Pittsburg State University - Kanza Yearbook (Pittsburg, KS)
- Class of 1978
Page 1 of 328
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 328 of the 1978 volume:
“
vm D ibm QR YB Q!! Q , I AC af' L, 'A . 2 . , V, V 4 . ' V ,. V. -,,,...,..-.....,--...,.Q..-...WV.mv...V.-.....,.4...--V---VAVVAAA-V.--Q-vw----VM-A -VM V AV----A -- - V- - f -Vf----------- . . V ,, 4 3 J V! . W V . V ' ' V' .u - i Q V'l, . .QV ' E f A , H . ' . ,,, v . V, . V VV , ,V . 93 4 4 . . Y. 7 I 4 ' -. Y l 'QV R dl VV it . ,, . - V 5 --V ,. f V g 'T' ,- ' k V' 'V ' 'V .14 . as ' ., V v-K tl., .. . , P .V-,557 V- '22 V 4 ' A VV, L V 4' Wx V 11 'V .. 'V. 'V,V-u1V'rf'?- 4 . ' 4' , . V 3 , 'T'.V.,1i 'VV? ' 'iv V F'-'rg' ,V V ' -V . . ' V VV 2 . ' 5. 54' -.fr V ff' , V' as ' ' - Vis I' 'ZVV 'Fc - :VJ ' 9 . ' . V ,, V-1 .. J 'Kp ' V' V . ggubffggi. EN' 'V -, 'VV'.- - 1 -. V ' . V-gy Mfg. us? ,watt VV , J- '- V- Vff. :VV VV V . f et 'V Vbyg . V , 1 ,V BV.,-dt Vi V I .171 ' 5 ,VV , 5 1 .V ' W V., f , QMHHV' 1 ' f V- ' . , V nf' ' '- ' V, may .If .yay Vg, 1 , fa-V 1 l V1.4 -V Mig. , ,, 'JV-V' SQ ' jc A 'Q' VV N VLIV-,, V, ,,VVV w V ,3,:.. Vg V V V V. V-V: V H Vw- up. ,A V , V ,A-,. .,, fx, V na., , V' .. V iff. ff 4: V- Va ' V . V Q 0 V - VV., V ' sr., - V .. Vs, '3'f, :'V 'wh .V V A .TV fi' ' fr Y' ,fn ?Wk'V. yi.-it 13 32, . ' ' fi-. , 4 ff. 2530. ' ' ny V V' H: V,V1' Y- 1'VpQi-2361 V Sir-. V ,JV -V--1 v V' .wily 3 V-e V A V --4 Ay :V V -'L .' '.. ' V ' ' - ,V V QW, i ' : LV: fp..-' K N 'V ' q' ! V ' it ' 4155 Vi J':Ez i47'f'V','UQ 1 .T V3 - . ' ' ,V . Y- V 1 'R'f,l'1?1fiV1fk5fi. V f WLV - , 'Q' '- '12 1' 2.31 V V . ' if Eff V nf ' 6 A V My V , -J ,. VV , V HQ V, V-V , V - fl V ur,-.Vi5,ai,VV,' V' 'V A ,V 164, Vx ,V V V ge .ft . .V h'I-V- - 5 ' 'VVV . --' .' V ' 'V V' 15? ' V--VV V. :VV- VV - . V -u 'W' 34 JZ I Y .5 5 V A '-1, ,V . ' ' 2 , V I 1 ' . ' .. , V . . V V! 'V -A 'V . :Bbw ' 5 , 'V . V VVVV, 1 .,.V. v ,M V .4 ' .Z -e ,Vg 'n A 4 . ,V ,. V, .- , . ' V 7' ' V .V . Vw' 1 -V ,SA 3 ' ' V ' xi - V-fVV ,.-in , .'V- ,,. V' .1 . Q V ff V' V1VV1 -1 VV. fVV1V?':1-J V V , fix? wx . ' V ' ,. , A V --Q y VM, . 4, VM, ,.V ,ff ,.,, V V, - . V . M . .- .V V, V L.. .q Q-.VVV-,V-,V 3, , V 5 -V , , . , V :VV , - .w -. , V , ,, A , . :VV xl ,ga V V:-325. V. . V, Je, . .V V, ,V. , V V ffggup- VV V,,.gg,,5,,1-.VV . V Q ' V' . V V Vw, ,VJ . . A., ,lgihgfi 4 V V. -ru -'g' , .'.' :V V ' .' 5.4, . , - 235511 5 V. . ,V z, V -3,3 V V ,, -V. ,5 V , ' ,.. VV Vw. V- we .ff V V m E . .1. . M, , V Q . , QS-V V V4, V. 4 A' 'JV 'fi ig? V ' ' ii' V' T. ,VV ' ', V' - V V' ' V. V ','.'4'Q'Vv,gV, . V V +V fl VV ,xg f ,. :VV -V .-, , :EV V Mg, ' , .gV,.!i.. yi- r.VV Vg. , rl ' V 6 :Q V. ' .117 Egg. 35:17f'?fV3Agi.Q,ng3EwW Q V :Q V:V:iV..'- .riffs 3 ' . W K' M i t'.1'1:.1f ' 1 , -Vg, 1 5.5: V , gas m ML:ew.1,5fFV ' Tit Qi ' . : . V 'VV ixf L.--4 W . V V 'LV V,p35'V,r V 'Q' , ' -:ff V , ., V f V ,V . V. . V,- -V .V ' V Jw V VV. ... - ,' luv, -1, gr., -3, ' ' -v - 1. ' V , Vi' 'A MV V. 3' ' V - V . ,V 3. V V , . - V 311+ fijsyy-V, ,V V ,C . VV . . i, ,V . V V V V . . . V: LV'- yi,'la'. . ' - Q V' , ,V - VV' V ,ENV ,V V ,. V4 V .V VM., 0, ,. , V , .A :QV 3 ,Q ' VV Ag fV V- 4 V VV .4 Vfjf au 'V ' V: N J VV, V ,Vi V V- ' , V . V V - V V V-Vg V 5-:TV VV. .,.,,'V: o'VV V .I -H 'V , '- ' A W V , V '5'af.qgi?'V., Y 1 V: ' -'V ., , ' , .. sri i his 'V 0 lf. HI-if, .':.,K',n. Q 1 J , 5. 'yi L , V gi ' : V V V ,VV V ,W 'E V A: j,!Vv1.'5q3.,?gjV U , g y 1 'N V Qu Ve. ' TJ. .- Q 'Vw 'V ' 'V V ,- . , V , X ' . , -. g, 'V V RJl'!K-LQ' V' 'V -U 1 . , , .2 ,VV V' ,-5:9515 V W: . . , K , V . V -V , , V4 ,' I , ' - V , , ,S 3,533 V. V I V V ,M-A fs VV, .Q 'Yu , , . , 4 '55, , ' Q ,V .V-2-V 31V V: ' . f ,, 9 A - .' ' 'f .VV K K , ' If .1 .Vif'VV. ' . VV, ' V r V, V' , Vs' . . - ' V 4 ' - H8 ' -A - ' ,.A,,V'4,VV A, - 1 ,... . , .+V A V.'. 5.1 V V 1, . A if '- 'f?VJ'5? ' 91 3 '71 ' V ' ' V -V ,Q :I-V.. V U I .. V V . ' 2' V V - V . 1 V, ,VV EVVQV , ,Q ., , ,, -4.-1 V .in .VV V . , , V V V,V.,4g,LV5,g V 391 fV V. V K 4 VV, ' V Y V , .V ,, A r 1 - V- Vi ,V , .. V ,. , V, H V V o . g - V - . ' 2 Vigkgfxgt V . V1 V A f V ' . i V , Vu V V .gm .- V V 5, V. . , V, . VV , V ,. . V , I V VV V , . . 3-, ' V - f I , . :. .. 4 if VV . V1 V , ' V V V ' I VVM, A V , .VV V 4 P NV. Vg M. J V1 1: 'f ,V ' - ' A ' ' . 'V ' V 'a '. - V, if ' ,jgVVV,V V -, iw, V . . . . V ,V ' ' ' il , PU: .ref ' ', Q DJ ' k - Y 4 ' ,.V,,,VE.VV4 I 1 VV EF, MV.. . V, . VVV , b V 4. I VV Q 4 1 i s V' ,i ' rl Pittsburg State University KANZA Pittsburg, Kansas Kanza Volume 69 :iw 'Q . v Xa E if-Tim 'fwfwwu -fw . ww ww New vw YBWNWSWNWWNYHQW-ffwswv 4 M Qwww :NW wa-vfwwis W Mm www, w qw- ,. w ,, fb FWS :Wg H w2.w'1w..:.Mm-ggrr NY ' ffafm jim Nfwwwwfm- msiwwwif3MsfifwWwaliwqkmqyqiwkm,,-wghziffifurs, M bwsi 'viQ?,H- - .fizfww f Yew 2-V :wa WQQN was H sx5ANSh?i5'fw 5fxJ':Q?aQ34g5i1WQ '5?f5nwgx.Q wma? Y? eiwkswqwgwwmfxswwwfizx-X .www YfwwawfwwrwmxwmwN:?MwSm,,w Mswmgmbfwwwafwykwvlfw wwwv,,,3f5if.v? Wim wvfglwwfsfvwwffwwa ,wfw-wi ,Q wNs?f,.3mQN21wwQfsMMweWN Meng gswxwwfwww -..,,, - MQMWQQQQMSW :.: XYQMQQS wi iw-Egw5jgaX7,?,5giRkS3g Qiwigfwuzgiiltyafbq vcgrwfgwiigxfswii 2fissMff3?:s5QiFg :fviwag'Nm3 i,:f f:p5,:,3yw9551S:g,wfmmwbiQms?w5.'Qg1fQv SY-'w?A3 M, 4ffv:sfss63M,gwY.1gsxrgh-:ggsgmwwig Q msg-Lfgwifw -w,g:,Ev5gm iS21 fm., . if . M Q f --:-..x.::.:.:.:.g . Q ,S ' is .:.:. .,., : ,Q W5 -.N ,. , Q iwwsqiw, , A 5' gm ,Q ff' 5 x, yw,g,?Q- x . f ' ' A ' -me Y is X N x ' ' :gg H 'E gg W :Q M, Q , g,w:,f,,f1.:, , vf W f5gw?5f,1,wgf1:f2a fA:xg9sff' wffawmyw sglaq ,V 5' A sw fiwwfw:Nm-s:i?2?s2wS:fwfw::s wwfswrsdsmsgw 42 , MEWSS? rw Wm: M revs - f'f ---- Q vw . -. -.-- . my 3 1W5,m,8e.ww.Q,wfwwmgx-m,, F, My WS-swam N vw, 1 f , f QW Af N w . r. an yr . , wk '12,,ifffffifwlrxiffaziff1L1?f::fwHf':L,i Swffzfgssssfw ws, f 415 fi - 24:20 4' f ffl: . f., 1 if - s :W ffm 'wf:gw4Iff22?aFg-2?Kf5G7,.:5.x:guSmHr?gp,fgfagqpigggg-3,'gw. :fr may ggig V W Frjuifs., ifgmgfg ' W rvgfsgfia 5V A X X5 . -A 2' A L fi ' fri: ,M 4 my Tm, :gf .ff 2515? ' :, w?ff2:'1SW 1:2 X A g . M --L-f Q, m:gfa3,gw?'3':,zm:: :warg :,, U -wisf ' f A x f , f -,r - g Q 5 ig5ig,fs.gWfQ 1521255555222 wsswiff N5552s,:5?fs.s?25i:4?: -2122: :Q-ie,fWgk: S::,.Z3f'f Wim? 2 U275?5,i?T5Q 255555: . . -5 ' , f em Mvspigii-iswsss iiffksvfisfyrfhfsfsemmg K wfibgmgwv x mm f, Mfg! Q' cfs, i . 2 A V, Q,15?f.n.,, X. Wwlywpw. by U. W f N ., H, , if fx, My Q M bm X. xy Q , w,54ww,9 M5'g0,,,hw m.,Qwmf Nf,f .M,f,zwy,:gWQM n,fx.,p?,, W.-'W-Q,:Nm . lfmgfk . wwf, w.5,,-x.f,,m,-N 'W Q Qggiwggvsggmgxgg 35115msg-w5:gxm3fmi,gw?gmQ'g,xg SwimhywS:gfmPg'w3wfwdizsw - , u.::m.fb' .Iw.?F+m?Z i.?s'wbz'1ff,eMHW3?M?v xi' EQ- :f i 593553 ffmisw?gm smlggszsggisswgsgffggaswgS: ggmggms:QSszssiiisgwslssfgisibwwf sfxzgwsvirfbiw::wff5wffQ:6f:na:f iizglgwffi , --122' W X ' 41555105 252550315 WHUfwrW!5s'gfmm2z3wawmmfffvk - dew f, A ' f 'F M 'f y U fir ' and . ::- WifxfiiywWW55P'?f54ff:gfi22, ' Piifiwf,2'1?f2F3z?555'f1,ffJff?f'P:E5if2'.:QYWV'A f 'W fffgiffiw 4 . fig K .2':::' M fisww sssw W 3'mSs1:w5SK'QW2'ifi SW? QiffzwgwsS'f3YN?ffsSfv. - :fm Nfgveii ----- ,- .::.2',::-- g-:-.: I f VA lem ig gym wigs Af gy. , S3423 igygiu, Qsfgggi ggi gg. zgmg kg? wigs . iii ' i I 'U ff 1 W l:f.qj55f::55's:fff VY 155:25 ff ,wfzgzgf mag bfigf ,i 5. V,?,i,U:f2-3:2 V i.g.35v:T., Y M A ..... Wim uw p gs ww :H fig.:3yf.zg,0-ww ,H :gm ',x,5h', ,-L, WM,,,,,:Vgg,m '-,psig ,V .iguwgn Muaugg' V15 gy, Wfg.-rgx H if Ei 1ff ',.5 ggsfpg ggeffisfw 1:51 q13g:1:g2:gi .,Qg:X:Qww. 5:55 lgfgiili Qswyeg in iifkzlilwrsgg f . W2 ,..:- .:. 5-::.:'::' J , ::,:.. .7 Avi? ' M? 2 ' 212 W 'Bb BL? XX? my 1 ww X M Sf, Wh Amsyfiewys 'wwgi' -15 'Q -1 5 bai'1m.g-MW E,w15'fQ-,M W N3 HU' QL ,L :gg . ..v. 3' -'-- wifawggggh 33263322Q.f3ggw,22ww?:g?:Frf'fg5f'21',5fgG.':5y'f355:g5gi':,gw?3m.,, fjgiiggwsff z Qffsgmisgfgfw?fw?F5g'f:r,gJ::gvnh5::ggi?'p5f.:A--iimT:gpg'cZf,:gi fF: 22 f K X N .,, ,ww fi -1 5--: . g . jigf.:ggg,,ms:55: 'g35::fg35.,,m..:Q?5.':5gsUg,,y5:.swgtvggig5,gHm2:sf25:,1 'Hy5'5w:1J5:gf W5:qfgh.DZ'5,:g5f. ?L1:g5rv5f,.ggwfggsggfS bjgsHfW,1':,pg5 wbgyggigg' X 1' . Q ff. :B A' if f-M 0 y ff 7 YW xswfwfiffw sw?W5w W Q sff:Qgm2fswL55mQwf:w25 Qffsilsg QwsjevfffiifbF1-,zsiiiazgizzxffx-JriiiasfgxswQfsfegwggxfkifliw .12 our Q mm W Qi 'N 1, .555 X f mg A 1 Q 4:35 2-Q, fA if gk fag: wg I gf e.:, Qs-1Q'5S3'f'Gw22595?X5:'?fQ5i2?g3.1v4Ei?:-v.1'?Q'1fxff121'RfWWsfifafffifgifigkisrfl225 X. Sfzf fy? N 5355 7 I 155 wifi: , RET f 3 5? w 3gi,S25?5S'gW::gg:fsQ3A,s2wf::w2zS:2fMQasg1:m:gfmmm :,Hmwf,fs: ,sw-maxim 4, wwfyum,,4ngQms,,gW,,Q,g.NWQzqgf-14,55QQ: M FQU N DE D H M 'sw .3?1'v-Mzw, w ' 352 ff' 'S 2:5 wwizwi 5? 1v5s2'fffmiG4:f 5,-Sy wfffo wba deg :wS3m, ?35w5'M 9335? iw 5.'gwz'gw?mW3Dgbz:NS:Yi 5 is Q n A 5 v ,:a'4s?--::'::- ww HS., -.:.., g-:.::.- W 'Wg ,5 Hgh Jgww as -w,'w,5W,1H-'W , Qelww ww UW Q 20 ni 6 f5:5v,:gg.g2gg.m- .Sym ,vs .5 Egig f- ,:- 5555:3Siiggiigiijg55:255265335553325355Efifiifiigwigglgqwifgffrs 5ig?K55S5EE3Q?-fi 555. a55 '1swg5gg?g?s5fW g N ,wg1qsg'f f,:::f :Nga ma y ,',.giggwf ,ii f 5 .52 gw gymeg gk-if :fb imma 22.-' Af.wg5f3m,55f:s:vg'-:f?S':SgViMf,f:f1S'2iwm 2 7 I fw L-eil: A a Jwgxgisaaqfai if 'wsisg ' -,gffgfh 5' WE HK, I :gag . Eff? ?lQ11fEW2?:5?5i5??5::5?5gfi2g3 ,Sf?,Etgi5Z?E:3f:J 55:?5.Ql5g5S?-gin - g I iffgl F xg.',,'r,g2wi1?4,5S3g,:4i,b,:535551553 V wr Eflzigfzlxi 5555: -Q, gg: 95?5l5i:52iiS5?ff:j5JZg .5 il ?2:gZi:sg:5p:g 22,3 Qrirwifiisffis yi f 5Q'?5,?:jNSQf,iE3fw 4-..:.::g:g-- ff few F32 QQ-wSff?: 'Q' '?UlN?Lf uw 5399 mi, wzwPHiMx12?q,q:? Sgfifgwyfrir , A 5 is W. 'vm fi' wwrfmm, 5: 1g:,1::,:: fS3:rw.i:w3sE5:Ws, Kg.gmi'iiQffwsxf2:w? Q W5 Wifffiwgmxfw -fQzgHw?,M gwwi W' 5 ?'im,gfi,: hw vsfiswfisq MLf?2a9fif:5ff?f1f2s, Qwqigfisiffiffbzfw img'smwlfspfiwss-.JwS4if5asx?iEN1Qi.w.g,?:.sg,M55nyf21fm1:a,i2gsM4LKzikiisgsswfwgl - .1 Effmsgwfgffqszwfg Qgzkiggxwl-11 wmfflwi ws wir fwwm was was Nwfiwffifflfi 5555:1-fmf2::gwsgwfsxfffmgh is X A M ? ips ,iffy75ff2555252165525S:Q2M?.c,:52i2f,sgWp ffgfsmfwsggm -sx,.wQ2fw,.: X yissgwfrg, Qgfqgmagiif X ffwgwmsvfssmf M 'f xi , - ag : Qgzsfigefggxgw5gesfggmasggsgfggfgssemgrgfg1, asiiaiwfi :H gf 1 ----- Tw: 'Q wma , si' Qz5wSw vfqrwimsv ww: 'sm W , fga,-wwe: :Q e ww , , :P M H wg ,ww eww, .-.. 1. New W ff X ,.,1- .-.-. v 53 Q? wsH?Q?5wSffgfif:2fQ?wifsw25225325s:s2Qf:sff:2f4'm1Vezffsffwmii sweargrssggkfmfsfsifgarggifm:rw A555252fwifggiifusssmssgggrgM21 wssszws . 3325? x?ggE'w.::gS S235-'S 4562? . , ,,wq,M,,mm,.,g1,g,g1,.,,f,.w at mQ,,gw,w,,,, 5W,,1,mKnwmplmzm .awww Qmvzaf Mm Q ffmww-0 H mam. Hmmm W Mu, wwmwmszm .... mwm,Q-ww-Q' ww Mas k: we -.-.. V wiwsgfw. ff w-'MW gm ? sm.225'm,,:1,QmM Q- .wi-ww -, .zwwiggv52::n:::vmm::f2mag.:f5 miffwUfwfzwsfmsslmfQ:gwz3ae1m::wS'fmagma-ffmfywwzimm ,M?w:w.s:m:i:ffL,wfswmgewfq fsfzfx vfsgfvsgm gvmag2:,w2::N?P.vb wmisfw Hifzwwssiwff sHwssspwsaxnergszmkfwgrw Ss f:.:- gfsgwbHiW5,lg5?z1g::y.,g5 Vg:mfwffagggw:gQ,rw::?mfg32q.g:5,2wggwi::.wf:-,.ggMmm:-inMisgwwws,W1fswissfwiff-wfySvzgmrgfhffg ' sasfwgfefavffsvyrafbpksraw A-is :Y-fshzfwsvfsgmpawswzwffgm. mgihsevwifsfwrs' wwc':fw2?:s-Q A Q U f f ' M S1 H42 V, wp.. M M, Aww.. . mm as wh, fn, we -Qt ., .V Xmm- M AUM Q. , W ML -W. ef A hm, X Wim. MN. ,. ww -.1 ww www, M,wh,, mi, MMM , ww S Y. www, ,QW mx. Www. f-we, me ehfxhfbqb Wws:f2m,5xlm MV,-M 1, ,WW -mm wfa,,,P,J Wm fa, ,1 ,,V..W.,, 1 gm Mag-W ,MW,,,2fv.w.h wb, wi., U .M , .,,,,,,,,,,x wa, M ., My vm Q , mmf., ,,,,,Lv , ,Q ma .www MH, ,Mb ROW, M K, 4 Q,M.M,f, tm ummm M, NWN? Big, XZ,-N,,,+Ndp,4,x,,,,, .,,qv, ,ward vw, K, ., vw, ,W A wsgwgws :wmfgw y wM.,gm.5,,gsgQg,gw,,y M,g5'fh.g,3mg5a1 4.,,gg3A.,b -.fsfuw V.,.,,w?w, N t w,ff,,a,,qm,,iN,a,,,wM2g5.,mf,L ,iw .,.,, mg, Af,,,gwmytgg.f..,Wgg.H,,JgMg2fmygb..,e,mX6,K,g2',, 222 , Q? ag :,p:rfy:'ga3?5:ggu,ggf:.g5I::gg4sggM,g3wf,gf:i5g5,f55Mg5g3g5msggfssrX Misa g gg.fgwiyekggfglqgghgigggggggga mi Q,,gg,::w ,qgggzgfww G M'H'figlgiiizsfbglfmrggfww?+fgwevgy,ym.,,4m,k5,N .... H gb 4 HgwwsgzgsfQiimgtjggbfQifi5g1ggs5w2a?gg2?gg5vgA - ,fIr4Ga5M:3:S'Mfsffi2W::+ff4':?wfw22:5iS5:5431 'Sf ' KM' w 5 ' N fer 2:31211 AMX' 151 li 4 ff mi V W wfia w mf, ,zum ww M f 15 H -i f , I Eff 15522 A ':5?:5:5f ' :Z EM 2 P55 5255? ' ?55g2f25 f54:?ff55S552i?5i55??2f52155 .Y di m A , 52g,:gggNg,ggggg:gg3mg:an-aggggMfgfrffw?2ge2'::::gfzgmfgwgsgg sezqgf 5:5332 if ff fm 'gflgggsmffgigzf ffiw, -U Wm? ,MS H H?e3S5?3:':E?i 'bfi 452: .ze wk wfzfzw' lf 2' QfsyfsifieivwsaweywWwfffms 1 A, A K S Q 95:52zfiwfqfaugQ55,wmmssfgiisq-xfsmmgmfgagriw Q: if k 951: M ,fzaifwasg-fir: wr ,fqffgfs 'Q' si s, W fi 5::.5:'.- 322552. - 4 Qf?95gW31'i5i5035gm figs 55'gvzigiigfigtmbkgrgg-?g?5?e?i?55gQS3 wf52SZKQg? M issy amiiigws f'-55593 wif w,Mzf5SS5',' :' -:W -2,22 gig QQ yi E 2 Q gag 22? sb 2 mf , 15 Q:s:26gf,ga?aXes'srnsg,, 5 f his gwsghmgebgwwsmgvssgizsg Wsgwiiibwisfisgv ,iff-5553:beWkfvgssfwMwfyaggamfqagrkiiymiikggfi bnisgfgzzslfffyfisgwgggg-feRsfgsfgs .-.. - .::- n:a.::1- , - ---- QF Q- Si? x W2f:kwz:??2Qwf5:ff5Q :HwangfremayffrsmiwfafsfiiiHfgfwsifszxifaidaqv ' fwfffsiiiwwwfQfwfifigfiswYi:55f::MffQfS?Qf5?:Hilwmswfiswa'S MW? 41 53 ........ 1 'Q gzgifggi : 1 .::g-5 - ' Lf Aw Pfmgw g gfwvgpg-,1gmg.W,g,gm,,.2.fvw:6 my QSM? nf-ff?3:vZ W , FzguESMwfZHmZ2,?M'25S?'1w5sm3'ZWfi.f5vwimgmwwQwfgDi wMvv2?ZSwA?Q2QsvmW?2SWg --.. , .,g ,: .lsgg bg -.-. Z ,. -' H wfZw1.? 4'+w,4 s?, Vfw v ,z ---- .- . E5 i: fgmjif fg,aiMgf,HQ?,,gf9xAk:gmm2a2wff5,?w5gg4Mggg35gggw6,wssggggwgzgmfmgamfsfmgmsh,f,f.11f:m,,:Qbgvyfs:eQ:fwzm,,g,,s,gm,wfgym w,gg,vmg1Nf,aeRg:wM.z QQ? Hi.. 4:-, ...,. ,,,,,, : ,ffmgm ,,Ww 52:01-1 .-.-., E, ...,.. ::::. M, W gfmfvyfw f,vfQ,,f. gm H ,e wp. Q, 5 FW, WW, H, ,W-Qwgv m1l,w05wxgQm35gSq:z4.Q5Aw,ggmwzwxmwfw .,.,. ,1, x gxqjr :e. ,:-:. 5.-f. ,,,, , -.-- ..., ,i -X :- ggxgevzxggrsgdfsgw:,a:5:15SLSfgws'Qw,besfavigffsiayiwfikZtfQ35W55Ef55?i?2:?if3QE5J5wS 5wgi::5f gg5 gpiigmssfifswsswqxq fgwf: 'iwgg5gg'i5gxSr??SQTwwm?5SEgnzwg.ze-fs-sz-:r-::: .:- . Ea . .: ,: N gesggfggsgw,afgyglufgggfwsxfggmgggwsg'gtfggavggm ggwggggsg, M g,gU:,Q:wxw.,eg qgggg gsmgylg, ,2w ,1 gAg5,'g? 6,53 V2f,ggaS,sw,12igQyi:5,g ' ,,,,gQ::g55 SN N 33,3515 .,..: :-- . 15,5 --f .:-,: - Q Q ' b .,,,, g-L::.'g:Q5,:-:-.-: 5- K : g g ,WJ 5 E1 1 w3fZfZ3'iQW-w?s22f'Q:3gQf,gwZlvwS3fgfb?3B QSSWSGQ Y-S f sgifigigfgwglisgwiwgfffgai Kwik? if? WN' Bffisiggiqgzgf -'--- I 'w?55H5?g9.?,?E5Qf?w?NgWa?2Y 4 :w.5g?.? :I-5:2 :I-:--21: H -:.I.2: A .5 ,ali-'rim- -f :fn:2:' .' 3 : QE WEE? Qwiwggviifwigf 3551 SQQQQFQ Em' QQQQYQSBESXQ ?' +f'S5'iQ'f' Ng 5Y3WgQ,g53L?2'5 f39ggb2?g?54'32S Q 3kgQN3v 3f5?.2gs1?'Q5q3 .f ...,. ,555 512- Wg 2.5 fg ---.-.- 2' gy 'X -.-.-. . .: 4 651 .- r gg Q 52 5 N g :sf2?f2f'?2Q5??::25E5Ha- a,Z?52:X2 Mgi2QW:'fSSisb 55g:s5W2?2 fiw?'f'S 5f?5S W ws 52 ggi 2 ' 255555553555 Smgiggsmiwwrzgxaig :,:?g2 fig: wkgsei sf S -' - .-..E . 5 . X Sf?SfQf3m42e5:::QfMa52-Wasiliwfzifwiil ifffsisww ---- wfgfsifwmgiissfiieifsif a5? ?2Q9S55f2 gS ,m1,,2,2af:ggMQ1f5,5 Q2?zs:wsa ,555 ,, F 21 , if ,W ' Ki f -1QQ?.i? 2ss?sm5f22?kW6 57f sfimf75:25Wf :gv?:?QQffQ6:2F'?NWJSEJQWSQ SSQFEQSW , K ffwirwfgf-5l?M9?5M:WW?S2' ,,':.:a?f1if'f'M '? ?2'v w i bm S S H 22 if - Q1 :352--E s. E5 af, F GQSE5. m v: srwsvf ww f ::'55?I3'IE'-f':'s5'-3-.I ,-5'.:2:i . Q 2r.r:s::, . ie, :Q-1:5 4: Wx Q K .-.. EY 2 1 .- fs my .... wgiggzfgq. . w A Wg --,- gggsm w ggvwkggw :.f. ,.,., :- if 5 M5 :..,mgg-:E- , .-... f m, 5 Q, ,. 24 ,,. , 5 4, 5 . LPN HGYEWQ. 392-:im-:'.::f-131:22-:'.2:.::'-.212-2:':: -I.-:'.:EQ:f55'.-:-II:'.:'.:f:::-ff-' 53 :E'-1:-:2:a::: :2?f:.: 1 Qwgz Q52 ii 23 - 4 ---- , QS? Qzfwgg xmw-1 ..... i iii wg 4l , asm, w w M5 ?22ie,m,2:sw :afMfssY ---- 1 f' ?3f555'51?BiNi W2?9H55?w5N ' x12Ni5W5S5 '3' Muwwgg? s- SH Ei. :ref 1:-el ix - :wa sf' .sw 3 H Wag? gqqaawavsmwwsaqas gg f mgmumg Qfgqzgggs wsffwiifm gwyzg gms-1::fw?m5 eww sm, r ..... 1 3 .... 4 .-.. ff -, 2,5 w- 5 fwf . .. ....: 1- ----- ., :.-r,-:4 ww 5 1 fE22:2:::,:f--- 2:zi-1. -2- 4 I 'i E www-f A . M Wi N SQ' M biz: 'W y as if Sw H ww? Q-1 5 0' Wpggikgpiggx ---- WW -' -. fx. him ::2-5-352 Q , 1 5gwsQghzf4?sw3fvww:2qM:Qf:si?1?W W g'5M5,X:zw,,,g,w pg5?W,?Ssg ' QEHHQSQYMSQNQMQZQQ,N,:m,f1ff?5-'ggw gfesff., .--.: Qswswaf w 1---- . 4,5 .EH 2 ..... W .... Q2 5 ,K M:w?Qsg5gm,ge12'gszfypgggisawmggffmw mgmmQgywsgwszffw:siQQ g5pYiggQgggg ,gggasgwxysawi -'-- I 'vi sig gi: ? gm,:5,wffS,:5g,ff fQ AfMZSSWYQQW,mm:Mw1f2x?2 S:H ,gm . lf' Q 2 5a ?523fS??S5w?:'5wx vi-'w2i2f'?5N 5f5m,yvgaY'W Sksvii igg? miff.'M2 G2k2ffQ-'f5sHkDi?g5ffZ5g5 vi' - H 3 5 35 :: 2 g 4 'mewgfwwffsi -.-. :E z - .ff'.:f fsf.aE.Zf X F K M 59 'nl-i::5 N 6 W fgivsfgfaxsbg 5:5 ..... E y 1 5 , SQNYI ,. i1'2g2Eg.Lm'a, fp Eg 363 -aff: 5-: -:- 1- --?.5: .:: - -H: .... .Mfg 8 : Ea--2-.2 5 5:4-5 rw.::gg.gg:-:.-:-.:.5a'.:- 4,:-'-aS:5:5g- :-f-' -:- - g ::.:-'- ----: :EEE 1 :2:. .: gyggb X y?w522m?S'3 -. A .-.- : .:- .: 2s2:ff?i3h -' '.::.,: ggwis? Jig 5 :- ----- 5. 3 mf- ---- f --r:a: wi 2 :r Ja- . I gdfssga ifbg zivsglm asmwf ' N5 Q - 25 .P E Q if! 1,5 x 3,QgfQss?2:5?QS::g's:, .ffw?2?VfQf m :sgff??5gSSg5 ,ewgwremggw2'gg?K?gfSsmS1:ss'f:s Q, mu J ..... 3 '1 ' :':f-if '-11121-V :., css, 5 EE ggi - a-f--f:.::-- fm-mfs' ss, mtv 5'm.4,, , W fri wk 0' www W Hz-4,,, me Sw mlwegggzvgm-ssmfswwwiii Mikwwffezffv-1 .... 1 g -.-.-. ----- - .-.. -: ----- --.-: .:-l.-..:-:-:- -s:+:.i- A ----.-.. : :,::gf-5- .,...:?-f X ' ,:: Q?gw2f:gM,fD:1-gf-Luz,ff',,f,gQg55p2,, Rimfiwmiiyswmgywg.x,f,g5?,:Ai'jZm:p'n.glhgsfgfgfxwiwew Mfwggfwrnfvseemifsz wggmzfswgwggw .-.. Mg .... .- - ..., V ...,. :-I:--.xg -: if 112 visffigfzsiilzsykfam:QQf2::4f:KK?2Ql25Sws,s522s::Hfff.:f::s5S,:5,:,:f5fP:f2fzifzrimafzawizsilgrsfeiwwvf.Gi2f4Sw2'fQwQfSseHv2f is - - .1 :- I s -rg.: : Q W f W 2 ivan ----2 I 5555 qiwfjgigwegfigsfisggys ? Q5:,ifSg,g g SzgM12Qfgi's?fsggS2:gg5F::Hfsw25?9xffssQS:: f :sh :Q Q, Flzzfwissifszggi glw g fugi g -1 ----- Q 5' 355: iwrsy 'Wgyvf Nwggvw 'ww , 5, ' 4 M 6 Nags N55 X Us? ew 4 ----1 JE gf? fi- i1:2.211:?'-12--212: 'SES wi Q wi :QQ :Q 'www 5 51251 9 bf if :ig f in pf mf ssl '22 Si L W -x Q f b fu ' if v 5 2 Q 5? . 5 25?if'f752 f1i4Q7ff5523355-ggfigfgigfisfiSQQQEYZZ.plzf,-32-MMMQESSSQKyqiimgziims ,5nMf5fSsz?w5bJ5L efssmzamifszgggffiwf524epff?1f, fq.,,ga'm Q21 wg - 1 ggxsggsgggssgxgfgg:pksgafzgiggg-iissd4522 'wfffa bw Y :SN vwgzlgliglk ml --.,gE:1-xr-:. Fug:-QQ, 10 My 9 53255, .gg gmigaf-if S H gyqmggf V, -.4Q,4sfQf,:f Qggsiifv f? ,gwgsgfgnsgfwbsgwszp wfmsgmafffmfzgw mvsfrfsffa SSS w?b,f2faffww 2s?Q55gQhswg? w4'1w 'bw HH E we gy- if wigs wg, ,V ' ?sv?s?v:5g-Es? - if 5ssgfgfgwsghsfggifgfegs? fswwem -2' meg: wang: wg M Us M if fy fy 1. 3 if ,. Y W Wggwnig f 4 Efwb fafixivwf gfgfifm mg ,, Qwgb M Xswirwffg ffsfgff msziiffzsi 4' ,fiw mains, f W J Wei SQ Hg? fm 31 fffvg W ? ESQ? si mf wi .2 W N J ffm 2 Q .:.,?1.:f',-:- X' if S ii fa 41 1 Y w i gggggggggi if 55335 ,jg Q33 if J Qwgm gg gi ,QW 555 gig ,Ei W 9552 , gm Q gy 5 5522 5 sg Elk 3322 wfwwsggm gssixzffiiii rims liz NPSA seg 'im wig: ,Q Wziwgsz, QM .55'-5W4Z',x,g1MW,1-Saifwfiggge-A -.-. ww ---- . -.:s: -5121'. .., sp-mg .-.. 2 ng igffiggasifwgggsbggsfbgz gg :ff54:3Qzfgggmffig.Q::g,.fwggsw55fg,gQamfmifwzffirffspiisfishiiezwwffsgfasfszwiimfzsi'qzymiwukigwrigQiifssmassggpa 5a,i.,?35i'fgWfwfg5iii3g6 ,E?ff3g5- -f re: mw ah -, A ' 21:55 ' Y 55 'H b wma. V W .Q H Q M 72 gfgghsqws MW:wiiseimsgwghgfhsw Swgzwgs ., 11,, Q fm S WR. by fam-f.gw W21yf' wwf 3i2Mw,'wxsa5W 'Q'-wxsfwasp wi r U Q iff X w :G Sw f wr Q fy :g'Q5'vzg23Q 4 a:M: gQsgM' Wgq sygia wgfwfflsh H' Q if bf -Q g ,Q ' Q , w,3 . ,:',:5-1- 3 :iw 1 ,Q nf- Q :Q vf we 5 iw Q M x i g g 5 'T?s?Sv:Qf5ggEfg5:g2z??,g?fgQ,M,f,f2amMf2f:Wwas 'ziigsfizzwRQQifbswiswssgisgfafaif-wwv?2aQfaw' wwwifsre figifiw 553:55 we ---- x ,wmffzmwwiifw f-M smximrg gwvmshwfgmimi-'vm QaS.3.?5'Hvgfasw:ki20,gm,szwSfG'Mf,:fkS255 XYEHZHMQZW wggiwgasiwjfifmamximi T: MSSQW SW? 'H ---- : -:-2-'::-:f-:.:a:?E ':::::m: -:::.: --: ---.-. . r.. QQ? iw :- 45 5 ggfgggrgigmgrf 2? 2. P55wif?Z2f52fP1f?2f:55Sgw53gg5z555f:mefw52?f'H:f52wf,-gfxsaffiaigzifif s:f-.f:-:a- ziggy -f:f.:1. :5- .::' vga? .3 .:- 2 H 5' 15-3 ,QEQMQfsSfggggffgwsmifssggiifsfgyf 'M:,: Nw fav ' Neff' 'wr nf' 54 ,Q-122555 gags? 'If MWJQWW-fawww s wcfmg , 2 ws V ,W Mfzfm Q swf :lf Q' Y Q sv' sffgfmi ggw 2 ws 7: 5 S .mv ,,., .2 -' ::: 5Qf f'f Wf Q'Y ?fNff:'viJ we iff SW 3 H S532 i73:5 392'W'wi '52 ff: X 19559. bmi W' 3 ,gx ' wil' ,:'.:':::- ---- NH W 'f P, 5 32 6. MW is 2 -- ----- . Eggs QQ W .: :- ,g .-.-... 5 Q1 W'?5S .:.:..:-:--: ---- -. ggzwgm ff m-W www Qhwam-swf? Sf W H, 2 wwwawvwmixwkvw Nw Q'22fwfSQ :.:. Qiwwf a ah ..... 3 -..g-g .. ......... . ...... :- .. ------ : 4- --------- .E-,--:: -b y ----- r 5 Sgigiigsg wkwgs ---- H ::-:if usb Eg5'E5-:5E5' c1,zLY3k2 5-3'35S?55w?3'?2ff5:2:E'f2?33s e5f,1g,Zf5Q?k,M,wmw?f::2mf 1-'-' .,,. ig ..... z tie gw wawwfsmifribffff miffffwwwfs-fmvsswmwifsgfgagiisggbizzs ffmiwMQ2::Q1fk?s5f:gQ?f:s0455:hSfgfLfsglif 2:1-Wmwfffsg w wssswsffvfg . ::-1-' sms Qui z af .':'gE1'-gl? ig f. -sf --:a.::.- ----- an f? ffF'w ?'ff ::?:' 5+5SF55aFwf ,'Mfi?w H+::g5mS'fSw35rf'f'1w2k'M??L2?vw?W s.,3w:'mw?3 Qffv-ffrkwiw 'm5MfwXfm :m,E? nigeria so-1 ::W-wwwfqi --.- f gh .- 1 ::- ..2i': - Egg ,::- wZfZwpg,.pw wzwiiwgg ff, wfafgbfbf wf2gwmm?Qxgh,wgw ffwfgwmfmzh 2-vewwmw gwsww swmmwwgyhgxq mm .... H .,., .1,:, Q: .... ..... 4 M3 ,.,.,,, : - .-... . -.-. , , gg .. ww w-mzwsr .. Ww?2zv5mwwQ:w.www:'1msiaswilaiswwwmmgw qfgiwwwwu Sf wfghlffkiv Qwgww? ------ ----- ---- ..... ---- -----.- ---- .X - Mwiiw f f 'lxgfwwm .-...... V S ,,,M,,H1wm mfgvxfrlxmffggi ' ,SW wfug 'W my 'S7 iY5WgA'2m,- x5 Vfv?521xQ.'0v' mW?:112iM.gg ,wqgf wfwmg Sy? ,.ggQ--..:.- :: ..z -:-., ..,.g .21-::.:.---.-fn.:-gif ZZ.-:-:--Z:-:.., .. ---.-. --,Q- .:.. ., f Six? -f m'?15 9wsaiv Yff 5+f?W5M 5W Www Xfgq Wiwiawf -. wiiwfwg H53 Eagftg ss fsigzi ..:-,:-:A w www ..:-:: .-:-'- ---- : -:-':.:.,.',.,- -: .,: ,:g1:g:--:a::,.g. -.-.1. :.:-3 5: .... : 5513 2 2- A -.-. . :.:::-- NQY QQSQSS ::E:::' gs .. g-,-2:2 4 ' 5 .321- 159 wg wgx 'W . - .-.. : .Z.I:::5-'-:i fgf Z J: ---- : wa -:-2:2:2-.2:a- --- , :as4m2:::r:M '..::::s:'fa2:--: -.:::-,:--:2-.2:'-':- .f'::'- Q f ,. , ..... .... 4 , .,.. - f .......... , Q R wi .... Q ' ,.,. g 131.51 Q -.-. , g ,Q ,-:.:. W 0335 2 s Q E is M K g .-..- -- xg .. - -- 11,-.:. ---.: Q . .... 21233 , ........... is gg ,, an W ..... W fe Q5 Q .. ..... .... 03 H .... X , ..... .... z gm B, ...... .. K , .,,,. z .. ..... ..... gw ..... , 5 1- ----- ' .i:'.::a-F-'-I is -:-I'2. :: '- - ww? gfw ES' s'f33Q2.2 A.g3N15?24f '- -'-- A ?2f,gQ3q33g .-:-: .:ff 25 A .. M .5 15 5' mlm gm my :. Q? .... E, my m,,g?f ,i. ibiza m wwwwwsg g g- A ---- .... bw 3 ---- .-.- mm , ---- ...-. : ----- ai-M ---- . .... : ---- : 1 . 5 ' , f3l?fSggwS5 ?wZ?H9?2fs5 G'mi , ??aj5'sggw5 w +m glgqlfiggwi -zvamgxifywifiwww 5'fw.?gS5'5EEf ,gggfm -w wgfwgii-3S'QgS32'Q? G+w - W-Fiiwflvfwwa afg S52 -.:':g:'g:::21- ff '-:- ga , -I-5.: ::- 5 ,E 5 1 .mia p m f.QgQf,,' ., Wqqggxi-gisgqm fm-'5,w5,5H?wfA:,,vwJ gwxlwzgggw ,gf wh gagfwf ,mf 'wg.:,,g1w mfg ,.g1,,g,9sgjgw ,X gm? xwsivmwnq ,:'1:wiQf :h-ww f-m.'M5 :.'5.5:' ,im Qgfww p f ff 5,---E25.5:',gg:.:.' I':' ' 5 sf' .. ggg251-.'.:2':E',:Q,g:5-I :2- ' , . ,,., ..., ..... . .H ,.. me mei, wg sm. mgws, ,,1,MgH:gmggw4,,,ew,,5M:HS'f2,f5,,g'??5gsw::WMg2:,?m,m, M f-1g:grgQs,M-aiga 5-'fin' ggavwekxgbwf ,, .-.. z .... z gpwwvbg ,g5gazg,b,,,W .... m y ,. Q 5,51 Q msgtgqsw New .. 13, .,.. l m ,.... Q55 sggsfgfgg Mgyg5:g,3,y,,w,fgggggggaggfqggm gyyggfgggggwgwgggggggzgwgw gigfgxgwmmgsggfw g .... ,E 1 .l,- E X 3 ggfsfirsfw mws2 ,, w'-QQ w2 i.EQ:95Wz, iimgmi :s v yew 12 1 . ..,. - .-,,:-,f: g .:,-.::, 1X.:.: 'S' 3? sf 5,-:-:.: Hbfw ggfxwg -:-.: .:. ggfggvgfiggwxg ..... : q -:-.- -.-.. , --.-- 1: ,:,:::- sg gg ---. : Q N .w52,,mgw ' '- - 1 eqgwiwxfi w fgiiigif ,2x,iggD,ff1?fSQ F5 :' 34 my .. :- Qgw .Y:':: g .g5,M5fg, ---.- Qgmggg ?5g, Egwxgg wwggggw m t 3gg:gyWQGm Qsgngggw 9' lggggf, N-'g'--:a-:' .g: gg:,g:,5- ,:',gg- -: 5 5-5- Q 559 X .:-,:.::.g::::- P ,..,- , .wf,gg,8 f .fgmig,,g.m, ,gygwgsgsfgp wrfsgwfssggmwbggwmffgw:ggqfga-wgwmfgwgfgwfgmm Wg,gm3g gW . wgd2.egW w3 ------- .-.. wg ,gf ------ : -.-.-. E: -2 ::: :g .... kwcgi fwizwigfp wfx:w2a2Q3:ggw,b5kssf?Qb-W gvizfwmswmswrw::f:ff5:zzH2,swffzysfwiggwKarim W kwiiwfxfef wsfzfhw gwwefw wffwssfs g Mf::3QS3m args ' K M'?ISD,? ,Z1S,,g -I-212-12 153504: skgaszyifxfixdsiygvqw gzafrssgffzxfs: Nfsisssgq ifg hmfifrisfafsis fffmszigm-1,2fi:iS ':,Gff5QvQ fiwiffgwx mibgw Gx zgw fiifiwf- wwkw egggiayngvsi f :- 2-2-1142 - 1 52: . : -' lg 5:52 w,:Q5a4x?'w1wNww55K2W24a,1m,5f mfsw:ww5:wfqsxgf2:xffsgwfmgizvwswngfiigmmM:25'If-vz:f:m3fp: 1Amy-bifwiiw'nf4w:Hm,1s':'f ffmQ5i'Ume,T?GfmKx mifmiffiswwffwwmifivgm'E ffwflxwmzfmw -'--- law '- '-'- w?MS' : fimw N,,w:w22:-Wwgwgfg ,grwzggmww,gyM:w,,,,gwaf:mgg:w,mWm,.wwgyQhs2w1-4 .:w,,2m,ag:, 4,f,4,,ffWfw:g,kf mbrmmfqw,-f.Mfsm1f,4g,,5,f,w,,,wg, bwfw,,,,,w ,e?m w?m6g4WW5?REN,, fmgw ,ggimwwm2:,ga3,,Awwf-my.yggaaigzwme x ,, gggfifsaggffir xyggismwifspgfq ,wisfwf Sv2wwfisszkfQs:w24:mg,W:?w:fissffmwgwiggkQy Mfmzsgfrgf-f fbQwmsgsfaizh,4f1ggh:ggm,ww::ff-uffggewMQgwkfgibhgfgfwfnfhiqsvysy, ww w:'w:2w ff M gfffmgdlwsrzggaswfzwwggf ' fwm, pffsgimgsfgfwfiiixzwfwzyggglzwfwgwafifffgggx, ifzfsflsfsgi'fisifsysmfsssgwfwwif?'gw'i:QXg,s25?f2 bf H2fQSQq?ff'4 fH?fm2'0:pgNfWffkQs2saf Q25swWm5w2 W 5,e im g bi A S525 3 2 E E sg, A 1 Q , M, ,mai Q, mqmwimnmmmmm wmw,,,m,mu,,,, M Wm im ,mmf E ,,,,WM,,,,L2,.,,,m ,Amity-E. ,,,,,,Wm,,,,.,.,,, .., Q, W mumx.-aww mmf wr M-W4 ,,,,q,,m, N. ,,,, M Wmmk WW,.., Mg. 4-Nr, -- W , Mmm N- ----' M--www 5,mm,WAWMMmf.,Wwmwmwmfwmiwwwwfmmgwmmwwwm awnwmm ,, , 5, -51-,Q H I 'L.m-.., I f pf' ,,,...-l533711t:' ff' Q 'j A ,1-'ls ,ff 5 rl x V ., 57 I yy, . 'j,v.'g,f Q. .' V .N 5. ., 5 r L, ggi, N xl infra 1 1 -', Mjwx V , Eff: ' ,uf 4' K 1 .dv iw f -ww 4- .f ww 1. Q fn- 1 2 ' War if L ' ' f i-,Q-'IF' fa- f V 'iss -' ,. mf' ,, ', ,IMA 1-rf. fa--W f' f ,W--N' '--1AqgpgV,., R Y 'Q' Vy'1i,4:1? -3. I . .' i , 1 I l f1 4 . , , - ff a!'? fe5f1f4':2Y7' f k' Wu -' Y Y-5,l, , ' I 8,it ' .' 1, , ff-a, -7. ' Y . ' , A ' 5 ' filo r M71-: J -, 1 ff' 'W' ,ff 'aif fli iii' ig 2 -V '- ' + if-'f5l0 w2.,m'f16fa4 +,- HSP: NV' f f 2 ff -V! ' av f . - s ,def x . . I flblfyf .9 I 1 Q ' xx , Y ' fffdlcai X yi 'g ,VVZ , Fifi!! .I vfiig, . 5' 4, ,N X .WMM-M,-f -..f Y ,4,.,,A, 3 vw w inf? ' W: Wt- ,. ' 5,7122 fi wg A 1 fa ' y . 'GHC V.,',b ' . V' I . 5.3! 4 e I Ig V gf, 5. 3+ z rf A-, F1 ws, f , ,Aff - in ., 4 Q MN ,., 1 wg ri V ' 4 Y i I N ',- ,lg V I-, .Il 4 .' 15, ---Nw--..uv ' ,' A A ' '53 il ' 9 5' ff 5 waz? W 9 M' ff' f ' - 1+ p fgwxd if f, V L .' f f' f Jfiif' - 'A f ' xi - 'v ' -J ., . V'f1. 5 f i1lf3:'+ ' V . , . ,H fffff - ' A4 if A153 9..gff,,,4,..r! 311 'IinV.4 g 9 V ' I f dggpi -7.62 V . H N, ig: ' - x H? U A jf? ,, , , K ' I, V, zu , 5 3 ajggyff- fa, ff- si v 'RR H55 ' fi ff if 'ZH ig F- -M32 fv f H '52 ' is 1' 4 '.- vi . . - :fu f -uw .. 1. . ,, ' '- ' ' A , L. . - ! N, ...gffjf 'F' . lf 2 w nv, Q25 Aj , 'l ,I 1- l.'4fP'? i1'l'ia ' I 'Y If i '4 Ii.1f:'1 Q , ' V5 11:1 xi--1.14. ,I I. '.'b 1 LV' 1 1, ' 1 -In-'V .L .v +' f . ' A 1 ' PI ,5,g17'm: --..Ny 5 ,Arg If ,. V. 7.51: 9- !V,92gflfV1: K V yi- -Lana. SV! r lgfxfp, Am ,':.' 5'!.' 4- '??l'f,, -if 1 V diff. 3 '52 i 'f'??el5if'?zf,W . f w f , ,lf ef QQEW ' .Y 'f'I1.ff1f:' . 'I' 1 2 , -.r .-, 1'f:16 -. ,Q f ,.,.f' if ff ' ' .fr I ' -. if - . Rl ' J - - . I I - - 11.1 . . as I ' ff' X -.,,. V J.r1 , .- V . if ' F11 xr A - V 'hr J, 1 ' . ' ' . ' , , u -' '-- -1, .' . I ' fffzifj' ' 7 1 ng ?.1 fUI:':1' 1 Q' 7.1 - ' '42 ji' A Mini' C6 I 'r 'Y-'Yi .A ' ' x1'1'ff . JJ!! ff' ' , ' ' ' 1 5 ' .ff- f L- IFA nL'r.f 'f4' , 923 ' 'Wei '1.:5P'3 ' .45 ' 57 17E5R5f5, ': ,-'Z' ' wtf? . ,f?.Q , I if - f M' lags ga: , A 'Q , - :ff f ,V f?s'gWZsff'fP - ' .1 'm -, ' f' ' 1- ,f.ff- - . f.. ' 'fx , -' , ' .' A - J , -. 2- X 51 ' M H -' Jw .A ff. WWW. I - ,' , ff- ' Eff, 43 r TAI? mx V911 C5954 ,, ' yy-f IM I ' ,,1j.i3Af'- '4f'gi'f',3'i52'!2'., 1 ' fx. 1 uf. iklcfii' ' A ' '03 'I '?'- I' EW! ' . 1 'N' 521' ' l' Y' 4 wffff-' f. .7-QT.. f f-1 9. 'rg--J., , . ,y ' V fpjja ,w,- 'z ' f -y', f af,--, :w , V f .r ', 1 z' ' s,- ,' ff: ,..' . N, f lr1'!J:qf-3 57,1 '- U 11,3 , . ' f ,- , iff r, ,fl X I' ,V -V 1.A, V I H ,H .1..,. 3 , 4??ffs.ff21. ,M f f wfla 7 f ' - mf: 'z f, N - K-12 12-1: Q -fm ' if 1f'ffsz2y:127ffrfff' X 52 'M 3, M f e-I JY Q 1 ' ,,z1-flpf 1 qfw f ' 'f. ,',,I. ' 1' XXX f' I. ' . ,1'.v I ' ,rf fb , Jr XJ 'I J Q 'gf C! ' HJ ff ' Q V .E f f - -1 Inf- W. .f . 'p fl' .- I . 4'-' ' 'I f,. 1 , ,V V.., 1 .,. ,:,,.x. U1 , 2 . 1 .- ',f'Q4,.7ML', lf, xg Nb ', aiu' 1' 4 ' Qs. vs1A-.-,,,-,,. I Xt- 'fq,! Lf. 2, E' M ! 'yi 'iff ' I, IJ ix- 2' I 2 Rig. 17,1 ,, . 'l'g'2'IT'V I-I I In 4.x JMV- -,- I N- ' 15,1 , ' '- 3 ,..f?IL. , X1 -fr-5 wwf ' f Sim- . , Q 'ix f ffflrf' H, .XKTZLA1 47,2-a, v-, 'QE' ,443 fa-f ' f, TI' V ,.4L-ifzx-, ,J me f . gf, ,gk if ,f , z?'?j. xQ'f -A IIS HJ, 'ln 'fllh' -Vn' ,, 52-3' ,v - Iwi, W ylgjt V I Q,5n: rf A!-E. ' ' ,411 , A .- if ' h EVIL lj -ff' -' . J Q, V ' ,. , 'v-.-'. T J: '--ai, H 4550 5 'fdfydi ff 27 mf- A 1 fi A 'M ff .fp we .L 2',f41.:fs- fgvsuffzl M f if '-f f w ,,,.:.c?Zf ,, :Q L zaxgd xgfl rlvv 51211, f -y , -11, fiqixfjyfy - . , , , I u av lagging 4,151 Nl :QI XE, will 4, ,j fi ,i If V : , if I Al ix K-VV, , g,,, .S -tf,,,',.9l .UV 'V g .K , Aff1.4fZgr1 '- qw' f' f 4 3' -1 'Z' .ff,ff'U',- :Mi lv ' 9 . ' 551 L5 15 .f j. 1-!f'- iff . ' ff 'JI 1' ' 'f P7735 915 I , 1 . .Diff-11 '- v' , Vw, . xgutff. ,, 181, f, , '61!.!':-341 'glmcnw RJ lr -fav..-,ll M, - , ,IV 0 VK , ,'v:4,,M., . GA - F5 1' ' l...,yfe1 ' A 155' fr J-,ri ff ' 'Y A 7:1g'iv'-f X KLM' mcg! 4 JJ'--L'.n l lf- '-JQL mf. f'.-!ff'f4y,gpf47 nj .- ' , Q5 ,f A,.- 1141+ . ,wr ,iw ut V :Wu ff , I , . -'5 W .--.--v. .-A1.r,Qj-K.6AJv.:fL...Z.,1f1-r-.L,v1,.sflivtlf 'I I .4 .ljlghll Vw jj, ,M ' fi' ,1,'i, ffyfgf T5 I - ' , .N .. V --N-.-..- ,V ,UI . . 15, 1, In . V . MH- 2,f2fJ'?:f.,0w4e4 .I 12 55 4 . 1 ,.,' VJ ru KL if 1' 'Ai , ' ,f,,f ,V I l I '4 J-' , 41 ,ff -f 5'1-ff1Z.'L?f1f-1fff3'-'- K 'Qu I L'I.,- f.enx-e:2L-,5si12--ff'f-- -. . .- ' X .fb f 1 RX A Al. . I swf 4 -.-gm ,.,., M-. ..,., -.--.. - ,. .,... , . X. : , hi ff, on I fc l g v I ' f K9 ,- : 69 f , -Q 4+ 0- ,Q .' : if f 3. l'a Uh A IJ! if of ' 1 .fb f K 115- qi M.-1. H .- my , I 5 v JI . 4 I 'Sis V , ,, if :K X 11' 'V ' Z' , . V , ,, . , H ' ' A . , NV s 1 Stud nt Lif styles 6 f., .':f K Q, 'J 51475: JUCCTL 'J Q li . j'.r 'N 1.j'- Graf ,, f, , ' ,A - 1-1.4 ff- .- - 71' xr kf- fs' ' 7 2521. 15'-W5 - W f A xr K, f .I . 'I ' Yi? ' I . ' N52 ,ggi If A114 ff! Z iv? .W aj, 1 1 s . I v . .V . jj' ix!! -if Y .1 'ffqyi , ' 'Jr if 5-11 , Ga' 5'if'NIg'f arf 1:92. 4 , 1 .SL 4 5,1 I C , JA , -af f 422W WM. . lffh i '. L. , .. .,f ,. ,. ., ,,.y , 1 Riff. v,3jf1fi Qf ' 'szfgff - ,fx 1 ' , f A . ' g V lu-51, fh a' .xx - xx- fffb' ,, ' . M 3 wg fx - .g '!-Sy? 1 ff. iq, . ww .'f , r. .HH ,H 9,551 -, , .-,I . ' , . 1' , ' f -'J 3 'J ' vV?iL- '4 -1 f. ' fh4'f-X I-' f Ai1L?T' 1-T s-Z l,-f - I. vigcivf' I , r f I .f.f?',-'Avi' V' 1 .-f Q 'wg xy Ff'17g,f! 'f.,1:,.F.g., ! I I 'V 4 . 1 AJ' jay ,V,51f:'Q 5 Qfflf-i'.a i1' '. - f ,rin jj: J, qxf, 'ffl 1 ,':1'jl5 -5-'Q'Q'4 K, Q --' . f-.lux 1 4f,,' -'ry -wxfn . . gi I-.'4,-hiigug L na, .js-gli! .Ji -iv L, Q, , f'. ,?' 3-fry f if-',l l' '. -ox f- f.zi.',,,.j,'j'f SSX 'fy 5 J' , .N ...Mei ' ' -2. A -7 , -11-,., ' . ,V , ,-4 l. igpggivizllgf v Lki.5., 'N gp- '-,H 2,173.55 jL it 71 V1 4 qv .5 ,C'2L'f'.fJ1v 1' ' . 13- V'.lLH'f'ffL3' V' ,' -1' ,I rv- Z Q..-'!U1,jf?.' . I .tv ,iv 4fhu ,,X 'QAJCQ J r. 1. 1-,A.1 L ', .IJ , . '.f .Liy 5.41 .' ' f ' 'M ' 'r' fig-f ' 'iiggf 51 vNig:'?.,.,i, ,P 'PX ic 0. X f.Q3 '.P ' Q'-ff F 5 3L'L ! ,. X ., , . ffpfz, tk .gw 1 nr F3 A A wif.: zffff If 524' gf I 'Ei A Pg.- 'f Y ', n J . 'V s 'Z2'f5.rk 2 ti . ' :ax f, ' 51 jg: 'Q 5' Q7 1 3 , -is z.yqv,- ' 1 . . ' f 5 --.AV A 1,9124 gi .95 1 .v ., 5 ' . - ' A , 5' L' 'Fff-H 'ei 1- 2 C I' ,y 1151-2,'1' If N f V .' , fx ,fi-, 4 A wx 1 fur . ,, I A A:i7fr,!,:,t. I LJ?-1 ffl QA , Q 'IJ I ' n'f 3f.L5 ! rf 'H 1 s - .- ' .-,wi .14 '- - 5 F.. -1 ,K L I vhs, 3 I -ro . J-' 1: X-A Li .JJ-f ' -L. - .' ,.',,' . l ' 517 .f:+5f5?'. :Z .1 ff. .wffkftisx 5? A-vi W, 5 Qf 5 :g.5i5.,a2 . ,. Pj ,,.g Q9ff,Mi..,., Gir l , . V A ,, . . ., ,. ,1.,., V A , . . fi-ff 59f' 1' if1 11.L,' if ff1':'53 ' 7 Wig? 'V 1 .U . z.. -,I . J s gzzria-I: f A 3 wfii X . I-fx q. A Al: ,x , I .. I RK 1 - ,,4 xifyffc' Q T g'f'1f??? 'KW 'EV P42 Fr? ffififs' rv- f ff ' l up-..:, , 'Y f . - fr,-.. f' -if 'ff-1. .,! Q, M rff ,,34v'g-JW M i. 4q2g.IfJImf-By. 8.1.5 f dr ! . Alu UR .V -Qf?2fQ1-imp l Ax '7wlj5,.ff5.LP, 1, ig, - - - U un. I , 4 ,h...MF L, . ' N x 2 'zwuwwww 'f f f. Qwllfltn N Y Q' ff: 'fd' rlfiltnvjgffa ' f I 1 V' HAH- M '- C, N I 5,fh N ff' ' ang! Iffgsi A Q ' if-I x - I 5, .Q vas Wa ,, Vg if ffjg , My. M, ' ...,.-,ig , 4 I A 1 , 1 , , . V f ' nu, rf ' v ' . S- , W if pfiffwii me M7 -5 iw Q42 f 6tI54g91'5 Q 1 , yi igjvy . djiitgl I . .11 I :T ll gil it . V. PC6451 . yy 5' . 4, J H .I 'IQEQ f ' ,AW 5 , , 155, 'fl 'lf' A 151' 'L , LQ: . f qwrfl ' 1 Q lk I CN' nw- ' . H in., .4 - ' 1 A I., . ' j 1 ' Jay f. 'iff : 111 1 . 4-.Q . , A q,,f.- : ,Q ,JL .,l3,A. .N ',. I 7- K fl 1 - -I, ,P . li Q I-yi... 1,3 , 1:5 1. . A ffiwfr 1. -fv I LH 0 fs 4' . 2' 35,5 f fir' ip mi-sw-4 1. .,l .1 Z' . 3.37 ' Q u' Q :ga is Vt 471,-, ' 1' 51' . W, 1' Q 1153? 2 -Z' ik 1 S? 04 .fff ..f1. LI ij: . 1. -, . va f . .- I -if-' 4. ff Dip ..,r ',,A,:jf -,yL,c,, 40, P f-,e f rg .. 7 + fn'- .'.lL.al, . i 5 .IS yy X lx f f i I ' 9 F 1 'lf' I A 0 x, 31 f ' ll ' ng g KK6? ' :F . , , JQi.,2?Gff -xx,.4, .1 1 A 15:1 N' IJ' ,J I I '12 . , - 1 . ,- . ff f 'f' 3 .,.',v,.I-14.5, .' . V' T QU. .?..2iiQif' f 'A -',, V 5 ,NJ ' - - -.. - A NG-.,...r4f' , vo f H ' . . ' - 1 , .'- - 1 , 1 arf-ff- ' ff ff 'P ., -.,-W 'N . .,, . .5 ,, -. .- .. J! ,JI U, 6' . 1 r nfvhl 11 ., Q, J 'qif N v ,r , f Ed' ' - fs .: .ff iff - VY A .xg :Inf-, VL.: 7, I 4. ,pg :. Uni fb' L, 3. . ' .w 4 . fa .- , - ff 5 'kv' F 'I ff' 1- 7 I .M .A y' 1,151 'I I ' Ve' I 1' V ' , . f V 'f:A -' -: . ' 'fur-' .,- ', '-'. -.J.': - f -' 'A 1 'I 'Y q 1 , Z' , ,-f:.:, .1 Y ,YA -,V ,. , I ,, ' .'.' ,'u17!-91ff'fTlvf3'1it7,,,7 ,.'f ' I ffff'-'I-'f 10,15 I' Iirjgl L. L- IJ, J 1. lkff-' ', jf --'Hi' L. 1 Mn.. ' j ,, , 1 If 77. , , f. 1' 'HL X ,gpm Q17 ,,. ,,,rff, f '91, I' f ,643 -, v f ,, nl,q I ,lglgs I-' - , f t, ,',fI '-' ,'x'.2'.' -Y fjf 01,11 ,,1 'll' 1 f f' .' gl N J 1qi1!,,ll I 'rl , f N La' '1 0 yr I ' I A, r A IJ A f A 5.3. s. ,som K.:-H The Student Worker Many students feel that working while going to school is a very important part of their college education. Not only do they learn to value the money they earn, but they also learn to budget their time and activities. Part-time jobs enable them to explore the working world. They meet new people and develop new talents which may help them in the future. Being a college town, Pittsburg employs a lot of students at quick-food stores, restaurants, gas stations, and discount stores. In this section, you'll find students who work in these places and students with different and more interesting jobs, such as writing for a newspaper, driving an ambulance, being a disc jockey, and even working at a mortuary. On the average, the students we interviewed work about 20 hours a week. Sometimes their work ties in with class assign- ments. Sometimes they're able to study on the job. But usually time spent at jobs is time taken away from studies. Some students seem to hold down two full-time jobs. They carry full class loads C15 to 20 hoursl and still manage to work 35-45 hours a week. There are several reasons why students work. Some find jobs that let them begin to get involved in their major field, such as music or journalism. Some work because they like to meet new and different people and because they enjoy the sense of re- sponsibility a job entails. But probably the most common factor to all working students is the money incentive. They all agree that college isn't cheap, and a little extra spending mon- ey is a welcome help. Whatever their reasons for working, most admit that they enjoy their jobs - at least a little - and that they appreciate what they're learning about the business world. Working is learning. EPPOLICEDLYE Q 13 ,L 415349 ' J VW MMM Jerry Clifford, disc-jockey Accounting and economics major Jerry Clifford, Lenexa, KS. sopho- more, is a familiar sight each Friday night at the Lodge. When the Lodge opened in February, 1977, the owner needed help and knew Clifford needed a job to help pay for school, so he asked him to work. I didn't start out here as a D.J. I learned it on my nights off. I played around with radio a little before, but I never did anything like this. My boss taught me the basics, and I learned from there and devel- oped my own technique. It takes a lot of practice to get everything coordinated. I love music and I love people. It's one of the best things that's happened to me in college. I just love it! It gives me a chance to see all my friends while making money, too. I enjoy working with people, and we get every kind of person in here! Clifford says there are good and bad things about working and going to school. 'Tye got to budget my time in order to study. It helps because it makes me study when I have the time. It hinders me when I have a test in the morning, because I canit study nights. That's just a price you have to pay. I know that I'rn working hard and making sacrifices so that I can go to school. It makes me appreciate it moref' Susan Broyles, clothing clerk For extra money to pay for a new Her duties include spotting sho- suitcase, and it turned out to be a car and to have something to do plifters and reporting them to a de- cosmetic salesman. inspired Susan Broyles to apply for a partment manager. You can imag- position at J.C. Penney's at the Pitts- ine how embarrassed I was when I burg shopping mall. Broyles, a Frontenac soph- omore and accounting ma- jor said, Working at Pen- ney's helps me to under- stand a lot of my business classes better? Job responsibilities include working as clerk in the clothing department and checking out customers at the cash register. Broyles enjoys her job because she sees a lot of people and gets a preview of the latest styles. Broyles works part time and her schedule is flexible. The 22 or 23 hours each week usually include some evenings and Saturdays and occasional Sundays. reported a shoplifter leaving with a Xl Qt. David Black, county ambulance attendant David Black, Arma sophomore, en- joys a job for which many others wouldn't be suited. A pre-med major, he serves as an ambulance attendant for Crawford County. The job offers him an opportunity to get some ideas iarliiiout what life as a doctor will be 1 e. Black said he works because I like it, but he does find that having a job cuts down on his study time. Even so, Black can still maintain the high grades necessary to gain entrance to med-school. He usually works be- tween 24 and 30 hours a week, while carrying 16 hours a semester at the university. The primary reasons that Black likes what he does is because it's interest- ing and it's different from the type of job most have during their school years. Whenever he goes out on a run, he can never be sure what the situation will be when he arrives at his destination. His job provides Black with a practi- cal extension of his course of studyg he experiences to some extent what his life as a doctor will be like. This relevant experience is an element that he sees as lacking in many of the part-time jobs that students have while they are attending the univer- sity. Black's job is as beneficial to his future as it is to his present. I an- 'R A Y I Cynthia King, cashier ' i lu-r-.fl 1, Supporting three children and goin to school full-time is a heavy load l 4,, g to carry. Cynthia King, industrial arts major from Dallas, Texas, works 35-40 hours a week at Wal-Mart as a cashier and carries a class lead of 22 hours. I usually go to bed at 3 a.m. and get up at 7 a.m. It's not easy. If I ever stopped, it would be the end. I've convinced myself I can do it. It's all mental. King moved to Pittsburg in January, 1977. I used to work for the telephone company. I was making a lot of money, but it wasn't some- t thing I wanted to do, so I quit and came back to school. She began college as an art major but changed to industrial arts because there are so few jobs for professional artists. Wal Mart is prett understandin if we call in late or sick Most ' Y 8 - places don't consider school schedules, but Wal-Mart does. They help you work around conflictsf' she said. Cashiers have to listen to customers' complaints all the time. When a new shipment comes in, customers complain because boxes are laying in the aisles. If they wanted everything put up, we'd have to close the store for two days and work straight through - it's impossible! If you come out here to a sale and see what people buy - it's ridiculous. We have to put a limit on sale items, and the customers still overdo it. Sometimes it's really nerve racking with a lot of customers complain- ing. Other times it's kind of fun! ximp, fm Lisa Shelton, a Pittsburg sophomore majoring in elementary education, spends several afternoons and evenings a week as a shoe clerk at Newman's on the mall in Pittsburg. Shelton said she enjoys her work. The working conditions are ideal, and it gives me a great chance to observe people. It makes me realize responsibilities, and the money is a defi- nite incentive. Employment forces her to budget her time more ef- fectively. Whenever I want to get involved in anything, I have to work Steve Rodich, printer A newspaper ad led accounting major Steve Rodich to Miller's Studio for a job. Although he started as a janitor, Rodich now prints pic- tures at Mi1ler's. Rodich started at Miller's a little more than two years ago, at which time he knew relative- ly little about photo processing. But two years of 35-hour weeks have enabled Rodich to be- come skilled in what he does. Hundreds of pictures go through Miller's dur- ing the course of a week, and Rodich is part of an organization that makes this possible. As such, he said he enjoys his work. For Rodich, a Pittsburg junior, as well as many others who work at Miller's, the de- mands of the photo lab unexpectedly became a major element in his life. Despite a part-time job that takes 35 hours a week, Rodich still carries a full schedule of classes. Working as many hours as he does, Rodich's extra activities are somewhat more limited than he likes them to be. Without the burden of a job, there are more things I would do. Lisa Shelton, shoe clerk around my work sched- ule. Even though Shelton en- joys her job, she can't see herself as a shoe clerk for life. Working here makes me appreciate the fact that I get to go to college and have a chance to get into a field that I really enjoy. Shelton said her exper- ience at Newman's will be helpful to her in the fu- ture. Any job will help you in the future. You can't expect to graduate from college and have someone hire you Without any work experience. As a music major, Pittsburg freshman, Brenda Bath, is required to practice the organ. Her job as church organist for the Reorganized Church of Jesus Christ of Latter Day Saints also requires regu- lar practice. Fortunately, she is able to intermingle the two. Bath likes her job. I enjoy doing it to say the least. I feel like I'm really taking a part in the service. Being a student of piano for 12 years and having studied organ for three years, she is well qualified. Bath set a record on the campus when she was six- teen: she was the youngest person to give a public music recital at McCray Auditorium. Her participation in music at the church began five years ago when Bath's grandmother was director of Bi- ble school, and persuaded her to play at a program. Thatls when they realized I could do it, so I did. Bath said her experience as organist will help her in the future. It's always something I can fall back on. There's always a need for an organist. Her ultimate goal is to give organ and Mike Slabaugh, laundry worker On top of carrying a class load of twelve hours, Mike Slabaugh finds time to work 40 to 50 hours a week managing the Fabric Care Center at 414 S. Broadway in Pittsburg. Slabaugh, a senior from Eureka, Kan., is majoring in business administration. Slabaugh said he doesnlt mind working the long hours. I wouldn't partici- pate in sports, even if I had the time, because I have bad knees. If I wasn't working, I'd be out drinking. Besides, it gives me time to think. By working, I can manage my time better. Instead of wasting my time doing something else, I can plan my school work around work. Slabaugh said working helps him understand people better. 'lCollege doesn't prepare you to deal with people. Working with the public everday gives me a perspective on the real world and helps me tie the two together, hopefully developing my thoughts to my advantage. Admitting he got his job through inside contacts m- his dad owns the business -- Slabaugh says it beats many jobs he's had in the past. Be- sides, a lot of single girls come in! Almost everyone from the college comes in at least once during the year. It's a great place to meet peoplef' L ,,.. I fd, V. g 5. . -. r,1frf,.,g,. Brenda Bath, church organist piano lessons, and she plans to start giving a few lessons in the near future. I want to be able to be active in the community and in the church. Her occupation is not without its em- barrassing moments. I was in a piano recital and I forgot the first note, so I had to ask the teacher on the way up. Another time, I started over on a verse when we were actually through. The worst time was when I was accompany- ing the District Choir and my music blew off as the air conditioner was turned on. Thatis called instant panic. Music is not her total world, though. Besides carryin 20 hours, and playing the organ in Sunday services, Bath works nearly 20 hours each week as an accounts receivable clerk in a local phy- sician's office. W 1 'I Sholeh Katouzian, nurse's ' lfl 5, ---x- H . . . :: A K .VL s I 3251 ' ss T' i , 1- ix is s H, aide Sholeh Katouzian, Iranian senior majoring in plastics technology, began her job as a nurse's aide at Medicalodge nursing home primarily to improve her English, which was non-existent when she came to this country two years ago. Applying at Medicalodge was a logical choice because Katouzian's sister worked there as a nurse. Katouzian works about 16 hours a week and nor- mally take 21 hours of classes at the university. Working while attending so many hours of classes cuts down on her free time, but she says she likes to keep busy and enjoys the rigorous pace. Katouzian enjoys her work. The old people get happy when I talk to them. Most Medicalodge residents are just old, not sick. But at times Katouzian finds the work an emo- tional strain. When somebody dies, it hurts, but she says that learning how to handle things such as death is important. They are a part of life and must be faced. Barbara Smith, ticket teller Barbara Smith, a Cosmeto- logy student from Pittsburg, spends five evenings a week as the box office cashier at the Cinema Theatre. It doesn't interfere with school at all. I have plenty of time to study. I donlt work past 10 p.m., and I get Wednesday and Thursday nights off, Smith said. She has worked at the Cine- ma for 2V2 years. I usually just work here, but when the drive-in is real busy I help out in the lobby when Pm finished here. Through working here I've learned what to expect from the public, and llve learned a lot about different kinds of people. I also think it will help me in money manage- ment. Smith said her job isn't as tedious as it might seem. It's kind of interesting sometimes. We get groups in here from the Boy's Court, L-Makers, 10th Street Man- or, and places like that. She said the most exciting thing that ever happened was when she helped catch a man who was wanted in five states for swindling money and forging checks at places like the Cinema. We be- came suspicious of him and called the police. I had to go down and identify him. Ron Neville, Psychiatric aide Psychology major Ron Ne- ville says he learns more through his experiences as a psychiatric aide at Mount Carmel Medical Center than he does in most of his college classes. School helps me. I can apply some of what I learn to patients here, but there's a lot of on- the-job experience. Nobody can teach you in school what a person's thinking. Nevelle, a junior from Par- sons, worked at the Parsons State Training Center while attending Labette County Community Junior College. He attended aide training classes and became a licensed mental health technician. When I trans- ferred to PSU, I cornmuted for a while, but working, classes, studying, and driv- Jim Friskel, funeral home attendant ing got to be a hassle. My sister told me Mount Car- mel had an opening, so I ap- New plied and moved to Pitts- burg when I got the job. Inga llie Out here we listen and talk to the patients about their problems and any- thing else they want to talk about. Then we have to make reports on their be- havior. The experience it- self is worth more than the money I make out here. You can see what you're do- ing right and what you're doing wrong and use that information to help in oth- er cases. I like this field, I know it's what I want to do. It's the most interesting work I've ever done? Unclassifiable', is how Jim Friskel, Frontenac freshman, characterizes his job at the Friskel Funeral Home. Friskel has a wide assortment of re- sponsibilities. He drives a hearse or limousine in funerals, and says it is a job he endures rather than enjoys. He often drives to Joplin to pick up empty caskets, or travels to the Gi- rard branch of the funeral home on errands. Another of his chores is set- ting up chairs for funeral services or visitations. When business is slow, Friskel keeps the company cars washed and dusted. Due to the nature of the business, working hours are dictated by need. I may work all day one day, and none the nextg some weeks a lot, some very few hours. However, he claims he doesn't let it interfere with his college classwork. Even though Friskel worked at the funeral home all through high school, he doesnit plan on going into mortu- ary science. His major is general study, and he is undecid- ed on any specific area. How will this job influence his career? It might have an effect on my future, but I don't know if it will help or hinder it. I don't know what my future is. Not many students find jobs that tie in di- rectly with their major. Wade Hannon is an exception. A graduate student from Coffey- ville working for his Ed.S. in counseling, Hannon works 20 hours a week at the foreign student advisor office. Most of his work is with international students needing aid in enrollment and other college procedures. Hannon considers himself more an advisor than counselor. Most problems he handles center around technical aspects of college. He does not handle any longterm emotional problems. Hannon eventually hopes to teach psycholo- gy at the college level and do therapeutic counseling. He taught psychology for a year zgkfieminole Junior College in Seminole, a. Hannon is more interested in the service he provides for society than in monetary re- ward. My motivation comes from the desire to share myself, my skills, and my knowledge with 100' Wade Hannon, counselor with his studies. other people who are struggling along also. He said counseling in school can reach more people. Then knowledge from classes can be applied to any situa- tion that arises, while on the job trainingi' helps with problems. Vickie Bledsoe, program trainer Vickie Bledsoe, a Cheney senior majoring in recrea- tional therapy, said work in her field benefits her while attending school. Besides fi- nancial help, working as a program trainer at New Ho- rizons, a facility for the de- velopmentally disabled in Pittsburg, provides great in- sight into the lives of the mentally retarded -- insight she could not gain in her classes. To be able to see the men- tally retarded grasp what was once thought impossible is indeed an enlightening ex- periencef' Bledsoe said. Hannon gets no college credit from his job, but said he is content knowing he is helping fellow students She said she has become aware of problems she would face in the field, such as state laws requiring excessive pa- perwork, which she believes siphons off time she could spend establishing client re- lationships. Bledsoe said she sometimes finds it difficult to find enough study time with a 40- hour work week and 23-hour school week. However, she sees the experience as neces- sary. I really enjoy being able to relate to the mentally retarded, and I use this in reference to my classes, she said. , . . ,Q f' Edd Ortiz, muslc salesman ff Art major Edd Ortiz, Pittsburg ju- nior, spends week nights working for Musicland at the Mall arranging displays and writing advertising. Working clashes with his studies and makes it rough, but he enjoys the job because 'tit makes life more realistic. I think the job helps you to deal with people. I enjoy meeting people, and you get a lot of different types in here. Ortiz attends school on the G.I. bill, and his job enables him to buy many extra necessities. The burden of sacrificed time is eased by an un- derstanding boss who enables Ortiz to schedule work around classes. He sees his work as temporary until he finishes school and decides what he wants to do for a career, whether it is in commercial art, teaching, or some entirely different field. The time hasn't come to decide yet. Egg 2 Sb Wiz: is F., ff as J 'AGNA' ' I I l , f Ill ,f - .F ' A 1 lib! x M 4 M F' Y rf' ' NTS Jil -fr 1,1 frt i gi I-F A M A if Mike Doue, motel clerk At first glance, the person behind the Extra Inn front desk appears to be more like an octopus than a weekend man- ager. Reaching for the switchboard or the cash register and checking in new people all at the same time, Michael Doue could barely squeeze in time to talk. Doue, an Arma junior majoring in business administra- tion, is enrolled in 16 hours. Doue said he used to have a problem in dealing with people, but this he has overcome. He finds working with people a trait essential for anyone wanting to make it as a student or in life. Doue said his work is both a help and a hindrance. Since he began working at the Extra Inn, he has been able to communicate better with strangers, but he doesn't have much free time for himself any more. He hesitatingly accepted the job from a friend, and though it started out queer, Doue said he now enjoys it very much. Working at a place where you meet many different peo- ple has been unique and challenging. Doue said it has given him insights into the real world. I-Ie explained he's learned to accept and when necessary, disregard people's complaints. One day a man ran in, threw his room key at me, and said he'd never set foot in here again. I just said, 'Thank you sir, will that be all'?, From now on I'll have a different attitude whenever I go into a place of business. When asked if it was really worth his time, Doue emphati- cally nodded yes. It's not only for the money, but for the experience too. . ...ft f Pat Ward, Pittsburg graduate student majoring in accounting, works in the office of David J. Redmond, public accountant. Working about 25 hours a week while carrying 21 hours at the university keeps her very busy. Ward spends her time at work in various ways. In an average month, she helps to service many of the firm's accounts, which would be enough for a busy week. But then during tax time, things in the office be- come more hectic. This creates new challenges for Ward as she works on the thousands of re- turns that go through the office in three and a half months. Ward sees her work as helpful in having a practical applica- tion of the things I'm learning in school. She sees the job as a Larry Parker, mortician Larry Parker, a senior business education major from Mindenmines, Mo., finds his work so enjoy- able that he plans on continuing in the business after graduation. Parker works at Brenner Mortu- ary in Pittsburg as assistant to the funeral direc- tor. He averages a 20-hour work Week, in addition to a student-teaching schedule. Besides the financial aid of working, Parker said his employment helps his self-development, as the public service requires sincerity and kindness at all times. I've found that I could do a lot of things I didn't think I could. Although he started out as a part-time organist, Parker's duties now include dressing bodies, po- lishing cars and greeting people. He finds the work necessary in order to keep an even keel when school gets rough? Parker added, The directors have really been great to make this a rewarding learning exper- ience. I am learning how to deal with people in delicate situations. Pat Ward, accountant good opportunity to gain exper- this advantage will help her ience in her chosen field. When when she seeks her next Job as she graduates, Ward believes a qualified accountant Aren't those plates about ready? Come on, we need more chicken? Phrases such as these abound in res- taurants, and Chicken Annie's is no exception. Kenneth Cameron, Pittsburg junior majoring in pre-dentistry, is the one who gets to listen to many of the requests for more food from the wait- resses at Annie's. Casey, as most call him, enjoys his work, primarily be- cause he likes being around people. Casey has managed to coordinate his work and school. Although he is working a 30 hour week, he still man- ages to carry a full load at Pitt State. For Casey, though, activities at school must be more limited while he is working than they would be if all he did was attend the university. Still, he has found work to be a worthwhile pursuit, and says enjoy- ing a job is half the battle in the struggle to do it well. English major Raymond Hemman, a junior from Coffey- ville, spends his weekends as a sports writer for the Cof- feyville Journal. Covering Coffeyville High School foot- ball and basketball games and writing a Player of the Week feature for the Monday paper has enabled Hem- man to travel and meet many people, particularly coaches, who he regards as some of the most interesting, human - or animal-life in the world. I think the experience I get from this job is important. The experience alone is worth the time I put into it. Of course, the money helps, too. Also, working on this job forces me to budget'my time. I know I canit study on weekends? Hemman plans a journalism career after college. However, an ROTC commitment will first demand four years in the army where he hopes to work in some area of journalism or public relations. He said such a job will be a step toward his ultimate goal. Hernman wrote for the Independence Community Junior College Buccaneer and the Pitt State Collegio before working on the Journal. His collegiate press experience helped in his dgetting the job. One thing led to another. I just happene to be in the right place at the right time. Linda Paulie, scuba diver f'1., . 1-4 Q Linda Paulie, who is working on her master's degree in accounting, spends a lot of time under water. Paulie helps in police investigations of drownings. She dives for the bodies. The first time Paulie ever got her feet wet with this type of work was in Florida when she dove with some friends in a Navy rescue squad. The first time I actually went down and saw a body, it was really gory. It takes a while to get used to it . Paulie estimates that she spends a total of 80- 100 hours in under water rescue work a year. Paulie also works 40 hours a week as finance director for the city of Fort Scott. Sometimes she finds it hard to work the two jobs together. In the past, my boss has been pretty good at letting me off when I was needed to dive, espe- cially when we need to get it done during day- light. Most of her work with the police departments of Pittsburg and Fort Scott is done on a volun- tary basis. Sometimes, however, she helps out with private investigations. Her salary then de- pends on whatever that party is willing to pay. ei- like '-. -- ?'0hl'5 I.z ..:'f- Due to boating and swimming Paulie does most of her diving in the summer. However she also works in the winter investigating skating acci- dents. Few of the cases she investigates are acci- dentsg many include some type of foul play. Paulie said winter diving is almost as much fun as warm weather diving. We've almost made a ritual of going down on New Year's Day. We make it a practice to dive in the winter - just to keep from getting rusty. She indicated that there is very little visibility in inland lakes and ponds. It's pretty bad in the pits. We use a lot of underwater lights. And we do a lot of nighttime diving with lights, too. Doing rescue work like this makes you want to learn more about people. I kind of wish Pd gone into law and justice now. I think it's more inter- estingf' I get a lot of satisfaction out of helping people out, and it's good practice for a diving career. Someday I'd like to get into a diving career, and finally get paid for it. Clancy Davidson, foundry worker Clancy Davidson, an environmental life science major from Pittsburg, works the 3:30 p.m. to 12:00 a.rn. shift at the McNally Pittsburg Man- ufacturing Corporation. Davidson, a junior, carries a 10 hour class load. He began college in San Angelo, Texas but dropped out after a couple of semesters to work for the railroad. I transfered to Girard as a signal maintainer in 1971. I worked for them 5 years. Davidson began working at McNally's in Sep- tember, 1976. Pm working there so I can eatg it doesn't have anything to do with my major. We design and build equipment for major in- dustry - that's what our letterhead says. I do heavy molding frnake castingsl. We've got a quota for a number of molds to turn out every night. My shift is also responsible for cleanup. That means we never get out of there before 12:30. Davidson says his job can be pretty dangerous since he works around heavy machinery and molten metals. But nothing has happened to me yet. It's not luck either. I'd like to think it's because I watch what I do. Working at McNa1ly's is definitely just a stop- ping off place for Davidson. 'Tm a white water canoeist. The reason I got interested in environ- mental life science is because of all the muck and crap in some of the creeks I've been down. Something really needs to be done about the environment everywhere -- not just in Kan- sas. And Davidson's dream: To be able to play in my canoe in the Snake River -- and maybe even make National Geographic Magazine. : t ge 6 i -Q35 y if - Q I ,X :E,g,g,, Q ,s ,Q ,, Jvf-a E:?'!LL.,'Mg, , Q ff as jim Q , I ey th 1 4 E fg 'gf' wg, ,-,f I I I Y: Dedication for an education Commuters talk about travel . What type of person would venture 800 miles a week, totalling 3200 miles a month, using 50 gallons of gas a week at 5741: a gallon, totalling S144 a month, to attend Pittsburg State University? Such a person is just one of the many dedicated PSU commuters. Needless to say, not all commuters travel 800 miles a week, yet the number who do is increasing. Coming from a variety of places, commuters have re- vealed various reasons for the mileage escalation. Those living in a proximity of 15 miles have relatively apparent reasons for liv- ing off campus. Home's easier . . . don't have to worry about meals and laundry . . . besides it's cheaper. com- mented Kingsley Walker, Frontenac freshman. In comparison, those driving from far reaching points need more substantial reasons than meals and laundry. Cam- pus Security said that most of the driv- ers come from Missouri, Oklahoma and Kansas. Such towns as Drexel, MO, Lockwood, MO, Miami, OK, Coffey- ville, KS, and Lacygne, KS are a small sampling of commuter residences. There must be a source of inspiration at both ends of the drive for a person to involve several hours per day in transit. Some have jobs they want to maintain while attending PSU. Others wish to remain within their familiar social cir- cles at home while incorporating a new world at college. And finally another justification is that rather than cope with a roommate's blaring stereo the commuter prefers to remain at home to study in peace and quiet. According to Bruce Johnson, Indepen- dence, KS commuter, Pm married and my wife teaches there. Bruce has ad- justed to the routine, as he has been making the 140-mile drive each Week- day for two years. There are sacrifices made by long dis- tance commuters, the most notable be- ing their lack of participation in cam- pus activities. Johnson explained that with his primary purpose being gra- .Q S , .. W- .T QR A Dx ug., iX5Qf',t- I - -... ,N ... as .. 'j ASQ- an ' riyaag- duate study, he doesn't worry about missing extra-curricular activities, which he participated in during his un- dergraduate years at Oklahoma State. Those coming from within a 30-mile ra- dius most often responded, as did Vicki Schmitt, Columbus freshman, that they vo .- would return to the campus rather than miss an important event. Carpooling has relieved some of the presssures on both the driver and the car - and many students find it essen- tial. Groups of four of five are common, with commuters sharing gas, driving and use of vehicles. The university has tried to accomodate long distance commuters by providing them with special parking privileges. When the commuter arrives after bat- tling ice storms, blizzards or torrential downpours, he is entitled to pull up alongside the union, park and hustle to class. Mostly teachers and businessmen . many work days, study nights Frank Page spends his days teaching mathematics at Frontenac High School. However, one night a week be becomes a student on Pitt State's campus. Page enjoys this time, especially when the class he is taking is math oriented. He likes spending some of his time as a learner, as opposed to always being the teacher. Page is typical of many Pitt State night students - teachers who need hours in order to get their teaching certificates renewed. Page must take eight hours every five years, and at least five of these hours must be math courses, since this is his field. After several years, these requirements become harder to fulfill regardless of what area a teacher studies in. Math classes that Page has not already taken are becoming scarce. The class he is currently enrolled in, Expository Math 773, is new this year. While teachers make up a large part of the 1,756 students who attend Pitt State's night school, there are also many business students. In addition, a typical night class might contain sever- al townspeople who are interested in improving their knowledge in a certain area, full-time workers who want to fur- ther their education, and even several regular students who just want to take a certain class at night. Night classes are different from typical day classes - largely out of necessity. Many run three hours, one night a week. Consequently, teachers must have a format that will hold interest for this longer length of time. Students, on the other hand, need to be relatively careful about what class they take at night. Generally, if it is a subject that they are interested in, the time will go quickly in the seminar-like situation. But if the student is taking it for an- other reason, that time span is likely to drag. Night school at the univerity is run as an extension of day classes with the classes being under the same dean as day classes. Lee Christensen, university registrar, explained that department chairpersons decide which classes are to be held at night. Some, though, are tra- ditionally taught in the evening. Then too, the instructors can volunteer to have one or more of their classes at night. Christensen also said that some depart- ments, such as business, try to arrange their graduate level night courses so that a person could acquire his masters degree in about three years by taking all the night classes offered each semester. Another benefit of night classes is their size. Most are relatively small. General- ly, they range from ten to fifty persons, with the average about twenty. Most of the time I enjoy my night classes. They are fairly interesting, Page said. He, like others who attend night school on campus, finds courses that meet his needs and interests. Par- ticipating in a night class is a thing that many students have done or will do sometime in the future. Such classes can be stimulating and offer the average student aspects of university studies ab- sent in the daytime. 5 Y - o J , Q ' . 1 v uf , . , . 0'. ,, ' 4 X g' Mg, , K, c 5 'E x f fri if ' lc' ' .. 1 2 'Qf ...bf , zw Q Y iw VM V 3 x ' k' 5.5 Q, G, If 3 y ' M ' E ' Wkix g ffrig. -1-'sw isa X l. , A - ,gif ff , -:w 5 f an nr ' ' he . if' . f 'ws---.. ,p .w, up i E5 2 KXMWWFQVA s 4 W Sxsnigxmff, is '---...N 0ff campus livin . . . Only 740 of PSU's nearly 5000 students live on campus. A relatively small mi- nority commute from distances over 30 miles. The majority of the rest of the student body have sought shelter and the com- forts of home in many types of dwell- ings near campus and within the sur- rounding community. For many stu- dents, home can mean anything from a basement bedroom or an apartment to the fraternity or sorority house. Some buy or rent houses or trailers and share them with a variety of room- mates. A few even manage to board four more years with their parents. Most students live in rented apart- ments, houses or trailers. Many places are rented months in advance of the semester for which they'll be occupied. For the majority of these people, living in a dwelling of this type is cheaper than the dormitory. The atmosphere is more relaxing, and if a person has a lenient landlord, he can even become more creative in such a setting. Becoming your own chef is one conve- nience for inconveniencel of off-campus living. You decide what you want to eat and when you want to eat it. Then all you have to do is cook it - or go out to eat. That's when apartment living can pinch the pocketbook. Since many off-campusers live with a roommate, schedules can be arranged to lighten the load of household chores. One might do the cooking one week and the other the housekeeping-including the dishes and then trade the next week. Most often cooking for oneself is more common. Everybody fixes what he likes and cleans up his own mess. A few apartment and house dwellers are lucky enough to have washers and dry- ers where they live. For most, however, the local laundromat becomes a famil- iar place. Decorating one's own place is an adven- ture for some, a chore for others. Most guys prefer the lived-in look with a few posters covering the holes on the wall and a TV and stereo close at hand. Oth- ers like to include items picked up over the years like Coors pitchers or pyra- mids of beer cans. Some more artistic students like to adorn their homes with plants, macrame, or original sketches. ppw- . Most students find that it's more con- venient to study at home than traipse off to the library every other night. As one student puts it, It's very relaxing and comforting to study in familiar sur- roundings, and a relief to be away from school. A few find that noisy neigh- bors make it necessary to seek other places of study. In an apartment or house a person can regulate the social contact he makes. Unlike dormitory living, he doesn't have traffic rumbling past his door all day. If he wants to have a private party, he can invite as many people as he likes with his only restrictions being com- plaints from the landlord, neighbors or roommates if things get out of hand. N o curfew is imposed or restrictions made on his visitors. Most students involve themselves in a few campus clubs, at- tend at least a few of SUB's films or local movies, and many check the activ- ity at Hollywood's or the School House several times a month. The monthly rent of an apartment or trailer ranges from S80 per month for a single room to S300 for some apart- ments which can house as many as four students at once. Many times utilities are included in the rent although most as ,,7 , 7 A V-J.,-1 f ig- p. .V .5 .5 -- 'Q ,... .5 ,L .L I' . 1, .L fy, . ,,,.f , A . A f - an - . --'Vg r- - af L--.4 ,uf ., , , fy J. I -hiv, fy- ,rgxkg . 'l I .-'W' HQ .f' 74 T-J 'Q Q1 aff' 'lgif' in ,gli ij? 1 ,, ,. ,. 1 .,. . ,-N-sl U. Y... v iss'-, ,,-, , 'K 75.7, ' 5 is-. . living as you want ,I i students must also pay telephone and Cable TV bills. Fraternities and sororities are also pop- ular. Nine Greek houses offer rooms to members of fraternities and sororities on campus. About 150 students make use of these facilities. House life with the Greeks is usually as wild as dormi- tory life. All three sororities and one fraternity have meals prepared at the house. For the rest, cooking facilities are provided or members can eat out. Many of the men prefer to eat at Gibson Dining Hall which is never too far to walk in times of hunger. Is it rare that studying at the house can be accomplished. lt's not the quietest place in the world. Therefore, most live-in Greeks are not unfamiliar with the campus library. If one is here for the social life, living in a fraternity or sorority house is a good choice. One can always find company to any kind of social gathering, or ride if personal transportation is lacking. Rent usually averages about the same in as apartments. For many this often includes monthly dues and meal plans. as Far Left: Nice weather allows off campus living students a free and enjoyable mode of transporta- tion. Center: Visiting the laundrymat is a regular trip made by Greeks and other students. Above: Off-campus living provides access to many unique meals not regularly served in the dining hall. Far above: The freedom to decorate is one advantage of having one's own apartment or house. The Leisure of Dorm Living During a year at school a dorm room can become more than just a roomg it becomes a home away from home. After the initial newness of the first few weeks wears off and you begin to relax, you realize that it's really not such a bad place to live after all. There's always something going on if you know where to look. The TV set and pool tables in the lobby see a lot of action. There's almost always someone to eat with or talk to. It's easy to find at least one other person who's interests match yours. It's a place to make friends. Top: Kathleen Bowers relaxes in her room at Na- tion Hall. Middle: Shirk men settle back for an evening of TV. Bottom:John Perry contemplates the meaning of life, 1 Akandli' Bowen Hall keeps up with the action Left: John Wise She hung up on mel Below: Resident Professor, George Wilson. Righ t: Kathy Ginsburg, A'Get on Down! 9 12+ rl? iii- 'CF First row: Steve Mumma, Otto Paul Stuber, Jerry Harper, Jeff Horton, John Elaine Sommerhauser, Isabel Suarez. 'Third row: Gyaneshwar Nigam, Oscar Bilby, Jim Breitenbucher, Robert Brant. Second row: John Wise III, Lewis M. Duncan, John M. Corpolongo, Gerald D. Hixon, John Jarvis, Greg Warren, Angleton, Gene Chadwick, George Wilson, Kathy Ginsburg, Richard Young, Deepak Khanna, Charles R. McCann. Shirk Hall . . . , keeps students active fo -1- 7 ,.., Below: Keith Jordan tries his hand at penny poker. Right: Roscoe Bassett is shown working at the Tanner desk. 041-Je 10 lx,,m,1a.?-MRA, ff 'I E 1 S sk vs Closed W 4 PM 'day Fildoy Sh, .l 5 ,ZW ' 1. v ' , ,M W gi, 15 First row: Kerry Shackelford, John Hart, Bruce Von Fange, John Young, White, Joseph Weiner, Scott Enns. Third row: Clayton S. Bohm, Bob Coffelt Brent Dowler. Second row: Larry Weis, Jeff Dilley, John Conrad, Shawn Wally A. Brown, Anthony J. Ridder, Derrick Hall. Tanner Hall a busy dorm , Left: George Silovsky takes a shot at one of Tanner's pool tables. Below: Pat A Shortell is enjoying a leisurely moment. mmm X. I guvfw -2 gr 1,51 KHIEAQU llll3lBAll 1 V QQ 5229 First row: Jon Graham, Perry Adkins, John Perry, Keith Archer, Richard row: Mark Siemer, Bob Unruh, Chad Cayton, Glenn Duvall, Leonard Tallmadge, Walter Chester. Second row: Brock Groin, Jeff Summers, Gerard Stauffer, Ed Lund, Greg Leichliter, Rob' Kobel. Ricke, Craig Summers, Joe Singleton, Terri Freeman, Henry Barkett. Third ,pw- Dellinger Hall -5,2115 f First row: Marilyn Lee, Sue Lutz, Sandy York, Kareyn Frost, Nancy Oches, Cathleen McCarville, Donna Rangaard, Denise Geurich, Korene Murphy. Second row: Charlie Hester, Mimi Gorman, Scotty Bunch, David Hoover, Devin Dettler, J.D. Harvy, Don Marey, Tim Sohl, Mike Scronce, Carla Ekoff. Third row.' Alan Lytle, Jack Copeland, Dan Ward, Galen Lewis, Marty Pennar, Stuart Minck, Cindy Robertson, Cora Denton, Rita Godinez, Allison Fitts, Pam Jocobs. Fourth row.' Thomas McDonald, Charles Gettler, Matt Williamson, Mark Wilson, Tracy Jarchow, Duane Hefling, Cliff Tay- lor, Lisa Weir, Sheree Parlier, Kathy Smith. Dellinger Hall First row: Pete Minck, Maria Rose, Sharon Wetzel, Cathy Cannon, Judy White, Marilyn Randall, Cheryl Belt, Tamera Smith, Stan Sweeton. Second row: Steve Giannos, Chuck Kater, Rick Oches, Lorrie Garrett, Leslie Carson, Kent Walters, Kim Hilt, Lindel Jennison, Dennis McAtee. Third row: Brad Wayman, Wayne Freeman, Mark Ostrander, Linda Townsend, Sandy Tip- ton, Terri Stanley, Mary Hilton, Peggy Smith. Fourth row: Steve Werder, George Kenyon, Don Campbell, Bobby Gholar, Carl Giglioni, Phil Brenner, Mark Warren, Tim Harding, David Wallingford. Party Time at Trout Hall 1935, R' row: Steve Hettler, Don Rommelfanger, Mike O'Laughlin, David Yoon, Kellison, Terry Schmidt, Rex Cullison, John Allen. Second row: Roger Donald Moore, Greg Shaver, Jeff Flippo, Brenda Luthi, Rick Francis Melle, Brent Thomas, George Brachen, Steve Stewart. Third Robert Breneman, Jim Eighmey, John Davis, Mike Rommelfanger, Scott Howard, Brad Baker, Andy Cole, Jay Harbeston, Mike Sherburne, Fourth row: Scott Pine, Bret Ponten, Kenny Sonner, Marcus Jones, Dave Kuester- Steffen, Terry Harrison, Bill Steuernagel, Curtis Beauchamp, Mike Gleason, Jim Morgan, Bill Clemons. First row: Joan Gast, Debbie Horne, Mary Ellen Ochs, Judy Wilson, Pam Rexwinkle, Becky Pruitt, Judy Sweaney. Second row: Debby Byrn, Diane Lowe, Linda Baeten, Susan Wheatley, Stuart, Kissy, C.M., Gloria Graham, Patti Nicoletti, Charlotte Worthington, Kathy Mercier, Karilyn Schooley, Susi Pfeil, Teddy. Third row: Teresa Phillippi, Kathy Meyer, Diane Miller, Copen, Linda K. Brown, Laura Cunningham, Debra Freisberg. Fourth row: Jolene Johnson, Mary Hetrick, Kathy Good, Deidra Johnson, Cindy Ward, Pamela Whitehead, Cindy Manlove, Peggy Owen, Melissa Gibson, Nancy Meads, Becky Neece, Debra Weast, Christie Bell, Diane Peters, Kelly S. Teague, Keri Kaisner. r . ,g-W .. ,. Mr., ,.,, , , J, V,.,,.,.,1 c,,,t,-K. , Debbie Burnett, Donna Powers, Dona Maffry, Blueman, Ann Weber, Susan ,f.vf1.n First row: Mary Pat Bumgarner, Cherri Willis, Connie Sue Rentz, Kathy Bowers, Gwendolyn Greer, Pamela Patterson, Patricia Sheppard, Carolyn McClaskey, Pam Amess. Second row: Cely Caines, Gina Kelly, Becky Feuer- born, Roxanne Harmon, Patty Bergkamp, Mary Beth Gleason, Michelle Ren- ner, Carol Wurtenberger, Kathy Kapler, Kimberly Boyd, Debbie Price, Marie Wright. Third row: Melinda Pouncey, Tammy Whitehead, Cathy Crowell, Susie Tullis, Sandy Eckl, Sharon Dodd, Delores Stolp, Kristi Longerot, Den- 'qi--e- f M ise Freund, Japote Ewalt, Sandra Stewart, Becky Brewer, Rosa Madrigal, Sheryl Pitts, Dana Austin, Rhonda Boles. Fourth row: Brenda Breiner, Con- nie Chase, Terri Raine, Ruth Wishall, Eve Cornwell, Jeanie Fowler, Diane Cicutto, Beth Westerman, Marita Stanbrough, Dawn Davis, Deborah Mills, Debbie Haefele, Janice McCarthy, Jacqueline Rose, Janelle Bloom, Marilyn Clark, Carol Ann Sizemore, Vivian Praither. Nation and Mitchell Halls Well, gang, we did it again! Yes, once more the women of Nation and Mitch- ell Halls were able to provide them- selves with a very entertaining and eventful year. The Pig Out Queen returned to help keep the 2nd Worst Parkers in shape, while the 1st Floor Fats Anonymous Group kept busy hopping on the scales and passing up snacks - sometimes. Fourth floor was famous for some big time parties. Third floor, also known for partying, was a little quieter this year, since the girls no longer had their bowling ball to drop on the floor. How- ever, they did have a pair of tap dancing shoes which could be heard going from one end of the hall to the other. Those girls in the basement were indescrib- able. Shirk and Tanner Halls created some very interesting situations for us. Tan- ner began the year's excitement with the famous Panty Raid . It will be dif- ficult for any of us to forget that quiet evening as we were all heading to bed when the herd of Tanner Raiders bombarded us with water balloons and shaving cream. Slamming doors, stomping feet, screaming and laughing echoed throughout the Hall until the arrival of our fearless batallion of de- fenders, Campus Security, headed by Our Hero - Butch! Others who invaded our halls were the mysterious Masked Raiders , who threw secret notes into each room, the famous Spider Man, who lurked through our halls in the late evening, and the hypnotic Green Lady , who remained a mystery. Shirk Hall invited us to a few super parties, two of which were held at the Lodge. Both were well attended and likedg the beer was flowing fast, the mu- sic was going strong and new acquaint- ances were being made! Thanks again, guys! The Coneheads were able to take a va- cation from their small town in France to help Nation and Tanner win third AK' ITA sm,, ry 0 ' i . g . .. . . .MEIN place at Homecoming's Yell Like Hell rally. We really stimulated the crowd! There were many other parties, raids, tricks and fun, but these things only took up three-fourths of the year. There was also a large number of girls who were listed on both semester honor rolls, who were organizational officers and who were honor students, belong- ing to Lambda Sigma, Golden Crest, and Who's Who. Our female athletes performed well this year in conference college activities as well as in intramural. And even though we had to give up our first place travel- ling trophy for TKE Softball, we at least gave it a strong try and came in second. It was a busy year. One that went too fast for some and too slow for others, but, nevertheless, a year that will be well remembered by all of us! Left: Sharon Dodd, Eve Cornwell, Dana Cun- ningham, Jean Fowler, and Dee Johnson enjoy a quiet moment in the dorm. Above: Kristi Bell irons on one of Nation's many built in facilities. Pittsburg State University Greeks TOGETHER, as sisters . . . The tradition of fraternity and sorority life remains active on the Pittsburg State University campus. Pitt State of- fers many opportunities to its individ- ual students, and Greek life is only one of the many options. The Greek way can take a lot of time, money, energy, dedication and unself- ishness on the part of an individual. But the Greeks can give one a sense of belonging and self-confidence, along with the opportunities of handling re- sponsibilities and bringing out leader- ship qualities among members. It teaches one how to deal with people, makes lasting friendships and offers in- dividuals a chance for new experiences. There are bad times, conflicts in and between the Greek organizations when any involvement at all seems too much. The bad times come and go. The indi- vidual or group, learns to confront them, handle them, and surmount them, only to discover the fraternity or sorority stronger and more united than ever before. There are also serious and memorable moments. At these times, a helping hand is given to those in need by frater- nity and sorority organizations. The Greeks in the past have sponsored such activities as the Muscular Dystrophy Dance-A-Thon, the Heart Fund benefit dance, the supermarket spree for the Wallace Village Children, numerous cancer and blood donation drives and Special Olympics, as well as collecting for UNICEF, making hospital visits, serving families, supporting homes for the blind or aged and contributing to scholarship funds. All these were for special needs, not for the gain of the individual or the fraternity or sorority. Greek is all one big party time! This statement, often made by Pittsburg stu- dents, could not be further from the truth about the Greek organizations on this campus. Campus leaders have usually been Greeks. The last four student body presidents were Greeks, two of the last three homecoming queens were Greeks, three of the past four outstanding sen- ior men and women on campus were Greeks. Furthermore the Greek organi- zations and their members have also been members of committees, honor so- cieties, athletic teams, and the cheer- leaders. Another impression people have of Greek life is that, Being a Greek can cause one to lose his individuality. Alpha Gamma Delta Alpha Sigma Alpha Lambda Chi Alpha Phi Sigma Epsilon Pi Kappa Alpha as brothers, as people. This statement may often be true, the student loses his identity and becomes one of fifty. There are times when per- sonal rewards are overlooked and the fraternity or sorority takes all the hon- ors. There are times when even the or- ganization must lose its honor or re- spect for one or a handful of members and there are times when all Greeks suffer because of one organization or members of one. But bonds similar to those found in a family keep the Greeks together. College days are the best days of your life! I'm sure every college student has heard this from someone. Despite the long classes, the hours of studying, the hard tests, the 7:30 a.m. classes, the night classes and the hours of worrying about one's future, college can be fun! The Greeks give individuals the chance to explore the fun side of college too. Greek functions at Pittsburg State in- clude a little of everything. Runouts are parties between fraternities and sorori- ties that are held not only for the pur- pose of rushing for the fraternities, but also to give the groups a chance to get to know one another. Sororities hold both informal and for- mal rush parties, giving the women on the campus a chance to become familiar with the Greek organizations. Retreats are often held at various places throughout the area for the Greeks. Travels to Missouri, Oklahoma, Texas, Florida and other states, along with trips to other campuses to visit Greek houses, are common. Alumni often gather together at the formal banquets and dances. The competitive spirit comes out in the intramural programs on the Pittsburg campus. Together the Greeks participate in such activities as Greek Gas, Graffiti Night, Derby Day, Fall Bash, Western Week, or benefit dances. And there are the raids between the groups that take place. Panty raids can be expected through all seasons, water balloon fights in the early fall and spring and snowball fights during the winter days can bring close friends closer. The Greek system at Pittsburg has es- tablished itself in all aspects of campus and community life. Represented ev- erywhere, from intramurals to Student Senate as well as excelling in scholar- ships along with each chapter's own ac- complishments, the Greeks remain very active and alive at Pittsburg State Uni- versity. Sigma Chil Sigma Phi Epsilon Sigma Tau Gamma Sigma Sigma Sigma Tau Kappa Epsilon Alpha Gamma Delta Terri Monsour, President Cathy Brummel, Vice-President Donna Izard, Vice-President Denise Gerken, Treasurer Shirley Edmonds, Recording Secretary Janice Morrison, Corresponding Secretary Barb Allison Ruthie Blankenship Billie Jo Burge Janet Carter Lisa Esch Sara Esch Liz Fast Becky Feuerborn Allison Fitts Liz Hixon Eley Iley Mary Hilton Mary Jennings Janie Jones Marcia Jones Mary Jo Keady Cindi Kenton Jodi Kingrey Pam Kudrna Ann Lynch Mona Madewell Beth Marsh Sue Maskill Beatrice Menghini, Housemother The 1977-78 academic year was quite eventful for Epsilon Kappa chapter of Alpha Gamma Delta. Epsilon Kappa took top honors during Homecoming activities, such as first place in the Yell like Hell contest, and first place in the float competition, with the help of the Sigma Chi's. Kathy Pryor, Alpha Gam Queen Candidate, was also select- ed by the students as one of the five finalists. Our annual Christmas Formal was held at the Hilltop Club. Terri Monsour was crowned Snow Queen, and Sue Maskill was chosen Outstanding Undergrad- uate by the Fall Pledge Class. Spring semester started off with the usual rush parties and runouts. During the semester the Alpha Gam's partici- pated in all the Greek functions, win- ning several trophies. This year nine Alpha Gams ran for Stu- dent Senate. Liz Fast, Cathy Brummel, Mimi Gorman and Marcia Jones were elected senators, and Shirley Edmonds president, with Annette Skaggs ap- pointed treasurer. The year's activities were highlighted by the biggest and best event ever to hit the Pitt State campus! The first annual Pitt State Muscular Dystrophy Dance Marathon. The event took a lot of hard work and dedication, and proved to be a big success. After all the work was done it was time for annual Barn Party and Internation- al Reunion Day. Then the Alpha Gams took their usual retreat and spent a weekend at the Lake of the Ozarks. Although the Alpha Gams were kept really busy throughout the year with various activities, there were times for fun. One morning the Alpha Gams awoke earlier than usual to a surprise champagne breakfast served by the men of Pi Kappa Alpha. Then there were the snowball fights with the Sig Eps, the rice ordeal with the Sig Taus, all the balloon fights with the Lambda Chi's, the hidden trophies at the Phi Sig house, all the extra toilet paper at the TKE house, and the ever ending battle to get the Greek letters of Alpha Gamma Delta on Gus the Gorilla in front of the Sigma Chi house. Alpha Gamma Delta not only accom- plished a lot for the community, the campus and the organization, but also had a great time doing it. ,ff n'0- Far Above: The Alpha Gams attend many activi- ties together and the first annual Sigma Phi Epsi- lon Heart Fund Benefit Dance was no exception this year. Billie Jo Burge and Mary Jennings smile as they enjoy a good time together. Above: During all Greek functions the Alpha Gams par- ticipate in the activities that are held. During the Phi Sigma Epsilon's Graffiti Night Beth Marsh pulled her courage together in the goldfish eating contest. Beth was delighted fand honored'?J after being declared the winner. Right: Also during Graffiti night various Alpha Gams participated in the fifties dance contest. Terry Monsour and Jer- ry Clifford swing into action to show their fifties mood. Debbie Placke Kathy Pryor Debbie Richman Karen Rommelfanger Elaine Rouse Annette Skaggs Tammie Smith Pam Thiessen Jamee Valentine Beth Watt Theresa Wiederholt Donna Zirkel Alpha Sigma Alpha First row: Debbie Atwater, Teri Ellis, Jayne Collins, treasurerg Peggy Smith, Renee Ackerson, vice presidentg Kathy Worl, Lynda Smith, treasurer. Sec- ond row: Kathy Baker, Cindy Wilson, president, Lynn Rollow, Diane James, Advisor, Amy Phillips, Louise Hilboldt, House Motherg Gaile Williams, Cindy Fehr, secretary. Third row: Jayne Kelley, Tresa Miller, Joetta Cum- mins, Cherly Sigler, Terry Penny, Kathy Mullican, Susan Powell, Vicki Selenke, Terry Martens. Fourth row: Denise Smith, Terri Elliot, Sheryl Williams, Roxanne Moherman, Barb Leist, Jenny Portz, Sandy Cigainero, editor. Top row: Ellen Shipman, Debbie Shull, chapling Terri Knowlton, Teri Pieper, Cathy Tannehill, Jenny Brookshire, LaDeen White, Stacey Nelell, Sarah Kreutzer. Eta Eta Chapter of Alpha Sigma Alpha enjoyed another great year at Pittsburg State in 1977-78. In the fall we all worked long and hard on a number of projects, not the least of which was Homecoming. Together with the men of Pi Kappa Alpha, we built a country fair scene on our float and won second place for our efforts. Kit Hood, an A1- pha Sig beauty, represented the Pikes in the queen contest and placed in the top five finalists. Throughout the school year we partici- pated in fraternity sponsored contests and did quite well in all. Some of these include Most Bewitching Witch at TKE Fall Bash, Pinkie at Phi Sig Graffitti Night and Pi Kappa Alpha Greek Gas. One project we were very proud of was our work with the mentally retarded in the Pittsburg community. We often vis- ited and gave holiday parties for the mentally retarded at the New Horizons home. Also, we took part in training and preparing these special individuals for the Special Olympics in the spring. With these projects and many more, the Alpha Sigs at Pitt State had a very fun and beneficial year and one we'll always remember. Opposite page above left: Teri Ellis and Mark Costello are caught in action competing in the Phi Sig Graffiti Night fifties dance contest. Above right: The Alpha Sigma Alpha sorority house is a proud part of the Alpha Sigs here on campus. Right: Each year the women of Alpha Sigma Al- pha sell mums during Homecoming activities. This year was no exception as various girls sell the mums. Far right: Jane Collins and Linda Smith share a smile among sisters. L. . . f f w :Eu NNE 0 R Si ma Sigma Sigma Marcia Millsap, President Janie Hughes, Vice-President Leslie Green, Secretary Lisa Richard, Treasurer Becky Long, MembershipfRush Director Diane Pernot, Education Director H L ii ee' Eileen Alsop I S i f i liii V , F 'Z' Lisa Atwater ' H 1, ' Nancy Baum . Diane Blessant ',,h f 3 ' 5 1' Diane Bortnick -A 'i ' 1 i f A ff' Trish Costello ,,,F ,,, . ' -- eili Kelly Dodd Carla Doss Nancy Gibson Mary Beth Gleason Diana Hurt Susie Kavacic Cindy Lowe Maura McGraw Rita Mies Tracy Morris Claudia Munjak Robbi Pazzi Rhonda Pernot Kathi Pistole Joan Ralph Kathy Recker Brenda Robinson Cathy Stareck w ' tl X .Y G 'ff ., W 'ff ' 'f , , ,,,, 1 ' ' mf' 'Y ' W' -R Y x g-Rf n 5 R- ' iv- .,, Wiifif c 1+ W fm if Tfe 1 I Q ? NW, fm l i ,ff I H A i Av . 1 Q A, . V. .. al ,, .- ,- iff Q 2' fi as .Q ff A-if , . -V . :asf , , fw..ag ' a 'We , .. , 'Vx ,af ,rj gg 3545: A , - ,W L., V . . -ci '- . 4 ,Mir Sigma Sigma Sigma's year was really an unusual one. With all our efforts for meeting the fire marshall's standards we found ourselves painting Arkansas Razorback hog heads , scrubbing car fenders at retreat, getting a run for the money from a Jog-a-Thon, singing sweet songs to deserving Valentines, be- ing dealers in fine crystal and forcing members to consume the liquid con- tents of various aluminum cans so we could recycle them. Pledge classes of both fall and spring semesters kept up old and valued tradi- tions, such as toilet papering, sneaks fwatch out Tulsa!J and last but not least putting various food particles in the beds of actives! Fall hosted the Tri-Sig annual card par- ty which was a great success. Home- coming events and our walking vegeta- bles added fun and laughter to the week of County Fair . Our two main social events, Pajama Party and Spring formal, truly showed the spirit and livelihood of Tri-Sigma! Thanks, Trish, for all those pre-parties - they were always an important addi- tion to the evening! We also held our first annual Polka par- ty, which, needless to say, was quite an experience! The Christmas Party for the Headstart children with the Sigma Chi's really got us in our giving, loving and sharing mood. We participated in Western Week, Greek Gas. Graffiti Night, Derby Day, Fallbash and other Greek activities. We also hosted parties for the Alpha Sig's and Alpha Gam's for a sort of get together night. The Tri-Sig's have had an excellent year in sports! We Won intramural bas- ketball, football, bowling, and TKE softball! The year would not be complete With- out the pranks ! Foil-facing is getting to be a tradition! We've bought the stores out of balloons in order to have a few water-balloon escapades, and of course nothing is more fun than being coneheads on a Sunday night. Thanks to a couple of fraternities for returning our clothing! Those raids were really something! It's been a great year, Sig- ma's! Jerri Dawn Staton Jan Steele Diane Strick Debra Stokesbury Bette Walker Cathy Walker Glenda Webster Joy Welsh Far' above left: Diane Hurt is shown participat- ing during TKE softball. Above left: A group of Tri Sigs are pictured during Graffiti Night. Left: Diane Strick and Karen Huerter enjoy Greek Gas. Above: Maura McGraw is shown at her best? ' Lambda Chi AI - ha Kevin McKibben, President Brian Jones, Vice President Bob Riley, Treasurer Darcy Mendenhall, Rush Chairman Doug Roberts, Pledge Trainer Bob Alford John Asbury James Bastian Ray Black Ralph Brightwell Thomas Burns Kent Cage Cliff Copp John Evans Rick Fifield Ron Gariglietti Robert Herren Timothy Janes Steve Kindle Randy Kittleson Mark Lancaster Steve McCullough Steve McLaughlin Mark Mishler Marc Potter Gary Robbins William Steuernagel Scott Suhr Gary Trinklein Dean Van Demark The year passed leaving many memo- ries for the men of Lambda Chi Alpha. Parties and dances filled the year with excitement. The successful Western Week '78 gave the brothers and the rest of the campus a week full of social ac- tivity. But parties weren't the only things the brothers made memories of. Getting the house in shape to meet State Fire Law requirements was one of the biggest goals of the year. Alumni came back for weekend work days, proving -once a Lambda Chi, always a Lambda Chi. That and getting together to make a day brighter for the handicapped at the Parsons State Hospital is what Lambda Chi memories are made of. Living to- gether, learning what each other is made of, pushing to achieve success, lending a hand to one another when needed, whether working or playing . . . that's LAMBDA CHI ALPHA! Opposite page above left: Tom Burns rejoices after winning the goldfish-eating contest held at Graffiti Night. Above right: Lambda Chi Little Sisters, front row: Kathi Pistole, Kathy Recker, Beth Westerman, Pat Kuestersteffen. Middle Row: Delores Stolp, Becky Pruitt, Kathy Kapler, Kristi Longerot. Back Row: Lori Girard, Pam Benoit, Dawn Davis, Helen Kirkpatrick. Right: Gag me, not another beer, Bill! thinks John Pettus. Center: Bill Steuernagel enjoys Greek Gas. Far right: Barry Brightwell eyes down his spot, during the shot-a-minute contest held at Greek Gas. ASN 11 tv ff, x gg b fi R 2,5 if gs. '-ww Q A K . I L, vx sg ,wnlfkq 24- I Q... AX Phi si ma Epsilon Scott Rule, President Kurt A. Holmes, Vice-President Stephen Ryssemus, Treasurer Larry Taylor, Assistant Treasurer Gary N. Akin, Recording Secretary Christopher Lamb, Corresponding Secretary Kim E. Kuhn, House Manager George W. Graham, Faculty Advisor Steve M. Batte Mike Boaz Steven M. Brentz Bradford L. Bright Paul Cook James J. Currier Paul Ellis Wayne S. Enakjer Michael A. Freeland William E. Hettler Sterling Hudson Michael Hull Monte J. Hunn Charles J. Jarlge Timothy D. Kaiser Greg Keltner Mark A. Lamb Steve R. Mc Naught Timothy M. Murphy Ron L. Neville David E. Noyes John C. Patterson Phi Sigma Epsilon began this year in a new home. This year's activities were varied, ranging from Phi Sig Parent's Day and Graffiti Night to dancing and running for Muscular Dystrophy. As always we thoroughly enjoyed our three formals, especially the three day long Spring Bell Ball. The Phi Sig tradition of victory was maintained. We won four of five tro- phies at Greek Gas and continued our dominance in intramural sports by win- If 7 Q.. ......,... it I A ,f f . ,Bi if ii . ' 4.1 K ? gg ning many all-college trophies. Wheth- er it's running a football to Joplin or simply keeping our guard over the so- rority houses, we are enjoying college life. College can benefit a man in a variety of ways. We will probably say that along with the scholarship, it was just plain growing up, accepting responsibility and changing with the seasons and the times. Yes, looking back, the Phi Sigs will say it was all of this and one hell of a good time. Paul Cook, DJ at the SchoolHouse Disco, takes a break for his picture to be taken. 21 5, -0 . N Z if .iglkgwag .3..,.. E:V: V 'P . , I I nl QQN1 Stephen J. Portz Jess Queen Robert D. Rhoton John A. Rule August W. Sprung Kenneth R. Wheeler Homer J. Withorm N9 Far above left: Mike Freeland participates in the goldfish eating contest held at Graffiti night. Above left: Kim Kuhn and Ron Neville discuss activities during Phi Sig Graffiti night. Above: Phi Sigs express their feelings about their fraternity. Below left: Various members of the Phi Sig fraternity discuss upcoming events of the evening. Pi Kappa Stephen D. Parker, President Steve M. Naccarato, Vice' President Michael R. Mattick, Secretary Mark J. Quinlan, Treasurer James Collar John T. Cigainero Brent R. Castagno Marlin L. Carson Larry P. D'Amico James Denton Richard Evans Thomas J. Garfin Thomas J. Heisten Shawn Johnson Kim D. Kimbro David Morris Paul V. Peterson John D. Panter Pike Little Sisters, front row: Lynette Ledford, Joetta, Cummins, Cathy Worl. Second row: San- dra Cigarnero, Sarah Krestzer, Monica Beth, Cathy Coomer. third row: Delanna Kent, Terri Knowlton, Tresa Miller and Cindy Fehr. Oppo- site page above right: Janet Carter and Andy Denton, Pinky and Fonzie contestants, are shown during Graffiti Night. Above left: John Cigarnero and Lynette Ledford work on Greek Gas decora- tions. Below left: Paul Peterson takes a break at work during Greek Gas. Below right: Larry Eck- ert is shown waiting to finish a shot during the shot-a-minute contest. Alpha at N. f 5 li it wt? Danny L. Stratton Stuart A. Warick Jeff Wells A .gg . . awp-saws-1-ar - -W I :rms-W-.HA Q, in -an f ... . We .A , f r -91: 44 of J S Sigma Chi Michael R. Hall, President Fred E. Sanders, Vice-President Mark T. Paden, Treasurer Glen E. DePoy, Secretary Robert F. Geasley, Seargent-at- Arms Jeffrey L. Beasley Steven L. Blackledge Thomas Bohr Jerry R. Brinker Frank D. Crowl Timothy J. George Larry R. Fry Steven A. Giannos Christopher Harrington Douglas W. James Bill Kearney Steven Kinnett Robert Koehler 1 iff' Greg K. Krokstrom Kevin L. Little Brad J. Mattivi Christopher D. Medley Charles A. Moore Jeffry K. Neer Brian A. Pollmiller Mark Pauley Rex Pope Don F. Preston Robbie D. Robinson Robert D. Robson ,. yg. Greek life plays an important role to those who pledge Sigma Chi. To the outsider, it appears as an endless array of parties, projects, and functions. To be assured, these are included in our itin- erary. However, the bond that perme- ates over a Sig's college career yields a significantly different meaning. He strives for friendship, justice and learn- ing. The friends he finds, the people he meets, the times he has will never be as complete as his tenure at Pitt State. A Greek is constantly hassled with tick- ets to sell, activities to support, things to build. Sigma Chi is no exception with tickets for the steak feed, the supermar- ket spree, the chili feed, as well as as- sorted raffle tickets finding their way into your hands. The sale of these tick- 3, x . I A K X N X .1 ets is compounded by the fact that ev- ery other organization on campus is do- ing the same thing. Yet they get sold Greek life, however, is a very rewarding venture. We feel good after throwing a Christmas party for the Head Start kids or singing Christmas carols to the resi- dents of New Horizons or rest homes. We can conjure a sigh of relief in seeing the float you stayed up till 4 a.m. to finish waltzing down Broadway. We are proud to send money to Wallace Vil- lage, even if we did dump 50 supermar- ket spree tickets on your fformerl -friends, and to aid the local Association for Children with Learning Disabilities by bidding on the gifts we solicited for the benefit auction. The work is one endless hassle, but an intricate part of the complete picture. Since we are a social fraternity, we have our share of parties. There will always be homecoming and sweetheart formal, but for others we have the Playboy and Heaven-n-Hell parties, Derby Day, and more. The perennial Friday afternoon kegger-combination-water-balloon- fights will end only with the first frost. Sigma Chi's are known as the gentle- man on campus, as the scholars Chold- ing I.F.C.'s Scholarship award for the last two semestersl, as the partier fwhen the time needs bel, as the Zoomers, as 31. se- f f f ,J Above left: Judd Blunk imitates Fonzie in the Fonzie Look- a-Like contest held on Graffiti Night. Left: Mark Harring- ton is caught pondering on a deep thought. Below: Janet Villamaria, Sigma Chi Homecoming Queen Candidate, rides down Broadway on the float the Sigma Chi fraternity and Alpha Gam sorority won first place on during home- coming activities. Sigma Chi Jerry Brinker and Glen DePoy walk alongside the float. Curtis E. Simkin Rick Snider Stanley Stevens Douglas K. Stuckey Richard J. Svaglic Craig H. Sweaney Thomas F. Toughey Bruce R. Vance Rick VanPelt Mark J. Waltrip David L. Watts Mike R. White Sigma Phi Epsilon Front row.' Rick Hunt, Jeff Batton, Paul Chambers, Jim McClure, Mike Wiederholt, Merrill Dudrey, Warren Pike, Bob Anderson, Pat Wiederholt. Second row: Joe Mayerle, secretary, Dan Manners, Terry Schmidt, Jeff Eastes, Claude Cummings, recording secretary, Dan Midfelt, president, Kent Dugan, Bill Rayner. Third row: Todd Horshum, Mike Elder, Dave Ritzman, Mike Elmer, Jay Pestenger, Dale Inlow, Kevin Hayden, Mike Hanks. Fourth row: Craig Dawson, Dwight Weatherford, David Neil, Larry Miller, Greg Martin, Steve Johnson, Mark Moses. Fifth row: Mike Stevens, Tom Stevens, Jim Davidson, Doug Stevens, Tom Schatz, Paul Marsh and Greg Pope. Not picturedg Craig Drummond, vice-president, Jerry Clifford, controller, Steve Elliot, David Lewis, Carl Leonard, Joe Daleo, Jeff Senger, Steve Noble, Phil Cowen, Kent Shore, Steve Forsythe, Jed Gillin, Terry Martin and Mark Costello. Sigma Phi Epsilon is a fraternity that works very diligently in accomplishing its chapter goals. The men of Sigma Phi Epsilon started off the school year with a newly painted house which expresses the true pride of this fraternity. Constantly, Sigma Phi Epsilon is striv- ing to do some type of service project for the Pittsburg community. At Christmas time the brothers brought a little Christmas cheer into the lives of some homeless children by giving them a party, and during the month of Feb- ruary the Men of Kansas Theta had their first Annual Heart Fund Benefit Ball, donating all of the money to the Crawford County Heart Association. Sigma Phi Epsilon is a proud fraternity with many high ideals, striving for a common goal, which is to enhance their brotherhood. Opposite page above left, Billy Rayner and Mike Wiederholt dare anyone to tread their territory. Above right: Dale Inlow, Pat Wiederholt, Tom Schatz, and Mark Moses work at the Sig Ep Heart Fund Dance, collecting money at the door. Right: Terry Martin, David Lewis, and Claude Cum- mings give out tickets during the Sig Ep Heart Fund Dance. Far right: Steve Noble is captured between shots at the Pi Kappa Alpha Greek Gas shot-a-minute contest. FU, , rw . .gm -f.M..fA , A ,.,1 e an in G PV 598' X1 Q-' if xi. N MXCHE Ill Sigma Tau Gamma Front row: Dick Magee, Marvin Tanner, Tim Pistole and Pablo, Bill Byron, Dennis Dickerson, John House, Chris Howell, Joe Singleton, Robert Poole. Dan Nairn, Dan Spence, Richard Bustos, Tim Wallin, DeWaye Durham, Back roW:Joe Sternberger, Bill Daneke, Rodger Weese, Randy Ermey, Dave Willie Shinn. Second row: Kevin Denim, Jay Rinehart, Ober Merndon, Bustos, Kip Wendler, and Nick Th0lTlPS011- The men of Sigma Tau Gamma started Year- the year off right with a firewood cut- ting project to raise money for house improvements: a new color TV, remod- eling the bathroom, new letters, and lots of paint brightened the surround- ings considerably -- so did the epidem- ic of Poison Ivy which sent so many of our members to the Student Health Center. We saw lots of involvement in Campus affairs this year. John House became the new IFC President, Jay Rinehart replaced Willie Shinn as Chapter Presi- dent, Rob Poole became Collegio Photo Editor, Kip Wendler and Tim Wallen were both involved in Student Senate and Kip was re-elected to serve next In the Greek race, Sig Tau's were right up on top, winning first in the Dead Man's Draw at Greek Gas and atten- dance at Fall Bash. The fall pledge class returned a favor to the Alpha Gams by thoroughly ricing their living room, and at the Dance Marathon we donated S147 from our Pie Throwing Booth. We'd like to recognize the Little Roses and their accomplishments this year. They reorganized themselves complete- ly and managed to get a lot done. And of course they helped brighten up the surroundings too, and added to the merriment of partying on the front porch. Opposite page above left: Marvin Tanner and Joe Sternburger are pictured at Greek Gas. Above right: Richard Bustus and Ober Hernigna com- pete in the shot-a-minute contest held at Greek Gas. Below left: Denis Dickerson shys away from the camera while Dan Nairn enjoys every minute of it. Below right: Sig Tau Little Sisters, front rowj Ann Lynch, Pam Thiessen, Diane Shepards. Second row: Debbie Atwater, Leigh Holewegner, Diane Strict. Third row, Jamie Jones, Brenda Loins, Jolene Johnson, Cora Denton. if as VB 33 'X Tau Kappa Epsilon Michael L. Snyder, President Timmon M. Oujiri, Vice- President Michael D. Wolfe, Secretary Ken D. Wheeler, Treasurer David R. Fithian, Histor James A. Robinson, Chaplain James L. Henderson, Sargent- at-Arms Chris Manion, Hegemon William G. Lehr, Chapter Advisor Fannie Frost, Housemother Robert A. Bettega Rick S. Balnd Michael S. Brock Terry Copp Timothy O. Dooley Michael B. Foster Bill K. Haesslein Kevin L. Kelly Denny Kimball Kevin C. Koochell James D. May Chester J. McEndree Nolan Mclver Michael Montgomery Niel W. Morris Michael L. Peterson John W. Pierce Robert A. Plummer John A. Rentko JR. Richard Rhoades The 1977-78 academic year proved to be another outstanding year for the men of Tau Kappa Epsilon. Hopefully by May, we will lose the services of Bert to graduation. Zitch, on the other hand, realized graduation meant he would have to attend class, so he left early. Petey is maintaining his used car lot, and Wolfman is out washing every car that goes by. On the economic side of the news, Vin- ney gave up bubble gum this year cause it went up another center. Up on the 3rd floor, Percy started up his New York Disco dance studio. Also sharing the 3rd floor is Johnny Piercey's foot- ball porneys on backfield in motion. Back down on the 2nd floor letting ev- erybody in on late breaking news is e s li I ,iii I s-,-- .ai-. .1 ..f-. , - N Flipo, alias Yak, Yak, who's still transmitting at his normal 85 decibels. The biggest news is Brock's assortment of slightly oversized ladies. His room- mate, Johnny Rentko, who is out now to refrigerate the world, might have just refrigerated his head, also. When it comes td music, Loins pulls his banjo out and attempts a close impersonation of the famous Roy Clark - at least we think that is who he is impersonating. The Spring Formal, RCB, held in Jo- plin, turned out to be a good time for all members and alumni and that. The field trip last fall proved to be very edu- cational for all who went. They all proved it is much harder to get out of than to get into Dallas. In. Fayetteville, they managed to get a 20-foot Winne- -faq - , - sss - ii- 1 . wk '84 as Q. . . Y -.., 8 i ix bago five feet off the ground by hitting a curb just right. In closing we would like to say may Vinney's Gap never die from the threats of Captain Ahab and Moby Dick. Opposite page far above left: Mike Smith enjoys one of the many Greek functions. Middle left: Mike Peterson finds himself the center of atten- tion, once again. Right: Chester McEndre gives a dignified look for all. Across: TKE Little Sisters, front row: Tina Kabrey, Linda Kirby, LeAnne Swenson, Cheryl Carcheski, Susan Miller. Second row: Andra Lehr, Dee Johnson, J amee Valentine, Debbie Richman. Third row: Carol Lang, Cathy Brummel, Robin Glennon, Gloria Graham, Jamie Wallace and Terri McIntosh. ...v-H Mime ,-4' PM sl M, X I I ,, ix -.ns 'G' ,Hx Michael Smith Craig L. Summers Michael G. Taylor Fraternity Sweethearts 5622:-3 x it S .J wang . ,afiffiw : . it fi af' f S if f 'Q K f Opposite page, above left: Sigma Phi Epsilon Sweetheart, Ann Jordan. Above right: Sigma Tau Gamma Sweetheart, Pam Theisson. Bottom left: Tau Kappa Epsilon Sweetheart, Linda Kirby. Bottom right: Lambda Chi Alpha Sweetheart, Pam Benoit. This page, above Ieftg Phi Sigma Epsilon Sweetheart, Linda Smith. Above: Pi Kappa Alpha Sweetheart, Sandy Cigarnero. Left: Sigma Chi Sweetheart, Janet Carter. I' W fl - , 'f '-' ' '37v'g59' 4 j ., A,1ffi,'--f'fQf:.,...wh f ' X Jn, HL 1-fl ,XXV YJ: lambjyi n,,Y,'lj'fn:'.,-1 A '4 f1,V-.fg:,,f , .. V 5 Li ,j54J3Q.QQg: ,a1 1L5,,5j,Q,.V,,5i-jV,X.,1 ' .f 1715? ,' '2 ' V' f 'f fi'-EX . .ff ' N fffaf 1 'IV V4 I Ju a n . r v ilqmzfh. ,U J' ,xQA,I!i:.. dl fi jf X:xx l,,,.f9f,f-fa f ..,A1 ff' ff 'V-L fy-'fli-'xdgf 3241 . ,I I ' , .V ' '. H- --.. ,f' ,V ' ' 44 - ' , '-1 f V V - - . V, ,ly-.' ' V, '--L4 '. ff' .1 -' iff'ff'n , jf Ng- rfmji 'Sf f . -' 5'-wi fi 1 ' J' ' I 1'-a' ' ' QU' -. 43,15 K, 'f- , I . If 4, . 5,5- Lx ,Q aj fy, 17,0 , .y, -. ' ' . V- ' ff -V 'A VL . ' ' - V l'6f'z 'Ziff gffjl 4 . ' V a ff,-'!.:,?': f- ,R !If'l , 5, - ' .3 Mf S., 1 D -r 5,rfff,65L3,, JPL sl 259' jf F K 'aifsf-V,-,m+ -fm fl. ff- V ' -A V-51,2-V-af,-- 1: 'I 1 A1961 :Lia - - 04. -9-tsp f 'V 'fgf 2,4 f A .UAI -Sui .VV -by ,,- - tirjirlff, - I 'I L 1. 551153: ET' .1 QI' A 'f 'V ff-3' f . ff J . Ein' V , 'fJ,LE2- , ' .. ff'fo 5 4.1 ,J-f,..,:A C' fl gg If ,,.x. gI,,15Z 1-gf A H' V I if '- ' , V VV' if 1 92. , 'fi fsj gp, f ik 1 1 f 2 20 ffiffu, J . ' K5 eV - . 5, 1 r 1, 1 . 4 f Y . x r '- I ,S l,, f ' !: ,1 ff . , x y 5 X ,V , .1.',:f1,'J '1 QL' '. ' 13,13 J H ara., - . '--,- - . ,i--ff - 1 5 f . ' 5f?f:?2'g . ,'H . ,pg 1' - X .1 QQ if 3, fx - J 4'-55 -4: -' 'W-L'-V-f-V L 4' Off fr 'S ' , ' ',if G' Lai I lf' iii? I 45' A 21, I Q-,jf X' ffilf 4 . I li , U ral! A L rj ..-Aw, , , , 3 1, pgy '. :uf V , t r , ,1,. vu wif... ,,, P X- , 3 fyll' jfggv. X f 7 1. -- , ', z,,, ,' , A',, A f, . 7 ,, - 'Ziff I: 5, . v, HU sz f ,i!:5f'7f?Q'! 1 J , v ! .I ..f . . , , ' fb.. Y AQ' 1 :'1 X' 7 ' hi' - ' -'V - 3' 11.59 - f 11 . 1 Hi , Luka- E U N K H 97 A' 1 fit 'HS' 5' f J-'7 V ? WGA -3 W? 5 -friffff-V45 1 A V' ffwf ffff V 5' Vf M mf' . , .-l' .fgyi I, Al ,- .A ul N q 1-in, . , ' i 7'Nyxn . 'dp 13 ,,- ,5,A- .-.f 'Z , H191 -.,g Ag, ,e , ,I -'yu t 6 1 4-,AK,.i!w 5 Z,-gulf. 1. , . :JI I 1 filly? J ,'H4A g-rv ' ,Sify-:,,tvl4I . I -..-F J, VNQQ- ,ru-., Ill -1 , .1 ' ' ' ' , ,Q ., L F ' - f - U ' 5 . .. h '-lf'f V ' ' ' -' -41 V221 V A . ,V W- V .M .WV pgs! W: .V .w, -241, ' 5 WV V A . ,,V. K... Y . ,f, ' -, f. . .X V .V -Lf 51,05 ,4-j-:'?fj'!,i2.5.ig.l4t',f,,j3.xZ6 gn ,I ' .':?i:G'l:b:'n ,H W4 I wavy nf tif' , - fr-,B-,l!M. gi4i , .-4 , ' M 'fl ' ' . Q .-' . fn -5--H -' fulgsme,-,Alfa 1153- - , ul-4,4-an----.1f-f..,.,, - ff' ! QW- L- jj:-,yjgv , Y 57 I , -ff'-fnm ,ol . 1 ,, , 'f lAf 'J 'x 5 , W ,--. f, ' ' -lf: -13'-j'f'Ef:I.6n 707-' 15 '- Q. If '1 '-f ff:ff,.fV. 'ms Yi 'Z 3, -P Rf'-.6 f V ,V 'W 'a.fzfwTf.i4fz:rEe54fI'5 nw, M '1' ' 4-59? . 7:51-k1:Qw'yf,,g5,,.'1,Q-,VI 'by ff, P2 . f 112314 f f 1 . ,VCfy1F',?,f'f' :- .f,'f'f':'51f, ,, f4 1 ' 1 ' 'f f' .' . 4, ' V. ,. , 'vf 'H - 1' -- f ,4 .'? :' f M - V '- KV. 5 fi? MY Zi ' W 2 : .. V ff 'f 1 ,- 2 - V f -,x , ,- 1f'f fg 'f.41 1 zf W- -- A ' ww .- 'M mf H ' f' nfl V9 M f .Jw ,. 0 ,f V: V- 1-W V 92' I QT T 'f'3?' 5 '1VV V V LL f W51 774 ' Y-ff ! - 1 . 1' 5711 frm 1 ,fr f j ,-nl J. fir. 15,1 afjg ' P.: ' ' '-.,,.,,3,,'i,W -an f I - im.-:4, lb, J-'4'55u f 1,1 . yi. 1' ' Rf fr Vf: aff 'V .- fl-f ' 2- HV ' V..:'.,, f wks! ' I g Q f- ' 1' 1f i'7jf'6, . ' 1-- Q 'x' F'--I--,117 'J ' ' 1' ff 'iff 5 1 4 .. , 3 1 9 -1-V, 43. J 4 f 3: f' Vfrff' ,31 3 7: f -,le -: -' W - , iq? 4 5 . l -3 frm af if b at .A 4 I Z1 1 of ,W I A 'gl , ' -',Vg44, 52-,Q A ,kb ,T V 'w up-IVQ. - ,.,r,' ,t Q., l ff' jf ,. , ' Ap gflgb 1415 ' 19' ? W, A. .' ,y I Q .- gf- fi? gf, 5 if ' -ff.,-,,,,y' if u 7,1-. 1:g, Vy-1 ,Cliff , il . ,V 'A A I ,,, .f I n -,M .gy Lig,!1,, J QQ 's ff IWW-V 'A V-' QQ! 113- 1 - 44 9 I1f-':.5' ff- '11 -'r s 1-4fL f?1E 'i1! ' r g - sm..-ziafvia' ah 045 'f , af fy, fi . ,' -K V -19 - -1 ,ff ' ' me v ii'5fW'- .f if V- ' Q ' Misra :X ' WN .V mf , ' f' 1 ffpdf Q, if ' ' f ':,', r ?i f9'3'i7 ' 5 S , J - - . . fq r, . g:fyJ pf, 1 V -1 ,f gg' Y 11 43 Q fff V 1 F- 1 'E-L4 ff. 412 1,3 . 7 j ECI 59 K if ' A I .41 my , pf f . 45-,7+.,fdg g5,,3'7tX1, 1 4' L- 1' 5 ' if Q' xg 11 M- ,1f 3 , ' ' V32 2 -', 5?-':.Q.f7' Eg 1 A I ' Q, A ,J 1.-, Ar BM 'fl' My ' 'fag' P- fi 'fy' Q Z ',.q5g,yy2 V3 15 7, '15 W N ' ' 'gm Pi' ,Q ,5 . ' 5 ',fg1V4.-E '32, wh a f,,.:x..'.1-.fi - , . li. I -' cr ' y ,V . ' i, I fl .JY ff:if?,5Vffd'f' tj?-144. 'L+Uf !wf' xo. 11 , , Vkff 5- 12-ff 'f-'.-3,f:'. - .., if? ,,,,,-SN +V-f -'df wife--f w asp -L K , if ,W -fl-54' -Q WV . -, . 5,3 1: , . -I ,Zo ,auf Jlgmml .J .4 A , A xxx ,W..,,,..Lji, , , - 5, 1 .- 431, 3 A'1,Qy5-yQ,iipf,i ,J 5 .5:5:.:ij': fggirliwii A, ',,:,?,u Q' 'f fflgfiyv lr A- X.. .f n --rm,-.,.,H ' I ,. N- 15' V ,X f - 4 f Auf- , W I ,Tl VW , f W Q N '-neil? V , A Q . MMM V M f' ' 1 - M. , V - '-fs-., 'rS:'ffQ - - ' - ! ' In agen :I -,jlsiilgjuifyfzf 4 51.47 n,L:'.,,l K -'Y in rrgfl' A A qv!! hi. u V 'Nw Agz p EMEA' ,?4 fy7'? - V.:..,f,2?A .6-. r F94 .,!,,,.:1!'-ch, ,xiii ' 'K flfwmf. vg.. ffyf:-. 1' -H rw! sz H f f -. v.. .11 JH. J .. rfhf. .. . . .fs ,f . .2 4 -rv .Kyra . 4 ,-'Ai flag, aan X .- LQ I 1 1 ,,,f','5 n f V ll, 5 fan- r!,v' Ai i7J:5 , P ,.'f 'vi' 4 ' -- ' ,--J - 7 'L - 1 V -V.',f, I . f ,MV ' my 1 'V ff' iff . .' ff,.Q,.s, - g,.' ' 'A'-.W '. '....,, Q ' . L ij: I -T 4 4 Af C 1 '4 ? 4 F if .. 'x I. I . 1 5 , , 1 i ff. - ilk , A v.-7 1 i v 7. X. 1 1 1 I, A 6,9 'Fa ,F ' I-41 'ffl 'W- ' 4 4. .','. J 4, : 41 - 1, Y , ' . ,L L 1,4 . My - v 4 1 1 . 1-X ,lv .. v, , f.. ll,- y v ,.. :', 4 1 , . 1. , .. 1 :lx 1' ' 3' . '1 .. ,I 1 1 4 1 - 0 3. 1. ..f If 4. 480111: ' 'nf .JI , . I:-x x V ' ,L -0?-: -i ' 1. . V gm .- f l .- I 1 . 1 r.,,., . I-1 ,Q 4,' .-1', ,. ,.1 . X - . v . 1 1 f A .1 av' K I , . 7 - 1 A PH ,.. 4,.f , . x 4 k Q A V 1 ', .,, ,f y., '- QA., v .w . 1 f A , . 1 1 . Q f ,, fl 1'- v , , , rf 1 J 1 Q 1 V ,A rf, f, 'f , 4 1 3 ,,,. , if 1. f., rs ' 1 I V v . , 4 1 A 4 , . 441 .Ng Academics W, ,....,,,v pxidhs: 'ry 'QW 'N '?4i1,mxf? ...M 'L' . NX , 5 .nuff 5. V.: 4124- ' I K 5 fv wMmMNN . S . M, Ha X- ri 4 ,' 4 A um 'nk -1. 1,5 I ' l C ' vb' Tl VI ff. ' 1 1, - QL, 'I ggffif' 'cl I' 'X 0' W - ' 'af ff? ' lg, L 73 eblfasj -QL, V - ' , f, V' ffl Q 412.3-'yfy li' .I ,QL f1Yj15,1, l jsl-jg:'xfl'f, .211 , f'?,'52I-,X Iwi' . 1' 1' .L Aff -' , , ,A 55fg,fF'p ,fi, Eff , W M .,' , -N ' ,h , I' 4 l ur Y ',..'f,1 50' ,F I . f 'JW 15 an M ,gi ., A, p Aww' QW- cf-A..f.'m f6i is, ,641 5 .,g,35f1? i-,Emu 35 8 n ,ffu uagsam' null 'V' 1 ' '-,Q ' j,: -f ' W' 'I . f 1 -- l?f-ff ' ' 1' F.- A w.gl,i'v'-E 4' ' -'Q n Xvlf' L, 5 f 'fNi 1f 1- 4: '+G?w ,g , I 4iL,,Xw ., I , ', . 'A-swfk -5 . '1-' 1 , . S f- ,fghfi 2 . jg jyfi A- 13,575 4 4 - 'A..:,1g' 10 I V ' 17' fiffv' i .,f'f57',:if -.-.,.. .. N K' ' - I A fr, ,Q dmv-.ewfwfw yr 1.4L ff:g5'.?eL., .. ' ff .3,,- ,A 33, QV, , xgiy' -I In J' . -f e I. . Ln 129 x'- f f' V: A .....,,4QA Qg,g if ' 034' f-111 , L' , 1 .' .un .' 5, ,,2f24a .A .,. , , ! , .., 'F -. 5, ff ':,,,?' J, W LQ , , 1 r 4 pr, Lf.- A - .-61: ' ., 'Mar va4 U. Ar ' rna arf! ' ' 1 -uLn'!l ,. . .gp I '. A' Fw ,f'gf1 lx Lu- L 15-:tif f 1 J, 1 gn rj. , , ,, .. , . A, :. ., :N QMJ ' f 75 524 4--1, 7f f 1 . fi? , S 'W 09 . V 5 il- .' f . .' 7ff ,WW ,2'f4f'f'f5'014, ,IG -' T'--1. 'f:5gt, I . fx xtyq? 'fat A , in : '5 'u.. . M - ., , ?4'-mf, fiff, ,K - T' 'l ,3l.7if ' 1 1 'FZ' F' fl vf 1 .ff .'f', 1 272:22 if L '. Mmww fm wmv +5 Qf' ' ,f QEW4, ' . -1-J jjj: - -- .Q '. , , 'Aix-2 Z , K 1 .I ,a,.f.Vf ,U .' ...-. ' , .... ,gf f' ,.5f,',51g.21,f . - - I n 1 -i,,'f:, J. A 'Tlx ',, 1 ':fj.if1 ?fff , , I '. fp, - ' ,,- fl f Q'71v r 3171- ,Y -. ' . V .I pk .sq ' V' AI 7 I ' 7 ,' 5 1- ' . .-H3 0' .A . f 8 ,-. fb' K- . vc- -- ' . an-QJW' ut 4 l by ll J. ' YS, ' .ly I 'W 'hi' 1 rl hs , , xg, 4 VM A l . ' rl, xv., , w. ,','1. Y rw t ij 4 up ' 4 4 y ff. fv'W,q Q .,x + Y 5 av, -.-V . pl' 1 xx M -dvsffww 2 Q A k,fl,,l, 5 , 4 f 1: x,' T'f9f jf ,L,f,f 4 ! R ' Al llxf, I! ' ' P fl , 2 1 U 1 1 4, J 7 , fx M, ,ww , K-fx., , , 1 fy , 5' l2ff 'f, :I 3- 'j ,,, f 2 - 'll . Hr, ya, f , 1 'f ,,1 .I 1 M 11 1 f 5 l f ' 'I ! rg 7 ?'c 1542! ! A'r'x i f 17 47 I , ul 1 ., , I 3 4 1 K , f 1 1 ' ' rxL , A 1 ' , I ' ' fy! I f ' .l S- ' 1 4 , 5 f ' ft ,Ef ,,Y f f, If 'J 'f 7m 4 5 If 1., 1 J ,'s'f AQ.,-1 , 92-fvw ,a' H' ?M,, v N xv , 1 11 , , 1 .G 1 x 1 5 hgh' I 'f ,I fl' 1 , ff ll 'f , 1, .1 5 :iff 7 . 1 U, I, 5 5,441 N1 5 ' 1 14 A 4 x 2 'S I, VI ,fs . f. Q- Q, I ,- nl 4 1 ' Elf 1'1 11' ' '5s L Lgyfx 18 . ' f 4 A , 3, 1 .n ,x. L I i ', J 'J ,L r: 11 Urn girl! wa, 1 3 L w v U I . xg ' rf. N 1 '13 Sym, ' H. 1 - YI Q Sf ' 1 ' w ' xl , y J1! 1 , . ,1., x X , 1 A Q . ,7 I 'R S ylr If kf7.! 5 ff '. ,' Z J' -3 , u 1 , I ,itz ,J Jr v v Q5 ' . A . . 1 ff ! 1 I I, f rl J ww . ,L SA 41 ,1 x I y 1 .r ' 11' 1 Q, f' 41' V '-. f' 1 I Ax f V75 'N' Lfih J, 5' J' 4 1 c 4. 4 ,QI f,f J' ' K J gr ll, 'g' 9 . A , Q nf , ,L A , ,I gi, ,: , N, 1 far' . ,nf 11,41 f 'C I I D , ff 5 LY N L ' 1 N 1 x, 0 J f 1 I 1 1'lf 'I 1,13 rx. 1 I 5 T I' Bw: ' 'X gfx, 5 VV 1 , 1 N -'Cl I' I ff, up 1. x r: 4 L' 1 1 4 X 1 I xl I I1 gli 1. 1 x x ' ' H f .1 If 1 V G 1 fngyne i' Q n ll gr tix S, ,H ri ,' 'f' I V I Saw ffm .,, ,W 5 1' m zz' c F K df L' ' X , ,5.,g .q' ww , , 1' ' if ' Letl nys' 9 Xxxg' , ry ' 1 'I X 5 K fl! :ui I '1 , wi '7 QJXS f 71 'J ,, v 1 I 5 1 ,H r -X 1, ,.' I .42- 'flL1 , .guy ffnif 1: '., J ,Eglin-4:46a The Student T acher Pittsburg State has long had a reputa- tion for turning out good teachers in every field of education. The university has excellent programs for elementary curriculum and administration. Stu- dents can receive secondary teaching certificates in almost any field they're interested in. On the following pages are close-ups on a few practice teachers this year. PSU students have a choice of 31 school dis- tricts within a '70 mile radius of Pitts- burg in which to do their practice teaching. They may also practice teach in the Kansas City or Wichita school districts. WJ? Xe sw 4. 'E' if s,.s ,E , 'K Richard Magee, industrial arts I feel more at home in a small school because I was raised in a small town, industrial arts senior Rich- ard Magee said. Magee student teaches in his home- town of Fort Scott. I can relate to problems in a small school, and I dorft want to live in a big city. As an industrial arts teacher Magee will teach high school classes in metal working lweldingl and wood- working, and junior high Industrial Arts Curriculum a Projects CIACPI such as World of Construction and World of Manufacturing. Magee is satisfied with teaching high school age students. I like older kids. I can relate to them because Pm not that much older than them. Now I can see reasons why I got in trouble for things in high school that I did wrong and the teacher didnit like, like not wearing safety goggles. One of Magee's classes is an all-girl shop class. They seem to work pretty hard and enjoy what they're doing. It's a new aspect to me in industrial arts. Regina Bailey, elementary Magee added that practice teachers shouldofttget too discouraged. They always have to act as secondeiro command, because the teacher has final authority. f'I feel you need more experience. If 1 thinkifm had after a year out on my own, then .PH get ou:t.e1 wouldnit subject the kids to putting up with mefif Magee decided to teach because he enjoys seeing being around young people. He has a desire to see kids learn and improve. Pm certainly not in it to get 1-ich! - V R k i 'I we-M 4 Individualized instruction is very: important to Regina Bailey, who student teaches fourth grade at Eugene Ware Elementary School in herd hometown of Ft. Scott. r e Bailey attended first and sec- ond grades in a one-room school. I like small schools. I've got 26 kids in' my class this semester, but Pd like to teach, a class with only about 20 students. I think thattmost children in learning disability classes wouldnt be there and would do better if classes were smaller, Bailey said. I like fourth grade because theyre still young enough that they respectfthei teacherg yet theyre old 6I101fgl1.iZ0i,dC5 things on their own. I ieii ' aaaeysaie she.waaza'1iieQt5 have taken e1nore extensive psychology courses. Wfhe pSychol0SY Courses wetre for quired ew aka dents-quite prepare you to handle the childrens 1 problems that .a teacher has to faceigin the classroom. o g Bailey is energetically' look! ing forward, to r teaching n . on her own. I 10'V8.CI1ilClifQ!lQ, and I think that aieyea ,exf i cited a about learning. they have 1a teacher who's iexcited about machine .It'SV3.C1?31' ienge, and! loveehallengesiv Kathleen Farrell, elementary Kath.1een4 Farrell, a Parsods sen- idr, student teaches kindergarten classes at Lakeside Elementary in Pittsburg. ShE has 22 students in a morning class and 21 in the after- noo11. j Each two-hour-and-45gminute session of class follows a pattern, Farrell said. The students start the routine at 8 aan. with units about the seasons, history dike George Washington! , holidays and other special topics. Next they do problems in Reading Readiness workbooks, learning letters and sounds. Then they work on num- bers for awhile. Finally it's snack time. After cups and napkins are put away everyone settles down for a story. Social play, when the children pick games they want to play, ends a kindergartnefs school day. The short attention span of the children makes it necessary to keep things roliing, Farrell noted. But she added that she enjoys the age group she chose for student teaching. I might go up to third grade, but I don't think Pd go much higher. Since PSU's education depart- ment changed the structure of some methods classes for students going into elementary education last year, math and reading classes must complete contracts. A conf tract has a list of objectives to meet by doing various activities. One activity must be completed as a test to prove that you learned your objectives, and a written re- port must also be written. It makes it easier to study what you want to. The classes arexft as structured as before, Farrell said. Fa1:re11, Who thinks highly of the Pittsburg school system, said she'd like to teach in Pittsburg after she graduates. She comment- ed about an important aspect of the system. Pittsburg has a read- ing teacher for slow students who visits several schools. The stu- dents get lots of personal atten- tion. I think that's really impor- tant. Doug Forbes, 23, a physical education :najorg finds that the grade schoolers at La- mar, Mo. are already highly motivated. 'fl xfeaily enjoy iahefkicls hereffhey are so conscientious about their Woik, and really seem to en- joy itf That enjoyment is nee- essfgry .pie fd!-5 any, learnirig exf p6EiQBC6.'?w' L Q , has been one of the most positive influences during college. Pm getting more ex, cited as the time gets nearer. Already applying to places like Wyoming, Forbes hopes for a small to medium-sized school system, He attended Pittsburg I-Iigh'Schoa1 and feels larger sehoois Acaxft dof , -N QFQ1ibbS,ifw hQg wi11w fhqld bmi- as much for the students inn iggqgjiuj7bi0Iw, g1 teaches alsa dividuailyg The more stuf jilrgiqgliiglx gm11seniqr dentslyou have in class, the 11e5?i51i4gHe ffiiiiiSiihefifzor- ' 1ess ti1nefy011 have forindi- i1re1atidh .i1betveeen vic1ua1',a-1:cfex1tion, and I be- vL3iiiarQL'Gxi:h1IQi3tQ' 'The' pro- 1ieve i1i's important' to have a' a1meygt pe:feef.QIgrea1- me of time forithfitf iz1y 1eiijby'1 gaing back taocam- q . p.,.l A , jpus11Qmc1 1isf1Hi1ing ifQw theoth- As far as Schdol syszemsgn, fer Q53t1idqe131i5tegcherB4 Howev- Forbes is afraid that there is gejrgfi was Sdepdirtmen- t0o much st1?ess'on sports to- .5fiQ5IiZQd,iQ.f'Th6i1- in Q ', smalier day. 'Although Pd really kffi1lPS , ' W would wm1k 3 witn like vm coach track ana field, 3gem3hg1is'f Kin W' Similar- prob- Ibelieve i:here's'an overall A,L,V.,, A i ,AKAV Ki ,A I rm V, ,A I I Q?9?1QQSQQ'5?id1 115'T31W9Y5 wwwitf ?6Hf2h+ 1 fffBf1dQ.'2iS11f:110W fgi12gn:'f5mgre H'int0 i:eaehing 1t11an W 45 , Q A, 7 feHGhH1'S-F0rQme,'wachingiS g3E Y?'?'iG?11Ge1if This Semester tendency 'to let the sports overwhelm the scho1aSi?ie as- pect of school, It'a na one's fault except the ccaches and firstg cpaching second? Doug Forbes physical ed Sffdiyattiifgg mix: fiafiiitibfiili Sandy Wheeler, elementary said she is impressed with the student teaching program at PSU. Many schools expect you in class on campus for a few weeks before the teaching begins. With this program we go Mondays to campus and the rest of the week is spent teaching. Wheeler attended a small school system in Thayer, but prefers the medium-sized school over the large and small- er. The medium-sized schools are equipped well and this helps with teaching. live read so much about the trouble with large schools, that I'd rather teach here. Wheeler said she only wishes there could be more parental interest in school systems. I believe Pittsburg has a really great PTA, but many schools and their students suffer because parents refuse to get involved. You hear a lot about teachers not doing their job. Parents have to help too. I believe Pittsburg is lucky to have the parents' involvement. Of all the endeavors with her student teaching, Wheeler is most impressed with the learning centers within the class- room. The children seem to adapt well to this set-up. Instead of a formal teaching method, we divide the class into smaller groups and work on a more personal basis. They are thus able to help one another too. Rebeca Langan, English X0 - I 'x xx Wheeler plans on taking six hours this summer. She also hopes to get a job in Pittsburg for fall while her husband finishes school. f'Although I chose primary, I feel confident about apply- ing for a Job since I have been here. This has been my best semester as far as learning is concerned. Wheeler, who said teaching should always be a chal- lenge, added that she had always wanted to be a teacher since grade school, and the closer I get, the more excited I get. For Rebecca Langan, a 23-year old student teacher from Atchison, stu- dent teaching provides a unique learning experience. I guess I never realized there could be so many dif- ferent personalities within the class. You can't use the same concepts with all the classes. Langan, a speech major, teaches public speaking and Eng- lish classes at Pitts- burg High School and believes the uni- versity has provided an excellent method. They get us started teaching immediate- ly instead of waiting six weeks for our ori- entation. I enjoy the Monday session on campus because of the other teachers' feedback. Although excited about the teaching field, Langan admits she sees proh- lems within many school systems. There's a great problem when a sen- ior can't write a complete sentence, or can't read past a sixth-grade level. I think the students have been ripped off of their potentialf' Langan suggested that Kansas should bring the Competency Based Education system into action. We would then have a good foundation for high school. Langan hopes to work in a large school as soon as she gets her degree. Although I attended a mid-sized school, the budget of a larger school attracts me. There'd be funds for de- bate teams. There's also more talent to choose from, although it may be difficult to give attention to the indi- vidual. Langan, who balances her school time with her six-year old daughter, plans to go right into teaching, al- though I'd like to get a double minor - English along with German. Right now though, I'll try to get a job, hopefully around Lawrence. There's an exciting future ahead Nursing grows at PSU Nurses are the largest group of al- lied health professionals, and as such must have the ability to adapt to a variety of health care demands. An education in nursing must be responsive to emerging trends in health care. Nurses receiving baccalaureate degrees from Pittsburg State are prepared to perform as beginning professional nurses and simulta- neously prepared to seek further study to fulfill educational, re- search and professional needs of a changing field. In the 1960's, a movement began in nursing to expand the role of the nurse to meet the increasing demands of the public for quality health care. The impetus for this is largely due to forces outside nursing - the shortage of physicians, increased consumer demand for adequate health care and improved technol- ogy. The expanded role of the nurse has required advanced nursing skills which enable him to assess the health status of an individual or family, screen health problems that need to be referred to a physi- cian, manage acute or episodic ill- ness, manage stable chronic ill- nesses, teach health maintenance and counsel patients about health problems. Not only can the nurse practition- er make a significant contribution to illness care, but an even more significant contribution can be made to much neglected wellness care. The nurse practitioner can provide optimum health mainte- nance through health assessment and health teaching, thus provid- ing the foundation for the full cir- cle of primary health care. One of the barriers to the nurse practitioners expanded role are nurse practice acts. They are gen- erally considered outdated and impractical primarily because they prohibit nurses qualified to diagnose and prescribe therapeu- tic measures that are within the scope of nursing practice. At this time, the Kansas definition of professfional nursing is under- going revision to reflect changes in 5, nursing practice to recognize the expanded role of the nurse. When the legal conflicts are re- solved, the professional nurse in expanded roles will be found in hospitals, extended care facilities, clinics, schools, industry and pri- vate homes with a greatly changed health care delivery system. l firmly believe that nurses have a much larger role to play in the delivery of health services . . . nurses still have a long way to go to interpret to the public and employers what nursing really is. I feel good about nursingg there is an exciting future ahead for nursesf, said Cecilia G. Waggener, retiring chairman of the nursing department. Waggener, who retired at the end of the academic year, was in nursing education since 1943 when she taught cadet nurse corp students. In 1947, she became a nursing arts instructor for Mt. Carmel Medical Centers diploma nursing program. She later became Director of Educa- tion for that program from 1947-1964 and Director of the School of Nurs- ing from 1964-1970. In 1970, a decision was made be- tween Mt. Carmel and Kansas State College of Pittsburg to phase out Mt. Carmel's diploma program and initi- ate a baccalaureate nursing program. Waggener accepted the position of the chairman of the co1lege's bacca- laureate nursing program, and devot- ed the first year to development of the program, recruitment of faculty and investigation of clinical facili- ties. In the fall of 1971, 35 junior nursing students were admitted to upper di- vision nursing courses and classes be- gan. Waggoner's initial goals and objec- tives for Pittsburg State's baccalau- reate program were to develop a strong program with state and na- tional accreditation and to obtain a well-qualified faculty, enthusiastic student body and good physical fa- cilities. Now, at her retirement, those goals and objectives have been realizedg and new ones have taken their place. Among those goals are increased in- volvement in programs for registered nurses, a program for school nurse certification, improvement in oppor- tunities for student clinical exper- iences, a possible master's program in collaboration with a university medical center, and involvement as agents of change. I firmly believe that nurses have a much larger role to play in the deliv- ery of health services, Waggoner said. There is a greater interest now in the cost of health services, the number of people who are still not receiving services, the emphasis on wellness rather than on illness and the high cost of illness care. There is more interest in the nurse as an independent practitioner, in home health care and chronic disease and geriatric clinics. With nurses that are appropriately prepared, these patients can be taken care of in a nur-se's clinic. This practical prep- aration must start at teh baccalaure- ate level. One of the things that Waggener be- lieves has caused difficulties for em- ployers and consumers is that they don't differentiate between nurses. Nurses can no longer be expected to know everything about nursing. Nurses still have along way to go to interpret to the public and employ- ers what nursing really is. There are still a good many people who believe that nursing is the carrying out of medical orders only. It is important that nurses under- stand the medical regime and modes of treatmentg but professional nurs- ing is much broader than that. It's up to nurses to educate the public and be good role models. In reference to the changing status of nurse practice acts, Waggener said, There is a role for nurses in promo- tion of health and care of patients with health problems that is quite different from the practice of medi- eine. There is an independent role for nurses as well as a dependent one. This is only the tip of the iceberg. We are only beginning to identify the kinds of things properly prepared nurses can do in the delivery of health care services. -v- 'w is .- Clefk Singlef0n. associate professor 'Practicing registered nurse, l wife and mother oWil1:oa Hansen is one of 45 nurses ienrolied in obeaccaleureateo inorsingg o courses, at l Pittsburg iSiief4E49ThB numbefffofooSS0Ci8i1Ge degree and di' jpigmg dimmed greciuaijee rizuifning to work on ebaoiielorj ofioeoienoeilnursingl degrees has o in- fimeeffrom elle four inixrees that first eefei ef 1971 l e i fron! diploma 'soliool in v fSHPB1fViS037i 'assistant df' freefor efeereioeand director ef nursing Service i of Heelitioiseifvicesaip esmali privatehospitfal in i do ieteff nurse, e head A?'ALf'bQIlgr8di1af'i0h,fIfl1ibB going book to create e fneye roleeffotimyself. Ijhope to workin my areas Gofiexperiiieelee independehtnuree consultant .io otiierffalliedo health professionals. f e poem we cheoging care sys-i e geese isgmyjpxfime motivationlfo? acquiring my 'bachelor of.ecie1toe5in,nurSing. Ae e professional continuing and ,reeearcil are flieemearelreeuired fe oieifiefeo Cleese and ore- egsreeieoeeaowtlwe'? Sed-i e l , Pittsburg State University die thefpritnary nursing education center withinlie hundred mile radius in the four state area and Kansas ie oneof the few states in the nation thai has i instituted mandatory continuing education for registered nurses, Anita Clark Singleton, associate professor or nursing and coordina- tor of continuing ,nursing leducatioxlisaid. o f'Thie unusual situation places a greetodeal of responsibility one Pittsburg State' to provide adequate continuingzedueation programs, l Singietonosaido, i l 5 l, l We can see algreet need foremony more programs thanthose eweeare presently lable to provide. I would Iiketo seed the offering of onecouree per month and the deveiopment of varied clinical experiences for both eR.N.s and basic studente.i The 'baccalaureate pro- gram here has ae commitmenito provide short workshops andgcrediti college hours for registered nurse articulatioxmf' Singleton said. Singleton believes that an aggressive con- tinuingieducation program is essential and that Pittsburg State must continue to grow and develop programs at a rapidepace in or- der tomeet the needs of registered nurses in this area. i l l e Wilma Hansen wwnmufefe 5 'Ulf me 'N'-w..,,s Laura Cunningham With the necessary preparation, I hope to assume one of the new expanded roles of the professional nurse -- the independent nurse practitioner, Laura Cunningham, senior nursing student said. Nurses in private practice can deliver cer- tain kinds of health care services more di- rectly, with less cost to clients and with higher levels of consumer sat- isfaction in ways that do not conflict with and are different from medical practice. The independent nurse practitioner does not deliver second-class medical care. Nurses are no ionger physicans' handmai- dens. As licensed indi- viduals, nurse practi- tioners are responsible for their own practice and accountable to their clients for main- taining standards of practice. With collaboration among professionals the key to quality health care, Cunning- ham said she believes that nurses have the right and responsibility to acquire and utilize whatever they can within the scope of nursing practice to fa- cilitate using such new methods and ideas. The Vocational Student For some students, basic college classes required for graduation seem like a waste of time, effort and money. Such an attitude does not motivate students to get any satisfaction or knowledge from the required classes. Pitt State has an alternative for these students and anyone interested in the programs designed for concen- trated training for specific skills in any one of these areas: cosmetology, welding, cabinet and furniture mak- ing, auto mechanics, auto body repair, drafting, ma- chine shop technology, air conditioning and refrigera- tion, electricity, clerical or secretarial and printing. These programs cost less, take less time to complete and require a minimum number of general education courses. The first ten programs listed are taught through the Vocational Technical Institute. Students take on-the- job training courses and receive a certificate at the com- pletion of the program. Each program takes 20 months to complete, two nine-month school terms and two months during the summer between, except for cosme- tology, which takes nine months, and auto body repair, which takes 11 months. The secretarial for clericalj and printing programs are also designed as on-the-job-training courses. The busi- ness department offers a one-year program of a secre- tarial or clerical sequence for a certificate or a two-year secretarial science program with a choice of emphasis in the legal, medical or general field for an associate of applied science degree. The two-year printing program is offered by the printing department for an associate of applied science degree. Pitt State's Vocational Technical Institute is rated as one of the three best post high school vocational techni- cal programs in the Midwest. For the past 15 years the institute has boasted 95-10071 placement. Institute di- rector Leland Boone remarked, We really have more problems having enough students to go to work. We receive offers for more jobs than we can fill. The only two things that Vo-Tech students can't do is participate in conference athletics or ROTC, Boone said. They can join any fraternities, sororities or clubs on campus, participate in music or theatre activities, play intramural sports and live in the dormitories. Before 1954 the Veterans Administration offered war veterans technical training on campus through the In- dustrial Arts and Physical Science departments. Later this was developed into a non-college vocational de- partment. In 1954 the name was changed to the Voca- tional Technical Institute and Leland Boone was ap- pointed director. 'W 3,3 Q J 'Ife:rvffHa1'1fiSQn, lafifSf:ye8r thatempldyerwfiilfhirefrwof e1Qq:1:rigity4 stude411g1:,grma11ageS 2 zsfearj: Students g3ustf as mick sq ga5rpgfcIaSS4gforfi30 f 1murs 'l ,aS, i1rqnickef i1han, foqrfyear gweek, lag11d fdfive l whomei eaf2h l 'griduatesy ffhQi:au5S4ef?, Wl6 1Z15013? ?Ug1W0gk-1 0151-' fiU1!?iii c5?im3ia5t4gf' ,f Wf1WQ ?fQiY4E5Z Q5fs1QS18 i ai! S fQ1 !a98QfYQ WQ1' i11EWii f?l . fI1fD, +4 iwiiiiliiiifwlifiligeifiifHlmiiivie 1lBi3lSeW?1!1SiH8fi 9fl5f1i5t1f0f.1?S?? ' bQQause fhsSfliw the4iprograml hY turesiwel work5 wifhg41agfice4fmd l ai151?it1:1 Swfe4 l 4f i 44:2 iii g'k5i?W1Pd89 lWhilGgWeffH 5665132 f gr1gf 'AYf ff '7 ' i55?i11111i6'b0rfiQ11ff?f1 3: i1i K5ii+Z '11t?6fi'6?3iiiifECh ffffj1iQ117? 5eii2Y9g f f:SE1S5 ffe??55f3i381?iD1?2 Hthatfihbyihifefalii 12118f 5 fhddedr 1111850 werG x COli1d1 bB f one ifQ1i 0Vein5mi3ifI?ekvf0f 5354 f won ygfii 69 1io +AmQ1:heri faclvanwge1 Qfffihe h2r1f1e raore vuwidezworkewinf 9VQPT9C1?1 QC2GD9effiIi4911t Glllffkid C0m9Qfiiii50ii813I C1U?' ghegfti tim6FfiguiredF52iif?84?i? 'd A i SQh001. jGfah 5SiV8 fag CGi'ti5GR?5GQs gf Hf?53FfUi 9fSHi?1?ff ''lliiiiiffffHkivifiegiilfgfliffiklgighti firieahsfivbi f ffrbiii EffhHif i9iP93Si9fiC?9i 11liif5kefs? R11d 1we Qaxxffilidh W6fi:G6H1ii 1i6ff6rQf106f1Ti in jobsccnerff HeAa1S0lbeiieves Sbhfwi-f' Q S andyBrunk, PsU?s fepufgiiim a1-ia 1acazii1nj Siifew sgiidy an nqsnietaiqgystgudent. f'I?d hee.rd that Pittsburg was , one 0f ig1re hest schoo1s arou31d4 I fiidn'tfeven 1061: ads any , Qth9f f3?h001543, g ' f '. M cosmetdogy A lib6f81 8ItS Qif1it6dfifiD fit 515115 Qffigif High school, QI didn't Want tango to Sciidol that iongzffhe cus- , gmenoiogy wqrse iw 10f shorze1g1and aes a1pqpenf5lfie1e1 2Y?1f?fe i0bS af2 eaSY w f'i11CY5T f Y 4+ ' 1 f gBrunkl menu1Qnee1ithafqsame he? fQ1asgeg within f,1fi:hgsm4y of coametfilogy-inegf.fde seIe?btricity4sbacfersiblogyf eg ifgf:iiiGQis12r:Q'afh:xatQmyy af16 lveribfiaiiwdeffeI0:in1i21ih lbe4 Qf QSQQSQ fthe fobrfinuglggsoxis Ciittirrisiyiizigal 81'1d 'h S h156ntf'e1itire1y in the c1assroomiDuringi, ti1e next? four' i Alesieisa2xQ5alisfudenf ' , QaglvancesF110gifIiGgSa3Qri SfaQefQf4th61i5t0grdmfShffioi hdfmay expect .1:o4werk v51iftwof or three busibrhbrsi a t1ayf0h3Satur- 1 da S 4, Wilford Huston, auto body repair Marc Potter, air conditioning Marc Potter, a Baxter Springs sopho- more majoring in air conditioning and refrigeration, said the main rea- son he chose this field is to finish school in two years and go to work sooner. And I didn't want to take all the general courses, but just get down to the basics. Besides, it's a lot cheaper! Potter said he selected Pitt State be- cause its program is one of the high- est rated in the nation. About 97 percent of everyone who graduates can find a job. Anyone who wants a job can get one. Students reinforce what they learn in class by practicing on refrigerators and other items. We help out frater- nities and sororites and many other people on campus. The law says we can't charge people to fix things be- cause we're not licensed yet, so we do it mostly for practice, Potter said. Wilford Huston, a first-year auto body repair student from Pittsburg, admitted his opinion may be a bit premature, but he agproves of the program I haven't seen any pro lems yet with the Vo-Tech department. Maybe there are no serious problems or maybe I'll see some later. Although we seem to have a heavy load with 30 hours a wek, I think it's necessary, Huston sald It's a lot like a job, I suppose, and that will be a help once we get out of school. Huston juggles his time, working part time at a local donut shop about 30 hours a week besides taking classes. By going with the two-year program, I don t have homework. With working outside of school that could have been a handicap. Speaking of the advantages of the two-year program, Huston said, I never saw much in a piece of paper the diploma. I'm happy to get out to go to work sooner. Huston, who will be certified in 1979, plans to work for someone first, and then, hopefully, go on my own. I have no worries, as the experience has helped. Qisssvmv' e 5' e 1 Potter said that most graduates go into business and industrial work, such as installing and repairing large rooftop units, because there's much more money in that area than as a repairman on household units. Pot- ter is no exception. He said he plans to follow the more financially re- warding route after graduation in May. gveniencecotl ettin out early with the two-year Anthony Gorentz, furniture ri making JeffF PP0f electfcmcs Accordiiie to .leffiFlipiJo, eiectronicsl stu-i edentf having to spende3O clgss hoursiperooweek, in the same classroom with the same two l Sseacliers ieanget boring. i y i siflipee, as flrsil-yew Yo-Tech Student from so Doufassg said that he plane to use his school-i c ies s , ,JA, y geineefeinte medical orephefesrephie f eiectronies and that he beiievesvthai: thereon? f Antliony Gorentzi of Arnie enjoys isheiliours he iputsi into his Cabinetyand FurnitureiMakingyclasses, perticularly, his favorite class, Upholstery: I-Ie plans' to workin aicusivomsr shop after he receiveskliis certificate and wants to open a shopyof his own in 'l3h8'Y1081 fl1lil.l1T6. fi W iv if ' ' a Gorentz9says5 he ifeelsiiiihaffin His field,ewVoeTech education ie more valuable than e, liberal arts degree. People seem to be hiriiilg people with Voe'2I'ech certificates mor 51-eadsly than those with a fancier degree. Our classes are more concentrated. I came Mto etuclylfprimarilye ufiholsfteryglrln the fear-year rogram for a degree in wood they only offer one semester of upgolstery. Here we study it moreein depthsovezqstwogyeazsi I get to study what 2 want in less time and more thoroughly for less money. Gorentzihaclito sign weitinglilisfffes scliooldjunior iii order togget ,intostherE'SUsfprogram5whep heygmduated. 'They only take a total of twenty students. Right now Mr. Farley is teaehingizhree groupsyof students on three different levels of the Program. iiii l i A i i Jails Farley, iiistriictoii, is fihie oiily lab feacher for the VofTech students. Gorexatz commentedfl think that's kind of good, thoughl If We hed more than one teacher they might teach youeto do thingsfin confiieting ways arid ggi yogi confused. Students in this department receive training in cabinet making and finishing as well gas upholstering. e' 3 i igrazited fotos ' i ?Vo-Tech r students. jwonder why we ca:n'tel1avei pa1'1sia1 fbrogsrgm ivigiehalie hiiii toiecqtiire ii good job Qne .major improvement Flippo eaidfiehe would like to see marie ewouid be to have college credit i Thirty school hours a week, plus the iiilsaonieworki ixivolvied ,eee can cube quite a bit of work, and at times I credit. J Although it cangbe boring, Flippe admits it's nite not having to worry about the required courses that tlie lilieraliiarts fstudentsrhavei to, worry about. Not havin to worry about term papers and image 1 lish exams is great? Althoj 11 he mee to be abie to were ggifeeiyc- Weil ee em-iyg Flippo saidihe would like to see a change of Scenery. The some oiaese room can become monotonous. Susan Ferrell, secretarial ey. t..,, It qaev- ' Robert Poole, o printing Susan Ferrell, a Pittsburg sopho- more, is participating in the two- year secretarial program from which she plans to earn an asso- ciate of arts degree. I think Pittsburg State has a good program, Ferrell said. Besides the seeretarialprogram, there are courses designed for le- gal secretaries which include le- ?al shorthand and Law I. I earned how to type up some le- gal documents 3 deeds, wills,rand contracts - in my typing classes, too. Ferrell has been involved in sec- retarial training since high school when she took office edu- cation classes at Pittsburg High School in a program that includ- ed working on the job. My first real job experience was working on the I-fittsburg Bicentennial - Centennial Committee. After I started classes at PSU I Worked on the Pittsburg Arts and Crafts Association commit- tee asa secretary. I had a lot more responsibility than before. I had to bring items before the committee so that they could de- cide how I was toract on them, Ferrell also saidrthat 'business communications classes helped her a lot with composing busi- ness letters for the committee. Ferrell also works at Raroseyis departments store in Pittsbur . Her secretarial duties iincludi bookkeeping, filing and typing. I like it,', Ferrell saidg I think I'll stay there awhile. oe-some feeeeriesieeefisesee eases sssiioniersierintinsfmsior,ss-if12?fffPi1hfsb11fsie gvfeslffmfi is rated time 'Of ftheishi 3568112 'ini 'l3l'!e'I18'lii031' Besides it Was? 95099532 riioliieifefwnitelamlmeirmgf ior' elrl. r irlr L I anxious go work and Wasitoldf that theifewesrlliif lrnuohidifferenoegbetsveen tbetwo and four-year programs I wanted to have the 'trsining'goVer andjget out working one the jobi Printing is e business tyovfvee just get to practice and work your way i up inf? or ' l i f Pooleworks asalpiiotographer and photo editor on the Cellegio and finds plenty of Waysto put his printing edu- cetionjto good uso. alt helps me understand problems between creating--F stories, piotureswedsi -- and producing -4-' putting everything together. I can relate to process limitations andedeacllinesf' r I l After aduating Poole finds the idea of working on a smalliily orsemi-weekly newspaper inviting. I want to be lable to haves designated position and Work up to a position of autifiorityf' Q l l i t l r t 1,ll,probebly corne back to school after Fve gotten myself establishedlin printing' and get at bachelors degree in something -- maybe journalism, he said. i Shelia Carpenter and Randy Shipman, drafting Shelia Carpenter, a second-year drafting student from Weilsville, is the only girl in her class of nine. Carpenter said she doesrft mind the guys have never made me feel out of place. She said her goal is to work in Kansas City in electrical or structural drafting after receiving her certificate in May. it Carpenter came to Pittsburg be- cause the drafting program is rat- ed the best in the state and be- cause PSU is fairly close to her home. I didn't want to go to school for four years. I chose drafting because it was different. I tried it in high school and liked it. I aiso have an aunt and uncle who are both draftsmenf' Carpenter isn't working while at- tending school. It's hard to find a part-time employment in this field with hours that don't conflict with time spent in class. I don't mind going to class all day in one room. It's like a job really. There's a job atmosphere here. Randy Shipman of Pittsburg is another second year drafting stu- dent. Upon receiving his certifi- cate, he'd like to go into illustra- tions and later continue his educa- tion with classes in commercial art. After living in California for 16 years, Shipman and his wife moved back to Pittsburg, and he began managing a restaurant for his father. It took up too much time that I couid be spending with my family, so I decided to work on a degree in drafting. I've always liked art, and drafting is just an- other forrn of art to me. Shipman would like to finds job where he can live in the country. California made me tired of large cities, he said. One improvement they've made in the program this year is chang- ing the method of teaching trigo- nometry. Students are being taught to use calculators instead of iearnin solely from the Smoley tables- which are used mainly for structural drafting - because most companies don't use the tables any more. I wish they had done that when I first started the pro- grams! Shipman doesnt mind a girl in the classat all. 'fi think it's good to have women coming i into this field. Shelia does 'net as Weil as I do -- sometimes lietterin Phillip McNew, welding The job atmosphere of Pitt State's welding pro- gram attracted Phillip McNew of Pittsburg. I figured I could get more training on the job than by taking courses outside the program. We're ex- posed to the trade more, and I like the job atmo- sphere. McNew, who works at Pittsburg Steel, glot his job through the Vo- ech pro- gram. The foreman called one day and asked for some students who could do a certain kind of welding. About five of us applie . The program is beneficial to McNew because my training relates to my Work. Every time I learn something new I find some way to use it out there. They chose the classes for the program well. McNew also said he found that being able to evaluate the classes was beneficial. The Institute has lis- tened to our suggestions and acted on a lot of them. This year they added a section on pipe welding. It's important. A lot of companies use it. After receiving his certifi- cate in May, McNew wants to work close to the Pittsburg area, . .. prob- ably with one of the coal companies in mainte- nance-type position. That's what a lot of weld- ing jobs are. Gene Livingood, auto mechanics Gene Livingood, a 20-year old auto mechanics student, finds the hectic week in Vo-Tech worth it. Although I go to school 30 hours a week, it's a relief to know I'll be out in another year. I didn't realize there was a four- year program, but it wouldn't have made a difference to me. His two-year route has no scholarly disadvantage ac- cording to Livingood. I feel if you canit learn it in two years, it's doubtful that four years would help. Livingood also said he liked the way the program was set up. I didn't Want to take any college credits, and I don't feel they are necessary. I feel that a large percent- age of Vo-Tech students learn better by actual- ly working with their study, instead of listening to lectures all the time. However, theory is im- portant. Livingood, who plans to open his own shop upon certification, finds only a few minor prob- lems with being a Vo-Tech student, like not being able to enter the sports program on cam- pus, and having to live on campus your first yearg but that's part of the sacrifice. Administration eads Th University Right: Dr. James B. Appleberry, Presidentg Dr, James Gilbert, Vice-President for Academic affairsg and Dr. C. Ray Baird, Executive Vice-President, are standing on the steps of Carney. Below: Presi- dent Appleberry delivers his Apple Day speech. Lower right: Administrators are shown talking with students after the Apple Day Convocation. Dr. Gilbert . Pittsburg State has a new vice president for academic affairs, Dr. James Gilbert, 48, who feels that education is the most powerful force for constructive change in the world today, but we are not taking the lead. Dr. Gilbert, a psychologist, brings his background in management and his ex- perience shaping academic policy, along with his credentials in administrative work as the former associate vice-chan- cellor and associate dean of the faculty at Indiana University-Purdue Universi- ty at Fort Wayne, Ind., and took office January 23, 1978. Education is something more than simply training experience, it should provide you with knowledge, the skills to use that knowledge and a value sys- tem that cares about something besides itself, Gilbert said. Concern about the problems of the peo- ple around us should be important to the students in college. It is important that we get concerned, that we care about others, worry about their failures and get excited about their successes, he said. I feel that it's important for universi- ties to take the lead in solving impor- tant problems that face the world. We haven't assumed our role as leaders in 30 years. We need to be proactive in- stead of reactive, to take the lead in such issues as civil rights, the environ- ment or consumer advocate problems. We should be out in front of these is- sues instead of bringing up the rear. The role of the university, according to Dr. Gilbert, should be to foster the cre- ation of caring in the students. Arrange a situation that provides an opportuni- ty for personal professional growth of both the student and faculty. Gilbert explained the development of a strong sense of values is the first step to caring. If a student comes here, stays four years and leaves with the same val- ue system that he came with, then we have not helped him. We should teach him to ask not just how, but why. We want them to test their value systems. We are concerned with values, we have . . . the new Vice- President for Academic Affairs, speaks on education. an obligation to provide more than just training. Education is more than just training because education asks why, instead of just how. Faculty has a distinct role in this pro- cess, Dr. Gilbert said. Their role is to facilitate students' learning, to dissemi- nate information at the optimate po- tential that the student has for learn- ing. He passes on his own methods he has learned for searching for truth to the student. The role of the student in turn is to learn. We need to rise to the heights of the times and face the issues. Our creativity is limited only by our own minds. You can't solve problems by assuming that they can't be solved. We are important here. People who do not value trained educated thinking are doomed. It is time we cared, and caring costs. We can be ready to pay the price. i 79 Deans ,,..-fn' ft Dr. Richard Welty School of Arts Sz Sciences . Dr. William Spence School of Technology Sz Applied Science . Dr. Richard Hay Center for Business gr Economic Development . Dr. Wesley Sandness School of Education . Dr. J.D. Haggard Graduate Studies epartm nt Chairmen Arts and Sciences The School of Arts and Sciences con- tains a variety of study opportunities for PSU students. Programs are pro- vided that lead toward either a general or specialized education in eight degree programs. Formerly known as a teach- er's college, PSU looks to its arts and sciences as the foundation of the uni- versity. There is worry, however, about trends in education. With university status, PSU suffers from the lack of a full time philosopher, and finds several depart- ments threatened because their offer- ings are academic rather than skills ori- ented. Dr. Reed Schmickle Art Dr, Ralph Kelting Biology Dr. John Reed English . N-if 5 ., ,gli ' ,ffjfw ,:'fi?'f 'f'P: ':iN3-f f A Affsffffte 'J l l X.:- , ,Q f f w, . Y,,, ,. . N , , 5' W 5 , S ,V ,M N sr ' 1 X N 'Q ,A , .' mis: N N5 . an-sg!! w N 7 f fn R by e ' f Q 'Z ,V f3 .v1X 9 l' ef 1,25 -, ,ffm wx, , , Qx, . , X , J ., 5' Q fm , fl K. , K l 1 jg as I in' 'X 'f fl 1' x . i ,JF W :,. cle ' 4 Dr. Melvin Potts all , -'I flfililq. ' --:f,, .aQ,f Chemistry -., ----ff,-V , ff, fx -,,L,q,,l K, I .:. ,xxx-.,,5., A '- :Qi - gill? .. sw Nate Ai- . f. ff A Xiiffs ' Weir:-P ,,-54.1. i NYC? f .vi Z' 'lifk W A SJ 'v 1 X 3 I x ll: Q-,L xr J- Ami 331 l 'Qi S' X' if i - I Mary Nell Bowman Home Economics Dr. Henri Freyburger Dr. Helen Kriegsman Mathematics Foreign Language 5 'iv Q f' e ls y - f 13 45 f, ?' si ,iv V d WMM lr 42 W. .A ff f li l' .av-W ' 'W' 4 Dr. Dudley Cornish 4 Mizqpflf X , ,1- History i1j??q.,W iw V 5 MW EM o 5, if Q, . , D Dr. Millard Laing Music Col. E.W. Hollenbeck Mlhtary Service up-al ' f' Dr. Bruce Daniel Physics Cecilia Waggoner, R.N. Dr. Harold Loy Nursing 1 Y Speech and Theatre Dr. Elmer Williams Social Science ...M Business and Economics Guy Owings Accounting V1v1an Nemecek Computer Science- Information Systems Dr. Henry Crouch Business Administration Dr. Morris Stevens Economics The mission of the School of Education has changed in the past 10 years. Where before it had been concerned almost solely with teaching personnelg it now concerns itself with most helping pro- fessions also. These include working with parents, government, industry, and para-professionals. The major goal of the school is the training of teachers and administrators. It emphasizes individual growth and development and it places emphasis on both today and tomorrow. Education Dr. Robert Sheverbush Psychology and Counselor Education Vocational echnical Institute Dr. Bill Dickey Dr Jack Barnett Health, Physical Education, Curriculum and and Recreation Administration Dr. Leland Boone Director of Vocational Technical Institute Technology and Applied Science 'g.x-....smlum The curriculum of the Department of Technology and Applied Science pro- vides study directed toward technical positions in industry or teaching indus- trial subjects. Other programs are of- fered in industrial management and su- pervisory positions. Faculty members in this department generally have industrial experience prior to teaching at PSU, and work in facilities designed to teach in all aspects of the technological sciences, including plastics, metals, and construction. Dr. Forest Penny Industrial Arts Education Dr. Eugene Gardner Technology Dr. Ben Vineyard Vocational-Technical Education Dr. David Vequist Printing ein Gray Lyle Mays Vivian Nemecek Daniel Collins Charles Dellasega Charles Fischer A. Steven Holland Morris Stevens Attalla Blackmon Cagle Connaughton Duffy Emmett Freeman Heckler Heffernan Hemmens Knowles Laing Perazzini Reed Shear Stockfield Telle Foreign Language Hans Beerman Henri Freyburger Collen Gray Bert Patrick Health, Physical Education And Recreation Connie .Archer Sandra Bauchmoyer Carl Beard Thomas Bryant Margaret Burckes Bill Dickey Robert Johnson Thomas Lester Alfred Ortolani Emma Penny Bruce Polen Ronald Randleman William Samuels Jerry Sbockard David Suenram Patricia Throop Evelyn Triplett History Martin Campion Dudley Cornish Surendra Gupta Fred Misse Robert Ratzlaff James Schick Judith Shaw Thomas Walther Home Economics Mary Bowman Doris Bradley Mary Hankammer Sue Hippensteel Irene Medlin Industrial Art Education Robert Bradley L. Duane Griffiths Edwin Koehler Clarence Miles Forest Penny F. Victor Sullivan Richard Weathers Instructional Media Rolland Cummings Warren Deatherage I 1, , QW , V5 H? if hy d 1 , L Mi Larry Wooster, associate professor of art, said he hopes his teaching helps make it possible for students to learn how to see and penetrate the seeming mysteries of even the most complex ar- tistic achievements. Wooster has been teaching for about twenty years and is always striving to make his classes more interesting. Of his students, Wooster said, I've learned much from students and enjoy working with them. I gain from them and hope they gain from me. Their ideas keep me young. Wooster's classes often include discussions and films from his travel experiences, and he strives to have his students respond. Wooster has traveled extensively throughout the world viewing art shows, museums, and even Egyptian burial grounds. His photographs record his travels so he may discuss various art works with students. He started travel- ing in 1952 when he was in the Navy, where he was an arts and crafts direc- tor. In Korea, Wooster studied Bud- dhist art. He then ventured to Norway Holland, Greece, Japan, India, Nepal, Panama and the Cina Islands. Wooster recounts various countries' histories so well that the listener can imagine being there. 7 Much of Wooster's social life is sports. He and his wife, Patsy, jog every morn- ing four to five miles, and he plays bas- ketball and swims. When the Woosters travel to the west coast, they surf, when they travel to the mountain regions, they backpack. In Pittsburg, Wooster skydives on weekends, having about 300 jumps on his record. Wooster says sports are art forms that demand active participation. The Woosters' home is the museum of their artistic talents. They bought an 80-year-old grocery store for an art stu- dio, and enjoyed it so much they made it their home. Never having spent more than S15 for the interior of their house has made their home an outgrowth of Focus on F acult their artistic imaginations. The Woos- ters attend garage sales, auctions, and other places they can get a good buy on furniture, and then recycle it them- selves. They are in the process of fixing up an old school house, built in 1875 near Chanute, for a new home. Larry Wooster Art Y Known among faculty as the host of the annual Let's All Miss the Miss Amer- ica Pageant in Good Company party and among members of the Interna- tional Wizard of Oz Club as not just another Munchkin , Dr. Steven Teller, assistant professor of English at PSU for eleven years, is more easily identi- fied as a bespectacled, bearded, slightly absent-minded professor of literature and drama. other literature and drama classes on campus. In his Shakespeare classes he requires students to read passages of plays aloud. Many students claim-and Teller himself admits-that being a nat- ural ham, he often takes the best parts for himself. At least once a year he even hops up and parades around on top of his desk during a passage of Richard II . Dr. Teller enjoys teaching Shakespeare, drama and film because he deeply loves the literature and possesses a desire to instill love for these subjects in others. My older brother had to read a Shake- speare play in school, and being a typi- cal little brother, I wanted to, also, Dr. Teller said of the first time he remem- bers being interested in Shakespeare. Dr. Steven Teller English Seeing Dr. Teller and hearing him speak suggests images of his office. There are books and papers piled hap- hazardly on his desk and crammed into the overstuffed bookcases that line the walls of his domain. He said it's merely a reflection of the unorganized thoughts in his mind, but the disarray should not be misleadingg Dr. Teller can usually uncover whatever he is looking for. Dr. Teller teaches Shakespeare, Film As Literature and several On teaching, Dr. Teller noted, I am not and have never been a lecturer, al- though I do lecture when the occasion demands. I do not believe it is enough for an exam to test a student's ability to remember and repeat what the profes- sor has said. He should also be required to show independent thinking on mate- rial covered in class and to defend his conclusions. A native of Chicago, Dr. Teller studied at the University of Illinois, where he earned a doctorate in English in 1967. While a student, Dr. Teller became ac- tive in the University Film Society. When Pitt State students discovered this, they sought his advice in choosing films for the campus cinema program. Selecting virtually all foreign and old films that students would not find available on television or at theatres, Dr. Teller has turned the Thursday night film series into his stepchild. He added rather dryly that he has nothing to do with the more popular and less artistic Sunday night films. Dr. Teller was married in May 1976, to Nikki Patrick, a staff writer for the Pittsburg Morning Sun. He is an active member in the Pittsburg Arts and Crafts Association CPACAJ, an interest he shares with his wife. Through PACA they performed a duet comedy last fall called Village Wooing . He has also participated in college pro- ductions and has organized readings of Don Juan in Hell performed by mem- bers of the faculty. One of Dr. Teller's hobbies is collecting books. He's especially fond of Rex Stout and has accumulated almost all of Stout's Nero Wolfe novels. He com- mented, I do not collect rare or valu- able books as such, but just those that I want to read. He is also an opera fan and has what may be one of the largest opera record collections in Pittsburg - at least 140 complete operas. He also collects classical records. During the spring of 1978, Dr. Teller was on sabbatical in London doing re- search at the British Museum, editing the manuscript of the anonymous work The Tragedy of Nero , and attending the theatre whenever possible. Carolann Martin, a music instructor in her first year at PSU, feels the most important aspect of her job is to get students to really listen to good music. Having taught music and music appre- ciation at Morningside College in Sioux City, Iowa, and at junior colleges in the Chicago area, she observed, Students go to classical music concerts first be- cause they have to. Once they see and hear the music being performed though, they are pleasently surprised. Martin teaches music appreciation for the non-music major. I want the stu- dent to be able to see inside the com- poser's head, and to be able to really understand how the music is construct- ed Martin's immediate concern is to im- prove the PSU Concert Orchestra. and see larger audiences at their concerts. As a conductor herself, she is very inter- ested in the progress of the orchestra along with a greater appreciation of classical music by the student body. She said that a problem she will have to overcome is a shortage of cultural events in the area. According to Martin, some students in her class have a limit- ed knowledge of music history. This is because of a general lack of interest in the area. She does not feel that the problem is major, however. The faculty is excel- lent here and the students show talent. Despite the fact that we are somewhat culturally isolated, we still have a very good departmentf' Besides being a conductor, Martin is also an accomplished musician. She has played cello for her hometown Oklaho- ma City Orchestra, the Norfork CVir- ginial Symphony and the Columbus fOhioJ Symphony. She is also among the growing number of female conduc- tors in the country. She conducted The Little Theatre in New Orlean's French Quarter and as a member of the United States Marines in Norfork. WW. With her rare moments of spare time Martin likes to play tennis or bicycle. She likes to listen to classical music as one might suspect of a woman who has been playing it since the age of nine Carolann Martin years. She is also spending some of her time getting aquainted with the area which she says is a lot like her own hometown. Martin says she is not thinking beyond right now. Her job of improving the lev- el of music appreciation at PSU should be enough to keep her busy for at least a few semesters. K , Music as 5, . ?9,uf't- 1 ui- P l - f wifi? 'iv-9 ' , The printed page is a vital part of our U.S. social system, according to Larry Thornburg, assistant professor of Print- ing Technology. Printing has provided our country with a factual communica- tions system and has been a great aid to the spreading of the gospel word in the missionary fields. Everywhere you look, printing is an essential part of our lives. The new technical developments has made it one of the most appealing fields of employ- ment. Ninety percent of all the printing students who have graduated from PSU's Printing Department are em- Larry Thornburg Printing 'nd' ,I 19' wighc- g . ployed in a printing shop as a manager or superviser, Thornburg said. Besides teaching, Thornburg sponsors the Graphic Arts Club and plays a ma- jor part in the planning and organiza- tion of the printing week display and award banquet. The four year course is unique because it gives students practical hands-on ex- perience in operating printing machin- ery while teaching them the academic knowledge necessary to manage a mod- ern printshop. After graduation the stu- dent should know enough to enable him to learn the operation of any new ma- chinery he encounters. Printing is a continual learning process. New presses are being developed everyday and a printer must learn to be aware of the trends of new technology, Thornburg said. Thornburg is also studying for a doctor- ate in vocational counseling. I feel that many students need vocational guid- ance. Many of them choose a vocational area that is not suited for their talents because of peer pressure, he said. Thornburg said his interest in guidance began when he was the Dean of Stu- dents at the Friends Bible College, Ha- viland, Kansas five years ago. Thornburg first became interested in Graphic Arts while he was going to a junior college in Hayes, Kansas. He got a job working in a printing shop owned by his landlord. Two years later he was asked to organize and build a printing shop for the Friends Bible College in Haviland, Kansas, where he became Dean of Students. After attending sum- mer school at PSU he joined the faculty in printing technology in 1973. Thornburg is a devout Christian as well as a teacher. Being a printing teacher provides an opportunity for me to ex- press my concern for mankind and a chance to help many students on an individual basis. The program here at PSU is the third best of the 12 like it in America and I am proud to be a part of it Y! Who's Who Forty-six PSU students were named to Who's Who Among Students in Ameri- can Universities and Colleges in Octo- ber 1977. Who's Who is open to any student who will graduate within the coming year. He may submit an application to the selection committee on campus, which is composed of faculty, administration, and students. In order to qualify, stu- dents must have a GPA of 2.5 or above. The honorees are chosen on the basis of their GPA, leadership, contributions to the campus community, and their po- tential. Those students selected for Who's Who that were not available for pictures are: Laurie Janette Hope, Charlotte Ann Worthington, Robert Lee Kricher, Ann Elaine Jordon, Patricia Louise Bar- tonek, Lisa Renee Atwater, James Allen Melton, Phillip Allen Cedeno, Cather- ine Marie Tannehill, Christopher Jon Lamb, Mark Taylor Paden, and David It 5 l sf I Arnold Blankinship. Q t,,,,,,,,,qq Opposite page, top Susan Gorton and Stanley Sweeton. Bottom: Susan Warrior and Pamela Zimmerman. This page, left: Susan Pfeil and Nonetta Thomas. Bottom left: Thomas Anderson and Eris Zager. Be1ow.'Joyce Butler, David Smith and Sharon Camac. 4' F, 'Un ' Q 41' U-9, M Right Jack Copeland and Diane Inloes. Belouc Kevin Jones and Debra Gillespie. Far Below: Steve Gardner, Jane Scalet, and Susan Vomhof. ,K , ng '32 ?i ff 2 1, 5 nf Upper left: Janet Townsend. Above: Perry Ad kins. Left: Catherine Elaine Freeman and Patri cia Costello. Right: Belinda Hope Binford and Gopi Karap- purath. Below: Patricia Ward and Terry Wilson. 'G , 1. .Ma Y Y f 4 L,, '-. 1 .Mi u Q, 1 1 'qv 1 w. Lin I Q of Upper Left: Janet Villamaria and Barbara Alli- son. Above: Roger Schrum and Doris Gowen. Left: Karen Call, Steve Johnson and Pat Cum- mings. Student Services The Student Services staff works to maintain interest in all aspects of stu- dent life on campus. In doing so, one would expect an army of workers to keep up with student activity, but Wil- ma Minton and her staff keep up dili- gently. There are several branches that come under Student Services. The Counsel- ing Center staffs professionally-trained counselors where students may confi- dentially seek aid. The Student Health Center is designed to provide medical assistance to the stu- dents attending PSU. Although the university lacks a physician, the center provides medical assistance to those who need it, or directs them to an out- side doctor. For those in need of financial assis- tance, the Student Financial Aid Office works to provide help through scholar- Clifford Beougher Director, Business Affairs ships, grants, loans, and part-time em- ployment. The Office of Student Housing operates apartments for married students and residence halls for single students, and administers dining facilities for stu- dents. In addition to this, the Student Services staff works with student organizations, Greek activities, special committees, and residence-hall governments. In do- ing so, they try to provide the students with the goals to advance in social, cul- tural and intellectual endeavors. They are also concerned with the individual student's academic problems and ques- tions, and they supply references for those students. Although their days may be chaotic, the Student Services staff has managed to keep the office running smoothly for their students. James AuBuchon Assoc. Director, Student Services N i '-25551.-1ssilf ' A M.s:egs:,,. X V Tig, . N. .. 4? f . ---Ps .sw Ken Bateman Director, Alumni Relations G- E- B100If1C-Emp ' Elizabeth Burris D1FeCt0l', Financial Aids Director, Public Relations 'Y gas-if Wiley Burris Gary Carlat Dick Carr Director, Student Records Director, Campus Planning Director, News Bureau X f' 2 .haw -f . 4 1- .. .. Lee Christensen Karren Drysdale Rod Dutton Registrar Coordinator, Women's Athletics School Artist 4u...... Theodore Flagg William Gray Stevens Hilyard Dif9Ct01', Personnel Director, Computing Center Director, Library Gerald Kramer Paul Lawrence Clifford Long Director, Employee Relations Director, Instructional Media Director, Continuing Education ff' .4 ,V pf Wm X. ,I 1 K kg' , 1 .eti A at v no Larry Long Ron McCaskill Ronald McKee Photo Services Budget Officer Director, Off-Campus Affairs Steve McLaughlin Assoc. Director, Student Services Wilma Minton Director, Student Services Larry Nokes Director, Physical Plant Jack Overman James Parker Director, Student Union Director, Admissions Terry Purcell Seybert Smith Director, Institutional Research Director, University Bookstore Ken Peak Director, Campus Security Michael Sullivan Program Director, Student Union Lon Seglie L. L. Tracy Asst. Director, Student Union Director, Career Placement Irene West Assistant Registrar 1 Focus on Student Services Rod Dutton, commercial artist at PSU, said that he likes his work, despite a few hindrances he has found. The key to doing your best is enjoying your work,', he said. 'Tm doing exactly what I want to do in life and that's very important. He finds hindrances such as a cramped work area and a hectic work schedule that often confuse deadline dates, but he is still a productive artist. In the five and one-half years he has been at PSU, he has designed everything from an Alumni Cookbook to the new university logo. The goal of his work is to commu- nicate the PSU image. Because of the nature of his job, Dutton feels he needs to stay in constant com- munication with the student body. Graphic art is a great communicator. It can say a lot about what we are. The commercial artist needs to be a phycho- logical, economic, social and market value of his work. Because a commer- cial artist has to keep up with changes of taste in his audience, Dutton said he keeps an open mind to different aspects of campus life and explores his audi- ence for new ideas and angles. Dutton said the new administration has given him all the freedom he wants to create a positive image, something he feels is good but has its limitations. Complete freedom for the commerical artists is not so appealing. He is limited from the beginning by the clients needs. Dutton feels this is the biggest difference between the commercial and fine artist. The administration also supplies him with enough supplies when he needs them. The only shortcoming is the cramped working area. We are frantic for new facilities. The commercial art department has to share its facilities with the photo department. This means Dutton has to work in a busy area. I have a hard time keeping a train of thought because of the noise and distur- bances. But the problem is evolutionary and really no one's fault. Six years ago there wasn't a commercial art depart- ment here. The facilities just have not grown over the years. These shortcomings seem too small to stop a man who has wanted to be an artist since he could hold a pencil. Dut- ton feels there is some new enthusiasm on campus and he also feels he contrib- utes to this enthusiasm by doing what he likes best. Rod Dutton PSU artist A 'X . ,yi Sam Ross, electronics technician if The Instructional Media Department has a unique electronics service techni- cian - Sam Ross. Ross, who has worked on campus for 16 years, can lay claim to several inven- tions he worked on while in Research and Development for the federal gov- ernment. Most of my work was in gov- ernment security, and I was sworn to secrecy when I left, he said. But some of it wasn't secret, and Ross explained some of the projects he worked on. Eight other engineers and I designed and built the launching cable fthe one that connects the rocket to the launching padl for the Redstone Mis- sile. I then worked on engine generator units Cportable power plantsl for Oper- ation Deep Freeze on the South Pole and I also assisted in the creation of a glide slope receiver for blind landings for military aircraft, he said. fThe re- ceiver is used when the pilot is unable to see the runwayj. In addition, while Ross worked for Pa- cific Mercury Electronics in Joplin, he and co-worker Jim French designed and built the Lorance Fish Locater, the first one of its kind to be made. We did it in about two months, and that in- cluded taking the thing to Grand Lake iOklahomaD and trying it out, he said. Ross received no royalties or copyrights for any of his work since he was work- ing for a private company or the federal government. Ross's career in electronics began 43 years ago. When I was 11 and 12 years old I started building my own crystal radios, he said. Sam has been with electronics ever since. Despite such a career in electronics, Ross never attended college. His train- ing in his field is broad, though. He took classes from the National Radio Insti- tute program, received training from the Navy radio radar and sonar school for anti-submarine warfare, and has a degree in electronics and powerhouse electricity from International Corre- spondence Schools. Before coming to PSU, Ross spent some time at the Army Ammunitions plant in Parsons as an electronics mechanic, and at KOAM T.V. as an engineer. For 16 years, he sometimes ran a radio and television and repair shop in Weir, his home town. Why, with a background of inventions and accomplishments, did Ross decide to come to work for Pitt State? I like the variety, he said. There is quite a variety of specialized equipment here on campus, and every day is a new day, every hour is a new hour. Each piece of equipment is a new challenge. Ross' responsibility is keeping all of the equipment belonging to Instructional Media in operating order. This includes all of the equipment that is loaned out from that department in Hartman Hall, all of the Tape Lab and the permanent equipment in Grubbs Hall and the ma- dia equipment in McPherson Nursing Center. His job keeps him busy, and even though Ross isn't in direct contact with the students, he still feels his job is im- portant. I get a great deal of satisfac- tion knowing that all this work I do is vital for a good education for the kids on campus, he said. Ross has seen many of changes on cam- pus, but said, I think that overall there has been no change in the attitudes of the kids. Most of them are the same, eager to get an education. Ross could be working anywhere else in the United States, but he chose to come back and live right here in Pittsburg. Why? I came back and stayed because this is home to me. My wife and our four children and our families live here, and this is where I want to be. I have sacrificed several good job offers to stay in this area, but I haven't regretted it a minute, he said. For more than 150 foreign students who find themselves thousands of miles away from home at Pitt State, the ordi- nary problems of campus life making the grade, fitting in, discovering who they are and finding a compatible major are a small part of life's complexities. Communication, not simply language, is the key. Most students from other countries have previously studied Eng- lish in school and are able to read the language when they arrive. But it is the difficulty in speaking that necessitates communication with the American stu- dents. Being foreign and unknown creates an atmosphere lacking in communica- tion, said Abrahim Jared, a graduate student in technology from Saudi Ara- bia. He said that during classtime every- thing goes well. The faculty seems to understand the special problems at- tached to an inability to speak English fluently. In the classroom, another foreign stu- dent added, we are included. The fac- ulty is aware of our difficulties, and they try hard to make it easier for us. They make every attempt to be sure that we understand what is required and how to do it. But the classroom is the end of Eng- lish communication for us, an Iranian student said. Out of the classroom, we are again foreign and must go our nwn way. Outside of the classroom, there is no place for me here, appears to be the common bond between most of the for- eign students at Pitt State. They are from Iran, Saudi Arabia, Viet Nam, Ja- pan, Nigeria, Thailand, Taiwan and Hong Kong. They feel they have impor- tant contributions to give and ideas to present. In return, for their contributions, those who will leave for opportunities in their own countrges want to return with a knowledge of American culture, not just an academic education. Abrahim said that he will return to Foreign students feel a lack of communication. Saudi Arabia to work after he com- pletes his education here because there's no place for me here. Ideally I would like to be able to have the people in this country understand me and what I'm trying to do here. I think that because Americans are not really used to foreign people in their community, they are unwilling to com- municate with us, Abrahim explained. If they would do so, our visit here could teach us what Americans think, how they live, and in what ways we are alike or different. On exchange, they would find out about us, how we live, and what life outside of Kansas and the United States is like. It would be a great opportunity, but most people pass it by.1a For those foreign students that will be staying here, there are additional prob- lems. For Kim Vu Pham, a data-pro- cessing major from Vietnam, the option to return to her native country is closed. For her, the problem of communication becomes one of dire importance. My husband is a senior in computer science. When we graduate we need to find work, hopefully close to Pittsburg. I worry that there will be prejudice against us because of the language and 8 gil our difficulty is communicating. Vu Pham and her husband studied English before coming to America. When she and her husband, Ngoc Thuy Bui, escaped from Vietnam, one of their greatest problems was the inability to prove past education because they could not bring any papers with them. Vu Pham said that difficulties in inter- personal relationships have proven to be no problem for herself and her fam- ily. Having my family with me and knowing definitely that we will always live here makes it easier for us to be- come a part of community life than oth- er students who are here alone, she said. The problem of having no family in America is a very real one to most of the students. Abrahim said he felt a strong tie to his family but, because he cannot go home, he travels. Family loyalties in Saudi Arabia are very strong. With no oppor- tunity to return to my family until I complete my education, I have traveled to many places since I have been in America. When the university is closed during breaks between semesters, there is practically nothing for a student to do here. So far, I have visited Texas, New York, California, and Washington state. -f .v -ia- i . sr ii XX jf sk knew, Opposite page: Godi Karappurath is one of the many foreign students who find the library a good place for study. Fat above: Susan and Kamran Ka- touzian are a married couple both attending PSU. Above: Daviush Dejam and Hossein Azarmgin en- joy Pittsburgs sunshine while taking a break from studies. Jennifer Wu, Mathematics major from Taiwan, said she came to Pitt State on the recommendation of a neighbor at Jef. -if fl home. She finds semester breaks and transportation in Pittsburg problems. The only real problems I have had here concern transportation and what to do between semesters and on vaca- tions. I have traveled some since com- ing to this country. I have been to Texas and Chicago during vacations from school, but the problem of transporta- tion was a big one to me this past win- ter. Because I live off campus, just get- ting groceries was difficult. Somehow, when you are without transportation here, you are isolated from campus and community life even further. She also had a problem this winter. In Taipai, we do not have the kind of win- ter you had here. It is not easy to get used to, she said. Another problem that foreign students talked about is the tendency to gather in groups that speak the same language. It is safe and easy, but the necessity to communicate in English remains. But a gap has developed between the Ameri- cans and foreign students. The foreign students feel they are forced to group together because they are not accepted by the Americans. I tried to join a fraternity once, an Iranian student said. I wanted to join in with what was happening on campus, and I thought a fraternity would be the way to become active. But I was too different, and we simply could not com- municate. Therefore I just sort of drift- ed back to the comfort of friends like myself? Perhaps if there were more activities on campus it would help, suggested Abra- him. A large part of the problem is due to the fact that we have no place to go and get truly acquainted with the stu- dents here. There is no place after class where we can actually mix with the Americans. Many foreign students felt that the In- ternational Club was of little help be- cause it met only once in a while and served only to segregate its members further from other students. American students say that they can always join the International Club if we want to participate in campus life, said '1 student from Thailand. But it is just another way of saying, 'Stick to your own kind. ' The problems of understanding foreign students and their problems is not unique to Pitt State. Students from oth- er countries say that each college and university in the United States with which they have been affiliated faced the same difficulties in communication. There is a solution, but it might not be easy, Abrahim said. The solution is for all campus organizations to make a visable effort to open their doors to some foreign students who are interest- ed in that organization's special activi- ties. We need to be given the chance to be known on a one-to-one basis, rather than the common denominator of being foreign, he added it would be an en- couraging step in the elimination of the biggest problems a foreign student faces - a lack of communication. giant step forward Waves of black robes rippled against the bleachers of Garfield Weede Gym- nasium on the morning of May 20. Nearly 1500 faces swam under black caps and tassels of blue, pink, brown, black, apricot, green, maroon and yel- low. Some held solemn expressions, others jubilant smiles, and a few just an expression of relief that they finally made it, in spite of the down slips, park- ing tickets and failed tests. The music of the processional came to a halt and heads were bowed in prayer. Then Dr. James Appleberry presented Alumni Meritorious Achievement Awards to Dr. Chester R. Anderson and G. Robert Gadberry for their outstand- ing contributions to humanity since their graduation from the Kansas State Teacher's College of Pittsburg. 4228425 Awards for outstanding seniors went to Steve Portz, biology major from Hays- ville, and Patricia Costello, accounting major from Frontenac. Fifty-seven specialist degrees and near- ly 350 master degrees were presented to graduate students. Eleven hundred sen- iors received BA and BS degrees in the arts, music education, science, business administration, education, medical technology, nursing, technology and vocational technical education. Nearly 40 associate degrees were bestowed to undergraduates. After a welcome to these new alumni and a short prayer, the tide of black robes flowed onto the floor amid shouts and cheers of jubilation. We made it! A ,Sf ,lf -vm? L- .af ,,. V Q V . ,- V V A I H nw A Vi .1-'fc ,,... ,fi if V ,QM In memorlam Dr John Quln y Reed 59 head of the Engllsh Department dled from an ap parent heart attack a few hours after graduatlon ceremonles He was worklng wlth bees a longtlme hobby on the E G Kennedy farm west of Prttsburg A natlve of Slrppery Rock Pennsylva ma Dr Reed came to Pittsburg ln 1955 from Storm Lake Iowa where he was chalrman of the Enghsh Department at Buena Vlsta College He was the frrst Engllsh Department chalrman slnce the creatlon of the department at PSU Dr Reed recelved hrs B S from Sllp pery Rock Teacher s College hrs M A from the Unrversrty of Plttsburgh and hrs Ph D from the UI1lV6TS1ty of Iowa He held membershlp ln many honorary SOC18t18S 1n educatron He was a mem ber of the KIWHHIS Club and the Unlted Presbyterlan Church where he was a past elder H15 publxcatlons lnclude a book Ben Jamm Penhallow Shlllaber and sever al artlcles on Artemus Ward rn the En cyclopedla Brrtannlca Mrdwest Quar terly Amerlcan Llterature and Mld Contlnent Amerlcan Studles Journal He also publlshed artlcles on Faulkner Twaln James and the teachxng of Eng IS Dr Reed s many frlends and colleagues attended funeral servlces May 23 ln the Unlted Presbyterlan Church of Pltts burg followed by hrs burlal ln Hrgh land Park Cemetery Hrs survlvors lnclude hrs wlfe Mary daughter Barbara son John and two brothers and two slsters Hrs unexpected loss was a shock and he w11l be mlssed by those who knew hrm f 1' ,f-q. A ' lfL l Y. ' A . ' ,Q i' ' f' 3 i1Z 5V'iT'?E g5 . . ' . 14 t Y If 9 . 'fog' Z L i' 1, , .1 99 im S ljzal ailing I l l . I. , ii':i, izisf' ,Mg-55 5 F L ' If lit. 1'?2?Q E3 .,121z:ff 'TTR '. A ' 'iff?gg. '-11.525 gf 1 - n ,J .i Nfl A A - fl- : l, l i,- ,ivy . ! - ' - 1 11 -' 1 I. 5' .A- .' A-' ' f ff,4Q1-4555 , f, . ' Z- 'v1'f v4 W v, . - -,J 1 an 45 A'fj'11'af' :Fin 1 . '.'f.l,YgJQ'l-'- 1:.., ff,,n1' 1174, fp 4 Jw-. 'x W4'ii7f,4ffQ. v 4, fu -j.fJxXhjlV:x , -I Ii? Q p , f,v f41g:.,- ' Q, ' -?.,,2.,.i-V: . . f, gig-f'f,r ,-I , -:li ,- - 4- 4757, ,.V. 4 ' iff f 1, 'Q' 3 I , '?.'3-' ' JW 734 :I-' ,- . 555532-f j2'?1 7!Q ' I fhqhgf ,lj , Ygf 536 X, I fy-QTL. xx . 'f 'U' 'fx 5 JM 'if' 1 rk'-'W' -5 A Q.-5:-2559,-V .gun 7 f.'Q,.f,. mwhfgy' .,grQ5a,QQ:f'C 'ft V g 1,'1:',?fq':'4i.- . Q 1 ,I 5- 2,55:4'i' '59 ' , x Z. X- - L 1 'sl H ' -3,1 5. A 1.-Z ,f rfnj f'Zi'QsQJ2,f,fQ.Q far 22.2 f' 'gygg 5 1p 'f:f4?'2r:'ygf, 'Y ' i f M 1 F : fy- 1 ,465 1 J Q' , gf! .gf-I ,c'x:.- pi:,?,,, Q I ggi, ,QL D: ,tx :.' I. . ,Ax ligiyxfg,-h F 5 gk-.ik ffgv, ii' 5 'ffiffgigf-Q ' V' 2721 Pi . '1-' , -, - - ' ,I , , , , , 1 ,Q ' ' , , 43 7 V - ZZ! H EGEAV' f' ' 1 'W' '17 5 1,1 j b l ,' V A -I 1 5 5 42751 tmwjzg 'fi --1: -. , ww' 2 4 -5 2 4 M 5 .5 125' -5 If ' -- . Q if 37 fy Q 5 MW I K. i ' ' '1 'ii :' f .- ,- ,,,-. -- ,nw ' ,G : IJ: 5, A 'il 5 A-zyaggiiiei-Ai?:.f3f'fA it -Qiidilbx ' Z5 5 Y5?Y4.-21512-: f1V9'fP'1 '75, sf J 5 ' y I ' - jizz' I Jflfti' 'Y 'c Y. 1- . 1 v . 1 , 15' V I - Q .- X .-.J'.?-aff -Hr N ffl' It ,A gfq,...n lx., ,f-1 it 'gm .xx r f, 1 ?e w :sf .4 1 4-'tawf' 1 ,4fQw.gs 'ne 'M' :Z wg 1 'mf ,fvfpf cf:-f ,q ' i f 15. A 449 Q51'Lf?,,Qs,4 .ii -ff gy I qfrllf 1. -' - 1 Pfqvw' H 5 1' 1 11 ff 4 -,rl 7 ,-ffl :ef f ' .vt-Q51 I-1:1 'Inu ' 'f .AY fig f :vt f iff. 'jf Fbt -, 15 Q yr?Q4+'Z?MfPEfz' 215315-5 f 7:1 Q idfiqfgwlflkffl 'Q-f . 911' yi . -. v . Q QI ' ff' 5 ' . , . , lf' I 4 57i'5ilg5s?5f.-1, ' 2,'h2Q J ' 91 H , :ggi 1' , g5,Mil,? 4v, 1.5 W 5 463444 13, ij y: 2 'QI-151y','7w 41,5 gpkrf-tiff? 1 4 ,ff Q 4ff33, f,',,f,f1?if.1QJ,' V' fhjt'.:L- - be I , - I dl I .LZ SP, Vg' :QI - 1 :I-6 3 G5 1 1 pf-21, - 152' 1 Q? . .pf 5'gg'Qf-fjJ3j- 'Iii 74 7 Jfqiilfiie.-' if , ff? ' -f 5'!!2' I 3,1 43 5 EiQg'J'+!4 'A ,ea W'..,f1'w . ' 2 2 1 ,. 3, , ,JV .. flu! I J.-f. f f I, 2 Q 5 1i,?fa6e95fEyyf?-5 'M ,if f 2 sf 1 ' 4. 6' M- 1 'I '-3 Q ' :gf-'fi . Huff 5 '5.r' ' fi-'I Q 1 94 i.f'5ghg7,y5 '!. Y' 1',-.sfrgi 'iffalt ug ri! iz ff L , jim,-Q, 331.3 Arr , -1145.0 . 5 ,1115 I Mm 5, xr- 2 , 945,44 -5591! 'yi'-. . p 1- ' L .01 ' 4 .M-Lg.,,.gf .T 1 ,g ,,Qjg,,,,. J, , , , Aa ,. ,5 , .45'n,, .Q f .,-.14 nf lf! - 3 . f-.. C' ' U, af' 'N'-- 'M' 'f 'Qf14' r I . 9 'i -f 1? fl ' 3.-sgflpwf' . fa: fm' -,, gf G. 94 '5 I V! n 1- -J ri: asm rn, ,ci g IJAFQEI I J ja ' M41 ffjpqbkx va 131115, Q 1,9 g'. g2'gj.g,6 ,QV 42.5 'bk ., f, fig? wgfqgfvy +1 jf wh, M -. ' ' ' fi, .-g9'A 51 an 'JEf':13, . , ' ,YV ' . 2 Af. , -IF.1,4 - ' - '-fir 7. V4 s IVN1 Qs i, 'gill i jig? tx CVS V 'L' , i- 4 -.-,4 ' '.b, ' ,,2 Y Q-Q5 5 143: X J! - 1QQh y4Q Q . ,l ,QM ji:--' fgfl., 'm 1 Ulu- ,: iff? . 1 ' , u -I f 13, 3 .fl , if 5' 3- ' 5 1' :I . IA , 25, . fil l l x 3 17,1 I L5 Xa.. ki lf JEL? : i 1 1 gZ2,+ 4J?'2.3'1t:.,'ff ' Q- g ,Mis ,, 11, , 'L 'I 1 f 1 'I 2 '?w5i4'i-9-iwi-sw ' s -'fify' 'f' 2 fx J M '- f-. r. N' '- f.. ff 7-'5f'5' K 3'f4 'rf,'?1?.19'C'i'-::'1' .2-7 ' 6 'M' ' '- ' .1':le.,-L' f. l J- . .- A 5 I, + .- 5' ' U ,Q h ff' - P J f 1 f..f 'l r., JM:-ff .f- 1- r ,t4f,1 , ,. I MJ ' UA'q.,ff:mp.543y-' , . . l v Q' f ' I gf ,J ' A in- fry ' 'A V ' '- 511' ' Q A -u- fx-,.e'fggr' Q f'm,34: I Y ' wt J 'K' 4? V ,, . -Q75 Cultural Event ,. f:,.,.? --- fir V-f.,,-k., 4 V. f ,H J f I-73 fy J lm.-. .. fy , Fry, -1-...-.-, .J -F 4'5.,'.- ,.15,f,g:y,- , 1,17 if f ,I 5 ?f'ff1Q::,.- .exfsf 1 s . 5 3 .f.f.-, f,,:.' v 5. ,fl , -A 'p 5 71,-jf A,, -ffl! n 'A . 'f ,:.' rf 21,3 ,' F .fnff' of c' vt -'-'fig ff 'ff' , S ' , -lzfllxp, gy.-f,:f ,Q 51- ,ay I-rw 'M-, rx .1 4.f,517kQ,.' , 1 55,1 2 FM! ' Jn 5 ' ' 1 .1- if 'JL '2 1.1 . if Jfierff I' . rt av V 1 4 3 k, ' 1 JI' 'P , Qs.. ' ' .f ff' Wg' N 7 if if F ' 1-I V, ' ' ', 1' ' lf x' f .,.l'7. .,' ' 'n IH 756,44 ' 1' Q'T?A4' J. V .ls A ., ' , W5 0, I 'H ' M2 iw A-'Y 4 ' ' I V18 x w'7 I , .1 ' r ! J 1 L ZW, .La 31 fi f ff 3 'f- Q. , Ai K A 'x 'Yjahfxx I .' I - v 1, f !1 A ,?, I J ,J 27 -'1'G.' .I 'ph 1 f , r, . rr, , jg 1 ,' x 1, . ff. ffl: ,JU 3 4 '1 L 'fl ' 1 ,Q STH . 1 I 5. 'sv r' lfffwjix , I .' 9 1 -Q. A . 14' lf: I Q' ' I f1'?'.,11-if 'I x'- -5 Kg-xg' . ' ' ag ' , 1 x ' 4 ,qi GQQIQ 'q I! ! , I f 3 ' . 6 2 R , ,pu ju ,ff if 1 - '- Hi .,' an J gp! I 'sian -4: J: x if 1 P ' -. , ,,o .Q,r. , 'Y ' 9 9,7 v ff:-cg' U-Q X , -I I X f Qi. t QL 5.2, ' 'J J' 1. If 1 J r' In 5, A ff ' '1 , f',l .41 1 v Q 4' 1 ,if ,151 ,1 ,C 1 , 5 2' f , I , , 4, fr , Q12 ln, 1 rf , 16, . Q-', , 4 1 ef' 1 P, ga, , .f - , ' .ff .4 I 1 I 1' 1 ,-tl' f .1 ,fb fr , C 1 I :Ava 'Q ' 1 ff' 1 J sf ' -:- 1,1 N531 023'-4.1, , Q ' I 4 4. ' Q1 f arf I Un 4. 1A?A,,,,J y' in rg J U 'I' Vff 1 4: 1 ..s ' .fix 7 I ,, al ,V I9 , Ll 1 A 9 f 1' ,Q ' J' yt I I f 'fflrfr A, 4. 45 g If I L qi 4 ' :. ..gnj.--.. L.,-:-. ' il. -I ,.1,?,5,:,':h IM-,,1. . .. f 1 ' -- Q A- .if f. - .. LJ. ' V yggsw '- .-,., W6 - A . A -, -14,1 it . Jiffy ' R 1'2 'i V'--.ff ' ' . 7 :fu'!f I ld -'Jr ' tg! - -4 I f. ' . I ,t ffiff' YJGV. 'I 1- CJ ' .ll-QA D 1 ' 5 '., . gf. ' - '51-ff. ' fPZT'51?. - . .4 - .-1'-W2 4, 'A I ' 't A .iii 2 - fl I -, V - 72f,j:5 f ii? 54' L.-' I ', -.A '. 'l'g. W., r. t G' '34 1155 5 . :FQ -L. Igivmgn JI Y . , ! I 'A ,I I 44 -1 . L ?f5f. .' --I If 4 , I - 'Hg .3 - -I , A -. . ' ,-Ji -.,' . , , N.. -- 1 ' '-jhl' ' ,K I r'.f 'L ..' ZA- . f ' . , 'GY' 9 43. Digi .mv . F. - A 11 Q51 -qi? 535.5-'jsbff 77 -,iilyf A-L , 'fx V 0 V1.1-fi . .,.- I n 'iff v -11,25 If V - . - . , ' ff: 22' .e-.L - ' .'l 'vf ,441 'xv-,191 ,qv V . J' iq , 'I 7'Il iLA.'::.'QA I 7-' .43 !-26 -'87-5:55:55 , -, :J 'f ,. . ' f , 'I ta, if Aj sf-fry,-f I.. aff 0. ,I- 'I -.9 . ' Z I .Aj .1 ,jfi , si? T391 1 'fvif ' -'ffl .C-,'Q'lf, - ...I .I . ov ,. - I., , V . -. in xL:I ,,r'l.g.:,, -L fffijy' . 2 I f l - ' - h ' ,o- ' -' I-'f 5 5,'Q ',? - AU f 17'f ? f 1- -I ' '!J1 7 vf'A3 AJ - if r' -- T' 1-ff ' . -Qfljgwrf-ff: '1ff.f'5 +f--.w'.2'- :'Uff4 4' 5 pf ,f 4jf '1:5:?'. mi' 275' -407,-4. fi? tif , 4 f A ff fr i. .S .f ,pife-' .. ' - - . 1 - ' , - H21 .11-rf, ff' 0.1 1 X' . .f - , 1' 129,55-f 'H f'f4-wzff57:'s'f- f fvzfb. ff, 1-4. .11 - , , . 'If I dzigiffj ,H rnkier l Q .H.j?Z?:v ,f fy Ji J, bs 4 . V 'I , -I I . fff: 'J-2473? .P ,-H' P221 4',' TX r ,A -1- S ,. 3 T , ,zgafkb V ,ko ll tl-ii :jig I? 4, V 7 i z. 4, I I- f .1 ffm - Q . 2 - Q . .0-........,' I I -,- . f'.,j, g,' Q51 -'ff- ' 5. -' I y, ,321 f 5 , 9-: .. gf!-',.,',,, l,.ff--.gif I-. ,. r ji .. :,' ,fr f . v ,sf-,jj lf- f' , ff if rf'-,lil f . 1 .X M'-.' !1f'f', ' -fzfjjfv' FD .1 -- '-' 1, QT gi . ' ' 1,5- gjLL Z57' 775.31 D' ,iff-1: f 01, Wm,.,..... - Q., ' -f - . 1. liiffffivgvfvw- .. ,. H- :- -- HUYQUWH - ' 4-T-Y 42 7 aw-f,g.,w ' '-Q '1 'f -' M-f .2-377 WF-'-1ff 1If. 4- - -f -f1'f6f1 f' -V ff fu. ,FTM-Mr , -am P 0 ff -1 . '1?4??b'1 f'Q-f 'ily' .- . . 1 . X I M Vlhiffzy -gf, : y -if 1,35-av H.:5sK,i A A 7 fyygyg- v 5, . 3 'mx 1-,ffjjygff ,H T O 7' H23-9 550, 6 ff I, .,,wifL1,Ln?A, - V, v .-,A f 1,-5 .h-, a '- . , 2 ,, f AY A- f, .f 1 nf .Q 12. I - ,',' 5... BJ ' ,. . Q , , vw iW2,5ff5-f' -. 0 39 gym ,,q7:?.,a.,fEjs -.' ff 14... 'fffdfff-Sid ,f ., .- , , ff . . .f I! h 7 i U - -, -:WbKll1i0pe ' h 0 I IW Aff: iff-fl ' , 3 :J:E'I 41' U' :A M 'Jai 2.5: 1 djpfl ,, ' - -- - Q- 4- , ,..1q.f x-121.7 ,f '-..,,f',,--.f.2.f,. -f . 7:-'mf - wiiewxrwi Nev- if A :fs P ' ' 5 ' ' .J f 7? f v'f1f if '- .'ff,..' t.5.'fi7 L 135' 31-4 725 , ' ' Free University serves community February 5 marked the date of the first class of the PSU Free University. The class was Square Dancing and was one of 20 classes offered during the spring semester. A free university isn't a particularly new idea in Kansas or in the nation, but it was a new project for Pitt State. It began as a proposed Student Senate project initiated by Cathy Stareck, Gi- rard sophomore, in September, 1977. After Stareck and Carol Lang, Iola ju- nior, attended the National Free Uni- versity Clinic at Northern Illinois Uni- versity, DeKalb, Illinois, in October the senators began working for a similar program in Pittsburg. An Advisory Board was organized to help the senators with any problems they might encounter. Members of the board include: Eileen Docherty and Pam Thomas, community members, Carol Lang, Cathy Stareck, and Lori Von Soosten, student members, John Q. Reed and Cliff Long, administration membersg and Robert Venturella and Tom I-lemrnon CChairmanJ faculty members. Also involved were Shirley Edmonds, Blue Mounds junior and Academic Affairs Chairman, Mark Huffman, Olathe junior, and Liz Fast, Columbus sophomore. Stareck resigned her position as coor- dinator for the Free University in Janu- ary and Liz Fast took over for the QQ 1-nl Y' rrfv spring semester. The Free University has now been established as a standing committee in the Student Senate. Here- after, the coordinator will be appointed by the Student Body President with a vote of approval from the senators. Marcia Jones, Yates Center junior has been appointed to serve as coordinator for the 1978-79 school year. Everything is running smoothly now, said Fast, present coordinator. The school CPSUJ is being very cooperative. We had a good turn-out for most of the spring semester classes - usually be- tween 15 and 20 persons in each class. We're planning a few summer classes and next fall we should have at least twice as many classes as this spring. Most of the Free University classes are humanities oriented. Very few in- volve technical skills. Most of the classes have consisted primarily of com- munity people this year. We expect more people to be interested in it next year, especially retired peoplef' Fast said. Anybody can teach, she stated. Usu- ally someone will come in and ask for a class in something and we have to find a teacher for it. Sometimes people call in and volunteer to teach something. We haven't used many KPSUJ faculty mem- bers so far in the program. Anybody that wants to teach a class should contact the Student Senate of- fice. Then he must send a course de- scription of what he will cover in his class so we can print it in the Free Uni- versity Catalogue. We work around their schedules to set a classtime. We let the teachers decide how much infor- mation they have and how long it will take to teach it Chow many class ses- sionsJ, said Fast. The Free University operates on limit- ed funds in conducting the classes. We haven't used a fund this semester, ex- cept to print up the class schedule booklet. We do have access to the Stu- dent Senate fund, however, for the pro- ject, said Fast. We can't rent class- rooms or pay teachers because if we did we'd have to charge students. Most classes don't require the students to buy materials although some classes of- fer optional materials. Prospective students should call the Student Senate office to enroll in a class. We keep a file on the people enrolled in each class, including their addresses, phone numbers, and some other information about them. Some people just show up at the classes. We never turn anybody away. It helps us plan better, however, if people enroll earlier than class time. We're just getting started, Fast con- cluded. This year it turned out really good, and I think next year will be a lot better. M f x 'uf 35555117 ,n: ,Q I -,-pw nrgyyg 8 X . A olrlla . V via, ssc. s as WSJ' Q 8 Most of the classes have consisted primarily of community people this year. We expect more people to be interested in it next year, especially retired people. Opp t page and far b e: Cooking class f th many class ffered. Other ph t A b' f db k ' Iso offered 2' f 4' , 4 ' ' ' U? -4 'Y The Pittsburg Orchestra Musicians gather from campus and community to perform HandeI's Messiah Months of practice went into this year's traditional free Christmas production of Handel's The Messiah . The combined choirs and instrumental- ists from the Pittsburg Centennial Choir and the Pitt state Department of Music were conducted by Dr. Marshall R. Turley of the university music facul- ty. Four prominent guest soloists appeared with the group in their two presenta- tions on December 10 and 11 at 8:00 and 3:00 p.m. respectively. They were Dave Evitts, bassg Vonna Miller, sopranog Be- verly Runkle Benso, contraltog and George Livings, tenor. The Marriage On November 3, the PSU Major Attrac- tion Series presented the Lyric Opera of Kansas City in their production of Mo- zart's comic opera, The Marriage of Figaro. The presentation was in Eng- lish, instead of the customary German, for the benefit of the audience. The Marriage of Figaro consists of four acts, all taking place on the wed- ding day of Figaro and Susanna. The action is centered at the Castle of Count Almaviva, near Seville, Spain, in the year 1780. The story deals with all aspects of love 1 suv of Figaro - the true love of Figaro and Susanna, the Countls lust for Susanna, Susanna's loyalty to all the members at court, and Cherubino's first adolescent loves. The opera's comedic effect is created by slapstick action and mistaken identi- ties, but the most outstanding feature is the exciting music of Mozart. Audience reactions were very favorable, and for many it was the first opera they had ever seen. It was a cultural specta- cle that most will remember for some time to come. 1 wp 3 1 'og- O ..v'0,Q -Q. A 00 'X 'O ,Q of a Q , 'P Q s s 0 -Q ' l Q 4 v 9 S I .aff o l 'Xgxvf gg f . ' ' Q ax Q 1. Q ' ' ' 0 1 15 ni 4 S A ' f 1 ,Haifa va l , O , 1 .Q il' M, g 5.2, .n- V ', .L V av 4 .. On. QQ. . N 'Ns A m 'jg 0 I' 'tw' x 0. Of , fx 0:5 K5 .Q Q' ' 'C-Q sh I. U. I, 5 .Q . Q U . slug .N Q S ' l 31 Q N5 :git QQ . , Ov'-4 N 'gn nw J , Q A '1 l --'kk ix, JA S ,L ' ' 5,4 ' A Q' 1 'E . A, . as H .L N I uqA 1 A Q, QQ ni 'Q ' sn? x.'N,.1 3 an 'Q L .V xg 'I X Q, 41 aku? Q ' QQ l 9 Q 'ff 1 QP, Ex ,oi ,d tu 'I:'Llg s ,,,pv7J-9--. s Q x 1' ,S 'Q I'K g vcdnff ml 'Y x if A H, if 'Um Q an iam The Magic Flute Cast Leads in The Magic Flute were David Lowe, Joplin sophomore, playing Ta- mino' Patty Broyles, Baxter junior, as Paminag Robert Diskin, St. Paul junior, as Sarastrog Robert Smith, Chetopa senior, as Papagenog Suzanne Blancho, Pittsburg sophomore, as Papagenag Te- resa Galvin, Holstein, Iowa, graduate, as Queen of the Night, Jim Mosher, Co- lumbus Senior, as Monostatos. In addition to the principle characters the opera chorus, consisting primarily of students of the music department under the direction of Dr. Marshall Turley, assistant professor of music, provided bits of musical dialogue and choruses throughout, with the members doubling occasionally as animals, priests, and other bit parts as needed. as ,L Music and Theatre departments work together This is the most enthusiastic produc- tion staff we've had in the 25 years of my experience here, and it is our largest effort musically and in costuming and sets, Dr. Millard Laing, chairman of the music department said about The Magic Flute . The opera, a renowned work of Wolf- gang Mozart, was a joint effort of the Music and Theatre departments. It was sung in English and presented in two acts on March 1 and 3 by PSU vocal artists, faculty, Opera Chorus Sympho- ny Orchestra, and local musicians. Dr. Burton Parker, assistant professor of music, directed the opera, and Carolann Martin, assistant professor of music, conducted. J lx NJW 7 I D K .. 'K-:Dux 2 ,ily Nw sg N' . x. 1 A ,. ,l ' ,x.. N X f ,A sl an Q, Ref- k K S'- ff ypqw :fs 4, 6 1 WMM X, :,. 1' 3 SQ 'L V sf. M. ,' X 21 Xj s 3 ,x -N .vjfi 0 s .fa Producing a play involves much more than directing actors on stage. Few real- ize the work, time and manpower need- ed for a successful production. Three theatre employees - Randy Bu- ford, Pittsburg juniorg Gary Weber, Garden City junior, and Kris Pearson, Ulysses senior - shared the bulk of the technical worries in almost every per- formance this year. Backstage worries exist long before a performance. Weeks before opening night, Barry Bengtsen, assistant profes- sor in design, lighting, stagecraft and costumes, designs the set and costumes for the show. Sets for this year's productions were relatively simple. Most were built so they could be moved to stages in Kelce Center and Grubbs Hall. Both seat about three hundred persons and often substitute for Carney Auditorium, where small audiences are lost among 1700 seats. The stagecraft class assisted in set construction, using mostly plastic and plexiglass rather than wood be- cause such materials are cheaper and easier to work with. Amber Crawford, a theatre student from Carthage, Mo., has been in charge of building costumes for productions for the past three years. Although sometimes a printed pattern is used, pieces are often cut and fit from scratch. Many times an actor doesn't have the right body build for his role. Crawford faced the tasks of adding more hips or a fuller chest or even making arms longer than they really are. Crawford made many costumes from those already stored in Carney. She was assisted by Robert Gobetz, speech, dra- ma, theatre instructor who found many originals for her at rummage sales. Mr. Gobetz goes to a lot of rummage sales, and if he sees any originals, he usually picks them up for me, because he knows I like originals. Most can be rebuilt five or six times if they're sewn well. Lighting is another important depart- ment in the theatre, where three types are used: fresnels for general illumina- tion, lekos for concentrated light, and a followspot. They are hung on battens in the auditorium and above the stage. Be- tween productions these lights, worth nearly a quarter of a million dollars, are stored in sealed vaults. On production nights, crews are needed to get things done backstage. Make-up and costume crews keep things in order in the dressing rooms. Most actors ap- ply their own make-up, but occasional- ly special effects require an experienced helping hand. Set crews are kept busy moving flats and furniture between scenes, and fly crews raise and lower scenery from above the stage. A props crew sees that the right properties are in the right place for each scene. Tickets for productions are seldom sold in advance since students are admitted on their number-eight card. Theta Al- pha Pi, the PSU drama fraternity, pro- vides ushers for performances and often runs a concession stand on show nights. Even after closing night, there is still work to be done. All the actors pitch in to help strike the set. Every item used must be stored, returned, or torn apart. Costumes must be cleaned, sorted, and restored, and dressing rooms and make- up rooms need to be put back in order. Hard work and dedication are needed for successful productions. The stu- dents who worked behind the scenes this year dedicated much time, muscle and imagination to make each show a success. A boy, his horse and his analyst Equus Director Barry Bengsten presented Equus, a production of theatre-in-the- round, on October 21 and 22. Written by Peter Shaffer, Equus is the story of a boy in a mental institution who is dis- turbed by his religious experiences and beliefs and societyls pressures. Mem- bers of the cast included: Martin Dysart Alan Strang .... .....i.i J ohn Ploof Frank Strang .....,..... Rob Gobetz Dora Strang ....... Charlotte Dodson . .Camilla Upchurch . . . . . . .Barry Bengtsen Hester Salomon Jill Mason ............, Rinda Gray Harry Dalton . . ..,.... Dan Mosier . . . . .Pat Stockwell . . . . .Sue Schimmel . . . . .Pat Stockwell Kingsley Walker Kent Fanoele Dan Mosier Horseman . . Nurse ..... Horses . . . Randy Buford built the horses' masks and hooves, and Gary Weber construct- ed the set. Kris Pearson was assistant director for the production. Top: John Ploof as Alan Strang rides his favorite horse fPat Stockwelll in his sacred place. Right: Barry Bengtsen plays the role of Dr. Martin Dysart. An Evening with Noel Coward 64 Dinner Theatre came to Pitt State in the form of the musical Tonight at Eight Thirty: An Evening With Noel Coward November 30-December 3 in the Imperial Ballroom of the Student Union. The performance included eight Cow- ard excerpts: Mad Dogs and English- men , Red Peppers , Three Juvenile Delinquentsn, Why do the Wrong Peo- ple Travel , Stately Homes of Eng- land , Ways and Means , Men about Town and Family Album . Directed by Cary Clasz of the depart- ment of Speech and Theatre faculty, the play also featured the work of Barry Bengsten, Designer, and Jim Kindal, Music Director. The cast included: Doug Carroll Wendy Ijams John Ploof Karen Williams Kingsley Walker Paula Tocci Sanford Garrett Ossie Kendall Dawn Murrel Donna Powers Jim Kindall Randy Buford John Keady Kathy Owsley Sue Schimmel Andy Houchons Kris Pearson Carol Carnes Dale Hubbard Trent Canupp Amber Crawford Bob Garrett Steve Hailey Leonard Harris Stan Hegeman Donna Hailey f A va U, 'ia' K 'W Peppers . Top: Jim Kindall talks to Kris Pearson in Red Pep pers . Left: Steve Hailey, Bob Garrett and Donna Hai ley in Family Album . Above: Kathy Owsley and Kris Pearson do their drunken sailor performance in Red The Last Meeting of the Knights of The White Magnolia Ramsey-Eyes Darryl Dotson Rufe Phelps Frank Kuhel Olin Potts Martin Burch Red Grover Randy Buford Skip Hampton Rob Gobetz L. D. Alexander Bill Shields Col. J. C. Kincaid Mike Taylor Lonnie Roy McNeil Lee Newton Milo Crawford Pat Stockwell Director Robert W. Gobetz Exhibits include a little of everythin if Q .t i if is lp i 'g p g' qi ,lg i !iiii'i 'i5ii ' Q A A y M r E f S 3 iQ ' .s A X . 'f 5. The Whitesitt Gallery featured an al- most never-ending variety of artwork on display during 1977-78. Exhibits in- cluded such items as posters, post cards, Navaho rugs, macrame and quilts. Each semester ended with exhibits of senior and grad students from the art depart- ment. Several faculty exhibits were also on display both semesters. -4. Above left: Senior art exhibit by Robert Crigler. Far above: Senior art exhibit by Christine fChrissyl Dillon. Left and above: Spring exhibit from the Safari Museum in Chanute. David Frost . interviewer Journalist David Frost cast himself in the role of stand up comedian as he smiled and joked with a receptive audi- ence of nearly eight hundred and fifty PSU students, faculty, and guests on October 5. Frost was the first speaker in the Student Senate's Emphasis Series. Frost's topic, Interviews I Shall Never Forget, included his conversations with former Presidents John F. Kenne- dy and Richard Nixon, and such digni- taries and world leaders as Randolph Churchill, Golda Meir, Chistian Ber- nard, Boldivar Shirlak, Prince Charles, Rose Kennedy and Dyan Cannon. Frost's attraction came mainly from his 1977 Richard Nixon interviews. Howev- er, nothing was mentioned about Nixon until a student asked Frost if his opin- ion of the ex-President had changed be- cause of the interviews. Frost retorted with a clever I now don't understand him on a deeper level than I did be- fore. He seemed to think of Nixon as another interesting person he has talked to but considers him no more special than anyone else he has inter- viewed. Among the people Frost said he would like to interview in the future are the Pope and General Degul. I'd like to interview Idi Amin againg I interviewed him four years ago, but a lot of things have happened since then! Frost said he enjoys satirizing politi- cians. Politicians won't say anything which might be daring. Ask what their favorite color is, and they'll probably say plaid. A question Frost often asks his subjects is How would you like to be remem- bered? Frost said his answer would parallel one that Israeli Foreign Minis- ter Moishe Dayan gave him: That's what I'm dead for - not to have to worry about what people say about me. Most of the audience enjoyed Frost's dry detached humor, which showed the amusing side of politics and people. Speakers Bobby Seale . . . ex-Black Panther leader The fierce appearance that once fit neatly into the white stereotype of what a Black Panther looked like has undeni- ably mellowed, but Bobby Seale still calls himself a revolutionary. Seale was a guest of the Student Senate Emphasis Program and also the keynote speaker for Black Heritage Week. At times showing flashes of the leader- ship qualities that enabled him to be an integral part of the American revolu- tion circa 1968, ex-Black Panther leader Seale explained to an audience of 150 at Carney Hall on February 8 his new pro- gram for eliminating poverty. Remind- ing people that there are more than 60 million persons living at or below a sub- sistence level in America, Seale stressed community-based economic develop- ment, for which he is asking Congress for S20 billion a year for ten years. Seale called his economic stimulus pro- gram a test for Jimmy Carter. He said he was surprised to receive a personal response from President Carter con- cerning his proposals - He said I had good ideas. But Seale said the sub- stance of the President's letter was mostly a put-off. To counter such rebuffs, Seale has orga- nized a lobbying organization, Advo- cates Scene, which he called a lobby group with militant teeth. Seale wants to use federal funds to enable communi- ties to incorporate and to enable people to become stockholders. He explained individuals could own shares whether they were businessmen, workers or wel- fare recipients - equal shares for all. Because all persons living in a commu- nity contribute to its economic livli- hood, they should all be part owners, he said. Seale also spoke on behalf of Homicide Prevention, a national organization which seeks to defuse potential homi- cides before they occur, primarily through counseling centers. Seale said he was a victim of child abuse which created a basis for his own lonely rage. He said those days of lonely rage ended when he helped found the Black Pan- ther Party for Self Defense. With Huey Newton and other Panther members, Seale patrolled the Oakland ghetto car- rying tape recorders, law books, and shot guns in an attempt to observe bru- tality. The Panthers catapulted to national prominence when they went on the floor of the California legislature with loaded guns to protest legislation for- biding carrying of weapons in an incor- porated area. He remembered the inci- dent which was a highlight of his ca- reer, but explained that it, the Chicago conspiracy trial stemming from the 1968 Democratic National Convention protest and his New Haven murder ac- quittal are all in the past. Downplaying the use of firearms, Seale said legislative action is now the key for solving domestic problems. However, if federal protection is hard to get, I'm still a revolutionary, and if I need to , I might pick up a gun someday. Ted Howard, genetic engineer Who should have control of our future, the general public or large corporations that already dominate our lives more now than most of us realize? This was the main question raised by Ted Howard, author of a book research- ing genetic engineering, in his speech April 19 at Carney Hall auditorium. Speaking to a crowd of about 150 per- sons, Howard described the great strides being made in the field of bio- logical and genetic engineering, and he said that soon we will gain the ability to harness our own evolutionary desti- ny D! Corporations today are too big, they are like nations within a nation, and I feel it is inappropriate to allow the con- trol of the future in genetic engineering to be held by the large corporations, said Howard. Howard said that ethical consideration should have been given before the fed- eral patent office said industry can patent and own certain forms of life it develops. This gives big business too much authority in guiding our destiny, said, Howard. Howard fears genetic power, if left in the wrong hands, could lead to eugene- tic philosophies and that artificial cre- ation of human life will transform sci- entists into gods who will address a hu- man being as an arrangement of chemi- cals, or more simply, a biological ma- chine. Howard said this is the worst thing that can happen, and that it will happen un- less the public becomes informed and takes a stand in controlling its destiny. I believe that many of the most amaz- ing possibilities ever written about in science fiction stories will become tech- nical realities within our lifetime. We are at a crossroads of human histo- ry. We are all dazzled by cloning and the manufacture of human life, test- tube babies, and whatever, but we are faced with important value questions. We will soon have the ability to control our destiny, to alter our heredity, to shape and form succeeding generations, but who will control this powerful tech- nology? Proponents of eugenics believe that to make a better society, the people must be made better and that you are con- trolled mentally and physically by your genes. They believe that by rooting out bad genes, and people with bad genes, you can create the perfect society. How- ard said this is prejudiced and inhu- manistic and thinks this should be avoided. Sexual reproduction is not an efficient technique because there is no guarantee of a good product, according to eugenic supporters, because you can't control what happens, and that is not good, said Howard. Bio-engineering gives scientists control over reproduction, making the outcome preplanned and perfect Development and progress in technol- ogy is inevitable, but the voice of criti- cal judgement tells me there is a time to draw the line. Progress is good to a point, until it gets out of hand, and it is up to the public to take responsibility for their future and take control in this matter. Where do we draw the line? This is a grave political and social question, dealing with the manipulation of peo- ple. Unless people get involved in the development of technology, it will get out of hand, Howard said. Zig Ziglar. . . Profit prophet Pitt State welcomed the guru from Ya- zoo City, Mississippi, Zig Ziglar, Feb. 1 in Carney Hall Auditorium. Ziglar spoke to an audience of about 350 stu- dents and local businessmen on the top- ic of Positive Mental Attitude KPMAJ. Everyone wants health, wealth, happi- ness, and more of the good things in life. I believe you can get anything you want in life, if you help enough other people get ahead, Ziglar said. Ziglar cited his own life as an example of how PMA can help you. He ex- plained that he had been just a small town boy with a poor self image and no confidence in himself. At the time he was working his way through college trying to support a wife and child, he attended a sales seminar and was en- couraged by a teacher to improve his self-image. One man's confidence in me changed my own personal feelings about myself and changed my life, Ziglar said. He cited the promotions and the good luck he benefitted from in the next year as he rose to star salesman in his company. Ziglar is the originator of the I Can course which was developed to stimu- late personal growth and which is being taught in many high schools and col- leges throughout the country. His cur- rent goal is to see his course taught in 1,000 schools by January 1, 1979. Ziglar is the author of the book See You at the Top . The book was refused publishing rights by all the publishers he tried, so Ziglar published it himself. It now has over 143,000 copies in print and is used as the text for The Richer Life Course taught in many corpora- tions. He has also co-authored two oth- er books. Anyone can make it, and God wants you to make it. You just have to get sold on goals and get excited about them, Ziglar said. Ziglar stressed that individual goals must be realistic. I could say I'm going to whip the heavyweight champion, but I could never do it. I could work out and come closer to reaching the goal. An- other boxer could say that and have a better chance of doing it because he's in a better position to reach that goal. Not all people can expect to reach the degree of success that I have, but if they try, they can come closer than if they never tried at all, Ziglar added. I don't care what you dog today is the only day of your life, the only day you are guaranteed, so use todayf' Ziglar said. Homecoming '77 The Queen Competition, Yell-Like-Hell Contest, Parade, Banner Contest, Concert and other activities kept everyone in high spirits throughout Homecoming Week. Homecoming '77 was highlighted by the week-long events and all those who participated in them. Queen Competition sparked the official beginning of the activities, which led to Convocation and the announcement of Pat Bartonek as 1977 Homecoming Queen. County Fair was the theme for this year's Homecoming. Keeping with that idea was Yell-Like-Hell, one of the most inventive happenings of the week. Alpha Gams captured first place in the event for the second year in a row. Also an- nounced at Yell-Like-Hell was Newman Center's winning of the banner competition. Homecoming day promised excitement and fun, and both of these turned out to be true. The parade was a success, except Above: Head East, the homecoming major attraction, brought the audience to its feet. Right: Pat Bartonek smiles after being announced PSU's Home- coming Queen. for a few minor mechanical problems for the Lambda Chis and Bowen Hall. These were solved for the Lambda Chis with team effort, which meant pushing their float down Broadway. Alpha Gamma Delta and Sigma Chis were trium- phant in the float category. Newman Center tallied more points than any other organiza- tion and won the Sweepstakes once again. After the game, nearly everyone on campus prepared for party time, mostly organization-sponsored parties. It was a week to forget the books and get involved - either with an organization, or just independently. Whatever choice, Homecoming '77 had something for everyone. Left: Joyce Marschallinger shows her spirit for the Gorillas at the Yell-Like-Hell con- test. Bottom left: Queen Pat Bartonek gets a kiss from Gus during the homecoming pa- rade. Below: Pat Horto, Graphic Arts Home- coming candidate, rides the Graphic Arts float during the parade. 15 fl if -R if F M N -Onyx. Spirit homecoming The PSU Cheerleaders, Band, and mascots Gus and Gussie, led the students through a week of exciting homecoming activities. The PSU Pride of the Plainsi' marching band, directed by assistant music professor Gary Corcoran, displayed their mu- sic ability and marching dexterity at the opening of the homecoming game. After queen Pat Bartonek and her court were announced at halftime 15 high school bands from Kansas, Oklahoma, and Missouri marched onto the field for a mass band perfor- mance. Most students were too wrapped up in conversations with old friends and alumni to pay much attention to the Above: Jack Copeland is caught in action, marchf ' rade. Right: Various high school bands from the 'V surrounding area, are shown during Homecom- ing's halftime entertaining the crowd. lf-it., X color or music of the show, however. Gus and Gussie ran around exciting the crowd as usual. One of Gus's favorite tricks was climbing the light pole to cheer for his team while mischievous students pelted him with chunks of ice. He never lasted long at his post! The crowd reacted to the mascots more willingly than to the cheerleaders who seemed worn out after Thursday's pep rally and Saturday's parade. . P1 ,rr N ing dowr11fBroadway during the Homecoming pai if i'i - is V S.ws.g. - gf 1,5 r -V f Q -'Q me H .Ns X XSQPQ 'NKQRQVW TEEN gsXR N VX? xo? 5 23 :ff A5.,KX1a XM mm N N Xxx .--. :wig-,. ---.:, vi. ...I X54 . is .Ll X Ks X X Q' if ii W as X X r Q eww Kiwi si ,MXN 7. , . 'Q 2 NR HX fi Q i fs. Sexy ,LX W,,.... sw, K ., .r 4, ks' 4 sim ' f 'S' ff! in - , ii 1 sf f' ' XX, ..fi-iff., 5 - 3 X , .gy QV - L. xszlf.-fel if X' 1 f - H ' ' M Ni i' 1 ei! Qi K W- f - is A wig 5 X N -X fww- M W 2- . '-'- - -Xue . X- A i ss. . 2 X Q f .gf , Q 7, ., . MX ... . XX - ,-fs X N X -X Mr- :sg -5gXQi,:Xg ww . A , 'x XA .. fs, .,. dxf----.:. Nm - , 462-1 . -2 . X.. -.X .. .X - X it Xi ., , ,:m- rs- QX--5. -sw , X Xr X -. . -. f . I X, X . N 1W 3i5'f K? V W .2'1:.53?es L Q' S5512 S -:L X was ' X.f,:.i 1. 5-12 1-. N f 2 -i km - Mi, 3:H,,i:.. Wf'L Y- WV , ji ri, 1. is X HEQSB 1' Sm Y ' . we -1 fm: .. 7 - . Q. Dfw-, we '- , .K r . N511 ,, . H-, ,. ,,,,, i .1-gl, , ,A Left: 1977-78 PSU Cheerleaders: Ann Olive Karo- lyn Schooley, Janet Villamaria, Lynn Villamaria Debra VanBecelaere, Sue Vomhoff, Claude Cum- mings, Bob Barnett, Tim Dooley, and Jim Robin- son. Bottom: Gus shows his spirit at the Home- coming parade. 3 S and her court Q... .X ,,,... 3 -fr Janet Villamaria Kathy Pryor Lisa Atwater Kit Hood Gorillas suffer heartbreak The Gorillas' record stood at 0-5 at homecoming and the football battle matched a young, inexperienced Pitt State team against the veteran Ft. Hays Tigers. In first half action, Pitt State scored on drives of 55, 49, and 74 yards to give the Big Red a commanding 19-7 half-time lead. Mark Hittner hit six of 11 passes in the game, one for an 18-yard touchdown to Greg Smith. The second half was even more action-packed than the first. It seemed for a time that the Gorillas might breeze to an easy win, but early in the third quarter, Fort Hays' offense exploded, and with the help of turnovers by Pittsburg, the Tigers took the lead, 29-26. A fourth quarter field goal by Jon Gifford tied the score for the Gorillas, 29-29. Pitt State made many attempts in the closing minutes of the game to squeeze ahead of the Tigers. The last try was with 17 seconds left on the clock. A field goal was attempted, but failed. Alhough the score was tied at 29-29, the game was considered a victory in many ways. After a slow start, Pittsburg displayed its most balanced offensive attack of the season, and by the end of the game the Pitt State offense had amassed 414 total yards. Also abundant were the spirited attitudes of both the team and the home crowd. Far right: Local high school bands honor PSU dur- ing half-time at the homecoming game at Branden- burg Stadium. Right: Wingback Greg Smith, Lees Summit junior, rushes down field after receiving a pass, and scores one of his five touchdowns of the season. Below: Joe Ballou, Overland Park sopho- more, missed at field goal attempt that would have won the game for Pitt State in the last few seconds. l l 1 -,-'fir ' ,-5' ' 0 Q ' Q9 ,pr A. -. . EJ. -M fy! n A ,. - ,t x f ' E P' 1 J , T, l f I' 'srl WM., .9 ....- ' -N ,AJ ,..t. H-K-.gf ,.f .-5' ,4-1 --1-.,. :Q-. M- ,. M-,uf T' , 1 1, f .435 ,' ' p v ,'?' gg' -' I ,nngf gf 5 5, ,, .wr -- A -JL ' . -'f ' - , 1 f -5- , 47,31 f ,- .' ' vs Q- fr f ' r-J'.r- '- f, N . ,' ff? -,..':V' - ...ya ,.,,.'Q- .2--ef , . . F . af 59's 'Br - 9' - -f' fav I 1-' - If 'A f , , . i HMA ' Q -' ' , 4 A . . vm L - f My Q, 2- 1 .1 . .ui 22 4.?gp:,q,T,,-. N't.u'.w H nr V ', . . A - ,lf-N ..-N v ul' V.. g'4:. f'1,411 'fm 3,--,' , 'YL-'1 mr, ' 'L J' J 335 f' 0 j 1 - . idk:-,,f . T . . wk .Q-. ly, A :Jr 13,5 . ,Al-1?-xi 1 W in I - . '. ,, , Q X W ?' f V - s ' -1- 1-' :1 X 1 '-Hin 1 . H ,, uk ' --1f l'13,tQlg 5 ' 'v4 x'f.',. -.R 1 r N HVQPVE ll -'gif' ,,-.,. ,. M ,, --L .. I QMH.. , A z' v ., u-gi A .- .- ,,f,,H..',,-l F an 1 48.1 ,. x f v fill-T' L' 55 - I 'I ,ff a.,'Qs A - 3' 1 . 5'1n- ,, Q' nc' Ain-vvi 'J I -I max, .captured the mood of spirited PSU Students with an outstanding performance from Pittsburg's usually quiet crowd greeted Ram Jam with polite applause at Weede Gymnasium in the opening of the home- coming major attraction. The concert differed very little from those in past homecomings except that it was in a new building. Previously held in Carney Auditorium, it moved to Weede Gymnasium which has a much greater seating capac- ity The crowd didn't understand the word uenthusiasmi' . . . or maybe just don't appreciate the jamming ability of Ram Jam. The latter was more probable as Ram Jam's drummer came back on stage after their forty-five minute performance and asked the crowd if they wanted to hear some more rock and roll . The audience wasn't extremely in favor of the idea. But their lack of response went unnoticed because of the group's blaring sound system, and Ram Jam returned for another number. The crowd did applaud when they finally left the stage for good, making it clear that Ram Jam didn't have Head East. much appeal for Pittsburg students. However, when Head East arrived on stage a miraculous change came over the audience. People stood, cheered and clapped. By the end of the second song nearly one hundred people had vacated their seats to stand - but never stand still - directly in front of the band. Gradually a hundred more joined them and the majority of the remaining 1500 persons attending got down on such songs as Never Been any Reason , City of Gold , Jefftown Creekv, Fly-by- Night Ladyw, and Gettin' Lucky. Once the audience got excited it was hard to slow it down. After flickering lights and chanting more, more, more brought them out for two encores Head East refused to be coaxed back on stage again. So after a painfully slow begin- ning the 1977 Homecoming major attraction warmed up to become a blazing success. More . More . . . More . . , 139 B su X f. entertains students ity. X, 1 Y, X H V 1: A , X 1' 5 r 'e Q ' 'M e .., 'sgj' 1 , rs r , ,. E . 1 Qfs' 'W ,A ' T, ' - YLE'MAKTY r 0UmlflANKENSTElN GENEWll.DEK PBTEKBO H eow: rmmy p eerxs was ea ure W1 e an K ILDER B 1 J' S h ' f t .1 'thth b d ' WHWMMGLBEA :'nTs'lfnnoo1cs Cole Tuckey. Right: Young Frankenstein was one of R :0muS.,:,,,,,,.. the movies featured in SUB film series. 'IU1'-'VWHAR ' ' ' '- wvfjg Top: Royal Scanlon and Gary Paredes of Missou- ri Woodland in concert at Carney. Above: Glob- trotters pull the 'old rubberband on the ball trick. Left: plays Ma Pepper in Dinner Theater. is au,-Q in , pf-v is -gf. J' q 6 'S 'S 3 1 f if ii 5 I A' WY X an-'wwf' ,yrg Above' Norman Blake in concert Left' The Rocky'Horror Picture Show was fegtered in the W h slr a film screens. or 649 Q16 el' 0,17 C' WF ummm gg Black Heritage Opposite page: Debbie Price was one of the models in the fashion show on Thursday's talent night. This page, top right: David Sheppard sets the beat for the jazz combo. Above: Randy Meadows and David Sheppard warm up before a number at the talent show. Right: Ruby Stewart, pianoist for the Gospel Choir, joins in the singing. '-2. k Black Heritage Week is for everyone, not just blacks, co-ordinator of activi- ties Myron Johnson said. People seem to think they have to be black to be involved in our activities. We want to get everyone involved. The turnout has been improving every year, but we'd still like to get more people involved. The major reason for more involvement this year is the bigger names involved in the festivities. Bobby Seale, the fea- tured speaker of the week, was a big name in the political activism of the 1960's. The changes in Seale from a rev- olutionary leader of the Black Panthers to a lobbyist illustrates a change in the attitudes of many black activists in to- day's society. A Banquet, a dance and several discus- sions filled the week. On March 22 Ca month after Black Heritage weekl Confunktion per- formed in Carney Auditorium. This band was contracted through the Black Heritage committee, but, because of their recording schedule, they could not make an appearance during Black Heri- tage Week. Black Heritage, as the name implies, looks primarily into the past. We try to show how the black man got where he is today. We trace our roots through music from gospel to jazz, our heritage of soul food, and our lifestyles from op- pression to our present-day status, Johnson said. Through Black Heritage Week activi- ties we try to reawaken black people to their culture and show white people how we really feel. Apple Day unites faculty and students. For the 71st year the PSU fac- ulty provided students with delicious apples after the com- memeration day program, nicknamed Apple Day. Dismissed from classes for the occassion, students were en- tertained by joining on the singing of Happy Birthday to' our university. Who's Who awards were presented as well as outstanding faculty awards, a project of the Student Sen- ate. Gene DeGruson, Library Sci- Q .-X Q is 1- .rf Q Above: Dr. Heffernan is caught enjoying an apple. Above right: Faculty pass out apples after the convocation. Right: Mark Quinlan tries an apple out. ence director, explained the history of Apple Day which began in 1907 following the appropriation of funds for our campus. The traditional apple distribution by the faculty was the students re-enactment of a fine of apples which founder R.S. Russ received at the Kansas Legislature during his attempts to obtain the 310,000 needed to buy land and build a campus for the State Manual Training Nor- mal, now PSU. W Roman Hallidays unites the dorms. 1 W 15? Dorm residents enjoyed a week full of activities. '33, s Q , N ws , W-- Si, Campu politics comes alive The year in student politics on campus was exciting as it held great interest for the majority of the student body as both faculty and students actively cam- paigned for one cause or another. Each party had a full roster of 25 candi- dates. There were also two independent senate hopefuls. Shirley Edmonds and Dean Van De Mark headed the SUN party, while Mike Hull and Kim Benedict ran for the REAL party. Both parties ran the normal campaign strategies, speaking to fraternities and sororities, campus groups and organizations, and handing out fliers revealing stands. The main issue was that of a proposed student fee increase for the athletic de- partment. Dr. Bill Dickey asked the Student Senate to put S10 increase in student activity fees per semester. In doing this, Dickey said he hoped to im- prove the financial base for the athletic departments. He hoped for better en- rollment with a winning team. Saying the current scholarships weren't enough, Dickey said that all other pos- sible alternatives for getting money had been exhausted. He was now turning to the students for help. The students felt the impact, and they definitely had their opinions. Edmonds responded by saying the SUN party would not declare a stand as she didn't believe in making a puppet party out of her running mates. However, she did strive to educate the students by giving them the facts of the situation objectively. Hull was against the increase, and his stand was to keep the costs of the stu- dents down to a minimum. The raise in fees, the REAL people felt, would hurt enrollment on campus. Dickey and his staff went out also to the students on campus, in hopes of educat- ing them about the increase. An open forum was held on campus to enable everybody to seek answers. An open forum with both parties was also held for the students. Both the presidential and vice-presidential ho- pefuls of both parties were asked ques- tions for an hour concerning the issues on campus. Then the time for voting came. Booths were set up on campus, and along with voting for the Senate elections. The stu- dents had to decide whether they want- ed the fee increase. By midnight March 9, the results were final. Edmonds and Van De Mark re- ceived 693 votes against Hull's and Benedicts' 656. Nine REAL candidates won along with 15 SUN candidates, and one independent. The athletic fee increase was defeated, and it may have been due to this issue that there was a high voter turnout. A total of 43721 of the student body voted while no other state campus had more than a 1027 turnout. -Am Q! X N I z 5 MW .E, I 1 Opposite page: Shirley Edmonds shows a sign of excitement, the new Student Body President. Above left: Marcia Jones and Billie Jo Burge both candidates for student senate work on their post- ers. Far above: Mike Hull, student senate presi- dent candidate, shows his way of advertising. Above: During Apple Day Commeration the two parties sat together showing their school spirit. Left: John Perry is ready to ask a question at the pen forum held before elections. K Th Student Employee Nearly 800 of PSU's approximately 4500 students work on campus. About one-third of these students qualify for the work study program. Most campus workers consider the loca- tion of their jobs a convenience. Many find that they can get along without transportation by living and Working on campus. For others the fact that their on campus job hours can fit around their school schedules is the only Way they can manage school and job at the same time. Campus jobs range from librarians and secretaries to food service personnel and staff assistants in dormitories to maintenance personnel. Every depart- ment has at least one secretary and many also employ students for other jobs as tutors, lab assistants, athletic trainers, key punch operators and oth- ers. -en v5 Simon Chigboja, ' As a student from a foreign country, Simon Chigboja finds his work in the media laboratory quite helpful. I know more college students and teachers because of going to all the buildings. The people I work with are very friendly, and it has helped me make friends. Chigboja, a freshman Eng- lish major, arrived from Ankpa, Nigeria, on Sep- tember 3. He didn't find speaking English a prob- lem. We speak it at home. It is the main lan- guage of instruction in Ni- geria. I hope to teach Eng- lish upon my return to my country. Chigboja finds his hours convenient. I can sched- medla laboratory ule my time around stydying. At pre- something like 10 hours. sent I am working 16 hours. If next semester I feel that it will conflict Chigboja applied for the job primar- with my studying, I can change it to ily as a source of income, but he alsgg thinks it will be helpful in the future. If I graduate M- rY- s and teach some place, it . will help me teach my . j ' own stu ents. fi Marcella Butel, micro-biology lab Marcella Butel, senior biology major from Paola, said that working in the micro-biology laboratory is a helpful step in acquiring her medical technology degree. It's given me a lot of experience in techniques. You develop techniques by practicing, and I'm getting a lot of that! Working in the lab helps her appreciate her science classes more, Butel said. It's made me more aware of how the department works. I know where and how the cultures we use are made because I prepare them. And I know those teachers so I never skip class. Laboratory work can be dangerous, Butel said. Often Butel transfers organisms in cultures. Usually it's noth- ing very dangerous. I transferred some pathogenic organ- isms last semester. You could get sick from some of them, but there's nothing in the lab so dangerous that you could die from it. Despite job hazards, Butel emphasized the rewards of her work. Working has given me more confidence. I find that I really enjoy this kind of work. l've gotten to know the teachers, and they've gotten to know me. They are important to me bacause they are my references for medical technology school. Dean Van De Mark, Weede supervisor For Dean Van De Mark, a manpower management ma- jor frorn Wichita, working as a night supervisor at Weede Gymnasium helps him see the relationship between stu- dents and the Weede regula- tions. Van De Mark, a sophomore and a student senator, be- lieves it's worth his time be- cause I can look objectively at both sides of the problems that may come up concern- ing Weede. A ma'or issue with the Student genate is the concern for the hours and regulations of the gym- nasium. I find it has helped me as a student to see the problems involved. The work schedule is not a worry to Van De Mark, as he only works five hours on Sunday night and takes 12 hours in school. I really am lucky because the work doesn't hinder my studying, and at the same time it helps because it enhances my abili- ty to relate with students and with Dr. Dickey on the issues at hand. The little ex- tra money each month helps too. Since Pm into manpower management, the work at Weede also helps by provid- ing me with the chance of re- lating to people. Because management deals with meeting people every day and because I deal with peo- ple every work night, I am again lucky to have this job. Carla Scasselatti, secretary wi Q English major Carla Scasselatti, a Pittsburg sophomore, works as a student secretary in the department of tech- nology in Whitesitt Hall. Another student and a civil service secretary join her in the general office routine which includes answering the phone, handling the mail and occasionally taking a letter. Working between 15 and 20 hours per week, Scasselatti finds the balance of classes and her work-study job a very convenient routine. Working on campus is really a great convenience because I have to drive to school anyway. This way I just have to walk to my job. I also get to work between classes, so I don't have to sit around and waste time waiting for class. Not only has she learned new words working in an unfamiliar department, but Scasselatti says it also af- fects her outlook upon campus life and people in gener- al. I've learned that you have to deal with people and be courteous, no matter how mad they make you. This will be something I'll always remember about my job. Larry Forsythe, tutoring As a mathematics and com- puter science major, Larry Forsythe, a Baxter Springs ju- nior, finds tutoring students in the math department a good review. Working as a tutor 10 hours a week doesn't put too much of a strain on his 15 hour class schedule, Forsythe said. Even though Pm a commuter and it takes a lot of time, I enjoy being in the math envi- ronment, and I enjoy the chal- lenge of trying to work out the problems the students have. Sheryl Pitts, dispatcher Being a dispatcher for the corn- puter center is a nice way to fill afternoons Sheryl Pitts, Tulsa senior said. My major is infor- mation systems so my job fits right in. I work 12 to 5 on Tues- day and Thursday. I don't have any classes on those days any- way, and I can study if nothing is going on. Pitts' job entails answering the phone and helping students with their programs. Students can call from six terminals on campus and one at Girard High School to receive help. If I can't answer their question, I can connect them with any of the computer science teachers dirgctly from my office, Pitts sal . My job gives me good exper- ience around computers which will help after I graduate. It's a good review of what I've al- ready learned. Pitts started working as a key- punch operator last year in the computer science department. After a semester I changed to dispatcher. It's more like being a receptionist. I like it a lot bet- ter. Working here helps me learn to cope with differentipeople. You have to learn to adjust to different ones. And I've made a lot of new friends here - people I never would have met if I didn't work a job like this. Tutoring is not working a problem for students, but it's relating to them so they un- derstand what to do. I can re- late to them because I was in their shoes when I was a fresh- man. Tutoring makes me realize the worth of my earlier math education and enables me to intelligently relate basic con- cepts to peosle in my field. Forsythe ad ed, It's helped me handle myself working with people. Af --.... Union services Iimited by economic pinch There is a diplomatic service on the Pittsburg State University campus. Averaging more than 3,000 service transactions each day, and in the past year fulfilling the needs of more than 101,736 persons, the Pittsburg State University Student Union Building re- presents and belongs to every student. The Student Union opened at Pitt State in October of 1951 under the guid- ance of Jack Overman. According to Overman, not a penny of state funds have ever been allocated to come to the aid of the union. It was built, is operated and is maintained thrfough the union building fee and self- generated money. To keep services operating smoothly, the union requires 35 full-time employ- ees, 15 regular part-time employees, and extra student help to serve large luncheons and banquets. While food services to students, faculty, administration, staff and guests of the university take the largest portion of the union staff's time, there are also conferences, seminars and meetings that require refreshments of one kind or another to more than 48,000 persons and special banquets for another 38,000 annually. With more than 1,700 meetings set up every year, each satisfying the require- ments of campus organizations in a dif- ferent manner, a great deal of planning and diplomacy is necessary. In addition to the union's daily func- tions, the Student Union Board pro- vides activities that must be given space and scope. Basically, the purpose of the Union Board is to plan and administer pro- grams appropriate to the Student Union which serve the cultural, social, recreational, and educational needs of the students. Mike Sullivan, Union Program Direc- tor, said that any student is eligible for membership in the SUB, and is always more than welcome. All that is required is that he shows an interest and fills out an application. Meetings are open to anyone with suggestions and a willing- ness to become involved. Funded directly by student fees 185.50 per studentl, the SUB Program account pays the salaries of Sullivan, a secretary and student crews when necessary. The remainder is returned to students in the form of programs and entertainment. The SUB Special Events Committee sponsors the SUB Coffeehouse, one of the more popular concert programs on campus. The coffeehouse is entertain- ment in an intimate setting and fea- tures folksingers performing on a small stage which makes them accessible to interplay between audience and enter- tainer. According to Sullivan, the committee is also trying to arrange a carnival or per- haps a circus on campus, and it handles the recycled record sales each year on campus. The Cultural Affairs Committee ar- ranges for performing artists, visual art shows, handicraft bazaars, the amateur photo contest, the magic show and the Good Earth Gallery. It also provides improvements for the union by donat- ing lounge furniture, magazine sub- scriptions and wall prints: The all-campus dances are geared for a break-even basis of operation. This break-even policy depends solely on the participation of the students. One ex- ample is the homecoming dance for stu- dents that are not affiliated with frater- nities or sororities. Last year more than 400 students and guests attended. The Hospitality and Dance Committee sup- plied the work, Sullivan said. Then something clicked last fall making all- campus dances successful, both socially and economicallyf' Under the SUB Recreation committee are listed a variety of activities. The committee planned tournaments of all descriptions, including racketball, chess, billiards and the College Bowl on an Intramural level. Despite all the activities, everyone wants more. Interviews directed at more than 100 Pittsburg State Uni- versty students and faculty members, indicated that each had his own idea of what additional services should be sponsored by the union. Forty-five per cent of those interviewed said the union's services should be ex- tended to 24 hours per day, with limited grill service after 8 p.m., complete den and game-room accessibility, and week- end activities complete with music and dancing. Fifty-two percent agreed that the union should remain open after activities in the union as long as students stay to enjoy the facilities. They objected to an abrupt closing of the doors because of an imposed time-limit at the peak of the evening. While 45 per cent expressed a desire for a 24-hour union, nearly one hundred percent said that, at the minimum, the grill should remain open until 6 p.m. and the den should remain open until midnight on weekdays. There was also general agreement that all services, with the exception of the cafeteria, should accommodate stu- dents on Friday and Saturday nights until 2 a.m., and on Sundays from noon until 10:30 p.m. Because of the diplomatic and repre- sentative nature of the student union, a large percentage of persons suggested that if there are guests residing on cam- pus during periods when classes are not in session and the campus is generally closed, the union should remain open for their use. Most felt that it is not in the best interest of the university for guests to be forced to search off-campus for a place to gather and eat. Foreign students, particularly those on campus for the summer Foreign Lan- guage Institute, find themselves with- out the benefit of a place to spend even- ing and weekend leisure time. New to the country, they often find themselves lost in Pittsburg while adjusting to American life. There was nearly unanimous agree- ment that permanent offices in the union should include only those organi- zations that are of service campus-wide and not limited to partisan interests. Along with the restriction concerning permanent offices, came the suggestion to enlarge the office space of the Stu- dent Union Board, and to provide addi- tional office space for the Kanza, the official university student annual pub- lication. The Student Senate, also serv- Student Union offers limited access. .ss- ing the entire student body, has already made plans to enlarge its offices with a 300-square-foot annex from the Gorilla den. More than 90 per cent of those ques- tioned felt that both the Kanza, the Student Union Board and the Student Senate should be accommodated first due to the broad service of their organi- zations, and in view of their consistant service to the university, they should retain the extra space without the ne- cessity of a yearly justification of re- newal of application. Previous to having available space in the union, campus organizations met whenever and Wherever they could find space, and had no central place to keep their permanent records. According to current rules regulating the use of office space in the Student Union, any recog- nized campus organization may make application for an office. Each year groups must re-apply for that office and state their reasons for want- ing the space. Overman said that nearly every year, the list of organizations ap- plying for office space changes as the leadership changes. Some leaders go all out making great plans and are certain that an office will be needed for their group. The follow- ing year, the new leadership is not quite as enthusiastic, and consequently, even if an office is applied for and granted, it is seldom used, Overman said. Apparently the shift from enthusiastic to apathetic is much the same with the use of the union itself. There was a time when the building was open many more hours than it is now due to popular de- mand, and it was economics rather than capriciousness that gradually eliminat- ed the extended hours of service. Practically speaking, simply to remain open at night requires at a minimum the services of a manager, Overman said. If someone wishes to be in the game-room, an employee is needed in the game-room. If a cup of coffee is or- dered, a fountain employee must be available. Consequently to open the union, three employees must be on duty at all times, Overman said. When fringe benefits are included, the cost of opening the union amounts to more than 3310 per hour in salaries. Evidently students want to move into non-campus situations on the week-end Where the lights are a little brighter, where the music is a little louder, and where the effects of a little too much are removed from campusf, Overman said. It's a matter of economics and psychol- ogy, Overman said. The union is un- able to operate at constant loss without increasing the student's activity fee. It's not in the nature of students to want to spend enough time and money in the union to make it break even on a larger scale. Basically the union tries to operate with the best service possible during the hours that have proven busiest through the head count,', Overman said. Our main objective is to provide a home for students away from home, he said. We want the students to feel that the union is the heart of activity on campus and we try to provide a pleas- ant place for them to come to partici- pate in or just sit around and exchange ideas. There are as many opinions concerning the operation of a union as there are people who use and operate it. The ba- sic problem Overman sees in satisfying every need lies in the fact that there is a statute setting that no tax money can be spent for non-academic activities. Therefore, union use alone determines services, and the headcount determines how many use it. It is an elementary problem of econom- ics - supply and demand, profit and loss, and diplomacy every step of the way. The question remains as to how and to what extent the union should serve stu- dents. For students paying fees and shut out of the union nights and week- ends, the answers of operating at a loss is not good enough. If, as today's nutritionists like to tell you, you are what you eat, the students at Pittsburg State University who eat the food service diet regularly are in trouble. They consume about 20 per cent too much fat. According to a USDA survey which ex- amined the eating habits of 50,000 col- lege students and the nutritional intake of those students, their overall diets tended to be weak in vitamins A and C, calcium and iron ffor womenl. Left to their own devices, college stu- dents generally select a diet low in vita- min A. Vegetables, the major source of vitamin A, are the most actively avoid- ed of all food groups, according to the survey. Yearly surveys made at Pitt State by independent nutrition experts from Chicago show students eat what they like rather than what they should eat. Bread, ice cream and soft rolls are the foods preferred by 94 per cent of the students. Other favorites are pizza, hamburgers, fried chicken, spaghetti, and foods sold in the vending machines. Vegetables, with the exception of pota- toes, are the least-liked of all the foods. The survey also showed that women have stronger preferences concerning food than men. They seem to prefer low caloric items such as salads and vegeta- bles. Even though women need more iron, they apparently have no natural inclination for foods high in iron con- tent. In order to present students with a bal- anced diet, the Pittsburg State food ser- vice was contracted under the strict specifications of the university 11 years ago. Until that time, the food service was operated by the university under You are what you eat. PSU students are no different from other college students. They eat what they like, not always what is best for them. the direction of Jack Overman, Student Union Director. John Stepnoski, Director of Dining Ser- vices, said that students have the op- portunity to obtain a balanced diet at Pitt State. If a person looked over the menu every day and made his selections based on nutritional requirements, he would certainly be able to have a totally balanced diet, Stepnoski said. According to the contract drawn up be- tween the university and the ARA, a professional food service company, ev- ery time a student makes a selection for a meal on campus, whether in the union cafeteria or Gibson Dining Hall, there must be both nutrition and choice available. Each day at breakfast, a selection of two kinds of juice, two styles of eggs and some sort of breakfast meat must be available. The requirements for lunch and dinner become more complicated. Only one of the three entrees offered may be a cas- serole, the other two must be meat serv- ings. For example, if stew is tabled as one entree, beef and ham could be the other two selections. However, if one of the meat choices is a low acceptance entree, the other must be from the list of highly acceptable foods. For example, if liver is offered, then something rated highly, such as fried chicken, must also be on the menu. In addition, the menu must meet other specifications. Soup must be list- ed daily, and the required number of salads and vegetables must never vary. Pie must be present at each lunch and dinner served, but it must be accompa- nied by other choices of desserts as well. The variety of beverages is also a fixed requirement, which includes milk, juices, tea, coffee and soft drinks. Depending on the item, all foods served at Pitt State must be rated as choice, fancy or U.S. Grade A. There is no cate- gory of food that is permitted to be used simply because it is cheaper. Even if it is less expensive, it must still meet con- tract agreements on quality. After the food is prepared, it faces the toughest rating system of all - the campus gourmets. Each compliment or complaint is considered by a special committee, Jack Overman explained. The system is set up so that each indi- vidual complaint is taken on its own merit and answered. The complaint may be voiced or written. If it is placed in the hands of Overman, Stepnoski or Bryce Johnson, Gibson Dining Hall manager, the complaint will be an- swered by the Food Service Committee. This committee is comprised of Over- man, Stepnoski, Johnson, students from each resident hall and anyone in- terested in sitting in on the meetings with suggestions. The committee, which handles both complaints and compliments, meets regularly every other week during the academic year. The minutes of the meeting are written down exactly. If a student says that you could bounce a roll off the wall, that is what is read in the minutes. There is evidence that some policies were changed through the suggestions made in the meetings. Some complaints have been corrected, and some sugges- tions have been followed. K' ay' . :e , Xxx 1 , Complaints such as those about the cold, tough ham on the north line, the stale peanut butter and the lemon pie that wasn't as good as it was before changing products have brought posi- tive action. There were also suggestions to serve more roast beef, to serve brown sugar at breakfast, to serve chocolate pudding in sherbet dishes, to have more waffles on the line, to have more cream puffs and to have shaved ham on rolls. All of these suggestions have been complied with. Some complaints and suggestions have not yet been handled. These remain on the agenda for the next meeting of the committee. Occasionally there are situations for which nothing can be done. One of these situations, according to Step- noski, is the request for roast beef served rare. Most students do not like it rare. When roast beef is pink, a little of the juice runs out of it, and they think it is blood and will not eat it, he explained. Stepnoski added that there are services available to the students that they may not realize they can request, or that they may hesitate to use. These services are sick trays and special diets. A sick tray can be obtained with a re- quest accompanied by a sick tray slip from the Hall Director. The student should also specify exactly what he would like to eat. By contacting Overman, a student with dietary restrictions can be properly served through the food service. While it will require an additional 20 minutes to fill his needs on the line, the diabetic and those requiring bland or high pro- tein diets can be cared for. Vending machines scattered at strategic places around campus are competition for the food service. The vending machine accessability grew until about six years ago. Over- man said. There were about 50 differ- ent kinds of operations set up indepen- dently of each other, and the vendor set the price. Six years ago, I wrote up the contracts for the vending operations, he added. I required that all new machines be specified by type, location, items sold and the percentage that the vendor would pay into the union operating budget. The fund benefits between S750 and S900 per month on the sale of can- dy, soft drinks, cigarettes and miscella- neous items. Whereas the students at Pitt State may consume 20 per cent too much fat, this may be the diet of their own prefer- ences. The professional food services operate to make a profit. Their direc- tors strive to satisfy students' eating de- sires, even if it may mean sacrificing the nutritional needs of those unable to di- rect their own diet properly. .,u1' .Am W Q ,. .gf I - . X .,-JAY f 'IW' , .f 4,,2.:ff',ffe1fifuf ' gzdffi? 'flyfgs fff'f4 2ff bf'-7 - gf'- ' 55 A? fk5gf. ',:'f'1 If 123910 2 ' 'ig3f'i'fQt'4S, 26,1 .Q hfff?-Sffffii. 'Haifa ,ip ' -ps' f' . . 1' -'r',5ffi'Af?f ' 9 T e 42 ,. !,,j,jfg,FF N .,. We W' :K-f'?f'H-f Q . V' '-'. J 1. ':Q' ' 'H' , 'bl' 3'Jf5'2'?'fQM51f 1 ' .1 -f , 4 J2X!,'.3? 5 4 'figl-43-if aj wr-4 i'Ili,',d5?f -1, ' X ' 'v ff - ' -' 45 , - xxx .fi Ii. I ' 4. .MW-f---w.. 1 ' H . ' J' V ' . f.,f'TlQ . f ,' - 1 1 -, 1 l, f--N -f,u6n,g. IS E, t 1 1 I 5 ., .. .I ' -VN 2 -WFWQ Q4- Fifi'-U , 5 f ff :ii 1 ff ,ff 1 4122.4 51552 we Y- IH f MU: -'zQff.4.1h fpwff 'f6f,..- v'v1'f-! .',S9 - 2 J' .1 5' Kew Karen!-,' Ef'fqif':-'fx 5-'44 ,gg- ' Q 'fa' ',f.'f '1-' -'f '1 'H H gig' - wg 3. 57133. I ,A-ff 12 '--Lf . -HQ F- .5 ,vlffafj kj 1211- i'7 I V ' ' ' gli! ff, fl , ' ff, fH.:v'vg.' . ,d J' - 'f fff7'i1'?' ff K .,-f' ji 1 , vi n...' fxqf 1' -' -I 4 - - U7 J' - 'T ' if Ma f 'Y'f' ' ' - '. w'f r , - ff ,ff if ,A . - ., lj? ' P' . . nf 'X' ' 1 ' ' 'J Hr r f. Eff' 4 ff u f, Bc ' f . - ' gl, lx 1' 1 if 1' . fx .z - J g l liw x 2 96 Kiki! fr pl' gf!-' , - ,Y 1.- -. TC C: ' ' 'sr' -'Wi ', 'V'f '6241,.ix f - Nff4 '-fm -' -M ' ' 1 1 r -P2151 ' . -, V x, -NJ. ' I . -. 5' ' 'L-2, 5 ' . j r' -.I 4' 1' rin! .K 'Ir' auf 'Mg . ' Nils!! . XA B35 , 1 . ' .I V' j?- - fgfg I mi Q . U. 1' ., Y 'nm 4 ., ff 1 X? it , , fy-V . I 3 V : ' 'L-5 ,' ? .,- tl IQ A 'I aff- 9- IW '05 -'1 'f T . wg: ff, M -,, . f. V ,v - ' 12 1,51 4, gk , , Jylfi -Y A V A' z','l1 f' :fi Q .L if . 17 ' ,1 ' I . , IAQ.. I 3 11,9 .. , .g - V I f 4, w iv? 4,fff, : f ' - 9 ,,,M,....W w :fm . f J? A -' 5' 'n'A Pu ' P .' ,. 3.,:?-Ulf ' , ,qs-u.. , Ma . I ' tx' 4' l h. .11 V, .nnafpesu !19Z'5, ,:i iiliubix .. , l V..-Q' ,- , ad ' ., WPI! SQA. 'rug' Wflgfv 'V ': 'f',, ' Q '.2f, t ,, y ' ,- ,Parr ff F ! gf, . ll 'ij-1 334-5171. ' f-' ,..- .1-r' ' v fl' , - ,tf ' 'fr-5jfQff1 ., f 40 Q I' 4 4. fr M ' fa 'f'fff,7'f4'J'ff'1 ' fs? ' agffaylvf - flax' 'A , ' K 1 im ' 1. tgff,-all A-y , W., I -4 dl I Y rv if . , ,I 5,11 H., X - .. 1, , g, ff ',,.m1.af , ,-, V ., ,, .. , , .1 . . u ' i iff, Q ' . .:-rgmrgufk .9 I f fi his 225.13 W I ,M M , , ,a,3,ff+11-.,' ,f 5 f 1 - - 41. J ',. -- 5' n Ma: 5 114' Q , 14'-, ,,-' N I 1 ,' V' Sf5?f 7- fl3lih4' QU ff'- '5f ' ,af 5 ' 5' .'- A ' f ,MY 1 W ',..fS1,'.g2 .!Mfl.p- , .. 5 ' ' .1 cf' dfiflsgffe. V A' - :Q ff- f V - - . - - V ' F. '-9'-'1x'f '9l11 Al' - ' ,L ' Af' x. v. 'J.-1421 I H251 V 4 X I 'W' Af' 'ff ' . ,IA 'F fd' if jk? j 47 1' !'7'?1f5.f'7'2' v' an ' 'f rw 'ri ,f.-'rf 1, 4:fpvf ff?2n5: ue , . if ' 1, 13 44 ,,i ' XE, 'f . :V ' :rf -f , l1 . 1 H ,- , eff ff: ., , .' f x. ' - fi H313 ,I 'kQi'Iq'i,'3 fx 5312, ff ' 1 ' I '. ' -'P' fi-P1 'Q 515 ' ' 'b 'ak'lg4 ru iff : 'f 'f : r . '- J 1 Y L 'A new ' 'h 'A' 'f , - 5 5 h 'f ,Irv :PJ 4,4WZV1zi -- fir '-w1735f- . fri f Qi' H- f 2 1 M4141 fi dj!! ' 1 UTD ',172',4f7+,4., ?f,J - ,xfff 7-J. 3 I f ,ff f .-.J fy fp .g' fi 14 11,55 'VV , 5 , 'Y in fb Q , a . I ' fp ...Q m.,--'ffm' .amy 155 N' . vifrfiig. '4'3iar.?, V 1,- E ' F Q qfiiw-'ft I M f ' :ij A 5 E Ymf by I , ,,N- ,L ' . I-wink ,.. W ff- , 4- ga , -. 4, , , - i gg: ,ff-'f' W1 v f ' f - WR 0 . -. Y Y- rift - 'Ziff . ,ff . . '. Y- J. fs .4-V jhf-if , ' JVJAQQNA , IZIJJ ff' ', ' ',?.lf' N' ' 'W ' J -fig Q if f . -5 1. ffdjlfl A .---.f' 2 0. -LHujef.1w fn, deg. 7 ,QJQQ-.9 I ,gf . 1 , . ., . 2 1, ., . , ' ss, Q --7 .if if f ,f'.,v ,- .. , ' , , ' , ,I 2, 1 , .- .,: .fx , s ,ghd-w,V f--,.4 . - ,ily ,gg W- 13 3 ' K '- 1 ' A 1144, , -' .X .-ff , ' E Q 'Q-'fn 'ffl W., V , 1.2 -H ,4?1f15A5?4 . 7L35i, .,,,1!' NK, , 11:giji,1?gLizT r,,, w g J if 'a.- , w .Z : . Mr f ,3--Q,- !yJf',.fi, . ' r.?f2 , ., ' ' . 1:4-W ig , M ' ',AR 'uWn, 1'f L7Vl: 4' J,f'Q:ecT:?fy?'4'i!fl ty.,7,v.4: M -1:,4-,.w,,1,f,x4Z,, VW,,7j,1f 1 I V 1 Drganizations ,W.M,,f-'Kg . f'N-- , X. f.,,-.NM U vw ' ' ,.-n.,,m, - .t' W ' 15' .' c ' . f . ' . j,,.:?. : I fn' '..xl. , ,A,'. 5 .: .'.' , , Lk-N K Inn X x , ,nu L. Y ' Y 1 rg, 4' . fu: fs: -,150 -4.4 ,. -viii. g 'mr 9 vf , f' , 1 gyxifi' 'BIT -' tu, ' i al I .A ' -I . ' f 'A 1 1 f t 9' 15,1 fit, ' v JJ ' 157 f 'xfxeiii ,J , . 1 , .i I A . . v, , 'Ziff L 'X I Nw-v.tf '-. ' 7 !fI,. xx - ag. ,ij ,f7'j,'?iLfQg -li f fu is ff-'f':','7f , .. , ,H , x ,'V,f.,,. I. X 131, ' 4 1' if HA -yfrgrfi ff' JI.. 'W , .V ' 5 .' x...,.v ff .I f . SJ, V 1 M, -f f 3' 5311 1 W:I7v':3,Vf 2-,mm -wi. H, f !f 'f , 41.47 ,JM l Hamlin A 'N' 1 i-quart' , - . I-og . - .ii Nk . I t I - .f,4fAZii'.vk V 1. .vigil lf. I N, 'o I -, ,' jk. ,Mi 1, f: L -- . x I ' ., , .. - -Ti. gfbfi-Z2 if ff1,f.gZ'fs?T YM! Q! I 727- Q' .'. fx-. 7,uilf,QY f,'ii'jf'.-'f 'ff 'Cfff f vL','i'y', X.,- V. f.J,'7fv'g flrj -as A 1,4'i'? gba: V Ji: VIS' xlgy ffl-'M' 'T' ' . 1' 'N-Qld? 4? . 1 ?,rili!L,'. , hi, 1 V, V , f,aiyF1.j,f .,n,,t5f , i ii . x ' ,Q-,FEV ' is . I- 1 -iv H.. ' -J -'sfffi , ,- -j 1-, f,. '-xx 1 ' few' Y 'f f 1 26 'QZES' . L 'f '34, j- . A. ,I F ' 4 rg. . if 1 1? lu ' I fx fy!! 'VW' HH 1 ' ' X f 4,7 7' If' '85, X- .ri 5 if 1 ff!2 1sf'1 -fe, Q- Wil 7yf!f1 5 I1 'f g :' :ry Q . .Fig pg ,ryff r 554, f fm , ,E ',ff1'! fl! 5 ' ' I 225 fjgsg ssifff - f ffbjg ,S i5,Q Q3'?iZf'1f5 i:l.iLf 12'-? Jil ,I .yi 1 5 5.'l751f? ' 5 -JU: -Pj-J 12 S 'ff ,',fffil '. ffl- ' !'15,Q E15 5 7 4: If ' V: 'aft il it '.f'li'I,'x ff'-'1' 'af ff fri 1,164 gf if 1 'gg -,ffzlligfyfy-. 315 9 'mn' lg' ::' X 11: fKH I ' :f' K '- Q-I'-nf. at I' x.a:,4: HH.. ' f, 14' fff f' - .lwagfsfwf ffgf ff +1 44 ,cup xy' .,,.A'f', V :A . 1-J xiii, I.. . I '1 Xr-!15 llf' ' f 1 .1:'xi'R'? V-I fA'!17 1 I, f' nys ifi riff 4 af-nj 'A 1 -za - .. . , T,1f f V . ' ,V 1 'fi' .- ' ii H 2325 1 2? fffzfi - ' 0' eff' 1 V . - '. ., f'f. , ' X if 1. 522 '2'aifa21,1s?E iw? , .Z KH'- wif . f1g'2:H,:g?y2sMR' ga-We 1 -fm fi E, 1 J' iff? 3. Uf1125,',f.5'Q2.,qX'i2 j 3 5 rfb' 17 Q ':f4f,1'fxC1cf-fE'f2-'ff I jx - gk. AX' 43 1Qq::1'7ldQg,'l7'4i -C '- K gb Q, f GEM 295 2.3 Hyffli 3 WA, 12. 51' 29 fm as new vi 1 1 Q, 4 gwsfs 'Z-'AV-,J:'n,1r-j f . 9 A 7 rwrf '- 1 H-1 F r Vs, -. f ,'l Iagiwfy-.i,'.1g1L1, 54714 5 App 3 'Ep-:pg fl ' A '-Hug '.:1 f ,,,- ' 1 Q 11 ZX' 31375 ji if-'lu K ri .vm R. , ' 1 . 1 , . . X , . - , . - . 7. ' 3 57112 521 A il 11211143 52 l '17 'ff hfgclf , H, I-72151 YL ,L f 1 H11 Vi 3 f 11711 1'Z,A la if ii-IEP' '. l r fi- L ' .f lv I 1 , Hwy: 7214. . ,- IQ '7rf1i1-'- .1 1 5 2:22. ii52ff?1WQif' HQ: , Q JM5gfEZf 'fzi539i5:5i? is gg 2221 e as we QM, 55+- f ,Q , .. .mf wif 4 sz i-2 L: 22 fill 'Ef f-I f 'lax iff ,af 54' QQ fii gg 555 QA 1, 5 -5 5 .' ! I 'J ,Sgf,5,j ff if Q: - ' If 1' 5 . f. 'I 15 1. .H J , ' V 11139 '- lg:-, 31' Af' gl if EE -.rl -3 -,Vid 'I ,i V au ra- Lf . . V U. fJ::.,, -, dl, is . xx,f5.3' nf A .fx ' -' '- -1 .Lk 1 fs' 'f 4 1 'H MH N -f ff 'fsu vw , yi 1.3 34 L! 1 .r , 'I vrk'. , '1. f XIV- .- ' DL -' I K ,T:jg'.' '. 741-' jj Y 5: i?H13 5 rf f .Q fQff:'-y.'--,h.wf- 59, xiiplf- TM ' A 5 ' Q' 5, 3 -ii' .7'r',-'1'f1'- 'wa y 'J q'.! .'-ff'2L f 1 ' 'J , H- 4' ' 'HPR I ' 57 3 Q 2 33? f'1f?'?'H ff1 N 'f73:!W5i--. -,m x . A ' If f!! !.ff'225 ' f49'r'k 'i 'LU VA-'K Z iff s 1 'Q V: 'ff' ' f fill'-f' Q if ' V' 'f f .L.,........-1 2 X' S f.,,L.f f 2 'fe 1'-'f 'f - J -JH! H+ Qffvft' -msn , ,ww ' . ' X. , -f' - ,ff , 'x f - - ,., .j, 1 r f 1 , '-'- '-ng -yl.T!-'- ' ' Omicron Delta Kappa First row: Shirley Edmonds, Carol Carnes, Elaine Freeman, Doris Gowen, Mancy Ochs, Diane Pernot, Billie Jo Burge, Pat Cummings. Second row.' Trish Costello, Joyce Butler, Kathy Meyer, Pamela Zimmerman, Eris Zagar, Susan Pfeil, Laura Cunningham, Raymond Hemman, Nonetta Thomas. Third row: Harold Loy, Janet L. Townsend, Diane Inloes, Terri Monsour, Phil Cedeno, Jack Copeland, Douglas W. Alquist, Doug Stuckey, C. Ray Baird, Richard Ochs, Brent Dowler. are V Graphic Arts Club I-wig, First row: Larry Thornburg, Dana Glaze, Paul Daugherty, Darrell Page, Ronald Metz, Sharon Ryan, Ronda Gist, Kitty Killion. Second row: Edie Ekhoff, Peggy Meyer, Edward Stone, Greg Parks, Curtis Caldwell, Frank Kermakshek, Jim Bastian, Jonilou Dotson, Richard Jacques. Third row: Stephen Hays, Bob Coffelt, Ervin Neff, Bill Offerman, Deepak Khanna, Jerry Chenoweth, Tom Pattee, Scott Smith, Roger Dent. First row: Beth Blurton, Shellee Brown. Second row: Carita Logan, Secenia ac r S Scroggins, Gloria Blurton, Martha Dorsey, Arlecia Scroggins, Janice Brown. X X B 5244, 'W . Left to Right: Brenda Robinson, Jerri Staton, Mary Misasi, Lynn Rollow, an 9 en IC Mary nnnnnnnn. Home Economic Club 1 First row: Teresa Shinn, Paula Steffens, Melissa Gibson, Laura Caillouet, Susan Gorton, Barbara Lakey. Second row: Kathy Ginsburg, Deidra John- son, Christi Medlin, Donna Hutto, Carolyn Hoheisel. Third row: Billie Jo Burge, Susan Long, Jeanie Bever, Paula Carter, Doris Bradley, Ardys Rob- W Q1 bins. if ' 4 J ,WY . Beta Beta Beta First row.' Lyle Noordhoek, Sandra Powell, Randy Pendleton, Becky Pruitt, Jana Sullinger. Second row: Terri Cooperrider, Mary Barbara Naylor, Shar- on Austin, David Goraker, Suzie Hammons, David Wilt. Third row: Phil Wittmer, Den Grimaldi, Kevin Walt, Jeff Lawhead, Horace A. Hays, Kathy Phillips. f:?4 sg. 51 Campus Artists First row: Ann Traul, Edd Ortiz, M. Jane Alberson, Lacey Clark. Second row: Valerie Bender, Eric Abraham, Suzy Que, Ann Miller, Cathyleen Smokewood, Terri Wilson, John Ploof, Jan Humphreys, Cale Kinne. Third row:Alex Barde, Mark Rountree, Howard Mann, Two Boobie Ruby, Farrah Faucet, C. Manson, Art Nouveau, Too-Loose LaTrek, Spike, ladora Dollard. Suzanna Sweetwater, Joe College III, Marabelle Morgan, Spank McKenna, Miss G. Gooch. Y! Biology Club First row.' Terri Cooperrider, Suzie Hammons, Joy Welsh, Nancy Tatman, Alecia Lewis, Susan Spineto. Second row: Jeff Lawhead, David Govaker, Kathy Phillips, Becky Pruitt, Jana Sullinger, Sharon Austin, Judy Crager. Third row: Ralph Kelting, David Wilt, Lyle Noordhoek, Russ Bird, James Baber, Richard Whitloes, Ron Summers. S I First row.'Jim Fry, Vickie Jones, Carol Brunker, Mike Shapior. Second row: Tammy Curtis, Judy Watchinski, Luella Carrithers, Michael Jamar, Mark ar e U Ostrander. Third row: Douglas Fugate, Victor Brown, Kent Walters, Dale Duhan, First row: Lesa Rau, Elsie Santagata, Dorothy Mullins, Joan Lorensheimer. a a a e a Second row: Steven Gardner, John E. Maier, Dr. Robert Noble, Robert L. Kircher. ,7 - ilfxihfmi' ,WMWHM Golden Crest Golden Crest is an honor society for seniors who have demonstrated leader- ship ability, service to the college and community, and scholastic distinction. This year's projects included helping with the blood drives, giving a Christ- mas party at the Juvenille Court Cen- ter, making valentines for the patients in the pediatrics ward at Mt. Carmel Medical Center, sponsoring an Easter egg hunt for the children at Head Start, and assisting the junior college trans- fers. In addition to the annual Banquet and May picnic, the members also enjoyed a special picnic with some of their favor- ite faculty members. Left to right: Pat Cummings, Nita Laing, Char- lotte Worthington, Nonetta Thomas, Max Mathis, Jane Scalet, and Joyce Butler. 'liar First row: Diane Inloes, Susi Pfeil, Jack Copeland, Bill Brady, Becky Par- Worthington. Third tow: Susan Warrior, Eris Zagat, Janie Clugston, Steve rish, Nonetta Thomas. Second row: Joyce Butler, Pat Cummings, Kathy Gardner, Debbie Gillespie, Eve Poanich. Meyer, Doris Gowen, Elaine Freeman, DeeAnna Hemman, Charlotte First row: Carol Carnes, Karen Call, Sheryl A. Pitts, Grace B. Nelson, Deb orah Smith, Marie A. Wright. Second row: Debbie L. Price, Darla Tref Alisa M. Reynolds, Sharon Chalmers, Kimberly L. Boyd, Derrillyn Shar ... 4. v I I First row: Derrillyn Sharp, Karen Call, Darla Trefz, Tricia Lewis I Yulich, Grace Nelson. Second row: Carol Carnes, Barbara Pittman, Ira Fosdick, Don Campbell, David Istas, Cpt. Byron N. A' ...,...,.,Z 0 u Associated General Contractors if uw f W . , fvflfgffwgzn First row: Terry Dvorak, Joe Levens, Garry Worthington, Vernell Grisham, Tim Ryan, Kirby Crowe, Dennis Dedrickson, Mehran Mavaddat, Kirk Nel- son, Teresa Barnett, Gene Russell. Second row: Tim Oehme, Don Vinardi, Ron Wilson, Charsetad Mohammad, Doug Delaney, Joe Cisper, Chuck Moore, Gopi Karappurath, Fasuludv Bayoh. Third row: George Kenyon, Ted Smethers, Doug Saathoff, Rolland Grigshy, Dick Parcell, Mark Pearce, Paul Hays, Tom Heiston, Chet Cale, Glenn Davie, Steve Dulek, Dan Hight- ower. ' ma, ,mmm W, ,.., ,.,, K MW as MDM www M' ZW Q2 Wil Sigma Lambda Chi OHM Jamah- -bmawma First row: Dennis Dedrickson, Richard Nairn, Vernell Grisham, Joe Levens, Tim Oehme, Gene Russel. Second row: George Kenyon, Ron Wilson, Don Vinardi, Doug Delaney, Gopi Karappurath, Dan Hightower. Third row: Paul Hays, Mark Pearce, Glenn Davie, Kirk Nelson, Mehran Mavaddat. vile: D I' t' up Left to right: Donna McAtee, Steve Duesi, Peggy Brogan, Kathy McAtee, I Clara Pruett, Linda Grilz, Elaine Camac, Larry Ammerman, Kaye Hem- Se mens, Suzie Humbard, Bev Zafuta u.',,,,,,, , l First row: Tom Schartz, John R. House, Charlie Cooper, Brent Castagno, Steve McLaughlin, Terry Copp. Second row: Kent Cage, Mark Paocey, Joe Daleo, Jeff Cook, Kevin Kelly. Foreign Language Club Photographed at Place De La Con- corde, students in the PSU Internation- al Summer program in Paris, France are: Front row: Dr. Henri Freyburger, Sharon Syers, Mike Kelting, Jackie An- derson, Judy Lee, and Charles Wilson. Second row: Pam Zimmerman, Claire Chuilon, Judy Snodgrass, Debra Sims, Renee Johns, Marjorie Caskey, and Mercedes Glover. Third row: Louise Leslie, Barbara Kadel, Pam Ruble, Ter- ry Ann Tracy, Erin Crank and John Caskey. If First row Carol MacKay Terry Ann Tracy Jord1Hannes Pamela Benoit Collen Gray Dr. Bert Patrick, Pamela Zimmerman, Debra Sims, Alisa Astrid Zagorski Glenda Alquist Second row Dr Henri Freyburger Dr Reyl10ldS Michaes Attalla- Newman Center . a year full of activities. The Newman Club started the year off with a great street dance. Blade pro- vided the music, and the students caught disco fever. Throughout the year, members of the club made fre- quent trips to the Icehouse, the Lodge, the School House, and had a great time at the Heart Fund Ball. But dancing is not all they did. A Spiri- tual Renewal Week was held in Sep- tember with Fr. Stephen Almagno, OFM from New York. Some members of the group said that homecoming festivities brought them closer together. Working almost every night in October, they managed to cap- ture Sweepstakes for the second straight year. Their candidate, Pat Bar- tonek, was elected queen, the queen car and banner won first place honors, and the group took second in Yell Like Hell and third in the Novelty Act. At the annual Christmas party, the members decorated the center and put up the stereo sound for the carols out- side. The beginning of the second semester brought snow, but the group remained active. Snowball fights and cold Weath- er made that fireplace seem even warm- er. Fourteen Newmanites attended the Kansas Catholic College Students Con- vention in Great Bend. The weekend provided a chance to meet new people and bring old friends even closer. Elections were held in March, and the following students were selected as offi- cersg President, Jean Cathcart, Vice- President, Joe Orlando, Secretary, Den- ise Freundg and Treasurer, Mike Elder. Fr. Steve flew back from New York for the 36th annual banquet and ball and our spring camp-out retreat. May brought the Newman Center's tenth anniversary. CThe center was completed on May 5, 19681. The beauti- ful facilities have provided a place for social and spiritual get togethers in the past, and the future looks even brighter. Graduation signaled the end of a year full of hard work, good times, good friends and lots of laughter. Y Qdxis' -5' . km-,.-c.s,-4-Q..-,.s,.-...sp K .. 1? at - .flff . f 'H ' 5 'Silt , -' CN' vi? ',-an Q N...,,ff gg, First row: Debbie Trasbey, Denise Freund, Walt Lickteig, Carolyn Hittner, Kevin Kushel, Robert Diskin, Morgan Worfuell, Phil Cedemo McClasky, Jerry Otter, Kim Kapler, Kathy Kapler, Thomagine Zahner, Kathy Duffin, Steve Portz, Phil Harkins, Christine Babich, Jim Vallacua Dorothy Gardner, Patti Nicoletti, Al Ortolani, advisor, Mark Costello. Sec- Mike Elder, Lynn Villamaria, Joe Weiner, Robert Brant, and Larry Blazek ond row: Tom Anderson, Jean Cathcart, Fr. York, Tony Ritter, Mark .fl gk sri-..w....q-y Thi. Far above left: Morgan Worfuell studies on the steps of the Newman Center. Above left: Part of the parade on Homecoming Day, was the novelty skit by the Newman Club. Left: Robert Brant works diligently on the Newman Clubs sign, dis- played during Homecoming Week. Above: The Newman Club holds their meetings at the New' man Center. Student Senate We, the students of Pittsburg State University, do hereby establish this Constitution of the Student Govern- ment in order to: 11 Provide a forum for the expression of student views and interests, 25 Provide a voice for student views and interests, 35 Provide co-ordination of student af- fairs, 41 Insure student rights and responsi- bilitiesg 51 Provide communication and cooper- ation among students, faculty, and ad- ministration, andg 61 Provide a learning experience in the democratic process. The Student Senate of 1977-78, under President Trish Costello, labored through many projects to meet the challenge of this preamble to the Stu- dent Senate Constitution. The students' concerns and needs were monitored by the Student Senate through open forums on a variety of subjects, questionnaries, phone surveys, open discussions and a massive effort to reach the students entitled Operation Outreach . Students were kept informed on Senate activities through monthly newsletters, slide presentations, and of course, the Collegio. A major accomplishment of the 1977-78 Student Senate was the establishment of the Free University Network where classes on a variety of popular subjects, such as gourmet cooking, square danc- ing, disco dancing and flower arranging were offered to the campus and commu- nity free of charge. The needs of the students were consid- ered foremost in leading to the estab- lishment of an available housing file, a commuter information pool, a book ex- change program, the purchase of a tarp for Weede to allow for major attrac- tions, a student concerns file and provi- sion for storage for students in resi- dence halls over breaks and vacations. Senators, more than ever before, worked to represent the students in a responsible and enthusiastic manner. Besides membership on a variety of campus and Faculty Senate commit- tees, senators participated in the selec- tion of the new Academic Vice-Presi- dent, and served on committees of the Board of Regents. In addition, Trish Costello, student body president, had the distinction of serving as chairmen of the Regents Institution Coordination Committee. The energetic students that comprise the Student Senate of 1977-78 are proud of their accomplishments and their association with Pittsburg State University. Bottom row, left to right: Cathy Stareck, Dean VanDeMark, President Trish maria, Greg Shireman, Brent Dowler, John Pettius, Mike Hall, Tony Rid- Costello, Doug Stuckey, Carol Lang, Barb Allison, Shirley Edmonds, Kip der, Fred Barnes, Kurt Holmes, Mark Huffman, Paul Cook, Greg Swaney, Wendlee. Middle row: Jan Steele, Lori Von Soosten, Donna Zirkel, Lynn Robbie Robison. Villamaria, Mike Hull, Perry Adkins, Lisa Atwater. Back Row: Janet Vella- 1- -1- ,-u-. l Above: Pat Wiederholt, Student Senate Parliamentarian listens attentively during one of the Student Senate meetings. Above righ t: Senators hold their meetings Wednesday nights at the Student Union, where all Pittsburg State University students are invited to come and sit in on the meetings. Below: Student Senate Executive Council consists of, from left to right: Kim Bene- dict, secretaryg Trish Costello, Presidentg Dean Van DeMark, Commissioner of Student Governmentg Greg Swaney, Treasurerg Shirley Edmonds, Com- missioner of Academic Affairsg and Brent Dowler, Vice President. Not shown is Janet Villamaria, Commissioner of Public Information. J,,,-A ...Q-Nm KZ...-v ' Katheryn Adams Mary Aubert Kathleen Baker Belinda Binford Rebecca Brooks Lynne Bruce Virginia Cailteux Karen Call La Vonne Carlat Gayla Casey Shirley Chalmers Daniel Chatelain Susan Coper Pat Cummings Laura Cunningham Stephanie Cyrus Beverly Emerson Pamela Fournet Cheryl Giefer Dianne Graham Cindy Hill La Donna Hofer Deborah Holscher Jennifer Holtz Mary Jenkins Shirley Johnson Cheryl Krone Loren Larkin Donna Mahnken Pearl Martin Anna Martinson Hortense Mason Tina McDougal Loretta McLeod Kathleen Mercier Johnny Miller Cynthia Moore Bobbi Moran Nancy Neufeld Cynthia Noll Judy Nystrom Terri Pence Susan Pfeil William Rhoads Nancy Russell Renie Russell Janice Ruth Jane Scalet Joyce Scheffield Karolyn Schooley Paula Shields Ellen Shipman Marilyn Shireman Judy Sneeringer Rosemary Steeves Gayle Strukel Bonnie Toth Darla Trefz Lowell Vomhof Karen Voorhes Susan Warrior Beth Watt Rhonda Willard Jill Vander Wilt Patricia Wiseman Nancy Wolf Charlotte Worthington Eris Zagar A , -, , 1 1. ':.1i1si2s,i?221f2f-if , 2 . 5 2 -E -mfs sswwwf- .- ' '--v--,-..-ensure ws s : Q1 -1 r a.M.f1-V . isefanfr--VAmigggf-an-155if e ' , . . as , . . , ..T y .Az v 1 f Q , .T -T1 2 5 U . f I . ttiii Q., 4 Karate Club Left: Randy Buchanan is shown a move by his instructor Dean Hein- itz. Below: Dean Heinitz, Rod Flynn, Alan Ford and YMCA members are demonstrating a Karate technique. . . + - sz-is-zaafssszfaiw f. 5 K NN X fs - - ' Q F , i 4, L 55 v- 'E .K 6: - ,nf 'S ,Sf 1' K . 5 1-,Q ,,Lk 'ig 'f ' 2. , . 1 -..,, i ': -52' I ' iii ., - - W- ..,. 'S , ii it rbr, eiiee - ' . e b Qei -1 A Y .V Karate members included, row one, left to night: Rod Flynn, Jeffery Spears. Row two: Randy Bachannan, Jim Otter, Alan Ford. Row three: Diana Deboutex. The remaining are members of YMCA. First row Carol Schneider Tammie Smith Janet Carter Annette Skaggs I I . . . . . L I e m a S Second row: Becky Holland, Cindi Kenton, Gaile Williams, Renee Ackerson. Third row: Denise Gerken, Donna Zirkel, Rayma Sevart, Jane Scalet. Maw III. 'R -WW J ? Mk V Y Flrst row Kim Meline Jim Gross Dana Glaze Steve Goff. Second row: Bert 1 l . . . . . Besthorn, Kirby Crowe, Dan Mosier, Ssg. Roy Jones. I First row: Fred Misse, Chris Catalfano, Barbara Borst, Katie Dutton. Second I a e a rows Sharon Harrison, Thomas Walther, Surendra Gupta, Robert Ratzlaff p Judith Shaw. vw X! Q mem, First row Greg Swaney Michelle Potter Claude Cummings Susan Gorton I . l . . Dean Stevens. Second row: Dale F. Duhan, Sharon Dodd, Lynette Higgi botham, Tom Eyssell, Pat Trowbridge. Il Delta Mu Delta First row: Kathy Recker, Scott MacDonald, Becky Parrish, Greg Swaney, Jody Ewalt, Linda Phillips, Lora Wang. Second row: Jennifer Smith, Terri Wilson, Vickie Jones, Nancy Dorsey, Shelley Fredericksen, Kathy Carpen- ter, Julie Meyer, Becky Coffman, Vickie Hosier. Third row: Doug Stuckey, Richard Ochs, Mark Ostrander, Romona Massoth, Holly Hurley, Kenny Kutz, Perry Adkins, Kurt Holmes, Becky Martin. f Lambda Sigma First row: Carla Doss, Calude Cummings, Merlyn Carver, Gary Doolittle, Greg Heidrick, David Yoon. Second row: Dixie Tilton, Sherry McSherry, Keri Kaisner, Mareta Smith, Lori Girard, Susan Spineto, Jill Gaskell, Lin- daKay Baker. Third row: Diane Blessant, Derrillyn Sharp, Annette Skaggs, Joy Welsh, Lynn Villamaria, Glori Graham, Barb Flakus, Teri Simpson. Kansas Association of Nursing Students Once named SNAK, KANS is an active organization on campus. The Kansas Association of Nursing Students held a blood pressure clinic at the Pittsburg Mall, where the students offered their services to every- one in the community. ,.-. .X KV. ' 'gi1.r+'4 av r First row: Kathy Daylong, Cindy Anderson, Melinda Veatch, Dixie Tilton, Janelle Bloom, Keri Kaiswer, Kim Kalpler, Lori Kemper. Second row: Susan Copen, Ann Weber, Mary Crowell, Sandra Stewart, Rosa Madrigal, Loren Larkin, Laura Cunningham, Barb Flakus. Third row: Susan Warior, Susi ,af ,-4 Q Pfeil, Pam Fournet, Janet Hadicke, Barbara Morrison, Becky Brewer, Janice McCartyh, Debbie Haefele, David Chaussard. Fourth row: Eris Zagar, Melin- da Easley, Donna Mahnken, Beverly Emerson, Belinda Binford, Janice Ruth. I I Q First row: Bob Benigus, Resa Toeller, Bill Vorrin, Mark Seeley, Theresa Wiederholt. Second row: Ra Hemmans, Ton Furse, Jack Co eland, Linda Journalist Y Y P Baker, Pat Kuestersreffen, Dr. John Knowles, Robert Stockfield. 5 or l First tow: Hazel Heaton, Melquiades Melochoque, Elizabeth Largent. Sec- a ond tow: Kerry Heaton, Dr. R. Harvard Riches, Don Johnson, Dr. John South, Harold Hicks. NAIT and SAE Left: NAIT sponsored an auto show which brought in many different makes of cars, all well done, and a lot of interested spectators. Below: Two take special interest in an older model Chevrolet. 9 C5-O96 First row: Bill Shaffer, Allen Butts, Craig Harrison, Jon Joyce, Anthony tings. Third row: Shawn Johnson, Aziz Hanzalzadeh, Thomas Weatherby, Ridder, Steve Goff, Cathy Duffin. Second row: Bob Steele, Rollie Peter, Joe Wayne Niklas, Todd Barnes, Greg Leichliter, Rob Kobel, Bill Byron, Chuck Alley, Mike Vermillion, Seni Sode, Bert Besthorn, Glenn Duvall, Rich Has- Ganzer, Mr. Ken Gordon. gn.. 'Wh 3 l First row: Cindy Williams, Tomi Billings, John Corpolongo, Pam Benoit, Cheryl Belt. Second row: James Taylor, Jessie O'Neal, Don Johnson, Kevin Collins. Third row.' Donna Haaland, Joy Hefley, Tamera Smith, John Con- nelly, Mary Hilton. - Piiiixws 4' First row: Mark Quilan, Becky Martin, Micheal Hall, Linda Daniels, Robert u Brant, Martha Farris. Second row: Ramona Massoth, Vicki Hosier, Chris Medley Doug Stuckey Jody Ewalt Campus Christians Activities included various things for the Campus Christians this year. Included was a singing group which preformed for students. The goal of Campus Christians at Pitts- burg State University is to attempt to praise the Lord. We are proud to be part .... of the campus as well as part of the master's kingdom. There are no strang- ers among the students, there are only -I friends that we haven't met as yet. Founded in 1966, Campus Christians has offered students on campus an op- H portunity for not only furthering their secular studies, but also their spiritual Bible studies. Through this means the student can become a total person, one who is to face the world outside the college campus. The meetings are open and accessible to everyone. If you are interested, mem- si bership is open to you. Kum - join - us! ifjla-A l First row: Sherry McSherry, Tammy Whitehead, Mary Hetrick, Scott Enns, gerd, Ddug Walker,.J ack Soden. Third row: Phil Wittmer, Kirk Boswell, Brian Cathy Good, Cindy Manlove, Pamela Whitehead. Second row: Marilyn Clark, Shultz, David Smith, Phil Uhler, Michael Klein, Don Wright, Ed Lung, Becky Coffman, Cindy Coffman, Janet Grafmiller, Dana Austin, Myron Hi- Chuck Beaver, Brian Steventon Kappa Mu Epsilon Math relays are big events for math honor students. Kappa Mu Epsilon, a national college honor society for students of math- ematics, promotes the appreciation of mathematics as will as its applications. Special topics related to mathematics are presented at monthly meeting by students or guest speakers. Other ac- tivities include aiding in monitoring and grading tests for the Math Relays held each spring for area high school students. Seven students traveled to Muskingham College at New Concord, Ohio, for National K.M.E. meeting. The Kansas Alpha Chapter had 43 members this year with officers Terri Wilson, President, Ronald Stockstill, Vice-Presidentg Nonetta Thomas, Sec- retary, and Christy Stine, Treasurer. Bryan Sperry and Harold Thomas are sponsors. I First row: Bryan Sperry, Terri Wilson, Lucille Freeze, DeeAnna Hemman Nancy Ochs, Diane Inloes, Christy Stine, Teresa Myers, Larry Forsythe. Second row: Helen Driegsman, Harold Thomas, Ron Smith, Annabelle Loy Dan Tierney, Sara Leu, Carla Doss, Susan Daniel, Thea Barrett, Gale Russell H , ,. V,V,.. my , Mary Hargitt, Nonetta Thomas. Third row: Thomas Alan Weatherby, Kevin Sperry, Ronald Stockstill, Gene Baker, Kevin Jones, Chuck Poznich, Brian , Shultz, Howard Thompson, Douglas Johnston, Tom Pope, Patty Turner. Student Union Board Bottom: Lon Segile and Mike Sullivan. Standing: Connie Farley, Pam Moser, Barb Murphy, Ken- dell Shipley, Elaine Camac and Jack Overman. In front of Gus: Shelby Scott and Jim Melton. Be- hind Gus: Laura Robertson, Jon Pettus and Steve Johnson. ,f'...w. e.-,w 7'-nv-vqgpuunq ww The Student Union is the social center for the university community students, faculty, administration, alumni and guests. The Student Union building and SUB programs are financed by stu- dent union program fees and do not re- ceive any support from state tax money. The programs SUB is responsible for are financed by a student union pro- gram fee of 35.50 per full-time student per semester. The Student Union Board determines the union policies and is responsible for providing a program of cultural, social, educational and recreational activities for the entire student body. The Stu- dent Union Board consists of five com- mittees: Hospitality and Dance, Special Events, Cultural Affairs, Films and Re- creation. There are no dues, no initiation and no GPA requirements you have to meet or pass before you can be a SUB member. mr-ng -.---Q. All you have to do is drop by the office located in the lobby of the cafeteria in the Student Union building or call 231- 7000 ext. 276 All that is asked of members is a time commitment, any new ideas for pro- grams and helping to carry out the pro- grams. What does the organization have to of- fer? SUB offers a group to relate to a skill, hobby, or craft to be learned, lead- ership possibilitiesg a sense of achieve- ment or fulfillment, prestige, meeting new people and much much more. We need new ideas! Your ideas and ideas from your friends. There are over 40 people involved in SUB at the pre- sent time but there is room for many more. Help us program events for the university community, join a commit- tee this week. F if I df' , If 2 ,s , 'Inf 4 I' 7 it ,wwf ff . ff- mf! SUB sponsored many events throughout the 1977-78 school year. One of these was the perfor- mance from Morning Star as shown above. Left is Jack Overrnan Student Union Director. SUB Committees Special Events Are you into music entertainment? If so the Special Events Committee is for you. You can decide which musical groups to bring to campus. Rock groups, jazz groups, folk music, or whatever you want. This committee also puts on the coffeehouse programs which have in- cluded such people as Bill Haymes and John Biggs. This committee also spon- sors the record, tape and paperback book recycle sales, plant sales, and much more. Now that you're all excited about joining this committee call ext. 276 or come by the Program Office in the Student Union and we'll get you started. First row: Jim Eighmey, Brent Thomas, Curt A. Medlin, Dennis Lee. Second row: June Meyer, Kathy Farrell, Liz Wilson, Jon Pettus, Chairper- son, Lacey Clark. Hospitality and Dance The committee for those light on their feet. This group puts on the big SUB dances throughout the year such as the: Welcome Back Dance, January Jump, Valentines Dance, Apple Day Dance, Street Dance, etc. Hospitality and dance also puts on the annual Bridal Show. If you want to be a part of these activities and more, stop by the Pro- gram Office in the Student Union building. K 'N f ji is Left to right: Susan Spineto, Elaine Camac, Chairperson, Susan Gorton, Brent Thomas. Not Pictured: Jim Eighmey, Lynda Weston. Do you like outdoor sports? How about indoor sports? If you like one or the other or both then you should be help- ing to plan events for the SUB Recrea- tion Committee. They do tournaments, bike races, road rallys, contests, track 1 i ' ...3 ..,. 'EEN 5? t v. r X I 1 N in ' -nifl' I F g 4 X. - ' meets and more. If planning and ex- ecuting programs such as these sounds exciting to you stop by the Program Office in the Student Union and join our team of involved students. Left to right: Linda Small, Debbie Leonard, Mark Kellison, Marilyn Matthews, Pam Moser, Chairperson. Not Pictured: Greg Herandez, Helen Kirkpatrick. Films Are you a Mel Brooks or Peter Sellars fan? Or maybe you enjoy the old sus- pense movies or documentories. You say the movie program here at Pitt State doesn't show the kind of movies that you enjoy? Well do something about it. Join the SUB Films Commit- tee and help pick the films which are shown on this campus. For information on meeting times or how to join simply call ext. 276. 9544 SZ.: Q- 1 . H 1 si. 5 K5-7 it , U ai First row: Kaye Hemmens, David Govaker. Second row: Merlyn Carver, Greg Hernandez, Kendall Shipley, Chairperson. l 1 Theta Alpha Phi Theta Alpha Phi, honoring those excelling in the theatre, is the oldest nation-wide educational theatre honors fraternity. The driving purpose behind Theta Alpha Phi is to increase interest, stimulate creativity, and foster artistic achievement in all the allied arts and crafts of the theatre. Under the leadership of Carol Carnes CPresidentJ, Derrillyn Sharp fVice-Presidentl, Elaine Freeman fSecretary-Treasur- erl, ands Bob Garrett fHistorianJ, the Kansas Alpha Chapter at Pitt State has played an active role this year in its promo- tion of Theatre arts. In conjunction with Homecoming fes- tivities, it produced the Pitt State Talent Show in October, 1977. The executive council traveled to Omaha, Nebraska, January 18-21 for the Regional Theta Alpha Phi!American College Theatre Festival. A.C.T.S. fosters opportunities in- valuable to the growth of theatre as an art and of students as artists. Recognition of P.S.U. student artists occured later in the year as outstanding performances and achievements in the- atre were honored by Theta Alpha Phi at the Annual The- atre Awards Banquet, May 10th. In recognition of his con- tinuing support, honorary membership was bestowed upon Dr. Harold Loy, chairman of the Speech and Theatre De- partment. -Q 'I iv Q ,Q ig j,i'g, 5'??i3' ' T' First row: Becky Parrish, Elaine Freeman, Derrillyn Sharp. Second row Harold Loy Bob Garrett Robert Gobetz Carol Carnes AQ Jazz Combo Growing musically and intellectually The Jazz Combo formed at the beginning of the fall semester playing at the PSU Gong Show and performing a recital at McCray Auditorium. During the spring semester it played at the PSU Dance Marathon and the Wichita Jazz festival. It was the lead act for the Confunktion concert and was sponsored by the Alum- ni Association on a tour of four Kansas City high schools for recruitment purposes. This summer several of its members will participate in PSU's Playhouse on Broadway. The Jazz Combo wishes to thank PSU for the opportunity and freedom to grow musically and intellectually. Also a special thanks goes to the faculty and students of the music department for their patience and cooperation. ' e .3-sy ' if... ,L its Q99 :rx U Q Jazz Combo members include: Doug fD.J.J Carroll, guitar player from Bonner Jopling John Keady, trumpet and fluegelhorn player from Pittsburgg Stan Sprmgsg Leonard Harris, Jr.,bass guitar player from Chicagog Andrew fAndyJ Hegeman, baritone sax, alto sax, bassoon and flute player from Caribou, Houchins, drummer from Overland Parkg Dale Hubbard, piano player from Maine. Not pictured are sound man John Laas and advisor Dr. Russell Jones. l First row:Jane Harris, Judy Sullivan, Refa Mayfield. Second row: Elizabeth R d N U S Lockard, Marilyn Stockdale, Wilma Hansen, Clayton Hayes. -wwe gum 'QW Q at 'Q 1: 1- ,....-f + 's , ,Q Fellowship of Christian Athletes Above: Left to Right: Chris Manning, treasurer, Jack Brown, vice presidentg Dave Ketcher, presidentg and Scott Janeway, secretary. Left: Charlie Getty, offensive tackle for the Kansas City Chiefs was one of the featured speakers for FCA's meetings this year. He talked about his football experiences. ., x 4, First row: Brenda Coover, Julie Jack, Joyce Cauthon, Sue Malan. Second I row: Barb Crossland, Bob Kircher, Debbie Matin, Athena McColm, Pat a a e a I Kuestersteffen. Third row: Regina Bailey, Melissa Gibson, Janie Jones, Mary Pittman, Joan Gartner. -'SEP Y First row: Gina Ferraro, Debbie Pierce, Joyce Butler, Debra Simms. Second Krause, Steve Gardner, Janell Barnow, Della Bowen, Claud Reno, Guy Koon- row: Dr. George Hudiburg, Debbie Gillespie, Jane Clugston, Patty Turner, rod, Linda McCoy. Doris Gowen, Linda Kay Kavacic, Carolyn Hoheisel. Third row: Ethel The world of Journalism. It's a world of words, typewriters, copy- editing symbols and deadlines: film, photo paper and final prints, cutlines, headlines, jumplines and bylines. It's a world of constant pressure, prob- lems, page make-up, pencils and paper, controversial quotes, tape recorders and endless interviews. And it's the world of the Collegio staff: editors, reporters, advertising personel, photographers, composition crew and typists. Each of these staff members works many long hours every week to- ward that finished product everyone knows as the campus newspaper. This year, 20-plus staff members com- bined their efforts to turn out 27 Colle- gio issues, which again earned the All- American rating from the Associated Collegiate Press. Overall, things ran relatively smooth, with the reporters continually covering their beats each week, contacting sources and double checking spelling, names, hometowns and classifications. The staff writers made monthly trips to Topeka to do their Regents' reporting, and the editors more or less kept every- thing running in an orderly manner. The advertising staff, the people re- sponsible for providing revenue to meet Collegio expenses and payrolls, consis- tently canvassed city businesses in search of prospective customers. Though not always recognized for their work, the add department is indispensi- ble to a newspaper, and they kept the Collegio functioning above the water once again. But it wasn't always easy. There were several tense Monday mornings when late copy flooded the newsroom, and other Mondays when empty pages cried out to be filled. More than once the photographers ran out of film before the new supplies came ing no film and no pictures equal a gray, boring page and paper. There was also the mysteri- ous disappearance of all the dacto knives used for proofreading pages on Monday nights and Tuesday mornings. And there was a missing camera flash - Has anyone ever found that yet? the Collegio ,gf , 'it Top: Jack Copeland, Editor. Above left: Linda Baker, News Editor. Above: Dr. John Knowles, Advisor. ,par 1 is... ol l 5 Top left: Laura Cunningham, Copy Editor Top right: Kurt Beyers, Managing Editor. Above left: Darrell Page, Composing Superintendent. Above right: Jim Fry, Business Manager. WH i --L. 'Ln- Jack Copeland Edltor Jim Fry Kurt Beyers Darrell Page Linda Kay Baker Laura Cunningham Robert Poole Mark Rabuse Bryan Masters Bill Vogrln Andy Hoffman Tony Fruse Jane Beyers Vmce Miller Terry Ann Tracy Ken Wheeler Karen Kennedy Sherri Frank Ann Waltrip Barb Alllson Mark Reddy Pat Stockwell Vlnlta Hampton Terry Stickley Terry Vining Judy Plumlee Mike Wallrlch Sandy Wallrlch Valla Muzyka Stacy Masters Herb Frazier Raja Frelj Susan Melton Mark Seeley Nam w w-+A. fi efaewf' lima in .xueivbv V 1531-+ '-fr. layin- 'xv 'fam' 1 0 Alfonza Watson Man Bo Chan Tom Pattee Ray Hemmen Dr John Knowles Adviser Top: Robert Poole, Photo Editor. Above left: Mike Wallrich, Cartoonist. Above center: Ray Hemmen, Writer. Above right: Herb Frazier, Ad- vertising Manager. -f fp -4' fwfl '--Simian l Top left: Tony Furse, Staff Writer. Top right: Bill Vogrin, Sports Writer. Above left: Andy Hoff- man, Staff Writer. Above right: Mark Rabuse, Sports Editor. wiqynvv- ' ws 5 ani KANZA staff members got an early start this year. Being prepared and or- ganized seemed to be the key to a good book. Even with such a hardworking staff, however, that inescapable word deadline bothered us a little. A few struggles seemed to improve the final product, though. We worked awfully hard on our inter- view pages. They didn't follow the tra- ditional yearbook style. They weren't supposed to. We decided a little change would make the book more interesting this year, and we think it turned out great! The annual trip to Josten's Topeka plant was very interesting. Besides learning about the printing of the book, there was an interesting chemistry les- son Thursday night - with a Frog and everything! Thanks Tracy! Congratulations to all the Society of Collegiate Journalists initiates and award winners. For the benefit of the uninformed, Pat Kuestersteffen was the outstanding copywriter and won the distinguished service award, Marcia Smith was the outstanding page design- er, and Resa Toeller and Bob Benignus were outstanding photographers. Also, editor Theresa Wiederholt won the Na- tional Certificate of Citation for Signifi- cant Contributions to Collegiate Jour- nalism. Several staff members received various other awards: Tracy Morris, the award for The Topeka Sig Ep Management Program, Willie Shinn, the award for Little Known Darkroom Techniquesg and Doug Stuckey, the award for Wild and Crazy Bookkeeping. We have to say goodbye to our advisor, Bob Stockfield, who is off on a new ad- venture as a newspaper photographer. Good Luck! We'll miss you next year, especially your New York driving and the help from you and your class with all the extras. Above: Theresa Wiederholt, editor, t'At this point in my life . . . Right: Dan Dyer, first semester editor. Far right: Robert Stockfield, advisor, What do you mean I'm late, I'm here aren't I . al pha, the omega . the Kanza. Q ,.....--1 B' 3 PM we 'o g is S,,,.. s I 3 L X, - -4-ZQJ 5 we 1 Top left: Resa Toeller, sports editorg How bizarre. Top: Bob Benigunus, photographerg Wasted Left: Pat Kuestersteffen, assistant editorg I'll get it done, I'l1 get it done. Above: Doug Stuckey, business managerg I'm a wild and crazy guy. KANZA staff Theresa Wiederholt Dan Dyer Pat Kuestersteffen Resa Toeller Tracy Morris Marcia Smith Bob Benignus Mareta Smith John Allen Willie Shmn Doug Stuckey Kerry Shackelford Virginia Hackathorne Dan Glynn Robert Stockfield, Adviser Opposite page, above: Marcia Smith, layout. Bottom right: Virginia Heckathorne, copy editor. Bottom left: Willie Shinn, photographer. This page, above: Tracy Morris, layoutg '4Maintain. Far right: Kerry Shackelford, layoutg 'Tm working, I'm working, Ifrn working. Right: Mareta Smith. layout. -Q-W. T'-fr 5-mn Contributors: Rob Poole Rod Dutton Larry Long Debbie Williams Rodney Smith Laura Cunningham Judy Plumlee Kurt Beyers Curtus Caldwell Bill Vogrin Bruce Cole Jim Stringer Tony Bickam Terry Vining Terri Sprague Vicki Graf Bryon Masters Marcia Jones Harrison Spears Kam 'ilnqk .- Ulu: f 1 SPUGIJ f .ff . . ,A Mm . -1 3, ' 1 1 Eff ff- 'I -1, - ,A 1' gi - nf I I' .2 ' ff' ' J '1'!!r-1.144 '- ' av ' 5,:cf.3L3 ' . 2 K ,milf . ,vpn , , A: -J w l ' .Q W., ,--' ,jpLA.-Y:,-i17,?:?,.,r??a yn 90, 5' --v ff-f x ' ' ff- As1 ',-1.2:f2f!i'.'f!'-f.'.-'H - Y 35 K 52-. 1 . Qi? 165 :,44wP ffa1e-r::ve4f.! ' 14 Hn 1 -' 224. -fl' 7 1 fir? '- b 'i'l' . A 44, lf. 3, Viva, I I ' t .uv In A A 7 Q1iE,1?!:I e,,:,,.:.n6rf7 ? A ', ' lufgggvfgw 'Z' .U ,, H1 H ?'ji'f54'f4f f Q. '-'ilff 4 Fifi? : , ' 1' M 1'fifcff 'J .1 M252-.' , fi ig-ft? 3456255 r.f.f2.a5vqffr.5f..-,L,4g5g,'-5153,ji f. if ff ,-A , hfjgj l 4 7.:,q:g, iran n If ,ffl - Q ,lx . g, I 4 ',7- H ' f, ,l '4 1 4 n v -3 f' ,IJ 'H' LL. - ., ru, ' -if - - sr . I mf me fm i51521'?7 1 ' X Kb x W .,,f.u , V- : 5 -' . g . , 1 A 5 '- rf,-A 7 -'f,, .. , . ' -' . I if ?fJ.f,1g-:liz gvjiiik, S. g 1 I J avg? 2 31360 vvvf v ak! -,Q ffl ! 'Q 'q+f,::,1? ymgfjygw .- , x ivy? 5,7 In ,ryg . , guy? 'W , K ', ian' ,, 6, 5 1.3, fy 151, 1-,qi-I I., ,'- , f.M,,g A. K , I. 24A g ., , 41,1 K .L ML, .I . X i f .I J 5' ' K 4 'df' .19 .if-. N41 ' , f 1: rsiife 7 ' 'i 'QFEQ5' 1' ' 2' . . f -.- fYz1v2f,eff1 f' 5'-5 if Pi! 1 5,133-' ' ,:'..fff?- '1' wiki? -f '- 'AM'-' ' -1? f'?G'. W5-' ' : 7: 32 5 ' J IMF A . ' f - 5535 gg 'f ?'fM,5 I ' . :If ,.':A75+irifW6i.gi!6,!jqWk1j. I Pgzygf: F.. Y I 5 , - ,I 1 ,-' I 6 fig mu ixrt' - 04, g,-P , . H15.IAu,,r ,v4',3.', il. fl, 5. . 2f V ,'y'W ' ' l'M.lq.f -3 ' 'go Q4 wif f ' ff. ,, 4 -fb i f 7.1 5gfi!, ::f 3. . .- , . ' I 5171, f r s. 1' 1 ,-l','.5 4 7,-. F,. ' 1-4 -' M,,,,g-,ywvfffffizwwfff'I ' 'Wav 35 ' W' A , - '77 v,1gQi 'u H5'WI - ', , 11frf?Wf?i'v'41'9'0'7 7'i3f J, ,,,c'y.? fr. f ' J' Mini. iff ' - A r ' I -' A .:Lx, c- f '7' '- , f .1-,..f . . : .1 . ,, - -V ,QWPAY . rf, , 1 g -' . nQ,pw'l5'f , bg , f f, 4 . 5651121.57115 g . 1, : N '9'Y?1:,1gQy,gg-,ejff,xfff 1254,-,I . ,7 5. I . V5 'Z , 1754, . aff: ,I - -- 14524 z.. :fy-, Jw' , .f..5ow.f,f..f.w--wh- 'f f' A f W .ffiikf V '9f if135'- V A ,HV 'Z :I 1ilm 1 f59-55.2'54?'u n -f,11,wf .1 '- wvmf' ',-:lf v -f 'f+. ' 1 'Lk J 7,f3fajl ' W W 'r'Mf 'iBi4f,:':' f'M5S1f3 . '4f!'i-'-Q 'ff4 .4ff4ef.1:f14f-'1'-f 1'c rw, ' 'M 'if V 5' ' ' wiv, 9 hZf'?f?'f' ffm'--U 50:I '9 '7L,- .0875-.fv'i ,fn , N J,4r, - r 4 W Ky NX' 4' I - , Izmir -1f9w,px3-K., 75 -QV!!-pq., - 7-'TM .ff'4 f' . V. U ' 7- ' '17-11.--. 56942 -1. WY! ff... 'Q W 1, x M L f ' ,',',,J -.Cut -411:53 . .., . W W ' . -.M Mfwe- ' w:,h,,,g,4,-,1,,,n4vY7:4fl. .ffnnvn-'Agile-lawp., ,,g,,, f - Haj ' , gm ,.-W ,lx : 1 - ,'.,,,-.4 -'guy' , -vu n A,,,!,,o--14 'T' , 9 ,. I A' V f 'M 'ri J inf: , .',1,' ,, ' '-'. 1y,,,, J,g,, ' f,3LfllL1ffIL'Ivl9fJn'iyj4,!la'JylAl,5L1v9'flLY!1f'V1af,u-:LJ M ' ' 94 yr, I :Alf Liv' .I A f yH. ':-'s'v- 141.49111 - ' , .,-f-':c'ff9 ' ' 'f f-'ff'-' 'f'...vl -'ET- '--I'-IE' lfxiffff '-'fi ., fr . .vm-'P ff-:nf-':LV,.-,-.1-H -, -'-Q'-am. ,U .f'-.,0- Y' -f - ' .--.- ,J,:.,,.r,v. 1... ,, H ,. ., U ,,. W , J -,I .lbw yvy,,1,,. . rf . , J N ,I K. 'v' 'Vu ' ,1 Y , -4 .--f 'V'-WR, , 'Jf1,1 ' v - ' Jw: y '-Mfr 'Y' K ' 5' ff' ff' 'A-X- 4-'fu-fp. fi'-'MVN : .H ' . ' fr 4 r:x,3.,. J f Q :I ,fr it! f ,. .,' la I, 2,-3-Chl ? .ghiuwr ' ,- 1' : , ,. ,-.g ff, I A- 59,4 , .W ' -4' ,5 r '- 'fi' Wy Z., '-2'-1 A N.-,',,,.fL.'-zyanfyg.4uWn'.vv'fwnwm5p4ff.,y ,V 'ZH fr, -515 ' if V532 if ,. f s.,,za:,E. ra -fwf 1 ,.' HH 'f,341!p9?P0 f ! ' ' ' ' ' '- ffflflfrv' R. f?i'f'Q:igg, f 'nvfgkl 4 ff' ff! Q' Qnuili' 'Aint' MJ,,',,,,,:.v'zvd , f,1,,.,:,g y, , U ' ,.,'. 1 -5 I 3 ,. - .. --.,, iv, - .:',..A '. , 4 ' - , -Y f ' f ' ' v ' 5' 1 'f Mr 29 1. '-251 'gin 5 Wa? 9 Q 9 ,Lf--v, 'N Wo, I , ...I ht. 'J!:dD4,..,, ,buf M. I . 41? V v , '. Nl 2, , , bf - 9 1 . -- -.awwfffwfffw f - A M- A--.gp f 1, 'ff 1 1fs.-- , ff J - - M . f Q. ,sw-WW-'M 1 . .. aw' -'A 1 - f V4 .. 1 ' Ylaf yt J - -g f,!,'-71954 5 '. .15-1351-. ,. Ilx 4. Lfflly ,drfpkf . ',':j -15:-H ' V : .., w -f'-l 'f'.. ' ' . 1 6 . HQ 5? Z'Z5'55 - 23 ,fl ' ' Y 3 f H4fg, AD. Q. H j'f'7,fxffn:L-f ' ' L' 7 r tv- 'rev yi '- V GJ k 'f'-s V X L. 1-4444 I 55'9.sSfG1 lwflxfn f I5 lk' JJ. E577 ' ff ?f'rm -v 1,1 V 4 5 - FIA . 7 '! 32'4- 250101 AY 'T f' I ' nn aff! A' w w -gy P f m'Ei'? 71'f Q 5 :JM , 'f,' 'wf,.Z psf 70, fm ,- 'S .mg ' gs. 3 new , ' 1. za. hgh 4' ' ' ,., 1 -- , ,pk ', 'Af 512 -. '24 ' , ff ,yggffxueww:-fwfwkzw-1fffff-Mfm,, 5,3 ,, W , A 1 L ,v72'7?1'fff4'Zf355 ,gf - I' ' ,f . ,.l , . gr! ,'. . ' ,1 1 .?f,. I 'B1 'f - l' ' fl' V -ff' il? .f1 , ., 5 Q, sgji-ff'.'f.1q,3 ' ,. . M if QL - 91.412, . .iff 'Z1, ' swf' 5.0 - Wiz: H wwpgpgapmgf.-my,-,1,.f,y,,-.' LM., A -42, Ju' ' of ' . -., 4- . A - 1f.'.:..:g.',1gf- ',.,,3.',.i.,-,fy,6:L.f- -' - - '- - - - -1,f...- H, f . 55' fl r . . r J 13, '73 ' .6-1g.,,,:h A -,Q I fi ' I if gf X :4'4?6fi,Q E:1 w,U,. :Ilif f f -4'rm,,ytL.:f' ' , ,V I f,1'i'f' 14 . I ' ' f f , f11f20acfmz,mf5:fg4f JI! 'I S r, 1 fd. n 9 .A . . , 11 n.r,, gf l 1,4 ,f .. L b ' 1-Ilfpfw . 11' J y ,,f E Q.. I-1fr!AfdfyL1il6? ,JW 1 L 'Q C.. fi g. . ' Sung., - d igg, ff' -B, - . WW f K A .1 - ' . ' - p ,Evil ,lip - Y '- b fflglffi i 1 -'V .- 1 - fry - r- , gy. 7:55 ,f ' . , A ' -ilgwn '9fe4J,f.. V f f 'f- ' '574f..l . I lj' If , l '-41fl,Qs5., , . 4,4 QCQU. . x V- ' , '- 1 .1 ,M-f-..,:. M f I l,,:rrrr-JAIQ IW 4 'full , 7. --4 :f?2xf,.,f ' , ':. 'I 2,9-:Aga , 5 -., ' :-.71 I 4- .Lk 1124 !- 63:5 'J w'?'1ff'25f5'f'7f '1 ff - A ' l.- . ' ' r' 1 I ' - 0 I ' . g, 4 L ffl-f' 5: K 1 K J 3 ! ju' ffl.: .-IQZIJ, , 1 Q,-1p1r1:,1 . ' if f v' 'I Aer, fy -ww E ' 'fog - ' , , , . A, If ' , :I ..'S'.f2 j f llli O 4',,,,1,:..-' 4? f w . 9 , ' KWQ Wxfwfl ,ff f -J J' ,M My . ,. g A. 7 ,r ,M pn ' MW' I: -za wv1,,,, .-.4 .. - 6, I J, h ,4-,rp-qv-14-1 pnfllllllffilj im J 4fwN 0 jg rg' 1 I 1 .,.v.. V M ' : I 3 Y. 5 -H ' -sr , 'V . 'X , 1 , Y ,. Q fl 1 'K '-: J. g , 1 ,,' f f. ., , . K A .. F4 3 fl ., .,..5, f ., A . 4 -. -MH, I 0,,,f,.,11.,-..L...-.,,-?.A.,-4-,, .I I Yi' f L'-L'-'Prfyi'.'1?','1-',7,-.1.'f1'g5l5.7'? ' 1 3 ' T7 5 5 ,- 7 -If 7 .I ,, r, , ,v -V ' ,I 1 'I 'E T Dfw? ' '7 F5 . 9.1. '5 ,:r 5 -' P ' 'Jr ' fo If Mg U 11: .ww V. 1 I-I If ', fx- .Af ff' 331' Lf, 'f ,, 554. -.. . A -J,--fs , ,.' Y . :.,w,,,.,.,,f.,,,. fr, ,M .F A .f U .-' 1- ,.- inf. -, ' Vf'-,--'Q r:.c' I 1. b.-,ff gf ju. if f,.- VA. 71. - ' , ., -cf , J. gli., 1151- , 5.4, , A n I I I , ,-,- . lf. 1,.,, iv ., ,, , .,. 1 .J,l, I 1. . ,I . f . 1.-f.A,,,g-H. , ,r 1, 'Q ,fu ' ':g,jwv Lkf 3' : 1 -.115 '. 1 . , f fx ,M -' 1 ' .-- . ' ' XL I if A' ,I Ar 0 . i 'V t L. If Lf, +3 '-'- .5 -74,12 :E Ev, 5, 'gi if '.f fi' Ulf- fn . ' t 'l1 f fi- '. . uf'-'fr Y ', if L , ig- ' FJ V, r. ,.. .J..zx 4 , , fl, 5' -' 147 QA- L. Ai J5,Q'Q9' 0 r. 2' V , L' fri. .L f-jf, if., 3.5,-Q y - -' f',: .1 .,,- :: '-C-rif'1-,.-.vfff - 'I -' fn-1, v r-.Ti . ,G - U, xrjg-41 7 4 1' .-,,fr -1' 'L 7,-. In,A.i.'1, ' z ,af ji-L, ' fx 'rf a f, Q, 'jg-79 ,1-ff. -3. Nl- ,L,.. ,...f 1- -, -1, 1 9- f .. . Z fy AJ fb l.', n'4.1.' K1 .-4' .1 'C ,K fp 3, :'.1' . '7 i'f 5 -v' ' 'Z '71 .-. ,s 4, 5 fa 1 .' 'I Kid RMWAIL KAN!'a7f'!,l7J7ASfl1'YL1'ZlFlS'EIAfbI ' 141115-il.'J S-UBJAILQY IRQ!!! Athletics . . a way of life Top right: Sherry Ventura ol' Pitt State surprises a member of'iJohn Brown University as Leanne Kennedy looks on at Weede Gymnasium. Upper right: The wom- en Gorilla's bench optimistically anticipates a success- ful season in a pre-season scrimmage game that ended 4- 12. Above: Mark Rabuse ofthe Pitt State 'l'rack team relaxes between events at a home meet. Right: The women Gorillas volley defensively against Missouri Southern State Uollege at Joplin. Top left: Steve Portz and Brian Jones make an effort for a rebound against Nebraska in a CSIC game at Weede. Far left: The Pittsburg track team displayed top form during the season as the Gorillas remained undefeated on home ground. Upper far right: Phil Scourten takes a breather during one of the Gorillas' home basketball games. Above: ln the first home basketball game for the women Gorillas, Pat Adams fractured her right wrist. Left: Gary Leuteritz concentrates be- fore putting the shot at a triangular track meet in Weede Gymnasium. f i i Opposite page, upper left: Tennis for the Pitt State men begins in the spring, but this player began training in the fall. Center left: A Pittsburg Gorilla bounds for a Fort Hays State University player at Brandenburg Stadium. The Homecom- ing game ended in a tie, 29-29. Lower left: Dave Wise, Pitt State trackster, moves along the home cross country course at Country Club Golf Course while golfers liesurely enjoy an afternoon of golf. Upper right: An official takes a break during half time at one of Pittsburg's home football games. Lower right: Pittsburgls Pat Adams takes the ball downcourt during a home contest against Kear- ney State College. The Gorillas lost 79-62. This page, upper left: Rick Gallagher, Pitt State linebacker takes a quiet moment during a Gorilla home game. Left: Early in the basketball season Lori Cundiff took a spill during a home game. Trainer Mardie Burckes and student trainer Nor- ma Likely attend to Cundiff's sprained ankle. Lower Left: Greg Wolf C241 drives through the lane as teammate Brian Jones sets a pick during the Kansas Newman game at home which the Gorillas lost, 66-63. Below: Raymond Harris, gives a baffled look to a Kansas Newman player during a home game. An athlete is a rare breed, an individual who sacrifices a few hours each day, year round, to develop his natural tal- ents for personal reward and satisfac- tion and for the entertainment of oth- ers. What makes an athlete? First, the athlete must be motivated in his chosen sport. There must be a will to work hard with devotion to both self Above: Pittsburg Cross Country runner Dan, Ford finished the practice course and takes the proper time to allow his muscles from becoming tight by walking and stretching. Upper right: Coach Rand- lernan directs Gorilla football traffic during pre- season practice. Right: Sherry Ventura stops to lis- ten to the basketball coach explain strategy in one of the -preseason scrimmage games. Conditionin and the sport. Second, the athlete must be routinely conditioned through a well-planned, seasonal training cycle. Physical condi- tioning enables the athlete to be at his maximum level and to exert his best efforts throughout the season. Third, the athlete also must be contin- ually developing mentally. The proper frame of mind for individual and team conditioning is important because ai athlete's body performs better phys ically when the athlete exhibits confi dence and desire in his chosen sport. Training hard, running miles, gaspin for air, feeling aches, pains, anxietie and frayed nerves, dedicating time an' talent, experiencing joy or disappoint ment, success or failure: these make a: athlete. ,. Mn:-as 5495235 1 jfs' HQ M,-M ,WMI ' 'S gp .gg . .W Left: It was a long and difficult season for the womerfs basketball team. Here Sunny York rejec' tecily sits on the bench after fouling out in the Pittsburg loss to Emporia, 63-59. Below: Carolyn Kensett brought success to the Pitt State wom- en's tennis team finishing the season in first place for the singles state small college championship. Below left: Pittsburg? menls basketball team faired no better than the women in the CSIC finishing the season 242. Brian Jones looks on anxiously during a home contest. Far Below: Year round conditioning for the Pittsburg football team keeps the players in shape for the season. Wee in pires ew athl tic Modern facility used for competition and recreation For seven years, Weede Physical Edu- cation Building has been a hulking, awesome symbol of athletic prowess at Pittsburg State University. A giant ob- long made almost monolithic by repeti- tion in its form and texture, the build- ing creates a unique visual impact. Whether or not the design stimulates the talents of aspiring athletes, they are motivated by new facilities. One of Pitt State's monuments of a new era, Weede heralds the awakening of a new athletic philosophy at the universi- ty. The coaches are given the opportu- nity to provide modern physical and mental conditioning techniques for the progression to a higher level of compe- tition. This building also reflects the images of the weekend athletes, as the facilities surrender their availability to the com- philosophy munity as well as the students, for re- laxation and pleasure. In the evenings the halls are always active with the in- vasions of elementary and high school students running wild through the gymnasium for amusement. And during the week, university students fill the building at intervals for classes and in- tercollegiate activities. Weede was constructed as amphith- eater, coliseum, and rena. In the past, it has hosted exciting scenes of intercolle- giate sports for both men and women. To the generations of athletes who have yet to participate in the games, the are- na seems ageless. Sunlight strikes its unmarred surface, and excited specta- tors, in festive moods, cheer the specta- cles being presented for their entertain- ment. Spectators fill the arena Right: An audience gathers in the arena for the Gorilla home opener of men's basketball against Benedictine College. Bottom Right: An added attraction of Weede is the Olympic size swimming pool, as viewed from the spectator's seat. Bottom: Weight lifting is an important part of conditioning for the men and women athletes. Students partake in one of the available Weight classes offered. Below: Second floor Weede houses the offices of familiar faces of Pitt State coaches, if 1,s::ff:,fgg:g:g5 , ,gy , -f K is ,H M WM ,,.,.,...-P' di sul 'wa ss, s Below: Wane Engkjer, Overland Park freshman, enjoys a vigorous game of racquetball in one of the racquetball, handball courts. Bottom: A room for all uses, the dance studio, is utilized for fenc- ing, karate, cheerleading practice and Dr. Tripe plettls folk and square class, one of the many dance courses available. Nm 8 1 v,'i'J ..:': ' If -ssl IQ: L , .. A , ji Athletes work out Gorillas undefeated at net Above: Pittsburg tennis player Ann Lynch, Chan- ute junior, executes a defensive forehand in a con- ference game against Benedictine. Above right: Linda Baker, Pittsburg freshman, returns service with a backhand that helped make her and Caro- lyn Kensett state doubles champions. Far right: After defeating a Benedictine player, Baker is congratulated. Right: Carolyn Kensett, Chanute senior, ranked first in state in singles and doubles. Near tight: Kelley Dodd, Prairie Village sopho- more, waits for partner Jane Hughes' serve to be returned. Victory never eluded the Pitt State women's tennis team. Another success- ful year was added as the top two seed- ed players, Carolyn Kensett and Linda Baker, swept both the singles and dou- bles championships in the Kansas small college tennis tournament sponsored by the Kansas Association of Intercolle- giate Athletics for Women CKAIAWJ, at Fort Hays State University. Kensett had an immaculate 12-0 mark in singles for the season and Baker had a faultless 9-0. The Pitt State netters took third place in the Central States Intercollegiate Conference QCSICD showdown at Em- poria State University. It was the lightning form of Kensett and Baker and depth behind them that enabled the team to participate in the KAIAW tournament. Kensett snatched the singles title, and she and Baker walked away with the doubles title. By winning state titles, Kensett and Baker qualified for the AIAW Region- Six regionals in May at the University of Iowa. - strides: ve god? she said Th State's women's athletic still needs to improve. It is un- fair athletes, who have worked hard and with dedication to the stu- dents and community and for the repu- tation of the school, that should remain the underdogs. Basketball coach Connie Archer think we have the basics of gram. We have the stability, it's time to go all out and get gram to a level closer to that schools. Volleyball coach Pat We have a which everyone facilities to house an but then li mg our I know d omen rules. This ents the Athletx h high school COC SS ll has ee g wAnothe modern techmqu area high School dto iv m i their hletes. Th1S system 1 hhhh 6 4 4. , .L. , wmv, if g e the new techn , i, 6, at , ,n oo , Pittsburg's image. l iiht Z and is growing as are receiving athletes. are the new year available for the with information concernlng lllf :,nt l li 3 takes and the 0l1S win, and do we or the Tam was planned for S Ol' sald. v 1 W 5 . still waiting for next year tential to be a threatening team, be- cause of individuals who are talented, young, and improving, such as Richard Overton, Booneville freshman, who rushed for a total of 850 yards, an aver- age of 85 per game, with 3 touchdowns. Greg Smith, Lee Summit juniorg Pete Peltzer, Atchison senior, and Wilton Jones, Miami sophomore, were Pitts- burg's leading receivers. Smith snagged 32 receptions for a total of 465 yards and two touchdowns. Peltzer was right behind with 27 receptions for 329 yards, Above: Mark Lamb, Wichita senior, watch- es from the sidelines. ...aIotof bright spots . . . Coach Randleman .1. l vfitfwsffig ...SH-m.. The 1977 season was PSU's worst in half a century. In 1928 the seasonal re- cord was 0-7-0. The opposition's scores totaled 113 while KSTC only managed 13 points. This year PSU accumulated 176 points to the opposition's 280. The span between we and they came down to almost 100 points in both seasons. The Kanza asked students for some comments about the season: Head Coach J. Randleman: We defi- nitely weren't pleased with our record. The play at times was good, but we wer- en't consistent and we made too many mistakes. There were a lot of bright spots in individual play however. Debra Williams, junior English major from Girard: It was a hard-luck They were young - maybe they'll better next year. Robert Robson, senior elementary cation major from Coffeyville: T seem to be a lot of freshmen on can so I guess Coach Randleman has cruited a lot of new players. Maybi they just need more chances to play to gether as a team? Dana Austin, junior English major from Independence: They had a lot of en- thusiasm and fine leadership, but they lacked the consistency to beat the more experienced teams. Lee Stroh, senior electronics major from Humboldt: We've got the best 1- and Jones tagged 15 receptions for 283 yards. B-1 team in the country. V im Wade, sophomore chemistry major rom Pittsburg: The football team did ood ..... we just had bad breaks. Raymond Hemman, senior English ma- ior from Coffeyville: I think they suf- fered from lack of experience. The new J.V. program should alleviate that in coming years. Sterling Hudson, senior physical educa- tion major from Erie, and Gorilla offen- sive guard: I think if you look at the team from the start of the year to the end of the season you will see a very noticeable improvement. Kent Walters, freshman marketing With promising young talent like this, up. -'L .. .rixliix pfgof'-fs? ',, , .. , Z.. f - is - Q-. i5,L'.f'-'Sgr t3wQw:,, .. - ' L 2541 Silt-'gf -mg' Spanish major from Prairie Village: I went to football games to have fun, not watch the game. Michelle O'Connell, sophomore wood technology major from Shawnee Mis- sion: Coach Randleman was really try- ing. I saw an improvement over last year. Angie Secrest, junior English major from Neodesha: Although I haven't seen any games, I feel sure that being Pitt State they were outstanding. PSU will eventually resurrect its foot- ball program, and next year, as the cli- che goes, there is no where left to go but Even with our record, we never gave up. We hung in there and fought, and this proves we have a legitimate re- building program, Randleman said. Above:Wilton Jones, Miami, Fla. freshman contemplates the season's end. . . . the best 1-8-1 team in the country. Gorillas disappointed with I don't feel badly about our season's turnout. Naturally we hoped to do bet- ter, especially in the Central States In- tercollegiate Conference, but we didn't know what we'd be up against, Pat Throop, women's volleyball coach said. The Pittsburg State team finished the season in sixth place, a step up from seventh last year, in the eight-team CSIC. The women Gorillas compiled 10 wins and 13 losses overall and had a 3- 10 record in the CSIC. We were disappointed for not placing higher and not being able to qualify for state, but I wasn't unhappy with the performance of the team, Throop said. Leading scorers in total points for the season were Joyce Thomas, 4145 Julia Maxton, 400g and Dena Dellasega, 314. A break-down of the different categor- ies of scoring shows that Thomas led Pittsburg with 254 points on serves, fol- lowed by Maxton with 250 and Della- sega with 134. Spiking was topped by Dellasega with 136 points, and Maxton managed 120 and Thomas 116 points on spikes. The possibilities of another year bring optimism with new hopes. Next year will be another struggling year, but we'll still make some gains and pro- gress. I will definitely look for a better year. The competition will certainly be tougher, but each year we've improved, Con't on pg. 225 .Me i ...f IQEQQQ M025 'fivmsm ies'-isis ll 41 f vs . , .i tough season .mwah - - 'Q . J. qi R Q ' ,, l V . !, ' vii: 9 . 1 4 aiaslnzaauuawnas we QQ T1 at Wwe Mez ' rllll!S'i!lEKU'2'Z,'mz:. ge' . .alvzzacmavmzm t fUl!fFillliiiw t we l!!'?'2illllh ' ll- '! ':ifxr . All 4 s L . V . 'qg'-x 0 mm? if or 13 -r' ,gqgjg 2, Above and near left: Mary Siebert Hutchinson junior, prepares defensively for an offensive at- tack from Missouri Southern at Joplin and poises to block a forearm pass from an Emporia State opponent in a conference game on home ground. Left: Leann Kennedy, St. Paul freshman, and Connie Reiger, Hillsboro freshman, blocks an at- tempted spike against Emporia State University at Weede Gymnasium. Far left: Bev Zafuta, Fron- tenac senior, cools down between matches. Top: Pitt State's women's volleyball team gathers a pre-game pep talk from head coach Pat Throop. but look to next year Right.'A demonstration of the unusual officiating of the women's volleyball game at Missouri Southern State College. Far right: Head Coach Pat Throop anxiously supports the women,Goril- las in anticipation of a victory. Far right bottom: An Emporia player couldn't get the timing to block Maxton's spike for Pittsburg. Bottom right: Receiving a difficult serve from the opposition, Dena Dellasega, Pittsburg senior, was brought to her knees to set up a defensive play for Pitt State. Below: Pittsburg overpowered John Brown Uni- versity at Siloam Springs, Arkansas, as Julia Mas- ton, Cherokee freshman, executed a forearm pass. . ,l' ' i W ,E . ,kkk,,,,,. . . or 11-in 1 Q 81' J K' 3 X ',,,.,wf- - KN' N J f'-- 'Half Q M.. , A Conlt from pg. 222 if we hadn't, our won-lost record would be a lot worse. Pittsburg exemplifies part of the trend of new, sophisticated women's pro- grams aimed at giving women athletes an equal opportunity in sports. It was not until this year that Pittsburg was able to take advantage of this opportu- nity. But the program is still too shaky to be complete, it is just beginning to see some signs of progress. This is dem- onstrated by the fact that only one vol- leyball scholarship was given, and the recipient did not see much playing time. Strength came from the athletes that are called Nwalk-ons, freshmen and transfer students. The walk-ons made up the major part of the Pittsburg team. Throop indicated that if Pitt State is to progress to the competitive level of oth- er CSIC contenders, the recruiting pro- gram will have to be more effective and increased. We're writing a lot of letters to pro- spective athletes and have received quite a few from coaches wanting us to look at their players. Next year looks promising. This year we encountered some major conflicts we had to deal with, which slowed us down, but we do have the potential to become a winning team, Throop said. - Gorillas suffer K The athletic department fared poorly in more than football this year as the Gorilla roundballers dribbled them- selves into the ground, turning in a dis- appointing overall record of 7-20 for the season, and 2-12 in the Central States Intercollegiate Conference, finishing in last place. The Gorilla cage team started off the season against two nationally ranked powerhouses, Midwestern and Howard Payne Universities, and came up empty twice. They returned home and grabbed their first victory of the season against Bene- dictine College, 56-53, and showed signs of being a competitive team. Pitt State then dropped two home games, one to the University of Missouri-Rolla, and the other to Drury College, both by lop- sided scores. A But Pitt State did not give up, as the team members proved to Central Mis- souri State when they won the fourth game of a five-game homestand at 82-73 in an exciting game at Weede Gymnasi- um. At this point the Gorillas' record stood at 2-4, and the season looked promising, if the team could just put it together on the road. Once again Pitt State pulled out a squeaker, this time against Baker Uni- versity, and then went into a five-game losing skid. The Gorillas lost to Kansas Newman, Southwest Missouri State, again to Drury, to Missouri Southern and returning to Weede, lost to Missou- ri Western. The team was unable to hold down a lead, because we played inconsistent ball and beat ourselves on many occasions, according to men's basketball coach Bob Johnson. Injuries also took their toll on the Go- rillas. Back problems kept Greg Wolf, Kansas City sophomore, out of the line- up for five games. The flu hit several Gorillas and forced Coach Johnson to go on the road with less than seven healthy players. Pitt State beat Wayne State, playing as if they could beat anybody, and hit the road, beating Central Missouri State for the second time, before dropping a heartbreaker to Emporia and losing to Washburn 75-55. Then Kearney beat Pittsburg, but the Gorillas got back on the winning track by beating Fort Hays and Benedictine, the last victories of the season for the Gorillas. The year ended in frustration for Pitt losing season State because the Gorillas lost their last seven games. In two of these games, their opponents broke into triple fig- ures. We felt we made progress at times, but then we would make more mistakes and be back where we started. Many times we played good basketball, and simply got beat by better teams, Johnson said. Pittsburg's cumulative statistics were led by Gorilla Don Simmons, Kinder, La. junior. Simmons came on strong in the second half of the season and ended up the leading Pitt State scorer, averag- ing 13.1 points per game. He was fol- lowed by Wolf who hit 11.6 points and Steve Portz, Haysville senior, at 11.1. Portz also led the Gorilla rebounding with a 6.7 per game average. It was a very disappointing year, you can't go 7-20 and not be disappointed, Johnson said. We are disappointed but not discouraged. We had young people playing who weren't used to playing with each other. It is difficult to get used to playing as a team. Even though we lost, I want to credit the players with never giving up. I nev- er had a player who didn't want to prac- tice, Johnson said. Our team was prone to turnovers and not a good free throw shooting team. Johnson continued, We stayed in the team concept, and some players im- proved during the season. We were nev- er a high scoring team. It was a year that started out bad and got better, but better was never quite good enough. Opposite page photo: Greg Wolf 12-H, drives the hall inside to set up a score against the Wayne State Wildcats, the Gorillas dropped the home contest 76-87. Lell: Pittsburg head roach Holi Johnson questions a referee's call during a home game, the Gorilla's finished the season with a T-20 record. Hottom.'The Pittsburg bench anticipates the result ofa Gorilla free throw attempt during ai home game. Started season with consecutive losses to nationally ranked powerhouses Rightg Pittsburg player Steve Portz, looks for an open teammate while fighting a Wayne State de- fender. Below Ieftg Pittsburg found victory over the Benedictine Ravens, 56-53 as Phil Scourten 1255 struggles on a rebound. Below rightg Scour- ten C255 reaches, to score against opponents Drury College, the Gorillas succumbed to defeat 52-84. 'Wi JAVX l. r Qt... Mas-i jo, Inconsistent play, bad breaks and the flu cause losses Leftg Gerry Dole 1405 and Drew Beavers f33J, tangle with the opposition, the University of Missouri- Rolla. Pittsburg lost the home contest 55-84. Below Ieftg Seventh ranked in the National Association of Intercollegiate Athletics CNAIAJ, Drury College overpowered Pittsburg in both contests 74-97 and 52-84. Below rightg Brian Jones 1441 and a con- cealed teammate, behind the Drury player, were out positioned on an offensive rebound. Women's Basketball I feel there were many positive things that happened this year, even though our record wasn't very good, Connie Archer, women's basketball coach said. The Gorillas finished the season with a 4-15 overall record, 2-12 in the Central States Intercollegiate Conference. I think we played a much higher cali- ber ball this season than last season, Archer said. In the CSIC statistics, Sunny York, Lawton junior, was the leading scorer in the conference, averaging 17.9 points per game. Pat Adams, Bentley junior, was the only other Pitt State player to place in the statistics with a 2.5 average of assists per game. Sure, we're disappointed for not win- ning more games, but I think, more im- portantly, we've finally become more competitive in the CSIC, Archer said. I think in the CSIC games that we lost, it could have gone either way. Pittsburg's cumulative statistics were led by York, with 17.9 points and 9.9 rebounds a game. Teri Hoseney, Man- hattan freshman, followed with a game average of 13.1 points and 9.1 rebounds. Adams led the Gorillas in assists with 49 and was third in scoring with 7.2 points. Pitt State evenly balanced the overall statistics this year. Free throw percent- age for the opponents was 57 and for the Gorillas, 56. Overall scoring shows Pitt State within reach of the opposi- tion averaging 60.9 points to their oppo- nents' 68.8. I really think we'll be a lot stronger next year, even with the loss of three seniors, Sherry Ventura, Joyce Thomas and Mary Siebert. We have a fairly young team that was just beginning to develop toward the end of the season, Archer said. The women are already looking forward to next year. Although things are pretty much up in the air with schlarship funding for next year, Archer said if the fee increase goes through, we will be able to offer more basketball scholar- ships than we've had in the past. But if the fee increase doesn't go through, we won't be able to do a great deal of re- cruiting with the small amount of mon- ey that we do have, she said. Archer explained that efforts for more money are being made through a schol- arship drive and other sources. Archer said she will also be trying to make the team stronger in areas where the oppo- sition took advantage of us. We'll try to pick up more height, the players in the CSIC seem to be getting taller every year. We're already looking at a couple of strong high school possi- bilities along with some juco pros- pects, she said. Next year's basketball season is just around the corner and Archer is opti- mistic, Now that the players know they are capable of competing against ,, w' K. 413' 3.53.2 1 . xxx other schools of a high caliber, they will be able to develop a winning attitude for next season. Next year's schedule will remain com- parable to that of this year. The Goril- las will play each team in the confer- ence once at home and once again away. The season will begin with several scrimmages with area junior colleges, and also include competition with other non-conference area institutions. The team will return seven guards, five forwards and five centers with York able to play both forward and center. Of the three seniors graduating, the Goril- las will lose one player from each posi- tion. Q 'vnu g o A Opposite page: Head coach Connie Archer and graduate assistant coach Jane Posch, signal for a time out during a Gorilla home game. Far above If-Hg Teri Hoseney, fights for a rebound from opponents Wayne State College, the Gorillas dropped the game and finished the season with a 4- I5 overall record. Far above right: Linda Baker ol' Pittsburg reaches for a pass against Wayne State as teammate Dana Cunningham 1201 watches. Aboveg Teri Hoseney till D, Sunny York 1243 and Dana Cunningham contend for a rebound against Washburn University. Right: Sunny York t24l, leading CSIC scorer, blocks an attempted shot from a Wayne State player. t 1 231 if? gg' 1 k 5 .xx, 4 .ann-uawf Far above: Leanne Kennedy, is being sur- rounded by Washburn defenders at Weede, the Gorillas dropped the contest to the Ichabods 65-71. Above: Sunny York was the leading scorer for Pittsburg averaging 13 points per game, goes up to shoot on a fast break against Fort Hays State Univer- sity, the Gorillas lost to the host team 65- 71. Above Ieft: On their way to a victory over Washburn University, the Pittsburg team listens to the coaches during half time. Left: The Pittsburg bench counted down to victory in Topeka against the Washburn Ichabods, picking up their first win of the season 72-52. Opposite page above left: Pat Adams lays up two points on a fast break against the chasing opponent Wayne State University at Nebraska. Right.'The team huddles dur- ing a Pittsburg time out and picks up the game winning strategy from the coach. Far right: Sher-ry Ventura displays the action of the Gorillas performance in a home con- test against Kearney State College, Pitts- burg was defeated 60-77. IAQ, Qs.. ,vw ...QQ 'Lg- EE SB FR The ability to throw a frisbee with the accuracy of a softball or hand ball is difficult. So we're taking frisbee out of the backyard. organize. It's hard to throw a frisbee good. And by starting the club we can relax, have a good time and compete in tournaments Successful season 'Wx mr -sit N. elf ' 1 T' mf , i' 'QR T ' yi lflif' .ff Y ,ffl J? 1 l . Above: Pittsburg State prepares for their first game in the KAIAW State Tournament in Lawrence, the Gorillas were eliminated by Emporia State. Opposite page, above left: Third baseman Barb Relliham and pitcher Mary Siebert congratulate each other after Pitt State defeated Missouri University 6-1 and powerhouse Southwest Missouri State 3-2. Above right: The Gorillas defeated Benedictine in a double header at Atchinson as Carrie Merrell raises her arms and Dena Dellasega smiles. Right: Dena Dellaaega slides past the Ravens catcher scoring for Pittsburg. The Gorillas took the doubleheader over Benedictine 9-7 and 11-7. 237 Q E' iiifitifSriiwgifi'leiifiiflfisgiglgfi-s fl f r iw ,-iegi9ef isllsvfg' .EA iii: +??'?5iififS?5fif!i5iziiiiiiifii, l ' 'fi elm' .ribs f?fs., Q,1H-T55 iflffiaia' 7'f?i'4 'iF1a2J' I .- . 3 'X .M , 'rf w may .W Gorillas defend second CSIC title as -mi, 1 , . if ' E7-12 . 0 -rl-Q,-1' -' viof: . ,Mx AQ,,?,::m L S15 '59 Q' .' ff. 5 f 9 313 Far above: Mary Siebert hurled the 8-4 loss for Pitt State against Empo- ria, which eliminated the Gorillas from the KAIW State Tournament in Lawrence. Above left: Washburn's shortstop covered second to tag Pitts- burg's catcher Pat Adams on a successful steal. Above righ t: The umpires prepare for the Pittsburg, Emporia confrontation in the KAIAW State Tournament. Opposite page, above.' Right fielder Sherry Ventura slug bunted successfully against the University of Missouri. Bottom: Short- stop Joyce Thomas slides by the Missouri Southern catcher to score for Pittsburg. It was the most successful season for the Pittsburg State University women's softball team, finishing with 25 wins and seven losses. It's really been a great season, some- thing we can be proud of. The team really did a super job, coach Connie Archer said. One of the most satisfying and impres- sive victories for the Gorillas was a dou- bleheader confrontation against the University of Missouri and nationally ranked Southwest Missouri State. Pitt State avenged a 13-0 loss in the season's opener to SMS, 3-2, and walked by the University of Missouri 6-1. The weakest spot for Pittsburg was in tournament action. I really don't know exactly why we didn't play well in the tournaments. It's difficult to play well in a one or two day situation, Coach Connie Archer said. Tournaments always turn up some- thing unexpected and we didn't come out as well as we wanted to, Archer commented. In the KAIAW State tournament at Lawrence the Gorillas gave a strong showing in their first game against Fort Hays State University, handing the Ti- gers a 10-1 loss. But the thrust of Pitt State yielded with losses to Benedictine and Emporia, eliminating the Gorillas from the competition. However, the Gorillas were successful in defending their Central States Inter- collegiate Conference title for the sec- ond consecutive year with an impres- sive 10-2 record. We will be losing four seniors, which will take away some of the experience and leadership. But we have some re- cruits lined up and seven of our starters will return, Archer said. Our performance was consistent throughout the season, which our re- cord indicates. We've gotten better ev- ery year and next season looks promis- ing, she said. 5 . .,,L ,lx , ,, f- vt 1, .X V 1 mf. fi. J' 'w' A ,W . . .- , . W .W , , ..a.,... M. ,ww - ,A . 1' s I 1 -. 1 . , 1 1 5 ,- ' .A.4,',A,s. 1-KL. lt was a season we could be proud of VY..-M , 575 k ,o,. LLL mv 5giaf '14 KRQQWWQ I -u xg NK X xx Xtxtxikib X1 NZ- s Y 1 No sm ' 1 1 ' ' A P1126 bg kfrwawwgyx .H a 4, A, L k,,. 4 L, . ,, I , , . .F Lay K ,Q ,41-,,.,.,, 1: e , . gn, HF' A . A A- SW .- T, A -1, ' Q .... ff I '- ,f 'iw , 1 , fvwn.: ' 1 4' -Y ,H 1 , -- ' ,A A ,, we W A Above left: Adams congratulates Siebert after defeating the Ravens. Above right: Cathy Crowell concentrates on the Gorrillas situation at the KAIAW State Tournament in the Benedictine game. The Ravens won 5-3. Above: Fort Hays managed to slide by Pitt State to score, but the Gorrillas picked up the doubleheader at home defeating the Tigers. Globetrotters Entertain Pittsburg For fifty-one years the Harlem Globetrotters have excited crowds with their pranks on the basketball court. Their combined demonstration of basketball and clowning brings images of delightful entertainment to anyone's mind upon the mentioning of the name, Globetrotter. 4? v:. 1 'Wf'4U , -My fi ns ur DY' un- Q fi gs ,Irv at 9-In There was no exception to this in Pittsburg. It was to the tune of Sweet Georgia Brown that an audience of about 2,300 had a ball with the astounding skill and technique of the Harlem Globetrotters at Weede Gymnasium. Magicians of basket- ball, the Globetrotters are mythical gods, legends in their own time. K Lf gl 'iv x4- u ' Q:-4 This coming season, promises to be a great one. The 1977-78 season was both, disappointing and reward- ing. The majority of the team was new to rugby. Not having a coach added to the burden, but the men still worked extra hard preparing themselves for the season. The result was that the team didn't win many games, but they formed a good solid base for future Pittsburg teams. By the end of the season the ruggers were competitive in every game, including very strong showings in the Empo- ria and Kansas State Tournaments. As every rugger on the 77-78 team knows, we were undefeated when it came to the second game. This coming season promises to be a great one as many of last year's team will be back. With the addition of some willing newcomers, this could be the best rugby team Pittsburg has had in a long time. Prospects look good for next year The highlight of the season was finish ing in third place in the Central States Bob Johnson said The Gorilla golfers participated ln six meets this season winning one The most striking performance was from Greg Harry in the Southwest Missouri Invitational and the CSIS meet at Wayne State Harry captured medalist honors with scores of 72 and 146 re spectively The golfers only first place showing was the opening meet in the Southwest- ern College Invitational with a team score of 317. The five man squad made an impressive showing in the NAIA District Ten placing fifth out of ten teams competing with a score of 651. In the Southwest Missouri Invitational the Gorillas snatched fourth place with a team score of 375. In other tournament action Pittsburg finished mnth in the Heart of America competition and 19th in the Crossroads of America meet. Prospects look good for next year. We will have four returning lettermen, and all of them have shown capabilities of scoring well in the tournaments, John- son said. Golfers swing into thirc H in Conference play Hr-'Hr-'rf Left to righ :C .ach Bob Johnson, Alan Sikes, G H K in Sperry and Bob Peterson. Not pictured is M Hitner. TENNIS The Pittsburg State men's tennis team finished the season with no wins and 10 losses in dual competition this year. Pitt State dropped its first two matches of the season, one to Northwest Missouri State and one to William Jewel. The Gorilla netters struggled to break into the victory column following five consecu- tive setbacks. Pittsburg suffered dual losses to Southwest Missouri State Uni- versity, John Brown University, Drury College, Emporia State and Missouri Southern State. In the Central States Intercollegiate Con- ference meet at Fort Hays, the team of Andy Denton and Gary Fry finished in fifth place in the number one doubles. Denton also placed sixth in number one singles. As a team, Pitt State netted last place. Although our record was poor, the season was a learning experience for me. And we'l1 come back stronger next year, Den- ton said. 5- Runners bring honors 1 Bringing honors to Pitt State, seniors Mark Rabuse and Bob McLeod proved themselves as national class distance run- ners in 1977 by finishing first in eight meets and placing second and third, re- spectively, at the National Association of Intercollegiate Athletics National Meet in Kenosha, Wis. Garry Henry of Pembroke, N.C., won the national five-mile meet in a nip-and-tuck race that came down to a final sprint be- tween him and the two Gorillas. All three runners broke the course record of 24.21 and finished half a minute ahead of the next placer. Henry's time was 24:11, Ra- buse was 24:13, and McLeod was 24:18. The Gorillas had the last laugh when they reached their goal of placing in the top ten teams. They placed 10th, and knocked Henry's team, Pembroke, out of the plac- ings and into 11th. - v ' w' f' .- -s. t ,Cir , Above: Mark Rabuse, Lenexa junior left. and Hob McLeod, Pittsburg senior, take a turn as they lead the runners at Emporia State University. Top right: Runners on your mark, set. go! Pitt State f'oach Dave Suenram fires the starting gun for the last home meet of the Gorillas. Far right: Bob Mt-l,eod catches his breath after winning his last cross-coun- try meet on home ground at Fountryside Golf Course. Right: Pitt State's runners lead the pack on the five mile course. Near right: Dan Ford. Kansas City freshman, is followed by Joel House. VVeir fresh- man. That race was McLeod's last for Pittsburg as he graduated in December with a total of five All- America awards. Rabuse totaled four All-America awards and returned for the 1978 track season. David Suenram, head cross country coach, praised their efforts. We have a tough schedule, Suenram said. We run against the best teams in the Mid- west, and possibly the entire country. Runners from the University of Kansas, the Univeristy of Oklaho- ma and the University of Missouri at Columbia are not to be taken lightly. McLeod and Rabuse not only beat those runners, they completely dominated almost every race they entered. Only two people beat them all season. One runner from M.U., Steve Fischer, outsprinted them in the second meet of the season, but I'm confident they could have beaten him later in the year. In the middle of the races when most runners were beginning to really hurt, those two would put on a ,. A 1' powerful surge that no one else could match. They made it look easy. It was very impressive seeing two Pittsburg uniforms way out ahead of the rest of the field, and those two coming down the final stretch talking to each other. What were they discussing? Undoubtedly, whose turn it was to win that week. Behind McLeod and Rabuse, the team was not as impressive. Injury problems and inexperience hurt the Gorillas, who often competed with four freshmen on the team. Dave Wise, Overland Park sophomore, was the only returnee from last year when he competed as the Gorilla's third man. Sickness and a knee injury kept him out for most of the season, but with only four weeks of workouts at the end of the schedule, he moved back up to the third position, placing 70th at the national meet, with over 400 runners competing. Dan Ford, Kansas City freshman, placed 73rd at the nationals and was Pitt State's third man most of the season. Close to him were Steve Nigh, Midwest City, Okla., freshman, and Bruce Reed, Bonner Springs junior. With this young team, the Gorillas lost their three year tradition of winning the conference, and four year tradition of winning District 10. But they still placed second in both of those meets to a powerful and much more experienced Fort Hays team. I-lays was one of the favorites for the national title but ended up in third place. Another Kansas team, Emporia State, placed 33rd. QW J A .1 W3 gf. ww , Jizz ,fans 9fl'f? fiHl Busy season in track Pitt State rounded out its competition in the National Association of Intercol- legiate Athletics CNAIAJ National In- door Track Meet with two fifth place finishes and sixth place finish. Although we didn't compete well in some key areas, I could have made some better choices of whom we ran where and when. I allowed myself to indulge in some wishful thinking and went on what might be instead of what my ob- servations told me was so, Coach Da- vid Suenram commented. In other meet competition Pitt State had a disappointing showing at the Em- poria Invitational, finishing in the 10- team competition with only three first and second place finishes. We just didn't look very good at all. We did have a few good performances, but in general, we didn't compete well, Suenram said. The KU Relays saw Pitt State place in all but one event it entered, including two first place titles. Winning individual honors were Ken Shade and Steve Smith. Shade won the 100-meters with a time of 10.81 seconds and Smith won the long jump with a leap of 23.95 feet. . Victory came easy for Pitt State against Southwest Missouri State. The Gorillas captured nine first place and 10 second places, but Suenram was not satisfied. I could just be glad we won, but there was nothing great about the meet. How- ever, we did have a few bright spots, he said. Senior All-American Mark Rabuse set a new school record in placing second in the invitational 3-kilometer steeple chase at the Drake Relays. Running a time of 8:44.3, Rabuse cut seven seconds off his own school record set at the NAIA National Outdoor Track Meet last year. I was proud of Rabuse, said Suenram. They went out in record pace and Ra- buse went right with them. His form was never better over the barriers and water-jump and he finished strong. With a talented group of underclass- men and a sprinkling of experienced veterans, the Pitt State track squad fin- ished second in the Central States In- tercollegiate Conference. This year's The Gorillas iavill lose only three ath- squad was one of the best groups of ath- letes to graduation, so there will be a letes at Pitt State that we've had in a solid nucleus returning for next season. long time, Suenram said. , 1 Qin- 113' Ms., ' wildern- . rams wi? 842. ' llll' L- .lu Volleyball Pitt State 2 Southwest Baptist College 1 1 Ottawa University 2 3 John Brown University 1 2 Mid America Nazerene 0 0 Missouri Southern State 2 1 Wayne State 2 1 Washburn University 2 4 Kansas Newman 1 2 Fort Hays University 1 0 Missouri Western College 2 2 Wayne State 1 Evangel College Emporia State Kansas University Fort Hays University Missouri Southern State Kearney State John Brown University Emporia State Washburn University Kearney State Missouri Western Cross Country Wichita State Invitational Emporia State Emporia State Invitational Southwest Mo. State Southwest Mo. State Invitational Pittsburg State Invitational CSIC meet NAIA District 10 meet NAIA Nationals meet Men's Basketball Pitt State 61 Midwestern University 56 Benedictine 55 52 Drury College 82 Central Mo. State University 85 54 Howard Payne University 94 53 University of Missouri 84 84 78 56 Mo. Southern State College 67 70 Baker University 69 70 Kansas Newman College 83 67 Southwest Mo. State University 74 Drury College 64 Mo. Southern State College 49 Mo. Western State College Wayne State College Central Mo. State University Emporia State Washburn 81 97 79 59 Kearney State College Q Fort Hays Benedictine Washburn Emporia State Mo. Western State College Wayne State College Kearney State College Fort Hays Kansas Newman College I Gof Southwestern College Invitational Heart of America Crossroads of Amerlca Southwest Missouri Invitational CSIC NAIA Dlstrlct Ten Pitt State first ninth nineteenth fourth third fifth 2 1 sa 76 5 73 2 2 59 ' 62 0 2 55 75 0 2 68 75 f 5 86 ss 1 2 72 71 0 2 59 64 64 69 0 2 64 73 76 87 61 102 as ios 63 66 IIIIIIII IIIIIIIIII Women s Basketball Pltt State Marymount College Unlverslty of Arkansas John Brown Mo Southern State College Kearney State College Fort Hays Mo Western State College Wayne State College Empoma State Washburn Kearney State College Fort Hays John Brown Washburn Emporia State Evangel College Mo Western State College Wayne State College Mo Southern State College Track and Freld Southwest Mxssoun State College Kansas Wesleyan Umverslty of Mxssourx Wlchlta Unlverslty Oklahoma Baptlst Oklahoma Inv1tat1onal Empona State Southwestern State College NAIA Natlonal Indoor All Comers Meet Southwest Mnssoun State Umverslty Empona State Arkansas Relays Empona Invltatlonal Emporla Relays Kansas Relays All Comers Meet Drake Relays Southwest MISSOUTI State Umverslty Relays CSIC Champxonshlps NAIA Natlonal Outdoor Softball Pltt State Southwest Mlssoun State 13 Wayne State 8 MISSOUU Southern State 0 0 2 Washburn Unwerszty 6 Fort Hays Universlty Cottey College 6 Emporla State 10 9 11 Benedxctlne College Marymount College 5 5 Wichita State Mrssourx Western State 8 18 Southwest Baptlst Sr 12 12 Mlssoun Southern 6 Kansas Weslyan 3 MISSOUII Unwerslty 6 7 Southwest Mlssourr State Southwest Baptlst College KAIAW State Tournament fourth Central States Intercolleglate Conference Football 5,8 Men s Teams Northwest Me State Unxverslty Walllam Jewell College Mnssoum Southern State College Southwest Mo State Umversxty John Brown Drury Collge Drury College Tn Match Missouri Southern vs Prtt State Emporia State vs Mo Southern Emporia State vs Pitt State Emporra State John Brown CSIC Tournament Women s Tennls Pltt State Northwest MISSOUII State Unlverslty Southwest MISSOUII State Umversxty Umversxty of MISSOUYI Kearney State Colliw MISSOUII Western tg College Fort Hays University Wayne State College Washburn Emporla State MISSOUTI Southern Shia College Pltt State Marymount Benedlctlne Baker Umverslty Emporra State Fort Hays KAIAW tournament CSIC Benedxctme Washburn won match won match won match lost match lost match first thlrd won match won match S g 56 . . 67 65 I . S S 72 S K 49 . S96 0 ' ' S ' gg S 15 ygggygs S S S 1 n g gj S g . SS 84 11, ' aggg tgitgg V S S V , g 1 g . ellll S ' est SS 4, 5' SS . A 0,0 S ' 2 59 SQ S S ' ' K S ,stle 's-t . 52 3 SS Sst' elli S ll 11 2 I . O S . S S A SS ,155 77 22' gsgS 4 SS SS S 1. S jg ySSSS SSsg jQ,SSffSgSSj f . L-'VV'LLLkl A 5 A ' Clif? ' A 7 'KLKSL A -1 A A A ' if 'ry' er: A A I Si K , kigkgfg kk:S . KS' , VKS KS K 1 SV K' k-S-gk QSSS , 5.1 Mk S-GL v SS SS 59 . . SS 1 ,I ,f SS S . S S S S S tSslS S71 ' 2 A S e'Sg S S 4 1 2 SSSASSS 159 S , ' ' Ss on ' 0,2 S g ' 2gSS'i2F csSt ttttttt 1' S S , , . . I 14 ' ' ' 27 - - . . . i. 7 . . gg VSSI . g i ' . . LV ,V A ,gg xA,, S I 3 Vi kf1'V :kfl-f if .f S A 14 ' ' Sctt S llt ' ' ' S 29 sss - 29 rsee-Ss so S ' ' S 7 28 S ' Q ' 21 gg, 25 S S ' ' I . 19 ' ' SS1S S Ura S Intram 9 U QU 1 Q i 4, ak' , . . 3 vf 'nu f 0 I 'N fy, if J, .,,, The intramural program for the school year was a big success. There were 3,845 persons signed up for the 34 different activities. This participation indicates the interest of the student body in intramurals. The program includes men's, women's and coed activities. Any student who wishes to get involved can find something of interest. A .,i:, .. ,... wk ,, ,,..nM.d 1- ' More than 3800 students participate 258 lc--xrxjfv ' L' r.' , N . .,,,- A ,situ new at 9 t.f- M., if tgp-. y '-, .Q74w'..'. of s 75. , 1, ji it +2 s ' ' -Rf p ,t W. '.lwj,'fifu3p,,, e to e e-my ggi? g. -. HgRf1As Hx,7':3xLv,-1, X ,,, 1-.. rl.- N?-E ink.. Kwai?-,3 -if 'eff -,ff4f.'.1',i?,'v Sw P L ., altx 5-4? H'iI'2?s-1.-V . ' 05,5 . w.. +1 Rf' . Lg: - f tr' Q, V ,ggi - U 335: V V-, 19, my Q-5:w,-ybfxx, f Terr - 7, -X 'nfl' V Q .eqvfggfw if --5 if 1, L ,Films 1' p ,. 3 gfgmg f?35i,2igtgwai,gv'gg, 'fin e f gm i 4 . Li sf 1 , .' M -Jfdffrizqix sizwlifi-a 0.1. filth ri,-.vf.+.,.e-Rs..fS Wffvfxx f -,y -z- wax ' .. I f -an ffwebxv ,K -in A, ' 'it f -vig 1 Y 3 if -Q, 4 , we i . , J 5, ,. ei Q ,'4 we l M I ' H -3' 'tif -4 Q R 'b' A '.Q,,ps2lf 'fi ' w 4, M Afl- wb rl I 4.2 is '.: 165' .V WN , Va, s t 1 S e ,QS ' -J Q . + ' IR ' 'K 'M' .wrath - 'fi X. ,Q 401' ,gtk ,gwi .tj ,-. kvn7qi'5.u - 43,21 - Q' ,H W I ,V X .-I A Ab ,init I at 44. ff wr Env v Qsxvv . Af 4- v TIQ, 'V fl in 54720-J ' 'Q '53 ., , , R . -, 2 W 1 'N 'S W 1 .J c. , , A m R. ,f C. ,. 'S ,QV N' . ' V A vw' 0 ' -' ' 'ff3.1lf:Mif 'fb' - f ,X - . . .',-Q. W-,fQ5.P,, ,Pg X' cn ixtyq, .. 4-.4 .F -wt yylblbg 1' X .,+-14 5 Atv. A TWA v . -,,, f 'ff S. H I - ff, l . 1- -, 4 .4-34, Z. i f ' f . ' f e, 'T f' ii v ' W - i A .M ft ff' ' tx , I ,viifw--if t V -. ' we - .- , .1 . X'-1-W Y! ' ' 'K' i -1 f .- W if ' x 'Z i i se m- ' t f .eww wlqlgi' if- ,g.-ggi-f'5.iQ , ' .f,'f ' , :wax ,'Wa:,3r'3 1239 A? WM, f-'7' if . - f'5T?x'2Q'g,hi ' .-64.4-ax ' 4 ,lif t 'L ' :ft -' in . 3 1 gf- .' 5' ,W .. ,t f QF Q i'3e4:z.tefew,wfy2,eex 4 A lg , VA . ,. ' I I xx . 'L' , ,Zi In H. V Q V 4. , gy ,EV e f. x't, wcffw, fsffw-sQ:v't 1 isiiifu it tif' at in 34 different activities. Intramurals enable men and women to compete in sports without the demands of school athletics. W - P1 1- - .. ... . ,:..sLae'3:- - , M f - - Y 51:1 ef- '- s a 4 ' Y .--mf ww! . it 'ie v A S ui ,.....-i M... Wi' .--:M H vdpf- .Q .. if 4 Qgiwwv F fx ', 4 . -.l....,.. ,. . Q' . L,, x, ' ..-r. ' Q , .f ,qv .S 3 2 ,, -A A - . - , .' 1 af .- ' - H A ltawiwn-, gg, Q - -W -:Auf . -, .r'VA'fs .. .L -fzwnl. . 4 QS ' 419. ,'u'i..13 ,- But there is still great dedication . . . A I f 22 0 c l3f is an , 4.2 and competition is keen ,- .,sc1,n-.. -- r .4 NNW - V -.1 ,.,- fu L -. - ,, 'w,, SX' '- 'v', 1 aZ??,?22?'h fv 1 A 1 '- f , 52-25-gk 1. ' , M . JI ,-.4.ff:----11,1 wifi-' rw-,s fVf'f'ff 2-9' -ff? gf?-92'--545fie-ga-if-1 ' K ' V, W, l': V ' - f :Af ' 6 1' .' Vi mf' 1 4'-ew ' hx-5, I if . '.J . tjfrfzlf f' - !,f ,.. ' --AYJ F r 5 .. I tl. , , ff! . ,Q - , 'Q--229511. v ffiyglgif ' . ' -'ffifffmw M: 'ff2'-Q2-2f5g6YfH A Gif ,, ,mf 5- U. . 3. -..l ., f - 'L N , f' ' Q w 2 . ,sv I . 5, fig ' ., A 1. '2.t,.:ffib . ' - gf-. lf- 'iq ' 1 . ' -- - V -A :H 7f,g'.ll,:., :Iwi ,d-,,,i,.:x 4 - 164 ri W,-.-.ig ' -af - w az- --eff 'il-ai 1 :Q - '- 1 .. -i7:'7f-, 'if' ' 2. ,43 - ' pi-3 ,u -1.-5,34 '-- V- ,,1Ai'?Jmf!f 1.1-'--I Q, - 3-.5,f?'.t15 A :hqfz Q-.L 5 , -I I -,-- .J i.:,,,4,---rl -ii if-119. - M f I li Th, K . 4. y..,,.,., ,. X' -pxf fi.. -132,1 x yggfvu' rzawzzstkfivtg i ai. V x-gh, Mq .l V' V U 6, . Z l , 1 in-4: . 1, -- '?,1,- jx? 5- - , . QW 5 . 7 , 5 V' Vigiiff 439--yi I-Jug Gp? 751 I' 1 I - I H ' 1 .,-iff -w g.. 46- '-4 .fgs-fm - ,fm -rg f wf , '-' , , .1 . 'xr , , 1 ,, a . ' JR? .f-tgfgv 1 -fi! -f.g.f M : - 45 as H' ff' 37 . ' ' ' ff -. - -, ., 9 'VM - 1 .X Mfq5+'f ' -Z9 fn Nw-- u K. xr Q7 ' gi W I ' k 1 f.f:'..' 2 :FJ t 'xr ' . .a . . Lf, -.cl -L13?'5'f ' -,:'N'- X! ' 1, , 1. 5, 1 -71 M -I 4 I vihS??,,Pf.v . . V' VX J , ' Q . I Qi..-'-L. ' ' I-U EP 11-L,,. Q 'QP . 4' 'F l 5 - 2, 175 -ga, f . 2, 23 I.-.WMM s! M,,, -f 7 . If g I ox sw-.1-t.f '?f'4v-Sw ' - , . f f f' We 'I -,.. :f 'I ' ' ' film Hg :I :w il l 5 fig-Us 6 -g jg .5 ,2 iffy? -i5,sl5::,:45'.' ,. Q3 5, 5- 5. gp ggi, -L 3- pq I 3 fi? 1, 5' L' j,!,f5g+p Y 3, 5 k' l flf L. J- IS., mf 5 ,V , 'I I 9 9 X! 5 , 5' fx 21-5761 Y- I , 4. 5 1 zz-ffm? 1- 55 'Eg - --. 4- 1 . - , -f ffl-uf - ' jf! In 1 Q' ,I Ir gl: 'S x if ' 5 I. H ' .1 'ff +V ,-5?-' f 1 ff' 4 -- - --h ff ' 1 - ff'- , ,r,...,,, AJ, ll-5 , , f Q - , -A -2' 2 '-2-2 sf? Zlff H-f ,M--4 A ' '- f!1 vjbfig v i 5 5? '57-f 5 . f l'47'iff'-f 2 1 g Q2 - w- -H .' - 1 ' . -f 1 , , . 1- - , jf! f-,I 5 9' '?l .I Q fr xr f 1- fda: ,r f 1 f my v J'.'A'Jt J ' ' gl 6 3 5 1 f J, Q L- El. H 2 f ' gf L if-,I U .sdffuq - 2 Z f ff, 152, 2 1 - --iv , ' .w -2, J H ,,'- 3 -i,.,,,, Si ' E 2, it ', .l 1f ' 42, 1, dj ZJM I .4 .args , E .f 1 .L ' -N4 5, 9 p . Wfzfffyiri- a 1, 2 - 1 'Sw ' ' ' YY- NWS. 5 ?y' ag agi- ' ' i'-' I-, -1 r ,' : 3,651-tl 3 -' 'i 35- ' f bffizflilff 'x 'F' 5,5 iffy gg, y 5,1 ggw . 1 'f' ' , 43' 'iff Y ' 4: -' J if f ' , - H 41 H 4' .5 Q4 .Q--, jj ., : I-je l ., -Q - - 1 pt ,.-7 2 - fi ff -. -f . F - 5-4 gi rf f' .5 - '1-1. ' fi. L9 vw 2: -- 'fl ze - ,-1 4 f 3,12 -Lf. .till aw' .1 S I . , 5634 if 5 13 fwtfxggfg- fart F' -if-Q f f 'ff' 1 2 -ff--. , 1 12-2 ,' , QF.ff,,.f,fg,572,f4--,fgg?33f- ,,- ,gQ.-fy., .if , 4 15,5- , ' -1 1','g.'i,,'-C46jh 6 - ,rf 1-.e?.f' . ' ,I 'j 515, A'-.,QfgQMj ?l', 'f.':15,'ryjfff , , ,q.l.-154' '.1,5,,5,'9 1 A 4355 gi .fr 9111? 11'-f'Qf -, 5451-91, . F . f ,M i':.,.?l'.-.7-,:p'.-gy'-f, b -1 -5-. :F ,itg,:y-,415 ,U -Jr. n.,l4f Y 1 Elia!-V.-:.,:S.-4 fp, 6: 'tl' ':. ': :if '-7-Qui QM. r?2!5G':-'5 x v g,-I ' ff. i 'Eff ,o. I 'IQ-ii, girl, - ,,-m..'i-55m 'Iggy . Q.-2 f, -- ' . , J' . ' f ,wrfiffif 3 ..'f?f:-?-S? 'I' E 5123, 1 1 Q. ku Za ,eff ,f'1,jQA.Q' i 1, , 'n, I - ji f , diy. .I 'Y , rf:-of -:qv u R? Lrg! 'V1I7'nj,.,q t h - 1 E in ffgitfy- - - 11 sway: izf' F' , ?2 , -rj 5?-.,jj:.QAiw:zm.mv.-pg! !'3g,'ff' . ,-,jfs-9-1-. 5 .. . 193'-A -I V. f 1' 1-A.'vfr-r7.v-ervlrf-V,pg 1 by-?i,':4lY .21 ' J ,J A 2 , A -2 I l r hpil -, 7 2 If ' ' I ' fi uf' fi 5' . ' I ' Lzf '.'Jfrl4-Bi: .i' 9571 fm .p.. ' Y ,- 1' rf- . 5113- f' .- ij 'Q L ' f f I ,-H , Q11 1 'f Sift. n . ' .A r,:' 3 '-. i1iQfvgg:!. '-Q53 rf 1. ' ' ' ,ff -fi-viii? f re : - ik MJ , fJ4fif??f!25f-1.6 ff- F 2 ' '- Mr-, iff 1-'1,iw'1f.'1Q,g gig-.1 :.,'fg.w'Q ggi, Sri- -35 ry . , -- .-',-'L!.'.g,.',i' 3-el ' rj! -- ' V' - 741- - ,- bw-.Mf R . r V , if :lg-Ajhvzv 'V :nn vigil!! .MIX f i S I . L.-. .'2'i,-5 I U . .. U J ,. I ZIP, ' 'ev :Nx W:u,.-Zl2'J2A3w??f'7.'A'f'A 5 Y ' lg' ' I L., ' ' hy . '-. V JV 4- I rc 'L 5 ,N M . q E ,. . ,. he , A I9 od -- A 4 , .VJ ,V .fr , . Vq' 7i7 f', 'A fl 4 if :ff 1, .,7 i :wif i .fi I lYi 'f'1fr ... ,. Q 471, '?' - f zf f . 'f gfa. 1.1, 13334: ,twig ,M . I: ,:aE.:' I.. MAP,-,.?gQ' i H a. , 4 45.,',3j'42i4ff,-7, ,,-,lf ' ff, ,945 3.134 ',-A Q f-til-. 452111 V ' ' ,H 3 1535: , , K, ,i?'1 a'C42i. 1 4 'fxifis ' - , .VI ,!lLi,B,:x7i:li'g.I:v- ra ., A W 1 iP'57'-f:Y'- 4111 ' ff. 4 ,V+ -w V. - -K 17 '41' ff ' x5P. '- .2 21- -'Q ' , ff' 1 f 1f l.' Q 1,!ff.L 2,-L74 '. 'z 39231 , V- -,rf-' V '-4 V 4 4:17- .ig 1231 ' ' ,. ' 42 P,-.' '.f,, 'A V ifyllffzf Qffqif ' F I f, 'L ..4 .if 45' , eg-4:2 1 ft ' 'ffl ' Il my. . I : ,FFT A if '-if xifvl I ri f ' ' AJ I. -' -, 72' 12.5 Jai yy- ' 'lui gif: F I - mga, I ,gl ,Wg-,f iM?4,, . ,V 1, Away qf.5t:J.p13i:l7,,,,r ,,,f'f I, V , A 51- , ,Jig-H V 4 f-Q'bf 'A-'QE ,pav 4,-1 '.W ' i i. p,3,,gfQ - , - , ,' 'S,, QQ! .fl-I ., I - ' - G 44,1 '.. v ,V Q, 3,2 . V 1 ,L-I 4 1, ga. qw A H, N1 . .. , ..,,4. -' - ' ,rm fb . V v f '1f' -' 'I' S if 'f ..fC'.. . - ' ' ' 7 , ' 'ff 'T ' . . . .V 'vZrV J7'Lf'f'YL?ff ... V 4n1' '.f'f:f-,f.'1-.f-. ,Q .I ul L'-I., ,, Q fb ., 2 J F-,-'gwfzl-V4!:,!??:f-Ing?b, ,fx yi ' I, v 1-Q.-5 -Z' 'I 5 . grae' I ij, -,jiFfyHf6fv, gE3y,.5i4 pi Mfj. ..-1,9 uf' Q, .- : 5..'f:,q. V ww 1.35,-, A. .L,-:fl,:.,r'.'x .N 'z-Q' 1 09222581 . ff .. --ff1,,,i'f1 . ,J il lygwyi V1 fig... 4 .,S1,'.,,Zjs36V5.gQ:f A,, , .25 3 1 51, . . W5?ql5,Vf 1532 14255 555 4 1-V, L - ' I -.faxggfgg ' 'swgjj--Vfff ,- fwrf- :. ' . , . . . ,V ,, ' '- fig'-Sizr,-'.l5 J, , -v l.-Vw ' V-.f','d'y f44fff-f. -V - ,. . V -- -' 472' tygf5'k'I. ,V J 5' Q ' ,diy . -xzvfi' Q ' -, 1 V. 5.4, 1 . , 5 - - 1 .4 yi -I , , -' hi: 'Inav' ,A ,f ,ff-f..!,...,,, , V A Q .?hiJ.51?!fvk 'il 4 --'-f:,,, fzf ,' ,f - 1612 ,Arif ,. 'I nw. 3 1 'jf' QM. '1 , A 'f iff' f f P .. .V nm f- 'w V'- 'l' '- 5 ' figfifff '51 V- . 1 f , ff Sf '..a.L', u I. 7 1, '11 via, -711 ' -,L L? ,x 'i ' I -.'f9qZt f1 ' 'W-,X Q -242, vf fff'-Z2 3' ' Z Jr '5 Y 5'-ri' ,. . K .- '- ff 165 1 ' V -V 2 , zztsu- f-9 1:15. 5 . 's V f. f 2 5' '7? P7'f.iQvkffaQ'f?'Fs-f.- I ' 2 X -. V ,I , ,pin if-4 , T- .-1 XV 221'-I h 5 Ls f '. AT-A 573 91 ' , if f 'A f-' -5. :gg ,Aa , -,ff V 67 .. .- - , 0 K A. QQ? fail' . . G 1',45-11,1 ' ,iff iulafr 4' ' -Ilgh lr .vw .,-,omv'n-v.,,,,5eL, A, 51.5,-ggi 'ivy 'ugyz , IKAU ?Za Q,,k'Q' ,4 1 ,. Iff:ai',g,5l! -. 41. 'ht -- sv in fu-Vf . 'f---f-- -'eu- ...rw .g 2. , ' - - g 1.1, re - -.q5,V,,.....,gf .gasp ri' ,QB V pq 3- 'FQ 7t?5 IV C,1- . -V w- Q ' - .. ' . .1 5- V -, ,', ,A m ' K A V- n, .U--.f i r l r' , Zi. I :JL rg:-Z ,. , lAJil'. l:ff1A:,z.l5 E I M, 5 , E au h 'P x V: v' 1' f 'Q A 'UV' , '-pdmy ff : -'WN 79' ,JU :yr 1 gV. If , ,, ff .. b -,i , guy ' ..--ld:-x ' 9,:,2f:V ':'+g,.'- qgyzefg' -'Qu' ,gr 'fl - ,ff 1--in 4, 4 7z?V:f'36 13,'g.Vg1-5.4745 V . . V 5- ' ' nw-19 . I3 14 ' ,V . J Q 'm'JA?i2l . 7 H- ig, :Q , .-.. .- '- HI f'.T77l' ' ' ' . ' . 1 1 , WI ! '2 Aw, !45'l?t ,pg-71119 3,11 , . 141, f 15:11 'A 151 E5- A -4, 5x - 1, f V 9 V: V.. r . -s 14, Vg, we r J V ve,-, .. 1 . ff, ' VW- 52 i w A UW if 'V . I L-' A' f.'?i,7?t 42 - --'V? ? 'i, 'JG ' 4 . N 39.-':. ,yax 45'.r?,,ff'L'1fi 'L 'vm' ' ' f. LV We 1 7 1245. 3 H ' ' :-fy, . 1,-g62ggjy , pg.-r. s ,Z jf if 1.1 . - - 1 Af' 195.5 Y ,-ff A -'Q . 3'!f,,, Ai 1:1 i' I x ' '. Q, Q. ' - b, 1.1- f' Va ' Gif 5' if 4' +11 1 -f - J 1, '4 f . 97' ffit? af 2. 123 ? , Vi PV 1.-.-f ' fafff' f -2 f - V ' I ' ll H.. 414' V I V , . f - f - r Vf ge q wi' ,r , - -' ' jf ' '-Iii r' ff, -I 5 J - 4 -' ' 'I , . I' 1,4 fig ' - A -' f ,f .' ,-V , .. 1 .- .e 1 gy , Q... :W rp. .VM I I 14:1 , rn : ,-1 i - 1... 'lf' V. V,.- I ,,.zN., , ,K Y ,. PWM- l - ff' , yi ,JV '-1 4. V , -fx. , -1. f-Q 1?-,QQ-fi.. - 0... lg .4 - ,, , f .-1,.,rl1- V 4,1 ip, Y 1 zfgf ill, ,I 1-,g:4,,:g','J.l!Q I -:rr t, JV. - .. ... 1 3 'e?'!'-f.. V' Qff4e,ff V125 ,ff 5 . U75 1 1 rf f ' 'Cf x ' -' ani! 1,1 4 i?, af:i G F: :Q I .5 91.15 . If -ww ,Vff f ..fg':- ' f:- ,- 'Mf ,-4711+152 22 9, i 'V?if'15 V . if ,Vi . 31 . ,M ' ' A I 5. ,F :V . I-1. Q..- ' ' 2:25,-ff fefflfie .4 .gfffgf P ' if f .Q 155.62 'J A -g?',,Qpl V.. If . .fff ga- ff? r ' 7A-- 'KN . V 4 ..'r ' ,wmv -' .-,145 ,jf .. ai 'ff 1 -'ir 1 f -fu-i.1V ,. .. -1, f. V' I- ,gg gf-- ff Iliff W, 41111. L 4,'!Q'J.', 14 ',,.. .f .' 9.-rn-Vfr 'VV L1-'-'Z' IQ if ff- ' fx I ., ,- N aff -ff V. V4 M .V , Ji' ffK .!i ' 1 7-ff! '-If. 1. .'-, 52 .1 ,. .ff 4 V f, fx . ':' X-fluff '12'.gI,E,1.'!l' 2, 1 l 111 , lzgklfm, 1 , 'Af -I - gf rn' 17. Qin if f. 1.ruV4?i.,7f :. A,-i. I 1, rn, ff, V L . .1,. - - M -231,--.5 ,npi - f 14 ,- :nap l, .. ,f! ,' 5 ,2 , . . -A, N. A ' ' ' 1 452' f . v jf? 1 K lf uf 12' Grad Students '-2 1? E i i A' pf, . 5 w ,ss 'WNV ' , QP as-Y at 4 14' ' 9 gf as i ,X F up fa., 1. Q 1 M if .1 ta' W 5 KW fix X we- E 151' if 5' , 4 fl 1 1 t , . ri Ik f 7 A ,,,, ' .ni ' V . 'R I7 ,'z, ,sf . x - 1 ' .VV, r frffi its ..f'q X ,5,,, , si , ,,,,,, I al, Q,,,,: . ,K 5 1, , If 2 . is Thomas Anderson, Kansas City Mancon Aroonpairoj, Parknampho Thailan Frank Bartonelr, Olmitz Fasuluku Amudu Bayoh, Gainsville, FA Bert Besthorn, Claflin Arthur Braden, Pittsburg James Breitenbucher, Keokuk, IA Shu Cheng Tina Chan, Taipei Tawan, ROC Shu-Yuan Chien, Taoyuan Tiawan Evelyn Ekhofh Oswego Jaw-Hae Fang, Taipei Taiwan Robert Gatton, Shawnee Geoffry Griffth, Galena Phillip Harlrins, Emporia Georgia Marney, Commerce, OK Roger Mc Wherter, Coffeyville Edwin Randels, Independence Kitirut Ratanayanont, Pittsburg Darrell Sharick, Springfield, MO Mohammad Soleimani, Tehren, Iran Mahmood Tabrizi, Pittsburg Camilla Upchurch, Indianapolis, IN Carl Walker, Frontenac Kenda Wiley, Lamar, MO Karen Williams, Fort Scott Seniors 'Qi 35x2Jf1iKa or Q 3 rg J . V W 5 Qrg ..:,,? I ,6 I N, 4,1 Q' ,V 4 ,1 ' a n A fs.,- xl Tj! -'v - X fx WI, K 1, 'Y 111. rr K VJ gifs ew if J A I W P I 'hi' llla of as L , ,555 ' L ' fwfr--I 'iv' 'Y' 'tram I1 iii' asf A Erie il x- 1 S - 1520 2, , 'I' fx J , r 3 f JL fri. 4 . , I ,N 2 f gy- . fv- av? 'Q il- ' Nw .au v w Uh aft Jackie Abel, Eudora Perry Adkins, Fall River Barbara Sue Allison, Overland Park Larry Ammerman, Shawnee Cynthia Anderson, Prairie Village Landia Antonetti, Fort Scott Lisa Atwater, Osawatomie Linda Baeton, Humboldt Lloyd Bailey, Lane Regina Bailey, Fort Scott Gregory Baker, Moran Patrick Bandy, Kansas City Fred Barnes, Aurora, MO Janell Barnow, Chanute Martha Beard, Fort Scott Jayne Beebe, Stanley Robert Benignus, Salina Belinda Binford, Uniontown Vickie Bledsoe, Cheney Jeanine Blessant, Pittsburg Mark Bodwell, Canoga Park, CA Patricia Brauer, Pittsburg Deborah Bright, Chanute Douglas Brillhart, Fort Scott Ruth Britain, Independence Gary Brockus, Ottawa Victor Brown, Kansas City Patty Broyles, Baxter Springs Ruth Lee Burk, Parker Christi Burris, Eldorado Springs, MO Marcella Butel, Paola Joyce Butler, Pittsburg Pride of the Plains The PSU Pride of the Plains March- ing Band, shown here in the annual Homecoming Parade, provides enter- tainment at all home football games. The spirit provided by the band is a vital part of the excitement of each game. 5 The band consists of students from ev- ery school within the university and is open to anyone who has performed in high school bands. Throughout the year, the band, under the direction of Dr. Gary Corcoran, as- sistant professor of music, performs concerts on campus as well as in Kansas high schools. Each spring semester, a well-known guest soloist is featured with the concert band. This year's solo- ist was Donald Sinta, Assistant Profes- sor of Saxaphone at the University of Michigan. Sjmr Qifff - i n - Allen Butts Sterling Pete Cagle Leawood Karen Call Cedar Vale ' Mark Call Pittsburg ,--..f Kenda Callow Fort Scott KQMP' T7 Elaine Comac Bronson Jill Carney Fort Scott Joyce Cauthon Cherokee Philip Cedeno Pittsbur Eugene Chadwick Anthony new v, 5 uf- fw?.vi f ' ' i , David Chaussard, Arma K X , X ' ' 'i A Linda Cliesnutt, Baxter Springs + in e e ' S 1 K6lViH Childers Kansas cn Mo ,gf . A fm I 1 yy .Y y p c Dana Chubb, Pittsburg , 45...- fe, 1 Judith Clark, Pittsburg 3 i K Q nkik , ,,, li 41 b V .- 1 f in lf A G y X .. we L ' . J K -1 . 3, 1- XV -e.,,..s- A EV . . J 46 ji 1 , . f kik' .. f WY f QW -xr. The Bewlldere Q ar I gaze across thlediam Vai 1- e lake and long tefdelve Beneath its shiny surface that harbors no fugitives nor holds no surprises for my faltermg and my imperfect eyes An overwhelming desire for something more runs through my brain like a bewildered bear gone beserk runmng into things knocking people gently to the ground leaving a path of destruction while trying to right the wrongs of time s misfortune arf? T225 VE . i L .. i 1 va K . ,Jas-Mt K Ks. uv- X V ,Arun ttf? .5--- ' . V K s J Q ss eef - 1 ,Q i-: YQ1- ks. .,, D .irg S Mg, ,fix A1 f ' s is a S QQ , -s. . i .Zf. ig, A 't lel . Cindy Coffman, Pittsburg Jayne Collins, Merriam Lucy Collyar, Arkansas City Judy Cooper, Chanute Kenneth Cooper, Cedar Vale Jack Copeland Leistown, MT Susan Copen,Grove, OK Patricia Costello, Frontenac Judith Crager, ST. Paul Robert Crigler, Des Moines, IA Barbara Crossland, Fort Scott Patricia Cummings, Burlington Laura Cunningham, Hutchinson Linda Cussirnario, Pittsburg Darrell Darr, Fort Scott Glenn Davie, Roll Meadows, IL Linda Dawson, Parsons Douglass DeLaney, Fort Scott Dena Dellasega, Pittsburg Roger Dent, Miami, OK 5 asf were K7 'WJ 5 W f ,Q Ag, fa av! I ,gg Y-ii 4 95- ea Ma fees, 5 My 1 leans heavily dgikpia We in ff eq tewenng elm and reef? at ' 33, for a moment wand QL J, 5 W he is running and what 43,3 he is ,looking for -1 But he knows rl: iireeemg the 2 lake s mystlfymg bottom mutt ,Q L5 Qgw E be seen from his perch shot? ,gjfgerr , so he clambers te the e rf edge geeiitie ah and- takes a perfect dum it iii, 21255 1, to discover the me!! ef Karen Laekey 135221 1 seafemaiif -V f wg!!! '13 J Tmaf 5 ,f ' ss r w , J M Ja fa- ' J- 'V gr 'eff.,,fw , sf lofi? . V ' VV ' V .IJJ VVV1: i fag? . eV :VVVJJ J,gaJ.a.,aVJp-V ' J ' J J -V ,,,. t' JJ ' ' J V V J J - - - . . V . ,V VVVV I ' V VV ' N gf:JJ - 3353, 'VV'VLJE ' ' i J, V A Vfrf T ,J I ' VVVV-W VjV,,J .Hgh ajk'Vr:.rJu J .,,J',5', .41 lf. wifi' ' V VV ' U 'V war J J,V 2 V V ' i VVV V. .J ezw-LJV 11- N V J , J!! J rf5,VQ-Lfieafifzff' VwffL'12ff??faf-M, V V V V J S V JJ JJ V J V . J -V VV JV .v -V V . x V J J V V J - V 1 -JJJ .J - .V V- V- J VLJ .Jet--V ...J JV 1 we J,ag?.V,s,eafV,V JV J ' -- VV J :gg NV .V . ' ' ' fV V 2 1 Ji-1 ---1. JVVZ rift TJ? I . V V JJ . VVVV L ' - -. '. ' 1 ' V. - J V ,V 'V VA VV .JJJ. J J ..JJJ J -V V cl J .J... J JJ VV 1 V -. ' Y VV V ' U L H V ' , J V . JV 1 VVVV- Mi . . VV f fe r 1 0 - V 'J :Vw 41:37, .giJ,u,J,gV V. V ., JJ JV k K 0. I , ' Q . .JJJJWVJJLJJJJJJ ,JJJar,Jgm: g:,p32,,,Jq,,Jkkhg f KA: .,EJ,,l.V K , , JJ . WJ ..JJ -J ,JJJ JJ,. J V . J V , J- like V VV J V VJ ,K , u .J M5 1 N EW 'mvfiiff if ,Q :J ' J ' ' ' A ' .1V 'MP V -V . JJ,. 1 V . ' - lg J J 11 2 25 1 . us- .. VJJV.--JVrV VJ- , - V., V 1- A .V.,3J,,5JJgfV,Vgezgrfcfr3,5g.g5g3V.,f:syg,,1m5-elm-gfgggr . . , JV J J W K 2: V' VQVJV V J, ,I J-WJ., I 1. M J JJ f-QV, 'V J J .- -V -V -iz -:V - r Q., .7 X X P F f , A Q Q l , if Ss . l ' Q xi v, f e il , rr 5 ' f , 5 I ,A ,JV f, Q0 C7 456 .. , 'ua J I n it , -I- 1' , 4 Q s on .1 1 ' .' J wc, tr ' - 'r f 1 7 ii I 1 At. f nlsrnnl Wfiiiv ff' if I K, mf. k: ' W gig, M i f fo s sl .J 'N , i.. 4 ' , r i li t f far 'iw lv ' VJ ESS Gina Detrie, Kansas City Patricia Dickens, Lamar, Mo Steven Dickens, Lincoln, NE Jeri Dilley, Pittsburg Nancy Dorsey, Pittsburg Brent Dowler, Arkansas City Glenn Duvall, Garnett Jeff Eastes, Pratt Donald Edris, Whitewater Randall Ermey, Erie Kathleen Farrell, Parsons Martha Farris, Parker Patty Feldman, La Cygne Alice Fenner, Neodesha Gina Ferraro, Carona Catherine Finn, Pittsburg Lana Forsythe, Pittsburg Joan Foster, Fulton Mark Foster, Topeka Linda Frazell, Pittsburg Elaine Freeman, Elk City Blaine Freidline, Clearwater Steven Gardner, Pittsburg Sandra Garret, Fort Scott Brenda Gasche, Olpe Nancy Gibson, Kansas City Cheryl Giefer, Girard Debbie Gillespie, West Mineral Rhonda Gist, Merriam Glenda Gloshen, Shawnee Rita Godinez, Chanute Gary Goldsberry, Coffeyville Susan Gorton, Chanute David Govaker, Pittsburg Doris Gowen, Pittsburg Above: Tom Schartz displays a tee-shirt that the Sigma Phi Epsilon fraternity bought especially for the dance. Below: Members of the Newman Center display their dancing ability to the crowd at the dance. Heart Fund Benefit Ball The men of Sigma Phi Epsilon spon- sored their first Heart Fund Benefit Ball February 24, 1978. With conces- sion sales and admission, the Sig Eps cleared a total of 873070, all of which went to the Crawford County Heart Fund Association. The doors of the Armory in Pittsburg opened at 7 p.m. and by 8 p.m. about 700 persons were dancing to the music of Sound Dynamicsf' the first profes- sional disco brought to Pittsburg. To provide variety with the disco-danc- ing, door prizes from local business were given out during the evening. Al- though the Sig Ep have always worked with the Heart Fund in the past, they believe the ball was one of their most successful endeavors ever. Unlike many Greek events, the ball is completely for the Heart Fund, as Craig Drummond, vice-president, explained. Our pur- poses are to incorporate our campus project with the community service project, to have a good party for stu- dents, to give the Greeks a better name and to give the Greeks a chance to gath- er together without the pressure of competition. This then lets all college students participate in a good time for a worth-while causef' The fraternity plans to make the ball an annual event which will follow the other Greek functions, and to give sup- port to the Heart Fund Association. K. A Q' X an All Fenclng draws student n l Interest at PSU Fencing is one of those courses that re- quires quick reflexes. The 26 students in the classes this year spent a lot of time learning to lunge and parry with their swords and foils. For safety s sake they always wear special padding and masks while they re dueling. ' fn 1 f ... 4, at . X A I ' i tlil six , W , i an f r ' 'X 1' X' f . N-fam.. Vicki Graf, Overland Park Diane Graham, Pittsburg Nikki Graver, Pittsburg Stanley Green, Pratt Gay Gregg, Dodge City Rolland Grigsby, Prescott Patricia Grimmett, Wichita Vernell Grisham, Pittsburg Ricky Grose, Dodge City Mary Gross, Overland Park Ruth Hale, Columbus Michael Hall, Mulvane Robert Hall, Pittsburg Melanie Hamblin, West Minera Mary Handley, Enid, OK Mary Hankins, Overland Park Wilma Hansen, Miami, OK Aziz Hanzelzhdeh, Ahwhz, Iran Arlyn Hare, Elk City Carol Harper, Cedar Vale . QK . - -lik? azz!-51. zvgiw f s f P + rr , 4 is 1 is X , x 7 mf Q fN -'wr . , , x ' ,ax on in., e .3 59 ' 1 K My fs ey! ig M X 5 A x X N 1 'A A l ,, if , ...l is -. ii .hhhb K I i xggrsgn X 4 'QQ I an A -f 'C' -.A f , ,..,, t , t , Ms f - , .. 2 or Q 4 2 Q . , A .3 . 23 372. l . , ..i it 4 me fs K 1 , 1 r 4h .ffl ' J 341 Jr-fs QQ . . Wk? 10 f-1 W-J' X F Timothy Harris, Pittsburg Robert Heifner, Sioux City, IA Dee Anne Hemman, Coffeyville Mark Herrin, Overland Park Edwin Hettler, Ottawa Cindy Hill, Overland Park Micheal Hillman Concordia Vickie Hosier, Fort Scott Joyce Humble, Scammon Jan Humphreys, Baldwinsville, NY Loretta Hunning, Hepler Donna Hutto, Columbus Diane Inloes, Pittsburg Julie Jack, Pittsburg Phillip Jack Pittsburg John Jackson, Pittsburg Theresa Jackson Pittsburg Thomas Jackson Parsons Michael Jamer Parsons Q ,andgother ylsitors during the Day Activities, Ogt0bel4'29 . i . ' 4- , , f Y 1 '51 ' . 4. . , dy' ' '- -.ff rw ' A 'A . 'nv' rt. ,QM f:r 2 , , I -A 7 'T Y V W' 5. 'I f--2, V ',, Q. 4 f f A ff -Q' ' , ' i ,Qty , W .z ,..,-ly' I M W L -'W Am. M .KM N A . ,,1, , ,, tl - ff'--'ff' L A 3' J 7 5 xf' is iig' X wal' XY a My V Y V is i 4 4 if U i if ' , x N 'W i UL, ' Wf ' f 7 , As, , 3. N ,nf W3 vv--:V gf I Q V x -,Y ' f N. i, V ,V 5 , . L, ,,,j'1,,V '19 Z v ,NRM M ,gs IV 425' ,i w 4 2 I3 I 4 Y'-'NV t 5 A' 53 4 , 'W -,cf .. A -5, -get .. i if , 1 L 4 C ,, s.l . 'QZIMT1 Douglas James, Eola Micheal Jenkins, El Dorado Tindel Jennison, Latham Stephen Johnson, Ballwin, M0 Brian Jones, Pittsburg Kevin Jones, Lawrence Ann Jordan, Newton Jon Joyce, Florissant, MO Judith Junk, Independence Bill Kampmier, Kansas City Kimberly Kapler, Baxter Springs Karappurath Gopi, Kerala, India Mark Kellison, Wichita Kelly Kirby, Pittsburg Linda Kirby, Pittsburg Robert Kircher, Louisburg Fern Klossner, Lenexa Melinda Kreissler, Pittsburg Nancy Krusmark, Pittsburg Rebeca Langan, Ellinwood Robert Larson, Pittsburg James Lash, Pleasanton Bobbie Lay, Pittsburg Walter Lickteig, Greeley Chukiat Lohkittikiat, Pittsburg John Lopp, Columbus Joan Lovensheimer, Coffeyville Terry Lower, Humboldt David Luelzf Pittsburg Cheryl Lundberg, Mission S. D,M Mahmqudzadeh, Overland Park Donna Mahnken, Pittsburg Brenda Marsh, Fort Scott Joesph Martin, Parsons Hortense Mason, Coffeyville wif' P: W ' , 1 dv.- 'fr W as W5 qi ,, gt ,X wi ,il fb 4 if 'iesf' ' is-wwf! .Nw f., 1 1 , f ,f gg ,. r e + I-,,. ,, rl unwise, -,'+' I . - - fi in ibn k i , ,,,. at .1 . , ,, , , ,,, , , aaa sl 5 .avvvv at .f . f ' ff 4, ' I, , Wt f , ,.,. ,E , f M , tt ff it i Q ,Zeit ., ' 4 , iv .. V 59 .H ,i 1 A . .Y A ., ZV5 as 15 b ,., b Q 3 fp 4-1: Q- of Xi ri-15' I' , 1 ,Q f ., Q, 5 'ii V L, ..,.. ... , if ' it 1 i X Vw 1: . , , , f 'er va 5 'Q if fn- 4. g Q r J' ' t ,, as A 430 '93 f 2 -r ,. , ' of yxv . .,': . , ,. w - i ,'rwff-gf.- -L , 4 . 'x'ni' 5 r N N- in , mf ' C v' ' .C 4 61,3 1 A 45-IP .ff-Sw ., 'ia A ' , 'fxt-. I V f . . 4. A A i ,, W ,x. , if-,mv-..fi14..f AA' . -.f, A . -. J if S ' , 35' ! A Qu y xy, x K 5 F 1 fx l 2 X 2 ,, .:' A Michael Massoth, Paola Refa Mayfield, Fairland, OK Katherine Mc Atee, Girard Richard Magee, Fort Scott Robert Mc Gowan, Shawnee Mission Kevin Mc Kibben, Leavenworth James Milton, Pittsburg Kathleen Mercier, Overland Park Barrett Miller, Minet, ND Diana Miller, Bonner Springs Larry Miller, Kansas City Vincent Miller, Cherokee, IA David P. Minck Jr., Hicksville, NY Nietia Mock, Kansas City Barbara Moran, Girard Diane Moss, Miami, OK Teresa Mott, Iuka Barbara Murphy, Kansas City Richard Nairn, Kansas City, MO Kirk Nelson, Leadwood Kent Neubert, Overland Park Wayne Nicklas, Lees Summit, MO Shahla Nikravan, Pittsburg Shiela Norton, Lamar, MO Sharon Norwood, Parsons Richard Ochs, Leavenworth Timothy Oehme, Pittsburg Paulie Olson, Coffeyville Jessie 0,Neal, Parsons Stephen Osburn, Elk City Mark Ostrander, Osawatomie Karen Page, Frontenac Leslie Page, Parsons Rodney Page, Parsons Carl Parker, Pittsburg ai 8 ' 'W p L as ,ss - ef' T47 Students and the Law In the Political Science Internship Bailiff Program students are exposed to the Judicial process and are able to participate as well as observe The purpose of the program is to intro duce students interested in law school to the court system The students are not merely playing ballrffs they are the official ba1l1ffs when they are on duty said Elmer E Wil hams Chairman of the department of Social Science and Law Club sponsor Judge Don Musser administrative Judge for Crawford County District Court is more or less their resident mstruc or This is the third year for the program It began informally This year lt IS a formal course under the title of Political Science Internship for three hours credit We have no regular docket. Some weeks there is nothing going on. When there is a break we have court representa- t' es come in and give lectures or hold informal discussions Williams said. Officials who have participated in these lec- tures and discussions include: the court administrator clerk of court processing attorney s office judge for Probate Court and the Defense Bar. The first woman to serve as bailiff in the history of Craw- ford County did so through our program last year. We ve had a number of women since then. l The Bailiff Program operates on a campus-wide basis. It s participants are mainly juniors and seniors, although some freshmen and sophomore volunteers also participate who are not taking the course for credit. The Political Science depart- ment is paid for providing bailiffs. This money finances the Law Club which pays for visits to area law schools at KU, Washburn, and Tulsa University. Larry Parker, Mincenmines, MO Becky Parrish, Independence Janet Parrish, Independence Mark Pearce, Winfield Jon Pettus, Baxter Springs Susan Pfeil, Parsons Daniel Pittman, Pittsburg Sheryl Pitts, Tulsa, OK Judith Plumlee, Pittsburg Dianne Poelma, Galena Sheree Porlier, Overland Park John Potter, Kansas City, MO Michelle Potter, Baxter Springs Eve Poznich, Weir Kevin Pursley, Pittsburg Dianne Pyle, Girard Mark Rabuse, Lenexa Porn Ratanayanot, Bangkok, Thailand Lesa Rau, Caney Cheryl Redhurn, Pittsburg Douglass Reed, Hume, MO Rodney Reed, Chanute Mitchell Reese, Columbus Donna Regehr, Iola Alisa Reynolds, Kansas City Richard Rhoades, Hamilton William Rhoades, Goodland Teri Riley, Miami, OK Cindy Robertson, Chanute Laura Robertson, Pittsburg James Robinson, Topeka Carol Rolti Overland Park Mark Roos, Shawnee Judith Russell, Pittsburg Renie Russell, Pittsburg Sharon Ryan, Fort Smith, AR Lynn Sample, Overland Park Larry Sandlin, Weir Barbara Sangster, Pittsburg Ian Sangster, Pittsburg Elsie Santagata, Coffeyville Clayton Sargent, Carthage, MO Karolyn Schooley, Clay Center Timothy Scribner, Shawnee Michael Scrounce, Grove, OK Diana Sears, Iola David Sheppard, Kansas City Marjorie Sherril, Fort Scott Kindell Shipley, Kansas City, Greg Shireman, Walnut Rape conference draws students and soclal workers from Southeast Kansas Rapes aren t commltted because of a sexual needs but because of the need for dommance keynote speaker Mar garet Jordan told an audrence of about 100 lnterested students and members of the communlty February 9 1n the open mg address of the PSU conference Rape It Can Happen to You or Those You Care About Jordan former d1str1ct attorney ln the 10th Judxcral D1str1ct and presldent of the Metropolltan Organlzatlon to Counter Sexual Assault QMOCSAJ Sald that out of 100 cases of rape an aver age of less than 3096 are reported to anyone Only about 17 out of the 100 cases are fxled and only half of these w1ll make lt through a trlal Trlals for rape usually last two and a half trmes longer than trlals for frrst degree mur er The mam problem wlth deallng wlth rape IS to get women to report rt Jordan explalned Most are afrald of hurtlng thelr reputatlon or the1r famlly more than they are concerned w1th gettrng the raplst off the street MOCSA s pro gram trles to deal wlth the three maln problems of rape 11 the lncarceratlon for rape 21 g1v1ng the v1ct1m strong support services so that more may be able to testlfy agalnst therr attackers and 31 educatlng the general publlc on the facts about rape Rape IS a repeat crrme Remember hes st1ll out there and can hurt someone else Even 1f we get a descrrptlon wrthout off1c1al charges pressed we re closer to appre hendlng h1m Jordan sald Jordan spoke about some of the myths and real1t1es of rape Only rn 1 41721 of the cases do the v1ct1m and the suspect meet rn a park or recreatlonal area Over half of the cases occur ln the VIC trm s own home and most of the rest occur 1n cars When most people thlnk of rape they thrnk of black on whrte Interraclal rapes are the exceptlon Wh1t6S rape whltes blacks rape blacks Chrcanos Top Margaret Jordan former d1StI'lCt attorney and now MOSCA presldent made the keynote address at the conference Rlght Ruth Con naughton ileftl spoke and helped organlze the conference and Chrls Serlo a graduate asslstant rn hlstory led dlscusslon groups rape Chrcanos The v1ct1m of rape rs not a person who has sex appeal or who encouraged lt Jordan sald She explalned surveys show that the more moral a woman IS the more llkely she wlll be a target of an assault Raplsts try to choose v1ct1ms who w1ll be too frrghtened or surprrsed to resrst They don t expect therr v1c tlms to scream or frght back or cause too much trouble Therefore 1f you re at tacked scream' Get attentlon But don t yell Rape' Nobody wants to get rnvolved ln a rape case Yell Flrel Ev erybody wants to see a frre Surveys show that the occupatlons of women most frequently attacked are nurses school teachers and receptlon lsts because they are trarned to g1ve per sonallzed servlce to comparatlve strangers at close range Jordan sand Waltresses on the other hand have more experlence at keeplng people out slde thelr personal sphere Jordans address opened the two day conference whlch mcluded a presenta tron by a rape vlctrm talks by a psy chologrst and volunteer counselors from SEK Mental Health Center 1n Humboldt frlm presentatlons and d1s cusslon groups An experlentlal group sesslon on self defense and self protec t1on completed the conference i f , I ' S ful 1, fv X NA A M H, A w e lt- f ,, A , , 'an' I I ,, ,W . Q of ,V 4, 1 ' fi A f i a fd 'N' -J GTI? '41 tylv, ,Jia 5 'V fa - 5 .f1-,, 4 , ai K-qi W2 ,,-1 ,eil uae? , 'wifi 2 A it fef' ,Q 7 'Ye v v at-X ww ',,.-V Marilyn Shireman, Girard Marc Siegel, Brooklyn, NY Janice Simpson, Pittsburg Marsha Singleton, Pittsburg Michael Sittner, Lararm, MO Michael Slabaugh, Pittsburg Linda Small, Neodesha Ted Smethers, Olathe David Smith, Dodge City Floyd Smith, Oxford Kathleen Smith, Fredonia Kim Smith, Fort Scott Latricia Smith, Pittsburg Peggy Smith, Shawnee Richard Smith, Independence Richard Snider, Pittsburg Karen Snow, Pittsburg Linda Speedone, La Cygne Susan Spineto, Pittsburg Terri Sprague, Parsons Jon Stephens, Erie Rosemary Stevens, Mc Cune Christy Stine, Pittsburg Kimo Stien, Pittsburg Marla Stine, Dodge City Marilyn Stockdale, Sheldon, MO Ronald Stockstill, Uniontown Delores Stolp, Overland Park Gayle Strulrel, Girard Greg Swaney, Havana Stanley Sweeton, Baxter Springs Richard Tallmadge, Sandosky MI Cathrine Tannehill, Pittsburg Pamela Thiessen, Independence Janet Townsend, Kansas City ,. f-fx ' ,, g Q '- 1 it fue' f 'M A , ,,Lxk.:gx:i S. 1 .. .h Y 4 J 4' - ' . X , 1 A 5 5 ., f N W' at s rg I Z5 fl fix I., - I mcse! ..- . .. 4 . gf xx ' I Q 3' lQ P H 5 . . fz L X ,, , 0 -9 inn ,A ., L ,Q s - . k, ' M c n if I W 1a 1 -' Q 7 1 1 f ' AXY7 ' W A K 1 . . f . 1 fs 1... Parking Problems 4f8cC2 that s the thlrd ticket I ve got ten this week' ' Oh that familiar line how often It IS used According to Ken Peak director of Campus Securlty the major complaint from students IS there are not enough parking spaces One often made sugges tion has been a hlgh rise parklng garage, but xt would take about S3500 per park mg space to build one, Peak Sald Future plans lnclude changing the re strlcted area ln front of Horace Mann from 24 hours to about ten hours Clos er parklng for the disabled and creatmg a motorcycle parking area around Trout Hall are two other possible projects, Peak said In six m Q im MINUTE again 1 .. 1 .WJ WT..-. f ls- H Mary Ann Trant, Columbus Laura Traul, Owawatomie Darla Trefz, Eudora Patty Turner, Independence David Twarog, Girard Larry Van De Mark, Lamar, MO Diane Van Leeuwen, Chanute Sherry Ventura, Paola Janet Villamaria, Frontenac Susan Vomhof, Olathe Karen Voorhes, Shawnee Mission Becky Walker, Iola Patricia Ward, Pittsburg Gregory Warren, Columbus Susan Warrior, Mission hyat , ' ' 3 Y . , . . . ' 9 . . ii 7 , I D . - - l A sm C :- ' ' X . 5- I -- S' ,, . . iffffi . -I.,-L. 12 , -T P . ss.. WSW V . ,,,,,,W: V 4 5, V Y ' - , ' . f .,,. . . - I ft' if .- . X-4: 1 - ,ae..r:.,1 H j .N K . K H-'ff K ' ' sf 's -K '-',g1,!I1 .. . , , ,L P- - K, - ,A . A L. .. - , QIQSSWZ . - -.7 .'.Z0:fff: ' ,, TO -: X. -' Us 'v C b- I .sq-Z jew .f - . M x - . - . pa- A ,' N n f r. , g,,,SZAi t , A ' fit .. P i P gtg.. i H . K V. 'V ,..,4C' 'L hu 4 Q Vi A in Pi.. ak' However, a problem remains for the South Complex students There are 10 200 permlts issued a year, and 1tS difficult to fmd a parking space near Nation, Mltchell, and Dellmger So lt looks l1ke everyone will have to take thelr chances for a while, and hope that l1ttle Cushman doesn t spot their illegally parked cars 'MS-r sm -ibm' SRF saifli 'svkwnvgk an Beverly Wells, Pittsburg James Wesley, Coffeyville La Deen White, Neodesha Nancy Wilbert, Pittsburg Matthew Williamsons, Moundsvill W N , it - , ,ff Elizabeth Wilson, Parsons Ronald Wilson, Morton Grove, Terri Wilson, Elsmore Nancy Wimmer, Fulton Gina Winter, Fort Scott va 2 r ig, K 2 A Q IL y ssy i ,, it ,, N , , Ruth Wirshall, Coffeyville Nancy Wolf Fort Scott f - Morris Woods, Leavenworth Charlotte Worthington, Bronson Carol Wurtenberger, Shawnee ' n A . 4 A, X ' ,s , f af' , ' 4' 57' ! I s, f , r .5-. ' e, , , at 22-rs.v23Sk-ff - -'- 4 f ' lk 1 it N Beverly Zafuta, Frontenac ' i X 'Z' I '-'file Eris Zager, Girard ,, ,, ,ov ff-an 'V' '5 1' ' ' Thomasine Zahner, Olathe , l . - I may Pamela Zimmerman, Girard f ' ' A '- if Steven Zimmerman, Mc Cune Donna Zirlrle, Garden City C' a lx Quinn' lp... -, 4 8 It 1 Y , iw X : X W 5 J' 4 z x S x ,K , g ,. Juniors 1' i. K-X1 . all riff' I 5. ' A . if -.- 1 J i . TP 556 f .1-fr 'ti we f l ,, as L'A' I, X :': ,,: v' X 'P -39 ' ,sv so l , ., We Us I? E I SB' ., Lliz :CUT ,V 4 O XX! x?-v --I W - ff J An paw! ,v . .o .QF SYN--S l . ----mi. N ,f s 'J 'rr--'-7 Patricia Adams, Bently Carla Alcox, Coffeyville John Allen, Hardther Mike Allen, Ottawa Thomas Agustine, Kansas City Dana Austin, Cherryvale Sharon Austin, Independence James Barber, Independence Glen Bachman, Independence Todd Barnes, Greenville, SC Dirk Becker, Mc Pherson Kimberly Benedict, Frontenac Mary Bennett, Fort Bliss, TX Monica Beth, Overland Park Russell Bird, Wichita Janelle Bloom, Osage City Mark Bowsher, Breat Bend Robert Brant, Fort Scott Rebecca Brewer, Hutchinson Arlyn Briggs, Kincaid Gail Broom, Leavenworth Kathy Brown, Arma Robert Brown, Colombus, GA Kevin Bulraty, Kansas City Matthew Burg, Chanute Billie Jo Burge, Girard David Bustos, Coffeyville Robin Butler, Shawnee Mission Bill Byron, Leawood Laura Caillouet, Iola Laura Camody, Baxter Springs Cheryl Caple, Altomont V QY f7 S ss., - .ap I t Carol Carlson, Pittsburg Carol Carnes, Wier Kathy Carpenter, Iola Rosemary Chandler, Parsons Diane Cicutto, Shawnee Mission Lacey Clark, Joplin, MO Linda Clark, Girard Marilyn Clark, Independence Denise Coble, Chanute Robin Cobler, Mapleton Rabecca Coffman, Galena Eve Cornwell, Shawnee Mission Ronald Crook, Mulvane Dawn Davis, Kansas City Gary Davis, Chetopa . e S Y 1 ax , ' ,.. gg 1 F l ' -- sf- me ,' Z. W , f , x, 7 .v Q X 'ul' N e - ,-s- N 3 X s V V- ..-- ' 'Q L , f f f me Ks, I iiii ' M 1 I x J , W Q W- - ifafgt fp .. L i ': -sf ' . ' - -K NNQQ 7 V .-' 5 --w 5 -- S C fr.: all I D At fy - -4 . s f ix ,-...-ff' . J sf? lil .eil SUB College Bowl These two graduate students, Ray Ellis and Chet Hiatt, were part of the win- ning team in the SUB College Bowl. Although their team which also includ- ed Mike Pendleton, Neodesha sopho- more and Jim Wilson, Coffeyville ju- nior, won the contest, they were dis- qualified from advancing to the Region- al College Bowl tournament because Ellis and Hiatt are not full-time stu- dents. Instead, this team was sent to represent Pitt State in a state-wide Kansas Trivia Bowl in Wichita competing against teams from Wichita State and KU. The Sigma Chi team took second place and went on to represent Pitt State at the regional College Bowl Tournament against teams from Central Missouri State, Southern Missouri State and Washington University of St. Louis. H f , . Q . P Q L v-Q rx Y . i L if 1 5 I 499 Pittsburg runner Bob McLeod instructs his son to behave at one of the Gorilla s home central state Intercollegiate conference meets at the Country Club Golf Course f . ' . N 'tg t, A , WxFff. A A A f I a gr , 2 - 7'ffgm,:' , ., f s '- -viifz Va- . f . V5 , ' ' V3 ' -'r 5 r sf , - if 'Htl I Var , K4 1, 7' 'S ,I , fi? 4 ,s if iff' Q' 'J' I if Kent Davis, Haviland Craig Dawson, Derby Kathy Daylong, Fort Scott Judy Deckard, Pittsburg Cyndi Deems, Lawrence Cora Denton, Garnett Charlene Dixon, Kansas City, MO Sharon Dodd, Leavenworth Mary Donnelly, Parsons Linda Draper, Baxter Springs Linda Duggan, Overland Park Dan Dyer, Pittsburg Gary Dykman, Shawnee Mission Sandra Eckl, Ronne Terre, MO Shirley Edmonds, Blue Mound 1 Square E fl. ,AX 'X M Michael Elder, Overland Park Barbara Elmore, Chetopa Lisa Esch, Rogers, AR Linda Evans, Chanute Jodean Ewalt, Louisburg 1-,QM-uf ,X Abiodun Fanimolrun, Ibadun, Nigeria Debra Feldman, La Cygne Jaclri Ferraro, Pittsburg Vicki Fessenden, Eureka John Ford, Sheldon, MO 'vcr' 13 Jeffery Forgey, Fort Scott Paul Foster, Independence Shelley Fredericlrsen, Frontenac David French, Moran Tony Furse, Mound City E dancing brings a change of pace Early in February the Free University program began a Square Dance session at the Dance Studio in Weede Gymna- sium. The enthusiastic group meets every Sunday evening at 7 p.m. to learn the different steps of square dancing. Randy Baldrldge Randall Hobbs and others, call the instructions to the music of a stereo during the three hours of dancing The group had regular meetings before dancing, and planned to form a club Thelr major planned to keep the sessions going each semes ter, so it s All four ladies promenade Go walking the ring Box gnat at home And glve that man a swing 9 1 X ' 7 ,,, 7 if ' Va V ,Q 9 i ' f .Q W' lf f ,L if S t gf-' ,, . f I wr' S - K T , We K ..Q1,,,. f E r 2' 1 Q 1 ,, Timothy George, Cimarron Steven Giannas, Prairie Village Melissa Gibson, Baxter Springs Kathryn Ginsburg, Summit, NJ Karen Golob, Arma Jamie Gott, Pittsburg Kenneth Gott, Pittsburg Victor Grali Sedgwick Kenneth Grimaldi, Pittsburg Janet Hadicke, Arkansas City Debra Haefele, Kansas City, MO Suzanne Hammons, Fort Scott Jordi Hannes, Pittsburg John Harrigan, Girard Janice Harryman, Girard John Hart, Arkansas City John Harvey, St. Francis Gaye Heidman, Fort Scott Raymond Hemman, Coffeyville Kim Hilt, Haigler, NB Deborah Hottenstein, Chanute Kurt Holmes, Wichita Pamela Hubbard, Wichita Anne Huddleston, Overland Park Mark Huffman, Olathe Jane Hughes, Parsons Mitchell Hull, Pittsburg Holly Hurley, Girard Jennifer Jackson, Elsmore Pam Jacobs, Chanute Warren Janeway, Lawrence Rodney Jenkins, Atchison Kurt Kanetzky, Pittsburg Lori Kemper, Overland Park Delanna Kent, Independence i. L,,, M. ,, ss, ,, . Q Y , li' 'if if . f f f ' - I if ff f . f' V Q C . . I 1 - vw ' ' . 2 ' nu ,ii 1' . Q 1' -V . ef fi 'am Wi if .,,.., ' ,uv .MM ,r I 5 , f ,. ,, rw VK , I ar f - ff',- ,,,...,,f.-V www M- we .,..- W, , .,,'f' as V ke, 'ijyfz . Zi? P if wi ,f A Dsl mi' fi ' ' :iii .if gif M' 2 'L 1 'Aga i- . M... l K ?gx,. Q33--'22, .-X PP 7 F V 1- . ,tiii ,. :I ,,kl .,,, I I , J , 95 5 ' ' -- va 2 , HY . , 3 5 is 'W t., , A: k V , Vg rry I in S K I n ffk, , Q- f ' . 'L :1k V ' ,ff X .. - . ,. .'i, 1,f , t at .1 ,...i a M if ' P ' 1 ' f V ,it11,,is,,.5,,.faefawffiwfwa' ' f .i:1f'1'f2H fi21fZ242Z??ii' M H W .aweef1ei2,..,-W..VV- We .... .......... ... 5 .... ... it K, W4 1,-f' We , ww ,X at 5 ff 2 f1f jg, Ci ,o 1 iiii i ' b t i . 1 M' , , Q , 7 'V e X , ' f-1 Dave Ketcher, Florissant Cynthia King, Dallas, TX Jodi Kingrey, Baxter Springs Helen Kirkpatrick, Newton Barbara Knieling, Topeka Mark Knoepile, Manhattan Kevin Koochel, Albert Pat Kuestersteffen, Yates Center Jeffrey Lawhead, Parker Kimberley Lee, Wichita Marilyn Lee, Kansas City Keith Lemmons, Pittsburg Jon Lippelman, Oberlin Susan Long, Joplin, MO Linda Luton, Parsons Susan Lutz, Westphalia Scott MacDonald, Parsons Rosa Madrigal, Kansas City Christopher Manning, Kansas City Jane MansHeld, Overland Park Nyron Marhsall, Cleveland, OH Patricia Marhsall, Girard Ramona Massoth, Piqua Marilyn Matthews, Overland Park Charles McCann, Paola Janice McCarthy, Wichita Athena McColm, Columbus Chester McEndree, Laharpe Bill McKellar, Neodesha Steve McKelvy, Chanute Phillip McKenna, Kingman Christopher Medley, Galena Christen Medlin, Parsons Curt Medlin, Pittsburg Steve Medved, Cinnaminson, NJ Dance Marathon raises 319,020 Rows and rows of dancers and specta- tors who llned the lmperlal Ballroom came ahve as the muslc of Dxcso Infer no opened the flrst annual PSU Mus cular Dystrophy Dance Marathon sponsored by the women of Alpha Gamma Delta Aprll 8 and 9 The danc ers had come prepared for the 36 hour event armed wlth a generous supply of bandages extra clothes and plenty of energy and enthuslasm for the gruellng hours ahead After he welcomed the 68 couples at 9 a m Presldent James Ap pleberry and hls Wlfe led them 1n a gl ant ram dance to open the marathon Thlrty slx long hours later 58 txred but exclted couples watched w1th antlclpa tlon as the flnal flgure was put on the tote board S19 020 almost double the goal that had been set Presldent Appleberry congratulated the dancers and led them ln another tram dance thls t1me a vlctory dance Preparatlons had begun months before the marathon when the Alpha Gams secured permlssxon to sponsor such an event Hours were spent recrultlng dancers food bands flrst a1d equlp ment and volunteers securlty and pr1zes Dances and other act1v1t1es were held at the Schoolhouse Dlsco and at Hollywoods durrng the week preceedlng the marathon Wlth proceeds golng to Muscular Dystrophy Local d1SC jockey Paul Cook volun teered h1s tlme for most of the weekend to announce contests and pr1zes durlng breaks as well as help keep sp1r1t ahve 1n the dancers Despxte the heat and thelr fatlgue the dancers kept up thelr Jubllant splrlt A splrlt trophy was awarded to Lambda Chl dancers Tom Burns Easton sophomore and Joan Gast Leavenworth freshman durlng the most gruellng hours of dancmg for thelr energy and encouragement to oth er dancers Meals were prepared for the dancers by M Qulck and served by the Alpha Gams Local restaurants also provlded mldnlght chlcken snacks On Apr1l 20 the dancers met agaln to turn ln the1r sponsors donatlons PIIZBS were glven 1n several categorles for sp1r lt and to the couples and to the Ofganl zatlons who ralsed the most money WA sir'-sllkssw 'N-we Sb., Mwevrwawy we :El ive. . .. 'Www sms Q-mar.,-A umwiiww Excitement, determination, fun, hard work, laughter, and sore feet all added up for the key to success for M.D. Ms- is ,. .-Q. 1 6iN....' ii, . Y x xw5.f 4-'+ ffl' I Xi- 41- M x 1 'MI ' 8 The couple raising the most money, Barbara Allison, Overland Park senior, and Kurt Holmes, Wichita junior, re- ceived scholarships of S100 and televi- sions. Second and third place winners received clock radios and watches, and bicycles. The Greek organization raising the most money was Phi Sigma Epsilon. Trout Hall won the dorm division, and Pittsburg High School received the prize of a free band for one night of their choice for raising the most money in the high school division. Sigma Tau Gamma received an award for the con- test which raised the most money and had the most crowd appeal. Terri Monsour, Pittsburg junior and Alpha Gamma Delta sorority member, will travel to Las Vegas, Nevada to pre- sent the S519 020 check to Jerry Lewis in his Muscular Dystrophy Telethon in September. Opposite Page top: 68 couples began the 36 hour event. Middle: One of the many special events was the pie-throwing booth sponsored by Sigma Tau Gamma. Bottom: Barbara Allison and Kurt Holmes raised over S1400 to win first place as the couple raising the most money. Left: Dancers and members of Alpha Gamma Delta became very excited when the final total of S19 020 was an- nounced. QE 3+ Kerry Merrell, Pittsburg 'V A David Miller, Garnett 'J .,, ' Deborah Mills, Independence iv. - r- A Terri Monsour, Pittsburg L' - Marilyn Moricorii, Frontenac i t 4 ' IN . A A G n 'X 1' htm i N 1 Z S . 1 2 . r. .... If Maryann Moriconi, Frontenac ff' N ... .IV Aw 1 er if ' Barbara Morrison, Fort Scott far it A A , . Valia Muzylra, Shawnee , -.Q V Wgjgf ' r --V 1 Wayne Myers, Elsmore 'T ' ' A ' 'iii li 5. N, N Barbara Naylor, Weir it , A 1 fu , 4 - is 'wi f Becky Neece, Kansas City f XA? . ,4 0 gi ,, ,. 1' 0 Pamela Noe, Farlington W t i sf. 1 'K 5' Nancy Ochs, Leavenworth - ' t 3 , 2 2 f J Ann Olive, Horton, MO ' J X ' X ' Wayne Opfer, Lansing -Q I I x K, gh .,1 X gf. V Q K tg , 47' f, .. K , ' IYDX 0 A 'xr' ,' ' i' , 'N A N al lim! PSU has largest ROTC program In Kansas Have you ever tried to swim 25 yards in web gear while lugging a regulation-size M-16 rifle replica? Or how about walk- ing off a swimming pool's high board - blindfolded - with web gear and rifle: Or rappelling down 20 feet of bleachers - face first? Chances are that unless you have been in the military or enrolled in a Reserve Officers Training Corp KROTCJ leader- ship course, you probably never have experienced these things. Developing confidence in yourself is an important step in becoming a leader and the various exercises these students complete are meant to help students develop necessary leadership qualities. This year marked the 25th anniversary of the ROTC program on the Pitt State campus. The unit was established here in June 1952 under provisions of the National Defense Act with an 1n1t1al enrollment of 335 students Pittsburg State currently has the larg est ROTC program in Kansas with about 275 students Because of the large number of freshmen and sophomores in the program ColonelE W Hollenbeck professor of Military Science said he hopes to have 400 students in ROTC this fall , 7 ' ' 7 Y W ,f - i . Richard Orszulak, Girard Marchella Palmer,Columbus Thomas Pattee, Lawrence Diane Pernot, Mulberry Linda Phillips, Chanute Teri Pieper, Ottumwa, IA Deborah Pierce, Wichita Dale Pittman, Mulvane Mary Pittman, Pittsburg James Plank, Coffeyville Brian Pollmiller, Kansas City Waneta Pope, Iola Monte Porter, Cherryvale Rose Porter, Cherryvale Cynthia Price, Reading Becky Pruitt, Parsons Kathy Pryor, Scammon Linda Ramsey, Bronson Kathryn Randels, Pittsburg Keith Rather, Independence Larry Regehr, Pittsburg Davene Rich, Pittsburg Robbie Robinson, Hallowell Elaine Rouse, Liberal, MO Bryce Sater, Joplin, MO David Schnichels, Fort Scott Kathy Scott, La Cygne Angie Secrest, Neodesha Jeff Senger, Overland Park Cherry Sheldon, Chanute Teresa Shinn, Conway Springs Willie Shinn, Parsons David Shoemaker, Galena Kent Shore, Lawrence Debbie Sims, Girard demonstration. Theres no fire Its only a The Campus Safety Committee arranged a visit by the Pittsburg Fire Department for Fire Pre- vention Week f0ctober 10-155. 1 n . P, X T ,. - W W w 3 lv' Q , T 'fxf' 5 o VVWA Q, I QF 'K i t. N4,iXff, Hoon: - 1, mvfgxnf 31f 'Y n V, . 'z .f ,, . o f t 1 t A X X1,1 i1,5.t , , -. , N x I Q i lv xr.. W - K ,Q fr - ... H q 1 iiil Q X If :gk ix fx 5 3 Q f I I 'tw f . i' nf' 'rm ' X . i ,f K ,I K S 5 ' -' f fi i W er, t rf- as eeee X of S Y S S f , N , ' , :.1. 5 .1 -v-X sf , Bl J i ieei - t, Janet Sloan, Mapleton Rodney Smith, Fort Leavenworth Karen Soleimani, San Antonio, TX August Sprung, Bonner Springs Dean Stevens, Uniontown Brian Steventon, Wichita Ruby Stewart, Haven Sandy Stewart, Haven Otto Stuber, Wichita Douglas Stuckey, Junction City Nancy Tatman, Chanute Steve Taylor, Scott City Amy Terry, Overland Park Nick Thompson, Coffeyville Janet Torrance, Independence . Q Q, 'xr ! N , K A NX X M 5 Ilsily 533: 7555. N--- -1 E N' Q E ' 1 l ., Q.. .3 ' eff ,A ., r ik ri w ' ' - 1 1 X vt 1 ' w QQ i ifgk PM-J .ev sf H, -Q--,sy-. , , , :A 1- sg--1, W s R 5 E , X it X si A , ssss 'Tl 1 S F is I - 1:1595 M., fu-ev t , Q. K gif' ,gi w ' P .df Don Tracy, Kansas City Terry Tracy, Pittsburg j. il i Thomas Turner, Kansas City Melinda Veatch, Winfield Dave Wallingford, Atlanta i ,J is ,lm ,-,, gg fy-1: I ' it , 1, A iiaa . v fs, a '33 X f , X X ie Morgan Warffuel, Santa Maria, CA Sharry Watts, Girard Roger Weast, Iola Susie Webb, Pittsburg Ann Weber, Mission ,dl si A ' ' 1 t Y 2 0,5555 ' ,ww if Q ,,-:W '. 1 Jim Welsh, Ulysses Beth Westermen, Nashville Jean Weist, Prairie Village Eris Wilson, Ulysses S A fvi' - Diane Wilt, Anthony Gary Wolgamott, Parsons Sandy York, Neodesha Kg, , -.f Betty Zimmerman, McCune Qs.-v ' Mary Zook, Larnerd we-as 3 was is fkgf ,. A i Q: 'A -3 S ,Q ,X l Kuff Life on the Ova Scenes like this are quite common on the oval during good weather Its a good place to stop and chat with friends and fresh air make a good change of atmosphere from the library for study mg, too On top of that the lighting s good as will as catch a little sun. Sunshine Sara Weltzheimer, Oklahoma City, OK Sophomores 'fx Si fA?'Q-fi F3 , E S aww jj T 'N o-N -0 on .. ' 7 News L-.p X X 6 .. -it i 1 'K ' aw' 'UN CT? 01' A h Qhfy La 45' . 1. 5 g 9 a w Dave Abernathy, Stillwell Linda Baker, Pittsburg Bradley Belt, Columbus John Bilby, Coffeyville Laura Bolen, Pittsburg Edith Box, Columbus Gwynetha Bradley, Kansas City, MO Barry Bringtwell, Shawnee Peggy Brogan, St. Paul Linda Brown, Leavenworth Susan Broyles, Pittsburg Roberta Bushyhead, Arkansas City Cely Caines, Overland Park Charles Cantrell, Columbus Ralph Capan, Pittsburg Doug Carroll, Bonner Springs Paula Carter, Pittsburg Merlyn Carver, Wamego Jean Cathcart, Independence Patty Cavanaugh, Girard Chris Channel, Galena Joe Cisper, Lenexa Jeffrey Clark, Kansas City Richard Crandon, Coffeyville Paul Crews, Neosha, MO Frank Crowl, Shawnee Mission Claude Cummings, Burlington Susan Daniels, Coffeyville Gary Doolittle, Leawood Edie Ekhoff Oswego Liz Fast, Columbus Barbara Flalrus, Wellsville T e Campus Lake When spring and warm weather finally came to the PSU campus, a large surge of students headed for the nearest wa- ter hole. Last spring more students than ever be- fore took advantage of the clean lake and the grounds around it for toasting their bodies in the sun, according to Larry Nokes, physical plant director. Besides adding to the beauty of the campus area, the lake provided a multi- recreational facility. It makes an excel- lent setting for picnics, recreation, wed- dings and receptions, and just simple leisure time. N X Q , JY, i f L 'ii' if 5 . -, ' . of a 0' 1 s A1 7 fi -ff r 'QT QQ, P 1 MS. .ka CSN Nb' Marjorie Fleming, Columbus Careyn Frost, Overland Park Jayne Ganzer, Overland Park Jill Gaskell, Horton Bryan Geiger, Chanute Carl Giglione, Leawood Lori Girard, Arma Dana Glaze, Emporia Mimi Gorman, Kansas City Gloria Graham, Fredonia Kim Graham, Fort Scott Kathy Grant, Kansas City Derrick Hall, Leavenworth Wnita Hampton, Cherokee Mary Hargitt, Kansas City Leonard Harris, Chicago, IL Craig Harrison, Olathe Linda Hartshorn, Galena Richard Hastings, Overland Park Kaye Hemmens, Pittsburg Greeks vlslt mentally handlcapped On a sunny and snow covered Saturday rn February members of the Lambda Chl Alpha fraternlty and thelr slster Crescent Club traveled to the Parsons State Hospltal and Tralnlng Center to spend an afternoon wlth more than 40 excrted young resldents The Greeks entertalned the young adults wlth many games personal at tent1on and refreshments served by the Although the day at Parsons IS an an nual event thls year s v1s1t was one of the most 1nv1gorat1ng as the resldents were feellng the restlessness of belng snow bound durlng a partlcularly cold wlnter The Lambda Chls and Crescent Club returned home tlred from the wearlng day but wlth good warm feellngs as they saw many sad and lonely faces l1ght up through the events of the day Top Gene McFerr1n makes frlends Left Ball' Dawn Davls Crescent Club member explams Above Paul Crews oversees refreshment tlme I I ' I A , ,. , ' 6 l :iff 1 5 E . . . . Q rr f :ll f 2 . it 1 s' Crescent Club. . g 1 , . , . . . 'V V, 5 . . . . l n , 1 i 1 . , . fi .H ,i-:::,f:.fs,,,:sssai .,ss--- 'X w. F' P ii M. I L52 P KI ,, L, ,. if gg., Sjv... We - LLL :,.,.., M, . .FEV ,K W' fr Hx -S ,X 3, , , Q K, : , , 4' S in vi? sg Tar --,s',:g:s5:,,5'5,, .:ff'a:EE?EssS 2!s X list 5 H-if P ff lvl 1: ' , es. Karen Higbee, Mission Linda Holderbrand, Columbus Mary Hilton, Leawood Becky Holland, Erie Mary Hudson, Girard Larry Hughes, Shawnee Gail Jamison, Baxter Springs Timothy Janes, Pittsburg Mary Jennings, Pittsburg Douglass Johnston, McCune Marcia Jones, Yates Center Keridan Kaisner, Chetopa Gina Kelley, Parsons Kevin Kelly, Prairie Village Ossie Kendall, Kansas City Thomas Kendall, Elwood Mike Klein Deborah Kramer, Winchester Sarah Kreutzer, Mountain Grove Steve Kubler, Yates Center Pam Kudrna, Pittsburg Paul La Bounty, Prairie Village Mike Lamphear, Mission Janice Lancaster, Fort Scott Sherry Larsh, Longton Sara Leu, Winchester David Lowe, Joplin, MO Kenneth Ludwig, Leavenworth Dennis McAtee, Girard Carolyn McClasky, Girard Nolan Mclver, Topeka Beverly McKay, Galena Stanley McNemar, Columbus Steven McNemar, Columbus Sherry McSherry, Columbus -E k,:'I . si ' X X W Eli? 9 if xx Nibxlil sm 1 w .,,.,h- as 'K . ,r S wiv :S . -,gf is 2' , is ttk I S J- fi use -em. P .i,1,f.,as- mil-5. k --ff J, Qsgkn ,V . ,5 . ., as Q .- 4, A ,..x. -,,- ' V lineups -. . A-N QXX 'F xx X an. Kim Meline, Overland Park Peggy Meyer, Tampa Tony Miroclre, Shawnee Norene Murphy, Bonner Springs Caroline Murray, Leawood Patty Nicoletti, Columbus Bob Oliver, Haysville Timon Oujiri, Cedar Rapids, IA Gregg Parks, Mission Robert Plummer, Normal, IL Mike Poole, Pittsburg Marc Potter, Baxter Springs Tonie Predilra, Erie Debbie Price, Chicago, IL DiAnn Quenoy, Frontenac Joan Ralph Farllngton Marilyn Randall Bonner Springs David Rangel Prairie Vlllage Tone Reese, Columbus Karen Rommelfanger, Garnett s . kv Qf ff-dr M sw W WM? ix NA? 'm' -Jr' f-0 s :s5'N1 r9'1,f:1fii 1S mail:--I, :,1:I'EEEv we 5 - . ,gm ,... Q:-qrmw, ' ,. see:-t or , 'f--- tv' f QR. , VHP-Q.: - ,. Q aswsgi Jacqueline Rose, Quenemo Steve Rose, Liberal, M0 Carla Scassellati, Pittsburg Nick Schmits, Baileyville Mark Shaffer, Carthage, MO X sk: is ' f. Fv x Sz. .ar we 1 . as 5 1 ft , I we A 'su Maia, as f ff X-3.4, 1 -fr P e , . oee fix Brian Shultz, Parsons Sheryl Sigler, Lawrence Teri Simpson, Wamego Sabina Sinkovic, Frontenac Annette Skaggs, Arkansas City in 1' Ki'i' . Darlene Smith, Kansas City Mareta Smith, Pittsburg Tamara Smith, Baxter Springs Elaine Sommerhauser, Mulvane . ' Nancy Spruk, Pittsburg 56, an 1 L f , 7 ff X. A e . A-QQ.. 1 'Zi-,4. Fai' A Cathy Stareck, Del Rio, TX Leonard Stauffer, Yates Center Jan Steele, Fort Scott Paula Steffens, Girard Nancy Stillis, Wichita 2 fl' tint SX X ...V ,,' if 1 WHEN? XXEg N s w N Vw it-zvxggx' Mwmw ym gwarwrza4smw W Mg' awa- .mwwm ' , wr' A Mil ,ny ,Q Aman., M' gpwsmmq. f-we saws wise hm YQ' sage wwestwit at W www QkA g mw W1 are ee SWAP' fm Wai, 4 H, E ESQ, N F in NQENYSEYQHWNA if f- MM .sg w fag, 'Q 'H Aw X 'AK WQQSA QM saw EH bi awww, Q-W Wdsmmm xseeaga aww ,WN W X M A ess f V51-QR ssesr assew Qr nbesmandsssvswf at 'fb M153 in si 1 ' K W X Mm: qwfssswsg Jw S h ai 'W W e Q' '96-rm' S81 vig' M zQ L's?e.-W vw L bww- + 1 WAFYQ XQ-gf? mf Xvbmnm X our pantr - watgheiw , sf New as-swim ss its s so Us mm-sw. aiwaffw 111811 f Nwwifmsenmfw .FF 1 ' swfemipmw-1 NM x me Y, qc 4 +9-3353 F ,Qmgwfwsff ijvilsiif Wai G eggs Mir P M -it Q. is Q attract is was Q issrrw was as X f 'Wx 'X Vi' at was wB6 -4.45, is W 'N ' Qskssrfii M ,M -A Egan stave ' all WN. Ajmeggre 75 Q we Q an wa W ,rr 1 Qu ,sr ,N fs 2 ae- -,.. M QU WSQQA it Pxgag 'J' is ,gtg -Q as as-wgws -N . wg-531 , Jax MP .. d executlves ln sag mg sults, he Mi imiwgmw H' WW s. .iisf s W tliizgi S 1 en Qhoseytm 6 'f Q rw lr rlch er '7i'V 4 Q g mrmwi?Q'FR?9FQE 5 Qsgis me fs tar K S' V 1' w-D gg xx, fa 15? Q, Q WL 35 as-w-ww Aww 'M YW wo mm ,nw- QM... The? some a searching for berries d nr he heat and serve w van m tmg 1 xr freezers iWf Xilsv E E B N sa ,gk 1 Yak ML r w Ke wwe Mrk and honey 4 Sipsggffgg ,gt 1 e Q gr mm, g ! X 0,9-'I-ps iw wi ms- saws e ,M Qgiww S g 6 is Thiy gone 'ig5g?isklK 5 H' 5- 'iz- Sires N Susan Mlllefafw M' sa. Q R435 P Mikww W. wise. ss vs- tmmk ,Mu s 'ii Q, N, U fwfifsfs , 4 iss eww, We mf: gym X, ,se ,S saw spirit as N. Meigs W, me 'ws K. R sm gil sd mit? Z is if-s Qfk,m NH f 1, 'Www i kssiftgwiwl 1 H? NK N was as arts assists -M... ef is rf W' 'fiilmx W W'ri??sref?S 23253 was 1 wks hiv is A L+ Na in 'N ji 'e W' P 5' N , a W if 5lgQl,',,:fi,f,5A 5. X , , 5 ' ' Z 1 l 4 , J H, '4 at , Z f Fifi, -, - -if mhfaf Yi?-3,31 3? I ' ,.Lfii.f27 'f:f' ' v 5' fw if ig 1 ' ,' 1 ga we JJ' 'f - ' 'M' K ::. ',i? .'f',f.', 2 r 0 '.f Q it fs 'if QJFJ 2 'P f I if I , , , It - 1 ' ,gifs :,z,,, 'gg ,,..,, 'ff wf f'f.'ff2'ggga.,- V, .7 M2 :M is '72, Q 0 . 'i ' 1 ff I . , rs f.- , -'ff ' 2 f . SN 5' .' l W fwfqq., qw , f , ,fe g.,1,fgf 1 D' I , P P '- ' 4 ' ' - . , 3, fi i ,fif , ,, ', 1322 a ii ' 'f ,g ,P ,, 4 ,,, ar , 3 5 fz 2 ' , 4 1' E H Za, 1' ,, , ' e,,fwV,,, , wit, f an 4 ffyfsia , -Q xsym wr' -i Qi fwzrrtxifzf, 251 'M':wV' '-fx we ,Q 3 5-'M tr,-V ff Q 423 J' 1 il f-Tiff WW - if '17 5 55 5 P' I- ' 1 if z N 2 , qvfffgg 1 f I Iwi' 'f 52W1L1?'?5gff, Q ' H -.1,,-,Q - M.-f,f,, A , 4 fi?1.,'sfsmr12.4, - i ,, N , 1:2 -of , V , 1? ,., f ' X ,- 'ff ' Q ,.fffv:,1fM-ef f ,f, wife . , 543.4 'f WW fp 1' , ' :fi 5 Q 5 A 5,55 ' -, af, 1 - ',irI, 'ws' .-,ai if'- ,fg1. T, , ,' aiu-uf: . ' if 1 Q r ' , as 'f' ' an , Q , -2, , f,-viii, ' iq Cfif'2Jrf1,5,a X fi, , ,K ' , ' iq ' 1 - , V, , ,fra 1 I t 1 'V'- t , 2 ' ,, i ' ' ,. ' N i s ' '55, ' f1iQi?:',iS: Mi!--' si wwf If f 1 , vi ZW' f nl flffgff-if-,:i1' 7 'fggsfi , win ' ' -ffmlw' ff-iff, V f CL, ,,,, .' ' '- 'ff '1 1 imb- 5,ii'if'2f-ff fy ' - 'fE '7 F72 ffl fi? 5, 1 ' N, Q AYQQQK' P P' -51,0 la 4.5, 1 q' s S955 XO' 'wx ly' , 6 A , 4? , ,, O 2 . -:egg , Q-4 .R Htiw tss 'Y f -A Q' W-gi fi YNQ-4 , 311. , Y r-'-s ,E fs ig if , .-sf, GUI hi xX ' 'fel' JL , x- Edward Stone, Kansas City, MO Le Anne Swenson, Atchison Brent Thomas, Springfield, VA Dixie Tilton, El Dorado Barbara Tipton, Pittsburg Sandy Tipton, Galena Linda Townsend, Overland Park Rick Van Pelt, Webb City, MO Mike Vermillion, Overland Park Lynn Villamaria, Frontenac Mark Warren, Uniontown Shelly Webster, Protection Joy Welsh, Lenexa Teresa Welsh, Garnett Susan Wheatly, Merriam John White, Columbus Rick Whitlow, Topeka Theresa Wiederholt, Parker David Wise, Overland Park Howard Worthy, Parsons Lovina Wolgamott, Pittsburg David Yoon, Yates Center Pam York, Columbus Patricia Young, Pittsburg Skip Bennet, Kansas City Backgammon and chess tournaments PSU offers a variety of sports actlvltles for students to become Involved with Is it knowledge or logic or just a lot of luck that enables people to win at such games as chess or backgammon? Many students find such games as these a pleasing pasttime time to get away from the homework grind You don t get much exercise playing them but then one seldom needs to call the game because of bad weather either Various tournaments for diligent mas- ters - or amateurs - of these various mind games were held throughout the year at several locations on and near the PSU campus. Ron Metz, Pittsburg Freshman plays SUB chess and back- gammon player Dale Duham, instruc- tor in the department of Business Ad- ministration participate in the tourna- ments. The winners in the tournaments were Joe Cisper, Lenexa Sophomore in backgammon and James Crockett, Stanley Junior in chess. The tournaments provided a chance for interested parties to match skills and learn a little from each other. And they're great opportunities to have fun, to find new people to challenge on the sly and to gain new ideas to brush up on before the next tournament rolls around. 411 ' C ' A Wii'A tire , 'K XY Q1-A ij g 'WYQU , A M i 9, ng' Qp..r.Q W i f'i S fi m e ' , -19? and ' W K I' 'Ui , , ' fi fff Z 'D if fm l'i am , X , X a 5 my-if tag ,V 1 - My aaa '- f., Q .A lt 'vfi T 'Q-7 ,il ,a I 'ff' 'F' ' 4 ,W . V , iw Dawna Alford, Peru 1 ' I ,ff V' Beverly Alkire, Osawatomie Q 1: pr 1 f ,ir Y' , 5, ,wi 'X Q , ff-A Q vw? Pamela Amess, Lawrence Allison Arnold, Pittsburg Kelly Bachman, Wellington David Badmann, Philadelphia, PA Sally Baker, Columbus Brenda Banks, Pittsburg Jim Barnett, Pittsburg Pamela Bawgus, Rockledge, FA Linda Beckman, Girard Lea Anna Beers, Lawrence Cheryl Belt, Columbus Patricia Berglcarnp, Mt. Hope Elizabeth Berk, Pittsburg Gregory Birdsong, Girard Timothy Bishop, Pittsburg Krista Bough, Pittsburg Kimberly Boyd, Kansas City Philip Brenner, Columbus Janice Brown, Kansas City Wally Brown, Derby Terry Butler, Tulsa, OK Linda Butterfield, Pittsburg Jane Campbell, Pittsburg f Connie Chase, Toronto Robert Coffelt, Derby Brenda Collins, Mulberry Lynn Connelly, Topeka Carla Conyers, Pittsburg Catherine Crowell, Oswego Cynthia Cukjati, Pittsburg . ,,,,l, r , ' ,X K . ,V , V, it AR A , if :hwy at ,,A. ' , ,nf X, G2 Ln' .iv S Y-W ,,h H f, , A-, 1 -rs 'av 1.15 '90 k , U ,lr - .1 w 424 . Vw ,, , Dana Cunningham, Shawnee Jerry Daniel, Baxter Springs Laurinda Day, Wellington Phillip Deill, Scammon Jeffrey Dilley, Wichita Debra Dittman, Pittsburg Robert Docherty, Pittsburg Catherine Duflin, Weir Laura Lea Dugan, Osawatomie David Dunlap, Parsons Larry Eckert, Kiowa Glenda Ellis, Lawrence Theresa Ellis, Pittsburg Sue Equels, Sterling Scott Enns, Haven Adria Fairley, Kansas City Rebecca Feuerborn, Greeley Allison Fitts, Overland Park David Fowler, Burlingame Paula Francis, Olathe Debra Freisberg, Lawrence Denise Freund, Topeka Cathy Galloway, Pittsburg Michael Galloway, Pittsburg Dorothy Gardner, Pittsburg Lorri Garrett, Altamont Joan Gast, Leavenworth Denise Genrich, Olathe Bobby Gholar, Wichita Cathy Good, Garnett Ronald Grant, Moravia, NY Gwendolyn Greer, Kansas City Angela Hammonds, Pittsburg Margaret Handsh y, Pittsburg Randal Handshy, Pittsburg The Disco Craze is sweeping the country. University students throughout the na- tion are flocking to discothetques by the thousands. With so many top rock bands producing such songs as Burn, Baby, Burn , Boogie Shoesn, More than a Woman , Get Down Tonight , Night Fever , and Inferno , it some- times seems more logical and a lot more practical to dance to a good recording than a cheap imitation. People everywhere are catching the boogie fever. Dances like the L.A. Hus- tle the Bus Stop, and the New Yorker are being performed almost anywhere the kids hang out, and theres music and room enough for dancing. Disco dancers don t just move these days. Today there s more organization in their steps. It s easy to feel a part of the crowd after learning the few steps that go along with any of the latest dances. Or make up your own and teach it to others. It s easy to be creative when dancing to disco. 7 9 7 7 3 Q I - . fasxsei, K ,-is ' .E f,.. ,... -. I ,KN f as . . f l X ,ov-Q Q si- .. I it K , nf f ...ig , y i , T . 4 . E is 'IF , , i ' .jf 3 1 l P 5 .77 - Ll' 5 ' Y P 'T' Fluff l N N ' . K 3- , -- '4 fo 'm 'i - 5' '- 4 -A ' A re A Y ...Q , , i if ..s. , ' S 4 . 1 0... ss. g , . K iight - fre- ' .ff . . ii f 'Q' RQ? -1 '- '1 - is ' xl ia Lana Hanson, Girard Roxanne Harman, Hiawatha Jerry Harper, Chanute Kim Hayt, Girard Shirley Herford, Pittsburg Charles Hester, Leawood Myran Higerd, Colby Debbie Horne, Princeton Jeff Horton, Chanute Terri Hoseney, Manhattan Patricia Hudson, Wier Janice Hughes, Lawrence Wendy hams, Eskridge Mary Jenkinson, Girard Deidra Johnson, Alden -.sg P N : I Q Q iw X - rrrrrr - X M 22 is '-:1:W1 is A V A Jolene Johnson, Overland Park f wx A - ,If Q it ' A'AA' -W Shawn Johnson, Kiowa -- fo 4, :oo ,, oo.o 5, T P ':'J T P 1' - - Stephen Jones, Fort Scott .V , ' M K Kathy Kapler, Baxter Springs AA -- - . , A X ,... - - Mary Keady, Pittsburg .- 1 'i1i'f Q., 15 r s ' tsigi..sr,1 sii-' N- flie r - ,fag gg A 1. P ' 'if -2 ' 2735 is ' - . r M tt N - . ,,', ' I I . re N Mary Keller, Pittsburg ,gs,a.v3.-55p K . g W , Sue Keller, Pittsburg fiff' M ' ' A - I I . V QI ' Thomas Kellogg, Pittsburg Q.. s- f K av ' 2 Karen Kennedy, Girard iff N, . H ee'i Marylyn Kilgore, Pittsburg rr f . l e r ' .r ::. ,.,. Q , -.,L Y E M , ' ,: . ..,, N,-,' - ,,,,. K r rll Q .t,..t SGW o i'-fy -15'l: tet P' 3 are in if x 6 ,N . , ,.E.....,x Q Ki-353 K Y? X 5 it X ig O zlz sg Q . . . F , s .. s' . L 'B' Country . . . Sherry Knight, Sterling Camille Kring, Lawrence Susie Kovacic, Arma Andrew La Sota, Franklin Lynette Ledford, Cherokee the music of Willie and Whalen has come to town. A growing number of college students are joining the masses of footstompers. Even most discotheques feature a cou- ple country-western-style tunes to throw out among the rock hits. The twang of a guitar enhances the twang in the singer's voice and seems to make it practical for even the worst tunetoter to sing along. The dance steps are just as organized as some of the new disco routines and require a good amount of energy as well as concentra- tion. Pittsburg is located in a good place to take advantage of both the recent coun- try and disco fads. The Greeks manage to include each of these as well as music of the 1950's in their special dances throughout the year. It just goes to show that no matter what the beat the younger generation is determined to en- joy themselves and that they will in- dubitably Keep On Dancin'. asv m,,W,..-,,,,. W f f- - , If g . r!.KY ..,4 ZZV , at f ' - g t, ?.Y l 1 Vlii , . ,e vs J' . 'W K if I , ' M P 1 i X K 9, eva kg: W at 4' I Mr., Q: -'L ' fu 1 A' I 'iw 1 J no vu. 'muff' A5522 51-1-uf L 1 lg its fl 4.1 xy w I , l 'r A ,. ,A , 3, Q-'-v 'Sl ff.. kan y v ffilf 47 ,,,, , fm. ,ax I tri- l ' ' ff f f' . 1 VV Q' .D f' B J -new--0 m N -t X A, K f'f..,,9 P X 'xl' E Q A ,. , gg . .,,, , in , ' or 3 '62, V - 3. V ,f , , , x .fr if - , wi J, ' my 7 I N, 'I ' -, 31, , . 1.41 X i. 4 ,f . ,W A j- , t 1, . J t . f , 4'b: 1 f 4- fl ' 1, J ,I 6.3, V! . n Sydney Lester, Pittsburg Galen Lewis, Douglass Kristi Longerot, Baxter Springs Judy Loyd, Girard Alan Lytle, Ottawa Ramona Madewell, Mindenmines, Cynthia Mages, Ottawa David Major, Columbus Reggie Mapson, Brooklyn, NY Kelly Margrave, Arma James Marrello, Pittsburg Terry Martens, Hepler Marilyn Masoner, Pittsburg Julia Maxton, Cherokee Dale Mc Atee, Parsons Thomas Mc Donald, Garnett Teri Mc Intosh, Ottawa Diane Mc Lean, Weir Francis Melle, Lenox, MA Stuart Minclr, Hicksville, NY Shahram Moaddeb, Pittsburg Maresa Monsour, Pittsburg Tracy Morris, Winfield Lonnie Moss, Bronson Kevin Myers, Lancaster Daniel Nairn, Kansas City MO Nancy Nash, Atchison David Newman, Leawood Karen 0'Connell, Shawnee Mission Scott ODell, Liberty, MO Mary Ellen Ochs, Leavenworth Peggy Owens, Overland Park Ramona Paarmann, Girard Pamela Patterson, Kansas City Robbie Pazzie, Girard uf'- ,iw X 19' 3 T it .. -:.'Q i 'I-Tx ,.,,v 5.4, 4 fr. bb. f-'W if r 4 6 Z ' f gilt W , if ,-'Q Q. sw l i: f ' Y Hn, , ,f 5 i J I l Q. :P f-:yu 'hyd' X. ' N A lv . ,Y .-va . ' Y 'fx ' Fi 'J N i'x ,gf ..j,fr tl 4.x W, ...JW ea 'Jn' ed in pf Kirk Pemberton, Winchester Marin Penner, Douglass Teresa Penny, Lawrence Rhonda Pernot, Mulberry Scott Pine, Lawrence Donald Powell, McCune Donna Powers, Kincaid Terri Raine, Fredonia Vicky Raine, Fall River Randy Reida, Cheney Michelle Renner, Garden Plain Connie Renta, Paola Ramela Rezwinkle, Altomont Anthony Ridder, Wichita Maria Rose, Overland Park Norbert Rupprecht, Denver, CO Vicki Schmitt, Columbus Lanny Schoeling, Iola Janice Scott, Pittsburg Marva Screws, Pittsburg Arlecia Scroggins, Pittsburg Michael Shapiro, Overland Park Kevin Shipley, Lees Summit, MO Gary Smardo, Franklin Carol Smith, Pittsburg Deborah Smith, Kansas City Marcia Smith, Pittsburg Scott Smith, Kansas City Marjorie Steffens, Girard Tamara Stueven, Kansas City, MO Joseph Stice, Parsons Iasbel Suarez, Columbia, SA Dennis Sullivan, Weir Judy Sweaney, Cedar Vale Clifford Taylor, Mission NJMQ x l -vt ,0- 94 w H me a n 5 x,A, I gff' 3 Kelly Teague, Baxter Springs Roy Treadway, Parsons Debbie Van Becelaere, Pittsburg Lori Von Soosten, Girard Eunice Walker, Pittsburg Kingsley Walker, Frontenac Kent Walters, Prairie Village Cindy Ward, Belleville Brad Wayman, Topeka Tara Weigand, Pittsburg Joe Weiner, Humboldt Larry Weis, Ulysses Steven Werder, Topeka Sharon Wetzel, Leawood Judy White, Overland Park Linda White, Columbus Sno White, Olathe Pamela Whitehead, Garnett Tammy Whitehead, Fredonia Rhonda Williams, Lenexa Sandy Williams, Oswego Judy Wilson, Chetopa John Wise, Overland Park Marie Wright, Kansas City Kathy Zager, Girard Brian Zuclr, Pittsburg Chlldren teach college students The college crowd certamly looks younger these days' A Actually these tykes are part of a col lege class The purpose of the class Child Development 335 IS to glve col lege students a chance to learn how to observe human behavlor as objectlvely as possible and to recognlze rn the be havlor of young chlldren the operatlon of prmcxples of human development The twelve chlldren ln the class fSlX boys and SIX glrlsl enjoy a varlety of actlvltles ln the Tuesday and Thursday mornlng class sesslons These mclude finger palntmg stones nature hlkes art and sclence projects games and snack tlme The program IS geared to provlde a Wlde vanety of experlences and to allow each chlld to select 8CtlVl tres of greatest mterest to h1m 'K 'Wap 4' KW' 'sis- jen MW I I I i lf ,,. liqf Q .1 '- 1 , e s 5 3 Q 1 5 K X c lg o w x - 'f T Y s . , , - . . , . , . , Y at . . . My ' ,fn 5421, Index Abel, Jackie Lynn 267 Abernathy, David Wayne 294 Ackerson, Renee Colette 176 Adams, Katheryn Godfrey 174 Adams, Patricia Lynn 205, 207, 230, 232, 238, 241, 282 Adkins, Perry Oliver Jr., 31, 172, 179, 267 Akin, Gary Nelson 46 Alcox, Clara E. 282 Alford, Dawna Lori 302 Alford, Robert 44 Alkire, Beverly Jo 302 Allen, John Wayne 33, 282, 200 Alley, Joseph M. 182 Allison, Barbara Sue 38, 99, 172, 196, 267, 288, 289 Alquist, Glenda Garcia 160, 169 Alsop, Eileen Elizabeth 42 Amess, Pamela Marie 34, 177, 302 Ammerman, Larry Dean 168, 267 Anderson, Bobbie Ray 52 Anderson, Cynthia A. 18, 267 Anderson, Jack 169 Anderson, Thomas Anthony 95, 171, 266 Angleton, Lewis Matthew 29 Antonetti Landia Swo e 267 1 P Arnold, Allison Jo 302 Aroonpairoj, Manoon 266 Asbury, John T. 44 Attalla, Micheal David 169 Atwater, Deborah Denise 54 Atwater, Lisa Renee 42, 94, 172, 267 Aubert, Mary Elaine 174 Augustin, Thomas H. 282 Austin, Dana Lorae 34, 184, 220, 282 Austin, Sharon Lynne 162, 163, 282 Azarmgin, Hussein 107 Baber,pJames Wesley 163, 282 Babich, Christine E. 171 Bachannan, Randy 175 Bachman, Glen Allen 282 Bachrnan, Kelly 302 Badmann, David Eric 302 Baeten, Linda Diane 34, 267 Bailey, Lloyd Herbert 267 Bailey, Regina ODell 63, 267, 193 Baker, Bradley Eugene 33 Baker, Gene Edward 185 Baker, Gregory Howard 267 Baker, Kathleen Ann 174 Baker, Linda Kay 177, 179, 181, 194, 196, 294 Baker, Linda Louise 214, 215, 231 Baker, Sally Frances 302 Ballou, Joe Dean 136 X Bandy, Patrick David 267 Banks, Brenda Kay 302 Barde, Alex 163 Barkett, Henry R. 31 Barnes, Fred Lee 172, 267 Barnes, Todd Wayne 182, 282 Barnett, Jim Kirk 302 Barnett, Teresa Doris 167 Barnow, Janell Marie 267, 193 Barrett, Thea Diane 185 Barrett, William Robert 133 Bartonek, Frank J. 266 Bartonek, Patricia L. 94, 130, 131, 132, 170 Bassett, Edgar R. III 30 Bastian, James Howard 44, 160 Bath, Brenda Lee 11 Batte, Steven Michael 46 Batton, Phillip Jeffrey 52 Baum, Nancy Kay 42 Bawgus, Pamela Peacock 302 Beard, Martha Jane 267 Beasley, Jeffrey Lloyd 50 Beasley, Robert Francis 50 Beauchamp, Curtis 33 Beaver, Chuck 184 Beavers, Andrew V. 229 Becker, Dirk Wyatt 282 Beckman, Linda Kay 302 Beebe, Jayne Krystal 267 Beers, Lea Anna 302 Bell, Christie Kay 34, 35 Belt, Bradley Jay 294 Belt, Cheryl Lee 32, 183, 302 Bender, Valerie A. 163 Benedict, Kimberly M. 148, 173, 282 Bengtsen, Barry Richard 120, 122, 1 Benignus, Robert Eugene 181, 267, 198, 200, 199 Bennett, Mary Kay 282 Bennett, Skip 300 Benoit, Pamela Sue 43, 58, 169, 183 Bergkamp, Patricia Sue 34, 302 Berk, Elizabeth Ann 120, 302 Besthorn, Bert Lee 177, 182, 266 Beth, Monica Fay 282, 48 Bettega, Robert A. 56 Bever, Jeanie Sue 162 Beyers, Jane 196 Beyers, Kurt 195, 196, 201 Bewiton, Beth 161 Bickam, Tony 201 Bilby, John Ray 29, 294 Billings, Tomi Pearson 183 Binford, Belinda Hope 98, 174, 180, 267 Bird, Russel Paul 163, 282 Birdsong, Gregory Kent 302 Bishop, Timothy Lee 302 Black, David Leigh 9 Black, Raymond Wesley 44 Blackledge, Steven Lee 50 Blancho, Suzanne 118 I, Bland, Rick Steven 56 Blankenship, Ruth 38 Blankinship, David A. 94 Blazek, Larry 171 Blessant Diane May 42, 179 Bledsoe, Vicki Gay 14, 267 Blessant, Jeanine S. 267 Bloom, Susan Janelle 34, 180, 282 Blunk, Judd Elliott 51 Blurton, Gloria Jean 161 Boaz, Mike B. 46 Bodwell, Mark Edward 266 Bohm, Clayton Scott 30 Bohr, Thomas Kevin 50 Bolen, Laura Jean 294 Boles, Rhonda R. 34 Borst, Barbara Ann 178 Botnick, Diane Louise 42 Boswell, Kirk 184 Bough, Krista Kay 302 Bowen, Della A. 193 Bowers, Kathleen K. 28, 34 Bowsher, Mark Allen 282 Box, Edith Ann Long 294 Boyd, Kimberly Lee Wanna 34, 166, 302 Bracken, George Raymond 33 Braden, Arthur Wilbur 266 Bradley, Doris 162 Bradley, Gwyneth Malea 294 Brady, William R. 165 Brant, Robert Samuel 29, 171, 183, 282 Brauer, Patricia L. 267 Breiner, Brenda Kay 34 Breitenbucher, James S. 29, 266 Breneman, Robert 33 Brenner, Philip Craig 32, 302 Brentz, Steven Mark 46 Brewer, Rebecca Sue 34, 180, 282 Briggs, George Arlyn 282 Bright, Bradford Lee 46 Bright, Deborah Lynne 267 Brightwell, Baery Lee 44, 294 Brillhart, Douglas Wayne 267 Brinker, Gerald Robert 50, 51 Britain, Ruth Mossman 267 Brock, Michael Duane 56 Brockus, Gary Lee 267 Brogan, Brooks, Broom, Margaret Ann 168, 294 Rebecca Allison 174 Gail Lynn 282 Brown, Ernest Jack 192 Brown, Janice Anita 161, 302 Brown, Kathy A. 282 Brown, Linda Kathryn 34, 294 Brown, Robert Leroy 282 Brown, Shellee 161 Brown, Brown, Victor Dale 164, 267 Wally Allan 30, 302 Broyles, Patty Annette 118, 267 Broyles, Susan Elaine 8, 294 Bruce, Lynne Renee 174 Brumbaugh, Teri 177 Brummel, Cathy 38, 56 Brunk, Sandra Sue '72 Brunker, Carol Ann 164 Buford, William Randal 120, 121, 12 123, 124 Cage, Kent E. 44, 168 Bukaty, Kevin Patrick 282 Bumgarner, Mary Patricia 34 Bunch, Scotty Shane 32 Burch, Martin 124 Burg, Matthew Huges 282 Burge, Billie Jo 38, 39, 149, 160, 16 282 Burk, Ruth Lee 267 Burnett, Deborah Elaine 34 Burns, Thomas R. 44, 288 Burris, Christi Lynn 167 Bushyhead, Roberta 294 Bustos, David Ray 54, 282 Bustos, Richard James 54 Butel, Marcella Clare 151, 267 Butler, Joyce Elaine 95, 160, 165, 2 193 Butler, Robin Colleen 282 Butler, Terry Alan 302 Butterfield, Linda Kaye 302 Butts, Robert Allen 181, 268 Byrne, Deborah Ann 34 Byron, William Kevin 54, 182, 282 Cagle, Pete Langley 268 Caillouet, Laura Jane 162 Cailteux, Virginia Ann 174 Caines, Charlotte Leigh 34 Caines, Cely 294 Caldwell, Curtis A. 160, 201 Cale, Chet Allen 167 Call, Karen Ruth 99, 165, 174, 268 Call, Mark Kenneth 268 Calguet, Laura 282 Callow, Kenda Rae 268 Carnac, Sharon Elaine 95, 168, 188, 186 Cameron, Kenneth Alan 17 Comody, Laura Anne 282 Campbell, Donald Edmond 32, 66 Campbell, Jane Ann 302 Cannon, Catherine Jo 32 Cantrell, Charles R. 294 Canupp, Trent 294, 123 Caple, Cheryl Kay 282 Carcheski, Cheryl 56 Carlat, C La Vonne 174 Carlson, Carol Ann 283 Carnes, Carol Jean 123, 160, 165, 190, 283 Carney, Jill Bollinger 268 Carpenter, Kathy Jane 179, 283 Carpenter, Sheila 76 Carrithers Luella M. 164 Carroll, Douglas Jay 123, 191, 294 Carson, Leslie Maureen 32 Carson, Marlin Lester 48 7 Carter, Janet Elaine 38, 59, 176, 48 Carter, Paula Fern 162, 294 Carver, Merlyn Lee 179, 189, 294 Casey, Gayla Jamesine 174 Caskey, John 169 Caskey, Marjorie 169 Castagno, Brent Richard 168, 48 Catatfano, Chris 178 Cathcart, Jean Carol 171, 294 Cauthon, Joyce Horrocks 268, 193 Cavanaugh, Patricia Ann 294 Cayton, Chad L. 31 Cedeno, Phillip Allen 94, 160, 171, 268 Chadwick, Ray Eugene 29, 268 Chalmers, Sharon Louise 166 Chalmers, Shirley J. 174 Chanbers, Floyd Paul 52 Chan Man B 196 Chan, Shu Cheng Tina 266 Chandler, Rosemary 283 Channel, Chris Eugene 294 Charsetad, Mohammad H. 167 Chase, Connie Lee 34, 302 Chatelain, Daniel E. 174 Chaussard, David Lee 180, 268 Chenoweth, Jerry Wayne 160 Chesnutt, Linda S. 268 Chester, Walter Leslie 31 Chien, Shu-Yuan 266 Chigboja, Simon Umamudu 151 Childers, Kevin D. 268 Chubb, Dana E. 268 Chuilon, Claire 169 Cicutto, Dianna Lynn 34, 283 Cigainero, John Thomas 48 Cigainero, Sandra Marie 48, 59 Cisper, Joseph L. 167, 294, 301 Clark, Jeffrey Lynn 294 Clark, Judith Lynn 268 Clark, Lacey Carleen 163, 188, 283 Clark, Linda Kay 283 Clark, Marilyn Kay 34, 184, 283 Clemons, William Thomas 33 Clifford, Jerome Arnold 8, 52 Clugston, Phillys Jane 165, 193 Coble, Denise Marie 283 Cobler, Robin Ann 283 Coffelt, Robert Dale 30, 160, 302 Coffman, Cindy Sue 184, 269 Coffman, Rebecca Lou 179, 184, 183 Cole, Andrew James 33 Cole, Bruce 201 Collar, James T. 48 Collins, Brenda Lea 302 Collins, Jayne A. 269 Collins, Kevin Lynn 183 Collyar, Lucy Denise 269 Connelly, Lynn Rene 302 Conrad, John T. 30 Conyers, Carla Stovall 302 Cook, Jeff Dale 168 Cook, Paul A. 46, 172, 288 Coomer, Cathy 48 Cooper, Charles Frank 168 Cooper, Judy Schoonover 269 Cooperrider, Terri Lynn 162, 163 Coover, Brenda Lee 193 Copeland, Jack Lee 32, 96, 132, 160, 165, 181, 194, 196, 269 Copen, Susan Marie 34, 174, 180, 268 Coop, Clifford Carlton 44 Copp, Terry Eugene 56, 168 Cornwell, Eve 34, 35, 283 Corpolongo, John M. 29, 183 Costello, Mark Anthony 52, 171 Costello, Patricia Ann 42, 160, 172, 173, 269, 108 Cowan, Phillip Alan 52 Crager, Judith Lynn 163, 269 Crandon, Richard C. 294 Crank, Erin Louise 169 Crawford, Amber Gene 121, 123 Crews, Paul S. 294, 296 Crigler, Robert Wayne 269, 125 Crockett, James Michael 301 Crook, Ronald V. 283 Crossland, Barbara A. 269, 193 Crowe, Kirby Harris 167, 177 Crowell, Catherine Jo 34, 241, 302 Crowell, Mary 180 Crowl, Frank David 50, 294 Cukjati, Cynthia Sue 302 Cullison, Rex 33 Cummings, Claude Alan 52, 133, 178, 179, 294 Cummings, Patricia Ann 99, 160, 165 174, 269 Cummins, Joetta S. 48 Cundiff, Mary Lorraine 207 Cunningham, Dana Elaine 35, 231, 303 Cunningham, Laura D. 34, 69, 160, 174, 180, 194, 196, 268, 201 Currier, James J. 46 Curtis, Tammy Jean 164 Cussimanio, Linda 269 Cyrus, Evalyn Stephanie 174 D'Amico, Larry Pat 48 Daleo, Joseph Lorenzo 52, 168 Daneke, William Martin 54 Daniel, Jerry Horace 303 Daniel, Susan Kay 185, 294 Daniels, Linda Peterson 183 Darr, Darrell Dee 269 Daugherty, Paul Alan 160 Davidson, Clarence F 19 Davidson, James 52 Davie, Glenn Martin 167, 269 Davis, Dawn F 34, 44, 283, 296 Davis, Gary Dean 283 Davis, John Arthur 33 Davis Kent Dale 284 Dawson, Craig Arthur 52, 284 Dawson, Linda Hill 269 Day, Laurinda Kae 303 Daylong, Kathy Jo 180, 284 De Laney, Douglas Carl 167, 269 Debouteux, Diana 175 Deckard, Judy Ann 284 Dedrichson, Dennis Joe 167 Deems, Cyndi L. 284 Deill, Phillip Byron 303 Dejam, Dariush 107 Dellasega, Dena Lynette 222, 227, 236, 269 Denham, Kevin Stacey 54 Dent, Roger Alan 160, 269 Denton, Cora Fae 32, 54, 284 Denton, James Andrew 249, 48 Depoy, Glenn Earl 50, 51 Detrie, Gina Lucille 270 Dettler, Devin 32 Dickens, Patricia 270 Dickens, Steven L. 270 Dickerson, Dennis D. 54 Dilley, Jeffrey Allen 30, 303 Dilley, Jeri Handshy 270 Dillon, Christine 125 Diskin, Robert Joseph 118, 171 Dittman, Debra Sue 303 Dixon, Charlene E. 284 Docherty, Robert K. 303 Dodd, Kelly Lynn 42, 214 Dodd, Sharon Kay 34, 35, 178, 284 Dodson, Charlotte 122 Dole, Gerry 228 Donnelly, Mary C. 284 Dooley, Timothy 56, 133 Doolittle, Gary C. 179, 294 Dorsey, Martha 161 Dorsey, Nancy Driskill 179, 270 Doss, Carla Jo 42, 179, 185 Dotson, Darryl 124 Dotson, Joni Lou 160 K Dowler, Brent Alan 30, 160, 172, 173, 176, 270 Daprer, Linda Sue 284 Driegsman, Helen 185 Drummond, Craig William 52, 271 Dudrey, Merrill Dale 52 Duesi, Steven Frank 168 Duffin, Catherine M. 171, 182, 303 Dugan, Kent David 52 Dugan, Laura Lea 303 DuHan, Dale 164, 178 DuHan, Dan 301 Dulek, Steven Thomas 167 Duncan, Oscar Merrell Jr. 29 Dunlap, David 303 Durham, De Wayne 54 Dutton, Katrin Linda 178 Duvall, Glenn Cecil 31, 182, 270 Dvorak, Terry William 167 Dyer, Danny Ray 284, 198, 200 Dykman, Gary Lynn 284 Easley, Melinda Kemp 180 Eastes, Jeff L. 52, 270 Eckert, Larry Leon 303 Eckl, Sandra Lee 34, 284 Edmonds, Shirley Eileen 38, 148, 149, 160, 172, 173, 177, 284, 112 Edris, Donald Laurance 270 Eighmey, James Dean 33, 188 Ekhoff, Carla Jo 32 Ekhoff, Edie Ann 160, 294 Ekhoff, Evelyn Kay 266 Elder, Michael David 52, 171, 285 Elliott, Steven Kent 52 Ellis, Glenda Noeleen 303 Ellis, Ray Duane 283 Ellis, Theresa Ann 303 Ellis, William Paul 46 Elmer, Michael Lynn 52 Elmore, Barbara Ann 285 Emerson, Beverly Ford 174, 180 Engkjer, Wane Scot 46, 213 Enns, Kevin Scott 30, 184, 303 Equels, Sue Lynne 303 Ermey, Randall Vance 54, 270 Esch, Lisa Gale 38, 285 Esch, Sara Jane 38 Evans, John K. 44 Evans, Linda A. 285 Evans, Richard Earl 48 Ewalt, Jodean Ranea 34, 179, 183, 285 Eyssell, Thomas Henry 178 Fairley, Adria Madella 303 Fang, Jaw-Hae 266 Fanimokun, Abiodun 285 Fanoele, Joseph Kent 122 Farley, Connie 186 Farrell, Kathleen Ann 64, 188, 270 Fast, Mary Elizabeth 38, 294, 112 Fasuluku, Amadu Bayoh 167, 266 Fehr, Cindy Lambert 48 Feldman, Debra Ann 285 Feldman, Patty Louise 270 Fenner, Alice Marie 270 Ferraro, Gina Marie 270, 193 Ferraro, Jackie Lynn 285 Ferrell, Susan Jean 75 Fessenden, Vicki Lynn 285 Feuerborn, Rebecca Susan 34, 38, 303 Finn, Catherine Summers 270 Fithian, David Ross 56 Fitts, Allison Rae 32, 177, 38, 303 Flakus, Barbara Jean 179, 180, 294 Fleming, Marjorie Nell 295 Flinn, Rodney A. 175 Flippo, Jeffrey 33, 74 Forbes, Eldon Doug 64 Ford, Alan M. 175 Ford, Daniel John 208, 250 Ford, John Warren 285 Forgey, Jeffery Lyle 285 Forsythe, Lana Martin 270 Forsythe, Larry Carlson 153, 185 Forsythe, Steven Wayne 52 Fosdick, Ira Lee 166 Foster, Joan Beth 177, 270 Foster, Mark Erin 270 Foster, Michael Bruce 56 Foster, Roy Paul 285 Fournet, Pamela Marie 174, 180 Fowler, Franklin David Jr. 303 Fowler, Jean A. 34, 35 Francis, Paula Marie 303 Frank, Sherri Lynne 196 Frazell, Linda Howard 270 Frazier, Herbert E. Jr. 196 Fredericksen, Shelley K. 179, 285 Freeland, Micheal 46, 47 Freeman, Catherine E. 160, 165, 190, 270 Freeman, Terrie Dean 31 Freeman, Wayne Edward 32 Freeze, Lucille Page 185 Freidline, Blaine Alan 270 Freij, Raja Elias 196 Freisberg, Debra Jo Anne 34, 305 French, David Chris 285 Freund, Denise Michelle 34, 171, 305 Friskel, James Philip 13 Frost, Careyn W. 32, 176, 295 Fry, Gary A. 246 Fry, James 164, 195, 196 Fry, Larry Raymond 50 Fugate, Douglas 164 Furse, Tony Ray 181, 196, 285 Gallagher, Richard Leo 207 Galloway, Cathy A. 305 Galloway, Michael Lynn 305 Galvin, Teresa Ann 118 Ganzer, Charles Philip 182 Gardner, Dorothy Ruth 171, 305 Gardner, Steven Owen 96, 163, 165, 270, 193 Garfin, Thomas Jya 48 Garrett, Lorri Karlene 32, 305 Garrett, Robert Wayne 123, 190 Garrett, Sandra Maxine 270 Garrett, Sanford Eugene 123 Gartner, Joan Pruett 193 Gasche, Brenda Kay 270 Gaskell, Jill Arlene 179, 295 Gast, Joan Louise 34, 288, 305 Gatton, Robert Allen 266 Geiger, Bryan Keith 295 Genrich, Denise J. 305 George, Timothy Jay 50, 286 Gerken, Denise Louise 38, 176 Gettler, Charles 32 Geurich, Denise 32 Gholar, Bobby Glenn 32, 305 Giannos, Steven Andrew 32, 50, 286 Gibson, Melissa Ann 34, 162, 286, 193 Gibson, Nancy Jane 42, 270 l Giefer, Cheryl Estes 174, 270 Gifford, Jon Raymond 136 Giglione, Carl David 32, 295 Gillespie, .Debbie J. 96, 165, 270, 193 Gillin, John Edward 52 Ginsburg, Mary Kathryn 29, 162, 286 Girar, Lori Ellen 44, 179, 295 Gist, Rhonda Sue 160, 270 Glaze, Dana L. 160, 177, 295 Gleason, Mary Beth 34, 42 Gleason, Michael Lee 33 Glennon, Robin Michel 56 Gloshen, Glenda Jean 270 Glover, Mercedes M. Lou 169 Glynn, Dan 200 Gobetz, Robert Henry 122, 190, 124 Godinez, Rita J. 32, 270 Goff, Steve Craig 177, 182 Goldsberry, Gary Lewis 270 Golob, Karen Jo 286 Good, Cathy Lynn 34, 184, 305 Goode, Phil 219 Goraker, David 162 Gordon, Kenneth Eugene 182 Gorentz, Anthony 74 Gorman, Mary Ann 32, 38, 295 Gorton, Susan Jeanette 95, 162, 178, 188, 270 Gott, Jamie Stephens 286 Govaker, David Anthony 163, 189, 270 Gowen, Doris Reed 99, 160, 165, 270, 193 Graf, Vicki Jean 272, 201 Graf, Victor Alban 286 Grafmiller, Janet 184 Graham, Diane 272, 174 ' Graham, Gloria Anne 34, 56, 179, 295 Graham, George 46 Graham, Jon Errol 31 Graham, Kimberly P. 295 Grant, Kathleen Barlow 295 Grant, Ronald Harold 305 Graver, Nikki Bell 272 Gray, Rinda Gayle 122 Green, Leslie A. 42 Green, Stanley Leroy 272 Greer, Gwendolyn Marie 34, 305 Gregg, Gay Lynn 272 Gremaldi, Den 162 Griffith, Geoffry David 266 Grigsby, Rolland E. 167, 272 Grilz, Linda Kay 168 Grimaldi, Kenneth J. 286 Grimmett, Patricia Grace 272 Grisham, Vernell Lyn 167, 272 Groin, Broch 31 Grose, Ricky Wayne 272 Gross, Mary Ruth 272 Gross, Montee James 177 Gupta, Swarna Pidara 178 Haaland, Donna Marie 183 Hackathorne, Virginia 200 Hadicke, Janet Kay 180, 286 Haefele, Debra Marie 34, 180, 286 Haesslein, Bill Karl 56 Hailey, Donna Marie 123 Hailey, Steven Patrick 123 Hale, Ruth 272 Hall, Derrick Grant 30, 295 Hall, Michael R. 50, 172, 183, 272 Hall, Robert Jay 272 Hammonds, Angela Rose 305 Hammons, Suzanne Ruth 162, 163, 286 Hampton, Vinita Lynn 295, 194 Handley, Mary Margaret 272, 305 Handshy, Randal Eugene 305 Hankins, Mark Alan 272 Hanks, Michael McCall 52 Hanners, Jordi Olsen 169 Hannon, James Wade 14 Hansen, Wilma Denney 68, 190, 272 Hanson, Lana Kay 304 Hanzalzadeh, Aziz 182, 272 Harbeston, Jay Roger 33 Harding, Timothy Lyle 32 Hare, Arlyn Van De 272 Hargitt, Mary Ann 185, 295 Harkins, Phillip L. 171, 266 Harmon, Roxanne Dee 34, 304 Harper, Carol Jean 272 Harper, Jerry Wayne 29, 304 Harrigan, John Dennis 284 Harrington, Christopher M. 50, 51 Harris, Jane E. 192 Harris, Leonard Jr. 123, 191, 295 Harris, Raymond Alfred 207 Harris, Timothy Paul 273 Harrison, Craig Alan 182, 295 Harrison, Sharon Knopp 178 Harrison, Terry 33, 72 Harry, Greg Alan 246 Harryman, Janic Kountz 286 Hart, John Leonard 30, 286 Hartshorn, Lynda Ann 295 Harvey, John David 32, 286 Hastings, Richard Gregory 182, 295 Hayden, Kevin Darrell 52 Hayes, Clayton C. 192 Hayes, Horace 162 Hays, E. Stephen 160 Hays, Paul Daniel 167 ,Hayt, Kimberly R. 304 Heaton, Hazel May Cox 181 Heaton, Kerry Lee 181 Hefley, Joyce Gayle 183 Hefling, Duane 32 Hegeman, Stanley Kim 123, 191 Heideman, Gaye Pauline 286 Heifner, Robert Allen 273 Heisten, Thomas Jacob 167, 48 Hemman, Deeanna 165, 185, 273 Hemman, Runold Raymond Jr. 17, 160, 181, 196, 220, 286 Hemmens, Kaye Elizabeth 168, 176, 189, 295 Henderson, James L. 56 -Hendrick, Greg 179 Hervord, Shirley Phillips 304 Hernandez, Gregory 189 Hernigna, Ober 54 Herren, Robert Michael 44, 273 Hester, Charles Edwin 32, 304 Hetrick, Mary Earlene 34, 184 Hettler, Steven 33 Hettler, William Edwin 46, 273 Hiatt, Chester David 283 Hicks, Harold Wilson 181 Higbee, Karen Jean 297 Higerd, Myron Ronald 184, 304 Higginbotham, Lynette A. 178 Hightower, Daniel Lewis 167 Hilderbrand, Linda Jean 297 Hill, Cindy D. 174, 273 Hillman, Michael D. 273 Hilt, Kim Allen 32, 286 Hilton Mary Carol 32, 38, 177, 183, 297 Hittner, Mark Steven 136, 171, 247 Hixon, Elizabeth Dawn 38 Hixon, Gerald David 29 Hofer, La Donna Joan 174 Hoffman, Robert Andrew 196 Hoheisel, Carolyn Kay 162, 193 Holewegner, Leigh 54 Holland, Rebecca Ann 176, 297 Hollowell, Rose Marie 177 Holmes, Kurt Alan 46, 172, 179, 286, 288, 289 Holscher, Deborah 174 Holtz, Jennifer Lyn 174 Honnold, David Alan 32 Hope, Lauree Janette 94 Horchem, Todd Alan 52 Horne, Debbie Ann 34, 304 Horton, Jeffrey Roland 29, 304 Horton, Pat 131 Hoseney, Terri Leigh 230, 231, 304 Hosier, Vicki Lynn 179, 183, 273 Hottenstein, Deborah Kay 286 Houchins, Andrew 123, 191 House, Joel M. 250 House, John Robert 54, 168 Howard, J. Scott 33 Howell, Chris Timothy 54 Hubbard, Dale Edward 123, 191 Hubbard, Pamela C. 286 Huddleston, Carol Anne 286 Hudson, Mary Alice 297 Hudson, Patricia Darrow 304 Hudson, Sterling D. 46, 220 Huerter, Karen Jean 43 Huffman, Mark Lee 172, 286, 112 Hughes, Jane Mildred 42, 214, 286 Hughes, Janice L. 304 Hughes, Larry David 297 Hull, Michael Raymond 46, 148, 149 172, 176 Hull, Mitchell Alan 286 Humbard, Suzanne Kelting 168 Humble, Joyce Lee 273 Humphreys, Jan Lea 163, 273 Huning, Loretta Lynne 273 Hunn, Monte James 46 Hunt, Ricky Dean 52 Hurley, Holly Emmons 179, 286 Hurt, Diana Kay 42, 43 Huston, Wilford 73 Hutto, Donna Joy 162, 273 Ijams, Wendy S. 123, 304 Iley, Eleanor Louise 38 lnloes, Diane Denise 96, 160, 165, 185 273 Inlow, Dale Dewayne 52 Istas, David L. 166 Izard, Donna Marie 38 Jack, Julie Diana 273, 193 Jack, Phillip Samuel Jr. 273 Jackson, Jennifer 286 Jackson, John Harvey 273 Jackson, Theresa Louise 273 Jackson, Thomas Ivan 273 Jacobs, Pamela Jane 32, 286 Jamar, Michael Oliver 164, 273 James, Douglas William 50, 274 Jamison, Gail Christine 297 James, Timothy Charles 44, 297 Janeway, Warren Scott 192, 286 Jarchow, Tracy Lee 32 Jared, Ibrahim 106 Jargle, Charles J. 46 Jarvis, John Michael 29 Jenkins, Mary Jo 174 Jenkins, Michael Louis 274 Jenkins, Rodney D. 286 Jenkinson, Mary Suzette 304 Jennings, Mary Ellen 38, 39, 161, 297 Jennison, Tindel Kirk 32, 274 Johns, Brenda,Renee 169 Johnson, Bruce L. 22 Johnson, Dee Ann 35, 56 Johnson, Deidra Ann 34, 162, 304 Johnson, Don Baker 181, 183 Johnson, Jolene K. 34, 54, 305 Johnson, Myron Eugene 145 Johnson, Shawn David 182, 305, 48 Johnson, Shirley Osborn 174 Johnson, Stephen Wayne 274, 186 Johnson, Steven Carl 99, 52 Johnston, Douglas Ray 185, 297 Jones, Brian Keith 44, 205, 207, 209, 229 , 274 Jones, Jane Colene 54, 38, 193 Jones, Kevin Lawrence 96, 185, 274 Jones, Marcia Lynn 38, 149, 297, 112, 201 Jones, Mark William 33 Jones, Stephen 305 Jones, Vickie Lynn 164, 179 Jones, Wilton Nathaniel 218, 221 Jordan, Ann Elaine 94, 58, 274 Jordan, Keith Lewis 30 Joyce, Jon Patrick 182, 274 Junk, Mary Judith 274 Kabrey, Tina 56 Kadel, Barbara J. 169 Kaisner, Keridan F. 34, 179, 180, 297 Kampmeier, Willard Earl 274 Kanetzky, Kurt Paul 286 Kapler, Kathryn Marie 34, 43, 171 Kapler, Kimberly Ann 171, 177, 180, 274, 305 Karappurath, Gopi 98, 107, 167, 274 Kater, Charles Duane 32 Katouzian, Kamyar 107 Katouzian, Sholem 12, 107 Kavacic, Linda 193 Keady, John E. T. Jr. 123, 191 Keady, Mary Jo 38, 305 Kearney, Billy Fred 50 Keller, Mary Ruth 305 Keller, Susan Kay 305 Kelley, Gina L. 34, 297 Kellison, Mark Lane 33, 189, 274 Kellogg, Thomas Charles 305 Kelly, Kevin Lawrence 56, 168, 297 Keltner, Greg 46 Kelting, Micheal 169 Kelting, Ralph 163 Kemper, Lori Sue 286 Kendall, Ossie Mae 123, 297 Kendall, Thomas Wayne 297 Kennedy, Karen L. 196, 305 Kennedy, Leann Calleen 204, 23, 232 Kensett, Carolyn J. 209, 14, 215 Kent, Delanna Rae 286, 8 Kenton, Lucinda Ann 38, 176 Kenyon, George Alvin Jr. 32, 167 Kermashek, Frank K. Jr. 160 Ketcher, David Ross 192, 287 Khanna, Deepak 29, 160 Killion, Kitty G. 160 Kemball, Dennis R. 56 Kimbro, Kimmy Don 48 Kindall, James Haworth 123, 123 Kindle, Steven Ralph 44 King, Cynthia Mosley 9, 287 Kingrey, Jodi 387, 38 Kinne, Cale Scott 163 Kinnett, Steven Mark 50 Kirby, Kelly Wayne 274 Kirby, Linda Irene 56, 58, 274 Kircher, Robert Lee 164, 274, 193 Kirkpatrick, Helen Sue 43, 189 Kittelson, Randy Lynn 44 Klein, Michael Glen 184 Klein, Michael Glen 184 Klein, Mike Stanley 297 Klossner, Fern 74 Kneiling, Barbara G. 287 Knight, Sheri Rene 305 Knoepf1e, Mark Gene 287 Knowlton, Terri Ruth 48 Kobel, Robert Drew 31, 182 Koehler, Robert Edwin 50 Koochel, Kevin Charles 56, 287 Koonrod, Guy 193 Kovacic, Susan Annette 42, 305 Kramer, Debora Ann 297 Krause, Ethel R. 193 Kreissliner, Melinda Kay 274 Kreutzer, Sarah Ann 297, 8 Kricher, Robert Lee 94 Kring, Camille Nanette 305 Krokstrom, Gregory Kent 50 Krone, Cheryl Ann 174 Krusemark, Nancy Marie Kubler, Steven Donald 197 , Jssc ciii 1 Kudrna, Pamela Rae 38, 297 iJs,c,i . Kuestersteffen, David B. 33 l Kuestersteffen, Patricia 2, 43,181, 4 199, 200, 287, 193, 198 5 5 J Kuehl, Frank 124 Kuhn, Kim 46, 47 , Kushu, Kevin 171 Kutz, Kenneth Vern 179 Laas, John 191 La Bounty, Paul Warren 297 La Sota Andrew David 305 Laing, Nita 165 Lains, Brenda 54 Lakey, Barbara Ann 162 Lamb, Christopher Jon 46, 220 Lamphear, Mike Stuart 297 Lancaster, Janice Leigh 297 Lancaster, Mark Stephen 44 Lang, Carol Louise 56, 172, 112 Langan, Rebeca A. 65, 274 Largent, Elizabeth M. 181 Larkin, Loren Dean 174, 180, 69 Larsh, Sharon Lynn 297 Larson, Robert E. 274 Lash, James B. 274 Lawhead, Jeffrey Dale 162, 163, 287 Lay, Bobbie Glen 274 Ledford, Lynette 305, 48 Lee, Dennis Michael 188 Lee, Judith Dawn 69 Lee, Kimberley Sue 287 Lee, Marilyn Renee 32, 287 Lehr, Andra 56 Lehr, William G. 56 Leichliter, Gregory Si 31, 182 Lemmons, Keith M. 287 Leonard, Carl Gordon 52 Leonard, Deborah Diane 189 Leslie, D. Louise 169 Lester, Sydney Gail 306 - is Leu, Sara Elizabeth 185, 297 is Levens, Joseph D. Jr. 167 9 Lewis, Alecia Anita 163 Lewis, Galen Dale 32, 219, 306 Lewis, Vena Patricia 166 Lickteig, Walter Joeseph 171, 274 Likely, Norma Lee 207 Lippelmann, Jon Eric 287 5 Little, Kevin Layne 50 Livingood, Gene L. II. 77 Lockard, Elizabeth, L. 192 Logan, Carita L..161,. s Lohkittikiat, Chukiat 2746 7 I Long, Rebecca A. 42 g Long, Robert David 218 A A Long, Susan Kay 162, 287 7 Longerot, Kristi Ann 34, 43, 306 Lopp, John Dean 274 Lorens, Heimer 163 Lovensheimer, Joan Ann 274 Lowe, Cynthia A. 42 Lowe, David Paul 118, 297 Lowe, Pamela Diane 34 Lower, Terry Alan 274 Loy, Annabelle 185 Loyd, Judy Ann 306 Ludwig, Kenneth 297 Luelf, David Dwayne 274 Lundberg, Cheryl Anne 274 Lung, Max Edward 31, 184 Luthi, Brenda Steele 33 Luthi, Rick E. 33 Luton, Linda Mae 287 Lutz, Susan Kay 32, 287 Lynch, Ann Arlene 38, 54, 214 Lytle, Alan Dean 32, 306 MacDonald, Scott Anthony 179, 287 Mackay, Carol 169 Madewell, Ramona Marie 38, 306 Madrigal, Rosa Maria 34, 180, 287 Maffry, Donna Nan 34 Magee, Richard Dee 54, 63, 275 Mages, Cynthia Marie 306 Mahmoudzadeh, SD M. 274 Mahnken, Donna Louise 174, 180, 274 Maier, John Edward 164 Major, David Michael 306 Malan, Susan Ellsworth 193 Manion, Howard C. 56 Manlove, Cynthia Lee 34, 184 Manners, Daniel D. 52 Manning, Christopher S. 192, 287 Mansfield, Jane A. 287 Mapson, Reggie 306 Marchini, Christopher M. 205 Marey, Don 32 Margrave, Kelly Jeanne 306 Marney, Georgia Taylor 266 Marrello, James Michael 306 Marschallinger, Joyce F. 131 Marsh, Brenda Marcille 274 Marsh, Elizabeth Ann 38, 39, 177 Marsh, Paul Adam 52 Marshall, Nyron Trevor 287 Marshall, Patrick Meck 287 Martens, Terry Lynn 306 Martin, Gregory Grover 52 Martin, Joseph Louis 274 Martin, Pearl Morehead 174 Martin, Rebecca Ann 179, 183 Martin, Terry Rudkin 52 Martinson, Anna L. 174 Maskill, Susan Ann 38 Mason, Hortense Paralee 174, 274 Masoner, Marilyn Shaver 306 Massoth, Michael John 275 Massoth, Ramona Ann 179, 183, 287 Masters, C. Bryan 196, 201 Masters, Stacy Newland 196 Mathis, Max 165 Matin, Debbie 193 Matthews, Marilyn K. 189, 287 Mattick, Michael Robert 48 Mattivi, Brad John 50 Mavadat, Mehran 167 Maxton, Julia Etta 222, 227, 306 May, James David 56 Mayerle, Joseph 52 Mayfield, Refa Hopkins 192, 275 McAtee, Dale Edward 306 Mc Atee, Dennis Paul 32, 297 Mc Atee, Donna Jane 168 Mc Atee, Katherine S. 168, 275 Mc Cann Charles Robert 29, 287 Mc Carthy, Janice Louise 34, 180, 287 Mc Carville, Cathleen A. 32 Mc Claskey, Carolyn Kay 34, 171, 297 McClure, James Albert 52 Mc Colm, Athena Marie 287, 193 Mc Coy, Linda 193 Mc Cullough, Steve T. 44, 220 Mc Donald, Thomas Kent 32, 306 Mc Dougal, Tina Marie 174 Mc Endree, Chester John 56, 287 Mc Ferrin, Gene 296 Mc Gowan, Robert M. 275 Mc Graw, Maura Helen 42, 43 Mc Intosh, Teri Lynn 56, 306 Mc Iver, Nolan Ray 56, 297 Mc Kay, Beverly Merrill 297 Mc Kellar, Bill Ray 287 Mc Kelvy, Steven Lester 287 Mc Kenna, Phillip L. 287 Mc Kibben, Kevin P. 44, 275 Mc Lean, Diane 306 Mc Leod, Loretta A. 174 Mc Leod, Robert Wilson 250 Mc Naught, Stephen Karl 46 Mc Nemar, Stanley A. 297 Mc Nemar, Steven T. 297 Mc New, Phillip 77 Mc Sherry, Sherry A. 179, 184, 297 Mc Wherter, Roger Dale 266 Meadows, Randy 144 Meads, Nancy Jo 34 Medley, Christopher D. 50, 183, 281 Medlin, Christen Divine 162, 287 Medlin, Curt Allen 188, 287 Medved, Steve T. 287 Meline, Kim Irene 177, 298 Melle, Francis William 33, 306 Melochoque, Melquiades 181 Melton, James Allen 94, 275, 186 Melton, Susan Teague 196 Mendenhall, Darcy Scott 44 Mercier, Kathleen Marie 34, 174, 275 Merndon, Ober 54 Merrell, Kerry Sue 289, 236 Metz, Ronald P. 160, 301 Meyer, Julia Catherine 179 Meyer, June 188 Meyer, Kathleen Louise 34, 160, 165 Meyer, Peggy Ann 160, 298 Mies, Rita Mae 42 Midfelt, Daniel Lynn 52 Miller, Annette Marie 163 Miller, Barrett 275 Miller, David 289 Miller, Diana Lynn 34, 27 5 Miller, Miller, Miller, Miller, Miller, Johnny R. 174 Lauritz C. 52, 275 Susan Jeanette 56 Tresa Lynn 48 Vincent Scott 196, 275 Mills, Deborah Rene 34, 289 Millsap, Marcia Kay 42 Minck, David Peter Jr. 32, 275 Minck, Stuart J. 32, 306 Mirocke, Anthony Gerard 298 Misasi, Mary Jane 161 Mishler, Mark Lonzo 44 Misse, Fred 178 Moaddeb, Shahram 306 Mock, Nietia Lorraine 275 Monsour, Maresa Ann 306 Monsour, Terri Anne 38, 39, 160 289 Montgomery, Michael Lee 56 Moore, Charles Alan 50, 167 Moore, Cynthia Sandlin 174 Moran, Barbara Lee 174, 275 Morgan, Lloyd James 33 Moriconi, Marilyn 289 Moriconi, Maryann 289 Morris, David Lee 48 Morris, Neil Wayne 56 Morris, Tracy Lynn 42, 200, 306, 198 Morrison, Barbara Diane 180, 289 Morrison, Janice Louise 38 Moser, Pamela Camille 189, 186 Moses, Mark 52 Mosher, James Michael 118 Mosier, Dan David II. 122, 177 Moss, Diane Gayle 275 Moss, Lonnie 306 Mott, Teresa Gayle 177, 275 Mullins, Dorothy Lee 163 Mumma, Steve 29 Munjak, Claudia Sue 42 Murphy, Barbara E. 166, 275, 186 Murphy, Norene Teresa 32, 298 Murphy, Timothy Michael 46 Murray, Caroline Sue 298 Murrell, Dawn C. 123 , Muzyka, Valia Marie 196, 289 Myers, Kevin Lynn 306 Myers, Teresa Ann 185 Myers, Wayne A. 289 Naccarato, Steve M. 48 Nairn, Daniel Timothy 306 Nairn, Richard Anthony 167, 275 Nash, Nancy Luanne 306 Naylor, Mary Barbara 162, 289 Neece, Rebecca E. 32, 289 Neer, Jeffry Keith 50 Neff, Ervin Edgar 160 Neil, David Lee 52 Nelson, Kirk 167, 275 Nelson, Grace Bennett 166 Neubert, Harold Kent 275 Neufeld, Nancy 174, 177 Pope, Greg D. 52 Neville, Ronniegl.. 13, 46, 47,sfj, Newman, David iss 'Anderson 306 Newton, Lee 124 4 Nicklas, Wayne Ferrel 182, 275 Nicoletti, Patti Lynn 34, 171, 298 Nigam, Gyaneshwar Nath 29 g Stephen 250 Nikravan, Shahla 275 Noble, Steven Clyde 52 Noe, Pamela Rae 289 Noll, Cynthia Jean 174 Noordhoek, Lyle Jay 162, 163 yooyo Narton, Shiela ehee Rae 275 Norwood, Sharon M. 275 Noyes, David Eugene 46 Nystrom, Judith Newby 174 O Connell, Karen Ann 306 O S7S:le Connell, Michelle M. 220 O Dell, David Scott 306 O Laughlin, Michael W. 33 O Neal, Jessie Tyson 183, 275 Ochs, Mary Ellen 34, 306 Ochs, Nancy Lynn 32, 160, 185, 289 Ochs, Richard Allen 32, 160, 179, 275 Oehme, Timothy Lee 167, 275 Offerman, William Verne 160 Olive, Marita Ann 289, 133 Oliver, Robert Allen 298 Olson, Pauline M. 275 Opfer, Wayne L. 289 Orszulak, Richard S. 291 Ortiz, Edward Anthony 15, 162 Ortolani, Alfred F. 171 Osburn, Stephen Eugene 275 Ostrander, Mark Alan 32, 164, 179, 275 Otter, James Leon 175 Otter, Jerry 171 Oujiri, Timon Matthew 56, 298 Overton, Richard Leon 218 Owen, Peggy Lou 34, 306 Owsley, Kathy 123 Paarmann, Anne Ramona 306 Paden, Mark Taylor 50, 94 Page., Raise, Page, Page Page 9 Darrell R.,160, 194, 196 Frank Warren, 24, 25 Karen L. 275 7 0 Leslie Kenneth 275 Rodney Dean 275 Palnier, Marchella Marie 291 Panter, JohnnyggDale 48 Paocery, Mark ,168 Parcell, Richard Mark 167 Parker, Carl William 275 Parker, Larry John 16, 276 Parker, Stephen,Doug1as 48 g Parks, Gregory Dean 160, 2983 Parlier, Sheree 32 Parrish, Janet Renee 276 Parrish, Rebecca Sue 165, 179, 190, 276 Pattee, Thomas Anson 160, 196, 291 Patterson, John C. 46 Patterson, Pamela Denise 34, 306 Pauley, Mark David 50 Paulie, Linda Theresia 18 Pazzie, Robbi Ann 42, 306 sser O Pearce, Mark Douglas 167, 276 Pearson, Kris L. 121, 122, 123 Peltzer, Peter Edward 218 Pemberton, Kirk Wesley 307 Pence, Terri Sue 174 Pendleton, Michael Dale 283 Pendleton, Randy Glen 162 Penner, Martin Lewis 32, 307 Penny, Teresa Liebert 177, 307 Pernot, Diane Marie 42, 160, 291 Pernot, Rhonda Jean 42, 307 Perry, John Brian 28, 31, 149 Pestinger, Jay 52 Peter, Rollie Wayne 182 Peters, Diane Marie 34 Peterson, Michael Lars 56 Peterson, Paul 48 Peterson, Robert Lee 247 Pettus, Jon Mearl 44, 172, 188, 276, 186 Pfeil, Susan Kay 34, 195, 160, 165, 174, 180, 276 Pham, Vu-Kin 106 Phillippi, Teresa Lynn 34 Phillips, Kathy JoAnn 162, 163 Phillips, Linda Lee 179, 291 Pieper, Teri 291 Pierce, Deborah L. 193 Pierce, John Wayland 56 Pike, Warren Albert 52 Pine, Scott Douglas 33, 307 Pistole, Kathi June 42, 44 Pistole, Timothy Clinton 54 Pittman, Dale Eugene 166, 291 Pittman, Daniel E. 276 Pittman, Mary Tucker 291, 193 Pitts, Sheryl Ann 34, 153, 166 Placke, Debbie Lynn 39 Plank, James Allen 291 Ploof, John Wesley 122, 123, 163 Plumlee, JudithgNew1and 196, 276, 201 7 Plummer, Robert Allen 56, 298 Poanick, Eve 165 Poelma, Suzan Dianne 276 Pollmiller, Brian Alan 50, 291 Ponten, Bret 331- 1 Poole, Michael Patrick 298 Poole, Robert Gregory 54, 75, 196, 201 Pope, Rex Leroy 50 Pope, Thomas Allen 185 Pope, Waneta Lavon 291 Porter, Monte L. 291 Porter, Rose Cudworth 291 Porlier, Sheree Lynn 276 Portz, Stephenslerome 47, 171, 205 3226, 228, 108' 3 Posch, Jane Stephan 231 Potter, John Michael 276 Potter, Marc 298, 44, 73 Potter, Michelle Lea 178, 276 Pouncey, Melinda Denise 34 Powell, Donald Loren 397 Posell, Sandra Funk 162 Powers, Donna Jo 34, 123, 307 Poznich, Charles Robert 185 Poznich, Eve Ellison 276 g Praither, Vivian11Lee 34 Predika, Antonia Anna 298 J Preston, Donald Floyd 50 Price, Cynthia Ann 291 Price, Debbie L. 34, 144, 166, 298 Pruett, Clara,Louise 168 Pfilitt, Becky Sue 34, 43, 162, 163, 291 Pryor, Kathy 38, 291 Pursley, Kevin Joseph 276 Pyle, Ruth Dianne 277 Queen, Jess Franklin 47 Quenoy, Di Ann Marie 298 Quinlan, Mark Joseph 183, 146, 48 Rabus, Mark Randall 196, 204, 250, 277, 252 Raine, Terri Lynn 34 Raine, Vicky Renee 307 Ralph, Joan Rae 42, 298 Ramsey, Linda Nelle 291 Randall, Marilyn Beth 32, 177, 298 Randels, Edwin Lee 266 Randels, Kathryn Eddleman 291 Randgaard, Donna Irene 32 Rangel, David Mario 220, 298 Ratanayanont, Kitirut 266 Ratanayanot, R. 277 Rather, Keith 'Leon 291 Ratzlaff, Robert 178 Rau, Lesa May 164, 277 Raynor, William J. Jr. 52 Recker, Kathy Joan 42, 43, 179 Redburn, Cheryl Anne 27 Reddy, Mark Dennis 196 3 ' Reed, Bruce Carroll 250 Reed, Carl Douglas 277 Reed, Rodney Joe 27 7 Reese, Mitchell Lee 277 Reese, Toni Ann 298 3 Regehr, Donna Kae 277 Regehr, Larry James 291 Regier, Connie Mae 223 Shaver, Greg Allen 33 Reida, Randy Leon 307 Rellihan, Barbara Susan 236 Rentko, John A. Jr. 56 Renner, Michelle M. 34, 307 Reno, Claude Benton 193 Rentz, Connie Sue 34, 307 Rexwinkle, Pamela Gay 34, 307 Reynolds, Alisa Mae 166, 169, 277 Rhoades, Richard Fowler 56, 277 Rhoads, William Lee 174, 277 Rich, Davene 291 Richard, Lisa K. 42 Richman, Debra Ann 39, 56 Ricke, Gerard 31 Ridder, Anthony Joseph 30, 172, 182, , 307 Riley, Robert Kevin 44 Riley, Teri Schliep 277 Renehart, Jay Merlin 54 Ritter, Tony 171 Ritzman, David Allan 52 Robbins, Ardys Maurine 162 Robbins, Gary Bryan 44 Roberts, Doug 44 Robertson, Cindy M. 32, 277 Robertson, Laura Lorene 27, 186 Robinson, Brenda Sue 42, 161 Robinson, James 277, 56, 133 Robison, Robbie Dwight 50, 172, 291 Robson, Robert Dale 50, 220 Rodich, Steven Eugene 10 Rolf, Carol Jean 277 Rollow, Trudy Lynn 161 Rommelfanger, Karen M. 39, 298 Rommelfanger, Donald 33 Rommelfanger, Micheal 33 Roos, Mark Gerard 277 Rose, Jacqueline Sue 34, 298 Rose, Maria Faus 32, 307 Rose, Steve Eldon 298 Rountree, Mark Alden 163 Rouse, Elaine Ann 39, 291 Ruble, Pamela Elizabeth 169 Rule, John Alan 47 Rule, Scott Lee 46 Rupprecht, Norbert 307 Russell, Gale Lynn 185 Russell, Gene Edward 167 Russell, Judith A. 277 Russell, Nancy Atkerson 174 Russell, Renie Sesker 174, 277 Ruth, Janice Kay 174, 180 Ryan, James Timothy 167 Ryan, Sharon Lee 160, 277 Ryssemus, Stephan 46 Saathoff, Douglass Craig 167 Samplem Margaret Lynn 277 Sanders, Fred 50 Sandlin, Larry John 277 Sangster, Barbara Ramey 277 Sangster, Ian Michael 277 Santagata, Elsie Rae 164, 277 Sargent, Clayton E. Jr. 277 Sater, Bryce Mac 291 Scalet, Jane 96, 165, 174, 176 Scassellati, Carla Jean 152, 299 Schatz,'Thomas Francis 52, 168, 271 Scheffield, Joyce 174 Schields, Bill 124 Schimmel, Sue 122, 123 Schmidt, Terry Gene 33, 52 Schmitt, Vicki Michelle 22, 307 Schmitz, Nicholas R. 299 Schneider, Carol Marie .176 Schnichels, David William.. 291 Schoeling, Lanny Genef?3G7 Schooley, Karolyn Kaye34, 133, 174, 277 Schrum, Roger Paul 99 Scott, Janice Irene 307 Scott, Kathy Lee 291 Scott, Shelby 186 Scourten, Phillip Horace 205, 228 Screws, Marva Nelson 307 Scribner, Timothy L. II. 277 Scroggins, Arlecia L. 161, 307 Scroggins, Secenia Denae 161 Scronce, Michael Lyn 32, 277 Sears, Diana Kay 277 Secrest, Angie Barr 220, 291 Seeley, Mark David 181, 196 Senger, Jeffrey Lynn 52, 291 Severt, Rayma Kay 176 Shackelford, Kerry 30, 200, 201 Shaffer, Mark Logan 299 Shaffer, William Kelly 182 Shade, Ken 252 Shapiro, Michael Bruce 164, 307 Sharick, Darrell Arch 266 Sharp, Derrillyn Marie 120, 166, 179, 190 Shaw, Judith 178 Sheldon, Cherry Eileen 2911 Shelton, Lisa Katheryn 10 Sheppard, David William 144, 277 Sheppard, Patricia Diane 34, 54 Sherrel, Marjorie Brust 277 Sherburne, Michael Lee 33 Shields, Paula Jo 174 Shinn, Teresa G. 162, 291 Shinn, Willard L. II. 54, 200, 201, 291, 198 Shipley, Kendell 189, 277, 186 Shipley, Kevin Lee 307 Shipman, Ellen Kay 174 Shipman, Randy 76 Shireman, Gregory Dean 172, 277 Shirmen, Marilyn Beth 174, 279 Shoemaker, David Mark 291 Shore, Kent Harrison 52, 291 Shortell, Patrick Joseph 31 Shultz, Brian R. 184, 185, 299 Siebert, Mary 223, 230, 236, 238, 241 Siegel, Marc Steven 279 Siemer, Mark R. 31 Sigler, Sheryl Lynn 299 Sikes, Alan Ray 247 Silovsky, George J. Jr. 31 -uw Simkin, Curtis Eric 51 Simmons, Donald Jerome 226 Simpson, Janice K. 279 Simpson, Teri Jean 179, 299 Sims, Debra June 169, 291, 193 Singleton, Joel David 31, 54 Singleton, Marsha E. 279 Sinkovic, Sabrina Lea 299 Sittner, Michael Lee 179 Sizemore, Carol Ann 34 Skaggs, Annette Sue 38, 39, 176, 179 299 Slabaugh, Michael Lloyd 11, 279 Sloan, Janet Elain 292 Small, Linda Jane 189, 279 Smardo, Gary Louis 207 Smethers, Ted William 167, 279 Smith Smith Smith Smith Smith Smith Barbara Jean 12 Carol 307 Darlene Louise 299 David Frank 95, 184, 279 Deborah Ann 166, 307 Floyd Marion 279 Smith Gregory Louis 136, 218 Smith Jennifer Frances 179 Smith Kathleen Susan 32, 279 Smith Kim Renee 279 Smith Smith Smith Smith Smith Latricia Andrews 279 Lynda Sue 59 Marcia A. 198, 200, 307 Mareta Jean 179, 200, 299 Micheal 56, 57 Smith, Peggy Ann 32, 279 Smith, Richard D. 279 Smith, Robert 118 Smith, Rodney, Jerome 292, 201 Smith, Ronald Lee 185 Smith, Scott Alan 160, 307 Smith, Steve 252 Smith, Tamera Jane 32, 183, 299 Smith, Tammie K. 39, 176 Smokewood, Cathleen M. 163 Sneeringer, Judy Alene 174 Smider, Richard Lee 61, 279 Snodgrass, Judy F. 169 Snow, Karen Sue 279 Snyder, Michael Lee 56 Sode, Olaseni Oludayo 18s Soden, Jack Dennis 184 Sohl, Timothy Louis 32 Soleimani, Karen L. 292 Soleimani, Mohammad 266 Sommerhauser, Elaine M. 29, 299 Sonner, Lenny 33 Spears, Jeffery 175 Spears, Harrison 201 Speedone, Linda Sue 279 Spence, Dan 54 Sperry, Kevin Matthew 185, 247 Spineto, Susan Patrice 163, 179, 188, 279 Sprague, Terri Elaine 279, 201 Sprunk, Nancy L. 299 Sprung, August W. 47, 292 Stanbrough, Marita Ann 34 Standley, Terri Jo 32 Stareck, Catherine L. 42, 112, 172, 299 Staton, Jerri Dawn 43, 161 'nlr Stauffer, Leonard E. 31, 299 Steele, Jan Elaine 43, 172, 299 Steele, Robert Allen 182 Steeves, Rosemary Simon 174 Steffens, Marjorie Rae 307 Steffens, Paula Sue 162, 299 Stephens, Jon Roy 279 Sternberger, Joe Everet 54 Steuernagel, William F. Jr. 33, 44 Stevens, Dean Lee 178, 292 Stevens, Doug 52 Stevens, Mike 52 Stevens, Rosemary 279 Stevens, Stanley Allen 51 it Stevens, Tom 52 - , Steventon, Brian. Lynn 184, 292 A Stewart, Ruby Christine 144, 292 Stewart, Sandra Carole 34, 180, 292 Stewart, Steve Allan 33 Stice, Joseph 307 , Stickley, Terry Joe 196 Stillis, Nancy 299 Stine, Christy Hale 185, 279 Stockdale, Marilyn L. 192, 279 Stockstill, Ronald E. 185, 279 Stockwell, James P. 196, 122 Stockwell, Pat 124 Stokesbury, Debra Ann 43 Stolp, Delores Jean 34, 43, 279 Stone, Edward C. 160, 300 Strang, Alan 122 Stratton, Danny Lee 48 Strick, Diane Lynn 43, 54 Stringer, Jim 201 Stroh, Lee Allen 220 Strukel, Gayle Lynne 174, 279 Stuber, Otto Paul 29, 292 Stuckey, Douglas K. 51, 160, 172, 179, 183, 198, 199, 200, 292 Stueven, Tamara Rebecca 307 Suarez, Isabel Fernanda 29, 307 Suhr, L. Scott 44 Sullinger, Jana Cyrisse 162, 163 Sullivan, Dennis Edward 307 Sullivan, Judy Newport 192 Summers, Craig 31, 57 Summers, Ronald Dean 163 Summers, Stuart Jeffery 31 Swaney, Greg Cecil 172, 173, 178, 179, 279 Sweaney, Craig Hugh 51 Sweaney, Judy Annette 34, 307 Sweeton, Stanley Lee 32, 95, 279 Swenson, Le Anne Denise 56, 300 Syers, Sharon Kay 169 Tabrizi, Mahmood T. 266 Tallmadge, Richard D. 31, 279 Tannehill, Catherine M. 94, 279 Tanner, Marvin John 54 Tatman, Nancy lzada 163, 292 Taylor, Clifford Darrel 32, 307 Taylor, Larry Wayne 46 Taylor, Michael Gene 57, 124 Taylor, Steve Lee 292 Teague, Kelly Suzanne 34, 308 Terry, Amerita Jean 292 Thiessen, Pamela Jean 39, 54, 58, 279 Thomas, Brent Alan 33, 188, 300 Thomas, Harold Glen 185 Thomas, Joyce Darlene 222, 230, 238 Thomas, 185 Nonetta Irene 95, 160, 165, Thompson, Howard Anthony 185 Thompson, Nick Kevin 54, 292 Tierney, Daniel Lee 185 Tilton, Dixie Lea 179, 180, 300 Tipton, Barbara June 300 Tipton, Sandra Joann 32, 300 Tocci, Paula Marie 123 Toeller, Mary Therese 181, 198, 199, 200 Torrance, Janet Jean 292 Soth, Bonnie Isabelle 174 Toughey, Thomas Frances 51 Townsent, Janet Lynne 160, 279 Townsend, Linda Lee 32, 300 Tracy, Donald Bruce 293 Tracy, Terry Ann 169, 293, 196 Trant, Mary Ann 280 Trasbey, Debbie 171 Trual, Ann Aarie 163 Trual, Laura Mae 280 Tredway, Roy Thomas Jr. 308 Trefz, Darla Ranae 166, 174, 280 Trinklein, Gary Michael 44 Trowbridge, Pat 178 Tullis, Mary Sue 34 Turner, Patty Gayle 185, 280, 193 Turner, Thomas J. 293 Twarog, David Walter 280 Uhler, Philip John 184 Unruh, Robert Duane 31 Upchurch, Camilla Ann 122, 266 Valentine, James G. 39, 56 Vallacqua, James J. 171 Van Becelaere, Debra Ann 133, 308 Van De Mark, Larry Dean 44, 148, 152, 172, 173, 280 Van Leeuwen, Diane P. 280 Van Pelt, Rick 51, 300 Vance, Bruce Richard 51 Vanderwilt, Jill 174 Veatch, Melinda Lee 180, 292 Ventura, Sheryl Lynne 204, 208, 230, 232, 238, 280 Vermillion Michael E. 182, 300 Villamaria, Janet S. 51, 99, 133, 172, 173, 280 , Villamaria, Lynn A. 133, 171, 172, 177, 179, 300 Vinardi, Donald Lewis 167 Vining, Terry Glen 196, 201 Vogrin, William J. Jr. 181, 196, 201 Vomhof, Lowell James 174 Vomhof, Susan E. 96, 133, 280 Von Fange, Bruce Todd 30 Von Soosten, Lorri Lea 112, 172, 308 Voorhes, Karen Rae 174, 280 Wachinski, Judy W. 164 Wade, James Merle II. 220 Walker, Becky Lundine 280 Walker, Bette Raye 43 Walker Walker, Walker, Walker, Walker, Carl III, 266 Cathy Ann 43 Douglas 184 Eunice Duncombe 308 Kingsley 308, 122, 123 Wallace, Jamie Rae 56 Wallin, Timothy W. 54 Wallingford, David Neal 32, 293 Wallrich, Michael James 196 Walters, Kent Howard 32, 164, 220, 308 Walther, Thomas 178 Waltrip, Mark Joe 51 Wang, Lora 179 Ward, Cynthia Leigh 34, 308 Ward, Daniel Mulligan 32 Ward, Patricia Bray 16, 98, 280 Warffuel, Morgan Ernest 293 Warren, Gregory Ray 29, 280 Warren, Mark Edward 32, 300 Warrior, Susan Lee 95, 165, 174, 180, 280 Warwick, Stuart A. 48 ' Watson, Alfonza Jr. 196 Watt, Beth Ellen 39, 174 Watts, David Leroy 51 Watts, Sharry Jane 293 Wayman, Bradley Lee 32, 308 Weast, Debra Sue 34 Weast, Roger Dean 293 Weatherby, Thomas Alan 182, 185 Weatherford, Dwight David 52 Webb, Susan Kaye 293 Weber, Ann Elizabeth 34, 180, 293 Weber, Gary M. 120, 121, 122 Webster, Glenda Sue 43 Webster, Shelly Rene 300 Weigand, Tara Ann 308 Weiner, Joseph Edward 30, 171, 308 Weir, Lisa K. 32 Weis, Larry Wayne 30, 308 Weise, Roger 54 Welch, Jimmy Ray 293 Wells, Beverly Rowe 281 Wells, Lewis Jeffrey 48 Welsh, Joy Lynne 43, 179, 300, 163 Welsh, Teresa Lynn 300 Weltzheimer, Sara Ann 293 Wendler, Kristopher Kip 54, 174 Werder, Steven Francis 32, 308 Wesley, James Allen 281 Westerman, Beth Ann 34, 43, 293 Weston, Lynda Kay 188 Wetzel, Sharon Sue 32, 300 Wheeler, Kenneth Ray 47, 56, 196 Wheeler, Sandra Thornton 65 Willis, Cherri Diane 34 Wilson, Charles 169 Wilson, Elizabeth Helen 188, 281 Wilson Eris Boyne Jr. 293 Wilson George 29 Wilson 9 Wilson, James Clark 283 Judy Lynn 34, 308 Wilson, Mark Allen 32 Wilson, Ronald Lee 167 Wilson, Terri L. 98, 163, 179, 185 Wilt, David Alan 162, 163 , Wilt, Diane Marie 293 White, Judy L. 32, 308 White, La Deen 281 White, Linda Lee Shaffer 308 White, Michael Richard 51 White, Sno Juanette 308 Whitehead, Tammy Lea 34, 184, 308 Whitlow, Richard Eugene 163, 300 Wiederholt, Michael G. 52 Wiederholt, Patrick F. 52, 173 Wiederholt, Theresa M. 2, 39, 177, 181, 198, 200, 300, 302 Wiest, Jean Anne 293 Wilbert Nanc Jean 281 , Y Wiley, Kenda 266 Willard, Rhonda Raye 174 Williams, Cindy Camille 183 Williams, Debra Kay 201, 220 Williams, Gaile Linnet 176 Williams Williams Williams Williams Williams , Karen Kay 123, 266 , Roger Daniel 33 , Ronda Lea 308 , Sandra Dean 177, 308 on, Matthew F. 32, 287 Wimmer, Nancy French 281 Winter, Gina Mae 281 Wise, David Michael 207, 250, 300 Wise, John Russell III. 29, 308 Wiseman, Patricia Jean 174 Wisehall, Ruth Ellen 34, 281 Withrow, Homer 47 Wittmer, Phil Neal 162, 184 Wolf, Gregory J. 207, 226, 227 Wolf, Nancy Ruth 174, 281 Wolfe, Michael Dean 56 Wolgaott, Gary Lee 293 Wolgamott, Lovina Leonard 300 Womack, Nancy Lee 177 Woods, Morris Gene 281 Worfuell, Morgan 171 Worl, Kathy Ann 48 Worthington, Charlotte 34, 94, 165 174, 281 Worthington, Garry Lynn 167 Worthy, Howard D. 300 Wright, Marie A. 34, 166, 308 Wu, Jennifer 106 Wurtenberger, Carol F. 34, 281 Yoon, David Kyu-Hon 33, 179, 300 York, Pamela Sue 300 York, Sandra Lynn 293 York, Sunny Gaye 230, 231, 232 Young, John Anthony 30 Young, Patricia Troutman 300 Young, Richard Allen 29 Yulich, Grace Lorrain 166 Zafuta, Beverly Jean 168, 223, 281 Zagar, Eris Ann 95, 160, 165, 180, 281 Zagar, Kathy Jo 174, 308 Zagorski Astrid Cruet 169 Zahner, Thomasine Mary 171, 281 Zimmerman, Betty Anne 293 Zimmerman, Pamela Lee 95, 160, 169 281 Zimmerman, Steven Ray 281 Zirkel, Donna Kay 39, 172, 176 Zook, Mary Elizabeth 293 Zuck, Byian Charles 308 Every individual accepts various chal- lenges during his lifetime. This is the reason that today man has the auto- mobile, can fly, has gone to the moon, and has done a million other things that gives him feelings of personal satis- faction. I guess that's why I accepted this position. Now suddenly it's all over and for some crazy reason I feel like doing it all over again. This past year has, without a doubt, had its ups and downs for myself as well as the Kanza. Being appointed Kanza editor last January, only after being on the staff a year, and a PSU student a year and a half I had my work cut out for me. But with the help of my staff and advisor Bob Stockfield, we were all able to work together and produce for --we !!w- the Pittsburg students this book of memories of 1978. As the years wear on, clear images be- come distorted and confused. Record- ing the year on paper is a difficult task because no two people will ever remem- ber something exactly the same way. So we ask you not to judge this book today, but wait. If this yearbook brings you memories of PSU during 1978 . . . then we have succeeded. I'm glad I had the pleasure of being part of it, and thanks to all those who helped. I hope you enjoy it. Theresa Wiederholt Editor 5 i Hunan 'af 14 S foe! gig V. A? w F K ig ,A mki is E 1 - A . 3 ' my Sr! an 204 Vw A' f si Uv' K.. 'rd' f ,f f wr an - 19 ui' ,. N
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
