ' O .1 I 1 Q i i ,. , Q: A: l 'QI 1 l E' , I t .4 .l i . 4 'Q 9 ii 6 i 2 1 I l i . il BELL'S BELLES i Q Q Miss Bell and Bell's Five Beauties, 1, . Are feared where elre they go, i 0 .A B As basket tossers they reign suprenie, ,ii V Of the niilk of the earth, they are the creanz. 'R 4' 'M Nell, Bak, Yea , Ricke 1, Dick and Carr, li , 9 3 .i -4' Don't let their opponents very far. 'Fi A+ N o scheduled ganies lost for six years past, we li Just goes to show they are zfery fast. Q! 1 Gabe and Bake are a little forward pair, l 0 5 A When it coines to centers Yeagi' and Dick, N if The stunts they pull are put on thick. lx, 4 Where e're they go they can't go far, 4 i Without the help of Rick and Carr, ' 2 ,QM -LEWIS BAKER, '28. f ,EQ U V 1 I fl is I. 4 Ninety-nine ,fpw 1fr 2 -by-Y----V-.. T-M-- ..., N355 XS ft5f5f'5fWW575fiW'-eawff ' ,,o,v, ,w, to S -. . , . f fv W fn, xl'lNA,3li' 3-9 .N . . i...V,,, ---nA-H---, -l GIRLS' BASKETBALL MANAGERS Helene Secrest and Christine Heer were the Girls' Basketball managers this year. Their assistant was Mary Louise Bernclt, who will take over their work next year. The girls have proved themselves capable during the season and well de- CHEERLEADERS The cheerleaders who kept up our school spirit and enthusiasm during the ath- letic seasons Were: Elmo Lilly, Harry Rapp, Bill Meixner and Allen Slattery. served their letter. gi. ' sr . if 2 Ai A 5' ' P Y ' '+G' W ' Q One Hundred '53-n ii: .' -AW ef F? U S PSD E R gl ' .. , Lf 2.12: f.' W t-?Z': . HQ '- -'LQW' -1 ., AT -'iw 5' A 6334- P' 1 -Y eff l E s-,Hi . -21, it 'Qi' 251, ,, , 'Q .- . si + '4 ' , gf l Y . sf. A 1? 1. -fl v .fe ,L 5 , g fl., 'f - .. yr .83 . x. , -.11 . ,4 Q as if is 1-1. E L . , , . if l .ly ,4 4 , H97- v+ 1 H V i , E l i 1 F51 f S W l 1:53 , ,g . in 'SE i 2, 1 l i .. S 35 hs. ,lf Q2 . ffwwusf 4- 12..a4w-'. : '-w .1v-w- ...ln .f .. V .. .. ,- W l us , . iffif-Y fa- af. A' Q 2- ff . idea' ' i GIRLS' TENNIS CHAMPS 1 ll Last spring a tennis tournament for girls' doubles was held at York Park. Many exciting games were witnessed by lovers of the sports. After a week of work and hard practice, all teams were eliminated except two. N . The finals were held in May and the Galmleman-Gerlack team defeated the Baker- Moore combination 6-O and 6-2. The girls were well coached under the leadership of Miss Bell. . gg v . i . Q p f Q .Li .- 'F l , . . Q f 5 . i I I J 4 afza. . A l T I 'Y' 'Y Q Q T 'lfflllif 'liflifiiflifl T I I T I 'T One Hundred One . a 1 1 L 1 f l T, .f f ' - i ' il s f CRUSADER i q 0 .... . 'a . . - I 1 VAC- 4 V V J ', ' X e 2 , f :QP Q ' llig 0 . 1 3 ll Q o l 7 i F 2 7 I 1 il f ip sy l 1 fl li: ' U .4 l ll fl if ll m - A r' 3 E 4 Q I sl Q l 5 :,i li I I Q 4 .ll ' . ' ll 3 ' l I ' 1 E-: v Di , ' f'? ffl U. X M mi so - 'f COACH, CHARLOTTE BELL , f' I l A 5 Miss Bell has been the girls' coach for the past six years. Ii Q Our girls have not lost a single game in five years. This alone i Qi? l is sufficient to prove Miss Bell's efficiency as a basketball l coach. She has always been fair in every way toward the girls 0 A ifi i under her supervision and is loved by them all. y rj u Ag 1, , n N ' 1:u i ,- iii 5 y , U iii 5 9 1 g I , r. KX f L ,l l . v, ,L ,uv J V fe One Hundred Two 1122 A l A ll .A CRUSADER Qs, Th :Ln ll 9 i V . Tl 4 l 4 -P - J V . O O lu M 1 n L 1 I 1 ! I A ': 5' 0 L.. rl g 4. i Q H , l. I ' l ' ll E 1 l Q A COACH HOPKINS To any participant in the sport of basketball or football, the I X' A name of Hopkins means confidence, loyalty, and pep. To work J for Coach Hopkins is a pleasure accorded to a relative fewg to - ,x enjoy his confidence is the motive of his teamsg to share his l PA, ' sportsmanship is the desire of all who know him. He is the ' p source of all power to his players and a sympathetic advisor to ff all. ,' U LX, V , Wm m LL I ., . V W j K e . l1l'l1FOWfI1FliflWFlifl1flWfl l' 'lQfl1fO!fl'fl'PlWPl17l5fl!Fl1flV One Hundred Three ,C 4 A v C R U s Akopia R T Bla,- nf.. . , , g V . . . . . ' 9 I E 5 3 g l i ' a . I .Tipp Q' I 1 . E i -I 1 Us i 5 ill ' fr if l 1 iivl 1 1 7 . if THE TRACK TEAM H l Iii 4- gl E The track team last year entered four meets: a dual meet with Ironton, the Q, f Tri-State meet at Ironton, and the Southeastern Ohio District Meet at Athens. + 3 au From these the team went to the Ohio State Meet. Those participating in the meets l fm are as follows: ' fi I' -l 5 ig DEVOSS AND LEWIS . . 100 Yard Dash ' I I ART DEVOSS . . . 220 Yard Dash I y 5 JAMES RICHARDSON . . 440 Yard Dash I I , JAMES RICHARDSON . . Mile Run ll DOLL AND LEWIS . High Jump i 2, , MITCHELI. AND BICKETT . Shot-put 'vi l A BICKETT ......... Discus I if , ' . ij i The boys who came out for track have been very faithful, have worked hard, I I3 p fully earned their letters. It Seems only right that these letters should be presented on an equal basis with other letters. We hope that we may see the varsity track let- T , 43 ters presented in chapel, giving the boys on the track squad recognition comparable 4 fi to that given members of the basketball and football squads. Ii If I T ii ii gig - I .ii I 9 .4 ' i .bw A air U L , 1 rip J . I I ' is I- a I ' ivu nvivnvlvl a i g' 'lii'i?ifii5 iwri-n m i mri avl One Hundred Four VZHHCRUSADER E h. E 'Q l D O 5 . 51 1 I . I 1 4 1 O ni l 8 Els rib I qv a 0 - 9 i l I ' .1 '1 U O 0 IG' ls. l 1 l E U. sl .l O ,' 1 O 4, 1 l A l I Q ,l OUR BASKETBALL TEAM .9 5 ll u 1 l ' Portsmouth High School basketball team went through the entire season with I ' but three defeats. The first two defeats were caused by lack of practice at the first ' of the season. Had we played these games later in the season we would probably r have come through with them. The third defeat came in the middle of the season when we bowed to the strong Zanesville squad. The Nelsonville game was won by a forfeit when they used ineligible players. y E SCHEDULE WITH SCORES Q . December 16 P. H. S .... 19-Manchester . . . . 25 , X 21 P. H. s. . . 25-Columbus South . . 33 'l , 29 P. H. s. . . 30-Georgetown 1. . . 23 fl if January 7 P. H. S. . . 47-Wellston . . . 11 lil tw 13 P. H. s. . . 45-Logan .... . 12 .ul J 14 P. H. S. . . 1-Nelsonville . . . 0 15+ L 18 P. H. S. . . 44-Pittsburgh Tech. . 21 'll f 21 P. H. s. . . 36-Lima. .... . 22 fi 27 P. H. S. . . 31-Pikeville Acad. . 8 il ,A ' 28 P. H. b. . . 41-Pikeville H. S . 12 'Sl J February 3 P. H. S. . . 38-Athens . . . . 36 ' 10 P. H. S. . 15-Ironton . . 14 1 1 11 P. H. S. . 38-Jackson . . 31 17 P. H. S .... 39-Gallipolis ........ 21 ,,-5, 21 P. H. S .... 15-Zanesville . ...... 33 ' jg, H 24 P. H. S. . . 43-Pikeville Col. ...... 11 'll V-al U March 2 P. H. S .... 35-Ironton ......... 26 9 .i .i lx J TOTAL ......... 574 TOTAL ....... 375 L f A . mra'vsv-auravvcxrawrvvva ' 'lvoVnvlVsvn1rnvnvsnra. i n g One Hundred Five 'I A K c R U s A-D if: R ' Agp I HOWARD DOLL Fomvrzrd and Captain Dolly's ability to put the ball through the basket, combined with his consistent floor work, resulted in his being chosen as an All South- Eastern forward. On account of his never-give-up spirit he made a very capable leader. Doll has an- other half season with us. MURRAY SMITH Forward Muss played a fine game of ball at forward. His small size was more than offset by his ability and quickness in getting off shots for goals, He possessed a cool head under fire and always could be de- pended upon for a steady reliable game. He was chosen forward on the All South-Eastern Second team. Murray has three more years. 'sf I F ij? it i L i G fl 1' 1 N l iz li a Q, I 7 lJ l u 1 I . 4 5- K. M. ft' ll I ,A . W I J uvivavnvuvavlvivavlvn iajijvirmrnnrsvuvuvuvavav. u d ed Six 1.. Am CRUSADER ,QL nu I . I J lf 7 A I . FRANK FEARIS A l , For'wa1'd , f Y l f When Frank was needed, he was YB mi right there with the goods. Frank A ol saved several games by his timely 0 long shots. This was Frank's first year on the Varsity and we are cer- I Q tainly sorry to lose him. . 1' L l ISV in 1 1 l ., 0 9 Q Q It Ig g fl tl A I l my v I ,, l I 1 'i LoU1s BAKER l , Forward l 5 Bake was a very consistent player, li 3 staying out until he made the mark. g L u Louie has been on the squad for 4 1 four years. At the close of this ll season, he was working into the red ' J and blue defense like a veteran. Hi This is Baker's last year on the J varsity squad. i l J J' S 14' ' ff . i ,i V 4 ' l 031 ' fin . 0 I X 1 I ,X x l I. J . . - ..... . . . ' , s 'V' ' - ' W. - One Hundred Seven JOHN FUGITT Center and Guard johnny has always been counted on for some good work in basket- ballg in true form he has never failed to deliver the goods. johnny is a fellow whose ability increased with coaching. He was high scorer for the season. He was chosen guard on the All South-Eastern team. Fugitt has two more years. pg l'f 4 . , I :Ni X l CHARLES BICKETT Center and Guard Bickett was a stellar guard on the defense and jumping center on the offense. He developed into a good guard, playing hard every minute. His defensive work played an important part in many victories. We lost Charlie this year because of graduation. One Hundred Eight w f -in--Q C R U s Ang-if 25' Q, l 1 f ' ' 'N ra dl QV! Q19 A JAMES MCCONNELI. ,, A li ' Guard - l l Count was the guard with the l strength of two men. Every for- A ward 'that opposed him realized that ' o he meant business. When Count ,, started for the ball he was sure to 'U' p get it. This was his first year on ru! r the squad. He has one more year Qi to play. W' i Q fi ,L Q 5 in .' u A ff is it El Q li l W . V f M i HOMER FELTY i ll i l Guard l A Flat feet was always on duty iii W ' helping make a winning team. D Felty showed the opposing forward l that he was as good a man as the A 'U next one. Much is expected of l , gf Felty next year. 3 ,AP if A ' ln ll l J I X is Gb, Q Adio l I I i V. ll V' l 1 w 4 1 l l ,l .A r , . , - , r . . 'l ' T T One Hun 4 'l r -ff 4 4 .Mx RAU.s A D E R LQ,- nl . ALFRED KEAGLES ' I :I Guard H 'Keagles was the Hercules of the A team. Someone was sure to get y A 0 hurt when they tried to take the ball 9 from Alf. Keagles was a man of y , few words but was always on the Y job. Keagles graduates this year. 9 L j i , , gg Y 'L new 1. Y l l 1 LE ' f' .p .l K Q all 2' Q i ll is 1 1 a Qi 1 1 E! l l 'J OTTO GARDNER 5 Q Guard , 4 J Otto was the largest man on the J team. He was a consistent worker never shirking and ready to be put 'I y Q in at a moment's notice. Otto will ' l be with us next year. Ji '91 fee I fi' I VW x L - X J ! v'Qf'QflQflQ?lV'QPlQflQ7lQ?lulv One Hundred Ten l .o , ,f o ,M efu fy cRUsA1w2R xglj e,-.Q A i L . if Q 51? . gf l A F11 .. A - - Info: W., 1 l l 5 s G. . I Al l ! 5 i l 1' it Tv ? il l ,Q 1 l l : , Wk: N f. Qwyv' ' FOOTBALL SQUAD I 'S 4 I :, l uf' J l +1 tl 1 ,1 445 '4 if Eg, l a VVe had almost fifty memhers on our football squad, including the second team, under the guiding hand ot' Mr. Armstrong. By having two teams under separate coaches we were able to improve our playing this year. XVe had plenty ol material to pick from. There were several hoys on the second team that got into the hig games. Of the eight games that we played we won six. and only lost two, a fairly good record. The strong Athens team with their Perkins heat us in a good game at Athens. THE GAMES l'ortsmouth 21 - Columbus East 0 31 - Gallipolis 7 13 - New Boston 2 40 - Nllellston O 36 -- Logan 6 13 - Columhus Central 6 O - Athens H 6 - lronton 13 ingiigligie' p r Y g Y Y i M4 An. One Hundred Eleven ll! 6 , W sl., l l A All V ,51 'T' QW ' J -. b.. T. i:,.,----aP-- 1- - .MA gc R u s A D E R Mn, Q s ff PAT MITCHELL Captain Pat was our plunging fullback, the kind you read about. VVhen we needed a' few yards, Pat was depend- able to do the work. Pat graduates this year, and we expect him to do wonders in college. Good luck Pat! Pat was chosen fullback on the S. E. O. team. I 'E 12 O '1 0 .A E, I 0 0 bi ll Y ,dz It il f J, 1:,'fe.f .1 .-'Jij' ' Jw. . H HOWARD DOLL .1 Dolly was the pilot of the team if this year. This is Doll's third year A Q as varsity quarterback. Dolly has ll ' recently been voted the best athlete 14 H in school because of his versatility .A Q in sports. Dolly will be with us an- L, 3 other football season. Doll was 'J 55 chosen quarterback on the S. E. O. team. H C Q l 5 , 'fl ,I exp gifs . ll l a 1 I E, , A QA, V 3' rig L . - .. . 7L? mf ' flillifl lfff iyigqgfvirniruvournvunrawruv. One Hundred Twelve A-G CRUSADER ' 58 MURRAY SMITH Murray Smith was the only fresh- man who won a letter this year. Quite a distinction. Murray played halfback and quarter-back. jon COLVIN Colvin played end, half-back and guard. joe was the fellow that could play any where he was needed. Colvin hails from New Boston High School, where he played on their football team. 'Ii 5, -. In :WP A 'lf ll W 9 Yi at ll W 3 t it ii if l g ll 2 tai iil fl t we H t I I r lt tl ll l . iff l l QQflQfQQ,flQflQPlQflQfFFl1'I l!l'I'lI'l'U'l'lfl!Pl'lPl!VO'!fl gp A ' 1 , Q f- ' ' ,, , V-A , 3' ... if . 'Xa , . . ----' ' , v - A - Y My Q, L5 One Hundred Thirteen ,,. 1- . 43 ' V-S M.-- Y' CRUSADEB A., 1 l O T D Q Eis FE A 0 GEORGE BARKER ' Barker played guard and tackle. Barker was the hard-boiled guy on A the team. There was always a hole 0 in Barker's side of the line. Barker was guard on the S. E. O. second u 4 i 1 team. p p U J. 1 9 D p ll I ll B . 1 il l if ALFRED KEAGLES . Keagles played at guard and tackle this year. Keagles was the silent helper. .- FE' ll I .l L J Q-'J T:g f w':We ' illifliflilfl' ggurovv lvsvuvnvovanrnv One Hundred Fourteen ,.y 46 CRUSADIiZR 1' L 0 . . . .. . . . - ,,, U I FW l . l 'A n N, 0 4 i GLEN MARSHALL y u L .i Marshall played tackle this year. is gl Rusty and Patterson made a good A M pair of tackles. Both were red- y Q1 headed. 5 9 y V Y LX Ji l Q I l , l'.l ' f' 4 I f . 1 rl .4 ,-t 9 Q 0 A I 5 I. Vx , Q 1 fl ll lf 3 ' a 1 E! ! QRVILLE BOREN ia ' ' Boren played a fighting end the l ' first part of the season, but due to . 'M H' an injury, he was unable to play the , last few games of the year. ll l r ' H rj N.. . Q 'Al vi aj irq L E L3 ff' i ? i s 1 ,5 if I 5' ' ' l l l 3 , 'V'V VlV lvoVo ul Q i One Hundred Fifteen One Hundred Sixteen CHARLES FUGITT Tub played guard this last season. He made the varsity squad four years. He was a consistent worker, and earned his letter his senior year. JAMES MCCONNELL Ourflashing half- back was no other than Count McCon- nell. Count was our Red Grange when it came to getting away on end runs. jour: Fuczirr John played end. This is -Iohnny's first year on the varsity squad, hut he made his letter just the same. johnny sure- ly could pull them out of the air for a nice gain. johnny is only a Sophomore. Good foryoujohnny. lfugitt made end on the S. E. O. second team. Rox' GORDON Center and tackle were Gordon's long suit. This was his first year on the squad, too. Never- theless, he made tackle on the S. ll. U. team. He play- ed tackle on the de- fense and center on the offense. One H uudrcd Seventeen ,P-2 ' PQN.. . . , cRUsAnRR DQ- 1 A L W I - Z ,lc THE DIARY C F ,gn A ll l 2' lim going to have lots to tell you this year, as I am a Senior, and I'm sure you realize what that means. There will be dozens of parties, exciting football and basketball games, wonderful plays, bushels of freshmen-they really are necessary, tl you know, a new principal-who is a very wonderful man, by the way, and what not. just you wait, My Diary, you don't know anything, yet! in l September 7.-The first day of my last year in P. H. S.! Itls a wonderful feeling, but a rather hurty wonderful, you understand, Diary dear, don't you? ,Q Really-I never saw so many freshmen in all my life. Someone just said it is the largest class ever entering Portsmouth Hi. Oh! Who is this green looking child Q stumbling up the hall, with millions of books, ink, pencils, tablets, and a pitiful where-am-I expression on his face? Of course it's a Freshie. Perhaps I should H help him-Oh well, I was a Frosh once. I-Iere's lots of luck to the class of '31, I think they'll need it. ,. October-Diary, honey, I had the most wonderful time last night. The Seniors , -that's us-gave a big dance for everyone. The Society Entertainers furnished fl the music, and they certainly knew how-and how! We were served the most de- ll lightful little lunch, but no one was really hungry. You know how it is at a dance, ll everyone wants to dance not eat. I think you'll understand me-anyhow, when ' Home Sweet Home was played, no one was glad. 1, 1 November 3-Tonight is the dress rehearsal for Seventh Heaven. I'm not really nervous, just sort of jumpy-you wouldn't say that was nervous, now would you? Miss Horst is a wonderful coach, so I don't see how we could help making it 1 ' l i l g 1 I ,V .I One Hundred Eighteen -,,,-.3 .Mg C R U s A D E R A., . ' a huge success. I'll tell you something about the plot and then tomorrow night I'll 0 A tell you how it turned out. be Well, it all takes place in the slums of Paris. Chico , lovely, lovable, good- Q1 looking fellow, played by Vernon Barton, falls in love with Diane, Ca beautiful girl, C loved by everyone but her horrible sister Nana, who is a dope fiendj, but doesn't . I like to admit it. Chico becomes an atheist, because of three wishes he has made, U . A never getting them. One was to be street cleaner, instead of the sewer washer, as , A 1 . he was now, the second was to marry a, beautiful girl, and the third was to have . f rj enough money to ride in a taxi. CThese wishes may seem silly to you, Diary, but j - they mean an awfully lot to Chicoj. Finally, he does get his wishes, marrying - L Diane, getting the hose as he calls the street cleaner, and takes a wonderful ride in A A a taxi. . 1 ' A o o just get excited for I've got so much to tell you and I'm just bursting with ex- citement and thrills. Football games are in full swing-rah! rah! rah! Thus meet- 9 ing, all our good looking boys are on the team and Diary, dear, we are going to win 9 ii every game for Pat Mitchell is captain and oh, he's wonderful! Everyone just has it 4 fits when Pat or Count or Dolly starts down the field. Go crazy, no, no, just E Y wild! And we are going to play our old enemy, Ironton soon and oh, how we want to win! Everybody went to the game, and Diary dear, boo! hoo! hoo! we lost! E The game was wonderful and I yelled until I was hoarse and everyone in Ironton Y I thought I was crazy. We were winning until the last five minutes and oh, it was T terrible!!! I'm going to stop howling about that one game for the rest were won- M L.. derful. Oh how that team did play! That Thanksgiving game was wonclerful- Q! . and Diary, dearest, the last one we'll see as Seniors-isn't it the worst ever. , 0 When letters were given how we did cheer! Oh, they're fine and Diary, they Q - are good looking, too! !.i I O December-Say, we have the brightest juniors and they gave the cutest play! ! And we Seniors get a big feed in june-Rah! Rah! Rah! juniors! juniors! it Juniors! Art DeVoss and Betty Dodd were just fine. No wonder they' fell .in I love with each other in the play. The girls were so cute and Janie and Mary were fine, too. There is no doubt that these Juniors are doing something. They are put- ' ! I ting out the Echo', now, Diary, don't you remember that we put it out last year? 3 , It was good, too, and so is there's. , Ab Christmas Chapel-Diary dear, our chapel was such a surprise! We wanted L, something funny, but we get to do that in june and at annual booster day. J The miracle play was so sweet and pretty and Fairybelle and Olive surely can ff! dance! The Seniors just wouldn't sing-they are fo dignified, poor dears. 4' Christmas Vacation-oh joy-turkey, dances, gifts-oh it's wonderful, glorious- lr. 1, ' the best time of the year! New Year's Day-parties, etc. ' ,U !'i 'fn M School Semester Over--Oh, Diary dear, I passed, I passed! Oh, I'm so happy, 1 New freshmen, new books, change of teachers and all we seniors are in 220. I I didn't like it at first, but I'm crazy about it now. New freshies! And I've got Mr. vis Diehl and he's a good teacher-tells us the most about his experiences--a modern ' :fa N Mr. HX . He's so versatile! ll 5, U I L! u w , V w J X L I .VI1fl1F!QfIVFl'lfl1Fl1fl5f!WflQl'l' 'UWPIVIVIWVUQPIVINVINFIQPIWPIV One Hundred Nineteen I I 1 4.6, c R U s D E R iF N'li3,aL ii 73 Deary Diary, oh I'm so heart broken, I've cried, stormed, laughed and every- 0 Q thing. Kate and Tom, Donati and Phil are married. joy to them they are so 'fs . happy! , 1-if ll uw if is i Q! February.- Captain Applejacku was given by the Revelers, and what a suc- !, . cess, too. Miss Paulsel certainly does know her dramatics. Barton starred again. 4 He is a wonderful actor-in more ways than one-so I've heard, Diary honey. Now A Tn of course, this is confidential. Let's hope he doesn't get conceited. Elmo makes l the most wonderful villain, and Sarcasm Newman Qthis funny nick name that I n A call Bob is a secret I can't even tell youj was the dearest butler. You should have i. seen Eloise Martin vamp her man--but she didn't keep him long, because I got him 1 Q in the third act forever afterward. Now-this was just a play- 0 ij Basketball games started quite a while ago, but Diary, I have been so busy I I I ' couldnyt tell you all about it. They have been great! Oh, how those boys can play, 'Y and we havea great girl's team. They can pile up more points than you can p imagine. They're winning and the whole school is proud of them. O yes, indeedy. I . lj You'll see their pictures and know them all in my annual! I , 'IP 2 ll February 27.-Really, deary! not a thing happened. Things were just as 5 p natural as they could be. No one did anything outstanding. Day almost a com- Q- plete failure. I February 28.-Oh! today the most exciting thing happened. Mr. Ende gave a ' part of the musical comedy Pickles in chapel. We all like it so much, really now. 4 . QI All the girls were thinking just whom they were going to take to the Glee Club If I Dance. You know of course it is a Leap Year Dance! '3 1 l ji H February 29.-Altho' everyone knows what day this is I didn't hear so many 5 comments. Glee Club play was on. Gee, it was wonderful. They had the grandest E carnival, everyone was having such a cute time. I just know the audience wanted ,l to join them. ij, Q ' wa ,A ' March 1.-Well, Diary, I don't know what a soul did today. just think an- ' l I 4' other month has begun and soon we'll be out of school. I'm just blue about it. C Q Pickles was on again tonight. lg ,li tl 1 I' il i 'f March 2.-Basketball game-Gee! It was so exciting-We won of course I 11' just know everyone yelled themselves hoarse. Ty .1 '+,, I ' I ' A March 3.-The Glee Club dance was sure a hit. Altho' no outsiders were A' allowed in, everyone seemed to enjoy themselves. 1, it I L March 5.--As usual no one has their lessons. The teachers don't seem to be angry about it tho'. Most of them went home over the week-end, so I guess that's ' , h , ' ll :.g U W y i I ,A VW Y i yy L J vavuvaVn1ruvavnvu Ti?iEl7 :Fil-1vTii?fi'fQfEFf-nr T-iiiii-an m r nv - One Hundred Twenty v , . . - f g .. . . .:. ' s .- R. .i'.1'!?T-.eiwpll ?:a.m'i1id.2i' .. ,. . .I.,.L .tl-fzli V in 3 ,wha r rm, A ...Gm CRUSADER Win, u March 6.-Gee! nothing exciting seems to be happening. I do wish some- -' thing would happen soon. 50 . . . . March 7 .-Mr. and Mrs. Dibble, Rev. Staples, and Miss LEWIS were ln chapel QI today. I heard so many people singing- You can smile today. I do wish they'd ' come back again. li i March 8.-Nothing at all happened only school. The Boy's Basketball team ll n J l is going to Athens to play in the tournament. We just have to win. I March 9.--Mr. Williams and Mr., Miller spoke in Chapel today. Wouldn't it be too exciting for words if we have a stadium next year? The football schedule is grand. I sorta wish I could be back next year and see all the grand games! ' March 12.--Everyone is beginning to cram for test. 1 T y March 13.-The Juniors are giving a dance Friday night. A Leap Year dance, isn't that cute? l March 16.-The Dance was tonight. The Gym was decorated so cute. There 6 were shamrocks hung all around, and a lot of green paper. A . , St. Patrick's Day.-The Echo was published today, too, and it sure was cute with green printing ink. - FLORENCE WARSAW. SUE PEEBLES. 1 B y B W y U lf' lv W lj I x V .'.'.'-i'. I 1 W -I s , X ' ' ' ' l. AV' 'Kiwi 'F A '1 J ' 'A M S , l . A U . fe: Il li . n . I 1 v V. j X V V 5 J vuvavuffiifir gqiiiivnrwrmrl' ij:j l'lfl'l!'l!fl5 I-iVl'!.fl!Pl'lflTf. One Hundred Twenty-one -., ,-i3,:.L:.g. Mitzi' je 5- n A ,, rc We .4 'A . 7' VV.. iflljyr, .- 'L fG4'5iw??ffll5f5 . .yn-1zs::':'r:aaganzn: 2 ?:,3 -ei, y -, t. S L- D ,rf A - s fi, 'in,',T ...,-if E152 W6-'Ei 1- - .. 'A 'figs i i SK' E017 1 D D D 'E ,,- i?Zl'f4ll'y-To Q +:Q, aa 1 - -Y '-- : eg -.. -f-1 r s 5 D .L 222:13 -f , Q if ef- ' ' 'If -F ee 3 i1-- . WJ e , , Qs' Y Sf - - ' ,Q gf to f .....- W, , , ee- - if A D -e es f WHO'S WHO IN P. H. S. I-landsomest Senior . Harry Ylfalker Prettiest Senior . . .Xnna Render Handsomest junior . . . joe Colvin Vrettiest Junior . . . Marianne Moore Handsomest Sophomore . Harry Cowdrey 4 Prettiest Sophomore . listher Gahleman Handsomest Freshman . ...A 'Nllan Slattery Q Prettiest Freshman . . . . Dorothy Geiger Cutest Seniors . . . Hill flleixner, Marg. Kelso Cfutest Juniors . Russell Saxhy, Charlotte Gilmore Cutest Sophomores . . . Val Heisel, Polly Grimes Cutest Freshmen . . . George Doll, Fairyhelle Mayo Most Talented Persons . Vernon liurton, .-Xrthur DeVoss Best Dressed Boy . .... Dick Fowler liest Dressed Girls . . Emma Kirsh, Martha Patterson Most interesting Persons l.each, Diehl, Xlassie, Cramer U liest Dancers . . . . . Aston l'ortis, Don Porter Laziest . . Byron McCoy, Vivian XVin'throp Sweetest . . . Katherine XVear, Bob Zucker l XYittiest . . . lllartha Fredrick, Charles liickett Most 'l'rouhlesome . .... lValt. Stahler V Fattest . . . . Fd. Stahler Tallest . Bob XVolff M Quietest . Julia Rickey Prettiest Hair . . Fmily Bush 1 Naughty Eyes Mary Ruhlnian ,K Smallest Feet Bill Meixuer Sig Daintiest . Dot Gardner 5 Most Friendly . . . lien XVeigers Most Muscular .... lilmo Lilly Best Athletes . Pat lllitchell, Nell Gahleman lolliest . . . . Martha Grice f ,fl . f A - s 1 - -- , ,.,, , ,mfs .,ff's..,q:s..Q4E-.Li-1 ' '25 :JL , -,-.,...D-,,-,-..-...,c,,,,. ew, Uv, ,, A, , A , Une llunrlrerl Twentyftwo . ,Af CRUSADERF in f A 'l l M N V I C I3 J TYPES N . . th Q19 The Blonde . . Marie Crabtree A The Brunette . Pearl Hazlebaker , Red Head . Pearl Williams , ' The Coquette . . Ruby Johnson 1 The Carefree . . Edith Dopps I The Serious . . . Paul Hartley 0 A The Studious . Anna Grace Spencer A 0 The Lovable . . . . . Marguerite Graham Q The Experienced ....... Jim Keever Tillie the Toiler ...... Thelma Ashworth 9 The Chemist . . VV'ayne Donaldson and Harley Glass ,I The Undertaker ...... Cloyd Covert ' 7 The Doctor . ..... Ruth Staples 1 l ' The Lawyer . . john Smith l V The Modiste . . Fred Tobias f. The Saxophonist . . Rusty Marshall E I The General . . . Herbert LeVine I Y T The Bookkeeper . . Helen Wharf f ,, A tl, fi ll fl SONGS ' Baby Face . . Helen Elberfeld Precious . . . . Augusta Schirrman She's Got It . . . . Florence Warsaw Charmaine .... . Pearl Hazlebaker H 3 I Know My Baby Loves Me .... Edwin Hunt ' ' I Wish I Was Single Again ....... ' M, Kate Kelso, Donati Wakefield, Bob Robinson, T, l Thelma White, Herbert Hill, Helen Fall IM D My Blue Heaven .... Edith Hill, Lawrence Hill ,A ' , Changes ........ Alice Denton , I Melancholy Baby ..... Harriet Gilmore A' .J Me and My Boy Friend . Mary Lib Hall, Paul Melvin I ,J Five Foot Two, Eyes of Blue . . . Martha Peebles ' , ' There's Something Nice About Everyone, But There's I , 'A Everything Nice About You . . Betty Dodd It J Magnolia ....... . Helen Tobias 'N ' Why Did I Kiss That Girl . . . Carlton Cubbage ' I Wish I Hay My Old Gal Back Again . . Bud West A Big Bad Bill is Sweet Wm. Now . . . Bill Gammon . M Is She My Girl Friend . . . Clifford Shoemaker 5, ,l , ' -NORMA MACOMBER , 4 V W Y 'O I x I. J ,vuv:vov1vvvnvlvlvtvuvl' ilvjifovnvlvovnvnvuvuvuv. ' V One Hundred Twenty-three il!! A . ni i i I r l 7' I ' i 'r -'R - ..-64' c R U s A or-:-iz LQ P. H. S. ALUMNI REUNION AND BANQUET TUNE I O, 1 927 The 59th annualreunion of the Portsmouth High School Alumni Association was held Friday evening June lOth l927 in the gymnasium of the Portsmouth High School. The Alumni Association increased its membership by 147 when the gradu- ating class of 1927 was welcomed into the alumni as members. The long banquet tables with their streamers of red and blue, and bowls of crimson roses bade a fes- tive welcome to the new members who occupied seats at the center tables. Directly opposite was the speaker's table where .Attorney Edmund Selby Dillon, toastmaster presided, and where the Rev. Arthur N. Staples pastor of Trinity M. E. Church pronounced the invocation. ' In welcoming the class of 1927 President Dillon reminded them that their membership in the alumni association was not based on political pull, personal priv- ilege, wealth or achievement, but on their high school diploma which was their only ticket of admission. William Young, president of the class of '27 responded for the new members and pledged their loyalty and support to the association. . During the business session, the alumni secretary, Miss Ethel Musser read the minutes of the preceding year and letters from absent members: among them Mrs. ii L l l I Q Gil 5 , l l. 1 3 l ,' Florence Angle Bamber, Wm. B.'Anderson Jr., Mrs. Anna E. Pursell, Joseph L. 5, Meyer, and Margaret Daniels. ' I , The nominating committee Willard Gustin, Karl Zoellner, and Miss Violet j McFarland reported the following officers for 1928: President, James O. Troneg f First Vice-President, Charles S. Baker 3 Second Vice-President, Wm. Bierley, I E Secretary, Miss Ethel Musserg Treasurer, Wm. C. Hazlebeck. . H The executive committee for the ensuing year was named as follows: Mrs. S M Katherine Hall Altsman, Mrs. Mavis Davidson Stockham, Mrs. Ella Sherman J Duis, Mrs. Miriam Neudoerfer Ferguson, and Mrs. Katherine Ridenour. l In memoriam was given by Mrs. Helen Dowling Baughman in which an ' ' appealing tribute was paid to the dead. Those who have joined the greater Alumni ii since the last re-union are: Emma Ball, of '78, Charles Katzenbarger, Class of '79, Mary Russell Stubbons, Class of 'Sl g Charles B. Richardson, Class of '97, and Bessie Hall Titus, Class of '82, 4 I A popular feature of the program was the songs by james Wilhelm, Class of ' '26, His voice always delighted his fellow students during his four years in the 1 High School. After a few remarks by President Dillon in which he expressed his apprecia- oh tion of the service of the secretary, Miss Musser, and the treasurer Mr. Hazlebeck, ch ' ' the address of the evening was given by Hon. Henry T. Bannon. VV . ' ' L P 7 J vuvuvavavavnvnvavuvri F 2fg?Tiii-Tifi l- iu un r av avnnrav One Hundred 'Twenty-four .. 1 .t,:I.n?....A l D U fa all l . l A ----.--.- M- .Af CRUSADER 5.11, 4 -- -L -an - - Q-H H-h-Lw . , 3 Mr. Bannon's address was along the lines of citizenship, reminding the gradu- ates of their duty to public and civic interests and to the welfare of the community which offered the institutions of learning. He concluded his address with an appeal for the young people to assume the duties of citizenship eagerly, earnestly, and early. The prolonged applause which greeted the speaker at the close of the address, attested to the great interest and attention which were paid by the assemblage. After the program, the gymnasium was cleared of tables and chairs and an evening of dancing was enjoyed by those who partook of this pleasure-while others spent the evening in renewing old friendships with classmates. The program of dance music was furnished by the Merrymakers Orchestra. Copies of the famous Ralph Parlette Lecture, Shaking up and Shaking Down were found at each place, these being provided by Judge james S. Thomas. The Executive committee who so ably planned this delightful evening were: Emma S. Ball, Eleanor W. Cookes, Richard Anderson, Lynn Padan, Chas. Storch, and Lucy W. Hall. It is a noticeable fact, however, that the number of members attending the alumni reunion each year, other than the graduates, is on the decrease. This is a condition which naturally reflects in the impressions and interest of the new mem- bers. They expect to be greeted by, not only their contemporary classmates, but by the members of the classes who have graduated from Portsmouth High School long since and who are now our business and professional men and women of our city. May this be an appeal for a larger and more representative attendance of the members of the Portsmouth High School Alumni Association. airs H is 53 'gall 3 la. .gil ' ' RSF rl is ' it W? :E ': 43 li 29 .4 xy, :gi Af YAQEPEPMS a+' li I 2 P+' . V X, '21 ' . U ' A. U 1 I VW l- P A .. niro1raVavlvl1rli'rlvu1rlvl' ivgyovlvlvliriurgvivlvgv One Hundred Twenty-nve any G5 A If 1 1. 0 w 1 . - rr' H , U .Mm C R-U-S A D E R A ' I F31 ALUMNI up What a fine thing it would be if the class of 1928 should resolve to perpetuate their class organization for all time. Husbands, wives, and children might auto- A . matically become honorary members and interest in P. H. S., would increase rather fl than diminish. How splendid it would be if each member should send greetings to ' W their class reunions if they were not able to come in person. How fine if local if members would continue to be boosters for their Alma Mater in athletics, in de- 1 bates, in class plays, and in publications, sponsoring every step for progress with 0 their wise counsel and assistance. We hope for their staunch support. A 0 CLASS OF 1850 We regret the recent death of George O. Newman, who was for many years the oldest known graduate of our High School. He received his diploma in 1850, and was one of our strongest boosters. CLASS OF 1889 The class of '89 is still faithful. VVe remember this class because the Alumni of P. H. S., was organized in that year with Augustus Bing fnow a professor at Ohio State Universityj as President. Prof. Bing visited us recently and we were glad to see him. CLASS OF 1902 3 .1 4 The pioneer class in achievement is the class of 1902. This class has held a re- J union each year for the past twenty-five years. It holds the honor of giving to the L J High School its first permanent colors, the Red and Blue. The junior-Senior , Banquet was also originated by this class, and it gave the first Class Play and pub- N15 1 3 lished the first good Annual. We are justly proud of this class which up to date ' has lost but one member. I CLASS OF I 903 Next we remember the class of 1903. The motto of this class was Carpe A Diem seize the opportunity. They stood the test and the class has gone down in High School History. g ,QQ ac - . . 1 KN I. V, .I .vnvvuvivvnvnvnvlvvlvavre-vu' 'nnrgiiro-u-p pnr.-qrgqmqp, -.p,v, One Hundred Twenty-six l, .- , Q 5 p . . N . 2 .. fr ...ffi..a..1mL-iL.hmin..i ---1 .16. C R U s A D E R ' Ah 9 - . . . . . 3 CLASS OF 1905 This class has done exceedingly well. Some of its members are: Dr. Henry Wise-Successful physician of Philadelphia. Judge Stanley McCall-judge of the Juvenile Court in Portsmouth. Willis Seymour Pixley-Vice-President of Sorority Coffee Company. Walter Pick--Engineer for the Harbinson Walker Company. Dr. Walter Biggs--Successful colored dentist. Mr. Pearl Milstead-Steel man. Mr. Charles Gillilan-Big man with the Good-Year Rubber Company. J. Edson Tener-Connected with the Peerless Ice Cream and Bottling Co. Crawford Anderson-President of a large wholesale dry-goods company in Seattle Washington. Mrs. Pearl McKerrihan King-Golf and tennis expert in Cincinnati, Florida, and California. CLASS GF 1911 , There were thirty-seven students in the class of 1911 : Margaret Appel, Irma Bauer, Arthur Beumler, Harry Brandel, Laura Braunlin, Oscar Brown, Louis Brown, John Burt, Clifford Chinn, Florence Crawford, Edna Dawson, Ethel Doerr, Louise Egbert, Lydia Giesler, Carl Graf, Edna Hermann, Helen Hosz, Ar- thur Lynn, Marguerite Mahoney, Mary McGregor, Genevieve Motavon, Mary Pur- dum, Clara Rowe, Ralph Peel, Mildred Thomas, Leigh Watkins, Gilbert Waite, james Williams, Cary Williams, James Wood, Emilie Wilhelm, Charles Zull, Thomas Cuney, Robert Padan, Arthur Copeland, Beulah Eason, and Elsie Smith. CLASS OF 1918 This class has done especially well. Many of its members hold high positions and are showing the world what P. H. S., has done for them. We recently had news of a Portsmouth boy who has done very well. He is John Ross, son of Mrs. Eii A l 0 fl 49 A. S. Ross, a teacher in the Bond Street School, and a brother of Miss Ruth Ross 1,5 of this High School facul-ty. Mr. Ross has been elevated to the position of assist- in ant to the chief chemist of the Eastman Kodak Company. sl 'L CLASS or 1919 pt, lk, P. H. S., has made some very successful men and women, and one of the re- ,Q cent successes has been accomplished by Howard Lowry, who graduated from our X, High School in 1919. Mr. Lowry was elected a short time ago to the faculty of N Yale University and he will lecture on English literature upon his return from Europe, where he is gathering material for a life of Matthew Arnold, which he pro- 1 poses to write upon his return. :go li it X L WMM A i J vgvlvlvqurlvlvlvlvqvfva' 'uuiiiiiavlirllflvluruvunrnwrlar One Hundred Twenty-seven E fl I 0 O .J b S NSY nm' CRUSADER lg., CLASS OF 1 920 It seems that the class of '20 has made a very good showing. Many are mar- ried, but there are quite a few who have not taken that last leap. David Grimer is Assistant Manager of the Firestone Tire Company at Detroit, Michigang Richard Hopkins is helping P. H. S., in athletics: Howard Moritz is Director of Athletics at Shaker Heights High School in Cleveland, Ohio, and George Staten is assistant coach of Athletics at Ohio Wesleyan. Dick Anderson is with Anderson Brothers' Company. Paul Carl Bode is in the Purchasing Dept., of the Proctor and Gamble Company of Cincinnati. Dorothy Duis is a teacher of Language in the Athens High School. Helen and Lillian Matthews are still working with their music. Madeline Revare is an assistant dietician at Ford Hospital, Detroit, Michigan. Goldie Young is head nurse in the Selby Shoe Companyis Hospital at Ashland, Kentucky. Tom Crabtree is an architect in Columbus, and Alf Millard is studying along the same line. Harold Clendenen in an electrical engineer. Paul Hobstetter 1 , . i C . g ' I 8 lull l l is traveling for a large firm at Buffalo, New York. Some of the graduates of this T l class are still studying at college, two of them, Raymond Jones and William Scaggs, . -, are studying medicine. CLASS or 1921 5 . tl ' Fifty members of this class were enrolled in various colleges after graduating. + Twenty-nine of these have received degrees, two are still in Seminaries, five in 5 0 Medical School and one in Law School. Some are graduate nurses, some are estab- 5. . lished in business, some are in government work, some in the banking industry, fl ' some working in offices, and quite a feware teaching school. Thirty members of i this class are married, and this class is represented in thirteen states. CLASS OF I 922 l 5 il 1' The members of this class are quite widely scattered. Some of them are still ' A in college, among them: Spencer Schwartz, who is studying medicine. Some are 'Q J teaching school, Gertrude Hood-physical education, and Oleta Albertson-music. lg Ha This class has a good record. Q 4' y L pl A It ' CLASS OF I 923 , 4' 'Pl 'Il Many members of the class of ,23 are married 3 many others are teaching school, and quite a number are still in college. The rest of the class is employed Y locally and otherwise. One of its members, James Ray, is teaching in our High A QQ., School. Donald Jordan is well located with the H. 81 S. Pogue Company of ' gg, Cincinnati. - i. .l xp Vl1flQFUQf liflliliflifliflifl ISIINFIWFIWPIUFIWVIWVIQFIHPI 'IPIV One Hundred Twenty e ght J Z? 'LT Lg '?7'1'1. - ,-, -.... 1 . . . . , , . . I. ' ' - i . L... - - ., - . -tai 1 r l A Qi ' 5 . 'L ,rj -nl- uo, R U s A D E R ,QL CLASS or 1924 I About half of the members of this class went to college, and many of them are still studying in college and universities. Many are employed in the business life of the city, and quite a few of them are teaching school. Thirteen members of this class are married, but we are sure that this superstitious number will be increased. One member of the class of '24 has been called by death, T. J. Coe. CLASS OF 1925 This class made a fine record while in High School. Most of its members are still in college. Among them are: VVilliam Plummer, Jane and Esther Carlyle, and Persis Bannon. One of its members, Nancy Grimes is showing her ability in as 'Bit ll her work on the Dortsmouth Daily Times. T ' l CLASS OF 1926 gg Most of the members of this class are still in college, among them: James l Wilhelm, John Kah, Richard Fuller, Pauline Ruhlman, Russell Dulin, Paul Peed, Hazel Wyant, Abagail Bradford, Katherine Blazer, Margaret Roth, Mary Frances 3. Crawford, Clara Randall, Martha Gould, Jack Bridges, Donald Ruhlman, Edward ' Pursell, Nelson Lukemire, Gretchen Schirrman, Vola Cook, Louise Gims, Martha A Kennedy, and Parker Dunn., One of its members, Hilborn Lloyd has taken up dra- fi matics with the Robert Mantell Company of New York. Elizabeth Clark, one of 'V' the members of this class wastmarried recently. Others, including Mildred Dearth ' and Eugenia Warnock are employed here. Q ,. CLASS OF 1927 l El . ' This class was one of the best that ever graduated from P. H. S. Most of its , , members who went to college are making progress in their higher education. , Among them are: Elizabeth Alexander, Chester Allen, John Anglin, Louise Ang- , lin, Mary Kathryn Baker, Helen Bradshaw, .lack Bush, Jean Cissina, Richard Cun- 'M ningham, Evelyn DeVoss, Edward Doerr, William Faivre, Robert Fuller, Miriam Q' Hartlage, Carline Hazlebeck, Kathryn Heath, Ralph Herms, Robert Hopkins, Ruth L, J Hopkins, Alma Howerton, William King, Catherine Knowles, Albert Lilly, James , t McElhany, Jean MacDonnell, Vtfalter Matthes, Robert Oakes, Martha Poffen- lf' TJ berger, jane Pressler, Donald Stewart, Virginia Yeager, and William Young, who ' 'T in was the class president. Some of its members are attending business college while lp, J others fill responsible positions in the business world and are acquiring practical , training. ,l - . , gg o V ' l ,Q L J ,vtvavaVivn1rnvlvl1fQdylY fiiFijif7iirl1rl!rivu1rsVa a1Plv g One Hundred Twenty-n'ne , lg-T Yi ..-9. c R U s A D E R by bin 0 A v ,J A ' III Ulls Q QQDD 4 PSALM GF A LEAP YEAR GIRL . 3 Tell us not in idle jingle, i 15 Marriage is an idle drearng ' For the girl's dead that is single ci A And things are not what they seem. os Life is real, life is earnest, Single blessedness a fibg M an thou art, to rnan ret-urnestf' Has been spoken of the rib. , Not enjoyment, and not sorrowg . Is our destined end or way, l, But to find that each tornorrow -' 4 Brings us nearer wedding day. 1 3 0 Let us then be up and doing, With a heart on triumph set,' Still contriving, still pursuing, t 3 And each one a husband get. Q, -CARL TUCK1-:R, '28. ' 3 . 9 14, W fl we 27 'ff U Jr , I ' 3 A I H+' ' 'N ,I K. l s ,J U Q33 -dv U A. I f ' J X X Y v ,L , ummqrp, Q L' i ' l rnrgxrqggpjggqf 'rlfiFliiliEffiFEf'l1l'l!VlNl'l!Pl'lFlV. One Hundred Thirty llgnf' fa: 1 Ll 493 5 fs? viii : lr, Q I fi ,. t i ii 'fi' s it . l' ' r I LZ' ' , L ,ii i l .gY, - .Q V g---MMM-QQHM ' R U 3 H 1 W ,, 4 it t 'W' - 4ryf'f'w i'i'i' Sim f c SAI R XT - f-, C Q n . . . . I . ri i 1 1 T ll I YR All I 5 , J ii i il l Pf l ti s lr I ' 1 CUPID'S PAGE This year there has been lost zi number of nienibers from our school clue to the artful work of Cupid. He has sunk his arrows in hearts ol inztny couples. Here are the couples who have gone over to Cnpiclk side till Death do them part. 'F , i 3 Pi l 1 fig V P' L4 -. V il if ,J i if Hi is Fil l J ili, ff l , ,CL it, ,fllx ' lk H5 'T is i L Katherine Kelso ,-Xbrzuns .... Thoinzis ,Xbrzuns Donztti Wltkefielcl Riigggles . Phil Rnggles rllllffllllil XYhite Robinson Robert Robinson Clara Brown Hill . Herbert Hill Florence l,urty Long' Donald Long ii '28 ii f nn,,,,,,4 One Hundred Thirty-one I ' .M E: Rwucsvg D E R A., O 1 in W LITERARY SECTION if D9 o:ll:ll.::o l ' . GOSH! IT'S GREAT TO BE ALIVE , .s IV hen old Sol is shining brightly A And bees are buzzing 'round their hive, 1 o Everything is happiness Gosh! I t's great to be alive. Q g 1 When birds are singing happily A Throughout the live-long day, T Gee! Ain't it a grand and glorious feeling, I, Is all that I can say. 9 If When you've just jumped in the swiinining hole, w And are sizzling in the water. bg You glance upon the bank, ye gods! f There stands the far1ner's daughter. It in 6 I3 She seats herself upon the sand O And fervently you wish , That either she would turn stone-blind. I Or you would turn into a fish. , While you're meditating inurder 2 Comes the blare of a circus band, Q The daughter runs to see it, Q g I Oh Boy! ain't nature grand! xy: A 5 Fl You finally go back to the city 4' J And 'though the night life inay be gay, 'Q lv Youfll soon get tired of seeing 4' New York day by day. L N A , lj You wonder why we have a boss, I up 1 They always want to boss us, , P' But sad to relate, in this old state, ff' There's one in every office. 'N ' s When you're sleeping very peacefully, G55 And you hear the alarin clock ring, .. I And there's ice froze on the windows, N Q u Oh Death, where is thy sting? I I Jw KW J L U J h ,vlvovovavavlvlvlveqin iiifviiiflif iraxrnnrovnmrnwruv. 115 V I - One Hundred Thirty-two ' ' ' , ,' T , . 'JW -' 'ff Q. 1. ,. ,.s' 1 'el 'fl 1.65 -ff.: af. .. ffl! ' L.mR,g M- , 1.4 sri: fm:s,,.Mm1.m.mes.xm-mz-g..+ wmxglfs sz5fb:s.mf..f2h.::vmis'...a!ws.x'amk if 1 , 1 1 I Qi E rt ' ,Af fCRUSADbER , L For breakfast then your eggs are cold, You find a dish rag in your slop, Death would be pleasant, you says to yourself . And they can believe it or not. Then the waiter advances and says with a smile They satisfy and you'll sure walk a mile For just another just like it. ahem he boasted. And reason enough, because they're toasted. app , 6 It 1 Not a cough in a carload of our boneless fish 1 0 So you says to yourself, I'll order a dish G R At the very first bite I got a bone in my neck. A 0 And it tickled my tonsil with evil effect. ' I jumped in my flivver preparing to drive, ' Just think. they are owned by four out of five. n I drove down to the river to watch the boats. T Over ninety-nine percent pure 'cause all of them float. f ' As the wind came down from a northern direction 'Q' I turned up my collar for my throat's protection. i I parked my Ford beneath the trees And rubbed swollen joints with Joint-ease. 1 When you go to a first class theatre and hear, That was no lady it was-my wife, QE Oh cruel fate, alas 'tis so . Someone's taking the joy from life. y And speaking of actors that's sure a ham, In fa-ct, as the saying goes, He's the ham what ant. If you hop out of bed in the morning Singing a happy song, Q q And light on a tack or wrench your back, , g Y ou've started the whole day wrong. ' 1 , Then you gaze out the window and read this sign, ,U ' , For a ca-mel I 'd walk a mile, 1 I 1 But this dizzy ryme must stop you know .J Eventuall so why not now. ' t 3' - T PAV an J ' 'But one thing else lest we forget, . 'N J This world is ours-don't knock it. its t . If you want to die, it's easy as pie, , lust sail to Mars on a rocket. -NORMAN VALODIN it lt fa. J, I. J .vnvavnvusruvcvlv4nrov1vl' iitifjvuvtvnsrnnruvinrnnrnv. One Hundred Thirty-three ,. :fr . -ca . -'- ' fs? AQQT CRUSADQR ,Wa is TTHESTPKlECDFIlIi.S. 'B There it stands all dusty and dark, The scenes have grown dim with age. f Here an actor has danced in glee. ' . Where another has paced in rage. A The footlights have long been shattered, A J' Obie,--.T-2-.1 232222 Sgqmsiemfu 323532 NWSQZLF. SQSSES. QQ? SS ze QQQNQ. 'EQNWHSMM M91 fa 'Q 3:23 s--22.2 SSG-nm ggwngfla-if amd' mb. we-Qixm QSCQ-QQ: 33:8551- H-XQ N- 233233 mg .mp QS G isa- 3, we-gr. bl ow Dwgg E' 'Q 'C -P N o more is the fluttering heart. The audience has sought a newer place As the world is wont to do, . 4 e - But ever and ever shall I come back To the -old, away from the new. 1 It is here that I met my first success, i Where I first received the thrill Q 1 I Of seeing the expectant 'audience Q As my name came on the bill. , What matter, if it's dark and gloomy? ' .,.n I r What matter, if it's quiet and still ? I K For it holds for me my wondrous dream. li . I love it, and I always will. , . 1 f I s 3 it -BURLYN LATHAM, '28 M ill? A I g W v ' ' N if s .Q 4 I g SbKDWl 5 it ' . J The flakes of white they seem to me. I Like little ships on a big sea: f 1' 'f' Each one on his uncharted way- T sr' ' Comes floating down+-but not to stay. . I W' ,J 31 A The sun soon melts each little flake. s 4+ s 'Till 'stead of snow-is a tiny lake, I 4 These waters mirror the stars so bright, I f s ' Which twinkle in the skies at night. U NJ I F .- -DORIS LEE MARSHALL, '30. ,, ic l ' f' uv J ' L , V 4 T -, ..-,gg -,-,... P .vnu-avavovlvlvlv'lvovavl' '!Z!1E 'V l l V'W V- A Ong Hundred Thirty-four D' to rs E I I - AAI CRUSADER I A., MGLLY O'BRIAN Molly gazed in disgust at the shabby furniture in her mother's best room. The best room, but still it wouldnlt rank with any of the poorest rooms in any other house she knew. Molly had lived her nineteen years right in this dull place, with the same shab- by furnishings. She couldn't remember when they were new, sometimes she had wondered if they ever had been. lg in tb l 0 Gazing disgustedly around the room her face suddenly broke into a smile, a 0 l' very rare thing for Molly O'Brian to do. But she happened to remember what she ' was to do on the morrow. She was going to college. She had won a scholarship. She was to have the same opportunities and the same advantages as Mary Gold. Mary Gold was the daughter of the richest man in the community. Molly had A always envied her and secretly she had almost hated her on account of her wealth. p They were both to start to college the next day. As Molly stepped into the day coach the next day, she saw Mary Gold get into the Pullman. Her heart smote her as she thought of Mary's comfort and her y discomfort. p While she was occupied with her own thoughts suddenly a voice cried out right behind her, Why, Molly O'Brian, where are you going? I am so glad to see U you. May I sit beside you?,' And down beside her sat Mary Gold. ' 8 Molly looked at Mary's wonderful clothes and was secretly comparing herself with this exquisitely dressed creature. 1 I am going to college, too. I won the scholarship, answered Molly rather p proudly. I am so glad, was Mary's gracious response, I was so lonely back there in the Pullman all alone, that I decided to come into the day coach. It is so interesting in here. Don't you think so Molly P Molly looked at her a moment in utter surprise and then she answered quite ? 3 truthfully, Really I have thought it dull and uninteresting. , p Uninteresting? Never! Look at that tiny girl over there, wouldn?t you like C to be her? She seems to be enjoying herself, so much. No troubles, no cares or 'H jd worries, asked Mary, a wistful smile on her lips as she watched the little girl play il L, with her rather ragged doll. 4, Why, Mary, you with your cars, wonderful clothes, and money, haven't any 1, cares or troubles, responded Molly as she looked at Mary with her down cast face. ,N A No, indeed, Molly. I think we people have the most cares. The poorer peo- ,M , ple seem carefree and happy, never worrying about what dress to wear to this ball or , I ' ff that tea, always happy and smiling in their little homes. They seem so close to- ' gether, while we are so far apart in our great houses. Yes, just houses, not homes. Never a moment to sit and talk, never a moment to do anything but go and go and G55 go. I am so tired of it all that I could cry. You simply can not realize, Molly, how 45, dreadful unhappy I am. I long for a home like yours. Full of happiness and sun- jj ,j shine. Instead of just a house where one just eats and sleeps. ,I v 14 , V V f a Y ls i i -V ,vnvavavaspjsrlvl lvivava' 'avuvvvnvlurnvinrovnvnvuv. One Hundred Thirty-five N.. T- ' W V ' Ji :T 2: .Q ..-Ga V c R U s AgDg7E R -Ang A I Mary sighed pensively and turned her head away in order to calm herself. Molly gazed at her in wide eyed amazement. This girl who had everything was unhappy. She began to see the other side of life, wondered if she had underesti- mated her own home. This was the beginning of a life of long friendship. Molly stayed with Mary on her way to college. They were the closest of friends during their entire college career. When they returned home one could have found Mary most any time at the little brown house where Molly lived. Molly d-id not detest the shabby furnishings ' then but would not have parted with them. Sometimes she looked at Mary, who was so radiantly happy when she was at Molly's, and was glad that she had no more ' than she did. W 0 I 555: .5 ll . ,1 . x r 5 . ' -DoRo'rHY KOHLIE, '28, I5 - V 9 if y - C1152 . T 3 A 1 0 as I ' THE OLD FISHIN' HOLE Q Down to the old flshln' hole 1 'JN , llfith bait and hirkory pole. y . di Thafs 'where all the fellows go, 5 'ff To catch mrp and buffalo. . 'M lm 4.1 A, You mn hear the mud cats roll J T l As you near the fishin' hole ,' There a boy has supreme right 'f M' I To fish all day or all night. T '+f. l . li if --HOWARD STONE.. M A Y I 8 L . 42-3 .. ll In viiv . ' Viv J K L Y A 1 .vu1ruva'vn1rsvavlv13f'FiT'ff!' qi:-4v'iii5i.fjififf'3iEf?? igi-iFFnruv ' One Hundred Thirty-six I L, Y ,--111 fu . .Am CRUSADER 'Silk is THE SILENT HORSEMAN Qi iff? A man, astride a beautiful horse, appeared on the horizon. Silently he gazed . across the valley which stretched for miles and miles until it was lost in the distance. A Through the center of this beautiful valley wound a small stream, singing merrily over the pebbles and moss, the banks were lined wtih small bushes and trees. Every- ll i where was silence seeming to suit the mood of this stranger sitting so silent in his l saddle. Suddenly there was a loud clattering of hoofs and a girl astride a beautiful 0 black high spirited horse burst from the trees along the stream. She was frantically A calling for help. The man seemed immediately to spring into action. The chase lasted for almost a mile and finally the man upon catching up with her noticed that the reins were hanging down' and the girl had nothing with which to control the horse. The stranger finally succeeded in stopping the horse and the girl overcome with the frantic ride fainted as he reached her side. He carried her to the stream and bathed her face and soon she began to stir. He learned later that she was the daughter of a well-to-do farmer near by. He took her home and her father was overjoyed and very grateful to the stranger for having saved his daughter's life and offered him a job as foreman on his ranch. As the stranger was very much in need of a job and had just been wan- dering around, he was very glad of the opportunity. He hoped in a few years to be able to own a ranch of his own. So, he continued working as a foreman and gradually saved enough to purchase the ranch next to this wonderful old gentleman. During these years he fell in love T more and more with the beautiful daughter and on the day he paid for his ranch she became his bride. They were very happy and contented and were always grateful to the black horse which had been the cause of their meeting. He can be seen contentedly graz- ing in a pasture near the house. . 8 ---SERENA REYNOLDS. B t 5 's H ,li 'il 'li ii' J l . it T iii . . f' M iw' 'fl 4 . ,a, ir in . D l Q V K j If V L i J .va1rmrai7uQrinrlqppqygv-i1rlv'o' Efgyvvg i ivunrsvi iv v, One Hundred Thirty-.even it ,fn ::, ' - T-V -'- 'P ,xi ,Ms c R U s agoga R Lam THE VICTORY 1.3-' . U o va QQ: jack Davis fumbled with the buttons on his leather jacket. His mind was wan- dering back to a few moments ago when he had trodden the streets homeless and jobless. His chance had come and he must win this race today. He mounted his ' motorcycle and was shoved out into the track. !j The smell of castor oil was in the dust ladden air. Excited voices could be u heard above the roaring motors which spit and coughed around the track. ' g Now the cycles began to get into a bunch for the start. A white flag was drop- ped as they whirled under the wire. The race was on! Thundering roaring, demons of the earth slide into the curves, throwing a volley of dirt and dust on the excited crowd who pushed and jammed against the rails, an eager, impatient cheer- A ing mass. 'lf ' The last lap! Davis was in the lead. The grim lines on his face told the A 'A story of his fight as he slide into the last curve going into the home stretch. What , was this that loomed before his blurred vision? A child walked into the path of this f roaring comet. A thousand thoughts flashed across his mind. Should he let this Q child stand between him and success? Woiild he crush it in order that he might , E win? No! He would die starving rather than do that. His machine swerved into A the fence splintering the board as it crashed through. ll The excited crowd rushed through the opening which the machine had made. 'i' Tender hands lifted the rider into an ambulance where he was rushed to a hospital. On awakening he was greeted by the child's father. Although he did not win the li. race he won more than money could buy, that praise which only a father can give to a son. l 0 L ji i iD? l , .e FAREWELL Q Four years have passed since we canie A n To do our best and strive to win. n ' , Though soine are fallen by the way, 1 ' 3 The inost of us are here today: ll' l But not to stay. fl ' ul I J' . In June, our hiah school days will end it , Which ineans the parting from inany a friend ll 'lj We each will strive a different way T' A ' Hoping to reach our goal soine day- ' ht ,w And rneet soine day. is, M' We thank our teachers every one kt 1 For all the good they have done, ' ' And if we all succeed some day A cg., We hope our teachers to repay: Aa If it can be done. ' j -HELEN ELBERFELD, '28, . 1 ' gl, L J .wifivuvuvuvnvnvlvggglylf 'Lii5ifi'1?Ti?Tii'iiWiEfi'PFn'r mrrv . One Hundred Thirty-eight lf E P, S 1 I MY!-7113 I M wr! 'W 1 I Q , m v M. -:Ig CRUSABER gg - . . . . . . . . ' A LITTLE MESSAGE FROM SOUTHERN BROTHERS Dear Friend : For four years you have been looking forward to receiving your high school diploma. Graduation from high school marks an important point in the career of young men and women. It is really a turning point, for at this time important decisions are made affecting after life. You now have what we call a general education-you know something of the orthodox 'ologies' and 'osophys', but your hands have not been trained nor your mind prepared to do the things that business requires-and you will be in business, no matter what vocation you may follow. We want you to understand that, while, our school is neces- sarily limited in its field, it does a few things in a superior way -in other words, we are specialists devoting all of our time, our energies, and our material resources to the teaching of a few things in a super-excellent manner. I 1 Q lil' I 1 ll l I ,I We, are adequately prepared to give you the advantage of skill- U ful, practical, complete training for the duties of business life, which you must in the very nature of things, assume very soon. A We shall be happy to tell you more about our school. We know that a brief time spent with us will mean much to you all 71 p through the coming years. We know that your stay with us will 5 i K be pleasant as well as profitable. You will have the opportunity I ' to be- associated with a fine group of young people-as fine a Q group as can be found in any college or university-and you will ,l be under the direction of competent, earnest, sympathetic teach- Q ers, who will make your highest good their constant concern. Q, Yours very cordially, I S. C. SOUTHERN, President. ,gf . SOUTHERN BROTHERS i O C O f' Portsmouth Business University , q A' INCORPORATED 1 BEST EQUIPPED COMMERCIAL SCHOOL if IN THE SOUTH il I PORTSMOUTH, Phone 882 OHIO. I Q51 Other Schools EL , Ashland, Kentucky, Washington, D. C., and 3 ' .IU - - - . 1 Mlaml, Florida x, 1 I y i g avavenru n o n' 'avvvuvu a ' 1 svn ' n-ura. sm g Ono Hundred Thirty-ui ' 3 EEE .MA C R U s A DvE.R X Q,- GIFTS CF QUALITY . I A ? l B 1 0 DIAMONDS WATCHES SILVERWARE I Q35 W . L. W ILHELM 55 4 JEWELED oPT1c1AN t A ' 507 CHILLICOTHE STREET ml ICE CREAM ICES Quick Repair 0 SCHIRRMAN'S ' Shoe Shop Q 5 ICE CREAM It J. s. GRIMM , PARLOR 1 'Q' 1027 Gallia Street Q, I NUT BREAD TOBACCO Q il 7 ? A Did you have a local anaesthetic? , ' O 'P ll No I went to a hospital in Columbus. Q I' 5.5 ii I See the New Models I I I., jbr Economicaf 'Danspartatian ,ll A L- - A i f CHlQVROLE'I'f g . W Ilcllll-EM COMPLIMENTS OF . V H 5 . h , IT'S EASY 'ro PAY lg A Fon A CHEVROLET t Clothes 1 . . C 311 Chillicothe Street U CHEVROLET CO. E99 GIockner's Corner, Second 6. Chillicothe St ' do . A LOWERED PRICES ' 5 ff X Kr I 'E L - J J 01111111-'y A 1 'I O r a l 1 I A-55 ICRUSADER ' H 0 554 MUTUAL TIRE ' Q Wil SERVICE CO. -all Q55 c A 1. 1. A ab H DISTRIBUTORS 0 I ' OF ' A GENERAL MOTORS TRUCKS ' Ll KELLY TIRES QL RUSCO BRAKE LINING I xl Phone 588 738 Fifth Street 9 1012-14 Gallia Street ,J Phone 78 I il 'T 4 if l - M wife writes me that she is all unstrun f, what shall I do ? . ? 4 A'SeI,1d her a wiref' P l W 0 I .l fl is I PRESCRIPTION SPECIALIST . FREUND SC KING U Devoss 81 I E I I . I Donaldson ' .QQH -1 aqu- ff I .. 1,2 If E Corner Gallia and Offnelre Streets 11 41 ARCHITECTS Phone 469 I AND ENGINEERS HSAYIT WITH FLOWERS A, ' -Nl-'R++ I 4 I LYRIC THEATRE BLDG. I T H erms Floral Company U Phone 474 Portsmouth, Ohio l , lx Phone 1009 817 Sixth St. , Vlifliflfflfflifllfliflffliflifl 4 , 93' C. L I -, 2 , ' ' . . . ' Tnvu nvlvnvnxravnvn n . ' On H d d F -one f e1 - -w w e - It is safe to buy at BALDWIN'S Baldwin Pianos have been Awarded the Highest Honors in the World I . 1 -' - The Grand Prix-Paris, 1900 9 The Grand Prize-St. Louis, 1904 ' The Grand Prize-London, 1914. ll S . Igtunna The Papal Prize--Rome, 1923 7 Terms to suit the Purchaser. They are the world's best instruments, 'K H FLOYD E. STEARNES, Representative 4 I 818 Chillicothe Street Phone 2037 ' Portsmouth's Leading Piano House ' W. M. ATLAS, P. H. s., '09, Mgr. BRANDAUS l 9 fl , Book Sc Stationery Co. Y O O 1 r fi Always Pleases the Students in School ,' T Books and Supplies Specializing in Garments for the High .A L School and College Miss 304 cmllieothe street if l E15 - Joe Colvin: How about twenty dollars, Dad F + 0 Father: No, you had better keep it. You will be broke next week. l 1' MITH'S A 7 1 1 ODAS 1 1: SATISFY Gallia and john 'I gl , , PRESCRIPTIONS li S mzih J . . - it F Free Delivery to any Part of the C1ty +5 p ON GALLIA SQUARE gl P' 'H Q 1. it WN in Compliments of 1, JI ' . . . fs, ,ll Portsmouth Dzuly Tlmes -.A i 1 l W 1 Portsmouth Mornmg Sun A ,, I U ii' Portsmouth Sunday Sun and Times 'Q' 0 a l f H h X I I -qbgmn F, I One Hundred Forty-two A, 1 ,Y B , . i- I ,A I CRUSADER I Tig, ' STUDENTS OF PORTSMOUTH HIGH SCHOOL I Over half of the families of Ohio are patrons of BUILDING AND LOAN if 15. COMPANIES. This remarkable record is due to the fact that the citizens of QQ- ll H5 fd our State have been quick to realize the wonderful advanta es to be obtained 'ull is g LTN QI! in these institutions. lv? ' WE INVITE YOUR SAVINGS ACCOUNT NO MATTER HOW SMALL g A I COME IN AND GROW WITH US I WE PAY YOU , I A 670 Compounded Semi-Annually 3 ff - at The Commerczal I v . . I Buzldzng F5 Loan Company I GEORGE E. KRICKER, Secretary S. Si HALDERMAN, President Q 'Y ASSETS OVER ss,ooo,ooo.oo I Q' l U , D Lady to Rustic : Could I borrow your pen? Rustic: Ask the pigs, Ma'am. Lady: But I want you to understand that I'n'1 a lady. 0 Rustic: Tl1at's all right, n1a'a1n. They don't know the difference. A R I , WK c fl 9 5 1 I SIS Gallia STRSEIZ , 1 ,gf N ff I it ORTHOPHONIC VICTOR RECORDS f 4' VICTROLAS ir L ,J , . R. s. ROLLS I ji pl' 1' Qvtx I 'rw I, PIANOS l M SHEET Music ' 5 'Ax 4+ EVERYTHING IN MUSIC .Qs F20 I K . I., .. - One Hundred Forty-three 1 1 l I U - 'O 'T' ECL or - ,,,, or .Mm C R Us A D E 3 -has 1 5' O' O ' 1 l 1 Q ! ,1 A ' 9.-. is ll Ill X' fa EXCELSIOR QQ! E9 Stands for Style and Dependability in Men's Shoes A ' 0 Every pair has stood the acid test, the same as every one of the young men in the GRADUATION CLASS of 1928 I Put your shoulder to the wheel of business progress. Q QEXCELSIOR SHOES assure you a solid foundation. A W 1J , THE EXCELSIOR SHOE CO. i L PORTSMOUTH, OHIO ' 1. 'l .5 i 1 if 5 Miss Horst to Freshman in study hall: VV hy are you only in here on Mon- C' 1 . day, Wednesday, and Thursday ? 0 I Frosh: On Tuesday and Friday I go to Comical Chorusug otherwise termed . as the Musical Comedy Chorus. j ll , YOUR DREAMS I 1 ii Your Dreams of Wealth Can Come True 1 1 1 g i The rule is simple: Save money. For money saved is the true foundation of Q Q . wealth. The dollar you spend foolishly will eventually find Q its way into some one e1se's saving account and J HELP TO MAKE HIM RICH. M p 1 Think of that! Q 1 t L N O O 7 O 9 ii The Cltlzens Savmgs SZ Loan Ass n Co. 1, o J Assets over FIVE MILLION DOLLARS ,ja j 6'Zp per Annum paid twice a year I Why Take Less? i oil This is a Good Place for the SAVER TO SAVE ta WELLS A. HUTCHINS I ARTHUR L. HAMM LOUIS J. VETTER Q 5 President Sec'y Ass't Secretary A Q., My vb I 4 'RII I FUFIYTIFUQIISFI' iffifjuffnfnnrsvuvavnvamrlv. One Hundred Forty-four -if ,A A CRUSADER - WILLIAMS BROS TIRE CO SERVICE WITH A SMILE PHONE 2450 Corner Sixth and Gay Sts. Select your Druggist as carefully as you do your Doctor CONFIDENCE In Our Ability Has Gradually Increased Our Business DRUGS 6N nuss f Formerly Red Cros' Pharmacy . !il' . F' A. o v 1 4 , F 9 fl Za L5 A A 9-, . ff' p. f l I L ll 1 gr Q on n X fl 9 I 1 S I2 ,I lil X 1 5 ,I Q I-Ii: VVhat do you mean telling Dot I'm El fool ? f O A Harry: I'm sorry-I cliclnlt know it was a secret. I f Ps P 1 l L ' 9 3 , 1 l Q P1 N L' W J LL rf lr, ' lr. 4 ' . X A 7 . J fi 1 l u I U J X L J Comphments Of the Phone 997 Credit Clothiers HIGH SCHOOL 9 atpf g LUNCH ROOM THE MODERN METHOD STORE 212 Chillicothe St. Portsmouth Ohio C1 DP Z CJ I-4 U II! Ci C1 U1 KODAKS SVCIOS 'H C v-4 F' C11 V9 C3 O O U ffl C1 v-4 C3 TP PU U1 iWur5!er 5 HART SCHAFFNER 8: MARX CLOTHES L ,uluulmmrujlnnc ,- I I :zu SICHIL IIZIJTHE STREET VI'll'l1FlWfl'.Fl1fllPl1FlifI1fI1fl 4 -- -Y 'A 1 ffm ' ' -...-nW WY..-YA '-12' IHPIQVIVIWFIWPIQPIFVIYFIRFIWPI One Hundred F tj-l Qi i f M S ..., T . GOMPLIMENTS OF T fa 6 . ab iw The Portsmouth O11 Company ' We ' ggy e Li , I A T DISTRIBUTORS OF , I ' 1 fi SHELL GASOLINE, TEXACO, QUAKER STATE uf I I 3 AND SHELL MOTOR OILS U ,g,. rr! , 'Yi nt: v ' T 1 , 5 i f 0 Q ' 1 Queen: 'Charles the baby has the Stomachachef' YQ King: Page the Secretary of Interior. L W ,5 .Q 1 E I! ! i 1, I1 I. ! ,. ,. ., g 4 il ,4 Lg 1- ii 2 K1 :W Q gl Tv ' Always Ask for L1 4 Q H 5 ' ' 45 P I , T f ICE R ' r Y ' ' CREAM if 0' . pb PM The Ice Cream 8'Bott11ng Co. Preaominms in Sales and in Quality ' pi i PI-DONE 315 TENT!-I s'r. AT ormmu: Riu E' E L U 3 ' fs: M U . ,S xx 5 E L -' ' .l!FlWl?l L!P-L' Tjgggvv n avuvn ' awramrvsz One H 1 d F ty-six l A CTRTJ-S-A D EE T ' Zak y I THE STANDARD SUPPLY CO. 1 1021-1023 Gallia Street U V . . ll WHOLESALE SUPPLIES y I FOR A .1 , 1' PLUMBING, HEATING, ELECTRICITY, MILL, FACTORY 1 0 f. . i 1 4 1 H X 1 0 I A 1- AND CONTRACTORS ' 1 1 1 ' I A 1 A I I1 I 5 ' - February ZZ-Paul Melvin and IfVillian1 Hartshorn taken into custody in the y O 5 city of Chillicothe, for the murder on an Indiana deputy sheriff. 5 Q . Z3 fl s A 0 T! :I OUR GREATEST ASSET IS THE CONFIDENCE OF THE I Q PEOPLE IN PORTSMOUTH FOR SIXTY YEARS AND A GOOD n - PLACE TO TRADE, I . F M J' Q ll- I ' ,I y 4, If THE ANDERSON BROS. CO. +1 4 CHILLICOTHE STREET AT THIRD ' I 1 ll , 1 , I ' V J U K A A I , pq-.nrt 'S evovevavg e svu' 'u n nvn nvuvuvovnvnnra OHddF- Zi Ace, c Rau-sua D E R '35, t ALWAYS USE Indian Gasoline U fs WJ! .L Havoline Oils and Greases ' I .. 'J 1 r li ll A Q Fill at any Indian Station . ' Q Try INDIAN RED---The superior Fuel l l I Qi .. lu' 131 V.. l il Flossie: Why do apples grow around the Great Lakes ? Elmo: 'KI don't know. Q Flossiez t'Cause they have apple trees there. 3 xl s i , G 1 Go od W ll! No Money Con Buy It H? ' 5 A, v A Q ,i ni - One of the greatest assets this Institution has, - A 15 ' you will look for in vain in our statements. 5 M L, We, call it good-will. It is the friendship, respect, J and trust of the people of this community. V gr 2 Good-will can't be bought. It must be earned. V : if A, ' ' And once earned, it is priceless. ' ip ff' 'S .t i The Royal Sofozngs 35 Loan Co. ll l . ll -A 0 Gallia Street, on the Square PORTSMOUTH, OHIO I 1 nw V l vw p J x If J vniravavsvsvavlvlvev-lvl' 'jiiifbrmriirasrnnrnrmrmrnv. V One Hundred Fo ty- 'ght -win ,Ax- U l C U DER U J A. - g COMPLIMENTS OF A l 'l THE AMERICAN ' 0 BUILDING St LOAN 0 l l 0 I ASSOCIATIQN I O Q2 , What's the matter little boy? -'5 Mafs gone and drowned all the kittens. - Dear Me! That's too bad. ' k Yep, she-boo-hoo-promised me I could do it. 5: 3 nl ll 5 - w Quality Ice Cream For Social Functions The I-Iibbs Hardware Co. S W9 3 l QE? l l vm. 'M R ach Ba eball Goods, Mansfield Aut E J T es 69 T bes, General Hardware J 1-I 11, B Id s' H dware +R My Pa t Olls, Stains and Va n'sh E ' lu , C9 l M- N 4 'N CM SAVE THE DIFFERENCE pure M,'1k Company ' 1. J lll'll'l1llifl1Fl1fl1Fl'FlFlfl'lIl1fl' 'lWfl1fI'ifl1f 1fl17I!7l1fl!Pl!PlV. i O'1e H I l I' -nine V ! :ir l y it 4- H I i 1 I 9 , M C R133 A bfl-R xti' I f, F 1 Ji E 5 X N I I - . W I ' I Bufli Klfelof Czompan i Coll e Annual vavevr K Lovlfv L L KLN KY 'V JA 0 1 fi . I . 1 J 'i' 1' E g ,1..... .,.., .. 5 4 5 knwnas- in ,x Q X L ' S li 2 9, 2 1 5 , l u i ! ll I . -3 3 l ' 1 me knientgenf ' 4 , ofexiaerf 1 if E., makes P Service CIOULL, I N A' f alualmle I .H ff E FH X 5 l ' kr Hi M ! 1 1 3 1 -' Q 5 I ! 1 ' I 3 2 wi f if ri'-,S ' ,fp W T W F Am I .. q i'ffif'ffA7 f T Qf' -f ff Q ' 'V'V V'V'V'V- O H d d F'fty U ,J 'i Ri ng A I 1 l ,Yi l L, o l 0 zu. 6 3 ll C J, 4 f' lx M, u '21 ll gl I VW A .Mag C RUS A D 14. R Th... GHIO TIRF SERVICE PHONE567 Tires Tubes EXPERT VULCANIZING CAR WASHING GALLIA AND OFFNERE STREETS ONE BLOCK SOUTH OF UNDERGROUND CROSSING CIGARETTES CIGARS EASY The New Wonder Washer CONFECTIONERY Ninth and Waller Streets 1003 Gallia Street CANDIES SUNDAES The Clarke Lilly CO Edith Doppsz flluring Rev. HOW itons talk in ch Lpelj Dont you think he's cute P The Western and Southern Life Insurance Company 18-22 Kricker Bldg. Portsmouth, Ohio We issue Policies which pay the following: A monthly income for wife and children. A retirement income commencing at age of sixty or sixty-five. A life income if totally disabled by accident or disease. A trust fund to guarantee children's educa- tion. A special policy to pay your mortga e. Business Insurance-partnership or corpora- tion. Insurance to meet inheritance taxes. Vlil' IQFINPOWPIWPIQFIWPISFIHFI I IVV! IVIWVI IWFIFVIWFI One Huml Cf 1' f K A 7 ' i7 46, c R U s A D E R lla, - l n Q n The Samuel Horchow Co. I. ' For Over 30 Years Portsmouth s Most Dependable Retailers of BETTER HOME FURNISHINGS 842-44 GALLIA STREET I 4 'Bin is l H fr r 4 I U Q 15 0 A T l I A 4 ' Ll s , lb 'JN L. T 4 M. . 1 4. L if n 4 ' Vw X U ,5 PHONE 2630 of. H. F. Glam K, . . , . ji S Cafeteria Drugless Physician : Mechano Theropist F HOME COOKED FOOD AND E' PASTRY OUR SPECIALTY Licensed Chiropractor L 913 Gallia St. Phdne 215 PORTSMOUTH, OHIO 726 ist National Bank Bldg. KE , Q Customer: 'lYou can't fool me. Do you think live bought groceries here for 1 fifteen years for nothing F 3 Wilbiir Crabtree: I shouldn't be surprised. I 6 PORTSMOUTH'S LEADING THE QI-HQ STATE I ' CLOTHING STORE - Q , Life Insurance Co. li Q Catering to the Clothing Wants of ,al Men and Boys jj Will Serve You Well i' .4 .4 HALL BROS. 44' . CONRAD ROTH CARL ROTH .1 Manager Gen. Agent A' 831 and 833 Gallia Street ' U Opposite Columbia Theatre C55 Portsmouth, Ohio 51 First National Bank II Q I vg' L .vmraurmrnwrmrmrl-nrirfifa gf :Fir-irlTifj5iFFiTifi7s-m rs One I-Iundre 17117, d Fifty-two .,,, . I 2. T- . A .Am CRUSADER IIA. I I l T. S. he lu ,ij ! O Smart F ayhzom ' A FOR THE ' . HIGH SCHOOL STUDENT 1 ' I MAR II GIS I ' I I QUALITY SERVICE VALUE I L I Flossie W.: I dOn't kiss men. A I Harry R.: That's all right, I'm only a boy. I is . E I YOUR GREATEST , PUBLIC SERVANT I 3 IIIIlllllfllllllllllllllllllllllllllllllllllllllllllllllllll I Q COMPLIMENTS I ELECTRICITY ii, OF THE J PLAY I I l'i'l I QL A HOUSE 7710 OHIO POWER Ca- WTI ' lllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII ' IN 733 FOURTH ST. PHONE 3160 I T UBRIGHTEST SPOT IN TOWN ll I IQ I I iv I I .1fl lQFlQfl'PI'!flqFl1fl'5fl1fI1fl 'l5'lQflYfl1flQfl1flQfl l!'l!'lV. O Il :fr :l l7'f . ' as C 5 , The Portsmouth Ti f, Paint Company , . If G. c. 1-1oovER, President L4. , 4 Distributors for the Dean 81. Barry Co. QQV1 High Grade Paint Products ill I 920 Gallia Street Phone 390-X 1 l 1 McCurdy 8: Seat ,. , ' FUNERAL HOME .1 'fl AMBULANCE SERVICE I LADY ASSISTANT I A Phone 37 1718 Twelfth St ARLINGTON ADDITION ON SCIOTO TRAIL Offers the best Homes for the least Money Ask us why and let us prove it CHAS C HORR Kricker Bldg. Phones 605-682 . W. . Wood: Lilly I was glad to see you in church Sunday. I illy: C with recollection of a headache Oh was that where I was? I 5 Henry Roth v Sportlng Goods j Qff fy, . 1 825 Sixth Street I PORTSMOUTH OHIO The Mutual Llfe Insurance Company of New York The Oldest Legal Reserve Life the Lar est Standard Co. in the World will protect you fully through your college years. Monthly income double ln- demnity and waiver of premium at all ages over 14W years. - business too large or oo small for our best attention. . LEACH Distrxct Mgr. 226 First National Bank Bldg. Phon e 435 I T l!llQfl9Fl9fl Flflifliflifl . ,H ' a 1 O I l 4 lWfl17lW.fl17lQfl'l'l!7lNFl1Fl'lflV l 1 2 l ' . ll 1 I! ! 1 ix El I 0 ' , 1 1 . l 'I .! ' .'. if 1 1 I I :M tl 1- 5 A: S as , u L 0 A ,I 4 6 y C6 97 K 1' A ll ll 1 W 1 I I 1 ' 1 1 E1 14 5 ' i 4 ' Q 9 n ' 1? l lj, Insurance Co., in America and Al 1-1 1 1 L li I ' 5 1 m, lf! 1 rl N, M No t k ll I ED , ' . 023 I gg: l ' I 11 LL I1 Q v I V.. I ' 'IV I . One Hundred Fifty-four . el KC- CRUSADER 5' ' ES ' d Riehman's Clothes 'j......l 'x:..i. 3' ,.wT..,T. i?.... Confidence Confidence is the basis of all Q trade. To have the confi- 0 dence 'of humanity is not only an honor, but it is a priceless qu li ALL 53.22 IB privilege. We go a long way to gain one's confidence, we go further to keep it and be worthy of it. W . ii i ,yr Q i F 311 CHILLICOTHE STREET i 'I V , . e I 'F 0 -'what is life insurance, iinlegnginceiv I It's keeping n guy poor all his life, Sn he can din rich? 1 'i 5 ll fi Chas. Zoellner 81 Co. THE 5 g JEWELERS STOCKHAM l ii ii COMPANY in ' Always Dependable-Abrest I with the Things in Styles I C E iii QUALITY IS oUR SLOGAN ' A FINE DIAMONDS PHONE 10 5 ix 4 h H l Our line is complete in G. H. Sandwich ' Hardwarei, Glass, Sport- J I i ing Goods, Paints and l Varnishes. Aluminum and ii Enamel Wm' 915 GALLIA STREET ll ,A i - I nl I Gllgen Hardware Co. S- P- WILLIS' Manager ' do o 928 Gallia Street PORTSMOUTH' OHIO I -w , i .. I X W I v l . ivo aru l 'l1l'i'lfl'U'l!fl ' - : viva One Hundred' Fifty-five -Q .46 T D CU S A TLEQIR S 2259 q ? i I ' The Taylor Unwersol Motor Co. 5 If-J. HOME OF F 0rd PRODUCTS , PORTSMOUTH , I SCIOTOVILLE . A 2 : gl The Cralgmlles D,,,,,t go to A The CITIZENS LILIIVITARY TRAINING I T I HOMES FURNISHED F0R1,f2j 1QfgSJ:5: 231 Q I COMPLETE ARTHUR F. YOUNG, County chairman iq 5 907 Gallia Street The Portsrglfautgaiiavigsfeei. Loan Co. 6 fl !! ii it ni ,, 1 1 V , E2 ,J if , , lf H 1? V5 Berndt: Why don't you play your banjo P '. , ' t Barton: There is no choice. 4 ' I Berndt: What do you mean, there is no choice? ' Barton: I have no pick? as T . I 1 ! 4 l ll Ei T he Sohmzklt-Watkz'ns Company , Asn FOIL. Plumbing, Heating and Elec- tl trical Contractors RICH AS BUTTER 5 1 SWEET AS A NUT 934 Gallia Street Made By I Ph 578 ' ' I one Adams Baking CO. U, 5 PORTSMOUTH, OHIO Qgul 1 AT YOUR GROCER . M -- 1 T . 1009 Offnere sr. Phone 1027 , , V 1-,Q E fn H , 1 . .1 .I M -4 l?lffI1fIQfI' 'ulvvvvvlvnvavsvnvsvnvuv. One Hundred F'fty- , I ' E D 46.- Q C R U S D E RO TT V 4 9 1 l EVERY EVENT IN SCHOOL LIFE IS WORTH A MILLER PORTRAIT YOU WILL TREASURE THEM I IN TI-IE YEARS TO COME 0 3 1 MILLER STUDIO I - I 'I V1 . 837 GALLIA ST PHONE 1071 I ? rouggeziigysif gli Zlgigaic-fly--wllich means one inch of powder, two inches of I if II THIS ANNUAL FRQM THE PRESS OF 11 I THE KAI-LPATTERSON 5 3 . PRINTING COMPANY . I I ' gf' ' ' 1 IE. TI-IE HOME OF BETTER PRINTING I GT 728-732 Fifth Street Portsmouth, Ohio E I f EH On H d d F'i -seven balfvvwvso ' -Y cRUsAD ER A QZQWMAUTOGRAPHS f' . ff K' :aff-Zjrah if-oCf,a4JDQ?f'1AiV4 6, Qfgwh AM -0-Qi?-:r.f...4,. f WML--vw c L 4 . L S.. . 4V , .::g .A , , V . . , ,. , i U A W :-WiQ'7 i f AUTUGRAPHS - - 5 M . I 4.1 47 I- V '- f, I J mi' X, A, fwfnf, , uqyyuff ff 1 . !l ' ' 6 it 'D H A I -mf ' . ' L . cafrbqwl! 193 , is K 'fl' -2 0 '9 '1-- , -: L . . V y , ,, 'Li . , IW ! fu , ,. '17 ' gwbif 95 W Q ' V J. 4 V W , Bl-bl. 90 f Q ' N I ' ,J A . -7 9. fx A C '17 H L 1 ,, 5 - 1 g 'U4 ' Z ,if i 3 2 L g 1 ' u' QL , . . 'ik A 1x ri, 1 . f , . , . p JS- wrrvavavuwpgmruirnvlvqnrqvn' I'!l'l'!flWfl1'Ilfl'lfl!Vlil'l'!I nr: One Hundred Fifty nme va- - , Y! . ' 1 V Y ' LE v '4 D ' - , 1 V, V 6 l J -..,..,,,,Y.:,:... .-., -.-J-:.: -...- V--- -- ' --, K H 1 I : M Pfi, W F. ,f .1 W '- KJ 4 K ..-,. ., . w 515' 1' 'ffe,l'.f'z44' 'i1fg'4V' g 1 , 1, , v, .., . ,. 4 4 ' P ., - W' ,.,gav+fg'v'aw9'frf5-5: rgmg. , , ,,yv..g4L? 3, I1 I 'gig N , .. 4, N M M-,Ymw 'min V' ' ' ' 'f w 7 -yn--F Y E. - 'L' k gs: gf ' x-we 31 4 :.....-A.: . c R U s A D E R mn- . , , , -..-,,,.,,,,, ,' .5 -4 l 1 ra 'A ff. 53 ,fl f ME- Q: Q 1 1? A s 2 1 0 : V P 1 I o 4 rx f I h l ' O ' 4 'g' L E 1 D . , ,5 1 o . 1 , -- b I I I if , v.,,XV1. if 3 EZJSM ' ' 3 1 nw , L, 'LTI 4 , 4 4 9 X .. fi ,Qf , 4' 'H 1: at 'C ' 'I 11' ' ,LV XO-1 I x I! eff ' 'A K' g an 'IZ ff V W ' -x. fi 4 sf :Tl K' . , ev' ' ur, .- 4 f 44, M Hag. u, - Af . ?,-. .- T , ' me KAN-rA'r1'ERsoN CD., rnmrzns, Fonnmourn, o. L u V I fi ' 1 'f Q 5 j A ' X ggz WW cf IE E' . .1 L 'J ff? ww-w ' vw- Q - ' 'E '. 51. , ' , lif if if ' - 1, . , , ' ' ' 'L , f!ffl'U'!!l'lirlifixrpqrgqppgf P ij ., Nt' ' , . , gf' ' 7: . Q 'V , x ' V , , haw' -. 'M-'J x -'L -ff: , . , ., , ' 'J1 A - Y 5. ,,,9+N.V,-.x':'f1::.kg, n ,- .x my Y bl F 44 J SWE' 'A T3.EMi!Mif!1Rlil5Si'51, -v4M'f'1B'IQMW! W! Fw3?l5n5k!f'Ni -MEGAN fRW5GD'!l1x' .T -L'5'4I!M-?J?L.M' 11' 4 I.-mii h.J ?P'?!::'1-'E' fM?i iH- ' , u4WkWeL.,M s.x3fi'HlkE'i.L'A,1Wf i'i2WL!!iir1'l1l5' W , x . 5 J 2 2 S J ,. fd 5 1 3 Q 3 5