V' J VV--15 75531-V ' ',i1,,V V, 1 .,v ' y , . .VZVVVVVVVv,VV,.1Vz.:,-:VVV V V VM3kVWW?7wV2'V'V4i4,,, , V V V V A V VV , V V' , V ., 'FV M55435'?mffVfV6Y V V- V .5mXv,W,f.-,,1.,,e,,, Y-,,,,eygqz:g,gp,5,-wyfwfwigmfl , VVI'V'Qfriffflawzfzfyrjf- L -3vf'4Z'?:,vAp,z-8446 Ve: V . y,ffZfwVV,g mrwfv ' -, V Q3nfVVV:f1'VVV'VyffM,,,eVY,uqgV,mwafky-.1V 'V WQWMVFWTMV . V Vf,V,- fx VVwgyvcg,VVVqV,aQfmw:VVz.V fffmwgwzfz V,122 Vf2w,:V V Q .,fg,,V'.wgeV21g,g,g,g,,4f9if, 57:4 71,awmgfl:,4,5gy-aywfqgvyy.VQJMV4yn37273,I . 'V '!V'T4 2l',7'77V' - M11,VVV:e1i:iV'1f,V,V :ZWVfVVV,V,M'ZW?Va'ff - V'wi,i? V' fa m VV - ,V,V.9w4,vL525q'2jM .Vg4,AJqgf'vV1,'555f,L4,,,yf,,,,fj:wf1zo,sj-,1V,VgV15fQ11fVV .Lama'VV?r'4f5MH,,,w,wm,' :Hwy V,.:,ff2?VVV,Mgw:49, . Va V VV . 4 1,55 f-as-.ff V V V ,aff 1 Vw- , V, V ,z V -1 VVV,,i:'pc:VMW .,:m5?VV.,,, ,-vm VpV494Vm4f,,, ga, ' VV 'f?'ff'?gg'-Z-'V '2f V, '3VV'1' -ww. Af V ' 2' ,Sf -4.,VAV L M'9!B?W157j' 4, Vf' V' ' 1f 'f?LWfiV, V ,V ,V V , 1' VJ V. f Vwvy ,,1,aV,y,z,2fE5V4Vx11W6- 17,,,n.1I24h'y :FV . , V V 'gyg.2ViQgg2'g.zgyn,5v-J6',Qf4, 14 ,.-,Q1,.fV,VW.g5,Qp5v,5g,, VV:iVV, ,,,, V ,V . .- V . . ,V,.w6Sg'a,wif-2V+gsf-'-,zV ,V4i'Aff.r :12Vpx,iV,fMZf z4fL,,V , 1, ,f,, gyggdhywmmfwq'KWH V V V VV V V ,','4.pivgV-YIV1'3L'V9Zi422,?fg1 ,ffm 1'VA.7f-nlV'5F4Z'??fg ' ,-'fV,VVVi'Vff'fvfwMVuV V '12WV f . . V -V VV ws,--, .V Viv V C PP VVVVV'4'V,V V, :fV4zV'-'VV 'r'xfZ'2YwV :46VV,cw'fWVV,1::'nV VVWvfV?f77,4gVf . W V V f+ gf:m'Va'Q e. :Vf??eaV5VV4fwf:4-WV ' Wwyi' WYVW 'V'VVVfs1V ff'-VVW4a5-'fW 2iV Vfifhiifiwwiyff3VW'V'7fV V V' VV ,Vjgedjf :AFL gfsq .mf ,fVa.4gg1ai:Q. Ayrw., -.59 '1,,.'g:ZqV.z22.4, V gv'VqPi4yVjQ,VgF275fi' ,g, VF .V, .V ,L I, fwafwfafi, 1- Lf ,Vw ww x V- Ar . VV Hr -- V VV f, ' 1,V.x55'wHV'1v.V,w:e Vw aw. 'VV m,f.V,,,MWV,.fwV V fluff'-e.'VE ,iq-Vf:Q5,l2j' V KQV-'xifzffx-Z -ffV2fgVnfi5j?f'5' gf' -c- u,Vfn+:V:xV MC: V,nVV?4' 'dugg' V V VV4rV?V fffwi.-ryzr ,VVM4y,,.V2f:mVV,,w.,,m,y1,,mwVV .Jw wus- , V V..-VM.-.,f,gVaVV14uV V...V1,:,ew1f+:V-,if -fVVV1fw2V , , ww VV VV mV,bVV,VVAfm:wV VLV,fLW4,V,,w.f VV mf V A-gfVVm+Vrfz 124-wa-VV 4' ww: -V-W.,VVV V,f4c.V.fVf1qVV.V, ,fr 'JL'fvwff'li'-V1,,wgf'Q4 55:VVf'5!5zwmV23?wVw'fcf,w+V:V .rf bf Vw- f vc' 5 V ,gy V fa'ff1 -,xg-:nw V,!r5tW ,JP ',,TC fif,,,35' ,,g. Vymqm, I V,.s gf Vgftfilf'ZHWf47yhgx'y.V74VVf :Ww'f1QiiVe', .ali-113513, gV1c,'-,V-4. V5Y+V'Kgi.-gQ',1i.?fKj,!!r4V 5JLp :V-V fwfr ,.g'4V,1':g- ' sg -, ,Vw 'zzfgji-Vfw f,'V.QV,' pw ,V , 477, VW 1 ,V ,QWTQ , 'GVVf41,,QjwV4,p:,-X, Vg-V1nj1MjmyM?M'V, V VV. - wefiiff-fif'!fV1zf1VfV vVavV-21-QCQVVVVYWVVV 1,.VgV:V1:VVV,e1V' 9'1E'5iZf,.Zi'fr1,V4Zf ' Q, VV, V , , VV ' V'.'fi?3VVff-JV!!-0VVVV.P?,42:V1f-V:f.Ys-..4'V1gV.v:.Ag.Vm..V WV? 2, .415-VVV . 'V ,, ,fm V 4- V, vw-5ZQM4fL4,,VVVVw,Vgyj5,fyVwVV,WnVVVw V ' 'Viw-PV4F'irfz:,'t1-5.g,wrmnV-rv.,572-4-tfsfz-V'1VVfV'TV':V9ZV?vfV.j.,J-VV Z-V -'MV-p-Vffiwdifff 475' .1 V' ,ff 'iw an M1qgZVVf?Hr9w2V VV:x,VVVQ.-,Vww:pV+'fVaVsf:,,2, ffVf,c+ . 4, We Vw' ,VV'3,V:V,.V,f,7 'VfffVwVV Vv. Vmwv -,- V--??m,'.zme:3VV.:.V,V- .., 1- W, 11f,.VV-V. V V-.ffm V '.-V- VQVM-rl ,V:,,-5-my-,Vf,, 'm'mbyw4WpV 4,4 ff- V544 VVQ VmVV2,V , 314 'V V-IVV-,,,x'3,4-V ' 5-F' -GN?VJZV Vi.'17W'N.,V1f' V: 51 VVVVTVA-4V1r:r,h1IV.fV,yK,VV-?4V:'VVVV,zVVVV.VV' vw, 'W Off V, V VV 'V ,wi any Hn V ,V -. 1 f A-H V 45f1'1-111939-if'1i3c':?V5A'6f-fya?V?l1JJ,:1I 954 -Vswfff ' Vg'+., V w '1 - Nw -,V-11 f1.V,4wy,,--4 V V . VP f..fV'bw4 1'lv1riVsa'-fsgfwiff Va LV' .fy ' 9:11 V M V ' ,MW ' V w V ,df -,M ,,f A 'Vg-,Q . J 1, V1 I V. A' ,V V -1. , . 5, ,I VVV, A - If M V , ,A -I V , , nn V6 ff ,V ., ,V 11 I ,,,, 9 '17 f,VV ,V . V ,,p.,H.f1,, im ,3 ,VV.?fw-gi, S., -V V ,Vw-, -VVVVJZB-f-,VV?,va'5Ks??A13'Znr!-VV'-af, 195491 wV ,Z7irff, , H f V V ff.-f f ,V W2,,4 . .MZ- '- V MG'?e5511f5' :Ai qzV1?:glV-, V V-VV?'?Vff'fq.f1U':V -My-5 Ve!1fe'i'-ef' :P 'V .4 1mV:w 'l1 'f ' V4V M',, 'ifnwtf' Whcfgc V 19587 VV V V,..Vf.-,.,' '1Vf.. V V,!VQfY'1Qw1,:.Ef,V V,.,:y- V21-V,g: :,4. 1-3-.ry--: VVV A,V,g?F'faAxV42,V,7. VV1!-wg-1i V..5mwVL 1: 'fp ,VifV'4 fV V V , V WZWQLV xfwkcmv, wVVVf.V4V wig - -MH ' HJ- f'v4-5vV fV:Z '?iV'faJ'Vx2' w,- -21' VV'-'f531.4f. VfV:'.Vfw.::?f'if'zux:V H'VVV'aW75V'.V-V-y?:V4wVs-'VV6f1wVV!. rw' Vf 'fVMfV.V1f Z-'YW auf' ' VV V.'afVfV7?9'i257VV ' 'VW' x,V F Wm 'Raw-4g55?2V 'Z V:fZ JZ 1-Vi -ng-Mu lvfkf.--se'5'-'4'L.fV, '1'-hm w-,wf',.1V,.V2V- 'www V an :I VV VWWWYZB747 Wu ' .,+, V 4: 6402 if V ,V :V V61 .VVVcVVV:VlVVflmf5MM,gW, V ,V .V V 'Vffim-V-VVV-VV-wr 'F5'gJ'1if'-' fi 'VJZWMPV gmws'4'+uVYf4w2aVVg'VV:f',wie-1zQwfVVVV V -' . V . ' ' ,M V?'- V' vu-4':n1'VQE31'iV. P V 1 . 1'- gi ' ' V' Vi'iV:1 'K'f' V' YH-53 ': ?,i!5ZJVifVW-'f. V,pf, A '5Q5gga?2'Wff,,,'VHa. 'Vi 'lr' V VVV V ', , ,, ,vw , . - ,. 1 V - , ,TWVWQ 1' 'V -V4,V - ' 'iii V J H472-V Vi,V '4f'df,?21'7T 4 h'ff V WVVV ' Hlfwyfw- ,w4ch'6'VV,'!w, TV. 'V ,, 'VNV 4-iff' -an- V +36'+: eil! ,Q ' VV -, V9'VV , pf 'F' '1fVWf.'iLh.z'w,,,.1Mfw15f4lV?' 9i,V ,, ,'7,V KV M, , , V ' 'V . 'V J Iff-7 4'3f53'Efif?F 'iiF'.ViZ'71i.vW' 4'7J VVl4ifVVf'5f WH, 1 - if ' ' V ,Vf , 1 1 -V, 1 - V zen, , 'V V -VV a,Vf,,,g4V V fy V ,VV V V.Vf,VV'VfV1v:VA'iVVi'4V:Vw', 'W-ff 235zf', bG'a1Zf79f'V, V fr M , G !5f ,wV 11237, V ,lf -af mf M pv1?fVfywW.,Vwm,4wV 11fV'f'VVf':VV Vn+,:T'!m1':QVW!1'Gaz:4V? :ff-::f2'99V57-HW-2f',VVV 1. V' 'i'42Vff2,w.wV V,'Y'W!?7'4Jf +V 'V , . .- V,V,.gVVVf,V-,ggfnsfiff ,wf,4fg,,V+.,7V,VVV,,yp.,'V M ,, VV,VW,V,V m?lf VV ,,V, ff, , fV 4 V V, V , ffm? '5vV4-.4-Ay V 0.1 f,,- , 1 VV V V, .,V, ., iz V.,,y,H, VMVM ,V1V,VV,V,,,, f, . . ., V V V V .'V:V ,244 V7V,,, 9 , ,k,,,, .7,V,V- -4 434, 4, V ,w f VV ,Vf. V 4 fvwfly Vf V Www, kwfyjfww 'V J 1. 5 '7 ' ':'fV' ' ' 'Vff ' ' V , V -,V4V1:rY.g, ' -7,2 ,LVL , :k g V V , . , , Q Y,- ,- ,Vi1?:71gIf,' ,V V T, fg2V5V:f.g V, I':LQV,jL,.'f',gV?gV3f3',V X VV ' V ' ' V V' V f ,V fn- V VVf+Si'ffVV' V' V Lgcgww, , J5gi3agiVVzqj4J 15253--,VV-f.',Vi,'Zj,j V VV 1-VAV.,l,2,-4 ., ,V A., U, .K , H - V 3 '-V- 'IVV' VV - V,--- 'Wg' 'W' H Q V' V- V -V Til L---1-'Vipxi' V- 4-nggsgjrj V- AV - -A-75.552-f -Q .,,.ML,..,,:,L7!94,. ,, A Amr Y Y V-A A--YA U --'Lk -in-U ' V 5 . Q, V FMQSL gui HC-ft! .m W' . 9, XN , was baba -,,,.,...,,, its w ' E XR 'Yi A it 3 I K ff a 3 Rx fpmk 2 ' f XM JA 2 4' if Q X , ,V+ H 3 Z www ,o0 ' ww' 1 NN., , Sk . -N4 .-- fffsxk. x 'X Lf 'W-X 1x75 Q E HONG KONG WOG DAY ' --,cxf T' , P' , 'mf - kg' , -if ,QB SPORTS 2 TABLE OF CONTENTS ,,., .. . TABLE OF ON THE ROAD AGAIN GULFPAC 1991 FEATURES Battle of Peleliu 4 Ship's Mission 6 USS PELELIU 8 The Storm 10 DAPA 25 Ombudsman 26 Wives Support Group 27 Ships of the ARG 56 Big League 58 Peleliu Funnies 59, 142, 161, 241 Word Game 41 Religious Services 42 Organizational Chart 44 Embarked Landing Craft 46 Editor 50 Asst. Editor 51 Departure 52 lwo Jima 56 Jeopardy 62 Fiery Vigil 96 Poem 105 DEPARTMENT CALL Commanding Officer 16 Executive Officer 20 Command Master Chief 25 Chaplain 24 Commodore 28 Chief Staff Officer 50 Phibron 5 Staff 52 TACRON 12 40 Operations 55 Navigation 82 Deck 86 Medical 114 Dental 119 SUDDI5' 120 Executive 155 Air O 144 Steel Beach Picnic Craftline Messages Embarked Aircraft Unrepfvertrep Stars of the Storm Navy EOD New Fathers Statistics Sports The Persian Gulf Photo Contest Memorial Assortment Advancements Wog Day PACE Tiger Cruise Bravo Zulu Late Arrivals Index Combat Systems Safety Communications AIMD Engineering CCO MarComDet 109 112 115 140 156 158 160 162 164 171 214 220 250 251 254 274 520 525 550 556 544 178 195 194 202 242 268 275 Hong Kong Dubai UAE Abu Dhabi UAE Singapore Hawaii -1-qu iii -1-1 -qu 11-1 1-1-I ,- g11- -1.1141- ,1-F111 Colonel Murray Mission Executive Oflicer Command Element BLT ACE MSSG MARINES 104 166 215 256 521 280 281 282 284 285 286 287 288 'I 15th MBU Fiery Vigil IWOJIMA in ELV370 .......-...-.- .,. iwo MMA TABLE OF CONTENTS 5 THE BATTLE GF PELELIU Peleliu is a small lush green jungle, about seven square miles in area enclosed by a coral reef, just like hundreds of other islands sprinkled across the blue Pacific leading to Japan. This island and others like it are relatively unimportant today. However, rn the Fall of 1944, 1,252 gallant young Marines gave their lives to wrest Pelelru out of the hands of the Japanese. Thus completing one more step in America's march across the Pacific. It is entirely fitting that USS PELELIU bear the name of this volcanic coral island honoring the brave men that fought and died there. The plan for assaulting and capturing the island base was simple and direct. First, soften the island defenses with naval gunfire and aerial bombardment. Then before the enemy can recover send in the Marines to storm the beaches and dig in. The next task rs the hardest, inch by bloody inch, dislodge an enemy that is battle-hardened, well entrenched, and cannot retreat because there is no place to retreat. Major General Roy S. Geiger, USMC, was no stranger to this type of warfare and lead the First Marine Division and the 81st Infantry Division with confidence and dread. He knew the Marines would win, he also knew the price of that win. To do the softening up, Rear Admiral Jesse B. Oldendorf commanded five battleships, eight cruisers, and 14 destroyers. The moming of Sept. 15, 1944 was classic in its beauty and serenity. The island the Marines assaulted gave no hint of the death and hardships that lay ahead. The softening up began and soon the island was lost in the haze and smoke of the explosions. Circling overhead, like so many buzzards, were 50 planes from nearby carriers. They dropped tons of explosives on the unresisting island. While the bombard- ment continued the small landing craft in orderly rows swam for the shore through holes opened in the surrounding reef. The bombardment lifted, and for a short time an expectant hush fell over Peleliu. The bow ramps fell in shallow water and the Marines charged. The peace of the beautiful day was shattered once again and it would not stop until November when many lives on both sides were over. Costly experience had taught the attacking Marines that tanks would be essential. Scant minutes after the first wave had landed, tanks ran through shallow water and rumbled ashore. One of the first objectives was the airfield. On Sept. 16 it fell to the Americans. Immedi- ately repairs began to make it operational. Two days later a Navy torpedo bomber made a successful emergency landing, and the next day artillery spotting planes commenced regular operations from the strip. 4 BATTLE OF PELELIU I l 3 Fx 'sg' A '59 ' .:' Y H3 vi rj, if T 9 I 1 i I 5 i 1 PELELIU ISLAND Two weeks after the bat- tle began, almost the en- tire island was in Ameri- can hands. As the last of the gunfire died away the island retumed to its qui- et ways. lt would take na- ture some time to repair the ravages of war and the airport would remain busy until the war's end. History had once again been written by the brav- ery and courage of the Marines. The Devil Dogs, as the Japanese called them, had won yet an- other battle. To over- come the 10,158 Japa- nese defenders the Ma- rines lost 6,526 men. Of these 1,256 were killed in action. It is to these gallant war- riors that this great ship has been dedicated. The Peleliu stands ready to deliver and support its cargo of heroes to wher- ever they may be need- ed, by sea, by land or by air. HQNGKONG N .PALAU The island of Peleliu is part of the Palau lslands. BATTLE OF PELELIU 5 PELELIU S keel was laid on November 12 1976 and the ship was launched two years later on November 11 1978 She was christened on January 6 1980 by Mrs Margaret Hayward wife of then Chief of Naval Oper ations Admiral Thomas B Hayward On May 5 1980 PELELIU was commlssloned at Ingalls Shipyard Pasca goula Mississippi USS PELELIU translted the Panama Canal on May 20 1980 and arnved at her homeport Naval Station Long Beach Callfomla ln June 1980 She was underway for her first deployment by March 27 1982 and made her second deployment on September 12 1985 Almost two years later PELELIU deployed on her third deploy ment visiting the Westem Pacific and Indian Ocean on January 14 1988 she departed for her fourth deploy ment again to the Western Pacific WESTPAC 90 was launched on January 12 and her most recent deploy ment CIULFPAC 91 was accompllshed dunng the pen od of May 29 to November 27 1991 in support of Operation Desert Storm in the Persian Gulf PELELIU S m1ss1on IS to embark deploy and land ele ments of a landmg force in an assault by helicopters landmg craft amphibious vehicles or a combination of all three methods It may operate independently or ln conjunction with a large force conducting a1r and sur face operations USS PELELIU was designed to main tam what the Marine Corps calls Tactical Integnty getting a balanced force to the same point at the same U time. She can carrya complete Marine Battalion Land- ing Team CBLTJ, along with the supplies and equipment needed in an assault, and land them ashore by helicop- ter and for amphibious craft. This dual capability, with emphasis on vertical launch and landing of troops and equipment, aids the Navy-Marine Corps Team in carry- ing out its present-day amphibious mission. PELELIU'S survivability is enhanced by two Close-In Weapons Sys- tems CCIWSD and two automatic five-inch guns. A secondary mission of the PELELIU is evacuation and disaster relief- was put to test during the Mt. Pinatubo volcanic eruption in the Philippines in June of 1991. Hundreds of tons of medical supplies and foodstuffs can be carried in her cargo holds and delivered to disaster victims within minutes of PELELlU'S arrival on 6 PELELIU HISTORY the scene. Fresh water and electricity could be pro- vided from the ship's engineering plant until domestic services are restored. PELELlU'S medical facilities can accommodate as many as 500 patients and provide out-patient treat- ment for hundreds of additional sick or injured. Two thousand evacuees could be brought aboard by heli- copter or landing craft and transported to safe areas. Most recently, PELELIU served as flagship for Com-- mander, Amphibious Squadron Three during CIULFPAC '91. In the past she has served as flagship for Com- mander, Amphibious Squadron One and Amphibious Squadron Seven. PELELIU has participated in numer- ous exercises, including her first appearance in TEAM Eight stars across top of shield - sym- bolizes eight Medal of Honor awardees from the assault on Peleliu Large Roman HV in center of shield - LHA-5 Ring in lower left of shield - by tradition of heraldry, a ring or annulet symbol- izes the fifth born SPIRIT '88. Some other exercises were VALIANT USI'I- ER, KERNEL USI-IER, COBRA GOLD, RIMPAC and REA- DEX. While on GULFPAC '91, in addition to some of the previously mentioned exercises, PELELIU participated in AL HAMRA I and II, and SEA SOLDIER V during de- ployment in the Persian Gulf. PELELIU has visited many fascinating ports of call, in- cluding: Colon, Panama, Balboa, Panama, Vancouver, B.C, Canada, Pearl I-Iarbor, I-Iawaii, Subic Bay, Philip- pines, Pattaya Beach, Thailand, Singapore, Hong Kong, Pusan, South Korea, Pohang, South Korea, Sasebo Japan, Yokosuka, Japan, Okinawa, Diego Garcia, Pele- liu Island, Guam, Dubai, United Arab Emirates: and Abu Dhabi, United Arab Emirates. 712 7 -1 Four-pointed star in center oflarge HV - symbolizes four functions of the Ll'lA it at ' X Emblem of lst Marine Division - Con- stellation Southern Cross, with numer- al superimposed T Motto - PAX PER POTEHS: Latin for I 'Peace Through Power S E I 9 pk flilll E PELELIU HISTORY 7 MILESTONES Keel laid . , . . . .12 November 1976 Launched ........ 11 November 1978 Christened .......,.. 6 January 1979 Commissioned . . . ...... 5 May 1980 CHARACTERISTICS Displacement .,,. .,.. 5 9,500 tons Length .4.... ,.,.,. 8 20 ft Beam ..., ...,...........,. 1 06 ft Draft .,.... .......,......,....,....... 2 9 ft Propulsion ............ Steamf70,000 shaft I-IP Crew ........ 55+ officers and 851+ enlisted Troop Capacity .170+ officers and 1750+ en- listed Speed .,... ,.... , .r.,..,..,., 2 0 plus knots Evaporators , . . ,r... 140,000 gallons daily Range miles .,.....,rr,r.. 10,000 at 20 knots Aircraft: The flight deck can operate a maxi- mum of 9 CH-55 Sea Stallion or 12 Cl-l-46 Sea Knight helicopters: the hangar deck can accom- modate 19 Cl-l-55 Sea Stallion or 26 CH-46 Sea Knight helicopters. A mix of these and other helicopters and at times 6 + AV-8 Harriers could be embarked. Design: Beneath the full-length flight deck are two half-length hangar decks, the two being connected by an elevator amidships on the port side and a stem lift: beneath the after elevator is a floodable docking well which is capable of accommodating four LCU landing craft or one LCAC and two LCUs. Also included is a large garage for trucks and AFVs and troop berthing for a reinforced battalion. Storage for 10,000 gallons of vehicle petrol and 400,000 gallons of JP-5 helicopter fuel. 55,750 sq. ft. is available for vehicles and 116,900 cu. ft. for palletted stores. Fire Control: Mk 86 Mod 4 gunfire control sys- tem and two Mk 15 Phalanx close-in weapon systems fClWSJ. Guns: 2 5 154 caliber and 6 20mm guns. Fiscal: Approximately S229 million. Electronic Warfare: ANfSLQ-52fVJ5, 4 Mk 56 SRBOC chaffroc launchers. Radan 5D search:SPS 52c. Air search: SPS 40B. Surface search: SPS 67. Navigation: LN 66. Fire Control: SPG 60: SPQ 9A. Air traffic control: SPN 55. Medical: These ships are fitted with extensive medical facilities including operating rooms, X- ray room, hospital ward, isolation ward, labora- tones, phannacy, dental operating room and medical store rooms. Electronics: Helicopter navigation equipment provided. Equipped with Tactical Amphibious Warfare Data System QTAWDSJ. Fitted with OE- 82 satellite communications antenna, SSR-1 re- ceiver and WSC-5 transceiver. Also equipped with an NTCS-A and JOTS network. 8 PELELIU STATISTICS l I 1 x Q 1 I w Y Wt E A 1 .ff X NS. i ...W...,....,.E,.,Mx W....... M,,.M,.-,,..,,, ...........,f,..4.7 ,...,M,.v, ff--,-VM,--4--,-N--V 5 ' . 1 , , . , , i 5 ,-,HLWM ,,, ,,.. ., ,,.. , Z ,....,.........-...4...,,....,7 ,,,v-'jj-:-f-vM,,NV V f....-,....,...j,T,...,,,..,x E,.T...,..-..,EA ,..,,,-,......M,., PEACE THROUGH SUPERIOR FIREPOWER oPeRAnoN nesenr sronm E uvvonr oun rnoovs 10 THE STORM in A MESSAGE FROM THE CHIEF OF NAVAL OPERATIONS Operations DESERT SHIELD and DESERT STORM were a magnificent chapter in the history of our Navy and our nation. Our hardware worked, our systems worked and our training worked. But most important, you worked. The superb professionalism and skill you demonstrated were directly responsible for the significant and successful contributions made by the U.S. Navy to the allied military coalition. Our active, reserve and civilian personnel serving in the I region, those deployed to other areas of the world and those who supported our forces from shore commands were critical to the allied victory. All of you did your part, and performed exceptionally. X The rapid and effective integration of reserve forces into active units proved the strength of our total force concept. The moral courage and devotion to duty displayed by our POWs inspired us all. And I share with you the hope that our missing comrades will soon be recovered. We also remember those who have made the ultimate sacrifice. we will forever honor their valor and preserve their memory. Through it all, we drew great strength from the personal sacrifice and unwavering support of our families and the American people. Each of us who wears the uniform, or works directly alongside those who do, will be eternally grateful for their continuing belief in us. I am proud of each of you. fa-cfs? Q'-'Z' FRANK B. KELSO, II Admiral, U.S. Navy i A MESSAGE FROM THE COMMANDANT OF THB MARINE CORPS It is with great pride that we reflect upon the superb execution of Operation Desert Storm by our Armed Forces. Professionalism, countless hours of training, and a disciplined strength of character resulted in a decisive victory. Our historic triumph could not have been possible without our total force. While world attention largely focused on those who directly supported Desert Shield and Desert Storm, the Navy-Marine Corps team continued to fulfill its responsibilities throughout the globe. We are indeed a force-in-readiness. The extraordinary public support for our young men and women who endure the hardships of separation and the uncertainties of conflict, is appreciated. The American people are proud, and rightfully so, for we have the finest fighting forces in the world today. Semper Fidelis. General, U.S. Marine Corps Courtesy of ALL HANDS THE STORM 11 12 THE STORM 1990: Aug 2: Iraq invades Kuwait. Eight U.S. Navy Middle East Force Ships are present in the Persian Gulf fcontinuous Middle East pres- ence since 19495. Aug 8: President Bush ordered U.S. Armed Forces to Saudi Arabia. Sep 20: SECDEF announces that, effective Sept. 17, personnel on duty in the Middle East are authorized Imminent Danger Pay. Nov 8: President Bush announces that in addi- tion to the 250,000 troops in the Persian Gulf region, more heavy divisions, Marines and ships will be headed for the Persian Gulf. Nov 29: U.N. Security Council approves reso- lution authorizing use of military force unless Iraq vacates Kuwait by Jan. 15, 1991. Dec 20: U.S. troop strength update: 280,000 in the Middle East region. Reserves called - 127,295. 47,514 Navy, 17,575 Marinesl. 1991: Jan 2: U.S. troop strength update: More than 525,000 in region: 55,000 Navy, 55,000 Ma- rines. Jan 12: Congress approves joint resolution authorizing the use of American military force against Iraq. - Amphibious Group 5, comprised of 15 ships fwith 7,500 Marines ofthe 5th MEB embarkedl arrives on station in the Nolthem Arabian Sea and joins the amphibious groups already on station, creating the largest amphibious task force since the Korean War. Jan 16: - Maritime intercept update: 6,960 challenges: 852 boardings: 56 diver- sions. U.S. Navy ship strength update: 108 total: 54- Persian Gulf, 55- North Arabian Sea fCrulf of Oman, 26- Red Sea, 15-Eastem Mediterranean. - To date, 19 countries have deployed ground forces and 14 nations are partici- pating in naval efforts. - Seventeen anti-ship mines discovered in Persian Gulf since Dec. 21, 1990. Courtesy of ALL HANDS Jan 16: fcont.l - At 7 p.m. QESTJ, the White House announces that uthe liberation of Kuwait has be- gun. The offensive action against Iraq, Operation De- sert Storm, begins under pro- visions of 12 U.N. Security Council resolutions and reso- lutions of both houses of the U.S. Congress. - following President Bush's address to the nation, SEC- DEF and Army Gen. Colin Powell, Chairman of the Joint Chiefs of Staff, announce at a Pentagon briefing that hun- dreds of U.S. and coalition air strikes on missile and anti-air- cralt targets in Iraq and Ku- wait are to Udestroy Saddam Hussein's offensive capabili- ties. SECDEF reports that 'linitial attacks appear to have gone very, very well. Jan 17: The Navy launches 228 combat sorties on the first day of Desert Storm from six aircraft carriers in the Red Sea and Persian Gulf. - First ship-launched Tomo- hawk cruise missiles in com- bat are fired from the USS SAN JACINTO fCG 565 and USS BUNKER HILL KCC: 529 in the Red Sea and Persian Cxulf. Greater gator l ,, ev, L Q :Nami aa wa sp. Mg a ' wa wafa haofway afa d aaafaa aaa ffafa. Wa - we won the war- wa Wed affaaay ffam a Small had aavaf aaa,-a an Courtesy of ALL HANDS THE STORM 15 , v . I Y , s K- F . Jan 18: The first Iraqi Scud missile lands in Israel, injuring 10 to 12 civilians. Jan 19: President Bush signs authorization to extend call- up of up to 1 million National Guard fReserves for up to two years. DOD raises the ceiling for National C1uardfReserves to 560,000. The Navy's authorization ceiling is raised from 50,000 to 44,000, Marines from 25,000 to 44,000. Jan 29: More than 700,000 coalition air, ground and naval personnel are present in the theater of operation, and more than 110 coalition combatant ships are participating. U.S. troops number more than 490,000. Jan 50: Two weeks into Desert Storm, the Navy has flown more than 5,500 sorties from six carriers and launched more than 260 Tomohawk cruise missiles. Jan 51: More than 52,000 sorties have been flomm 42,600 todayl with no air-to-air losses of U.S. aircraft. Coalition air, ground and naval personnel pass 705,000. U.S. troop strength passes the half-million mark. Feb 5: The battleship MISSOURI fires eight 2,000-pound shells from her 16-inch guns, destroying prefabricated en- emy concrete command and control bunkers Iraq is moving into Kuwait. This marks the first combat firing of MISSOU- RI's 16-inch guns since the Korean War. Feb 4: More than 44,000 sorties have been flovm- approx. one bombing sortie for every minute of Desert Storm oper- ations, including 250 sorties and six B-52 strikes on Repub- lican Cxuard troop positions. . f I f 14 THE STORM Feb 11: The air campaign in Ku- wait is complicat- ed by smoke from more than 50 oil- field fires. DOD suspects Iraq of placing charges on oil wells to cloud the bat- tlefield and mask troop movements. This is in addi- tion to several million barrels of oil dumped into the Persian Gulf by the Iraqi's on Jan. 25 at the Kuwait Sea Island loading terminal. Forty Iraqi aircraft and four helos have been shot dovxm in air-to-air engagements with no U.S. air-to-air losses. 156 Iraqi aircraft have flomm to Iran thus far. Navy and Marine aircraft have flovm more than 15,000 combat sorties since the operation began - 1500 Iraqi tanks, 800 armored vehicles and 1100 artillery pieces are confirmed destroyed in verified bomb damage assessments fapprox. 11 5 of the Iraqi inventory of tanks, APC's, and artil- lery eqpt.I. Feb 14: DOD announces that Iraqi's military sit- uation is precarious. Feb 18: Within three hours of each other, USS TRIPOLI CLPH 119 and USS PRINCETON ICG 595 strike mines while conducting operations in the Northem Persian Gulf. Feb 20: United States has lost 56 aircraft to date C28 fixed wing in combat, five fixed-wing in non- combat mishaps, eight helicopters lost in non- combatl. Coalition has lost 11 aircraft . Feb 21: Marine AV-8Bs conduct bombing runs Courtesy of ALL HANDS Jff the flight deck of USS NASSAU ILHA 49. This is the first time in histo- y that Marine AV-8B jump jets have :onducted combat missions from ielicopter assault ships. - DOD authorizes awarding the Na- :ional Defense Service Medal to all Ll.S service personnel on active duty after Aug. 2, 1990. Feb 25: At 8 p.m. IESTD, President Bush addresses the nation to report he has directed Commander-in- chief, U.S. Central Command, Amiy Gen. H. Norman Schwarzkopf, in conjunction with coalition forces, 'Ito use all forces available, includ- ing ground forces, to eject the Iraqi I army from Kuwait. . . . The liberation 9 of Kuwait has entered a final phase. EE- Following President Bush's state- . ment, SECDEF announces the com- gmencement of a Ularge ground offen- L sive. as 's Feb 24: Forces of United States, Unit- d Kingdom, France, Saudi Arabia, nited Arab Emirates, Bahrain, Qa- r, Oman, Egypt, Syria and Kuwait roceed in a major ground, naval nd air offensive. . Amphibious task forces off Kuwait's oast conduct naval gunfire to keep raqi forces on the coastline. Ten hours into the ground offen- nd sive, U.S. casualties are remarkably blight. The offensive progresses with 1 'tdramatic success with no reported muse of chemical weapons by Iraq, and more than 5,000 EPWs cap- tured. With the exception of one engage- 'Vment between a Marine task force and an Iraqi armor unit that results Qin Iraqi tanks and troops retreating, 5' there is only light contact with Iraqi lgforces. Iraqi troops are reported to h'be retreating, not engaging U.S. or :oalition forces and surrendering. Some contact is made with Republi- if :an Guard troops. JW- The Navy, along with British, Saudi Wand Kuwaiti naval forces conduct :arrier air, minesweeping and am- phibious missions along the east 1r15coast of Kuwait. eb 25: Naval forces, including bat- leship's WISCONSIN and MISSOURI, ontinue naval gunfire support and ther operations. MISSOURI alone res 155 rounds, or 125 tons of ord- ance, on targets. Minesweepers lear additional fire support areas , lourtesy of ALL HANDS Q? for the battleships. Feb 26: DOD announces the U.S. and coalition forces are en- gaging, out-flanking, out-man- uevering and destroying armed and fully-retreating Iraqi troops. 21 Iraqi divisions are destroyed or rendered combat-ineffective. Feb 27: More than 50,000 EPWs have been captured fmore than 48,000 since the ground war be- ganl. U.S. casualties are 28 KlA's, 89 WIA's, five MIAs since start of the ground offensive. Overall total: 79 KIAs, 215 WIAs, 55 MIAs and nine POWs. - President Bush addresses the nation, declaring Kuwait is liber- ated. Iraq's amny is defeated. The President announces that at 12 a.m. IESTJ, exactly 100 hours since ground operations com- menced and six weeks since the start of OperationDesert Storm, all U.S. and coalition forces will sus- pend further offensive combat op- erations. Mar 6: President Bush addresses a joint session of Congress: I can report to the nation: aggression is defeated. The war is over. Mar 15: President Bush estab- lishes a Southwest Asia Service Medal for members of the U.S. Armed Forces who deployed to Southwest Asia or in surrounding contiguous waters or air space on or after Aug. 2, 1990, and partici- pated in Operation Desert Shieldf Storm. Mar 21: U.S. ship strength update: 86 total: 51- Persian Gulf, Gulf of Oman, Northem Arabian Sea: 22- Red Sea: 15- Eastem Mediterra- nean. - U.S. casualty data: 124 KIAS, 102 non-combat fatalities, 557 WIAs, 21 MIAs C4 Navy, 0 Marinesl and no POWs. - U.S. troop strength update: 445,000 in region: more than 55,000 Navy and 67,500 Marines. To date: 95,000 personnel have redeployed to the United States: 6,661 Naval reservists are current- ly serving in the Persian Gulf the- ater. Apr 6: Iraq accepts the U.N. terms for a formal cease-fire. Apr 9: The U.N. Security Council approves Resolution 689 estab- lishing a United Nations-Iraq-Ku- wait Observer Mission to monitor a permanent cease-fire. - The U.N. Security Council an- nounces that a formal cease-fire has been established, ending the Persian Gulf War. THE STORM 15 Q- M.. Commanding CfI'iC6f 211- July 1990-28 February 1992 aptain Myers Captain Richard T. Myers was bom in Wilkes Barre, Pa. and graduated from the United States Naval Academy in 1964. Following his designation as a Naval Flight Officer rn 1965, he reported to VP-50 where he participated in three deployments conducting Market Time operations from the Philippines and Camrahn Bay, Vietnam. In November 1968, Captain Myers reported to the U.S. Naval Test Pilot School, Patuxent River Maryland, as a student. Upon graduation, Captain Myers was trans- ferred to the Weapons Systems Test Center where he was the Project Officer for numerous state-of-the-art air Anti-Submarine Warfare Programs. Dunng this tour he was Mission Commander on a P-5C which set world class records for altitude and distance, flying non-stop from Atsugi, Japan to NAS Patuxent River, achieving an altitude of 48,600 feet. In October 1971, Captain Myers was assigned as the Flag LieutenantfAide to COMSE- CONDFLT. Following this tour, he was assigned to VS-21 which was the first S-5A squadron. In July 1976, after deployment on the USS JOHN F. KENNEDY and USS CONSTELLATION, Captain Myers assumed duties as the ASW Operations Officer on Carrier Air Wing Nine Staff. Captain Myers assumed command of VS-58 in April 1, 1980 completing a deployment on USS CONSTELLATION which included 110 consecutive days in the Indian Ocean. For carrier excellence during this period, VS-58 was awarded the Amold J. Isbell trophy as best Pacific VS squadron. Following a short tour on the COMASWINGPAC staff, he reported to the USS RANGER as the Operations Officer, and subsequently the Executive Officer. During this period RANGER completed a WEST-PAC deployment which included 121 consecutive days in the indian Ocean, followed by a 15 month overhaul at Puget Sound Naval Shipyard. In. October 1985, Captain Myers reported to the Officer of the Chief of Naval Oper- ations rn the Oflice of Research, Development and Acquisition Management. In April 1988, he assumed command of USS OGDEN QLPD 55 in Long Beach, Ca. ln October 1989, he reported to Commander, Cruiser-Destroyer Group One as Chief of Staff. He assumed command of USS PELELIU in July 1990. Captain Myers' awards include the Legion of Merit, Meritorious Service Medal Air Medal, Navy Commendation Medal, Navy Achievement Medal, Battle Efficiency'Rib- bon with three awards and other ' ' ' . campaign awards resulting from Vietnamese: Indian Ocean and Persian Gulf service. Llgieefioglgf nr. anpld Mrs. Richard S. Myers of Everett, Pa. Captain Myers is married to ary eresa Jackson of Olmsteadvrlle, N.Y. 16 CAPTAIN MYERS ,0,-- -v-.Y SUPER ABS 'ii J' uf' ,f,1-- :U + +- ,.,,s7 , ,Mk 1 .534 ' -4 4 x .1 f aw f 1 A ww- , - ,.f+,,x vw'- f ,M-9 ?r'v.r,1 5 'Wg fm.: ff -Xf,'fY'm5?'w,f A Af-1' -ww: Www 1 21 X Q W.. ,Y I L.. Al MQ. X...- -J 4 -.- ff-N ...- .-... -.Agn W. wg, :Mex YN .. .rr- VA r 'affvfli L -,few .wg X , -N f X' ,F 432 ww, ,gay-..... Aga' , -...Q ' nz -kv My , W 'ff' -- ,, 'X f'y'JhL'1m wt J Q' ? w rv M303 ' N, ww MM... 'W 1-wp, J ' -.sv 14...-gg,-up-1' ...- Q. nm 1 wfv 1 4 5 v 1 , , , 18 CAPTAIN MYERS v-J.. ,Q X., X .T Rkxxfxbixilvii-55, I - Q Q ' . THE SKIPPER EXECUTIVE GFFICER APTAIN CARL E. WE1scoPF USN Captain Carl E. Weiscopf was born in Fort Monroe, Virginia in August 1948. He graduated from the U.S. Naval Academy and was commissioned in June 1970. Upon completion of Naval Guided Missile School, he served as Fire Control Officer and Navigator aboard USS WADDELL KDDG 245 from November 1970 to July 1975. ln 1974 he graduated from the Naval Postgraduate School in Monterey, Califomia with a Master's degree in Computer Systems Management. Completing the Surface Warfare Offi- cer's School Department Head Course in Newport, Rhode Island in July 1975, he served as Operations Officer aboard USS TOWERS CDDG 95 from September 1975 to January 1978. Remaining at sea, he then served as First Lieutenant aboard USS FREDERICK QLST 11845. In September 1979, he reported to the Naval Military Personnel Command in Washington D.C., for duty in the Management Information System Requirements Divi- sion. He was ordered to the commissioning unit for USS ARIES CPHM 55 in September 1981 and served as the first Commanding Officer from Sep- tember 1982 to October 1984. Retuming to Washington, D.C. he served on the Chief of Naval Operations staff in the Enlisted Plans and Policy branch until April 1987. After completing the training pipeline, he com- manded USS JARRETT QFFG 555 from October 1987 - September 1989. Continuing to develop his personnel management subspecialty he was assigned as Force Personnel Officer on the staff of Commander Naval Surface Forces, U.S. Pacific Fleet. In April 1991, he reported as Executive Officer of USS PELELIU CLHA 55. Included among Captain Weiscopf's decorations are the Meritorious Ser- vice Medal with three gold stars, Navy Commendation with Combat HV argl, gold star, Navy Achievement Medal with gold star and various other n ons. Captain Weiscopf is married to the former Charlene Garland of El Paso, Texas. They have two children, Christopher and Jennifer. 20 CAPTAIN WEISCOPF CAPTAIN WEISCOPF 21 wig' Q - fir. ' - ' 3... ' fl 4:.6.mxw x e. 'fa WW, .J mf ,, +-:ng ,K s ,.-M, W - un' 5 N -..-, ff, V- ff ' 47',ff':w HA. .. , 11 L, f ,.A, ,c.,,,, L , ,mi 16' 9, h f X ' ,,,...,.. ..c.,,.A.4 A, ,., , , , , ,,,, .,g,, 19 C. ,M 1 ': fi- ,N, 4 Q- .. an 5- g , , ,. ' . :. I V A Z f 5 fa ' 35: ' f C ig? . rm-'fn ' 1- K fy- gays' fps- I , f -5 SX-. lf,-gi 'Q1'f'f. t Cp, 5,1 ' -5 f. , N' .i-ff -f ., 'W-.,.,....1 I uv- 41' :'- L- M---1 ,- f-4 2... -1., , , .,,, ,A Mg, , , lvlAclvl QSWXAWQ THOMAS c. WALLACE COMMAND MASTER CHIEF Master Chief Master-At-Anns fSurface WarfarefAviation Warfarel Wallace enlisted in the Navy in October 1961 at Boyne City, Michigan and completed recruit training at Great Lakes, Illinois. Although assigned duties have al- lowed Uaround the world travels, his entire thirty fplusl years of continuous active duty has been with ships and units of the Pacific Fleet, including: USS HANCOCK QCVA- 19J, USS BON HOMME RICHARD CCVA-5175 USS DIXIE QAD-1451 USS TARAWA QLHA-13-tPlankoumerl, Special Operational Group One QSOG-ll: River Patrol Force QCTF- 116l, First SEALORDS QCTG-194.033 River Patrol Flotilla Five, CinC-PacFlt Staff: OLF San Nicholas Island, Ca., Na- val Support ActivityfNaval Station Long Beach and a tour S.E.R.E., 4Survival, Evasion, Resistance and Escapeb In- structor at Wamer Springs, Califomia. He was assigned as PELELlU's Pre-Commissioning Command Senior Chief until Commissioning, served as Chief Master-At-Arms be- fore his selection as Command Master Chief in Septem- ber 1982. His personal awards include the Silver Star Medal, Bronze Star Medal fwith Combat Distinguishing Deviceb, Navy Commendation Medal lwith Combat Distin- gulshing DEVICE, Navy Achievement Medal twith Combat Distinguishing Device! 2nd Awardb Purple Heart Medal 42nd Awardb, Combat Action Ribbon, Republic of Vietnam IRVNJ Cross of Gallantry Cwith Gold Starl, RVN Gallantry KUSNJ Cross, RVN Honor Medal 1st Class, RVN Staff Service Honor Medal 2nd Class, Navy Expert Rifleman Medal and the Navy Expert Pistol Shot Medal. The Command Master Chief is the Senior En- listed Advisor to the Commanding Oflicer. He I I is involved in every aspect of life of the enlist- ed sailor serving aboard PELELIU. His position is an unusual one, in that his role as a repre- sentative works two ways: While he represents the needs, desires, and concerns of the enlist- ed sailor in the command, he also represents the command, its policies and requirements to the enlisted sailor. His mission is one of support- support for the chain of command, both up and down. COMMAND MASTER CHIEF 25 Q WW W'-dm, Av , H .,.-.......,.,,,,.,........,,.7......, e....,....,,.--f-...-.--Q--1---v-.-.--..-..,--,-....- -N.. ---- -'------'--'- f -- .. ,,...,.,..,.......----,.---..,.....f.-.,.,,.,...........,, - -V .-. --v '-' 'k 'W ' ' .--if-X .l----X . ---A 1 3 5 M' : 1 , 1 i E x I l l 0 . fn? 3 5 . , . 'D 5 . f f -.---blb.-s. S --B-J gg QE-Lair ' if L .. jl.,,fQf55?J1 ny ' , gif. g , ,Lf, . Chaplain Branscum enjoying rare moments of leisure 24 CHAPLAIN . .,....-C...-....,... ...,-.....,,,.,.,,,..,.....,,.......-.N..,....... .,.V - ..,..,,........ -....f ... ,..-............-....,..... .,... -....,,. Wi LCDR D. BRANSCUM CHC What's the easiest job for some. one aboard a deployed ship? Be. fore you say ship's Chaplain, talk to LCDR Dan C. Branscum, USS PELELIU's Chaplain. 'lIt's not just Sunday services and nightly pray. ers over the 1MC. During the de- ployment the Chaplain and his staff of two handled more than 500 messages from the Red Cross. These messages usually report some type of emergency at home- accidents, serious illnesses, or death of a loved one. lt's the Chaplain's unpleasant job to inform the chain-of- command and tell the crewmember. Frequently the crew- member has to take emergency leave. lt's the Chaplain that makes the arrangements to get the crewmember home as' quickly as possible. Many other problems arise at home when a ship is de- ployed. Messages and letters flow in daily from the Ombuds- man and family members asking for the Chaplain's help' and assistance. Not all is gloom and doom. The Chaplain gets to tell an anxious sailor the good news about his new son or daughter. Chaplain Branscum and his wife, Judy, a CPA at the Long Beach Naval Shipyard, made it possible for a young Tiger and his dad to share the trip of a lifetime. Ninety-nine percent of the good works of the Chaplain goes unnoticed and unheralded. As spiritual leader to more than 800 men, Chaplain Brans- cum is uniquely equipped to handle the job of counselor and solver of what may seem unsolvable. He holds a Bache- lor's Degree in Education from Northem Arizona University and Master's Degrees in Divinity and Counseling Psycholo- gy as well as the Navy Chaplain's basic and advanced courses. f The many facets of a Chaplain's job are familiar to him as he has been a Marine Bat- talion and Navy Hospital Chaplain early in his ca- reer. Before reporting to Uss PELELIU, Chaplain A Branscum served aboard uss PROTEUS KAS-195 in Guam and was the Staff ' :ii Chaplain at Naval Air Sta- ' tion Jacksonville, Florida. A fiiiifffi' 4 .... '?5?7st.z'f,S'21 M . my ,QL -c..,,t,..-...4...-....,.......... ....-1.1,-.........f......,..--- ...-............ , .,-.....- ........ . l r JUST S TO ABUSIVE BEHAVIOR DAPA LT Sco'rT BATTLE USN LT Scott Battle of Deck Department, serves as Peleliu's Com- mand DAPA CDrug and Alcohol Program Advisory. He is assist- ed by RM1 QSWJ Christy of the MAA force and EW1 fAWfSWl Tumer of Combat Systems. The DAPA is responsible for programs covering education and prevention of drug use and alcohol abuse for PELELlU's entire crew. He must advise the Commanding Officer on the provi- sions of the NADAP 4Navy Alcohol and Drug Awareness Pro- gramb and ensure that changes to that program are circulated quickly and completely to the sailors it affects. The DAPA schedules and coordinates counseling, treatment and reha- bilitation as the C.O. directs and works closely with the Naval Station Long Beach CAAC 6Counseling and Assistance Centerj when inport. Correspondence from incident reports to semi- annual command status reports come from his office. While not an official counselor, he must track the progress of over 40 clients through treatment and monitor their post-treatment alter-care. While implementing the Navy's Zero Tolerance policy to- ward substance abuse, LT Battle also ensured PELELIU sailors who needed help and support from simple questions to in- patient hospitalization for rehabilitation had full advantage of Navy resources to continue successful careers and healthy lives. AY DAPA 25 Left to right: Elea- nore Salas, Kelly Armstrong, Ann Striewe, Elizabeth Livingston, Lauren C h a n e y . N o t shown: Zoann Tur- pen and Evelyn Cniger. 26 OMBUDSMAN OIVIBUDSMAN Command Family Ombudsmen have proven to be valuable assets in stimulating better communication between commanding officers and family members, foster- ing a better understanding of the needs and viewpoints of Navy members and their families, and providing information and assistance to family members within the command. The commanding officer selects the Command Family Ombudsman who are spouses of active duty members within the command. The needs of the family members of the command determine the number of Ombudsmen needed. In addition to the basic functions of Ombudsmen already mentioned are: the interaction, cooperation and familiarization with military organizations such as: FSCS CFamily Services Centerl, chaplain's office, medical facilities, Navy Relief Society, American Red Cross, and legal offices which are often valuable resources in obtaining assistance for command families. Regular communication with fam- ilies of the command. Assistance in organizing andfor acting as a coordinator for the families as part of the command sponsor program. Organize, maintain, and update all records conceming Ombudsmen responsibilities and resources. Repre- sent the command on committees, boards, and groups concemed with services and support to command families, including the civilian section. Participate in any activity, as directed by the commanding officer, which would promote the morale, health and welfare of the families of the command. Thank-you ladies for a job well done! CoMMANDER, AMPH1B1oUs SQUADRoN THREE 28 CAPTAIN LEVIEN APTAIN I'I.A. LEVIEN USN Captain Henry Allen Levien, bom 1 June 1941, is the eldest of eight children bom to Carl and Gwendolyn Levien of Femdale, Washington. He graduated from Washington State University with a Bachelor of Science degree in Dairy Science in 1965. He began his naval career when he was commissioned an Ensign in April, 1964 after completion of Officer Candi- date School. Following a brief period of training in mine warfare, Captain Levien's first duty assignment was First Lieutenant, Mine Counter Mea- sures Officer and Supply Officer onboard USS JACANA QMSC 1955 from July 1964 to June 1966. His next assignment was in-country Vietnam as Assistant Officer in Charge, Mine Squadron Eleven, Det A from June 1966 to June 1967. He was subsequently assigned as the Anti-Submarine War- fare Oflicer and Personal Officer on USS LAWRENCE CDDG 45 from August 1968 to April 1970. After a brief period in Destroyer School, Newport, R.I., Captain Levien was assigned to the USS HENRY B. WILSON QDDG 75 where he served as Operations Officer and Chief Engineer from December 1970 to September 1972. From September 1972 to April 1975, Captain Levien attended the Naval Post Graduate School, Monterey, Ca., where he eamed a Master's Degree in Operations Research fSystems Analysis. Fol- lowing post graduate education, he was assigned as Executive Officer of USS FREDERICK CLST 11845 from June 1975 to December 1976. In Janu- ary 1977, Captain Levien was reassigned to the Navy Recruiting Com- mand Headquarters, Washington, D.C. as Director, Research Analyst Divi- sion where he served until December 1979. From May 1980 to June 1982 Captain Levien served as Commanding Officer, USS JOHN TOWER QDD 9755. Following his command tour Captain Levien was reassigned as the Senior Examiner of the PaciHc Fleet Propulsion Examining Board from November 1982 to September 1985. In October 1985. Captain Levien was reassigned as the Chief of Staff Officer Amphibious Squadron 5 where he served until July 1986. He next served as Chief Staff Officer of Command- er, Amphibious Squadron Seven until his assignment as Commanding Officer, USS VANCOUVER KLPD 25 on 14 May 1988. He assumed duties as Commander, Amphibious Squadron 5 on 14 May 1990. Captain Levien's decorations include the Legion of Merit, Bronze Star Medal with Combat Distinguished Service, Four awards of the Meritorious Service Medal, two awards of the Navy Commendation Medal, the Presidential Unit Commen- dation, Navy Unit Commendation, and various campaign medals. Captain Levien is manied to the former Camilla Carroll Gardner of Suffolk, Va. The Levlens, and their four children, Peggy, Alan, Andrew, and Matthew, reside in San Diego, Ca. ,M- 4 n s P'--..,,,,N I Jmnm 'f f'm.,f, rw r , Y , W, I . ,fm .1 ,, ,, ' vw- V 1 '-wx V 'fm f , NNW-,P QQ IN., I ,.,+.x.M.i A--e1...v -, CAPTAIN LEVIEN 29 CHIEF STAFF QFFICER oMMANpFR 1cr1AEL W. TRFFMAN, USN Commander Treeman is a native of Sapulpa, Oklahoma where he gradu- ated from high school in 1968. He graduated from the U.S. Naval Acade- my in 1972 and was commissioned an Ensign in the Navy. His first duty assignment was as Operations Officer of USS ADROIT CMSO-5099. During this tour he was assigned TAD to USS ESTEEM CMSO-4589 for the mine clearing operations of Haiphong Harbor fOperation End Sweepl. Follow- ing his tour on USS ADROIT, he was assigned for a period to USS NEWMAN K. PERRY IDD-8855 and subsequently to Destroyer School in 1975. In May of 1976, LT Treeman reported as Chief Engineer of USS HENDERSON QDD- 785J in Long Beach, Ca. In January of 1978, LT Treeman relieved as First Lieutenant in USS SAGINAW ILST-11889, homeported in Little Creek Va., where he served until May 1980. He then reported to SWOSCOLCOM, Newport, R.I. for instructor duty. In June 1982, LCDR Treeman reported as AidefFlag Secretary to Commander, Cruiser Destroyer Group One and followed that tour as Executive Officer of USS CUSHINC1 IDD-9859, both in San Diego, Ca. In January 1986, CDR Treeman reported to Commander Naval Surface Forces Pacific as the Force Operations Officer. In Septem- ber of 1988, he assumed command of USS BRISTOL COUNTY CLST-11983 where he served until his present assignment. CDR Treeman reported to COMPHIBRON THREE as Chief Staff Officer in October 1990. Commander Treeman has been awarded the Meritorious Service Medal twice and Navy Commendation Medal three times. He is married to the fonner Valerie Mendonsa of Middletovm, R.I. They have two teen-age children, Nicole and Eric. 50 COMMANDER TREEIVIAN , . 4465, :rg , MM, .Jw ,, ,..,k,,..f I My iw - ,.-Mff COMMANDER TREEMAN 51 52 PHIBRON 5 ,....., ,1 V-A ,H -V-C. 4 f' 1' 1 ' 1 . '. f ---'-,--- 1-11 - s f, .1, , ....q M, M-, ..,, ,.., ,-R-X. f ,R 4- .1 . 1 . 1 M X , W, 1 V, x f--A 1'--'14-ff-A fu 14----:f '11.'nA'fs Q. R ,f - A 'U ' 'ff' 1 ,f,.-Ns. 1 : 1 1: 1 I I 1v.1 1 I A 111- A . g. X. 1, I 1 , A A ,- .-.1 1,,f--. 1. 11 N1 . , A 1 X. 1 ,X,,,,,,, . 1 ' 1 fM--- ' I -1 ' I HJ 1 , 1 1 1, . 1-Q.. I I I X '-'11 115 1QHq1,111 '1r. I I 1 I 9 I I I I I I I I 5 I A11-1'e1,11f11,f!:,f.,1g:1l--.J I, :1,,,N,, 11.1.1 11,1 I LQIII mil ffl YIII Fw, 'xii I1 5 I fi' R ir B4 C I I 151,11 1 i1111 1 1, 11 11. 1 Q '11g1x'.v,,,Xgf1 Igjlf'- xg1 11:1 15131K lflxx 1 ,a11e1,. 11' .1 , .11.1A 1. 11 ri Iiiizkxiii 175 4 IllVI111'1,1,1ff E I I1 I I 2 1- I 1 , 11 ...ff i 1 1 , 1 1 1 1 1 , . 1 , , ,, 1 11 1 . 1 1 .1 11 1 -. 1' 1 1 A. 1, 1 1 1- . 1 , , 1 .1 . R 1 . i 1 1 E 1 Y 1 A 1 1 , I1 XA V , X g 4 1 x .1 1 cW,!' ,K X ff . Mi. ,f . .uv ,,, 1 L M-Jxxh A, , - 1 1 1 K , , I , -, , , --f - A -- ,, ,,.f .H-N, ...g QVVV, . . X-m,,, YvW-f-w-- ff- -- ,fss 4 Q 2 ,mg ...s,,...1...,.,- :WS N.,, -...J F S I Amphibious Squadron Three was originally commissioned as Amphibious Squadron Seven and consisted of some twenty-one ships. Initially homeported in Long Beach, the Squadron moved to San Diego in 1975, and returned to Long Beach in 1984. With the reorganization of the Pacific Fleet Amphibious Force, Amphibious Squadron Seven was redesignated Amphibious Squadron Three and moved once again to San Diego on 1 August 1986. The mission of Amphibious Squadron Three is to prepare plans, embark amphibious forces, conduct rehearsals, movements and perform assaults upon hostile shores in support of national policy during low intensity conflicts and as a component of an integrated battle force during major conflicts. This Squadron has the capability to land troops and equipment by air and sea simultaneously, and to support troops in the field with fixed and rotary wing transport and attack aircraft. When assigned to the Westem Pacific, Phibron 5 carries a 2500 member Marine Expeditionary Unit QMEUD plus the equipment and supplies to keep it fighting for up to two weeks. Phibron 5 was the first Squadron to deploy in an LHA to the Westem Pacific and the first to operation- ally employ the USMC AV-8 Harrier vertical take off jet in the Indian Ocean as part of an Amphibious Ready Group. The staff has 17 oflicers and 50 enlisted men assigned, and is headed by Captain H.A. Levien, USN, who holds the traditional title of Commodore. 'I I I ' 1 I I f 9.1 f,s,,,.,a 1.99 r.,,-.wf...,..u L, L.. .... ..1...,.J 1 ' . AMPHIBIOUS ' A fl y! fy C' y . . 21 , 1 K 4-1 f sf? sg I Mrfgjf- , Q .1 ll 1 i 1 I If 1' 412 P I F 'L Q ' M 'X 1' ei? 1 'ly , ?! K Q77 4322 .W 1 cf ,.. 1. f 11' xsvgimg pg-'Q I fig gif! It -4 4' H .vw A! 1 I 1 N 'Wg 4 mi af .Mx V... 1, E 1 1 I I 1 IA I If LEW. I g 11 CDR J.R. WARNER CDR D.A. Jonnson LCDR F s I-CDR MU' N-5 oPs OFFICER SEWC orc NAMOCATCAT BARRINGTON STAFF CHA FORCE MATERIAL q PLAIN OFFICER CAPT E.L. LUCAS, -..E usmc L COMBAT CARGO I OFFICER T P T LCDR R.J. THOMAS SPECIAL OPS OFFICER LCDR J.lVl. TWEED INTEL OFFICER LT J.F. BARRON N-I5 OPS ASSISTANT '1 LT P.J. HURLEY LT B.J. HICKIVIAN LT T.R. TI'IIEN LT. P.J. ROEDL LCAC LIAISON OFFICER INTEL OFFICER N-I5 OPS ASSISTANT N-I5 OPS ASSISTANT LT C.N. PURNELL LT M-L CARRE STAFF JAG OFFICER N45 OPS ASSISTANT From left to right- CTRI5 IVIESSER, LTJG TARNE, CTO1 HARTMAN, CTO1 IVICFARLANE and CTRI5 KEILLOR. .-va!5.?6p-sh ,N x .-fan -- rv ' fm . :7-'45 - - 932s f ,QT ae s ::F !!: '-vb :Q T 1 9 MF! '49 '3' ze x --54 I-1.-1 4, S: .I f f 'ERA n-1? : O gf k i '-a'1I5h--.4-' ,X Sxiksssb SK g xx' HMCM J.D. GILBERT MSGT T.R. MOSER Mmcs Af. PETERS OSC5 SG- WELCH Not Pictured PHIBRON Z5 515 CAPT LEVIEN takes a slight pause from his busy day. Lefl to right- OS2 SMITH AND RP1 BAGGETTA 54 PH RMC T.B. SNYDER Nia YN1 R.A. SCHILKE RM1 D.K. WILBURN OS1 B.W. COURTNEY OS1 J.C. BERRY CT1 B.R. DGNAHUE OS2 R.S. JOHNSON MS2 OS2 J.A. LEEPER 5 RM2 M.C. POHL , Y ..,., ,- ,,,, ,- ,...V-....,...... ..-N -......-... .. ------ ----K-4v-----,--- ' 'mum E-'I 19. Xgg n QMC D.c. Emslom 5 w R.. , V . gy? 1 OS1 F.C. EHLERS 1 ff 'N 2 N 1 4.-5 1 wg,-.R inn, M55 BGL. TYLER YH5 RJ. LAVERH ISIS M.K. LYTAR OS5 R.A. FERGUSON RM5 K.M. HRICKO MSSN DDA. MARQUEZ ossm M.J. NEUWEILER YNSR L.A. PAYAN Right- It appears that CDR TREEMAN has his 'Xgame face on. Below- MMCS PETERS and OS2 FERGUSON , W4 ww 2 HMCM GILBERT PHIBRON 5 55 .H--v ........ ,,, ... ,.,,....,--1 ...,.,..-,...,.- - ,Y.,: uss PELELIU QLHA-51 Displacement: 59,500 Tons Dimensions: 820ft X 106ft X 26ft Guns: 2 - 5 f54 caliber guns, 2 close-in weapon systems CCIWSD, 6 20mm guns Aircraft: 12 CH-46 helicopters, 5 UI'l-1N helicop- ters, 4 AH-1W helicopters, 4 CH-55 helicop- ters, and 6 AV-8B tlarrier jets. g X Complement: 55 Officers and 851 Enlisted Troops: 1900 men The primary mission of the USS PELELIU is to take an entire Marine battalion and their equip- ment and successfully deploy them ashore. PE- LELIU accomplishes this objective by the use of its flight deck and wet well deck. In addition to its primary mission, PELELIU is iitted with exten- sive medical facilities. 2 . .V , H ,, 5--1. V ' .. Q v 'K f., USS CLEVELAND QLPD-71 Displacement: 9,528 Tons Dimensions: 570ft x 100ft X 25ft Guns: 2 - 5 f76MMJf50Ctwin MK55l A Aircraft: Up to 6 UH-1N or Cl-I-46 Helicopters Complement: 27 Officers and 446 Enlisted Troops: 840 men The LPD replaces the amphibious transport QLPAD and, in part the amphibious cargo ship KLKAQ and dock landing ships CLSDJ. The LPD can carry a 'lbalanced load of assault troops and their equipment. The CLEVELAND has a docking well for landing crafts, a flight deck, cargo holds and vehicle garages. 56 SHIPS OF THE ARG si LHA s Q1 if 'X Q V M' -Q., .M 'S t-Q: iwf . .ye K Q ,f I .aft A. . A ' 'T c.. , is .vw K 1 S 1 .r , i ' 4' fig-:fs , 4 ., M f Q, uss colvlsrocx CLSD-451 Displacement: 11,125 Tons. Dimensions: 609ft X 84ft X 2O.5ft Guns: 2 - 20mm CIWS fMK16l Aircraft: Helicopters or VSTOL Complement: 19 Officers and 557 enlisted Troops: 558 men The COMSTOCK carries a balanced load of As- sault troops and their equipment. This Whidbey lsland class LSD is based on the earlier Anchor- age class. The COMSTOCK can carry the CH-55 series helicopter and or the AV-8B Harrier VSTOL aircraft as well as four amphibious Air-cushion Ve- hicles or 21 LCM-65. LSE QT LST LPD uss Bmsrol. COUNTY QLST-11981 Displacement: 8.450 Tons Dimensions: 522.5ft X 69.ft X 17.5ft 4 A Guns: 4 - 5 f76mmJf5Oftwin MK55J y Complement: 14 Officers and 211 enlisted The LST operates with 20-knot AMPHIBIOUS SQUADRONS to transport tanks, other heavy ve- hicles, engineer equipment, and supplies which cannot be readily landed by helicopter or -land- ing crafts. 2 t , A SHIPS OF THE ARG 37 BIG LE GUE 'kg Big League 2 arriving after a SAR mission Big League 2 flying into the sunset of the Persian Gulf 58 BIG LEAGUE 'I T i i I I 5 The flight crew of Big League 02, theT ship's organic UH-1l'l Huey , is tasked with the prosecution of Search and. Rescue QSARJ service in the Amphibi-I ous Readiness Group, KARGJ and also to provide logistics support. The avi- ators who fly l'Big League come from Air Department, Operations Depart-, ment, Safety Department, including' one U.S. Army liaison officer. The air- crewfSAR swimmers are all from AIMD. l Big League enjoyed a highly successful 5 tour of duty during Gulf Pac '91 includ- ing over one dozen Medevacs. Among the most memorable flights of the cruise were: the Battle of Iwo Jima Me- I morial Service flyby, sorties in support of personnel evacuating the Mt. Pina- tubo volcano eruption, and SAR sup- port flights for USMC amphibious exer- cises off the coast of the Persian Ciulfi nations of U.A.E. and Oman during Op- eration Desert Storm. NAVAL Ammon i v ' 1 I I K ,VJ K I ., f , f ,V 7 I ff, iw! b,X,7Q5W,J7!,! H !,fY72,7gfZ,.f,?7!i9y,L,.!71,7 L! ,T Y N N D U , V - , 1 fy gi X, ,,'V X ff gf . M O O 0 z 0 K 1 . . , A O0 9 . . 'L f W D' 0 K XX ,. ..', ,..,,- , W 'A . ' Y A 4-wg? , ly' aaa 4,-Jj.Q.5Qj2gia?fx-.h I O 9 0 .L1 f'-T 7f-f1-f- Ai,'r:',',fq...,i'.::f O 5 f f ll 43 15-1-,. ', -, , V 55 575' P521 ,'7:5:Q:3f173'p?,.,'fIf5 213255 S ' C 5 m y ' ' , :D 3 -ei Q ' fx- 'R'Ziu5r'53i -' -ar. f- A ' ez. f 1 I ' ff 5i5ef29 ! I I , A DD Q ' N f -I 5 Q Q-, . A. H - N' .:q,...z-,EN a -D - T ,T F - 9452112 is .fwiriiitfi Y. I ' Aw .il:'- -fq J ,' ---- Y.-13. -46.5'Tuf-W , , ,. ,,,1f'wpW , 4j,f',L7- ,l ,QS ,. 01 - . - V:: ---H -'w fra- - n-ng' ' X ,-,,,, D NGN W FRESH WATER AT LAST! 1 Y' D . . -f - - --', I ,Jll...,-,. --..u ' . 'W , :fx .' .4 f A Q -- N 'paw ,g .1 'iff 1:1 - f --- D D , , D 'S'I:2i:kfm:':-1521::3:3:3:,..-,-. A.-.5.3,:.g.-V:-1-1-1-:-za-1-:4:1,5.3.5.53.4Q:-:-:4:-.1.5.3.3.,.1.5-1-.-.'.-.g.A.g.5.g.3.g.g. li.,--1 V 'I I ' . H isa 135'1':'fEIEE1Eif:l:i:1:I:3:E12:35:E122:12215:1:1:f:Ei22121215125252122112E:52213152E3E2E2E1:f1f5FfE2E1E1EN:-522E152551513?122E2222151?-52:331r2:22EIE152?.,, ...i2E1E5E1E2E2E2:f:1 a-... - ' -- 1717 if- - E 32252:1.:.1:1:aii22:1.Il1-'W ,,1:z2s22is::,'1f1:iW .V DQ-' 55 P 13 -A '-fi S - ?fif3fI:i:f:1:3:f:i:f221221:- v.f.''1:i:2:Q:2:2:SZ2i5ff:1:CE3:1:2:E2:E1E2EL.'f2:'ffitl Q,:.5:g1gI:':'f':3:3:2:f.f:f:E22ZQ 1f53EiR1r,7:E:Ei2E2f1if2135 ':Y:2:f:2:2:3t5:3I51:1:f 5' 'ffm ' 1' .. 3 52?i?E??2z22iz2z2z2f2222232eEz:322Ei2iA.'Af '122212121Skiafsiiii-F12.,.552222252sf2is?ai2i2?2152e252322isSZSEa:1'12:2i1E?12si232? 25325 '2:s:s 1 '71 f.,+: '- -'A' EFI' 17 ,ff N 12223522-.4i'ff2gEgEgE3535233233523 955253323525253555533E:E5E1E1E5EgEgE5E:f3E3E555EE?E1EE3E3E5EgEgi3EEEZ31 :.1rE3 --4- w--M V- ' N'2g:.'a.... ffW 1' 'ani-'L , -V' , wifi 1 ,5 1 if , X If A '- Li 'U'1f'+4.J'eSi1-ii 1 'L' Fushigi I cm Anriwfws Fur . . i1E15EZi3S3EEZiE-'f:i1:g.f2E5E22E?5?E5E?1E?32EgE355:11435E?5:5?3E2EgE2::2E5E5355ii55E2ri:Z:EgE2335559 15i25F1g2gsgE53. .,,.. 3 ,, Cr , gem- IT 'ZQQS .fue ,'Q,,f',QZ5S. .::'+. TROOP BERTHING- ,W D T.i,-,.DLw..L-.-.1 3 ' 541g'7' f::m+:m,f:f:::. -1 ' ' : ' EEE? 325E5E22552352525EE25E3E??iEiE335i2'35551:ESE5E25E1f5EE21:E5E32EE555E522 1 f ' ' '1ff:22?2: . :- ' -' ''+lu:1:-'-I-:grgz1:I:1:1:f:1G:1 '-21112: '12 :E:E' QK 7 519 - nh :sf -- A ,.4,, D ' , Ll Sin C A l gli, 1- r X A , ax '- C 1 . ' 'V 1 I ' . ' i ' if 4-DV. - k Q f - - . Z I f: 5, l ll ! T f f' ' f , ' - 1 ' ,, 'f -4- . ..- . r. .----- vp ,X A '12 QM 4 . '-A f'f : :1:f ,' A-. 4 ' - O ' ' Vi T -' '. .. .., , 1 - 2 ' Aw- .+:1:f:a. '12111111:ss:z:s:2:f11f:1a...12:11211era'ease-1:2:2:Q1211121was:6sf:2z:z:1:zf1:s:z:a:as:1,. T . 5 N. N A 5 , 6 1-:c-P15922- I+-:41V1-:-:-FSD:g:f:g:g:grqIg1g2k1:f:-1-is1-1:gif2gigki:-11:2-1-15:1:-Q111:f1:14I1iziz24-1:11gt-if111'I1151:1:-21514:A:gc51111:1re1xi'-11:3:-2:3.5215:I:-:ff:gpg211112:111:15:-:ggzgzgizrgzgiiizrz-1-:-:if R ' T - , , - v -Q! xx harm' - N b Kyiv: N , .. 1 .' :D - X X LES! -Qi-Y Hao BACK T0 SLEEP1 MARINE. THEYIISQLL 1 , 'SLEEPERS1 SLEEPERS' EVERY HORN V 4 N - Qi ., ,f g aHMP U'- .gi . ' . 3 15' of ' ., ,,,..,...,:.'M,,:' , L, ' AND EVENING. NP- . -.9v' ,,1f ff .m ..nD11:.N.f ., .v M-. 91- . -4L,,,,, rm I 5 L N ' .- ' - ' 'D-Jffx' -ill? P ' :Tiffin , wsu. THATS mf: END OF we POUDERED mu: 'f'- 1'f,fi'3 'X , I AND N0 ONE KNOUS THE RQCIPE T0 NAKE noRE ' T ' vm e if 1 1 n r e -- :nose cold 2: bgx fgngxenguy ' PELELIU FUNNIES 59 T ACRO The primary mission of TACRON 12 is to control all air operations, anti-air and supporting anns coordi- nation both with commands that fumish air support and those receiving air support during the planning and execution phase of amphibious operations. The mission of Tactical Air Control Squadron 12 also consists of establishing a fully manned tactical air control staff on board an LCC, LHA, or an LPD and carry out the operational assignments. Aboard PELE- LIU, TACRON 12 functions as the naval component air staff of the Amphibious Task Force Commander. Operating from TACC and the Supporting Arms Co- ordination Center QSACCJ, TACRON 12 coordinates fixed wing and helicopter assets against enemy air, surface and sub-surface threats within the Amphibi- Ill ous Operations Area. AC1 MICHAEL BAILEY receives an award from Capt. Levien for a job well done. 40 TACRON 12 y f 'fwx , CDR ALSTON R.W. Irvington, N J OIC TACRON 12 DET Gln Lcpa HAUGE, s.A, , Wilmington, DE ASW COORDINATOR t I OSC HOWZE, M.L. ACC PATRICKA, J. San Antonio, TX 'UbIy, MI 1 Q MAJ BERRY, L.J. I'IELO COORDINATOR LTJCI DIXON, P.lVI. Brooklyn, N Y TACRON 12 INTEL O s ,5 ? 5-, S OS2 ROSS, K.T. Cleveland, OH Torrance, PA Acz sTRouP, J.Vll. Msz cms, s.1.. Chamberlin, PA NOT PICTURED LCDR COOLEY, R.T. LCDR DUFEK, D.F. AC1 FLENTGE, W.J. OS1 PIERCY, A.T. AC2 FIELDS, C.B. OS2 WRIGHT, G.A. AC5 BRYANT, D.G, RM5 STORY, M.A, AC5 SUTTER, J.E. OSI5 CARRILLO, IVLP. ACAN VANHORN, S.A. ACAN PUMPHREY, K.V. ACAA VANHORN, K.T. SA BARRETT, L.J. SR ROBERTSON, A.R. - 3 f , I i X S I I I I 1 ,,,, - AX .. - ::.. .. zz .... . ::.- 'z -- :L - L... . ' I-ff:f3' ff: ff' .z'z' z:.' -..' -' zL:.' .. - .' zz. -- 1. :L'-II' 3' 3 f 7: fu.. -- 7-.VF-ff 'Il ' ' ::. ILQ- 1' ::',-- ., I. -- ':.J'I--.1I-e:- sa:-1' 11: eff 21'-f:-' 51-ss: -. .. -zz: -- .. I- .. ' ' 21.12.-II' ' 2. I .. -- ... ... -- Z ,L Tu.. :... n zz .... K L... .... . HU .. 1. .. , ::. .: I. .. . N . .1 I. .. li.. .. :.... . -.Il -I' II. ' ZZ.: 1Z..I .. '.... .. 'Z. -. ' .. - - ...- I. . T.. I 1. .. I- I.. ... - ' .. -- .. -.-..-I . .21--I.:--'f'f-1'a::::.123 .- 2fr1'..:- -f .i3'II1'....-I f .- - - 1' :f-'-- 543 ' .I .- -- :ei zz: fz2:'.'. fi -.riff I--II-1' ' ::. :. ' .1 :.-:r 3 -- 5 EI.- EI ..?ff'. E222-' 3 '5- 'II3-I -. TQ . 3 ff: 7- -- I mfffi '. 11' -- II 3 FQ-'lf . Tl' -- f'IE I ' '.- ' E: .'?.7L'I FQ-I '. II .... I.JI3I'EIIf'.IE lf 'I' 3Icf'I.. .. - -' .. .. -.::.. zz. ::. -4. zz. - ' zl - - :I H If-zf.ff ' .I Q' -' ' II '. 3 .. - f.1I.E- ffI..'f 'III IE. EEf '-- EI' If - ESI - I I I: 3..z 'L.- 5'-..- 2 .. 3- 5- r'I Iff I' 5-15:0 IEQIJ' '-TI In IIII .I.I...I I' fi Eff SEI . I '- I' fi EEI5'. '- '- - Q' -- 'H .-IQ' E21 -' ' .I I If. -- 1221 .. 3. I . ESI 1111 flllfl 3- : ' . If II .JI .IE EET? IW- 55' .I -- -..,.-.I 7 ' I..II-,'III-III1I- I- .. 'I SEf f Eif - II.-'l -- .. - zz.'.' . ..1 .:.-.zz .. I.. z' .. -' .: -. zz. -... .. ...I::.I... ::. zz. -- - :: .... 1 ::.:L . ..i - 12.4 :. ' Il. - CZ. .. ' ZZ.. ZZ. ... . ZZ. ,- .. ZZ. 'I 'C. -.I ' ..1.. ...- CZ. . I-I. .. ZZ. .. -. ' .... ' ZZ. fl. -f':fr 4 f.f.H 1 If:-r'uz'fmMvz arff xmnxsgfzam. 22-2111 ::.':- -: YIIILII .I --II... M . LII: In. -- .. .. .-z:- .. -- '- . .... -- .. 7 :SI :i EZ- . I' 5' I- '33' .. .. -231552 SSI . -' ' - . 11.421 - .II '. ' 'I '1... 1... . ... ZZ. II. I' . II. .. - ' .. .. - ..-' . 1' . '.. :. '.. ....-:' I .. . ' ..- ... zz ...-:Z.fL.-1 I--I.z.. 'L- I I I 'I'IfIII IIUIIII TI III IIII I I ISI II'I I 'IIII-'I I I'II III I ISFII I IIIJIF I IJ Lf' IIJI'-I 'I.'I'I I- ,IJI'II'II.II I I I 'I IIC II'I! III I I II.I X LI I I-'Cl'IJI'IIILII I JI 'IIII I LIKII I I-I IIIIIIIII I'IIII IIII IQIIUI I JIIII-II 'I IIJII.III'I'II 'III I-III .II7'JI1'I'II'IIIII 13 'I I III I F II III I I 'I. 'Y'I II If'IICI IAII I I:'IIII I IIII II3I,xII I I IIII II I I-JIIIDI I I IILIII III I-'I LII'III.III, 3 II ' IIII, I'IIIIJS1'f'I IIII I.I.-'IIIIII11I.II I IIIIII'--'I I-1'I'I1III'5 I'f' I I I'II I I III-lI'II IS II II II' -I IIII II 'I IJVJIQI II I 'TI 'I I'III II'II I I I 'T II'I I I I I IIIIVI LII I I'-II,-II II-SIC I I'-IIIIIEI II I I FII I I IITI IIII- If'1II.I I.I I ITI LII'II.IIII 'I'I I IIII 'I .vIII I III I I' I II'-II 'I I3I'I'f I I I IIII,-I I I I II'II I 'II II I 'I ISIS I I III I III I 'I IIII I . ,I'IIIII III WHI III II I1II'II IIIII' I I If?-IIYI IIIITI 'I IIII5II I III I III I'III'II'I I 'I IIC I I'II III I I 'II . I II'IIII'EIIII IIIIIIIC I IIII' IIII III 'L 1.-I'r'III IIAII II'I'-,IIII I I,-'I I-II'3IJIII'II III'I I I I'-IT II IIIII I I II I-CI 'IIII I' ILE I I 'IIII I IIII III LTWIRIIJI 'I. II'I III II I I'II'-II III-'I I1 r'I!LI.I3II IIIII IIII III I IIII IIII'IIIIIfIJI . I III II II LII II II IIII I I UI I-I IUISI ll' II I '53 II II'-IIZII-II 'I I 'I IAII -:Isl I II I I-155 IDI '-.-' ICI I UI'IIIIIIII'sII I I. I 'I-LI'IUI'IIIII I I .I I II I III' TI'II'I 5 I I II' I-II I-JI IIII I III II'IIIII'II I-'I-III'r'IIIIII'II IIII I IIII'II II I II I'II'IIj'I L I'I VIH II II'I 'I I '.1 IIHII I 'II IIIII I II I III-'.II III 'INIII'I?'zr'I Il 'I I I LSI IIIII IIII'I II'I IlII'II-lI II'-CIJI J IIII IIIIII 'I II' I'IIQiZ.I CII I IIII UI I.I11I'II-'III II'-IL , ' IIIIV' III II 'III' Ifl2I I I'II IIPI'1I I IITI I I'-II IJIIII-I I TI IIIEII IIIII IT II IIII I'I,xII IfI I I I IIIIIIIKIIII III UI I II II I IJII III'-'I I IIII-'IIIIII II II'II I I'II'I I Iw 'I' I I'-IIII I I:IwlI STlII'II'IIIII'I'I'I'II'IIWI IMI I I-II IIII 'I 'IIII IIIIU2fZI'JII I II I II IISIII II 'I IIQ I I .IIII I I I I II III IQI'r'I II 'I I I I 'I IIII I 'I I I I. I LIJI I I IIIIJI '-,-'I I-'I I IIIIJI' 'IIIIIII IIIIIQII IIISI IJI 'I'I II II II I II IIJI 0 I 'If' I III IIIIII IIIIUI I I III IIII I II'I II.II I I IIIII II I I'-IIIII I I.'I I III II-'I I I' -I II 'I 'I 'Y'II'I 'I'3I II IIII F'I II-'I'I III II II II'IlII-' LI IIII 'I 'r IlII III IIII 'I I IJ I I I LLSI I II I II I II I'lIf,. III I 'SL' I IIII'I 'Y'I.II'I 'I' I' IKIIIIIIIIQI I'I 4 I I If1'llII-II..iI I--I.I.1::SI-.I::. I I I:LI-Q,I.I--II.I I I--'I:.'-I i.II..II-IITTI'-I-'I::. IIf-II-iIz:.II.It3I.JI 'II::. I .I.IJI'II::.If?II::.I'IIIZ'I--4I:.If'II-:II...I...'f I'L,IfIIfII-iI?QI IIIIfI7II I 5 I I IIII I.-'I II II I III I I Iwi! I'-IT I I II'I LIIII I'TI,III I II'I'-.-'I III II I'II II IQ' IIJVIDLII ' I I I I'TI IIII I II I-CFIIII II IIIII IJ I.I.'I If I III .I ,III'II'II IIII I III'II I III'IIIII:'I I 'I'II-' I I II III I 'I I I'III 'I I'-II'II I I II I.-IIIII II I III '3 I III II IJIII I I II IZ, II.II 'IIIII I III I II I I I 'SIII II'II1'I I IIII I III If' II 'I'-II I'-ID II'III'3IfII'IlII I II I'Il II I II II II7 3 II'II I'II-'I, z I I'II LI II II II 'IT I ' II ru I I III IIII 'IQLII IIII I-'I I IIIIII II IIJIIII II'II II' IIIPIIIIIJ I I II I-'LILIII I II UNI' I I w'I,-.IIIII-II? III1II I IlII I'II I IIII, I I II IIIII I IIII I Iw' I I'-IIII 'I I'I'II-1 I I'II I'-II II II I IIIIIFIII I II.I II II IC'I II I I III 'zr'I'Il.I '.w IIIIUI I I III'I I'-II 'III I I I I III L III'-,II II I'I I I I.I IINII I'7III'I IUIKI I I ' I I'III I II IIII IIIII I I IIII I I I IIJI III III,-'I I III I I'-II IIII II'-II I.-.II III I'v'I-I I.I I'I I' ,LII II I 'f'I II II II'III I '-.-'I I 'I I'IlII I II'II'IIIf'I IIIII III I IIII 'I 'I-ll I2 I I5II'1 II IDI'-II I II 'TIZIII 'I 'I IIII-'I 'f'l IlIIII I'-1'I LIIIUIIII II II I I,'II IIIIII-LI II'I I'I II'I'I IIII'-,II I fSI I I I'TI.III. II-IIIIIIIILII II LI 'IIII I .'I II I II III II I II II'I I IIIJI II III III III I II 'I I III I I 'I IIII I.-I II I III LI'II'IIII II IIIIIIISII I L.I'.'IIII'TIII I I YI IIII'I'.IIIlII I III'-II'I'f'I 'I. I I'I'TII' III I IIII I'Il II I III I I 'II II II II . I I I II II I-3II'I..'I I,-' LG I.IJIII 'I' II IL I-'I I'III zr'I'IIII'II'-IIII I1I'II'-II II'-II'-II 'r'III II 'I II II II . 'I rl II II I III I I I I'III II If IU! IIIII II I I'I'UIII-II'II II'-II I,'r II-IIIIQII IIIIJI 'I I-'III IQIII'-II II I'l'r -I' I I7 EI FIH IIIII II I'1.-LT .II I II ' I I'I.IlI ' I-'III IIII'-I'7IJI I IIII I-'I LI IIII-LI I'I'-IIII I'TI'-,-'III fII'II'III.'I II I': zr'I'III I I--II I I IIII I I III'ITr'I'I' II I I ICI II'II '-:'IIIII. I II'I' I I IIIII II .L I I'JI 'I II IZIIII I III-'I '-JI InI'I'UI'III III-'I Il II'-IIPFIII III I I GI 'I I 1' fl'-I I IZ' I I.-'I ESI IIIKII I IIIII' -I,I-'I III II IJIII'-I I I Il I I IIII II II II I II II,I II'II 'I III II-ILIIII I I I.II III I T I I ', I I 'IMC' ' I I II r'lJI I LIIIII'-I I IIIIII' 'II II I III I I-I,fI II'-IIT IIII II'lI iJ I I'-I II II I 'II ','I I 'IIIIM-'I I. IIIII-..C'l.: I IIIZI... I 'l..It..-.I. I I.I..II'III....l,' 'v'I.-I-.Z I .I.l.,I II...I...II' ., IILII-1 I. ..:.fI-.II'-.I I IxII...I...'sI I'III .III' III.I.I ILII,.III.IPII...I-.'I' I lIIII - IIIIIII, I LI II' ICI IIII I I I'-.I lil' lx' IIII Ixl H DIVISION QUMMUMIQQTIQMQ DEPMRTWEMT 1 H5 DIUISIUH CUMHQIQVSTEMQ UEPHHTHENT I nxvxsxmm FQIWIHQQF IIRST nmwmsxmm wammmn DIUIQIUM EMTML DEFMRTHEHT mmwxmmvxmm DEPMHTHEMT NIMH DEPGWTNEHT mmm DEFMHTNEMT I nxvxsrmm naman Qyfzfa Immmh Ummm UEPQHTMHMI IQ-Dmvxsxmm THIRD DIVISION wmwqazma miyzmx as nyumgymm Immmmmn Cmwaam QQUMQELUH gnvw - Itmwmmnv UPMHMIIUMQ UFPIQH nummx Kms xiwn rum? Qian NUMB Hmmm rmwmmxm UPEWMTIUM PIER? VIGIL uumml SPORTS Solutions can be found on page 45 WORD GAME 41 ,,..,,, ,-,,,,,..,.,,. ..........-.-.-..-..,,-........-...-..-..s..-4r---,-,. , , ,, f...........,.4,.--nf r-V -4 ---N ,,,, ...-..-.., , , , - ..,,.....,-.......-......-,A f-.-- --W.. --,-W------fy---W f-- ,-. RELIGICUS SERVICES The Command Religious Program is the Na- vy's way to meet the religious needs of crew members and embarked personnel. During a WESTPAC deployment, sailors and ma- rines are away from home and their regular place of worship. However, there are many opportunities for personal and spiritual growth during that six months. PELELIU had onboard three Chaplains, three Religious Program Specialists, four volunteer Layleaders fRoman Catholic, Seventh Day Adventist, and LDSJ, live vo- luntary musicians, and several vocalists who shared their talents. On Monday through Friday, there were many on-going religious programs. Each day started with 0650 Morning Devotions in the library. Roman Catholic Mass or a Com- munion Service was held each noon. In the evenings, either a Prayer and Praise Service, one of several Bible Study groups met or the LDS Home Meeting was offered. Our days were closed with Evening Prayer over the 1MC. at 2155, just before lights out. It was a very common sight to see two or three sailors or marines, in whatever space or time that was available, sitting down together in study, discussion, or prayer. Weekends were just as busy. Catholic and Seventh Day services were scheduled for Saturday. Sunday had choir rehearsal for the two Protes- tant services, there was an LDS service, and a Catholic Mass. Religious opportunities did not stop when we made our portcalls. At each place, small groups made contact with local churches and their members, where we shared in worship, fellowship and many fine meals. Our Chaplain says he put on five pounds, due to the courtesy of the Intemational Christian Church in Dubai. We were all very well received during those short days ashore and found kindred spirits wherever we went. The Gulf may be in the middle of nowhere surrounded by desert, but many found our deployment to be a place of spiritual re- freshment and growth. 42 RELIGIOUS SERVICES Above, Cl-IAPLAIH BRANSCUM leads the con- gregation in song. .,:-- 1-'? ! N ' 'r ll. , ,517 lk sip.. ', f3' I .- Ji -f 4:44N:S04. 4 S' Y ....... I D RNS! nm. RP5 HADDEH prepares the altar for services AEEYCUHEM-EXECUTIVEDEPARTMENTSHFETOZDIVISIDNQPHICUHHUHIPHRTHENTHU IIERCCDHI9EF7FNFLINEERTHGDEFGAIELIIEFQNFFHOTGRQFFLWEJOQRHQNRQAIND RIHOTFEYUUQVEQLLIUGINNGHELLUHFIFQTIIJVILECWEQCREUNNEQTFIQLTHIVFYF DHRIVTHHQEEENHMERYIEUSTYTIHEFE0FHU?TUFUSQDNEFDORHEECFEYNIQLLYIQIN ELEIHMREEEENUUEIIHNb0NTAHIGfETHRDviVUIFEIMODIMITHNGHEENTFUNFLEMII PNMUITHMLLTHEFUSEIEELEDELSIGNYEHHEPLQVDUTMEQHBIITICHfHUSFETHMATTH AIMDDEPARTMENTIEYETQF:KUUDVISDTNEBFEQTYUUAHMIAEEWERDUBAHRAINTTENH RFTERFMFTIFIFQTINLUIDNUFEFEHTEIOHFIRERHUINGILTNENENTTUHDNMFOHIOFU TR?UHEUELLPE3ERUEDTREWTQHIFPEPLQFQTIFIRSTDIVISIUNUHHFTEPRQBOUUTFI N EDSQHSTHEFENEGDTFUCNIEFHQYAAMMHINQHIHEMCIEDYFUFTHEFEFHIHMGUNLFC EURJEUPARDYCRUISEEOOIFHUTOGRRRDIVISIDNFHEAVQJSUIHEDLUSMROUNDGDIND UZUCILFEQNDFEHHINEIDNITHUEUHTTTILTHEFHEFREFLTOHHUFQFKIQHELUTE'Ri TTUFOHHUHEIHHTRNINGLEEALCUHHNMIMHIIFFEFENETTHEINGvHEITHTHIEEUPUIT IQwkNEITTHEUEFYEESTTPHMTFELELEIUEEHHSEUEFEHNDMFUPFUUFTHOSEUFKAI.. UHUEDIVISIDNHMUEFIOUAFEDOUTTHNMTTNNHIRIQMRLETSUFFLHDEFQTEHPRURHTH EEDIDTURTHOFEYUUENJURIEPTHIQLTITTLTTEFUIYCLEEDINCEHUUUQSFENOHTREH ETHLVLTHEIIFFEFENTTHMINGvHEHMbEOTTEHFTEDTUUIUPTHIETAIHERHROUNEDIQ DTHMSCOHHUNICATIDNSDEPQRTHENTSTHHZHHETHEUNHULAEHI'HIONTOHQTUFNUTH WUI ?EIf.'fTiMHi?t: H I T :f.m7'm7HLhV1 I I I-IILIPWDIEDTH . VQUFDCDUFVENEREHUKHLTUNEMEFTHMNUTHERFHELOEUHFTUIRHQFITUSRETUFNINE IUTENGINEERINCDEPARTMENTDILUNCEEMCHMWDHLLLOFYMOUVNHUHHLIETQVENEHR SREUFEW EFfTHIGHm?OMDUNTPINATUBOUELLUHILEDHEHEHXEIEEEHmAONEUEHQ.P Y ISPDEWIUUHNLLUEV' FHMNDDUEMLmu3:fELIHRTEDNTHEDSUFFOBRTYOJJFIZ .SIRI mi E fifE3-f'KDC IRFFEHWUXTHEUDQHELFHTNPQTTIENTUIUJTUIini HILHUIFEFUFLL NE fumumm 3fZQ MiuTxTUrUUfHFELHITHQQEDEEDBMYFLEFSQ UFETDFMUTTGHIQEUUFTUTHIRDDIVISIDNEETHEEFORWUUMNLICMNONNLYHUFETHMF TYOUFEAELN UUHMIEUDTTENYOUEHDNECHENUFTHHDPERATIDNFIERYVIGILQIUUDU ImEnhbUU0INMLLYUUOPERATIONSOFFICEEFUTUFEENDEHMURQHNPHQYYUUTQIEEQU LHDH'QnHITCUHEQHNITRrTOHHFEITQFELIMLFUFEUERYUNEQFUUHD UUTHIQFUYZN CSDIVISIUNLEHHSCEEMTEDUNTHEEIGHTHUFHUCHQPLAINSUFFICEGUETICQ115002 I I I ' -1 v v rl 'W I v .f I S v ,I K I . I , , ., , x , , ' 1 x I u. ... ,,, 1 , In , X in 'S If ' ' ' 1 L' 'S ' ' 'I 7' 'II - I: I' L . ' 'I . ' 'Z 3' - A' F32 - IC ' I: ' I 'V 5' 3 . It I 4 K I C vi 'N I' yxk I -s I 3 -.1 I 1 ,J I rw It 1 -x, ' I xxsx 4 xx 'I' L71 I' l ,I :I xJ.,yI M I. xx- I 'Irs ,I I' I M I III? Y . x ' ' I I: 3 ' 'T I XI K It I I I x -s 4 ,' II 'II ' I J ?I ' ,. ' C' 1'l 4 ff I ' ' l lI I I px-Q I: s Q :I I: It I -I -. I- ,I :I , :I .1 , I: ., i J ' I ' ' ' -' I ' I I If' I Y I s s X NPI! I 'W ,I ' ,I I I SI x .I IK x Ll 'I It IL xl 'S' Ir' I I s a s 1 1 x I ' ' I: It x I v I I 'E M: V 'Q gf , xl I: I in A : x : C I III VI T I 'I ' 2 -' ' ' F -1 Il , -: ' HUC ,L , 1 xl 1 1: H I I J I I 1' I S4 5: I . I ' ll I C1 I in J .f ,XI is I v C Fl II' II. I IKIL5 I I I .I. E3 I-. l:. 'I' 'I' ISI FQ III I I U T FI' E 'Y' O IJ I I Fl 'v' Ifif T FII Iif I'1I '23 Ifl I'I Iii 'T' I U I'I E2 FTI E IKI If' F71 Eff FH B I... I.- 'FT LJIJCII I-CEI 1IC'I3II l X, ,I rw A I I I 1 I I I 4 y , K ,I ,I In 'Fra I 5 24' P - -I I II I1 15-13 If IIJI4 TUIII' I I II ICU! 'NI INID I Nl -IIT!! JLI II UI IIQI IIII IIQiISlnIIf'I'IRD c'I I I III I I' II' L7 I' . l i r'I3 1' ' 'O I f ' ' I '1 In I I I 1 I I 1 .1 I M.: , I 1 ,J ,x -. ,x ', ,' ' 'X , 'S Q E : ISI Q SIIL ll! I 'K ll fl , I' 'IJ Iv ' 'I Hx I If I, ' I' I 'I 'I I, III' I' II:'I'I 1 Sl L I ICI1'I'IU .. ' I 'F I PII 'I 'I-' T LI ' ' ' ' I IMI I-'I CULT.-II I I JI FI.-JI IJUICI' UI I 'I IJ r'I JI,-'I I 'LI RCI' ' .J . I N' II. N01 ' I Ir' III I.L I PII I I IflIiI IF fI4f'Il,If SE ' J I I ' I II-' 'I I S I I I I I K fl H ' I -. I U ' ' I 1 I IYI -Q I., -x I , , M: I: , I ,I I -H GX: II A I I, K, I Is I ,rs -s I , I I Q Z f Ixl in : , x-:H :I ,IXI , C N: , -x I: ' , Q ,I UYI MI: , A A A I -. , IW , pl ' V I s ' I 1 I ' I I H I EEUTIUE DEFMETNENT ENGINEERING DEFNETNENT u DIVISION EUNNUNIEHTIUNE DEFMETNINI U DIUISIUN '-.-' EUNEMTEYGTENS DEFMHTNEHI If :GZ-Z' Iii' ITQ fli I'-.I I E23 I--I lj Iii' IIHET DIMIQIUN EEEUND DIUIEIUN 1 I I1IT'61IN. IDlEl:'FhFk'TI'IEZI1VI' IXIFHKJ I IBEW T I i3I1I IBIS! 'FIVE TI IE IKVI' MIND DEFMRTNENT gym DHPQHTHHMT HEUEEZQM MDNIN UFFICE IIBML DEER DEFMHTNENT II DIVIEIUN THIRD DIUIEIUN IHMFLMINE OFFICE E5 UEUXEKUM HMQMW EQQEEW EQ ELG? CCTV IIUFMRDV UFEEHTIUNE OFFICE 'HEQZ IND JINM IIIllJl1VT' I:'1IhIihT'LlI3EJ IIHKPEQE 54233653 IHHEHIN UFEHMTIUN FIERY UIUIL DUUMI SPORTS - Awmmp CAPT MYERS CAPT WEISCOPF x i 3 +I S E ,115 E ' I 2 II - - -ur II I I CWOWSH I ' I PRINT SHOP POST OFFICE LEGAL CHAPLAIN I n o an Q 2 Q rn 11 -1 +1 '-1 -i Iii DENT Lf MM' USS PELELIU ILHI-II DEPARTMENT STRUCTUII1 ORGANIZATION CHIII N , 3 I 0 NAV - - iuron srmewe In 3 rf! 111 E21 I 1- -z 1- '57 ln: WRAL CRT M T ,-'ggxg X251 :,4, N, Y? ' I as Ap 7 9 I ei Q 'o , , f .lt sl I WYYYY xllll Kllll X X fsfl-'fxff' Z Ab' wifi Qvf- Em? 4iFXC3, 99155028 'Q-Aitiiim .gf-,dp--m-4-fffib The mission of the LCU is to land and retrieve personnel and equipment dur- ing amphibious operations. The LCU is used to land personnel and equipment during and after the initial assault wave of an amphibious operation. The LCU overall length is approximately 155' with a beam of 29'. Her maximum car- go capacity is 168 tons with a full load of up to three M60 tanks or ll-50 combat loaded troops. The LCU displaces 186 tons. The LCU is made of a welded steel flat bottom construction. The maximum speed an LCU can attain is 11 knots. The fuel capacity is 5220 gal- lons. The LCU power plant consists of two Detroit Diesel 12V71 engines pro- ducing 42O horsepower on each of the two shafts. The LCU is manned by a chief petty officer or first class petty offi- cer, who acts as Officer in Charge, and 9 other enlisted personnel. The LCU has the capability of sustained inde- pendent sea operations for approxi- mately ten days. Each LCU has its own galley and berthing. The LCU was intro- duced to the Navy during World War Two. During this time it became clear to the Navy how important the LCU could help the mission of the amphibi- ous operation. y .......-,....---.,...,..,--.4...........2 -.,. -....-.......5.- . , ..-.. ........2.. The Landing Craft Air Cushion KLCACD is a new generation of amphibious assault landing craft. The LCAC employs air cushion vehicle QACVQ technology combined with gas turbine propulsion to yield the capability to deliver men and equipment of up to 60 tons at speeds in excess of 40 knots. The craft is capable of exiting the water where terrain per- mits. The LCAC, like all Uhover- craft , rides on a cushion of air. The air is supplied to the cushion by four centrifugal fans driven by the gas turbine en- gines. As the craft accelerates over water, it reaches a critical speed at the.18-20kt range. The transition th r o u g h t h i s speed range is re- ferred to as get- ting over the hump and re- quires a high level of engine power output. Once the transition is com- plete, the Craft ag- LCACs on the sandy beaches of Iwo Jima with Mt. Suribachi in the celerates quickly DHCKQYOUHG- and power may be reduced. The LCAC is manned by a five man Navy crew assigned as follows: BMC Craftsman, GS1 Craft Engineer-Navigator, OS2 or QM2 Load- masters, and a ENFN or GSMFNXGSEFN Deckhand. The LCAC is a vital EMBARKED LANDING CRAFT 47 part of today's amphibious assault. 48 EMBARKED LANDING CRAFT l Clockwise, Upper Left- PELELIU's playmates LCU's 1648, 1655 and 1655 tied up to starboard while in Dubai Diydocks: LCU loaded with troops and cargo during Sea Soldier V exercise: LCU makes her approach on PELELlU's 'iGreen , Well: LCAC 50 roars towards PELELlU's stern gate. is fin EMBARKED LANDING CRAFT 49 I would like to take this opportunity to interrupt your viewing pleasure and remind our readers that 500 pages of fun-filled action packed ex- , citement await you as we begin the 1 saga ofC1ULFPAC '91. So sir back i and relax as your about to get un- Q derway with the USS PELELIU crew 1 for a six-month odyssey. The 1991 l PELELIU deployment to Southwest 5 Asia in support of Operation Desert 5 Stomx has been a significant period , in all our lives. lt was a time when ! Amphibious Readiness Group QARGD ! Alfa with her three cohorts, USS l CLEVELAND CLPD-75, uss com- R srock QLSD-453 and Uss BRISTOL COUNTY KLST-11985, represented 7 the amphibious fighting forces in the i Arabian'Gulf. Add to that responsi- k bility the harsh environment present 5 during the Gulf summer months and 5 you have a deployment that tested 1 the metal of every Sailor and Marine. Before we start our adventure, l would like to extend special thanks to all Cruisebook Committee and Editorial Staff personnel who helped get this cruisebook completed. To all the writers, photographers, car- toonists, artists, lay-out technicians andsalesmen, l salute y'all for a magnificent job! Without any further adieu, I present the 1991 PELELIU 'XAFTER THE STORM CRUISEBOOK. ENJOY!!! f l i K fx! .-H 1 V 'X I ,, . ' :IE 'A-'i',:y. vt, I - ' ' Elf . ' , b ' ' i EJ . I 4 :',',1,45,igff5Zl,5' . ' f ' .' .5 T rl ' 'Aw,y'l'f 'f'tQit73fi'1G vffhwf l'-'l,.-auff', ' L 'X I- 9455, 11,3 Vxlpyw. , ,f V V,.4 f' ,QV ., 4 T, .I A ,,,-V. . U, ,QH,,AVA,, N. .4 , 9, M A ,.......-- I H ,gfvsmff We. . - if 1iT'f:l ' fi73t51If5'r' +l L'f7:'3T22i?'5571g ff' - i I fl.,-A ,qi-,,.r,.,, .Im .Mfr ,,.,,.,M,.l,.,,,',mIg:a, yt 45 ,, I, f , ., fr:'4g,.f ' f - ' ?,:QIa31y+'53gg4lf 41 ' Vg ffgifgifgfi1'.i,ELff4:rg13Q5uQfa-:29, ,xv rf W V 45, 'S 5 l,,4f.:i,-B? 1,1 -5 M ' ,r if ,jg2q1'i?,g., -j.VQ,Vffrf.5,y1,3.P:w1VZmze3g.Xi:i uf in Q 54,+i,,:I,pf5'fQ,gjggtmfqMi.,,gf5E4fvv'gxWV, 4 ,F- 1 ' , wi fi' 5'-i J?9if'?:f PM JP cs- I A.,+ii+5ii15! ' - 514 - 1gjggigaziivgftiliiifiiigiifwft'' , 4 1v ,i, - . ,.'f, C-5, L4 ' 'v-44 ,'1f'E ',-V' ,' M V - a r ' -nl. 'Az' Vg- ., Q.-53,352 ,N AV. ' I V .u 'ap 1 ' f M331 .' f: .ffi . 5f41'c'1 'fail-.qu : ff, 'kg yggvwi -,T Q,-, .wgffflm . . ,yfj,M,., V. ,Vw W I' v, .nl H f ffl-,ii-221' 1'-:A+ - ff 4- :M 1' 'EY 4976 I-7' ' .f .' 7 ,3g,n4f5'.'afLg-EL' ,:- '2I iL'QI' -.,g1-f' .q J- 'fi 3 K . lil it Eff.-. -. uv ,- Q ' , 442335 : H I x wwf .'q,f.yf' Am -' w .- 35:5a.+'2,,1cQ. '1 in f M, I '--gif' 1' X- .,,4,-,,,,,-3 - V ,1V1-,Mfg J ' , -155-,V,g.,,l-5,,,.,.5:,ww ..-'aww 359:15-f,3r,5'f,3g' J' r .pr I . ww- ' i? 1'4'f1etkfAs'1f'-fliif,' r.6Wi?fflw fz-zlfgv, ' ' 'ff' 1' :Mg - , lf- f sqflyl . '+ 'va'-g:tq:sw,'j ms ' hrmwfwi :ri -' ' m e,- 4R3 em Mfr.,,Iwv1e-w,5:2?Jzp'1'f-05'V+- fmfflifmf , . 11 y f , t-J4.--: ,l5YQ'L6f1i1?f:4?i?4'- -'f' .iagw-mai' - ' ' 4 - 4.4-,I.,.x. V ,V V -,4-,,.... ' I in ' if F, ffx, - . fb Y LEX! X i.. ,. I , W ,, is ,-f I . fv 2 'H ww f 4 4. , ...--, lg ,V 454, f 5 I w14zl.1:.f.:..e..-4.:14.,..Q A I-r,,4V, ' , . at X, f if , ., , f . ,Ns-ffmx fs. EY' ' 'fl 'f Dfw V, 1, fx 51, W, V -V ,1 I, Vg V , gi VV .. V Wifi , KQQVVL ,, '-mt, , V My 4 V 2 f ,V '5 F SV-53'-f ', ., 1M , iff- 5 W ww, ffww- ,Y ' i' x, ' I , - ' 5-L3 iff . 4 f Wh u, 'L I5 VVVK V ,gtkylfqkw , V V, ,gill ,,qV,3V,,5?fV1,V5t,VVlV V . V If-AJ - ' ,,,,'gjf, ,VN . -, ,- ,..,,M.l. , . V , -, ft. . f N , Qmi,EVV11fI : xii, AVI TVVV A N, V . s3,..- , v , :iii 'lf 1- I n ,I I ' Lg -T ' 1,4 - WIQV sq, V' A , i i' M if ' f LVWV:t,f ,J VK, 'r 1, 'V VV 3 1' VV pQ.L1V1I.,f'4? V iii. jf V ' ., QV' ,I I it I '- 'V '! V , . V i 5 5 9 Q K G77 ' .. ,4Sf'f'if ' - 3172 - 'f' 747 Q '51 ' 51 ' X M , .V not VV VVVK V V AJLVAE, , VV NVE V ,ug , f ' , V A XV j A GV A,.' 1 f Q 1 Am, Q VV V VV ,.,, V Nw V U VV VV V V 'I ' fu' VV fV X ' 5 5 -:fig PQ-I Wfmfgw ,ff M J HEL I was a little reluctant when I began working on this year s crulsebook as Assistant Editor Why? Because I foresaw the amount of work that such an undertaking would require - e long hours limited staff and resources and cramped working conditions to name a few But as the days went by my mood soon changed Instead of seeing everything as work I started to vlew putting the book together as an educational venture You see this is my first ship thus my first deployment I hterally had no idea of all the departments and divisions needed to operate the PELELIU in order to have a successful deployment. To know that every man on board has a purpose and is counted on by fellow sailors to do his job. The teamwork and coordination required, and the selfless devotion to duty. Although this is your cruise book, I dedicate these pages to you- the crew of PELELIU. I only hope that you will be filled with pnde as you tum the pages and see yourselves and your shipmates. I want to thank you for teaching me, and for making this book what it is. MRYMQQ ASST. EDlTOR'S PAGE 51 , -..-W: W. A,-K., A f '90- '- -gm. .kwa f'f,,f ,.m,aww an eegw, 1 H 1 -mf gmt Ri? , x x 2 W --.f H k ,sz A, z gx , xr KW M '4 x v QL W 'D wf7'5?S1vw'n s 'I K 'Lv ' KS? Q wa bg Q H. fx w 5 Q- w 1 'Q Wx M 5, 1 II 5 'm ga was Xi N31 252.gif K Q Q59 ixigijgygaah w -A Q, F X554 552 .iw ww M ye. N A 'fx m may 5353, M f, . wk X45 x S23 f 'ii W' Y ,N wwgwciiw ,,,,Q.,,-1 Q5 Eg gy, 352, QW -avr , ff. 'ai W1 Q3 ER WW ' V ,ZSZH wfldmqf' 5195 fg ? f ' V2 fiwgix M ' M mi 4, uw, i 'S awed-ap. -vs 0--.. A we 5x4 nw. :JQQETPS5 J 4 ..v.2.1f!. f.3,3.f.: T W, W... 'YL' 23.2.:i7f:,f:,r:3i-:V-A :i5ffffffTf14? ' Q Mlm, ' 14212, Q 532' ,Q W w ifikffigfw 53'-L 3336? 352m 1 A4 Q Q4 my 1 2- , Q62 binge! cQ?S 3 VW Q ww ,Nw ...-. vp0A .........ff+ - 1' s ,f4,.,,v ,, .,..L......wv-ff x,Q:,.,,.w,-1-fr::. . V, 1 .xgenf - X .Q , , M WN, x as x .M tif' 5 N 'iw N nik . S ,. ,V W, f f .1 w 4 31 1 4, ,J gr f.4,,,W ,5 ,VKX , W 0 , 1 Q , ,gif 'sx: 6v 5:? 395 ,y my? 4-wk. f ag V14 v, aiifai, If VK 44? zqlafm' wi 5553, W w v 31,9 S xi iff q 5 H, ,K mls A 'ir ziffr fi Mznfzm Y ff 3 fad' xyf f J V! Jw 4 f X A Ae,- , ag, Alhff V 3. fd A 1. f-' N ' Q .1 Q, fw in - z4...f--QMA-rfw -M -V V wiki, ilf ', 1 f ,A , ,4 ' - . Mm. wc, I iavifm oe: : 2 Misha. 'x 7 3 ,. X V f 9, f 'ff I .gf.,,yWzf fixdiy'-1 'f' Wi ef ,V , , f 1 3, '1 -Hfw . f'.'f,,fQ,,,j' ' ' . Q I V , .. ,I ,M . ,,, f .cw , f I ,,ff?,,f,,,., ' f4W1w,, 1 af., f f, H W 1 ff I i 1 I I Z i I f 1 H x Q I 1 ' ' I 4 I 3 4 I 1 9 4 4 5 1 F 4 4 4 Y ,,-x--......---,..,,.,,,., ,---V ,.,Q ,,,, ALM A..- Y ,-, Af, A ,W , -..AY , V W M-AV V- - A- A M- A I 1 -- 4 Photo by DS5 BUENVIAJE Photo by DS5 BUENVIAJE DEPARTURE 55 1 1 A I Awww rffmwvw-2 -ww ffnwwwf N-nwwm-Awww 1Mmf,q,w.ff :Aww :wm,v.maxxw-vnsw -M rw.-ww and 4 I S ,XXXX X A X X X E X X X X X XXX. XX X X X f f f ' f ff,,ff f , ff ffyff f f f fff ff V X X 419 l 1 X I i s, NAVY IWO J IMA 61 ..,,.-.-.,, , ,-,, .,,-...,f...... ...,,.. S. X X W Qi X MI ZZTNZIJ :NgW.K.,,x,N...W,,M NQZVZ IKQIWN WWAN72 I :xmLf I33'v'1zvw1'?z!m 'xam'.ww'3:1ftK't 1t . f...g. ::::sr:mraw2:aSs'7' xmzzwcaw' uwzwvf-v-m'7'e:w 11:'vw::: ::rm-vxwwz: ,xxwvw-wggg-0 vzzzsrvmm 'ww if EN f 5 E ivf 11 I I, 1 5 I 4 E 1 i 5 E .-...A -, 5. ,Ai 62 J EOPARDY 4.---.,..,. .4 .......f ...... .fat EE Left- Birdseye view of PELELIU Jeopardy action. Below- DS1 FRANCO seems to be caught up in the fun. . 1 Left- Teams listen closely to the next answer. J EO PARDY 65 it 'www i'f'1,fJ.f W, ,r ini., iyiy 3 uw Fsiwis 1-' ,A Hi Q Y' ' ' ' ' ' ' E in 'Q '! ff-'?+Ei.'1 E ,HQ N, .N ,.,!., M f .f1f,,1'sv- sw wg :Quay 'J '- D ,L!,N , 1. 1 1 iv f, K ',!- 'fsiyi -f Plffvxi lei iw wi iii? , n,,,,.,, ..,, , 57 elf 'Q-fi inisxzrvmi gij:1E'ff'i-36115 iffififfflf Siixyasazaa gifxptligiil fvf1,?,i'-5,2 2?effi'i3w?fF X Q'lf.',g75,jf 2-iffQ':5 3'3 Swjuym '2'-Q 2iQ1w5:5fii?1i Q:-ifvfaw ia' -1 i FT-iii 15,1 g5P2Ei3i3? Miriejiii 'ul 'f lf ',g5ft5:'Qf1341'g', , Qi,5TgI1J,if3g:.f iff 15. V iii , my .31 sroms , , ,NWA f 5' lm! f gi 9. QE TQ LDFI Lf .V . . v ai V., ,. ,,,, . ., vs ti-are-2siaCr1MJ.92uE ,, ,, ..,V , ,V,,, 1:.i , 926: . V 5. 5 S100 by 5195 ' H' V Z, F' W4 Aff. E iiE DiDio 4 ii Q f Q 400 3? W-L1-'xii ti if is 1- .,,AR Q ,, fi R Q , 64 J EAPORDY BALL' 1 ..mwzL,.aWme 'v I ILY DOUBLE CAPT MYERS, HMI5 HUGHES, CAPT SCHNEIDER, and HM2 KLOPE look at the Double Jeapordy categories. SSSNCOVINGTON, DSI5 SLAWNIKOWSKLI and DS2 SO feDresent Combat System's CD Division. .M....M...No.,..,,......,.,....., , .. ..,....,........D ,D 1.7- Below- CO plays the moderator while Vanna tums the cards. ii 5 5 Above- PELELIU CHAMPS, OA Division, l show their stuff. ff,.j,f, ll 7,1 ,!!,.V, fllivv, 211,16 1,1134 .ll IIVI Alu!! , ,,,.f,HlU! WH, ,IMl,vv, ,IW :qw V V ,V A If V V. II ll A 1 ,, I ' H local Gulf garb. 'X' ffl .ff f .'.f ..fw4.1f, ? 4' 4 fx. ,, ' 1 f f ', .. If 1, 2 I vs-,QR Left- Jeopardy Specta- ' tor CW02 'iShe- ' keeens DAVILA dis- guises himself in the 3 ' Q J EO PARDY 65 E Ang nAF1-fic f'Nf Y X DOH LL I CONTROL LL. C9443 Cl-1567 COBRA 5m Sl o 510 5'o M CI V if N Q -I O W ye N : M . M, xo ,---- O X If '-'SL ' M5 , Vvx go q xx. Oo x PUQCBOY 4 r , . Q A Er , Q' , W' . KX A. XM' WK , I YI XJ Q :VZ N. , - I T O 1 5 T Q, 1. iw I I fl pf w X 135315555 5 I Q6 ,ws Qu- I I X of J ff I AJP I X I QQ hosfzfe 3 ,Q X Q IMF? eff Q2 X . -1 I : .- eq I' N I 1 ' -gg '12-' ff, O, N .IL lx f 410 o 0 'Q 6 E 4 mg? K Vg ' 5 X I X Y X53 X X 1 X 66 OPERATIONS 42: M OPERATIONS DEPARTMENT WHEN IN DOUBT CALL OPS OI- OPERATION SPECIALISTS OA- AEROGRAPHERS OC- AIR CONTRQLLERS OZ- INTELLIGENCE CDR D.P. COOK Edgemont, SD OPERATIONS OFFICER Operations Department is one of the most multi-talented and versatile organizations aboard PELELIU. It literally has its fingers in every piece of the pie . From air control to weather predic- tion, supplying intelligence data to ship's photography, all facets of the ship's day-to-day routine are coordinated and controlled by this department. Spearheaded by CDR COOK, the Operations Officer, Operations Department can be broken doum into four areas: OA, which handles all forms of weather prediction by gathering and analyzing complex meteorological data: OC, which controls all airbome ship-to-ship and ship-to-shore move- ments, OI, the largest division in Operations is responsible for gathering, processing, evaluating, disseminating, and displaying tactical information for various users: and OZ Division, com- posed of several job specialists, it provides all joumalism, pho- tography, intelligence processing and evaluation, intemal televi- sion programming and public relations. MAJ S.J. TALBOT Fall River, MA AIR OPS OFFICER 5, f 2' and U' NIMH: tl OSCS C.G. RAY Denver, CO OPS DEPT LCPO LT J. KOZAKAR Arcadia, CA SURFACE OPS OFFICER ENS D.fl. GOSSETT Ft. Erwin, CA CIC OFFICER 4.5 1 ff 4, Q OPERATIONS 67 01 DIVISIO OSCS B.W. REED Waldron, AK OI DIV LCPO ,, ,.,-1' fs,- ' . .ff-- -'J . Top- OSSN CHRISTIAN passes ship traffic bearing and range information to OSSN COONROD who plots the data on tracing paper. Above- OSZ5 PICKUP keeps a close eye on aircraft movement as the ship's Air Tracker. 68 OPERATIONS -,,. 47 f if Traditionally, the 24-hour day is divided into seven watches 0000-0400 Mid-watch 1600-1800 First dog watch 0400-0800 Morning watch 1800-2000 Second dog 0800-1200 Forenoon watch watch 1200-1600 Afternoon watch 2000-2400 Evening watch The dog watches -from 1600 to 1800, and 1800 to 2000 serve to alternate the daily watch routine so sailors with the mia watch one night will not have it again the next time. It also af. fords each watchstander an opportunity to eat the evening meal OS Operation Specialists IOSJ are responsible for collecting, processing, evaluating, dis- seminating, and displaying tactical informa- tion for various user stations. Some of their multi-faceted duties include: keeping tabs on all air, surface, and subsurface contacts, providing boat control during amphibi0uS ship-to-shore movements, aiding aircraft to intercept points, computing ship traffic in- tercepts, maintaining a navigational plot, updating all tactical plotsjdata bases, and relaying tactical and administrative infor- mation to other platfomas using communi- cation circuits. As the OS motto states, IN GOD WE TRUST, ALL OTHERS WE TRACK AND REPORT . O51 C.D. WHITE 051 PENGILLY OS1 CLE. SPREWELL Brooklyn, NY La Nlrada, CA Los Angeles, CA ZX ,, , , '-',f,iV -7,1 gy? 1 I , 7 f W mg Z ff ef f 'f f 7 f X ,Q 1 l :fx V X,-. f Top Right- OS5 SILVER smiles after a successful soda run. Above Lett- OSSN ZBORIL relaxes after a twelve- hour watch. Above- OS2 'iElvis GOODWIN makes a cameo appearance in berthing. Q A Q, uw I y Q gy Q9 Kg, s i 0' , x S 2 S S 2 Q X A Q S S ' 1' S .Q E if if S ff. 4 pax Ffa r'01 6s Above- Hey Randy lOS2 SHIELDSJ, what are you smiling at? U GPERATIONS 69 ... St. . PLACE 052 R L SHIELDS 052 C ZONE O52 MJ... LEONARD O52 S.K. NEERING O52 A.A Thomas, V.l. Seattle, WA Bellflower, CA Alle TX Whmlef CA ' Y . .Tk . vi., 5 f, OS2 R.L. GOODWIN ,,,g1j Q,g I ,Q Whittier' CA - A W ' ,eA' ji, A fi , V fgygqfl 70 OPERATIONS SHlP'S HEADING SWEEP LINE 110' RANGE MARKERS fO X Qi ff ff nf , f ,.,.,., Wk, , 4 W f 1 ff Z f O55 J.J. MCCULLER Pascagoula, MS OS5 J.B. MORRIS Detroit, Ml OBJECTS R z xs xo -5 a o 1,5 'O' vfyq nw Wx ',Jv'. ,.Xf M 4.-X f if f . ,if ,,, if ffl A A X , . 1 C JA , 4 ef fl ,Vf ff f X in A W 31 f' W n ff 'ON-.N xx -N.,x x.,,NN Nh-W g Nv',., Wginfwwbi J WNZX Q N V two W. .w Shu' f mmxwgiyk vfg , lyme, ,Q f N 'P 0' Q, I' 4, w , W' 30 .0 S ' s - !,f 1-NNNXS W 0 s Kb 1 ga E 9 j 4 X 06 Qc. '5' 3 0 2 S Y 'J O55 B.C. PRICE Columbus, OH I ' '1 'N Z 'Z sv O55 J.J. COVARRUBIAS Los Angeles, CA O55 R.E. MILLER Turloc, CA OS5 J.J. SILVER Hermosa Beach, CA O55 R.N. B ELLO O55 R.A. MCINTOSH O55 E.E. WILSON O55 W,P, PICKUP I-OS Angeles, CA Oregon City, orc omaha, NE Wyomissing, PA .- lla, . ,-ff ! Wk Top- OSSN SAHL and OSSN MCBRIDE point out the vertical plot located in CIC. Above- OS1 PENGILLY takes care of some admin for Ol Divi- sion. Q6 Top- OSI5 JOHNSON keeps track of surface con- tacts at an IAWTDS console. Above- OS2 GOOD- WIN plots the latest tactical formation for the ARG. OPERATIONS 71 ,.........-.-...v-.....-.Q..,.....-...T .......,.N.-.,Y-.,.- - .,. -...-.Y v --,V -.,.c... -.-..r-....C..................,,---'--1-.-..--i.-.-.,..,...f -.,-........-.--........-..-...-............,,..,,. .,.. ...,, ,.,-.- .....--,.-... . c, 1 O55 W M. SMITH OS5 S.A. JACKSON OS5 A.T. JOHNSON Seattle, WA Top- OSSA JAMES maintains an accurate Bridge status board. Y 1 v 6 Atco, NJ Herford, TX P 5 I OSSA K.L. JAMES St. Louis, MO ' nw. ,. Above- takes tufn at the QSSN R.L- MCCLANAHAN plotting table. 72 OPERATIONS Lincoln, NE OSSN M. SACIATU Long Beach, CA OSSN J.D. COONROD Fayetteville, NC If A , i, . VXXQ C f Q 'P X.. X A QXN N -fx' X ,X Vs. Q I A Q cv ...M x S x , N N S S X fs, S , ffff .f , W , , f .-E?-I bk! ' . ' Sw'-I ff N -5 ,, ' X 'i w, ,X mm-: f -W , C, -4 - If . is-sf,,, W Q .fgr Y 7 Nw X X, S ff. C X - , , fs ,TQ -F' 6 S ' S Qff-N f' 2. 4 , bwgfif I OSSN T.D. CHRISTIAN Chatanooga, TN OSSN M.S. ENTRICAN Monroe, LA OSSA E.T. MCBRIDE Indianapolis, IN 1 2 , I ,I I A ,, ., sxf N X , C f W . . . NEWS A61 E Q X If W x X X X 'A I X ,HKS W I. C V OSSA J. WILLIAMS Bulfalo, NY I J's lx iw , I Left- OS2 NEERING, PE- LELlU's top Air Tracker. Below Left- OSSN COON- ROD, OSSN CHRISTIAN, OSSA HESS, and OS2 GOODWIN getting the job done in ClC's Surface Ops Center. OSSR J. VARGAS OSSN P.A. ZBORIL OSSN E.M. SAHL Quebrad illas, PR Norwalk, CA Edmond, OK R' I x Q f we , N ossn rr. HARRIS ,EW XM X 5 Miami, FL X! ossR A. WASHINGTON Queens, NY OSSN T.L. WELSHIMER Riverside, CA 'X !j H ' X, f ll hostile 'korg et! Q Q ' f I O U , Q xx O N4 0 New arrivals checking in. OPERATIONS 75 74 OPERATIONS 1 Top Left- MAJ TALBOT caught in a most inopportune position. Top Right- What a striking couple! Left- Search- ing for that lost liberty card? Above- OS1 VANDEWARKER Ciwally Walrus J working on this crui- sebook. 4 I, u 1 r 4 EAI' il iw? G Pennants and Flags inn lugs :.' Inman pu.. lil OOIMY 'HI 5 fl Z! lil? YI 'YW' Fill? ll 'lllltllf ll EE lil' il Kill' 01-0 H1153 nun up IGI!!! Wifi 01101 Hill? 'X' IIIIN li Kill! HN! TWIN' Ill' Gm ii 'fl' KVI! L! XIV 1 'il' QUIK IQ - 3' in mal' Fil! X! QHNID ll ' e Q: g 1 3 I! 1 1 L r x 1 r uv- - um.. nm -mu n-va-maui in has he Inna hu has 1 n iv Y' nun - nn y num 3 IA -ull' I 23-KU' s is 2 ' mn novunu :mu 'L'2' 'i'2'f 'IEW' e 0 cl V 1 ESU '2!4 o r IND . I can un 'von- -gsmf -vmgig l 0 mm mum l I' ' ' 1g5ow- -uv gen- Www r n mm' . was - O . -vofsrnor -g.ia:an- Mm' V s 1 nm A 5 nu :mu -mm- -ww an an un- I r nom. moo -song' --naar 4 -,lf - ' . i in uma - r nu muon 'savor' 'fmou ur' 'vw-ul :our- 1 v unnr - 0 'Llul E-T -vrmrur and A in an V o Ill 11111 -unit' 'ww' 1.2-1'- v. x 1' + no - o t Ill QIY + .u,,,. 'ELYW' '1Q!llY + + Navigator Commanding Officer Executive Officer : i I l T - ' I acticai omman Duty Officer , 3 Acdonlomcef uf appointed, ' SEMO! Watch Offkef l I 1 l...--.n.......... Office,-ofthe Deck -J --Command - -Q Administmive junior Officer of the Watchl ' lumor Officer of the Deck Damage Control En ' ' - I gmeertng ommunication Watch Officer Officer of the Watch Watch Officer OC Watch Omce' Security Repair Boiler Elec., Intercom airi d gine Radig essage rgna QC palfols Parties WGICPICS and Auxiliaries Aumiaries Watches Center Bridge Watches Watches Watches iTrafficl Watches Quartermaster Sgt. of the Guard Bcatgwging Marg of the Watch tMarine detachmentj of the Watch Steefsman Steering Corporal of the Guard Lifeboat and Sridge Special Watches AirlSun'ace Aft and Brig Sentries Life Buoy Watch Watch iFog lookouts, Lookoutg Patrols, and Sentriesl do U,Riitii127?ff!i::::1:F?.,, aa, de wait X L 1 117,10 NX 150 . o ff, 'rf WAY Vg N, .ann.uvm,. Q 7,0 4' NX 9' l -u 70 - Qx l 20' X Q W l b If QS . 29- sxw' 5 sig JS A 2 S 'E' 2 . N 1 di , 21 gsm, mas uc wma 5. 3 ga 5 3 E Hmm :Asn sky-mia 17-IC sum Q59 Ei ' ,vm A my 5- 1 ? fi sera. 52253 at -W is wax W. ' tm. e,,,,3' fm - :EJ us, Ava mmf- un I-A uw . r. t... .V51 WM, rumen E ..,., ,, 3 ffl' Wm Ava um Amr '- C.,, 8-if Mt u.tiA a l Surf' WS! A-:F val-ul 51:5 E 'Q f 9 E t .Nun IKJI Q N nur it-zu umm Z S W rum. 3533 5 'S ' 'P 3 ' . c X mu ui sun uma SZ l MM, 1-Al 2 eb i .9 S 'mn can ' nn-uv ! A4 Granular mm wma., ' S 'Q fb ! si S9 era., W- 01 2 , M, , , nm ,dm K'0y 'V 2 WN,- N, rum UW' yqingq 4114 'Th 9 I0 NNW NIA GI MMM lgunq Q ffl! 'N i 170 M945 ' gflff vc-vm 'WAIII' - I N l ltiihltlx QQ wi ,.,,,.., :E-31 'f NL rffnl::,:lg1iiliiiLQll of :fx 223520 fgigg malaga HC ww tcium ,ann cmwnm UN-fl 94,30 Nxcassasnammr 906 Cunnan! ', , ,,,',,,, aar--.mtv it: 3:19, .ea USM nut su muy. 9 v Wit jj o cm:-o si-:bw HA our-r up 'J' IOIIAGA 1.144 Mc rm-can r-as wmv HIM 044,34 mal UA!! urn Su Slliinh N1-Nl ,, ,F cum unc NMA ::'u.sgA him -SY -. :iff mann um 3. 'un s Q nm Tyra swim ul: mfmt 'bunwgt W 'rig n nt-srl 0-111 ,,,- .--gig : -JJ ' ,. ,,- , . .-vq 2-5 .. .Q-- m.51q UJOG . .- . . J,-:P.rv.,-I ,- -iq-' may wnln sumo sarah 1-U KI'-uv' ' -Y- K 51 ,N . -,ah W... rs. Mr' 'm... N :za '- 2 ' 1' ' -2 ' I t i .- , 7 i . l .-e-1-1 -.z n igz ' 1. A 5' ' QL - f O - Mzxj' .,t,,L ' -1-.Q-. if 91.43. -J '14f3- . - 1' -zen 3 - ,R . - . Jl'-. . -9 , '7L44lS?:'X Zf --- ft ii. W 33-:....'.,.2-..,f..:.,.1r, L XXXQ, 4.50 :A .Y Liga.. . 1 . v '- Q' i:f5i '.Xi:2 .-'Jul - I ff h,- Xi.. 'QW-,g:Y'ga'2? 'fa lst : - , ,, .. , ,- . ,.. z ' vscrf, ' . 1 i ,aa lpn -' X fgkx. . . , -. ,-. .-.,-.. it tg' - f f',f .j-.-6 ee:-'-Q1-N -:- --X .. .., -- v 3. 3 'W -.,i:.:'f.:'::-f.. '-' .,:'-.,:-' Et! L Q 3 ,' tad OPERATIONS 75 DIVISIO g:r:rf.:z:::1:::::.i:.:':::L ii V fwqm qi F 'M' 3 F57 X ,ja X A xjT- Xl a? EX X 5 ' ' T 1- x E 'Rini N. . ms .... ! J A fa s tit. 'X ' LT .1.w. CAMPBELL .9 is T Monument, CO J 7 i , OA Div o- offgoing xl ll LT .J.E. JosEP11 A Radford, VA OA DIV O- Oncoming nf 6' ' T Adc D.w. KIM Honolulu, HI OA Div LCPO WWII' .1-if w 5 . AG1 R.R. BALCH Comich, NY The Aerographer's Mates of OA Division are PE- LELlU's meteorologists and weather techni- cians. OA provides service 24 hours a day while the ship is on deployment. Their responsibilities include weather forecasts for daily operations, amphibious landings, pilot briefings, exercise planning, port visits and transits. Weather tech- nicians, with the aid of complex and state of the art equipment, take hourly observations and maintain the ship's official weather log. These weatherrnen give crucial information to the Am- phibious Readiness Ciroup QARGJ Commander and PELELlU's Commanding Oflicer for the plan- ning of safe passage throughout all the oceans of the world. 76 OPERATIONS Qu: 'Wi s N E I 7 e 4 AG5 J.G. LIVINGSTON Suttons Bay, Ml Y W ,.-- . -,. g., C x O N , uc A ,, N., If I I C 1' ,- -P5 X ,.f'-'iw-Z jf ,Y . fr, f gfrgwg, . 'J wfxx--gf, f'-1 H .Q f ,, -N, , 1 f df-.1 ,I ,X -I I I 1 W.-gk .gf , gf ,flflfyx .S .1 - xA , ,. X121 ,api XXX V' 1 Iliff! v.'!f'D-X-X IFIILAI Ux ff fffwIILIIIf:f I X4 II 1 pg: ,-X' fn Wg! -,',,f11:f.,, I J X ILj43Xk.,xyQ,l.Ldj': I xy .lox X 'R Rai I. f X-nl-L... w xxx- I aw N' , A + --L' ln, w -XX V, xgihx-3 fx, 47, ,f A 5 rf, gag' lx-fo :.. NX, CX U ,I f--'-xy 7 KX X C 4- , ' X' 4 ffvo X 'xbbff-,TF V ,. .f 4' -- U17-ik T , 10 X ,,-- 4 Avo ,ff i-,Zn iu , .fu ,-vi AGS S.R. JESTER Atlanta, GA '-Q.-4 wx E Q , AG3 R.E. PARTAIN BC3UI'l'IOI'It, TX AGI5 S.R. HART Tarpon Springs, FL AGAN P.E. MCCORMICK Tulsa, OK OPERATIONS 77 ACAH J. DANIELS Wan'en, OI'I 78 OPERATIONS -f -v------- ---- -w-...av----Q--...f -........-...,,..,-.....-..........,.----........ -,.. ..,, .,-.-.,.,... ..-. , OC DIVISIO The Air Traffic Controller's of OC Di- vision are responsible for the safe, orderly and expeditious flow of PE- LELIU's aircraft. When the weather is marginal, especially in the Persian Gulf, air controllers are a pilot's best friend . In order to ensure the success of every flight mission, AC's provide all pre-flight briefings. A sig- nificant milestone was accomplished during GULFPAC '91 when the AC's contributed nearly 2000 instrument approaches to PELELIU. The men of OC can be justifiably proud as PELE- LIU once again received the famed ADM FLATLEY Flight Deck Safety award. 'Via 4 Acs w.T. HORHBEAK AC1 rm. HAYNES AC2 K Oklahoma City, OK St. Louis, MO Longview Klfvflsl-3 AC2 J.M. SHAUGHHESSY AC2 J. APPLINGTON Monroe, LA Lewiston, ID LT D.l'I. HAWLEY Oswego, NY OC DIV O ACCS E.C. BINGHAM Richmond, MO OC DIV LCPO I , I ' NWA. i AC1 G.R. PIERCE Oklahoma City, OK 4 , 7 ACAN M. VONSCHERR I Ridgecrest, CA I I ggi GZ DIVISIO fv f,-ffiffrlrf I .5 ,f ,, ' 2753? , , T N, ,727 , 6 Below- Josn ASDEL updates Lcpn LAR- NN On the latest happenings in ccrv. LcDR s.L. LARKIN Bottom Right- IS3 EDWARDS in disguise Junction City, OR on the Oman coast. INTEL OfPAO ..f. D S fix, f I ff' 'Y - Av I I g I I 5 III My I. I o ff if 1 ' I It , xxXxxsS . we . f- :M i,,g,,t , kk.. M. Wwgm, W, 4' CZ Division is comprised of a dynamic range of ratings teamed together to perform a variety of functions from intelligence gathering to public affairs. In the Joint Intelli- gence Center CJICJ, Intelligence Specialists, Cryptologic Technicians and Data Processing technicians collect, in- terpret, and process intelligence information. The Photo- graphic Laboratory iPhoto Labi is manned by the Photog- rapher's Mates who record on film everything from ship's tours, changes of command, ship's exercises and intelli- gence missions. In the Closed Circuit Television CCCTVD Center are Joumalists who produce newscasts and air television programming during deployment. They write news articles and perform other public affairs duties. To- gether the three work centers provided superb support for the entire ARG during GULFPAC '91, , .tyi OPERATIONS 79 Y Y Q- W r , ,. -. w-QA-k-gm-.-.. ..-.,..-.-'-----v--- f -V- .,.. , ,....-..:.........,...,.q,...,..,,-,-1 .,,.x .Y V --1--f --N ---Q--'-'- '-'---f ' '17 ' , MPSOH 051 D.L. VANDEWARKER 151 D. LARSON PH1 D.A. LAMB PH5'B.A. SQHUCK K-BQJFOCA Cerritos, CA San Diegg, CA Birmingham, AL Bemen Spnngs, Ml 9 f QL a --In.. EL 3 Vx 'Q' I Q., 300 'E Z3 - 2 SP Q09 280 SG 1:2 V7- fffzavma' Eff - 0100 3' nO 30.-r :- Zio--1' cn? -. FPC- SV A :-M940 :zmz 9123- U1 -QL' 1 if E EF' e-rw 2 mg TU .Tw rn . L., , O To 3 w: :sp 55 270 539 FE 160260 'U 11,59 E by :Ia I5 ff? U rn 49 U7 2 qt? . 5' f:? nu- 0-1--f-' K2 E f 2? f-YE Q ig 5 o 2 A, E 00103 l0 0o1 ' lf-any .mn 4 Y f 4 i IS5 L.C. MARTIHEZ CTMI5 W. SCHNITZLER PHAN T.T. KINNARD Long Beach, CA Boulder, CO Utica, MS 80 OPERATIONS -..Y.:....-Q ..,.,..-.. .,l.i...s,.....-,+...-..,,A--.h--..Y-......,w--.-.,,..,.....,. - ...... --...--..g,-.4.--.............4ul...,.,f..1,.. .,-.-...--Y,- ,.-.......,-M- . ......,. ........-1-H.. ...W ..... , A . -. . ,, . ., . PHAN M.W. WHILDON Delmonl, HJ Q T A A-My -iw , s -Q . f. fx ff - A. S7 I -4 L- I 3 f of I ? X V -Z5 4 ' , , CTOSINI C.D. CORNELIUS Baton Rouge, LA IRAQ mo--. KUWAIT ' IRAN SA? OI ' ' ' midi J-3 BA Q sr.. f- --1 ll ApN j I SJO J JA .. k AQABIA MuSs.J 0 e K 'A' 950' Sdialarx PHAN C.D. WEBSTER Tyler, TX ISSN G.A. ESCOBEDO San Antonio, TX JOSH D. ASDEL Enterprise, AL CTOSN IVLR. FALDEROFF Erie, PA DPSR J. WILLIAMS Orlando, FL LL if f I 2 WK Qfff fy ff W TTA A T C 1 5 f S ,, W Mf W f f ff! X Z :I I X 7 5 Z ,, A fff fQ3 f y an ff Z! I IS' 9 5 ff , ' V F 'Sf 2 V. ,if 7 5 ff 2 'Q,-S 7 f , 4 fy l ff 4 if X ff 6 f Of X , eff f f f M ,, .... W ,, 2: ,,- 4 42 Z Top Middle- IS5 ED- WARDS on libs. Above Left- CTOSPI FALDEROFF, CTA2 MCBRIDE, IS5 ED- WARDS and CTMI5 SCHPIITZLER. Above Right- PHI5 SCHUCK beams while standing the SBM watch. Right- JO2 REELEY takes a break from the Family Gram. My OPERATIONS 81 H c LCDR J.G. STRIEWE Evansville, IN NAVIGATOR QMC M.J. HLASTAVA San Diego, CA NAV DIV O VIGATIO LCDR STRIEWE, the ship's Navi- gator, is overall responsible for the safe piloting of the ship. He is assisted by an able group of Quartermasters QQMJ led by QMC I-ILASTAVA, the Navigation Division Ofiicerg The top priority of these highly skilled profes- sionals is the safe passage of PELELIU in any body of water around the world, This involves constant vigilance on a twenty- four hour basis. The tightly knit band of Quartermasters are able to accomplish this by prop- erly maintaining accurate and updated charts: taking visual! radar bearings and ranges: plot- ting coursesp monitoring naviga- tional aids and hazards: logging ship's events: computing ship's positions: making celestial ob- servations: and assisting the Navigator and Officer of the Deck fOODJ in the performance of their duties. QM Below-D CAPT MYERS and LCDR STRIEWE confer on how to best enter San Pedro Har- bor safely in the fog. Below Right- QMC HLASTAVA shows symp- toms of radar repeater vision. -f-'Q 82 NAVIGATION F .Q N-G3-p 5 si H0085 N-Avi' ! ,L x I 0 a if E ' 23-65 i 5 5 R: Q 5' .gf 'EW iff A SMG? Iliff Q If 3-wx I A:-X -vs' if 'A ,- 3 .Q E ?:v f A - 11,01 V . 4' '.. . ,df . 'pl-I' it U73-T VW' I x ' QQ Q.. , A E - gmthifg, . Cc? x' ' 'Jqix ' ' Sf ' MWA-cl I ii f'f.','YX : M653 fm its-ft E fl l m:fQ!,,92 is mi: 'ra-uma THE DOir IS Rlgwr GATQR. -Ha 'ro -lB.T'lME izojsle, we Lose A DAY. 444 4 4 '4 4 4 55 ? l L Tffll I A 'Z'f1l?'--, 4.f,1:.f-fe-1 -Af I I I I l I 5, li W U gl I f ff J 'illmw V ! f '1 8 Q- H s,,,..ni ,... F'BUaLuu TR. Aqyg Ry 4 A F- WEE QM TOOLS OF TH ' ' - ., ......... :zum .... , .... Hug.: .... , .... .... , .... .... , .... .... , .... .... , .... . . ' 3 gm .... , .... --fl 1 ..-. I ..., , .ms Rlght Q... sz,-6+ glial, gl yr, f Lybjr Parallel r '---gg., ,ggr-'-2'--Q., , ,,,,,, f Q.-J 12' 'Uv X I f -cv: --- vor X If plotter 6: gg'-. f wi k!f'fQ.X--'.,f jg, -11 .QNX-.gg 2 v4 -' le ' . , PMP am- S' ll '1 Below- asv ...- . 1 -i-el . --w- ' .-. -..nz i is Gyro e . e ' Repeater Figure 7Zlb. Parallel plotter. . 3 'ww' fi'5f:l-' 2-iii-Elf . H151 241' QM1 M. Rommss QM1 13.5. EGGLESTON ---1- .:i13':'4-if Pearl Harbor, ru Little creek, AK . XGIGALIQJM ' 'ff D. , I ' nz: .V V' - l ' 'd rs r uovmsom 'ff '--I--, --,-CT. f DIVI e W , -zu., . -------' '-A 0- -. mzoow. '-on 'Q - an l '1 5 'll 5- , Chronometer A X X k 'raomsavmu wwqpmfoag. I. l Xvemmusox Tutslgtreep X uouumuroov , rgrfjn Sextant NOTICE TO 1 MARINERS ,fi ... ----- ,.1 . .nn-..-umm-r.,-u..-: Q-an-xv-an . -no-an-n-1.4-n:nua.n i I I , norman I .. . -0 u-me-ness -v...- - nu ' . bf... , . ... I ' lnuiiiisbha . Ml 5 ....q......,...... ... I 5 Q..--.-ug-Q. ,.. ul Q o--.. , H ,,.., ..- I pa ............. , .,.. ... , , ......-. ...., ritz' ... ..- -Gil ' I 3 ..........., .... I f ! Stadimeter NAVIGATION 85 QMSN JANS and QMSN DELONG pohsh the Bndge Engine Telegraph. f5w x 'Wallin IKWQ Wlllnn IHVNX I U I ll.l1g1 jg5E't' NI 'G' I ' pin. oo po, 31 1 E Z'7' v3VVI:gf 5 :fungi 1 mi 1 Qke yf 5 4 Q .- . Roch which doo: not cover 1251 u mr thuignr abou UIIWI 2 llJncov Zll flock whkth cours And uncovovs , QJINNIN wan nufgm mow curl sounding 421 qw d I I I A um soc introduction Rock awash nl fuss! lou! ol char! Sdundinq dlium P91 Dollar! lim ornpiwsins dal lliviqalinn Dock awash lholghl unknown! Dolfod lim omphadzos danger fo mmgaliou Suhmergad rods ldepth unk Dotted Nm omphaslzls dana nsvigalion Shout sounding on Isolated rock 0' rocks Submcrpod rock nal danger lo sulnuo novlqalion 1 MAIN DECK SECOND DECK THIRD DECK 4 L QMS M.O. MILIAN Monrovia, CA mm ofcx seconn oecx man oecx In mnom How moon DOUIII IOTTOMS 84 NAVIGATION MINING All Accunnz vosmou osrmmeo mm our aerensucs ro mv vuevvous vou- TIGC. ESTABLISHED BY ELECTWIIC, VISUAL, N CRESTML OBSERVANNS. ESYIMATED P09 YIUN. IS TN! WST PROB- l8LE POSI YION QF A VESSEL, DETEIMNED FROM DA TA OF QUESTIONABLE ACCURACY. SUCH AS APFLYING ESTUMYED CURRENT AND YINU CUIRECTIONS TO A Ol POSITION, U.S. LATERAL SYSTEM A3 SEEN ENTERING FROM SEAWARO PONY SKOC Qnmanniuuon runnin-nnsnnnalpumlllflh UGMYIO IIIOY Ml Gown! M N . 11.333 - Ilg:Lr.:1 , uuurlu dawn nn uhndndinll- UUNVIU IUOV lu' COIL!! JUNCTION uuuuveuvuunuaanc.Nonunoos.nuldN' Inc-noluraiuoulnp Wluucvduon-Wkorlll umwnounvl- uanno an ua no 'N' i ' I z-Au. WAYINS 2':?...,.'S ...... .i'2,....l .... '- ':9..TJ.L'.:'?19.,........, mm IIIIIIII IIIHIIIIIIII11 l u rrs X Q O M QW ,wr-r Q 4 50' GATOR speaks, Well, we didn't do it this way on a battleship! s Ls QMSR J.D. DELOHG cedar Rapids, IA A CLEAT 9 w ylllllllll 54 S I xXx ffl 8 aa NX 'f ' o cuossocnocx X Q f 1 3 C OPEN CHUCK If V:-Jura-, -3?-4 gf 21 'w 'N If f E -5 NWI. I 'W ' ' ,jj , www vi ' n , X , .' V 5 5 W s 'n' .- T s xx 1 Q , pf? X AK X I I f III ' I I I 'X ' 2 - - I f' -5:3 ,.:-.E-5:41.-X,:,,i,.,, - Q A A 3 ll - II Ss 4 - gain, ' is 5 .. 1 'E jfvxzuvx ,Q g, : E gf: ' '.o'g -1,-Q s-5 :. 8 : ,E Lg, ' Q . , 35-- ' 3 -.E .5 -,Lit : ' -37 it 9 sm! 5 fs as -Tw ' 1 15 X , S -L' I I. - I -Q.: I s 'mE.-1:- N . , -, , -lf!-7' ' ' 3, 9 S ' . W 2 f 4, xx S - Q D , - 7 1 ' . . 'ff N Xxx IW XXV 1 W! mmf. 4, I , 7 V ' 4 F. , , . - Q S ' Q PQ wsf 2 f T E if I I X X xxfgfs X gs sf ZS Q X Q fx X, Q E fxlfgig vw I A 1 Q f fx x N . ' 9 uso- Runmng Llghts Runnmg Iighh for :tum or other power-dnvcn vesxdx. Q M C H S --17020 F0 DT SCI!!! VIII' IIEQUIRED UNDER INLAND RULES FOR NON SEAGOING VESSELS REQUIRED UNDER INTERNATIONAL RULES FOR SEA GOING VESSELS OF OR OVER -klEQUlRED UNDER INTERNATIONAL RULES FOR ALL VESSELS UNDER WAY AND I7 INLAND RULES IN CASES WHERE NO OTHER LIGHT IS VISIILE AFT THE NUMBER LISTED AFTER THE INITIAL DESIGNATING COLOR IW FOR WHITE, ETCI IS THE NUMIER OF POINTS OVER WHICH THE LIGHT MUST SHOW A POINT IS IIVQ DEGREES. READ OPI T ? E gr-an 7 Ill, G ! Q W I X X 41 ffm za 'E 3 I3 O 3- Zh if S 'ee S if 'U N a 9 ll E sf 3 B- 5 3 x x 4 W f 9' 2 r u 3 Tl 5 9 2 ar 51 fo Q 2 A 5 3. S u 'E 2 3 A R F ? , la-,V W Q HIIIIIIIII a 'rw lv, , rss I 'I ng N X WX X WMWIIIIIIIIIIIIIIIIIIIEIUA goes to war on Chart Room lntrud ers 3 E' E ROLLERCHOCK p mguno in s 'L Y' NAVIGATION 85 . A.---,......-,. , ,,.......- . .q.-,V.g.--.....,..........f -- ---.---Au -- 0 GOA ...P i 1 cs M ,6 I ? N f P 5 A N J' QQ 1 I A 5 qnuuxu 0 P i lr 1 'smeer' E - - L , ' . , ? . ' is 'Vw f F l y - e I limi 5.07 l 5 Q . A ,, X 15 sa- af X Y if ul thought I told you to weigh anchor, not A Z 1 X T R v i WEIGH the anchor! Z-4-,ZX - , u:ge'l' - g lDCCKff 4 Department is Bf's+slQcCflIi5.,Cii,' - ' rf ' .T spiitf into gthree divi- 0+lme,51f-1 X ' '1-. 5' csionsg A totalof 65 per- , ' i sonnelarefresponsible , A X 05 'fofrkeepingship-shape 5 . e D. f 1 X. yi over,156,475 square 5 ' 4 u hoh feetf of 5 iexrenor sur- ' 'N' - 5 D V qls, tgxhvw-H faces, pfoufr 56 foot F :T-hh ' 5 fLCFL Srr1all, boats, I ,T .ei if XX FZ' -Aefw 1 I W r , ft fsfgszsgfziz G, -El . W Aircraft fcrafne. Deck T M- iq - ff' hccc Q if T Department is also re- 'ii-iu f- ' -f- Y ' 1-1 ,. iiii- -11 ili-Q ,.-1 -- - ' 1 -ui I 5. ,asm DECK DEPARTIVIE T 1ST pg 88 ZND pg 92 5RD pg 94 86 DECK i i r tsponsible for maintain- ingthree vehicle stowages lparking lotsl having a combined square footage of over500,000 feet. ln addition, they use twof2E ton, anchors with 550 fathorns of i attached T anc Q or, chain. fpti Deck iDCP?ft' ment personnel stand various watchestdependlng on the ship's operatingconiditiong These watches include mannmgthe budge zomm gunymounis 5 154 gun mounts mlneandflowFv1s1b1l1 ty 100 kouts Besides directing? f underway! replenish ments they man repalrparty lockers gun mOlmf5 and the Pilot House durmgoeneral Quarters Deck Department IS the only department onboard PELE- LIU that is manned with only one rate That rate 15 called Boatswam sllvlate or BM forshort The BM I5 one of the oldest and most traditional rates lrl today s Navy It can be traced directly back to the time when sailing shlps ruled the seas Deck DG partment is also where many new sailors get their start They gain an invaluable foundation in b8SlC seamanshlp skills that make them more effective in whatever they go on to do ' o Q I I II u . 1 o 0 o o - O u I I I I n 1 o 1 , . I c 'I Q . . - O , . ll ' I 0 n ' so Q 1 Q I u o . Q . . O 0 o g 0 ' o O Q . O O 0 Q n Q I USS PELELIU can ballast over 12 000 tons of seawater for tnmmmg the shrp to take aboard or dlscharge landlng craft from the well deck PE- LELIU also has a fuel system 560 OOO gallons per hour Dunng wet well and un derway replenlshment oper ations the Boatswam Mates play a vxtal role ln getting the Job done, safely and effectlve , 0 l 0 O XS 1 I .5 I . . F Ca ' pable of transferrlng Q 4 , . , fy . ' ,, H 3 . v ly. - , Sa-urs is:-urs :sum lawn' anions :Arm .-Mn., 'VWEAV--I.. 'V' I 0400 ' oc -------.--:::::::::2?92 T-.Q2.- ---H ,---,-,,.-..-2.2f2I-'E..- -mQQ+.--Q1.- .www oecrc I I 'MN D595 - -- JTQ -4- - l- - X Qkofw DECK l ' l secono oecx - - ,i. ... 5- THQRD Decx ,v Tl-HRD DECK 1 -N ,, ,,, 1 L ..- l nv PLZAYTQFCRM 1 ' E 1.1 furwsnm ., .. - JZ! ..A.- -41-1 acl' wc 1 o - i - 5 X znd PLATF-OHM 'I MAC,4,,,:'E,l, 5 A -E3 I l'f1fgf7 l - - - -53 - I -- P'QlQ.V---. 4- , ,, i i f - , i f : : -: A : LCDR .J.K. SIPES San Diego, CA FIRST LIEUTENANT- OFFGOING LCDR R.B. SPEEGLE Cullman, AL FIRST LIEUTENANT- ONCOMING or , X mucosa QYW, 'X oouelz aonoms DECK87 l .el 5 lmnlul 117553 1 ' ' I I Jr X- . , 1 tiqdci First Division IS led by LT Battle and Chief Boatswain Mate tSur face Warfarel Gomez First Division maintains the majonty of the deck searnanship equipment and spaces non'nally as SOCl8tCd with the BM rat Locker Bo s ns Locker and the I Forecastle or Foc sle I PELELIU s two huge anchors and relat- ed tackle are located in the most forward part of the ship. The Boatswain Mates maintain the foul weather gear locker in addition to 118 C125-many CO2 life rafbs.fThis hard Q f I working divisiontplays as I key role in most every shipboard y evolutionm 8, ing such as the Paint I ' 9 I ' ' , I K P f . f S ,C 1 A I I I b X I 5 1 I r I Z ii f V ,,,,, W., 5 f ,nf ft X... W If I W Kozo, Okinawa SW -U u, LT B.A. CIUDE Costa Mesa, CA ASST. FIRST LT.-OFFGOIHG LT. S.C. SCHUELER San Diego, CA ASST. FIRST LT.-ONCOMING LTJG 5.5. BATTLE Salisbaiy, MD FIRST DIV O 'MQ i , Top tcartoonl- I thought I told ' f you to weigh anchor, not WEIGH the anchor! Middle tphotoj- Let- tin Q0 the anchor! F It D - - BM5 J.A. DEBOER BM5 L. CONLEY Q u on, M Gardena, CA Lexington, NE Inglewood, CA I BM2 J.s. BLACKWELL BM5 Q T ALLEN 88 DECK BM2 S.l. HATHORN 3 5 J Q 5 if, I I w I J I f 'i 15: l BMC D. GOMEZ Whittieff CA BM5 J.c. QIRALDO FIRST DIV LCPO Houston, TX BIVISN D.S. BRYANT Toledo, OH Top Lefl- BMCKSWJ GOMEZ, Look l'm a Chief! Above- Getting line no. 1 ready for mooring. ltop: left to rightl BM2 GAMMAD, SN BANDEROB, LT BATTLE, Cb0tt0ml SN HERRERA, SR BER- KAVICH BM5 J.F. TAYLOR Baltimore, MD S BMSN L. OTERO chicago, IL sm C. ROCKENBACH Fx. Hays, RS 1 l -se BMSN J. LOPEZ Los Angeles, CA sm J. souxno Daly, CA SN R.M. RANAY Wilmington, HE SN CLR. ADAMS Kansas City, MO Sqn. DECK 89 W 0 49 f f 4 ,WY , ,ff 1 fi '4' 'ff 'Q E WI 2 615, xx f ,X f v' WZ W' f 1 , HX 'A fy jf! ,vzjgfyirff ','j.U7,!g W ' M of QW' W ,, 7 ,W y. A fr , , M f 'f, f W5 5 ,,,, , I fffmfy M 744. 1 k, 0 O ' 1 7 7 l 'fo V f,4rlL'1 5, 1 , 90 DECK .ALMA AA... J ...k gf x - A 7,1 ui: -3, , I l- fx 1 5 WN A 'Mir X f' N X' ' k ' 1 vm Q H ix 'S Q, as- 5 gf X x W WW f f ww iff? gf f? SA T.M. ROWE Detroit, Ml I 3 a , SR F.E. BROWN lll Philadelphia, PA SR L. mcnotsom chicago, IL 1 N A SR K.M. LANGLEY Dallas, TX SA J.K. SHAFFER Johnstovm, PA 4 l 5 6 ,V Q-6 if 4- ' 1-,gy gf 45-ZZ, ,, y , W f Gif Z iff J if Z f 4 ff Z -' 9x75 Q X Z if 1 ' f f fi Q , - iff? f . f - . , f f ff?-Z-X? if W f 4 y 4 4 , Q f TW! if W 4? fl? ,V ,,W f, ,c ff ,Ney , f X ,f f ZQ f ,4 f Q M f I,- N A ff' Q him 'X 53: ' P flirl VV , 1 'QWQX 1 Q!! 975 ' 1 ., MQ fe , ,W- V W!! SR L.V. MAHGDOU Falalop Ulithi, Yap SA M.A. GRIMM Tronto, OH Y J n af ' . l M21 9 , f-4. W ,ng la ,Zark 652 Top Left BMZ5 TAYLOR, SR PERLUNGHER, and SA GRIMM hard at work? Left Middle- BM2 DAVIS with an LCAC in Well Deck. LCPL-4 on SAR boat duty. Bottom Left-LCDR SPEEGLE seeks heavenly guidance during docking. Top Middle- l'Letting Go the Anchor! Above Left- SR MURPHY in the Foc'sle. Top Right- SA BERKAVICI-l polishes the Foc'sle capstan. Above Right- SR SPREADBOROUGH mans his swab. DECK 91 92 DECK ' ' Peliciari hookjyg 7 Spanwiregend . WP - ,, gi 1 ii If g g-.5-'-ref? LTJG T.P. FANSHAW f If-.5 p ' W if -'1 2s22i':.Qg0s.Sesf 'CA . U' , 2 i L 'Q' 1 k ypme :x:ar:3Sm Probe receiver Q .A BM? N. RIHARD 4 Chicago, IL V Second Division is under the leader- M ship of LTJG Fanshaw and Boat- ! swain's Mate 2nd Class Kinard. This E B ' division is responsible for maintain- ' ing all the spaces where Marines KT fx- K H 9 store their vehicles and supplies. f'4'X-X 'g They also take care of the immense Well Deck area. These two areas combined equal almost one-half mil- lion square feet of stowage space. Additionally, Second Division shares the responsibility of tending the aft mooring lines during docking. For all underway replenishments, Second Division mans RAS 5, which is where the ship receives stores and person- nel. When the ship refuels, Second Division takes charge and sets up appropriate rigs to receive aircraft and diesel fuel. Although PELELIU does not use sails, it still has a Sail Loft where deck personnel can be found stitching together covers for equipment ammings, shades, and skirts for handrails from canvas or herculite material. Second Division also main- tains the accommodation ladders and both side ports. During operations at sea, PELELIU often loads and unloads equipment from landing craft QLCU 8: LCACJ boats. The ship is able to load and unload the LCU boats without bringing the craft into the well deck. This tricky maneuver is called a ustem gate marriage , one of many diflicult evolutions that the highly skilled men of Second Division do so well. BM2 DA. Jonas Gardena, CA , 11' wi ff Laredo, TX t fy l mam, BM5 l..E. RUSH mm Dallas, TX A '1 , 1 f BMSH R. mrs Newport, WA BMSN c.J. Lovstsss Gary, IN BMSN C.P. JUMPER Denver, CO SH T. ALVEAR Brownsville, TX W . 1 SH J.1.. zlARmck A Ridge Crest, CA 'w of 'E rmmhi 7 f. 'V ,. H BMC N.L. NELSON, ul AM the Chief! ,I in SA M.P. HOLDEN Sheboygan, Wl SA M.E. WILLS Washington, DC J I V A SA SELLERS SA J. RODRIGUEZ Yaklmflf WA Los Angeles, CA SA A.C. SMITH SA W, MEANS Chase, MD west Covina, CA SN M. WHITE Miami, FL VV 4 ,Z , iiw I f V? f' ' 'Vi 'X I W7 .i. 7 , I' , fw'fZ A ' L. , ,f1f2fZ27 2 C L SN K.W. HUNTER ff vi f X 1092 ff X f Kay i , f ,4 ' f f' H Fort Worth, TX ' I , f A .Xi, I ff 4 ,Wi M ,gf 76- Mfl' ' N A ,f fl fy f f, W 1 f Vjw X W ff I f f 7 Unrep RAS station No. 7 with SN RODRIGUEZ and BIVI5 LEAL. i K wma' f Z , 45 SA T.E. KOZAR Bloomsburg, PA SA J.l. STEPHENS SR C.C, INCORVAIA SR D,T. CARTER Evanston, IL Elkdale, NY Albardo, TX DECK 95 ... ... ..,,.,c.c,......,.,cw,-,,,,,,o WW s ' well cu-r' B 'S+oI C 'vioofr 0+nrve g 1 I I ,. C? DANE'-'mix -ELEUU ...i A ,,,.... Third Division, under the leadership of ENS Miller, the ship's Bos'n, and Chief Boatswain's Mate Nelson is responsible for the maintenance and operation of all the ship's small boats. ln addi. tion to taking care of two LCPL craft, they also maintain the Cap. tain's and Commodore's gigs. Other responsibilities include Cafin for two boat davits which are used to lift and lower small boats img the water, a large 50 ton Boat 8r Aircraft crane, as well as providing the personnel needed to operate the small boats. W 94 DECK 2 I Falls ' IONIIGMIIQ L : 0' gi We-,ifffr . Q59 Grips I S X le' ' I 1 4 BMC D.w. YANCY NY BM2 I-l.L. MYERS BiVl5 D.F. JULKU SN L.J. WASHINGTON ?Il:3l27Ef DW LCPO Toledo, OH Fitchburg, MD Hammond, IN SA J.B. LOWE SR.J.R. NAYLOR SR J.P. ESTEBO SR K.J. STROMBERG Fairport, NY Arlington, MD Garden Grove, CA Warwick, Rl 3 -Square knot. TI E AN OVERHAND KNOT 1 mf LAY ONE END BACK ALONGSIDE ITSELF u-'y. s 513101 COMPLETED KNOT num Q 'ix waf f 51 'mirrors rq i O X 2 f f 4 ,Wg 142' Above- BMC N.L. NELSON and BMC J.R. WALTON Right- CONREP in progress at RAS 5. iloft to right! BM2 JONES, BM2 KINARD, SN ZIARNICK cwuth paddleb, SN LOVELESS. SA M.S. MCFARLAND Colombus, OH SR J.S. CONDITT Kansas City, MO I SR KE. JACKSON Ottawa, KS BM DECK 95 S.,,......,,..... ,.,. X- .....-.....--..X.--,..,..,..,..,,..-,.. -...A ..... -. X ... - Y . 1: K X X X . X,,' . MX S ' , .X 5 3 TQ ' W 7 QQ. K- XQXQ, , X X X .QXQX XX ,Xy X, m ,Q Q X X . MXH' XX X- iff. If XXJXX-X , , X.,,. . ,XX ,Q Akh,. . I , X X, M X J Q -3, QXXX- XX - X, X-XW'Q,:X Q f . 'ill .X X 'LX Qif 34. X g f 0 f y,,..X,. - j, QKX .XX S vQX,XQ4,.X .X-S ' ' Q X 5 ' f-Z. ff! XXQQ X . X Q, .X XX Xfsf ' ,, ' ZX .1 QQ XL . ff y X, 5 ,, 1 Q X X X5 XQX, Q. fX,f. LZ X M XXX! ,I 2 'Q QX- Q XX ,-:S XJ -XM X Q -:Sk X -XX Q Q Q Q XQ- .VXX XXff.X,fXQ , X4 Q, -Q - XXQQ Z! Q f ' Q, Q X Q X QX Xw Xp ,X X XQQQ X FQXI ,XZ Wi? Q ,X .- XX XXX. Q if jifffgj 'QX LX X . X X fi: W M465 X, . ,X , Q,.X XXXXQ ., UQ . S r k X 4 X YQ Q W-5 X5 W BTW? X 4' -X f 1 . ,, X Q, , : X QLXXQ, X5 XX- XXXXXX W ax 6 ,W X W. Q .- Q 5 Q- if f W V W X- X X X Q X-'Q W X M X 4, CX X X Q--X XX QW X W., . FXXX ,VZ Q, Q, X' X V -XXX, wfgis- i M, ' QQ .1-'Q Q, . - X. , ' 'X ' X , ,S ' ' , J4XiXj,t.1j,Q5 XQQXX IQQZQ K XQQ. X 44 1 W j if ff X f f gf FE'-f Q' Y Q XXX' Wm? , ., XQ QX Q ,,, Q ,,,. .X XX 'Q XQXXX Q, , W.-XQ QQ X X . Q :7..XQQjXQ.? WDW XQQQ -3QQ50- QXX 4, g,, -Q, X X . gf XX5,Z:egQQ . mg, XXXX .. Q, .- Q, .X Q .X Q, XX f X L Q, I Y X1 :XX X XPX43X- XX QXQXXW-XXX QQ, XX fi Wm i, , X- Q Q, Q Q 3 0 37 Q ,ZW X ,. ' X5 X, XX, .XX ig. X ,- A ZXQ IQ -'X -XV ff -. X X ZPQQXXW NE, W ,, Q, XX Q X-XQ XXX ? X 7 j L X 3 X! Xw1XXplv.i.Xgi., - XJ Q- X , . .X m X f ff X,,, i ' X -XL ff J , ' QQ, XSWXSWF XX Wf, SX XNXXXX Qji , .D.lp...Q..QX.fQ,X.w,X- QX 5 , X'XX'7'-X. X, 2 3, im-W, -Wfh VX X X fy , MQ X, X 'Q, .: 'XQ, X Q, X-X M 5 W ' .W 'Q N -X , ,il,X.: Q'S'W1S5 Q ff, .XXX .XXXXXf' Q X Q 45 f' 31 X f -X 'W' Q .X rg f q QQXX WX. ,QQQ -X 4 XXWX gf, X'Q.XX . X4 Y :A T, W - 3, X wr 'W'f Q. z IQ ,XQXX nf Q XQXXXQ f X 1 X. XXX- . X X f ,M XX, X y X3 , -QW S5 ,Wg 3 Q-Q .X 'ivy fli f ' ' SXfQ W5f?ZQQQQ ,Z .,, , k . XQ,..XQ.X QXX Q X ,X Q! L, XXQXMX f...XXXX My X. Q,..X,XQ . Q .X W 5 ,W ff . X QX QW W XXX yy X -Q, -QQ X W MQ ' Q. mwfXFfQif5.X5X .XXX W XV U XwXXXLQ 7,5 TQ, X 12 XX 'WWA A 'U Q Q Q Mi' . 52, XXX XX Q E .1X,, Q.XX Q .X- Q f' Y il .. X QQ X' Wi ig, QQ fm X Q, .. QX 2 X 3,2 Z3 gQ,p..1Q X-Q50 Q..XQ,XQ.- Q-X ff f QXX' X ' Q M-X76 MX W. JTXXXXV 5, ' X --XX . X X X X . 1 if E Xygaiysf'-X ' if .5 ' 29452 Q' TXX' X X 5 gf Q - - X X, QXQX X X, Q X X X XXX - - X vw ,X I X 3 Q Y X -in '. X 4 3 X X , X 2 f X f , X Q 'X 5 1: , Q. X Q I . B ,4 .I My , XX ., X . ,X S . Y, I T 3 ,, .X , , XM 1.1 XR Q X , 1 ? .2 ' S---X Q - X X-.:.,......,.,4X Q? fs , .. 5 X 9 . X ,X X , X. .A , Q , . Xx MX XX X ., Q, X. M ,fi .af p fi ...XXXQX ,,, X , . , ,gg ,,, ,QQ X X-X QM XAXXQ :ig wal XQXQMAQX. XX X WX x ,N sscn David ROWAN 96 FIERY VIGIL CPL Jeffery ROBBINS AFTER soo YEARS or s1LENcE On June 19th, USS Peleliu CLHA-59 arrived at Subic Bay, Philippines to begin conducting evacuation procedures in support of Operation Fiery Vigil. Due to eruptions of Mount Pinatubo and heavy rains and high winds from Typhoon Yunya, USS Peleliu postponed its scheduled liberty stop in Hong Kong to assist in the transporting of American Air Force and Navy dependents from Clark Air Force Base and Subic Bay Naval Station to the Philippine Island of Cebu, where they could be safely airlifted to locations within the United States. Upon arrival at the Naval Station, it was evident that the mission at hand would be immense. ln pouring rain, Peleliu Officers, Sailors and Marines began embarking the first of 2,526 evacuees. At times more than twenty busses wait- ed in line on the pier. The continuous heavy rain made the onload much more difficult. In addition to the eva- cuees, Peleliu sailors and marines took on over 100,000 pounds of luggage and the ship became a temporary home for C58 dogs, 25 cats and 2 birds. A kennel was established in the ships Well Deck where the animals were cared for by various crew members. Most of the embarked evacuees were women and children. Children ages eight months to 14 years spent many hours coloring, drawing pictures and watching television in the E-6 mess. Sailors and Marines, both Officer and enlisted, gave up their beithing areas and Staterooms to allow evacuees to rest on a soft mattress and have access to hot showers. The guests were also provided with much needed meals. T he m6SS lines were opened around the clock as Peleliu mess specialists served over 15,000 meals during the two-day transit to Cebu. Many embarked Marines stayed behind in Subic Bay to help with clean-up operations and Df0Vlde needed sewn' ty at different locations around the base. iii F14 P-I4 FIERY VIGIL 97 -in 1 Y-, ,vw ,Navi ,,,,,,,,,,,,,,,,-,.,,,,,.,,.,....,,,,,,,,,, ,hh,.........,.-t......1,i..,....,.,.,,,..- -v--f...w-1-...,-....---f-----------.-,-w- -W--W f---------f-- f -V - ' ---.,..7..-..,.. --........--...Q,, P.- ..v,- ,,. ,- , 29 JU E 199 When USS Peleliu arrived at Subic Bay Naval Sta- tion it was dark, hot and windy. A very heavy rain was falling and a grey colored powder covered eve thin in si ht. It was evident from feeling inside ered with W Q Q over the base that many during the stomas that Mount Pinatubo on ' Just two of many buses that delivered evacuees to USS Peleliu . . .x . 72 V' - V t.,Uj, . hai' 9 ,. '-rxgflzjg d 1 tv , V gi' ' , 1 Wa! l , ' , 4,..-- 1 35,5-. H v, .. n L,. ,.,. ' 98 FIERY VIGIL at . I-1vf+4sf'. 1 . sr q 'swf-, .vi .Aff ur 471' J' y vt 'J W ET2 Bruce GRITTON submitted all three of the photos above. DS5 Erik MONTVILLE submitted the picture of the busses at left. DS5 Esmeraldo BUENVIAJE gave us the bottom left and right photos and MACCSWD W. CROXTON captured on film our first glimpses of Cubi Point, bottom center. V Many of the children didn't really understand what kind of disaster they had just lived through. But when they came on board most of them were very tired and very hungry. Many came on the ship with frovms on their faces. It was a fun experience watching their fears disappear and smiles cover their faces. Just about every mother who joined us for the transit to Cebu was worn out when they finally got settled on board. It was a thrill for those of us with our oum children so far away, to watch the little ones while mom got some well deserved rest. FIERY VIGIL 99 PELELIU BABIES During Operation Fiery Vigil USS Peleliu provided transportation for well over two-thousand Navy and Air Force dependents who were forced to evac- uate Clark Air Force Base and the housing areas around Subic Bay Naval Station. One ofthe biggest and most exciting highlights of that operation were the four births which took place onboard. FIERY VIGIL WE WERE PROUD TO SERVE AMERI- C A N D E P E N - DENTS :A f 100 FIERY VIGIL Vita ax 1,1 , , l , , ' -'c W' --- - -- ,,, ,... - ,, i Left top photo submitted by CPL J. ROBBINS. Right top- Peleliu photo lab. Left center- RM2 B. ISELLEY. Above- MM5 J. COFFMAN. Thls ramp was the gateway to the fllght deck 'sfxggi a,a. can f I Dunng Operatlon Flery Vlgll the younger chlldren were lnvlted Into the Flrst Class Mess and Lounge area where they llterally colored for hours and hours After each plcture was finlshed lt was taped up on the bulkhead Dunng the two day translt there were enough plctures colored to wall paper the entlre space Three of those plctures have been reduced and are featured here The Information wntten below was sent to the shlp ln a Thank- You card July 12 1991 To the crew and members of USS Pelelnu Thank you all very much for the care and klndness you gave us whlle we were on board your shlp You wlll always be a part of my Ilfe because I felt safe then when I took my first step on your shxp To the gentleman who escorted me all the way to the slck bay because I got sea slck and to the hellcopter crew who asked my name and comforted me because I looked scared I Thank you all very very much God Bless you all and God Bless Pelellu Mrs APIITA DAVIS ' s 1 - I ,, M , , 5 If N 2 9 I gg Z 1 f , A f I NX 'flu Q' ff 724-X f F3 xl ft 710 X , .xx 1 I I ,ffm I I I ll af Q fl 6 7? f? ' ?v' 191' f2 vm H f 7 , . . . . . f 1 xx I I f I 2 XS I O I li Fil ' . X 0 V tg ll . . . 2 A j ,I L f,, fl A WW fag V gl? W wa WW, f 51 ' ZW? fi W4 A . . fa f y, W f X W fff 1 f J fwf WW ff f Wy f f f Sf G W7 X . KI 6 ' fa V I I v gi , . 5, K I f if I A 5 Q I 1: I X C If 0 , f X , W ff I 3 7 , Vw, Z ff W A ' Wm ff f ff I X ,X 75 ft: f M W f ,Z X X I I I Y M, I ,za fm X A V , W . . M, W X 7 X f ' If . I . I . . . . . . . . . . - I . 1 I . , . . 1 1 A. 1 1 1 ff 11 Dear11 511f, 1 1f 1,g 111 111 1 1 f f f fy TUHHK1YOU1f0f1 2VefMfhiU9 1Y0U aHd 1 fthe 1 peop1fejfclid1 1111 for lLl1Sf 11 1 g dU1ViUQ- gfthC l evaCua1ti0n 1 D C1l'i10d5l Your DC0P12 1 helpedvs 2101- EVeWD0dy1iS1W0H- 11 , derfvl and 11 and mydavghter will ali W3Y5f 11 11 l'Cm3mbe1'fQfQ1fhC1 fLCX1D3fiCl1C64 5 1 1 Please Say1 fhE1nk5g to1j5 lfl121th 1C 1 1 ai1QrS 1 '1 1 f3lfld1M3fil7lCS 1 1 that2are 1on 1bOard 1th1iS:ff 11 Shiv- BY lfheway,1ly0Uf1ShiD1 1is neat Q1 and I amvwproudtobeonyour11 1 ShlpJ'T07fhCvW0l'1dCffU1l1 f eo levofrhe 1 1 , 1 1 1 . 1 USS f Peleliu1, Sailo11fsQandp 1 M317ilfl6S,+ 1 1 a1ike,1 fTl11ankQYoL1Q QI . jforf fifiehdshipl above and fbgycmclth1e11Q a111 0f1 du ty4 A 1 1 I I , A V' .VV,V I 1 1 , I Carolynkand1 Stephanieg 1 1 11 1 11 M 'x 11 1 1 12 - B 102 FIERY VICIIL J A BETTER MAN, THAN I The old man sat- Stared at me, His eyes, they told- A tale. l probed his face, Great sadness, one could feel- His wrinkled, weathered, leathered lines were genuine- were real. We, watching, both the other- lndeterminable- was Time, A lengthy conversation- though- We never spoke a line. He looked of devastation, Horror and despair- Of supernatural fire, Of lightning everywhere. l watched, in awe- and wonder- His trials- so unjust- Unfolding legs, up he stood, ln ashes, soot, and dust. He smiled at me, then nodded- As if to say, UGooday , Peered beyond my shoulder, . . . pointing Far across the bay. Tracing from his crooked finger, Through the darkest clouds on high, I saw the Devil's funnel- pouring- Smoke into the sky. He brushed away the ashes Which lay upon his brow, Ancient lines, upon his forehead- Could clearly be read, now: Told a tale of Eons, Of ancestors, long ago- Who lived beneath the shadow Cf another volcano. Gazing all around me- Realizing it was noon, Ash choking off the daylight, Brightest sun: became the moon. We faced the silent other, Each thinking of his soul, Earth trembled in the darkness- Daring each of us to go. Proudly, he stood his ground No fear upon his face- Opened wide his gaunt brovm arms, His land, he did embrace. ln dust and haze, l saw them- A million men in all, Rising through the ashes . . . Somehow- Beckoned by his call. Our Uconversation finished, ln the corner of my eye, A crystal ball was forming, As l gulped a sad 'lC1oodbye . The teardrop slowly trickled- 'Cross the ash upon my face, l turned in shame- and wondered? Were such men of human race? Western man will surely flee- East, too, will run away, North and South will founder, As if it's Judgement Day. T O noble Philipino, True keeper of his land- Will dig out from the rubble, Will take a mighty stand. Rebuilding- like their fathers- So many years ago, Never will they be defeated- By the sleep awakened giant, Named: PINATUBO. by:LcbR. J.k. s1PEs 6 July 1991 FIERY VIGIL 105 X .2 E , F2723 Z fsx I f 1'X- 58 F xxx Hzmgh 47173 Wan 9 1 3 9 2 4sJ0m 5Mf X k ,D x'Hung 9 185 3 x V 2 f X 206 T 457 Xxx gl f 0 X X 152546 Cl WP, 107 1 A f X34 'EX ff 21 fp -42 16 wow ' F - f 'ff 'Z , 1 143 4 12 3 . 103 .oe 101 MS,S,, 599,55 175 5 .giiyxx Sa f 1 G1 5 Q. f L X -wus 119 y al- I gf Z J 'X X u ll 145' Y If 6 Msfsn liz! SEX KX 103 PWD or M I ' X 'Z-' l 1 132 f117L xily X-Eb W? KN 7 E?1Q81Foul, X 123 X lolx , Q -..' J-' I f 5 X109 L'-W . !'- X o I qlgvanpooigg Leaf lv 1. I C I 4 QE X 6 W' 1 f 2 fsv lol X 10 312 El: f 1 8 1 X Pfff F X ! , 4 if , ff ' A yi - X A C J fx N W X if -.--V -.- Y . .. ,,Y--...-. -1 . ...-.-.....,.......Y-.,-- --- ,.Y. ...- w -- CPL J. SKINNER CPL J. ROBBINS CPL. J. ROBBINS The history of Hong Kong is longer than that of the colony itself and begins more than ZLOQ years ago. This is when the first Europeans were attempting to pene- trate Chlna for trade purposes. The Portugese traders were the first in the area. They arrived on the China coast in 1515 and managed to obtain an establish- ment at MACAO in 1557 through which they sought trade with China. i E I l Left: The first thing on everybodys mind when we hit our first liberty port was to call home. 'i f Q ml GMG2 J. KROWITZ Left Middle: LCPL ONGLEY, CPL ROBBINS and ATAN CLARK hitting the streets of Kowloon. Above: Stanley Market was one of many places where good shopping was available. Left: DS5 SLAWNIKOWSKI and DS1 FRANCO try to look like natives of Hong Kong. D55 E. MONTVILLE HONG KONG 105 -f--------f'------.----I'-+-A-'-----n-'- ..,--- -vf - ----.-V- .--..-1-1.--if-....,... ...-.T.....T . g, ..,-Y ,,.,, ,, , ,- I 1 While Peleliu Sailors and Ma- rines were celebrating Inde- pendence Day in Hong Kong - Peleliu wives were having a celebration of their own. The cake was made by Kelly Arm- strong. All of the individuals shown on this page became friends to Peleliu sailors and Marines while the ship was anchored for the holiday. CPL P. BRADLEY DS5 E. IVIONTVILLE FC1 R. ARMSTRONG ff-'XX QW .4 .N ,4.. '. Ja. x,nvl v 1 flip ,' - ' QNX fi , -- :I .4 . 'X . ,, ' 7 .. ' 1 'X X f gc, f 'f Q y - , f I . ,I M., 1 , Q DS5 R. LAIRD and 'I'IlS Cafe. ssor s. LARTER 106 HONG KGNG 3: -.r HMM I . ,l-', '5l1G STAYIOI g .9 l I I CPL J- SWNNER ssor s. LARTER Left Middle: Three em- ployees of the UGo Down Bar and Grill Hong Kong. Right Mid- dle: June Wild salutes the U.S. Armed Forces. SSGT S. LARTER lvl-. A CPL. J. SKINNER This veil dance was performed in the Sung Dynasty Village D55 E. BUENVIAJE TM- f- -sf ...Q-m,,..,, .jlig . ' ig. s'f'T ' .L '71 '+..,.,-'g., ' ,asv A-. ,W 'A ... 9 Z, -N M A 1-gt AQ jj' ,f .J-, f .. ' ,,-,-'wi ' -' W' ,, ...- . V. -4?-.- H .. , . ' - ' -.., - - N, ,M-w.,--f,,. - . xi-i 7' ,.,:'.......4: 'N ' 'W H .Q-QL- . mf' Q..W ff-' - t,.-qw-.-.. ,.,,. .. i --N Tfirqrfxr---e-F.. 'ff-'A i f-4 ' .J-13 ' na. ., ,, ...M .,..., W, ..r f- . . , N. . - ,.,,,- . -M., .. t ,,,.,. -- -an... . -.....,.,.-P ..,,,..,, W A, N -V ' W I my V ., M, , . M... ,... ., . V ., W.. ,' ,,,,, , -T Wm., 35' ,, UUSMQ, . ' Hfwvgce: 1- ,Y ., fmlamm, . ,. AVVF ,. . CPL L. GILBERT The Island of Hong Kong was offered to the Brit- ish traders as a depot during negotiations be- tween the representatives of Britain and the Chi- nese Emperor's Agent following the Opium War of 1859-1842. ln January, 1841, the British occu- pied the Island without waiting for formal ratifi- cation of the offer. The secession of the Island was confimaed in 1842, with the Treaty of HANK- ,, 1111 8 lNG: thereafter Hong Kong was established as a free port, open to all. RMSN T. JENEWEIN HONG KONG 107 LCPL M. HERRES Top: Sailors and marines wait at Fenwick pier. Upper Right: DS5 SAM l-IOOKANO tries to look Chinese. Right: A few marines outside Stanley Market. Below: ln CANTON the main form of transportation is the bicycle. Below Right: Jumbo Floating Restaurant- the place where OA Division decided to spend some of their Jeopardy winnings. AGC D. KIM D55 E. BUENVIAJE SSCIT S. LARTER f 1 108 HONG KONG AGC D- KIM sscn S. LARTER LT J. cAMPBcLL and Aoc D. km '- H' ' f 'Y 'f -: --- -------M -- .....,. Jul ,i-i, A,-A. ,V 4 fb i Aim -W wi i f A i A v i A A BEACH Pl Close your eyes and picture this. The smell of food grilling over a charcoal fire makes your mouth water. The sun beats dovm on your body and happy voices of many people around you raise your spirits and makes you want to join them. Your nose wrinkles to the sweet smell of suntan lotion. No, you're not on the wann, soft sands of the beaches in Califomia. With your eyes open, you see you are on the USS Peleliu QLHA-59 at a Steel Beach Picnic. Sailors and Marines are all around you doing many of the same things they would do on a beach in California. There are no girls to watch, of course, but then there are no ants or gnats either. The grills are set up near the stem. The volun- teer cooks toil over the hot coals and the fragrance of hamburgers and barbecued chicken drifts down the entire flight deck. This time there's an added treat, though, as melted butter and boiled lobster add their savory aromas to the others in the air. Quickly long lines form. Not only are there foods from the grill and lobster pot, but also baked beans, creamy cole slaw, sliced tomatoes, lettuce, Condiments, chewy brovimies and cold sodas to make the meal worth the wait. The activities you find on the flight deck are the same as found on beaches all' over the world. There are the inevitable sunbathers toasting in the hot sun. A few individuals play Hacky Sack, where a small soft ball is kept in the air by using the feet only. Several musical instruments soon appear and impromptu groups play and sing in the shade of parked helicopters. Card and board games begin while the meal settles and cold sodas are sipped. Aboard the USS Peleliu a 'Steel Beach Picnic' is that rare opportunity to set aside things military and completely relax with your shipmates, if only for a few hours. if Pl-4 i i i r P STEEL BEACH 109 ' ' A f -2-- ---K-'---'--f-v.-.-- .-----1 v v--..-,--......-.......-. .w . in involved ln. The things that make a Steel Beach Picnic so pop ular are the same things that make a picnic popu- lar anytime, anywhere. It's a break, a chance to get away for a little while from the everyday routine. It's a chance to do something different. A chance to do .what you want to do. A These are just a few of the activities that sailors and marines Q 5.125 T. HOLCOMB 110 STEEL BEACH ' ' W H ' W ' 'WH - -- .. L.. -,, , 4 . .-..-.-.....,f.........i.,.-........-,,...-..-..-.....-,1 .. , FU THE SUN . ,. 'wigs-'E-iff? ' If t X L 5 1,1--mg-yr. A ' Y i X-lfgugzgim -,rw-,, V ,, , , , -f f-N54-. N dim:-.11 '- my l L V ff A M., , ' 3.-05123-'fnga, Q ff ' ' V f .SQ--, - -' - ' '- waist 1 ' 1 ' -1 H, Ny, ,p-4 15' .Q .1-11404 F- ' CPL. P. BRADLEY The Food Service Division sponsored our JUN 9th Steel Beach Picnic and served over 2,400 hamburgers, 2,000 hot dogs and 5,520 canned so- das. For most of the crew, it was their first liberty to relax and enjoy the vast Pacific Ocean. The Oflicers took their turn to cook on SEP 9th when they served over 25,000 chewy brownies and 400 pounds of steamed corn-on-the-cob. D55 E. BUENVIAJE CPL. J. SKINNER LCPL M. HERRES CPL. J. ROBBINS LT B. BAKER IVIIVI5 J. COFFMAN STEEL BEACH 111 ifrv-'Wray , cf,-.xv .Q Q In July Rod Williams, Matt Serritella and Barton Hays arrived to take the pictures that fill the pages of this cruisebook. While on board they made it possiblefor everyone to have photos to send home to loved ones. During the four day photo session over 1,000 individuals got their pictures taken. With Barton taking the or- ders, Rod positioning each person forthe photo and Matt behind the camera-vit looked like a ballet performance. 5 y 1 1 3 CRAFTLINE Photography 10425 Rockwood Drive San Diego, CA 92151 AbovefBelow- Rod Williams sets up each shot 4 l Below- Barton Hays takes orders outside CCTV. 7 fa ,Z , . C 4tst 6 ,pil t We , fffwf I ff f X L. i.,,. VZ Z 1 Matt Serritella takes another picture. 112 PHOTO SESSION 1, 'rt' I ', , W f S V! 'W tj l 'fL,.J IQ, ,, :ffl W . , ' Eff X f X, WX KW 1 I ig ' 5 X ffl? 7 f ff . 'Mfg' if 'Q if 'f M. ,u44g:-1,1 V, W, , Aff l ff? fi!! 9 z f 4 , ,1,f C6195 566-6090 lo, X an C ' ' 'Y 6... 'V V ' ' ,, I -- i ,,,, f ' fs ,KW 1,1121 6. ' .ps is 'iff 4 W W ff, , 6 f W swyii 5 f L . Q , www, V 'Wg 5, fgsyggg wh, ,Q f ' 5 A sgyfyfat' 1 ff ' , sf-SW fl ,rf ff z 1 ' - u ff f , -f , V- .AQ-My mJSy,, I SAY, .Sf ,y - 2. ,QK,,,,: , ,V gl,t 6 V' X Q NQWMQW U . fr . , , , , , r ' ' my I , A-si,fff' wiki V ,, 1. .. Z Z. ,ulwi . , X 4 ,,,, ,f V f 7' M WY wggw' 'rt f Y Wy -is Zmf-'VQWNQ 4 h -M wg W ,I I I sw, ,WQXQZ4 1, V 7 -,fw C. , -ss uWfw-sfW1-syW- , f 0 , f 5 if f fm ' 4,-X , f ,ff .Q - Wiz, ,Nh SLS?-sj,fV5X75g.,-psf W Q ff, f , f 4. QQ Mfr fi , fy 4 . f, y 0 6 .. X , f ff f ss, of, yya,--X 1 M165 'f wtf, W' f K wW . ' 4 ' f , ' , f W f 'L :ff My fl--fisf',fW . , ww , f ff , 4 , , 4 f , fy ff -X f mf fsvo A , ff, If -f if , ff? f ff: , pf, WW Ms, ,, V MWF f f f 7 77, iff-ffwfmv' 2' A fr 1 , f , f , 4,7 I, ,, ,yy 4.tfft.6jt.0-X-,M M143 ysxf -K, f 4 , ' ww ,Wy ffffvfo,--,,--6-z W 7 W' wht ,fy X4 f W f NM 'mst l QKK . if A B 3 K . ,.. X M xw. . A . X VOD Photo submitted by .cPL E.M. JUAREZ. cen- er- LcPL MA. HERRES. fbove- LCPL M.E. JOYETTE. W W, OPERATION FIERY VIGIL l would like to extend sincere appre- ciation to the staff, ships, and men of the Task Group 76.5 for your flaw- less support of evacuation efforts in Subic Bay. Exhibiting genuine con- cem for the well being and needs of evacuating personnel, you provided shelter, sustenance and transport for a total of 5,475 displaced per- sons, speeding them to safety. This number increased by four while at, sea, as skilled hands successfully delivered four newboms. ln this evacuation operation, the ships of TG 76.5 traversed an aggregate of over 1600 nautical miles. Through- out Fiery Vigil, your perfonnance was marked by success, skill and profes- sionalism. To a man, you exempli- fied the finest of Naval Tradition. I salute You. Farewell and Godspeed. RADM P.E. TOBIN CTF SEVEN THREE Top right photo submitted by BMCQSWD D.W. YANCY. Above- LCPL M.E. GOYETTE. Below- AT1 S.W. WILSON. Bottom Center- CPL J. ROBBINS. FIERY VIGIL REMEMBERED 115 J ha.- .f 8 4 if Q? Z eit' f, Lac Q. D55 E. MONTVILLE l'ARRRRRgh! NOT NOW! todays field day!! MEDICAL DEPARTMENT Xml , xexddde 6 1 Q J -Q 11 A hey The Medical Department provides the Peleliu with its Secondary Primary Mission- to care for and treat the sick and injured both in and out of the field, whenever it is needed. The medical department is comprised of many professional and skilled workers with various specialties and health-care knowledge. The embarked staff is made up of a combined team from three groups. Ship's company personnel, the embarked fleet surgical team and the medical team in the field. The ship's AV company personnel and the embarked surgical team make up the 'BLUE' side of the house, while theteam in the field who provide care for all the embarked ma- rines make up the lCrREEN' side. 9. 5 S ta 5 f 7 N ,ttg f lx We K HN S- SCOTT rm s. scorr HM2 R. REYES LT Q. MARTIN 114 MEDICAL HM1 Steven Shoemaker and HMC John Boldin. ' 'Wh Q 2 HM2 R. WHITE writes a new cleaning bill. LT SMITH, S.D. Seal Beach, CA MED DEPT HEAD HMC RING, DIL. Nitro WV MED mv ofLc:Po EI Paso TX Quay, HMC BOLDIN, J.H. NM HH HUGHES' LW- Cabot, AR Hins Dale, IL 5,54 nm SHOEMMER, SJ. LCD.R. L. DENNEN in the op- HM5 GLADNEY, w.L. San Pedro, CA eratmg room. TGXHC-amlaf TX HM1 CASIO R.Z. HM1 DIAZ, M.A. HM2 REYES, R.C. HMS BRYANT, CJ-- Brooklyn, NY Manila, RP Denver, C0 5 K MEDICAL 115 HM5 NEWSOM S C HH BROWN R O HN JACOBS, D.I. . HH SCOTT, S.R. HMS CARABAJAL, M. , , , , , , Lubbock, TX Whittier, CA Monrovia, AL Los Angeles, CA Los Angeles, CA In 3 LCDR DELEON-BLANCO is the ship's Aviation Medical Officer and hails from Orlando, Flor- ida. BZ to HN SEAN R. SCOTT for representing the Medical Department and submitting Artwork for this Cruisebook. J C I nq-.- I Lcbn Dau-:on-BLANCO, M.A. 116 MEDICAL f,x,,3 K. - 'W O rv -nw M ' 9-'I O f 65, it SQCQTT CAPT SCHNEIDER, J. San Diego, CA LCDR BUTTERWORTH, D Catons Ville, MD LCDR WALSH, T. P. When Mt. Pinatubo blew its top in JUNE, Peleliu's medical teams went to work providing care for one hundred and eighty-nine patients. 109 of these patients were pregnant women. The highlight of this operation were the HMC MORRIS, R.Cl. HH VIEYRA, V,R, San Diego, CA Modesto, CA l'lN BENJAMIN, T.E. Pollock, LA l'lM2 KLOPE, D.L. HN NASH, s.D. Ridfne' OR Clardina, CA four babies brought into the world via Peleliu's medical department while un- derway for the island of Cebu. fgf ,,, I rf ,im f. ,R Q ,, l W i 1 1 LCDR SPILLAHE, W. LCDR DEHNEN, L. San Diego. CA LT BAKER, B. Battle Creek, Ml LT MARTIN, C.R. Dallas, TX HN ADAMSON T.S. uv ...E 1 l 4, 3 ,, , Z.. A W W , , W www' 7 Photo submissions: Left SSGT D. ROW AN. Below HN S. SCOTT, LT B. BAKER J , K... Mankato, Mn ' LT Brian Baker and Capt Jon Schneider in Hong Kong. MEDICAL 117 Photo submissions: Top- LT B. BAKER. Right Middle-gI'lN S. SCOTT. Below- HN B. MUHIZ. Right Bottom- HN B. MUNIZ. 118 MEDICAL HN KIDD, R.T, Waterford, Ml HA POWERS, J.P. Gillett, WY HN MUNIZ, B.J. Apline, TX f, 6 Left- HN Thomas S. Adamson, I-IN Michael Martin, NH Victor R. Vieyra COR Techs! and HM5 Thomas 'E. Benjamin pose for a picture. Below- HN Luis Corrales applies a dressing to an injured hand. HH CORRALES, L. South Gate, CA Q0 Q, f , 4: . W, ....,.,. '77 1 5,7 7 N. 4' Wxxjxgf , xt Q, Y i 'W . A x X W 5 3 1 ? 3 i ,N f X ff SQL? W' W , N if L 1 rf A P f A DENTAL ,N , ' f ik DEP RTMENT Q53 Q ' Statistics: Operative Q, Dentistry: 1,002 ' X-Rays: 1,750 Dental Exams: 950 E 5 Extractions: 50 s .4 1 K Q Root Canals: 21 eanings: 525 ff f F fi 'E C' ' f WX' Patient Anesthesia: 700 ,L ff Total patient visits: 2,200. The Dental Department is re- sponsible for the oral health of all personnel on board Peleliu, and all emergencies in the ARG. BZ to DN Brian R. HYLER for re- presenting the Dental Dept. on this years Cruisebook staff. DT DN HYLER, B.R. Columbia, MO DN FARMER, J.M. Sulphur, LA DN PAMAN, J.T. Baguio City, RP wg- 4 f LT MUNLEY, P.J. Sugar Notch, PA DEN DEPT HEAD Above- DN J. Paman. All photos to the left- DN J. DT2 HUNTER, R.E. FARMER. Oberlin, PA DENTAL 119 .N I ,,,--'4 '-k. 4J-P I L OC 1 A I C O K, XV xxx X ,N I tin 7X . 57f?v My VJ I 5 1 7' 'VOR v ' aa F ,?!o,,y'Vc xv 4 f 2 M 4 1 OO ' c ' 2 K a .. f A I f 1 N XXVxXE'xx'a:X1 Ax' i, ' -M-5 ' fi X w px 5 NQQXXW1 5 1 ,, 2 X jj, IQ . , 4 3 A .I 0 .5 ,Q 4 I O 'f VU-I I We i l l Y b K 2 r 1 ? L 5 5 5 5 ,155 N -2 - wx - WHAT? om N' 4- u2ge.5 YOUR XUAJCM' LU Jia KNouu 1-He, 5l2, Jus-if X-low You MGS wilfii ?MvA?f' A LMC6 IT. 1 ' ' ' 216' A 13113 2 L1 Xff 9 X. , ' 2 'di' x F 17' K 1 M x f WAKDR , X 2 32 C J. - 1 P5 f fff' . . U I Avlatlon Supply 120 SUPPLY S4 S1.......pg. S2... ...pg. S55 .... pg. Wpg. DEPARTMENT CALL: SUPPLY 122 124 126 128 S5......Qpg. S6.......pg. S7.......pg. S8 . mpg. 150 151 155 154 ,ii- ..F0R ABAYZ 1 off SOAP? 0 O Offs f 2 KLQ 1 tibirsnaunsgcq xffffcx i A ' H ff'XXk . I I QII 42 p 0 ' N 4 AI I Q 5 9 - '::: ' f Ut 'xv YW9' I ' 1 o I I S I 5 is Q Q ' I ?-NE 7Sv- 3 ! I1 i Q. l ,r , uvt,IrHrNK iN' l A ORIDER ONLY ONE coops' s Y 7 I X Il sckjja H n swicki Swdapsn WX 4 3 J , ' Q-3-'bin TEZMQLNM. r A 'LQ .-- ' xx F. 'X . n ,Qi-N I 1 'C ,L lint, QI l I' 4 YQ' 1 Ji L, l F ni- I Q 'Q' as C S gl S M Q p ssc Piotr UP UD . . ' Li? r --df Y - S.. 1 C it There are eight divisions that make up the Supply Department. The first is Stock Control CSU. Then there is Food Service tS2j, Sales and Person- al Services fS3j, the Disbursing Of- fice fS4J, the Wardroom Mess Ca- terer and his staff ISSJ, Aviation Support CS6J, Automated Data Pro- cessing QS7l and finally the Stores Division CSSJ. All of these divisions work together to support all the ac- tivities that take place onboard a Naval vessel. Y-W, m CAPT KSELJ SCHNEIDER, CDR KALAS, IVI.R. LCDKCURRY, C.J. J.W. San Diego, CA Long Beach, CA SUPPLY OFFICER - SUPPLY OFFICER Assist. SUP O OFFGOING SUPPLY 121 --4'----1--4-T-.f--..Y.-------V --f-----'--- - A-J -- H--f-A-.-...,,.-.----1-..- ....,.r.. -V--,..,-....-- - 3 LT WILSON R E - Long Beach CA S1 DIV O SKC LINATOC V R Spnng Valley CA S1 LCPO CK ggsm X 544415-me OD CIN iffy ,f N! A lf -, CCCC ,s U5 A ijlll X if ,, O If P49 LA, x w l STUCK CC T RGL Y is im Qt? l '1 it 1 W ' I ' law I I 53 , , -,,!Ki?i'2mzzm..., 122 SUPPLY -me Stock Control Division is said by some to be the ncenter of Supply Depart- ment. Generating all sorts of adminis- trative, financial, and stock reports this hearty division is always On the Cro . We are composed of three divisions and everybody basically has their own title. Stock Control is made yup of the Shipboard Uniform Automated Data Processing QSUADPSJ Systems Coor- dinator, Financial Clerk, and the Func- tional Area Supervisor. Quality Assur- ance is known commonly as the Watchdog of the department. ' Finally, supply administration which is run by the assistant supply oflicer. All of these together and you equal a mll' lion dollar budget. They research the effectiveness of supply procedures and process mountains of paper WOYK- X l l 4 I l i x I l l K l AK1 EIGINCIER, K.W. Grove City, OH kwin SK2 EDNALINO, A.T. San Diego, CA SK5 BRUCE, J.A. Dallas, TX All photos submitted on pages 122 and 125 were donated by LCDR C. CURRY. BZ to SK5 JOHN BRUCE who represented the Supply Department on the 1991 Cruisebook staff. AK1 DELEON, E.R. Lemoore, CA so I lr C 0 P ,1 SDK? ,-W... El E, SK2 LOPEZ, A.L. i Long Beach, CA Wi mgwwmsmassw YNI5 ROBLES, C. Corpus Christi, TX SUPPLY 125 MS1 PACADALJEH P M52 WRIGHT R E. SCS PABLO A T, M51 SANGALANG, P.c. mst MCXNALANG, Ko. Moreno valley, CA, I cedar Rapids, IA Illhilippines I I Rockwall, TX Philippines 'lm YS A IR Ilt P A 5.31. do 63? . ' N CZ A 1 ' A . ' Rf , 4,-il 'E f ' 'h. MS2 CAHLAS, A.l. Philippines MS5 MARSHALL, J.B. Buffalo, NY MSI5 MORENO, R.C. Los Angeles, CA 124 SUPPLY Q 3 CWO2 TRINIDAD, E. Corpus Christi, TX S-2 DIV O MSCS REYES, C.C. Philippines S-2 LCPO ' nr Int ,a collective Sense, each division , L aboard aship is equallyfimportant.I , fcannotlexist without the other. Oneof the , , many divisions thatmake up the SLIDDI5' I li Department is fthe Division. This Divie sion ptrovidesfll, meals ia day, aside from birthday meals, steel beach picnics and special meals. These are the unsungli1E- ROES thatjust keep rolling alongno fmat4 ter how harsh the conditions. They are amply rewarded by the thoughtthat they have made someones day. Reward is not their motivation, Service is their missiong MS2 SWIHDLE, Y-5 Memphis, TN MSS DAVIS, IVLG. Alexandria, I-A MS M55 ROGERS, s.l.. Milwaukee, Wl Dearbom, Ml MSSA BEYDOUN, F.H. A x xmbkmkwfiz as MSSA WEAVER, T.T. MSSA CHAHEY, V. Long Beach, CA Unknown MSSN GAINES, B.W. MSSA JOHNSON, J.W. I Jackson, Plttsbllfgh, While the Marines were participat- ing in exercises ashore, the Food Service Division was busy prepar- ing and transporting hot meals to the forces on the beach. This tre- mendous effort did not go unno- ticed. MSSN HERMOSURA, J.D. Long Beach, CA 4 MSSN MILITAR, E.T. Unknown J MSSA CLOSZ, P.D. Long Beach, CA ' MSSR FIELDS, R.A. Wyandanch, NY MSSA SANCHEZ, R.A. West COWIIB, CA LCDR C. CURRY sub- mitted all the photos featured on this page. SUPPLY 125 -...,.-...,..:..-.,.......,.......,,- .... ,-...-., L T .....,,....., v -.-,...,..... ....,.,....- , --4--,f-...Q ..-,,. ..,.-....--....-....-.- SH1 ESPINA, P. Long Beach, CA B l , alla S-5 Division is the sales and personal serf vices part of the Supply Department. S-5 is responsible for a large retail operation which includes a ship's store, snack, baryi and several vending and amusement ma- chines. The service sideof the houseymain- tains the officer and enlisted barbershops and the laundry and diy cleaning plant. The laundry washed more than 860,000 pounds of clothes. In order to maintain this suc+ cessful retail operation, supply has its own yi administrative group., This group consists of a custodianfof fourlargey storerooms, ra ,FORA N2 oi: soAP7? ' O Q O f- fcml. , T iQ N f fff,-A VQQ Q ,V 2 5 CQ, A Q- , L cash collection agent, a recordkeepyeranda chief petty officer to direct their efforts.1 The L Sales Officerguides thejeffortsgof yS+5f.- p This dlvlslon IS I in SH1 DIMILAHTA, E.E',. Moreno Valley, CA SH1 YU, R.R. San Diego, CA SH2 DOLORIAS, R.G. Long Beach, CA 126 SUPPLY manned by 15 ship's Servicemen and a ship store Officer. gg'frA5HEtRf D- sus cAi.DERori, J. amen 0' CA Rizai, Philippines A LTJG WEIDNER, B.J. Park Rapids, MH SHCM PORTO, A.l'l. San Diego, CA .A ,f SH2 PAMA, E.C. SHSGN PEREY, l1.M. SHSN COTE, P.J. SHSN LINDSAY, S.J. Bacolod, RP Cavite, RP Tracy, CA Gilbert, CA W n 151' Photos: Left Middle LCDR C. CURRY, Below-Supply De- partment, Left Bottom- CPL J. SKIHNER. Artwork: Bot- tom LCPL HALL. 'ff 4 Q-4 ' gg' I 'sf - if 3 The main beneficiary of S-5 In money is the Welfare and Re- f f creation Fund. During this de- X ployment S-5 Division earned over one million dollars and 'CQ the WelfRec received f S100,000.00 to spend on if p crew oriented programs. -7 4 , BZ to SHZKSWJ PAMA who gathered our statistics. Z J sn 3 Jtfqjf 44 2 MLN SUPPLY 127 -.... ........,a.-.......,. v - ,, ,. ,mu M- ,.......,.s,,............- ......fR,........,...,, ,f -- 3 LTJG GRIFFIN, B.R. DK2 FMU' H-S' Greenville, MS DK1 FLORES, C' Pago Pago, Amer. Samoa 5-4 DIV 0 Angeles City, RP DK5 ALBAYALDE, .J.C. Manila, RP DKSN DAVIS, K.w. 3 Nashville, TH 2 .4 4 . h I2 D1 Slam Rshxoci Q H Q - ill 'NV YW? T -4 5 Il . 'tl' 128 SUPPLY S-4 S-4 Divisionis the source 'of allymoney in this floating city. Erupting1ikeiO1d Faith- ful on paydays, month in month but, DKK make paydays happen. Operating similarly to real fQur1tains,'Se4 recollects a lotof what itfpaysoutg Through Collections from the shipfs store. Post Office, Chiefs MSSS andy WardroomiMess,y funds filter back init? the idisbursing ofiiceifor the nextp21yd?Y4 To keep this system flowing 'S11f10QthlyQf1ff? quires constant attention Tto pay r9QOfdS, automated data I p systems and correspon- DK dence. I , I I l O I I Nm9 I , TOD right- DKSN K. Davis safeguards our money as LTJCI 15. Griffin closes the disbursing safe. Lett- another satisfied customer. SUPPLY DEPARTMENT- AVERAGE GUYS DOING A HERO'S JOB X SPS , . A , ss X Y L E a NX WM? 14 4 N1 s K7 X ' ' gg! if ff ff . VWY MX ,ly f if 27? ff 5, 549, rf. f , f ' X 5,4 f . f, ff , ' X, fy, ff f Q f 'Z ffl 7 X K! I 9x if f ff My 45 f f Z 5 f X Q ff! ff X ZZ f f W f JJ j',!4f ff ff 5? fyff, X f ffff 7 ffm, M, f if Z5 f ZZ fff X f X f 7 V7 1 77 X W W Q! ww X f f ff fffff fff?Z ff fffyff 1 X! of 4 fff Q ff off y Z! f'?fyff, 45? f40 f7fJ X X X X X! S-5: SI-IARKS 1 PELELIU Op Supply personnel recover what's left S-25: LTJG B. WEIDNER ponders, 'Was that 55521, or 5,1Z52? from a VERTREP cargo drop gone sour. Q ,906 J I if N-aww 44 S-5: MSC HATIVIDAD serves another outstanding Wardroom msec- S-7: DPI5 HIELSEN and DPSA WOZITHAK play a quick game of NIN- ond Setting , TENDO on the ship's SNAP I temunal. SUPPLY 129 Ms1 B.L. BRAND MS2 M.M. FERRER Ms2 T.A. sau. Ms2 s.A. DEARMIM LBEALILILZSN orlando, FL Norwalk, CA l-Ong Beach, CA Long Beach, CA Q I 150 SUPPLY ENS A.W. PEACI-IER Washington, DC S-5 DIV O MSC E.S. NATIVIDAD Sacramento, CA S-5 DIV LCPO H f uaads Yoorz lunch, 5'-5 5l2. Ivsl- l-low You LJK6 IT ll ,.fs W WAKDR me Q .. X .Eff C The Wardroom Mess Caterer and his staff are ready to ac- cept any job on a moment's notice. Taking care of 655 ship's company officers is not always easy, but these guys do it with style. Serving three plus meals a day to the ward- room, in addition to the Cap- tain's Mess, rarely keeps this division off its feet. Making any occasion a success is what the Wardroom staff does best and doing it with flair comes naturally. l l MSI5 O.N. CHANTHAVONG Harrisburg, PA J , MSSN J.C. SHERIDAH Long Beach, CA MSSH A.J. VITUG Manila, RP MSSN R. TEMPLETON San Femando, CA AK2 J.S. CIUFFEY AK2 R.lVl. JAMAL AK2 R,R, CRUZ El CCl1tl'O, CA LOYIQ BC8Ch, CA Wgst Covina, CA Akz F.M. cmwom CWO2 C.T. TUCAY Hollywood, S-6 DIV O AKC l.J. ALFORJA San Bemadino, CA S-6 DIV LCPO Aviaiion Sttppltj AK2 BAKER shows his acumen with a forklift - Aviation Supply division's basic function is to support the embarked COMPOSITE SQUADRON CHMM-1653 consisting of 28 aircraft and one organic UI-I-1l'l helo. The division consists of 11 Navy and Marine personnel, led by a division officer and two marine officers. During the entire deployment one aviation store-keeper is as- signed to COMFAIRWESTPAC DET in CUBI PT. RP for the expediting of all material to the ship. The divi- sion owns 11 storerooms, man- ages DLRs, handles high priority CAS-REPS and l'lMCSfPMCS requi- sitions. The S-6 division can be uh justifiably proud of all their ac- A ' Y complishments during GULFPAC Q '91 AK2 M.D. BAKER Brooklyn Park, MN S- AK2 CRUZ and CWO2 TUCAY take a break from the heat, while working on an l'airhead beach in Fujairah, UAE SUPPLY 151 -.-,..---...-....,.,,--.....f-....-.--.,-.- , - ' '- - '--v-- --f--.........-.-..,... . , AK2 CIUFFEY Cstanding lefty dunng a VERTREP evo- Am QR, DAVENPORT AK5 D.R. THOMAS AKAN D w JAMISON Santa Monica, CA Hastings MH lution in the Persian Gulf Dallas' TX AI'f2'CA'i'IPON, another outstanding member of the S-6 supply team Cflffllnal. 1 AK2 CRUZ moves cargo with a forklift under the direction of CWO2 TUCAY MM -...,ssxx5xx DP1 N, CARTER 52933 Sfgn' Birmingham, AL fx' X All Ez X515 cwo2 RA. scncu. DP5 NIELSEN teaches DPSN WOZNIAK and DP5 2 U El! in 0,2 Pleasanton, CA DP1 Di. RALL GRANT a valuable lesson in the lWorld of Data Pro- pid-f 57 DW O Rancho Palos Verdes, CA C6SSil'lQ' JV- 4,-' 'xxx AV ,. N--' DPC M.J. ARMSTRONG DP2 M.C. DUQUE Stockton, CA ULN X MWF! , tam, 1 fsi .7 f ooopg. 's x-dy, HS ' kiwi wins 195 Q n 'QL if 9-. Rig lDJllD'5 4 ec l . A 3 .570fL,f nmkm - 44, ,122 f , Phoenix, AZ S-7 DlV LCPO The Automated Data Processing di- vision provides non- tactical computer support facilities for shipboard supply, maintenance mate- rial management, administration, avi- ation supply sup- port, and flight hours accounting. The S-7 division's area of responsibility in- cludes ADP security, new systems develop- ment, software installation, troubleshooting, operations and user education. The ADP divi- sion is manned, functional and open for cus- tomer support 24 hours a day, 565 days a year. DPS T.M. WORLEY DP5 J.B. GRANT DP5 R.J. SATTERFIELD DPS5 J.J. NIELSEN San Pedro, CA Roseburg, PA Wichita, RS Torrance, CA SUPPLY 1255 LTJG. J.P. CONEY Philadelphia, PA S-8 DIV O SRCS A.R. ANDAYA Dagupan City, RP The Stores Division CS-89 is responsible for receiving, stowing, and issuing sur- ' face related repair and consumable ma. terial for the entire ship. Their inventory of over thirty live thousand line items in- cludes everything from toilet paper to y pencils and hydraulic pumps to paint. ln- I ventory is housed in twenty storerooms s-6 qcoNT.p DPSN P.E. HAMM Upland, CA DPSA D.S. WOZNIAK Boise, ID DPSA J.L. MEREDITH Winterhaven, FL 154 SUPPLY , My s-8 Div LcPo and issued around the clock. uh,1 9r'Ll.rQuQ if ORDERED ONLY one 5 g , l , ' it .N Y SK I 5 s 1 1 A Ai l i ,SSC Plclc 05' 1 i S-8 .. W Z if .S W 5 .rw .0 7 ,,- ff My 4,f,.-wi iffy-7' i-jr-y,jfy3-,vw ffk- ,k,.- W.--,H ,,,, ,QW-Wt ,.,, WM, ,,,, M WWV .,,. Vw, , ,, ,W Q f ,, , f,..,tff,..Wf,,,.., ,M rm, 4,31 ,, , ,f ,, f, f 5 , ff 4 W W r Q.-eg f, any wig ,.-wap-ws ,, ,, , ,W ,. , ,. , ,.f- ,J ,tw f ff M W f ff , aww, V,-qfww ffgtawf,..Q-j4f,,.,WQwwyyfzyqW,.5ifV.f,yLw, ,,M,Z:W, CAPT MYERS reenlists SK5 JACKSON while at sea kgpw Q-as . SR1 S.F. ELMA La Mirada, CA SR1 D.M. METRA I Santa Cruz, RP l SK1 S.I'l. CRUZ Long Beach, CA SK2 J.B. PADAYAO Lakewood, CA S SKI5 M.W. STEWART Seal Beach, CA SK2 K.D, BRESHEARS Tulsa, OK SK5 MJ.. JACKSON Maywood, lL SKSN l'l.X. NGUYEN San Diego. CA SKSN J.L. URENO Ontario, CA SKSN B.S. LOHAS Long Beach, CA The S-8 team Commitment to Excellence Xu? U 'Ss - sv. 7 l s N . B SUPPLY 155 CWO2 DAVILA, C.A. SI'IIP'S SECRETARY- 156 EXECUTIVE EXECUTIVE DEP RT NE T The Executive Department is as diverse as any department onboard the ship. The department is responsible for providing various personnel services to a crew of approximately 900 sailors and 2,000 Ma- rines. Executive or HX Dept. consists of eight separate areas. Here's a list of just a few of the services that the HX Dept. pro- vides: preparing awards, drafting and pre- paring business and social letters, main- taining officer and enlisted service re- cords, printing the Plan ofthe Day, draw- ing charts and illustrations, operating the ship's post office, providing law and or- der, giving spiritual guidance, performing legal services and career guidance. As you can see, the Executive Department has a vast range of duties and responsi- bilities. There is no way one can have a smooth touron the ship without the help of 'XTHE MEN FROM X. I Cabo Rojo, PR OFFGOING V If H.Y6Au.-sUfzE,. , 1'f'5IwYoup,fzeco2v-5 K ,l Your! be Q7 - - Owl f n TZ f a v 5 , Q' - Qhf A0 CWO2 VISH, S.S. fm SHIP 5 SECRETARY' ONCOMING .rii rifi ' if I V l , ,Z W7 fwgycfgf yy! f af X X X 4 X f f J Q ZWVXZXZJ W fy f f X X f 7 Wbyy JS 7 f f Q f A f f f y Z y , f 1 ,ty l fi V fa y Aww sf X f WXWVX K xfxgyxf Q X! my W XXJXQWK Q f Z f f U 7A77V Wtwfsfwwi bf 1 , V - ' U WW WN V , ' f Way bf V 75:2 Vs 5 KWQZEZQQ Boswell, f 1 QV ' f - f Zytaff ff ,W 4 WXWWWEV , , ,Q W ff!a,ff QM Wwyfxfx 0, 0 M f 74? W f f fX',s,6 W ,r j f 4' ,f gn 41 1' as MASTER AT ARMS ADMINISTRATION CHAPLAIN'S OFFICE PERSONNEL LEGAL PRINT SHOP POST OFFICE CAREER COUNSELOR EMCM RIFE, R.J. Spokane, WA 5-M COORDINATOR j I, xi . Z Fi x 0. Y ,i.l .av . ll' img' J Q ef liiggsa 1 fws' Nfl-'4 4'vi-. N, 15 9 t MAC W.K. CROXTON MA1 s. ESKRIDGE Seattle, WA Galestown. MD CHIEF MASTER AT ARMS .L X In I N51 MA1 E.C. LOCSIH MA1 D.E. KING Legaspi, RP Wichita, KS A h-My . ith. -.-1-gn ,. . rl. MA2 M.B. SIMMONS Stone Mountain, GA fi Z, v I N! A01 MJ. KHOLL MMI PLA. ABIVA ABF2 l.W. JACKSON Arvada, Co Chula Vista, CA Houston, TX 1 4' AD2 L. LARREA Quito, Ecuador EXECUTIVE 157 ,,g. 'w NCC R.L. Jones NC1 KW- SMITH Salem IN Townville, SC CAREER COUNSELOR N PC1 mn. ANDERSON St. Louis, MO M PC5 J. CARRILLO f f f f ,, .Z X X 4. ki .W X M, w f ,Q .,,.- 3, ,- AAL- ..., ,SL ,Ah..x ., if I my . gf vj Z j A..-My 2, .10 .4 .f , iw -LLA f, .ITV 1 -45? Vs? Qo- f X , f f f ff f V f f f f X w y fa f f ff I f f f ' f f f f f f f f 1 ff X .-zwfvwfUQ.-w4y:w7f .1 f. ..f,..mqw?f, f f f f mf, f, , M f f f f w X f 1, X 15 f 1 X f , fi! f f w H f f X f X V X fyf f ff X f W f , f f ff W L' if f f f X X ' ,f ff M f , i f 1 X wi fy X f f f f w ,. , i Zhi? .,fw.ff, 45.:f,w-215.-14 gf' In W-5? W Q 525' fif -A R 1 f f wb f f f , ff L47 mm X f gc. ff, f X079 z ff ff X ff f 4- f f 7 f U LNC K.C1. CASTERLIN sn I. RAWLS Batlett, TN LEGAL OFFICER V X X X y Spokane, WA X X f f .ff . f-ff,., Xfaff o.QffX- !fX -N 4X1 4: fNfX-X X4.Xo 1: 4Xa vw X f, 4, 1. ,L ,T 0 X' 0 sf, j' 5, 3 f ,X as z.XXm.g, QM, f A -'af X f 4551- X f f f , , f f 1 f 4 X f , X f X f f X X f , X f , f X ,ff ' ff ff? f ,f W f ff X , X-, 4, 0' , f 'V f y V w X f, f0,,, ff . Q. Q X 0 EW X X XX X X X X f X X X . ,,,, LL.. 4 f O eww-W KV, K.-4.4-ff,..f,...-msz-Xaf7..k.MX4i.f, f H Q.: , 4, ..,. -XY.,,7i,,.l , ,Q -wif f,4f5z,.Q0 fi .- X , 0, ., 'VW T, 4 ' fsy.-Wsw- V7l.V Z-wioopflyfff 'f,,'iff-we M., f f-V2-,:1,.-V..-W5 W-of Vfwf ' MYLMXME 1, ,WX X , lying. .W-4 1 'nw ,,-,,V-QfVk,,..,fWkj,fff V 'V ,WWW 54, DM2 S. MOORE Los Angeles, CA 158 EXECUTIVE ,J ff:f..wfff:0..f aww- . XM . Q..-Wqfmw4,Xw4,5wSW,.w-XV f f RP1 Cx. GRAGG Clayton, GA RP5 T. HADDEN Sumner, WA I ,mf - K. ,ff ig ..j,.Xf..f 42 f7 gf .. f ' ' nw. -rf, X , X y , ,, f X , X if .7 f f f X , ff. f X X f LISN T. SIMMONS Muncie, IH f ,W f ff X ff W X .Z .... ? wif 0 ,ff ,XM-of 12,90 fsf.-f :WU QM... gh.. Z rw-f :VX-f .47 3.1 .,! ,qw J, Q-ja, ff.- ff M, wwf X w ,. , vfff O.-f f M ff w my , w A .. 0 .. M W ,ff .WX f f f f Flint, Ml elf. I QQ., 1 vw ,v 'il ' 1 if 5. 7 w ,n X5 il 3' l E4 6 ,L .JM A. ..4 fl .L , ., 1 1 ff. 1, , 3 l l 1 i' 1 , l A X 4 YN5 F.L. SAM Austin, TX Q4 YN YNC T.J. WHITLEY Point Mugu, CA ADMIN OFFICER YN5 J.E. WHITE Carson City, HV r l St. Louis, MO YN5 J.A. WINZER YNSN A.L. BROWN Ruston, LA Goldsboro, NC PNCM I'I.G. CAMBEL f A PN2 P.l'l. BEARD Oklahoma City, OK l Laguna, RP I PERSONNEL OFFICER PN x Manila, RP sn ...,...l. 5 , ' '42 PHS F.V. CHAVEZ PH5 D.J. RASPER PNSN S.G. TAILLON Sacramento, CA Buffalo, NY Plastow, NH PH1 J.O. DEJESUS YH2 C.l'I. URICH l l l i ,, i. F EXECUTIVE 159 CH-46E SEA KNIGHT The mission of the CH-46 Sea Knight is to provide heli- copter transport of supplies, equipment and personnel for the landing force during ship-to-shore movement and within the objective area. The CI-I-46 is a fully instrument- ed, all-weather, twin engine tandem rotor helicopter. A rear landing ramp provides rapid loading and unloading of cargo and vehicles, while an extemal hook allows for UH-1N HUEY The mission of the I-Iuey is to provide utility combat heli- copter support to the Landing Force Commander during the ship-to-shore movement and in subsequent oper- ations ashore. The UI'I-1N is a twin-piloted, twin-engine helicopter utilized in command and control, resupply, casualty evacuation, liaison and aerial wire laying. an extemal lift of cargo. Speed: 126 mph Range: 250 miles Speed: 166 mph Crew: 4 Eigsei 170 mllesfferlw Payload: 16 troops or a combination 2 f Payload: 2 tons, 17 troops 0 guns and rockets' SUPER STALLION The mission of the CH-55E Super Stallion is to provide helicopter transport sup- port of supplies, equip- ment, and personnel for the landing force during ship-to-shore movement and within the objective area. Utilizing three engines, the CH-55E is rated at 16 tons of lift. The Super Stallion can lift 9Z50!o of all heavy equipment in a Marine Divi- sion compared to the older CH-55D Sea Stallion's .'560!o. Speed: 196 mph Range: 1,000 miles Crew: 5 Payload: 16 tons 56 troops 140 EIVIBARKED AIRCRAFT CRAFT I AV-8B HARRIER The AV-8B is a single seat, transonic, vectored-thrust, light-attack aircraft. The AV-8B is capable of increased payloads and extended range and offers improved reliability and maintainability over the AV- 8A. It is designed with a vertical short take-off and landing QWSTOLD capability to provide increased responsiveness to ground force close air support requirements through basing flexibility and high sortie rates. The AV-8B is configured for the Angle Rate Bombing System QARBSD which provides extremely accurate first pass attack capability and high kill probability through the use of passive laser spot or TV tracking. Speed: 0.88 Mach Range: 2,000 Nautical Miles Crew: 1 , AH-1W CGBRA The AH-1W Cobra is a two-seat, twin-engine, single rotor attack he- licopter. lt is an improved version of the AH-1T, incorporating more powerful engines, strengthened transmission and greater ord- nance capability. The AH-1W can be armed with 20mm cannon, 7.62mm machine guns, 2.75 inch rockets and the TOW missile sys- tem giving it anti-armor capability. Speed: 207 mph Range: 560 miles Crew: 2 EMBARKED AIRCRAFT 141 I a I PELELIU IRPLAN E MAY i' --'-' ' I W G2 fav .. ANTLER IT'S EVIL EYE AGAIN. THEY WANT YOU TO COME BACK TO ,PELELIU AND DO THEIR PMC FLIGHTS AGAIN JUEY JUNE SO WHAT IF IT WASN'T YOUR FAULT THAT BIG LEAGUE WASN'T HERE WHEN THE BOSS WAS READY TO GO YOU WANT A BOTTLE 'UR NOLTYT ,sf-751 .KWH - T'2i'3W?f'4tm f A AA Eg6fff2 7 , A - I u TZ. :xl m I -.ff ...,, 3' '--. egg?-.I sim ,X A I : V T- I ,..' 'Q ', 'comm IN, LT HAWLEI I WANT TO DISC WHY YOU CANCELLED MY FLIGHT AND NOT THE ONE-ARM MAJoR'sl! : iff AUGUST i awp SQWQ ' ' 'v , fi? Q-'iii x ' v4:1252:QQ-Ef,'iQ-EHQ: I 5 -'-- Wpg f ,Awww f- X : E N ga ???,:j.25Zf S 1' :fl if IO 494' A-Ji --9 ' - ' ' 1 if E ' Wi'-f59fL:A -:X 0 Q6 1 -im , hrffff ONE OF THE BEST STEEL BEACH PICNICS I'VE EVER BEEN TO! 142 AIRPLAN CARTOONS R3 Q ,fre 30:5 1 521. fp , 1 - ' 'I an , . A44 sp-h I , . E31 -w. . 154.2,e ..fv 'lr X1 L I 4:51 .I 1 X IGH xg SIR, I CAN GET You some: nous. BUT THIS IS A SPECIAL MEAL WITH THE cAPTAIN..... THOSE FLOWERS Q THE MAIN coURsE. 1 I I J I l I ! N 1 l COMICS SEPTEMBER OCTOBER . 321312152-2:5:i.af2f:r1r-1 va,,..:1'se:3:a:2.5:e12.5111:s:::z:f:':s:5-1:2:3.2:s: 'w:.e:1:1:1:f.114-1-H112 . .... ,..2:5:2:f1f'1,...1:.::'f1::f :E:E.2:':f ' ' ' '---E25','EfE2E-2122322'ES55-E1E2E32jE:253:5': '25-32E'E'..:-: -.-.- 21E152E225 ,.3E5lQE 1E53E1:1212f -:-2533 ks' ' AA ' . E659 A..A E 4 O 5 ,vv'l U I H Egzgijiiz-:Z tugglqi ....,, :J ,:i:EE2i5,:git2i5ig- . ,-:.:..::1.., V,E15EE51IEirxiziiil -. L . V M O 2215Elffifsl-31-1'-ri'ii'2i-Ei?22'E ' 1 ' - 'O '-.- 1 .L-Av A .2 2: - I .: as 1 O ff f' - K9 ' f . ,. 'O - ' , , . 1.1. - .JE Q . - ' , ' I sAnDAM, HONEY :Ts MOM, My 'rv sm' HAS ' ' GONE 'UN NIY AGAIY . . . . DID YOU P SS OF' THAT fini GEORGQE AGAIN tm.. L ' coo, A mmm IS sonmmunc You HAVE 'ro ORGAIIIZE, NOT JUST THROW TOGETHER. NOVEMBER W! .51 Q O :fl rl,' 'll' .II I b I. !'fOf ' X . M gm L ' ' f L - 0 M l ' Q 6 afauvr THE DAY AFrER.'YTHE GREAT Bos'N sMOiCEoU'r.f' AIRPLAN CARTOONS 145 il i il. iii 4 I 1 r I I VH 'il .ig- ,fi I 4 Ti '4 Qi Q i IR DEP RT IVIENT Air Department is manned by approximately 150 officers and enlisted personnel. This department is tasked with the move- ment, landing, recovery and fueling of embarked Navy and Ma- rine aircraft. It is additionally tasked with aircraft firefighting and aircrew rescue which might result from an aircraft emergency on the flight deck or hangar bay. Air Department consists of three divisions: Flight Deck Division QV-15, Hangar Deck Division CV-55, and Aviation Fuels Division IV-49. During GULFPAC'91 this ADM FLATLEY Award winning Air De- partment logged more than 8500 safe landings and proved to everyone that it is the hardest working and safest flight deck in the Navy. CDR. R.L. DICK Columbus, NJ AIR BOSS LT T.B. DUKATZ LT s.b. LANSING LT F..1. zucco Malibu CA Detroit' M' Fort Wayn, IN AIRCRAFT HA Mlm Boss Assr. AIR oFF1cER orricck NDUNG ABCM J.P. NAVARRO San Diego, CA AIR DEPT. LCPO 144 AIR i, F S 1 3 , irq ABHCS J.lVI. SIZEMORE CWO5 W.IVI. SANDS Elgin, IL Billerica, MA V-1 DIV LCPO V-1 DIV O ABH1 P. ROSSI San Antonio, TX v 155 ABH1 M.L. ELDREDGE ABH1 J.R. GABA Ridgecrest, CA Los Angeles, CA ABH2 MD. FORBES Westfield, HJ Z! X2 kr' VI ' 'ln Swag.,- OI'0 J I '39 gifftlbf A ' g g 'fi w-,--'ff Oi...-'55 Q, yi 0 K- -' J f eb 5 .il V-1 Division is responsible for the safe and professional handling of all aircraft on the flight deck. Everyone in V-1 Divi- sion has a very important roll to execute. LSE's QLanding Signalmen Enlisted! di- rect the movement of aircraft as well as all launching and recovering. Tractor dri- vers tow the aircraft. Blueshirts' are the chock and chain handlers: they secure aircraft to the deck, operate the flight deck elevators which move aircraft from the flight deck to the hangar deck. The Crash and Salvage team is responsible for aircraft firefighting, flight crew rescue, and the maintenance of fire fighting equipment. All members of the Flight Deck division must work together as a team to ensure each aircraft is handled safely and precisely. ABH2 E.P. COSBY ABH2 J.S. MANGONON Long Island, HY Escondido, CA AIR 145 ' N-we---- .. AB F 1 ABH2 D.J. SMITH Kingston, HY ABI15 G.M. BATEMAN Holt, Ml Ha. 2, i I X . ABHI5 D.P. HILT Ploxon, MT ABH5 R.L. WALTERS Corpus Christi, TX 146 AIR Y W7 ,,......-'v--' Photo Above- ABI-ICS SIZEMORE walks the flight deck while Marines are being loaded onto a CH-46. Below- LSE holds AV-8B I-larner in STO launch position. ABH5 C.E. MYERS ABH5 M. ORTIZ ABH5 C.K. TAYLOR Charlotte, MI O'Donnell, TX Shreveport, LA ABH2 R. F. WHITE Scottsdale, AZ ABH15 C.M. CHETWOOD Loudinville, Ol'l 'Wu 1 ,, ABH5 L. TAYLOR Yazoo City, MS AN E.S. ANTHONY Big Lake, MO 'fi i l l 1 5 l l l E l 1 l i 1 l 5 l l l AN T.L. BIVIHS Birmingham, AL AN J.C. CARAS amish I I 0 I 5 00' 4 AN P.F. BLOUIN Rockville, CT AN K.O. EMSTAD Stockton, CA AV-8B Hanier chocked and chained in the Aft Slash Anoka, MN AN C.E. JAMES Columbus, OH AN AJ. PITTS Stanley, NC 2 vw 6 Q P 4' i AN J.T. LATTA AN D.A. LUZ AN R.B. MORALES Hillsbourgh, NC Fall River, MA Snohomish, WA AN K.D. RECK AN R.T. REYNOLDS AN C.H. RINESMITH New Carlisle, OH Philadelphia, PA Whitmole Lake, Ml 'QS 7 4 6 nog 93 l AN R.A. HYKIEL Hamtramck, Ml AH T.Ci. SPELLMAN Colorado Springs, CO AIR 147 AA J.A. STECIER Arvada, Co AA HILL -Eager, AZ AA J.G. MENDES HBITISOTI, NJ AA R.D. ROLAND Warsaw, KY 148 AIR ff ffm ff 1 jff. if IZ X W f f I ,ic I AN M.A. THORH AN Lf- TONEY El P3591 TX Rockford, IL AA CLC. BENNETT AA R.V. DIONEDA Urbana, OH Granite City, IL LSE directs a Cl-I-46 into a perfect landing at Spot 5. f AA T.L. SIEBRASSE Emerson, MO Cornville, AZ AA J.C. SOBLEY AA R.M. SULLIVAN AA C.A. WELCH Lakewood, OH White Settlement, TX ,U-vb -,TA I il?t:-v,,..,,-- ...- .ff ....-... -.r YH, AR M.P. BAERTSCHI AR KN. BAUZO Toledo, OH Bronx, NY AR J,W. BLALOCK AR R.A. CLARK Porterville, CA San Jose, CA AR R.E. EMBILE Cataffnan N. Samar, RP Left- Flight Deck FOD-BUSTERS Below- Delivery of CH-55E to NAS CUBI PT., RP AR T.C. GILLIAM Philadelphia, PA AR E.J. GOEDE Spokane, WA I AR C.M. LUNDSTROM AR M.J. MEISCH Arvada, C0 Porterville, CA Left- ABHI5 BATEMAN, AN RAPOZA, AN IVIEISCH, AN STECIER. Q -f Q .4 AR S.M. SHEARER Comdenton, MO AIR 149 .....-..-,,.---...........,.....n.....,......,,,.. ,. ., ,.,-.... ., ,,,- .,...- ., ......-....., M-..-. ,.-..........,....... Z. f THE GREEN ' 427 Cogeq, ,. PLE T'-4 A SE :L ... - ' '21 l. i i f -M . - fi!!! , Mn I X ' JH f Nw' ' X if-ff? WWI' iff-' Q fw 1 ZH! M? 6 I 'I HANGARTQECK . f 1 ,V M, W ff f yi .-V , Q 5 ,f-mg , VALE ' f ff. J! og oo ol PARKING: , , W a Myf n-1, f ,t J , V , 4,7 f 5 f , , f' ff N g ,-Z ' g o G - - - - - I ff W ' in wana V4 Q I - -I ' X . . .. '- G . o 5 ' W f of 2 WWA, -- 14.-. wngq ' 6 C C - 2 f Us C is c 'J f Q , an.-IHA X A r . C 'g 'a' I' LT IVl.J. IVICCOLLUM LT L.W. SMITH ABHC D. KING . 0 0 ' . Humngton, CT Visalia, CA COUPCVIUCI WA V-5 Division is primarily responsible for the safe and expeditious movement of aircraft on, off, to, and from the hangar deck utiliz- ing two aircraft elevators. These highly trained Aviation Boatswains Mate Handlers CABHJ are true masters of their craft. Com- mon are situations where mere inches sep- arate aircraft from one another and this is the same on all aircraft carriers or ships equipped with hangar bays. In addition, V-5 Division is responsible for the upkeep of all associated fire fighting equipment on the hangar deck. They also support the flight deck team during aircraft crashes and res- cue efforts. V-Z5 Division is a group of moti- vated professionals who are continually re- quired to do their job right the lirst time. Their motto is IF IT AIN'T TIGHT, IT DOESl'l'T COUNT , which is supported by a four year 'crunch free' movement record. u ilu, v-5 Div o-orroomo v-5 Div o-omcommo v-5 Div LcPo K mm' 'Y 48 EJ Il ABH2 G.E. RUCKER ABH2 D.J. SWANSON ABH5 K.T. OBRANOVICI1 Toledo, OH Chelmsford, MA Butner, NC 150 AIR ABH5 R.D. TUYOR Bellflower, CA AN F. RIOS Los Angeles, CA Mun, if 1 wo a AA A. LITADA Oxnard, CA AA J.G. THOMPSON Chilliocottle, OH LQ'- , ng 4 1 5 I f uhh. -.. .,...-. -qw., ,.,'--Y -' J Z AN S.P. BARRY Costa Mesa, CA AN R.A. THOMAS JR. Houston, TX 'Q' f Z X AA c.J. snvwsom chicago, u. AA C.W. MORIARTY Dickson, TN 499 ff API L.G. HOLMEN Windom, Ml AA B.C. FANGOH San Diego, CA 1 I v-4 I 'I UNLEADQD, I I PLEASE V-4 Division is charged with maintaining and operating the ship's W fp'-K multi-million dollar aviation fueling system..They also take care of i fi 5,-L the ship's motor gas system CNOCIASJ Whlch IS Identical to fuel I QI used in automobiles. This type of gasoline requires special han- ,g ' - M ml dling whenever it is used, because of its high volatility. V-4 Divi- II A5'ff 0 , sion's ever vigilant mission is to safely deliver jet fuel to aircraft. I OQ my Aviation fuel crews below decks are tasked with purifying and. I '- 4 C E stowing the jet fuel which at a moments notice may be needed on I . 1 the flight deck. ff' on ,Ji C CFI cW'th qw ome y 1 e . Right- ABF2 MCMANUS maintains comms while AN CLARK refuels. -I - A Above- AV-8B Harrier is topped off' with JP-5 prior to another flight. 'Wh ABFCS D. FERNANDEZ CWO2 B.G. DUKE Brovmsville, TX ABFC D.F. WALLS ABF1 EAI- ANDERSON ABF1 G R SHARP Chicken Scratch, TX V-4 DIV LCPO La Mirada, CA Los Angeles, CA Lanaganfmo V-4 DIV O V-4 DIV ASST LCPO 152 AIR I 5 rims, Y '-'27 'I '-'37 , 2 ABF2 D.G. BASSIG Seal Beach, CA ABF2 T.W. MCMANUS Bronx, NY QM Kal ,.l , - 1 ABF5 V.J. DUARTE ABF7 T.F. ROPA ABF5 L.B. ATERRADO ABF5 R-CL BUNCH ABF5 RIT. CI-HLDERS Moruno Valley, CA Gen. Trias, Cavite, RP Dallas, TX Baytown' 1-X Los Angeles, CA -gwf Above- 'lThose silly XGRAPES' are trying to fly again! w QNQXN 'I '47 V ABFC5 J.K. MAGUIGAD ABF5 S.D. SPAINHOWER Long Beach, CA Los Angeles, CA AIR 155 ....,,..,.....,,......--3.-f---... ...,..,, ' Wh,,. S 'VIA at ABF5 J.T. ODELL Sun Valley, CA ABF5 C.M. MORTON Huntington, PA ABF5 M.l. MARQUEZ Los Angeles, CA 154 AIR ff f hwy 1 1 1 1 f f ., l .Z ABFAN F.R. BURTON JR ABFAN B.C. CLARK AN CLR. JOHNSON Green Bay, Wl North Charleston, SC Kalamazoo, Ml wmnm Z. 5 , Mah' f Y X X le? Z V ABFI5 A.P. RIVERA San Diego, CA ABF5 V.B. PASCUAL Santa Maria, CA AH M. PEOU AN A.A. CUYUGAN El Monte, CA Long Beach, CA uf: L ..,--. . .,.-.-a-..-f ,,,.,,,,....,,A -.. -- r v 1 1 w i v P E a 5 3 AA K.M. HUNTER AA D.N. MITCHELL Bellingham, WA La Porte, TX mu 4, AA D.A. OUELLETTE Brighton, Ml AA J.L. VALENZUI-:LA Ill AR A.M. BROWN All-'53, CA Cheyenne, WY AIR 155 -' VERTREP Qveitical Replenishmentl is the transportation of solid cargo from one ship to another by the use of helicopters. Vertical replenishment aug- ments or, in some cases, replaces' connected replenishment. It can be con- ducted with the receiving ship alongside the delivery ship as during connected replenishment, or VERTREPS can be done over the horizon at great distances. The range restrictions depend upon the type of helicopter, flying conditions, and load weight. Over 1,100 VERTREP evolutions were conducted during WESTPAC '91 with PELELIU receiving nearly 800 pallets of food and cargo as well as delivering over 500 pallets to other ships in the Amphibious Readiness Group. X I kg c. - ' 2 - W .gmwyfwf 0 Li ' 1 ' ,. ' H f , . , mv, X I, it sf' 3 3 Y . ,, - - XM l fy, X1 ij 1 'ri I f f 5 SQA ' .- ggf, Q fy I .11 -S gf .1 gg cf, gi 552595, WF Q is ,ZEQ.wi..X, swf, at his-'y,':-' f is-ff .aff me , 1 2 ffzfm-72 . if ,f A ,A asf, QM, ysysyvhyz f Ammsmixx is ' 4' .Q .ft ,r .41 . ,,.. ,l we 4 , X X , X . xi X , X : 3 ' X X it ' 5Ng5bwifss,,, XX ' X? X 3 l S ENS rg it E Q X , X XX 5 X 1 g S f v X, www igxgss , f f .Xe X, ,Q I 3, my N Q - ' X1 x., . w w X SW UQ gg TXfg1s,,FXifV L 1 A ki X Xjgs 3 f 3 1 . it M S50 X X S 3 0 X' -Q ---- K , ' V 1 S W X-5 A- Xb A XX vii Q - - K ' . X r Q X R . .. K .xc Xb X . . F K X X A- fXXs, f i 'ss X , X , s Ng Q ff ' , 5 Xsf 0 s X bi RSX: - , X sw X5 X: vp .N K s ,p Q 3 1 fl' .,-' , Nggiss ' 119 W1 I X 0 Q Q' CF fksfr S X if X .Q as dwg 4 I W X, gb X :X g ,i X ' if A 3 X i'i S N QQ N X? A Q fx 'a V X if N' My - O U 'W . L ,X 1 1 X X , NW gnc A F K X Sys Annum NS i rs x 0 gtg X was NX X, 1 sm Xt ...mx .4 ,2XXfXX www Ig x XWS QW Z Q. S X3 Underway replenishment QUNREPJ refers to all methods of transferring fuel, munitions, supplies, and men from one ship to another while at sea. The tenn Ureplenishment at sea, fonnerly used in this sense, now applies to all methods except for fueling at sea. Before the techniques of UNREP were developed, a ship that ran low on fuel, supplies, or ammunition had to retum to port, or the fleet had to remain stationary while they were replenished by means of small boats. Consequently, the effectiveness of the fleet was reduced by the ships that had to leave, moreover, a fleet lying to in order to replenish was more vulnerable to attack. The first UNREP occurred in 1899 when the tow-ship Collier Marcellus passed coal to the USS Massachusetts. Now, more than 90 years after that first UNREP U.S. Navy ships continue to lead the way in the art of supply at sea. With UNREP, an entire fleet can be resupplied, rearmed, and refueled within hours, while the fleet is proceeding on its mission. While on WESTPAC '91 PELELIU received 7.6 million gallons of DFM fship's fuell and 1.5 million gallons of JP-5 Qjet fuell. During UNREPS, PELELIU can receive 6,000 gal. of DFM per minute and 1,850 gal. of JP-5 per minute in addition to numerous pallets of cargo. PS .L R ' 4 'az ,, ' W e I W u ff' , , an X f' , Q M X, y ,ff , ' f ' ,n,,,-f -Wzzmrafffffr N 4 3 as 7 I , Z f ' ,psf F X y f- ,.,,, A .r f , , M 3 ii , V k SH? X! U 3 1 , at 5 ,' WX ' I 1 5 4' - f mg , M , 0 L f ,,,.,g4,f if 7 f 41 . A , f,,ff,w11PW M W 2 UNREPS 157 I f-hvvw--H-2-----v-Q--v-W---. --f.-.,....-,-,cu-,-f... -....-,.......5-.,-...v--........,...,.................,,., Tuesday, Sep. 10th will be a day no one will ever forget. This was the day of the Stars of the Storm tal- ent show. Promptly at 1850, LCDR Nelson Rosado took the stage in his black tux and gold cummerbund. He was a better Master of Ceremonies than Ole Ed McMahon. For the next two hours heintro duced 18 various acts to a full flight deck. Each act displayed their entertaining skills for the enjoyment of the Peleliu crew. We had instrumental groups, three and four man combo bands, acappella singing groups, and soloists performing a wide variety of music. We had a juggler-comic, a story about Fred the dead dog, a spoof Jeopardy show which poked fun at all targets of opportunity, com- plete with right on target 1MC announce- ments. 158 STARS OF THE STORM RM Lastly there were two show stopping perfor- mances. Gne by LCPL Bond as he did a dramatic interpretation from a scene in the book, Uncle Tom's Cabin. The other grand finale was by Engineman lst Class Light My Fire Piula with his flaming Samoan Fire Dance. He set the audi- ence on fire, and almost did the same thing to his loin cloth. The distinguished panel of judges awarded a total prize package of S400 to the performers. A S100 prize went to EN1 Piula. Five other prizes in descending amounts went to second through sixth place. All the other participants received a S10 prize for courage and initiative. Many said it was 'ithe best time they had on- board, the crew clamored for an encore perfor- mance. Don't be surprised when you read of, The Mother of All Talent Extravaganzasi' STARS OF THE STORM 159 LT. R. SELIGMAN St. Louis, MO EOD OFFICER C .ff BMC J. CONTI HT1 D. BURCHE Chickopee, MA Branson, MO f 160 EOD i J 6 izfij. C kj-5-ff T' Q. C bl' E Left- lt was right here just ten min- The mobile Explosive Ordnance Dis- posal CEGDD unit provides the Arn- phibious Readiness Group with the capability to locate, identify, render safe, recover, field evaluate, and dis- pose of all explosive ordnance in- cluding chemical and nuclearweap- ons. Our multi-faceted air, land, and sea capable EOD unit is based out of San Diego, CA. Above- Gone fi- sh'in. Right- EOD, it's a Blast! , C dmoz J. naownz cheny nm, NJ AZI5 B. STILWELL Schaumburg, IL HN 'QA' ' J W fm -to h avin 6192.459 QQSSXXXXXN Sfls' fn 'vi Zz u ll 3 2 op f o f, . 'xJVAVsi ' I t I xxXXxxxS utes ago! 1 .a f 3 l . L 1 il 3. P af- Yi lu- 4 Q-E-N x if 514 gi N W - --A.-- --., ,,,.. 3.4. . . . K. , xx xi , TIE?-L. '- sd. X 1' ww 'QM X frm' T' U1 'f 1 HAIX fgnnwr XO- XO. IT IIAIIUY HAM' ANOINLR CAFIOOPI MIOUT Till' HIIINUII-.ITIu' . A I MIMIT IT STOHIQ 3' I u,.,'r K. , H 21 ku V, l I 'l in ' A i ' li . K 'T XT ' X A U J, M TNI x xXx L, I ,X XX - A FIVE - 3 H A f A 41: X11 j I I B W X UID 1,6315 '41 ll I x Fl A , I ,rf I W' x' X0 . 4, '-, 4 X , f I , JD 'li 11559 ,S ' DHTI no ' 'I IV: v W - 4G , . - -F:uJAIfRA4H ' Arvauwpg 1 I H, 'SIM mwwE1vfIwwx , W :A Im 3,5 2 I fxf U3 EQEHIIEIIHME :2 11'lA I DON T KNOW IT LOOKS LIKE A HA'?'I R AND THAT S DEFINITELY A HARRILR PILOT-I BUT IT S CARYYIN CARGO? P I P , I ' 1 . 1 . on ,va xv' I ' f 'K 7 ' .X'2I..,f ins If 51,5 9' 1' AX XKZNVV V 3 t ,mf 5m. ,g- ,1 A ,E W' 1 li fx Z, Anlffx N an v N 4w'iz4, ,. nl, ,, . . , I I 1 Qfc,x'2?.C,1A,Q '. . . -ZA 3943 0 Mwgfifi A :gg ' ' ,. ,bffgg 2. A 4' -. R . J X4g:I,,,fA:,M , l A+ 2? I, f my fzfAzfA,,,4 , ! K if I ,- ' ,A vw' A 'Q , , I ztyvxvssog H , I' lar' ,X I vywhm ,M ' 5 Q- -s , '- I In :mwXjf.jiE'f B ,I 1 4.9 .9 on 5 ' T 4' M. ' A L' 'W' Q' .JV-,y kr o , wr, 5 V ,Wim 5 15 J P A 4 4 f Zh Q J 5' .., 2: ' 5 WT U' V' . MQ K. +V A , I V. -In ,.-f'I.-,wir . .. Q , .-... I ...... . . 1 'Q I Sf Iv :P A I gtwyx www I K 1,- 2 9 . I ... x .., 72901 lf 5 3 Y . . . M :' v I IK hp 1 .- , ' I I . -sli- ' 1 . iifiiflfifsiiisiiib T ' 'A ffiiiifiziiif , A -A A - -' 5 HSA . v , ' ,,, Sa'!?5gr5',- -if 2 11... , . A . iii? '52 119212 U43 - T M I P . e'?ff 'ff?vY' y ian ,,f2,2aYi-My ' x 'W' C0 -Tr- ,1- '. 'Y-sfswiiizsfi- Q iq? ' ' 1' - I ' QI E. ...,, .O,, ' fx 1 . -. . ' ' A 5 A - I fx I , If, .,.,' 2:-f '17 ' 'v'A 5' A. if '- Asia - - 4 , , Y' . , M- If ,. A ' f Xl! 9 I? ' fa , A ' - . WO:'Q1gggglnhyegglshzzg2121211323 fozililcig Goon NORNING1 PELELIU. THE u.s. IS Foo 2 0 .f,muse,o5mdshsome,,,,,,q...: , THREATENING TO ATTACK IRAQ1 THE STOCK TTARKET CRASHED11 AND UE DRIFTED INTO A NINE FIELD. BUT FIRST LETS TAKE A Loon: AT spoms. . . ji' H . Iac DIOTNSEE I -- , f K ,A ,KL I Il ' I ' 6 '5 - 'H '-A. 2 e f cn lm . o s ' A un .I .,.V, ,I+ NA, , . I U11 - gf . U' In U31 ,::g,:-: -.-f-.- - --I ,,.--,- 3.5441-A .duff-' I , Emqv,,1fq J,- WWWA awww M 4 A :fax ' 1 I , ' I ' I ' .- 7 Iwi-f.::::,?1?5ff'fiIf A ' iimfw..-1 V. - ., ' PCE MYER .. --'-4 AX -- I su Q0 - if I ' Bow A MY F-AU-LT-? QH YQ'gH you -' That'sit,piIfeitCHlEF'..... H01-0 iT DRSPPED -Too c.yQz.s Powsa B-QIIIITHQRE' yngg,-5 THAN I LOST' RADIOS and you 49117716 cor Eve fhch haS 'atuigei EICAHAINT Cl Kfcxf.. U 3 R- MOST -' REPLEN SllMENTS,lT I A' we une TOT . - ::fibnze:As:n::AAE . A ' I J ne mmm , RX fm , I f r QT A .f E x 3 .5 I M. I dql UI. RTL . i i ,U QE5 sw .ii ry. A A I in Ig '. ' S Q D 1 .,, 3 V I E- In 'lm' N-X'f- QF: AY:-Ili' W Af- 1 , ' 1 x ' PELELIU FUNNIES 161 V V V V , k V, , ,.,Q, .,, ,, ,V-,,Vw,VVVwqMlYWVVVV V .. 'W -f-- ' ' - ' ' V. V ,,..,,..,..,....w,.,V-MVVWV-Wm -'W''M 1 Q ' V 'NJQT x'f M ' 'f f u'N T15f7f'M- , , , , ,' V' , ' , ' ' ' V ., A,,f V V V , ' f' V . ' V 721 V V V fl V V V V ' VV , VV VV VV A' 'I 'f' ' ', 'V 'V 1 2 Vi W' ON YOUIQ 'BABY BUY IV 5 Lf 'h g , K ' V' ' 3 ' 1 Ulf ' ' A ,,LN , V V 5 gy, V V , . V . V V ' , V. VV' L :Vi V ' 3 ,VI 1 V 1 i . 1 I '52 ' i Q .y ,V V 3 1 Z r 3 1 5 ,,.,f ' , :ff ' Z E 'N' 1 I F V '-wzfff' l 4 1 +f .JV W ,fy 5V , if , , , L 1 -,IVV ff V 9 'IH R 'V 1 Q-- -lf, , 2 41. 5 5 f , 51 ?!' J 1 -if L ,VV 1 1, VV if ' g w 3 I ! J 3- rz o I if 2 - . , ijfv .f V ' 1 . N I , -. VI ,:,VV' 'if 'Lt ' 'SV 5 - ll 'f Q 1 5 Z T 2 Lee '2 C 2 'Sf V. , . X' f Q g '-.' fllL,L deg 1, ?1, f 1 V ' . V 3 V . and Q ' i , -' ' ' - , , -1 , -r . Vw 'V - 'I li M, , ,V ' A' Li' - ' 'ii , Q -, ' f V N MMV.,-'. A , ? ,gh V 'N f f9 3 ' Nil, Qelf 2 V' A xggfl ' A 'rf , V11 N. V, j k V- : V. ' .V V -, V. 'f f ,V V1 ' G HIVVVT V 1 , V I VV L VV V,,V:, .V , 5 , , , ,x L., . 1 r, ' VV VV EV 1V V N. if. V , M ' V If Ollfl 5' i 'Q . ,, , 3 . 1 ,.,k ' - V :QV T V VL , 1 . A V452 if .V 53 f ' 3' V VG Q Tj 'N ,if fi' Z1 ' ' . 'E 2 3 1' , 3 5 7i W 2 1 J ' + - 2 15 f ' , V du- 1,4 , ..-' ,' 1 V, ,- - VV: hu... H--ma.. . VV- VV w 2 1,,V -'rf Vg LV IV VV S 4 I I - I 2 V5 1. 3 I X I lv :I 5 3 5 .X 2 1 Q i 3 1 1 5 5 .s 1. V. V. , l 15' . . , VV , V V V V , 3 w. V, V E V Mt it ' ' 5 F1 i 'VBR ' V , .5 , , u V - JV ,,, - ,Vi f A 1 , V V -' .,--V V! if .. V V' 'V , K 31: 3 lr' - ,.,,f- '1- 11. ! - : , ' ' - ng : 3, W 3 - 33 V1 1' '11 k 1 V Vg Fi ' -, r' ' . V- 1 . x En 7, , Us ,NV ,gp ,V , 1 2 ,Q fi . QV V V VV ,ff f 'V , ity. V, Zvi, 1 , V , 72'-:tw 'i-'f YF' -Q ,,, .. , ,. i i'2y1,gA'.', Rx? ,f.f',:r 'f'L',.Vk V , 1 pe El VV ,VV .aqghgkv fV V,,q,-g. N. -'Q ,N V V V V ., , V ,, . V V V- 'V A V-r.V 'Vp' ' V . ' g V .Vi VV VV , , .-V..,..V -V - V VV :V Vgf1z.ianqa:1gnv1Q4,5,a,pzg.J.,i-15,..,,,,uLV,VxVV 3 :LVM ...W ,.,.,,-..A......Vn-VM ,....,.,.,.. ,. VWMW,Q,,,,.,,,.,Q.,,,.,N,,,,,,v. VV NVVVVVVVMWNVMVVMVVVV Nfl., W- MM 7 ,gl.2..,..,.....V,-uf...-.-4V -R. V, Vi, V V V VV , 2V V ' V ' ' , V:.aA.:' -MV. VW+Mf--V-4-Q.. ,, - V V Q- .' ff : , ' 5 'f ' . , ..,V. ,..,.f-V--N V- V ' - ' ' V ' we-f-wwf , V , Vw ,.V, V . VV: i . '..Q!pnrjf-V-7..f-'f,v4l-.7-asv' 9' . V . W---V ww' V V N--W... 7 .V,. ' Vp M.. f '--Q-3-1-.wpznfr VN V! , , ,Vu ' Vf x , 1,. V V .A tl' 44 1 Qany clfgcl n Q -H m W M as U- fm an fm qw g, I K, 1 sv? f 's 1 ' . r 3 l 24 Cqfffeyf 7 xy ch cl a Nt? in eltla , AMS Li ' 7 4 Qany f 5 7homa5f' o Rolent gf' Rodney and V , n Stanley and 1 .A 7ocZcl and fggen mgiv pnew Fennet, S tlltaml f Ronald Shenny Paagh rw e 2 2. 3 flank and Joy Agalttno, f'? enny and P all! , rf' My Ntcole Dawn -.M 4. ,J ,M 1 - ,. I. x 41, i ixj X - ,uf nj K . .,g 5 all A A jx ij - 7 E? 5 M f 1' . X 4,3 Zhi? 91 :S ge . 'Q WE will e H ,fx-qL,xX,,,, W,,,f NN. f Lfm,uf'Ku,.,w, wwf- -A. M'-i,.NxrNwk1M 'L XJAJ'xh!kH,.,xm AM'..N,a.,pXU,.-f1,,,fxfK.,,.w'Mlf+-,kat ,,.2!.xrW.LxAvFiJ,,,x,'gh'E, W SCH I'E'lJlLL1c'iJEiO1'1S Q 5 g Q Q ON YQUQ NEW DAUGHTER i 11 t y xx f' I no Q MAS .,..i.,.. S 5' ' s M t n la l ,.. 4' n ' no y , , ,- 1 gzip HJ. I 'I f ,,,,,V I , -WIN-,qL:f'v:ti!Lg?f-fc' 1 My B2Z5?4cn'tp'?1o4eph and Dona Chavez, laly gtnl. 'qnfl mfg ' X 5' ' Ramon and Nicky 7ejeda, Samantha Chntlttlne, 4,3 f,M5,11f ' 5 if U! fxgnegony and Michelle Daante, Bnanclt W1 t Matthew and Venontca Dollana, Lyndley 5 ',f'4l7f h 5-Qhifgtfstophen and Shelley, Sanah cfllzalet ,'VyfljL ',-,K y Q 7 and Olga Allen, Salama. fxliyftx W ' 4, ldtllent and Saltta, Kelley, Chyna. 4 , y A fy f john a Rowe, Lynn Qnactela, f' gn 1 ,E Haql9,4Lnf5, flmeltann. 2, f 5 l qi ' W, Q afitin, 34' , ly 4 2 N anzelal S!Qe,f2'7if2Z7Ld7 W ,x . 9, H w C ff gf yn ' if Sifigg ' x ,tri 1 f s ei, 5, , 1 -.J ww n is X I . 7 5 'i A Q! 'I' ii if ottf I N. -. Q 3 fm Q 93 5 ffl' 2 ow rw 'bf ' F ' . I O A 1 xi., Q ja-Bolstua Ntcole xg X ffl 1 Q GaCamenon Atnonz, Bnttanny Nante. 'lfx gq-, 1 - Ae: , Q -' f 5.2 ? I . , 3 v.-A 1 1, 1 , J , - .. I: . ,TN A if Y .??T'4Sf 3 V jj '51, 3 1 . :ffl X , ' '- 5,,,,,.J'4 xi X Qfnff - f-'V'-'1--,xfvv-.,,,f---fn-of-' N.w.ff,.fn1XJ ' -hw no 'yo V fhyv 1,-'W Q, J fw j -K' 'f-'fini I' V Y, X' 1 . t , I K , 4.4 k '1 My ,.,- V 1- A V l 2 U' A 1 N: yLl!,,iumw, m mw mfzffa: mama my mf mwmmw MA PERSONNEL ONBOARD uSS PELELIU ' 1,526 MARINES I :Sz OFFICERS , I94 ENLISTED I,3I7 NAVY 92 UFFICERS I l,225 ENLISTED 4,200 SICK CALLS 451.0000 Soons 42 REENLISTMENTS nm SAL JP-5 .....,.,.-...-'S .. .... I7 Soo HAIIRCUTSI 68 BIRTHS I 24,073 MILES SAILED GULIFPA 43 SEA 9' i ANCHOIR ' I Y' .I P 2I 4M GAL WATER 36 400 GAL MILK 39 soo EGGS I5O CHECK IN I85 CHECK OUT l,O62 GAL ICE CREAM , ' 1 I , I 3 V . .26-OCT-9If ' ,I D I , I I Ig In I V I I : 5 v. I I i A ,, I . A I L SINGAPORE , I' , f xx 27-oc1'-91 , -D I 164 59. IOO BURGERS I4I,0O 55 341,,,l'If5 Q2,S',,,2 'g',1',f2?x 4. MILLION DOLLARS m'O00,,gg3E,, DISBURSED 6... GAL ...Em 90000 LBS OUT GOING MAIL I COMING MAIL TRASI-I I 000 TURNED Z- non? 200 000 LBS IN I3 500 BAGS MESS DECKS I-IELLBACK t 9.326 'LANDINGSl TAK EOF F S f ' 2 soo oeznm. APPOIN - 'Q .i bg 3 I,400 CRUISEBOOKS SOLD A I4 EAWS QUALIFIED I COURT MARTIAL 7 ADMIN DISCHARGES '00 PUNCf'0NALS 'LLS 83 NON-JUDICIAL HEARINGS 8 esws Au ra 165 44 O5 or 1 3 I 111 0 1 12 1 1 ' 14 8 555 132 131 147 142 1-5 132 129 f 12 In Pont465 AUG - 10 AUG 142 Lat: 25 16 N 129 Long: 55 18 E36 122 122 136 trade fairs, c Eferences, an-gl ofcourse luiggidays. 14 135 131 127 1225 119 116? 125 115g ,,,.. sg ,..1,.. 11-Q cya fi' 1 58m 3M ,752 - 1 104 Benh 6 . : 9 jQXYxQ1'L5 E H 3 102 f 2 1 S 115 , . 112 Mofksh 1 -4 'I ' : FQ i 1 fr - 0c2s 2 . DI' 11, I ff.: 12 ll V' lfn 11 54 10 nj PF '43 U' - . 2 : 114:: ,fb ':: ,Q nf: g f! 55 'ru 255 'N shi' IAQ 3, 41 2 1 1 : 114 111 117 f ' Currency Rate: 55.65 DH to 51.00 US Dubai is knovm as uThe Gateway to the Gulf 3l'lH5fOI' goog reason sinie Dubai if a very cos- 11 mopolitan a well as most prosperous city in all United Arab Iiniiifates. Dubai is the center foir business ag Sttracts visitors to sporting events, 106 Dubai is als Snell eauipped with first c ass ho- P, tels in me d imtown and SCHSMQFC areas. 136 117 113 9 111 M brk Sh 12 fne Sbrlc5l1 1: 7 X05-S1307 1.. 12 1 102 13 544 Q . in 11 I' 5 MbkSl 1 1 FY ff A V0R8m3M Mbksnsf 136 6 1 1 5l7rk5h Mbks 121 1 31,1 10 101 135 I 13 YG 9 4 - - - ' M 131 MINA RASHID 13 125 2, 117 11 11 3 122 11 MbkSh . 1 5 114 5116 i 111 1 2 I FY me s bm sn M 5' I I 1 16 1 19 121 115 115 5 105 105 Dredged fo 115m if 119781 '59 DUBAYY DRYDOCK 0 V0 5 511 Co 24 2 291 Obsfr is 18m 10 101 102 103 C7 r G09 .9174 I DUBAI TI-IE CITY DUBAI 167 3 T DUBAI S1-1oPP1No iv The main shopping areas were the Gold Souk, the .El Ghurair shopping center, and the Karama Souk. The merchandise is widely varied from copies of American clothing to Arabic styles. Gold was avail- able throughout Dubai, but the largest in- ventory was at the Gold Souk. Prices were slightly higher, but bargaining was expect- ed. Tapes were also inexpensive but they were black market tapes. v T I I J i ll 168 DUBAI 4 ,. l,, X T L, 514 ,'L' ' .. L: 'V 72' 8 if ,A . 5 Dubai is a very busy city, both day and night. When the sun goes down, the city is radiant from all the lights .. Shop- ping is good and there is al- ways a place to get a bite to eat. Clubs and bars are locat- ed at most hotels. The Sher- iff's at the Metropolitan Hotel and Pancho Villa's at the As- toria Hotel were favorites. ,, .. Q .. . 4 .7 '4 .1 - ,Q A . .X ' ,. ., fr-57 I - as AF' WS A -wa ' 5 Zi '4T'cu 525221, ff -. - -. - gf . -.gr ' ff 1-, -P' :Q 412- Q , ff, I 'L 1 XE!! Wi: A ' . 1'-'mvf x. 'MH ?f:12fjt' rg-5 , X - .Q Af -' ga 'VS if .9 53 , A - , V ijstzf' '-V -. ri lf - 1.5 i , 'I R Y h ,I , , - U 4 U -V fi ,Q 5 '? - f 2 y , K ' X if - - 1 'I I 2 1 .v '- - , '- ,5 :- A. -, .Q . , , . , :. -- Above DC2 NEAL and EN5 HAUVER dance to the song walk like an Egyptian 4, .-479, -i ,. K '- DUBAI 169 5 ' Qi? if? DUBAI S PEC PLE I 1211 Zflgllff f f .. 5 5 4 ,I ' I? R X A young woman in her traditional muslim clothing A Dubai man off to work in the heat of the day Two men of Dubai eat a traditional meal at a local restaurant One of the many local cafes in Dubai province 170 DUBAI THLETE CF THE YEAR ,, s 1112: 043, v'o'.'i't',. X'-llf V TSX Ixx N Xxx X N-IX UK? ' w WK X A xxx w sv W .58 X M xxyi . Q ff . X 1 in 'Qt my - Xi DEPARTMENT OF THE NAVY N USS PELELIU QLHA-51 nzzv vosr orncs AP oauza-nezo I 'K W3 F Fnom: O66LcUeA and Cnew o6 USS PELELIU ILHA 51 To: Navai Staiion Long Beach, Cdl2L60ll.l1i.d,, Mwk AtJ1.toJioA Depazetmeni sabj: 1991 ATHLETE OF THE YEAR NOMINATION ICO CAPT R.T. MYERS 1. The O66Levee and ciew o6 USS PELELIU tahe pteaiune tn VWM4-VUDUJ1-9 ouzu, Commanding O66i.eew., Captain Riehand T. Myvu 6on. eonitdumtton ai Navai Staxion Long Beach.'A Athiete o6 the Yea,-L 6on 1991. 2. The nomination o6 a. Commandtng O66i.een. may Aeun a big unonithodox. to Aome, bui not to the Liivuaiiy th.ouia,ndA o6 Aaiiou and maainvs thai have bene6iied 61v.om Captain Myui' dedi.eatLan. to Gif-RMA, health and Aponii eompetiiion. Evenyone who hai aiiended a Naval Station Long Beach. Apofvting event h.nowA Captain Myvw. He hai been -LnvoLved'tn Nauai Station Aponta pnoqnama Atnee he cvuaived in the Long Buzcn aznea. in 1987 'aa Commanding O66Leen. o6 USS OGDEN. He hat 6Loided a team Ln eveny Aponli toll,-Lnameret held Ln the a,-Lea wnenevm the fshipbe .eeheduie pefunttted. He hai Anonzsoned indtvtdarzi eompetbfioni 6on. hii :new nangtng 6aom Scuba dtving to Bait nidtng. Captain Myvai playis on the PELELIU wandaoom baihetballt and bowLLng teamfs, in addbfion to being Coac.ILfPiieh.vr. 604, the PELELIU GOLD Ao6tb-LU, team. when no Apontb tou.1uu1.meniJA aie to be 6ou,nd, Captain Myvw eaeaiea them! Becauie o6 the Ahip'4 exiereatve 1991 undvmway Aeheduie, Captain Myeu Ataited luis own bowling teagae which eonitated 06 twelve teamA ali 6n,om PELELZU. whiie deployed to the Peeatan Gui6 tn Aapponi o6 Opvmxion DESERT STORM, he -Aolieiied competition. 6n.om Anabian Gu.l,6 nationi, naval, and othm mcvaine anbto and held apofeting evenii in evmy pont vtaiied. Duzzing a two-weeh. apheep peniod Ln Dubai, Uniied Anab Eminatw, Captain Myvzi Aporvxoaed the Zangeat miiiiaiy Aponxing compet,iA'ion even. h.e?,d Ln the PenAinJL GUL6 called the HAPTER THE STORMH touanament. Thii mammoth. event 6eaiu.,w.ed two 32 team dou.bte elimination Ao6tba,U, touzuuzmenti , two Z 4 team dou.bl.e ebiminaiion ba.Ah.oiba,U. touzummenbs, two 24 team Atngte elimtnaxion voU.eybaLL tozuuwmenii, two 44 team bowiing touzuwmert, a Aeven team Aoeem tounnamervt and a. 10 team Awtrn meet. Teama eoniuted o6 eiementb 61am the USMC 15TH MEU and u,ni,tA 06 the Amphibiozm Readtnoib Gfv.ou.p A , Battle Gn.ou.p F , CJTF Middle Eait ai wail. ai toeai UAE civilian and mtlitany teama. lt wai twiy the btggeat Aponting ezebuzvaganza in United Anab Emiiaie hiitony. It Ahouid be noted thai not only did he pvmionally manage the entine eompetition, bui he aiao panttcipated tn. the 4o6tbaiL, bceshetbaii, and bowling tou,n,nameu,tA. HLA PELELIU GOLD Ao6tbaFi team won the 6ifv.st touzulameni and 6LniAhed 6ou.nih in the Aeeond. HU, bowling team wai the tou.1u1.amera,t fuennen-u.p. Sponfbs competition with UAE national. teamb wai a.LAo axuuumged by Captain Myvzi duning poni viiixxs to Abu. Dhabt, UAE and Stngapone. Navy-wide Navy wetglxt ely but by SUPER ABS edaeaiion. teat than OUTSTANDING OI1. abt hii Phytical, Readtnoit Toiti. 4. Faced wixiu. a deployment to the Puusian. Gui6, Captain Myvus wanted to erusaae Uxat the 2,500 Aaitoni and mazv.Ln.vJs aboaid PELELIU wane nent buiy and given evuy opponhmity to atay Ln. on get .Ln Ahape. He did thii by 6ou.ndi.ng the Bob Z Delanelx Hope FLULMA Centvu IPELELIU GYMJ Ln. the 6aU, c6 1990. By nebtoning the Aeefimvlzaiion Room and Atoehing the gym wtth. the vmy but o6 aumobte, 6n,ee-woigl-li, and nauiitui equipment he enauned exoieifse equipmeali would be available 6011. ali eaewmuzlbvw u.Ae. The Commanding O66Leen. o6 the 15TH MEU, Colonel T. Munnay Atated that, My mazxinefs lpe6t PELELIU Ln. eonitdwmabty befim A1-Lape than when they a1uuived. I6 you. Looh. ai what Captain Myvui hai done Ln. eveiy phaie 06 Aponi competition, ii .should be ne62ected that tllia tnemendoab aeeomp2iAhment wat andeniooh, whiie PELELIU wai at Aea. 608 o6 the time H14 06 3661 day.4 dlUliJ1.g ealendaa yearn 1991. 5. A devoted athlete, Captain. Myeni'4u.eeo,AA in Aponfti pnognnma both a,A a. pan. CANDIDATE 601 YEAR. Super Abs s o -.,...,,,,.?..s,...s..,,, ,,W,,l,V, ,W , Top Left- Rugby team action in Sin- gapore. Middle Left- PELELIU SHARKS team com- petes in swim meet while in Dubai. 172 SPORTS Top Right-PELELIU SLAMMERS volleyball team puts up a good defense against the UAE national team. Middle Right- SM1 SHIELDS displays his hitting skill. Left- PE- LELIU tennis team in Singapore- 0 Right- PELELIU PUMAS vs. CLEVELAND in a rival soccer match-up DARTERS take aim on the flight deck 1 PELELIU FASTBREAKS get physical during the Dubai toumament E 1 3 il r l x l I 3 1 i E l l 1 Left- Golfers tee-one-up during Steel Beach picnic I 1. 4 I 3 I l Z 1 l 4 I l I I V i lf lv l I l E ! If li SPORTS 175 l Team: ITop Row LfRI OS5 JACK- BMSN WASHINGTON, MS5 AD- SN BROWN, SN SI-IEFFIELD, JG GUITY ICOACHJ. IBottom Row Lf , SN JUMPER, CTOSN CORNELIUS, www-mn-m,.,, Mwf ,, Wardroom Basketball Team: CTop Row LfRI CAPT MYERS, LTJG GUITY, LT ROCl'IE. fBottom Row LfRJ LT MUNLEY, LT ZELEZNIK. I I ,Af ,Dx FAST BREAKS Basketball Team: EIVIFN SHORT, FN LEE, DC5 BELL, FN SIVIITI'I, EIVI5 DUPINING, IVIIVI5 KING, PI'IAN KIININARD, BT5 LEWIS, IVIIVI5 BROADNAX, EN5 DALEY, Sl'I5 WOOTEN, EIVl.'5 PIERRE. ,- . 4 . POINTERS Basketball Team: fTop Row LjRI SSOT HAWKINS, BT5 WALLS, AC5 HORNBEAR, MSSN FIELDS, SHSN VERGES, OS5 MORRIS, BTFN ED- WARDS. IBottom Row LfRI MSSN FREEMAN, MSZ5 WILLIAMS, RMSN PHILLIPS. 174 SPORTS .. -...,...,f.n.--'..,r-fv BLUE Softball Team: fTop Row LfRJ SM1 SHIELDS, GMO5 CHAMPAGNE, AO5 MOORE, DC2 SMITH, PH5 SCHUCK, EMFN SHORT, MM2 MIDKIFF, PHAN KIN- ,mm I , ...-,,..W......W...............,.: NARD. fBottom Row LXRJ SH2 ASHER, DC5 CHESNUT. GOLD Softball Team: CTop Row LfRl ACAN DANIELS, ABF2 MCMANUS, BM2 JONES, CAPT MYERS, NC1 SMITH. IBottom Row LfRJ ETZ5 JOHNSON, AO5 PITT- MAN, DSZ5 SLAWNIROWSRI, AC15 HART. . f., RNS wp. ,Nagy fWiW' IX 2 Dart Team: DARTERS, KTOD ROW LXRD LT SMITH, UNRNWN, LCDR BRANSCUM. fBOttOm ROW LXRD DS5 BUENVIAJE, SA PERLUNGHER, DS5 HOOKANO. mi, W 2 IX SHARKS Swim Team: CTOD ROW LXRJ CIYSCIT WHEAT- LEY, CPL DOWD, CPL THOMAS, CPL CASTILLO, DCFN DENNIS. fBottom ROW LXRD CPL BAOLIETO, LT SONG, AOC RIM. SPORTS 175 L, ... S S ..,-L -.- A ., ,L. .,.,L ,M L - Y .,...,,.w.n.-,,,..L,,.., I 1 L fs-, Bowling Team: fTop Row LfRJ AS2 HEMSHAW, QAPT fl MYERS, UMKNWM, LT SMITH. lBottom Row LfRl PFC 5 SMITH, CPL MINER. SLAMMERS Volleyball Team: lTop Row LfRJ DS2 SO VERN, QMSN JANS, MMS CHAPMAN, SSCIT NICHOL- SON. lBottom ROW LfRJ YN5 SAM, EN5 SANER. AIMD ALL-STARS Team: KTOp ROW LXRD AZ2 CALD- WELL, ADC MACAOILE. lBottom Rowh AS5 MCKAY 176 SPORTS A-GANG Softball Team: lTop Row LfRJ EN2 BUCK- LEY, MM5 PACHECO, EH5 MORROW, EN5 DALEY, , MM5 ROYAL, EN1 PIULA. lBottom Row LfRJ EN5 V SANER, MM2 PETERSON, EN5 BROWN. W, , ..,,-A -..- PUMAS Soccer Team: 4Top Row LfRl ATAN CLARK, . fA LT BATTLE, MM5 COFFMAN, ET5 LEE, EMFN MARINO. CBOtt0m Row LfRJ BM5 LEAL, ISS ESCEBEDO, DCFN DENNIS, MMC5 ROUNDY, FN GUERRERO, SN SO- LANO, SN RODRIGUEZ. CAPT MYERS is always looking for new talent 7 .f ,,.,,, , , M -W, 2 .TJG GOSSETT and LT KOZAKAR COPS SOH- ball StudS J LTJG GUITY and SN RAWLS experience the thrill of victory and the agony ofdefeat DS3 SLAWNI- KOWSKI fThe SKl J Stern Gate FISH- O-RAMA '15 , SPCRTS 177 M29 Clnleg lookS like Q +hjrcr:,'E3 igqgvxffi i mr 9 v T 'QQ N17 K , 'xii I' C ,I 'Q Di fs fa? 63 ' OJ c L 0 fl: T wh. H16 5 C C E E' ij, !.l1!?l1!?:i': -'ff-0 T' Q ' 0 E C c C , T 4 '0---- a cc cf 128 ' E lilo C K 3 C TCTTC 0:30 C CCC QSC, 9 fb ,, , ' S OOF Eve fhch f'1oS FC - S ,, CA KfcK?..,. T f 4 1 1 O 1 0 V ,249 P 1 Fl 4 S I of CW T T C ' T 1 Q za I T S C' G 4 T mx T4 CC MEAT SYSTEMS CA AVIATION QRDANCE CF FIRE CGNTROL CE ELECTRONICS TECH CD DATA SYSTEMS CG GUNNER5 MATE CI ELECTRGNIC WARFARE 178 COMBAT SYSTEMS DS5 WEBER presenting CSO LCDR SCHOEN- FELD with supply re- quest chits. No more money! UO You 529 0- Prdolem, M0-Sl'er Clnfgf ? l . K I xx- 'LXU3 , -N .lt A. . 9 L 'W 4411, I SMD HISSLE INBOUND A7 ww ix Combat Systems Department con- sists of six divisions totalling 91 enlisted men and seven officers. These divisions maintain and op- erate the ship's weapon and elec- tronic systems. These systems in- clude large caliber and missile de- fense guns, radar and electronic equipment, and data systems. Combat Systems Department is also charged with the handling, storage, arming and outiitting of all aviation and Marine ordnance, the ship's armory, and small arms and munitions. Combat Systems maintains some of the most so- phisticated radar and electronic equipment. This equipment in- cludes: surface and air-search ra- dar, navigation, identification communication, anti-missile, elec- tronic surveillance, and electronic countermeasures equipment. I Combat Systems Department keeps on-line the computers which process and display the vol- umes of information necessary to fight with and run a modem war fi- ship. These computers are primar- ily dedicated to gun-fire, tactical, t I 0 .- 'O gutg xxx Vw '11 P 6 mph!! QQ l i JE --I r ' 2 K. 'x x L' ' ' ' L 9 4 f f S Q ' Y' , 5.0 o f ' ft! ' EW communication, and supply. LCDR CLB. SCHOENFELD Cincinnati, OH COMBAT SYSTEMS OFFICER --ii'2f'.. H1541 LT P.W. ACKER Dallas, TX WEAPONS OFFICER CWO4 CLF. RINGROSE Baltimore, MD ELECTRONICS MATERIAL OFFICER comm SYSTEMS 179 CA DIV ENS A. OLIVAS S El Paso, TX CA Div o A The Aviation Ordnanceman's Creed: Upon my honor I swear that I shall hold in sacred trust the rights and privileges conferred upon me as a qualified Avi- ation Ordnanceman. Knowing full well that the safety and lives of others are dependent upon my skill and judg- ment. I shall never knowingly subject others to risk which I would not be will- ing to assume for myself or for those , dear to me . , . Combat Arms Division r is comprised of two work centers with 24 personnel assigned, responsible for the safe handling, storage, build-up, . requisition, issue and accounting of aviation ordnance, Marine landing S force ammunition, shipfill ammunition and mission load allowance. In addi- tion, CA maintains ammunition cargo hold maga- zines, fire protection sprinkler systems, and var- ious items of armament weapons support equip- ment. CA provides rockets, missiles, bombs, flares and gun ammunition for helicopter squadrons: 155mm mortars, grenades, ground fired missiles and small arms ammunition for Marine ground units and demolition explosives for the embarked Explosive Ordnance Disposal Team. To provide such an array of ordnance requirements, Aviation Ordnancemen are meticulously trained in ord- nance handling safety, flight deck ordnance safety, magazine sprinkler operation and repair, cargo weapons elevator operation, and electricfdiesel forklift operation. 14- 180 COMBAT SYSTEMS I AVIATION ORDNANCEMEN Top Row: AO2 Hart, AO1 Naugle, AOC Bass, AOZ5 Battle, AOAN Dunlap, A02 Denney, AO2 Vaughn, AO5 Fields, AO1 Wilcox, ENS Olivas 2nd Row: A01 Jackson, AOAN Schafer, AO1 Knoll lst Row: AO5 Moore, AOC Darbe, A03 Bienfnann, AOAR Silveus AOAN Diaz, AN Coleman, AO5 Pittman Front: AOAN Hinojosa, AOCS Rauer -.. . I , f' nf - ' 1 . A .zz ' I I I ' K , WMI.-I. K K A I BOTTOM LEFT: C If I S -any I 5 Q Steel Beach' fl!! g skeety shooting M llllljjli,-Q- In. QM-, .V . C . . I SUDervised by g ..... -. y A Q AO1 WILCOX P D I k C Photo by LT r 4 R0 T 0 y gi MARTIN. 1222 1 . , A , , G, I I Cartoon by DSI5 MONT- VILLE AOCS RAUER looks for a bargain at the Gold Souk, Dubai, U.A.E. Photo by AOC DARBE ENS OLIVAS takes his turn cooking at one of the Steel Beach picnics. Photo by DSC WILLIAMS AOCS M.R. RAUER Inot picturedl Chicago, IL CA DIV LCPO ..,--.- - -,,,-,,u,':,,w-.Hsu-ef.vie-Nw '- A --- ' ' AOC D.E. BASS lr Highlands, A01 B.C.-JACKSON A01 F.A. CIEIST A01 J.E. NAUGLE A01 J.D. WILCOX CA JBCKSOFIVIIIC, FL Los Angeles, CA Sterling, CO Tucson, AZ AO1 P.K. REEDY Albany, NY A05 FIELDS watches over the inspection of MIS-76 practice bombs for the AV-8B Harriers. ?QVQ11KZ?!4fZ2Z WS' Lounging by the pool at Chi- cago Beach Village, Dubai UAE are ETI5 LEE, AOAN HINOJOSA, A03 PITTMAN, and A03 FIELDS. A02 KW, HART A02 L. VAUGHN A05 P.A. BATTLE Albuquerque, NM Flint, M' N0 f0'k' VA .... ......... .....4..- .- . ...- AOCS RAUER's safety lecture on AIM-9 SIDEWINDERS. Photo by ENS OLIVAS COMBAT SYSTEMS 181 AOAA SCHAFER, A0AA SILVEUS and A02 - DENNEY with 4 Sidewinder missiles. Photo A LCPL A BOERIGHTER AoAH J.A. BIERMAHN by D55 A05 me FIELDS A05 A.R. Moons A05 T.A. PITTMAH - M .Hand Ml BUENVIAJE Greenville, M5 Colquitt, OA Columbia, SC Palmer, TX HI I E . l l AOC DARBE finally finds the light road in Dubai UAE. Photo by AOC DARBE. Flight Deck ordnance safety observers: AOC BASS and ENS OLIVAS. Photo by ENS OLIVAS. Mun, AOAN T.1.. DUNLAP AN Nl-li COLEMAN Cglumbial SC AShVlll6, NC AOAN O. HINOJOSA AOAA JJ-, BERRYMAH Houston, TX Austin, TX 182 COMBAT SYSTEMS they Ch'eQ IookS Ike 1-he N'1'DS compf-'I' 'Q Off'-4 3 ' -' I ttf rcftiir .IC fb Cartoon by DSI5 MOPITVILLE Combat Systems Department's Data Systems Division KCDJ has eighteen Data Systems Technicians CDSJ who maintain and re- pair five of Peleliu's Tactical and Information Processing Sys- tems. Work Center CSD1 is tasked with supporting the Tactical Data Link-11 System as well as Radar Display equipment throughout the Combat information Center, Helicopter Direction Center, and Tactical Arms Coordination Center. Their system comprises of digital modems, multiplexers, and radar display equipment. CSD2 maintains three mainframe computers central to the Tactical Amphibious Warfare and Radio Communications Data Processing Systems. They also support interface with Pele- liu's Fire Controlmen in the Mark-86 Gun System. CSD2 main- tains digital multiplexers, magnetic tape units and high density disk storage units. CSD5 is responsible for the SNAP-1 System which processes all of Peleliu's supply information. They pro- vide maintenance support for embarked staff units with the sat- ellite based Naval Tactical Command System Afloat CNTCS-AJ which comprises high speed processors, large screen high reso- lution color displays and digital video multiplexers, They also maintain the Naval Intelligence Processing System KNIPSD which is used for tactical planning and mission related information processing. All these systems help ensure Peleliu's Combat Mis- sion is fully supported in any theater of operations. DS1 FRANCO demonstrates trouble-shooting techniques. DS5 MONTVILLE with a ba- nana beer salute. Photo by DSI5 BUENVIAJE. tim n fa.. DSC J.O. WILLIAMS Florence, AL CD DIV O 'V ps1 F.M. Fmnco ps2 L.1. Drzcmn ps2 s.M. or-:mms ps2 RA. LAIRD ps2 .1.t. sovigiln vanejo, CA ' Flint, Ml Lebanon, Fi. Bun'alo,,HY I-OS Angeles' DS Y O - COMBAT SYSTEMS 185 A 1 DS3 EJ. Monrvltts DS5 E. BUENVIAJE D55 D.W. Covmoron DS5'S.H. rloorvmo 13:3 gezlggsjnfillxd Boston, MA New Orleans, LA Brooklyn, NY Wahlawaf H' ' i. Mo . K DS5 C.R. HIMS ' Seattle, WA , X 7 5, K W S W DSI5 PAUGH takes a break from the heat in a desert tent in Dubai Elk Garden, WV UAE, DSI5 R.H. PAUGH DSC DOYLE and DSC WILLIAMS review evalS. CD Boys Night Out in Abu Dhabi UAE. DS2 NIMS, DS3 D SKI, DS5 WEBER, DS5 WEBB, and Elsie, 184 COMBAT SYSTEMS Nyvy Below- Banana beers? Quite 3 Party at Mad Dog's in Hong Kong. DS5 WEBB, DSS HOOKANO, DS5 MITCHELL, DS2 LAIRD, Dszi BUENVIAJDQ DS5 T.A. SLAWNIKOWSKI Sauk Village, IL a,,' DS5 J. WEBB Marietta, GA I I I I D9 YOU See A Pfweyn' Hlsief Chief ? I 1 ' Lg I' I . f xx , --: LSLI3 l U A bl .:. Ol 1 LL 1' 9-fr, A xv-'I I N123 'ii I 1 , I s ' ' 1 ETCM Lb. PFAU Long Beach, CA - Y- N j CE Div o CE Division is one of six divisions belonging to USS Pele- Iiu's Combat Systems Department. CE Division is respon- sible to the Electronic Material Officer CEMOI for mainten- ance of the ship's electronics systems, including Radar, Communications, Navigation Aids, Torpedo Counter Measures, and Electronic Test Equipment. The Division's normal complement is twenty-three men and it is divided into three work centers with the following responsibilities: Radar Repair Work Center, CSE1, maintains Surface and Air Search Radars, Identification Friend or Foe KIFFI, Tac- tical Air Navigation QTACANJ, Satellite Navigation QSAT- NAVD, Omega Navigation, Fathometer Cdepthfinderl and the Torpedo Counter-measures System CNIXIEI. Communications Repair Work Center, CSE2, maintains the LHA Exterior Communications Suite. This is an exten- sive system unique to the LHA, which includes LF, HF, VHF, and UHF radio transmitters and receivers. Also in- cluded are: Satellite Weather Receivers, Satellite Commu- nications 4SAT-COMMJ, Single Audio System CSASJ, com- puter controlled switching systems, various voice and teletype converters, cryptographic equipment, and all as- sociated auxiliary devices. The Electronic Calibration Laboratory, CSE5, repairs, calibrates, and coordinates the issue of all of the ship's General Purpose Electronic Test Equipment KGPETEJ. They arrange for replacement and upgrade of GPETE that IS obsolete or beyond economical repair. The Cal Lab uses the MECCA calibration suite. Cartoon by D55 Mom- g VILLE Top Left- Signal Gen- erator gets calibrated by ET2 BERRY. ET2 GRITTON makes the connection for ET5 MITCHELL's MARS phone call. CE f , 1 DI , ET2 S.W. BERRY Warren, Ml ET2 IVLE. GOLDADE Muskegan, .QQ M ET1 J.G. PHILLIPS Gales Ferry, CT ET2 PLE. BONNETTE Youngstown, NY ET2 B.W. GRITTON Madison, WI COMBAT SYSTEMS 185 ll!!-L. ET2 J.A. HUMBERGER Bozeman, MT l Relaxing at Steel Beach Picnic are ET2 GOLDADE, ETZ5 MITCHELL, and ET5 CHARD. ET5 CIEIERSBACH tak- ing it easy on the Cat Walk. ET5 SWINFORD and ET5 CLARK are hard at work on the HF 8: UHF antenna ET2 M.D. SMITH Oak Harbor WA ET2 R.J. STURM South Euclid, OH ' , , couplers. 3 my v Identification Friend or Foe gear gets repaired by ETS DAVIS. l I 3 l l I F Il ll ll' X l ET5 c.s. CHARD ET5 A.D. CLARK ET5 R.L. DAVIS mg, RIA, QEIERSBACH ET3 D.L. JOHNSON Grants Pass, OR Dearbom, Ml Brea, CA San Francis CA C 186 COMBAT SYSTEMS co, hicago, lL ET2 HUMBERGER and ET2 STURM jogging on the flight deck. E ET5 S.T. LEE Warren, Ml Photo ' ' lisa. I U f ET5 A.w. Lonocon ET5 R.T. MITCHELL ET5 D.w. SILTMAN ET5 T. SMITH Stockton, CA Halfway, MO San Bemardino, CA Miami, FL !f 'X 44. X-..,.,.f Maw A-nv la M , ET5 R.L. SWINFORD San Bemardino, CA ET ET5 SIMPSON, ET5 WILKENS and ET5 CHARD with the TA- CAN antenna coupler. ET5 LEE and ET5 JOHNSON work with the SMQ-6 weather equipment. ETSN J.W. VICKERMAN Benton City, WA va.: SQETQY Photo by DS5 BUENVIAJE ET5 S A GARLOUGH Kailua Hi ETZ5 LEE with the Fist in Palm memonal in I-long Kong COMBAT SYSTEMS 187 ' HTL . , 4 A XEVSD,-ms? S YY' . X.. ,, f? if , ,' , L L55 .. 4 1 Q Q 5 V A 4' l 0 - I ,,, yon., il fm, fy W .... -L J .e:t.-W ---,' -S Z V, .V . 3 5 L 1 u 1 ,A 4 P, A -L , 3 ff W, XV, E 'if' I X Q. 5 V W7 . f J x 0 wins' ' ' ' Y 4 'ff 4 'S 9 S' 1 XX ' ' II ' ' . .A ..,., FC'S Sf MK- 86 keep 5 f 54 guns LT C1.J. FLORENCE firing on Bridgeport, CT target. CF DIV O CF DI FCC W.G. THOMAS Cookeville, TN CF DIV LCPO 4 FC1 R.T. ARMSTRONG Verltllfa, CA FC1 M.J. CHANEY Channahon, lL FC2 K.E. KOENIG FC5 K.A. DAHKERT Tucson, AZ Oceanside, CA 188 COMBAT SYSTEMS CIWS Upload Team: Top Row- FC5 LEDERER, FC5 DANKERT, FC5 RICHEY, Bottom Row- FC1 ARMSTRONG CSOfAQJ, FC5 RABEL FC5 TESS MK-15 PHALANX CIWS says, lf it flies, it dies! l 'fu VI FC5 E.A. DAVENPORT Edmond, OK I V FC5 P.F. LEDERER Temple City, CA Honolulu Liberty: Top Row- FCZ5 TESS, FC5 DAN- KERT, FCSA LUJAN. y BOiltOl'Yl Row- FC1 ARM- l STRONG, AOAN DIAZ, FCS l HOLTZ. A -' FCC THOMAS takes a break from a long day of exploring Dubai UAE. FC 0 I' XI -1-3 I gX , 7 jg 'lrffl V A . VV rcs J.P. Mccnssmcv Denver, CO in lu.. 4-05 i ' vi' o g G1 D i LQ A 0 C3 gif v I, A il wh Cartoon by DS5 MONTVILLE CF Division is manned by Fire Controlmen, who maintain and operate a variety of highly complex weapons systems. These systems include air search radars and gun fire con- trol systems Although each of these systems IS unique, all have basic elements in common All gun fire control sys tems combine radars which can detect and track targets of opportunity Then through the use of sophlstlcated comput ers this radar information is used to calculate finng solu tions for the weapons delivery system PELELlU's Fire Con trolmen are responsible for three major systems The first is the APUSPS 52C Long Range 5D alr search radar This radar IS highly effective against enemy counter measures and IS equipped with a 5D capability which means lt can glve altitude information as well as beanng and range data The MK 86 Gun Fire Control System combines a surface radar the APUSPQ 9A and an alr tracking radar the ANfSPC1 60 with two MK 152 computers to provide detection tracking In addition PELELIU IS armed with two PHALANX Close ln Weapons Systems which fire 20mm high denslty penetrat ing projectlles at incoming anti ship missiles if FC5 M J SCHAFF Colstnp MT 7 f FCC5 D.M. RICHEY Corona, CA FC5 E K TESS Ml a kee WI COMBAT SYSTEMS 189 Q . . I , 1,415 A' g A . ' ' . r 4 1 Z and fire control orders to the ship's two 5 154 gun mountsf CG Division is manned by one oflicer and nine gunner's mates CGMGD. Their mission includes the operation and maintenance of the 5 j54 gun mounts, 40mm saluting batteries, 20mm machine guns, various small anns, ammunition magazines, and associated magazine sprin- kler systems. Gunnery division also provides training for the 5 f54 and 20mm gun crews. They conduct all small arms qualification shoots for Ship's Self-Defense Force personnel and security watchstanders. Gunner's Mates issue weapons and equipment during security evolutions which require armed personnel. In addition, this divi- sion is crucial during underway replenishments, when they man all line-throwing rifles. .., and HOU A Y Off me me has Q WCK P Qs Qt Qs Cartoon by DS5 MONTVILLE V 1 X ' X f ik I 1 1 I7 f I I uma Aung: M 1 '- a 7 ' bs hr V x 'EIA ii l ' l gxlnvnua -' I illflllk ga sums v sushi: W A 1 wan wel ll X ' f-Quai: l IL ENS R. GUITY Bronx, NY CG DIV O N C Casper. WY Athens, TN Gunner's Mates train crewmembers on the M60 machine gun. ' GMG5 B.A. JAPINOSKI QMGSN R M, 190 COMBAT SYSTEMS Cm, Spmgsi FL LA GMC C.S. BUTLER Vaughn,yMS A CG DIV LCPO A GMG1 V.E. NYLIN O'Fall0rl,, MO f GMG1 D.G. PALMER GMG2 J.A. NORMAN GMG5 J.R. WILLIAMS A Omaha, NE L CHAMPAGNE GMGSN P.G. KAUFMANN Glen Rock, WY l l 4 N W WX' , 1 I 2 B 1 I GMG2 NORMAN is ready for 5 f54 gun op- eration. EWC BUCKLEY and EW5 HUGHES man AN! SLQ-.'52fVD.'5 during GQ. LT ACKER, GMC BUTLER, and GMG5 CHAM- PAGNE qualify the crew on .45 cal pistols. EW1 TURNER loading a sRBoe canister into the launcher. o GMG1 PALMER fires a shot line during UNREP. gglwifu as W '-15 AOCS RAUER gets sllmed bythe Kill er Tomato Ewsm ALBE at the Gold Souk Dubai UAE COMBAT SYSTEMS 191 EW1 R.E. BUCKLEY Pensacola, FL Cl DIV LCPO EW5 FLETCHER Clown- loads a SRBOC canister. LT. D.T. BARNES Lakeland, CIA Cl DIV O 1 Q Q K! CI Division is comprised 5 of the ship's Electronic Warfare ftechnicians, Their mission i is the operations and mainten- ance of PELELIUa's early warning elec- tronic surveillance R and T electronic counteremeasures f system R TKAENXSLQT 52iVJ5j.i This system provides the eyes and ears Of the electromagnetic r E spectrum while the ship is underway, EW's monitor the electromagnetic en+ vironmentyfor hostile target emissions and provide an electronic defensegCH- pability against all incoming f targets, PELELIU also serves as theeleCtronic warfare posture ship for all thevessels in the Amphibious Readiness Group in the conduct of both offensive'andXde4 afensive electronic warfare. rCoordinat4 ing the shipboard intelligence and de- ception techniques are also partoff CI: ' Division's charter. it , t , EW5 YANIK, EW5 HUGHES, EWC BUCKLEY, EWSN ALBE, EW1 TURNER. I SAiD. L HEL? 'NMN0 it T l, v Q ,I J R ' vu- M V , , 1 ' 5. 1' 'i'-' , S , W ll' U , S. 1 XV, L 3 EW S 192 COMBAT SYSTEMS EW1 TURNER and EWC BUCKLEY enjoy a good meal in Singapore. X 4 5 EW1 M.A. TURNER EV St. Louis, MO Jn ff M. f K 2 X , f X , Wywfffggf f , 7 411' 1 f , , f fi 4. iv f f ani y f H, up I Q fziafffw fi X A ra A Ny! . li W i W . Z , no wr f ff 7 11.7. ' X ' Wang! f of 'mfg Xf 4, X , , if W L 1, X ff X, Jvc , X ,X ' X K, ff 'WIZRZQ7 Qi ' ff iw as , Ji Q 7 ,X 1 gr 4 EWZ5 S.P. FLETCHER EW5 D.R' HUGHES Garden Grove, CA Fountain Valley, CA ,,..4-..- .. -.. .Y .-.14-'-1aq,.,.v N--V- .-A '-H ' '--- ' The PELELIU Safety Department is a small but es- Xb Q Qgfslh-S,glCmW 55,2325 sential part of the PELELIU Team. The Safety De- g 'ttma , C511 i om-IF ea Go' I ' :If ui :.- if fl' 'ffsfrfifffffff' ' y -. 4-I ,. , -, I , than 'TE-ft7'g::':'?'9?-:,-1.1-eff 71 ' ..x::gvFlL:'4,l!.. Zi I 21.3 , :nm-EE , If .. . if , M, 'JRE-c- --'C-W 11 f1+f-f::5 ::. JCM -..fl:t:4..g'. ... --..t?f'F 'jL-3 Leu: ' g'1gj .::::5ff:::::::5f1:::5::::E5EiE2::::gg,,:....,,m:r., I ,.:::::::--.:.:'::' ::::'--1 .::.::::::5if2f::::51':::::5F2::::::5:3ff!i:55f'1522f5:f:7122 - 'H 1 -'22rr'::::?'1:::?::5 szziflff- 5 -1 .- - .eslsrsg-:.f,!gggg::n :messes ' . 1 :,'..1..!'::::- --.. :gg :::::-.. M- f:::!:::?5F22f::fFf1:?x:r5:f27:::::5:1525555E522::iEE7f525 - . ,,,:,...l .... :g --.. ,... ..,.... ::l::g..:gg5,,,.::::::g,-.::::gg:--,:::.::-.::::::'--fffrrv'-flflr'Wi- . -... -... 22: ...': ll' ' H A ' if . f5!I5a'f!fi!!Hffisi:!: zu Yif... ----.fsfisfnssfsssss:ssssssfzssss at . , LCDR ROSADO, N. Fort Dix, NJ SAFETY OFFICER ::..u..l:n......:y-.....::'--H partment is responsible for implementing a com- prehensive safety program based on objectives es- tablished by the Naval Safety Center, Naval Instructions, and as directed by the Commanding Officer. In canying out this Safety Program, the ship's Safe- ty Department must promote maximum coopera- tion in Safety Matters at all levels, ensure a wide distribution of safety infonnation, monitor the sub- mission of required safety reports, and maintain appropriate safety records and statistics. In implementing safety programs involving Gener- al Safety, Aviation Safety, Motor Vehicle Safety, Environmental Protection, and Personal Safety as prescribed by the Navy Occupational Safety and Health Program, the Safety Department must in- still all crewmembers with an attitude of Safety Awareness on a daily basis. Common sense and Safety Awareness lies with the individual, promot- ing and improving that attitude is the task of the Ship's Safety Department. ABH1 JENKINS, R.D. Texas City, TX f On board PELELIU, safety is always the main objective when it comes to doing an important task. As shown here, DECK and AIR Departments are taking safety seriously. Safety is an all hands evolution. SAFETY 195 Denver Q0 , I l LT C.C. CREASON COMMO- Offgomg cwo5J M.R. STRAmso T . Scranton, PA TRADTO OFFICER COIVIIVIUNICATICNS DEP RT ME T 194 COMMUNICATIONS CR DI ffiwmi I I I 2 RMC K.L. BAKER RMC J.A. BJORGO Littleton, CO Undenvood, MN MPS LCPO TECH CONTROLLER RM1 D.G. MCDANNALD San Diego, CA K RM2 R. SANTIAGO Miami, FL 9 YT! , rv 7-3'-is A RM1 C.L. MONTGOMERY Long Beach, CA 5359 if u RM2 M.A. SMELTZER Portage, IN ' if RM1 S.F. NORTHRUP Scottsdale, AZ mu RM5 D.S. CLAY Houma, LA RMSA BELL distributes incoming and outgoing message traffic into departmental boxes. Y -Z? A, , RM2 T.A. HARRISON HOUSLOH, TX RM5 CLA. CRONIX Mesa, AZ RM2 M.A. RUBE Clovis, CA RM5 A. HARRISON Sylacauga, AL COMMUNICATIONS 195 J -' .37 wi , 5 Q, f WN f iff 55? , fn ' A1,Li,g v,e, , Yr Q. ,f ' 177, 6' N, 1 LQ? A K W , f gif' ms? L-ns, X ft , X 'iwfxfy V Wiifgiw, X ,aj Y f nw , ,Wm-ff ,gif L 1-W :xi Af V an W- f, .-41 ., H , fr' ' fu f vp ! , .' 14 wg? , 7 ,L , , ,ff-fm-'f'Vf'w'W f Z1 f W ic., 1, 'ff X ! 25 3,3 . 5 ,J ,M J f 3 Zmi f X ? Q W X, f ,U I X, Y f L I y Wx I Vlrlrh IW, X ., X. S ' 2 7 i ,, RM2 SANTIAGO and RM5 SCOLARO establish radio com- munications with the ARG. RMZ5 CRONK assists a fellow Marine in obtaining knowledge on communication subsystems. Y Sm CLHICAGS 'L4v,DErRolr 7 G Nl U L will Q, l RM5 D.L. LUND FLASH message trallic for the CO. XL' f I M V Q 1 CQ, n in ,fl I P Seattle, WA Wann., RM5 R.C1. REX RM5 K.J. SCOLARO RM5 T.D. SMITH RM5 JL. WAL-I-ERS RM5 M J WILLIAMS China Lake, CA Tampa, FL Detroit, MI 196 COMMUNICATIONS Bailey, M5 Baltimore, MD Phonetic Letter Equivalent Spoken ALFA AL fah BRAVO BRAH voh CHARLIE CHAR lee DELTA DELL ta ECHO ECK oh FOXTROT FOKS trot GOLF GOLF HOTEL hoh TELL INDIA IN dee ah JULIETT IEW lee ett KILO KEY loh LIMA LEE mah MIKE MIKE NOVEMBER no VEM ber OSCAR OSS cah PAPA pah PAH QUEBEC kay BECK ROMEO ROW me oh SIERRA see AIR rah TANGO TANG go UNIFORM YOU nee fonn VICTOR VIK tah WHISKEY WISSkey XRAY ECKS ray YANKEE YANG key ZULU ZOO loo GENERAL PROCEDURES RMSH J L GILL Falls Church VA CWO5 STRANKO talks about radioman advancement require- ments with RMSN SEDLACEK. RM5 SCOLARO RMSN HARTWIG and RMSH JENEWEIN enjoy a sunny steel beach plcmc RMSN T M HARTWIG RMSH T M JENEWEIN RMSN O KIHSEY Chicago IL Kenosha Wl Baxley GA RMSN W L CUTCHER Detroit Ml RMSPI BG LORFIHG Shawnee KS COMMUNICATIONS 197 RMSN P. PHILLIPS Houston, TX RMSPI R.D. SMITH 'lwhxl-1 RMSN CLP. ROBERTT T arzana, CA RMSA C.L. BELL .gu- RMSH Rn. SEDLACEK Libeny NE RMSA READY KILOWATT Whitney, TX Dallas, TX Three Mile Isl., PA 198 COMMUNICATIONS RADIOMEN gag 6' D0 IT lluugmg K, GLQBALLY fig' ., if 5 'I I II -. , .hzM,,I,,W We! X TSW is Li- I I I I gym ete e At 5: WIN I tr na-.,,,-' ,Q O Q 1 ff-J - ' 'Q 1 A , BM , x .. . - ,,, F 4' Qt N 5 u-fs' Y, 'V Q A 'Qi s 'Ls-qp1 :: K ,MWHNQ M..,,4,,NvN5 Q RMSA T.C. BURBRIDGE RMSA C. DOBBINS Santee, CA Atlantic City, HJ . nt.. RMSA B.R. EDWARDS Port Deposit, MD efijf W RMSA Bn. MANUEL RMSA D-M. WARD Blackwater, AZ Kcafncyf NE COMMUNICATIONS 199 Q cm DI fi N it A ' W x 'I M - 51625329525 L J- cs Div ofcms o I I ' 'ni I me ia- A I SMC M. YOHNKE Long Beach, CA I CS DIV LCPO I SMSA MCLAUGHLIN communicates with a nearby ship us- ing the Signaling Search Light. 200 COMMUNICATIONS 'X gr!! SMI D. SHIELDS SM2 L.D. BALLEW Brooklyn, NY Richmond, KY SM2 A.L. CLEVELAND SM2 C.D. PIHDELL Simi Valley' CA Potomac MD SMSA M.T. MCLAUGHLIN St. Louis, MO SMSA M.A. TOPASHA Yona, Guam COMMUNICATIONS 201 I W AHEY. WAS THAT I 'RWINGI ' Dozen wmgg . I l 9 ob 5 I use-IH!! ' N cm - 5- 3 I HAIMER - I . I f - -' ' Q 'K I -- V V, I A A I vfmes A , - ivy'-1 , 15 ' MM W ffl f fwff MW? I rl I I ' Q ff Wm ' o I QU! K UQLL I M o ns f g A A Q Z X t ,, Q 6 I U' g . V gg X 3 Q 1 , IA I I PA, A - ' , I 1 i P 5? , 5? f AIMD DEPARTMENT F CALL: I ADMINISTRATIVE AVIQNICS AIRFRA1VIESfPGWER PLANTS SUPPGRT EQUIPMENT If V: I ,. V4 Il? . III 'I 202 AIMD 1 XZ, -. .,,,Y., ,X '- The Aircraft lntemredrate Maintenance Department QAIMDD rs compnsed of four divisions which rnclude 17 different work centers There are 68 Navy personnel dunng deploymentl from MCAS Tustin Camp Pendle- ton and Yuma AZ This department rs responsible for marntarnrng the ship s ovrm helicopter QBIQ League 025 as well as providing search and rescue assistance for all embarked Marine CH-46D, CH-5.'5E, AI'I-1W, and AV- 8B aircraft. AIMD owns and maintains more than 400 pieces of aircraft support equipment, aviation weapon Support equipment, all forklifts, and all flight deck fire- fighting apparatus used onboard PELELIU. AIMD has the ability to calibrate electronic equipment and mea- suring devices, repair aircraft engine and dynamic com- ponents, analyze oils for contamination, fabricate lines and hoses and test them at pressures up to 10,000 psi, manufacture, weld and X-ray various metallic compo- nents, repair aircraft and support equipment tires and wheels, repair radios, computers and other electronic and electrical devices, provide repair and rework to aircraft guns and armament release gear, maintain and repair rafts and pilot survival equipment in addition to providing all scheduling and control of all productive work throughout the department. Lastly, AIMD ovrms more than 9,000 pieces of support and test equipment valued at 545,000,000 and operates on a yearly budget of over S1,000,000. permanently assigned'to AIMD, End 78 Marines CTAD CWO4 T. HASS San Diego, CA ASST AIMO AFCM J MCDONALD cwo4 HASS works with Az: oLAss and AZ5 HoLBRook San Diego CA AIMD DEPT LCPO - -L -.--,..L.f,.......L.,,W , - D,....,...-.... , , I IM-1 Division is the branch that provides the staff and administrative functions for AIMD department. lt is comprised of Production Control Quality AssurancefAnalysis and Maintenance Administration divii sions. Production Control operates under the leadership of AFCM MCDONALD and his supervisory staff consisting of AZC WHITE and CIYSCITS BRANDENSTEIN and BERCIIN. Its functions include induction of aircraft components for repair and coordinating the maintenance efforts of seventeen work centers. Quality Assurance is managed by ADC KARAHDANG as QXA Officer and ADC MAcAoILE as QfA Chief, Y Quality Assurance programs include the management of ADC 13.5, KARANDANC, , '-jlgjlijijjggj-g Data Trend Analysis and the Technical Library. lt provides oxnard, CA A -- technical support, conducts work center audits and IM-1 DIV o makes recommendations to improve safety and qualit C Lastly, Maintenance Admin deals with logs and records, AZC M.C. WHITE Bakersfield, CA IM-1 DIV LCPO correspondence and personnel support. It provides clen- cal assistance, distribution of messages, and mainten. ance of equipment records. 'AFcM MCDDl'lALDAvvorks with A2c WHITE and AZ5 ADC KARANDANCI with ADC MAcAoILE and AE1 BURNS. ADI D.E. MACAOILE Long Beach, CA CORA' A21 J.E. WILLIAMS A51 A.Cl Raytown, La Union 204 AIIVID DUI-UENA A21 s.L. GLASS AO1 L.J. PAULLIN Am MM, BURNS Murphy's Boro, IL San Diego, CA Hickory NC lla A I ,W x X4 Lr ' 5 1-.. rw I AK2 R.P. HOATS AZ2 C.L. CALDWELL AZ5 C N CORA Flint' Ml Washington, DC Patmas, PR . L HeY,wA A Dozen swmZT5 yomsm? ' You onberzen? au -L UGHHEQ - 1 f Y , Q ,gli W 3 i' 4 Eg - K U. B-B'Q ggi ' 3 Am 0.5. comm AZ5 G. HOLBROOK M5 C B JOHNSTON 0 WINGS pg .. 5 N rk,m Atl ra,GA a' E f- as 1 ' ewa an Odessa, TX - ffwfffw if HAMYD PC.-. Y 417 AZ5 J.R. JACOBSON Ashland, WI Long Beach, CA Long Beach CA AZAN J-li BROWN LCPL B.w. WILDE .i UINAYA1. ' 'L lMf.Dff0G f 6 . 40699 O 1 ,. Q 1 ll U nn . S 'I' ,, gh ff W , U IVNMKYI U 1 V' Qi 'fn Yaeeeeeoeahol I BIG LEAGUE O2 RETURNS. i 'Q df ': F '1 5 rl ? nu L :FMA ' ' E , I 'Unk it lx 1 4 . 1 af , a l I Q .I '-47 0' Vw!! It : V ..X4,-'B' 2 'Yx U Ag' 'Q g mg. 5 f f-,1 k , H 1 .,: 11-KES' ,meh 1555314 2314257 n , IU Q 1 N X X V' W T I X ' x jg un X U' Q 'I . ' v U x , i Q.: Q . ' as f rv. Qt' M Q - . I ' ,fy F -.' , 3' - - ,L 0 . ' . H.. v ig Q 'X ' ' ' f22 .'T? . ff 1 ' 4 , an 4 L U '27 n AK2 HOATS and AZAN BROWN assist LCPL SLAYTOH from WfC 610. AIMD 205 Q W .........,,.....,,,.v.,. , TQ... ...Q --. . , - ' ' -g-ang-l'?w-fun ' ' -.,,.,,...,,-,.,sm,..f,. . x' S 5 AMH1 IVLA. TEJADA Puerto Princesa, RP IM-2 DIV LPO AMSC R,F. STREIB Lemoore, CA IM-2 DIV O IIVI-2 IM-2 Division, under the guidance ofAMSC STREIB, is Composed of the Power Plants, Airframes, Hydrau- lics Paraloft and Aircrew work centers. When called upon, this division delivers the following services: jet engine build-up, inspection, and repair of rotor blades, aircraft battle damage, aircraft tires, hydrau- lic Components, and aircrew sunnval equipment. Ilii- 2 is also responsible for the maintenance and reD-Hlf of the ship's UH-1 organic helicopter, BIG LEAGIIIE 02. Their motto is PDO IT RIGHT THE FIRST TIME . AMS1 E.R. REYES Not Pictured me W .., 7,0 X949 0 -W.. 0 fy W2 we Z f S9 M 5-04. ,K 7-W.-W 45' M f,.!,'W,-X ff . ,QW 5 7 ' X WXQW ix .. 'X Z .-fi T- ,NNW- p f-+4 Wg- ,..-agp :gf 1,-ff.. Z fm-Z.-V 0 mn wc-ff, 1,-W,-' Q . ?,-'W-W-wsff Q., .. .- If f,.- r. W. WW? W- W-My, Q -WW ., A ,iff J Z 5 K.. . f-r,..-W,f,- 1- f..-7 r, A A--Q.-W., 4 W Q-WWI ,-M.-W., -J.-Q., I., f-pw.-W,.W,, gp, W, f aw - Z M .. , 1- 0 - . S7 45 mm. W W gm -Z ,W nz -W .W -W ,f7g7y,- 4 - - , .O f -sw -f, .-7 .fy 0, W-f,..-1, 6 4,-W-A-f 5-ff, AME1 J.s. LAMONT AMS1 G- SUTTON AMS1 K B HAMMOHDS AD1 KP- 519-SCAN 'TVILCNEIL Upper Sandusky, on Mounuake Terrace, WA . . , , d I Plymouth, IN Not Picture 206 AIMD gfgfgfg .Q--Z ww . .www fm f fe w 1 Z VI.. , ?kf4:.Q:,Z:.-WZ.-Q 4, f W -WQQQ wiv! f 5.4 W w. ,-- ,,-W,--Q--, -my f-fa.-Q--Z.-wwaw-My-f f ,Z 3, .Z iw vga --2 ,QQ 5,0 ,,4Kg..4.-ww.-W gm-,jf . Q.. W . 4 w .-4 f Q -fa.-4 ,Q af fy! K f af- is ff X -A-Q 'W- WWW, 4, 0 Y, , C7 ww-w-W-W' f Q, ff fy fx 5, ZW ZW. f w-,.-W.-f-1-+ X 50. . W.-,..-,-awwww-W ,fafyqyqy W f ff 'nf f hw.-W-f-W 'f f ,,.,,,,,,-,-,,.gaQ,- ff f Q,-W.-W..Qyw2-w?w2WyM f VKX Wiwfmw..y..-Mya.-4-Q Q-if ffvbgf yay ff 45 w al- QQ Q 42 4:91, fy-W.-4 -nga?-My Wjfygfj ii 5,5 4 4.-W.-f.-W-nw-f, f, , f f 47,1 ff-W-ww-W--Z-W V f f 66,00 , M f 4,-W gg 4 1-My-ww f af f f kk.. V kk.. W., ,W , ,..,.4.-57, ww-mp,-Q.., a-may-z.-Z w wkwyw--yy-wr-JVM? 59 W ,..- WW., , ,. ..-f..f.-f -f - - ,wifi .W awifffff , ..-4 .-, ..-,,..-nr.-f .- V, W -ww? ff Cf - f Ss' 'illin- l '? Q r 'Ma MMM AD2 M.1. GUIGAYOMA San Pedl'0, CA rim CPL HILL repairs a tire. I SGT R.J. BYRD PR2 J.R. VALDES Houston, TX Miami, FL AMS2 T. FRANKLIN PR2 J-L- WALKER Chicago Hts IL Pe EII, WA 5 I X '-2-.fx ' -.ii AME2 J.L. SANDOVAL Los Angeles, CA Nl AD2 W.C. REYES AE2 J.L. MusoRovE Pampanga' RP Albany, GA heres 'Hue problem WK 1 I 34 cu I: N 'ii HIXIRTER -'ff' A if AIMD 207 gd an 1315 ' :fl I . ali I T AD ' vm.-Nh xw...,,- N-vC.,.,,'x N AT5 J.M. DARLEY ADAM C.Q. REDD CPL BC. nowss CPL D.M. COLLINS Mt. Morris, MI Los Angeles, CA Middleboro, MA Oakridge, OR CPL T. LANE LCPL T..J. SCHARA A CPL J.A. VIRDEN LCPL M15 ZIPMS Irvine, CA Helena, MT Irvine, CA Euroa, Australia 208 AIMD A05 T. RIVIERA Taylor, Ml AD5 M. AGUSTIN San Jose, CA S i 2 AMHAN NLE. MONTRY Seattle, WA ATAN D.G. HECK Houston, TX LCPL BROWNING is eager to bring gear to the shop. 'K 'f 'h. ,Wm- ,, I f f LCPL J.J. HUGHES LCPL L.R. OLIVER LCPL B.E. MCFADDEN Truckee, CA Mansfield, MO Agency, lA LCPL W.R. DETERS LCPL J,A. ALVES LCPL D. PERRY Centerville, OH Cliffside Park, HJ San Miguel, Ml zf: 'EE:g:::-:A :I:I:fg2:1g:5:g:5:5g:,:-:1!' .,.,.gz::g:5:1:-:-:-:-.-.-.-. :-:-:-:-:-:-:-:4-. wg 2:' -f5:1:f:1-2f'f 'f f'fi '-ff1f'2E2E1ff1' 'E151S1E:i:1:3:5:5S1E1E1E2E1E1i2E giiliriilfriririgg123:-'S1i1:2i2i-l . 1' fafi' az: -'f::e2s2sI.fE.-'...-122525232?2f25fsSzfs??fiS?2?S5fffffffffi iii?''f?Sf55f12fff2fff2f21S5. 52525 1 . .-:?:f:-:-:-. '25 '7'f ' 41: .' f'7'7: Irv 22:21 1:12 5555 ,.::rErS1ErE2E1E1frEr flfz-315252523 4:1 - ,- .-.-'7'5f?f5:15' 'firiff ' ifffffiziz, 'ia'-,.1.,:55355252555EgEr55E5Eg55EE5555555555525 5 55 sfsif .2555 'I -:Az-.-:.1.1: ' 'EEF:''.-:1E5:513f535132513151555121553525E5E Ea.. 1312. 9553555131 ,I,lgsgsisiiiififiiiiififi:ff :.f.f.:. :.,.,.. ''--1Zfiiiififififisizfzfsfsiifififiiifm iisifieiei. .5155 E25 2555? ,.,, ,' 'Tj 22112 . ' , '- 2,115 J' ., 4.3.-. ,'. .g.g.5.f.:.gIg.j pg-g.g.g.g.g.j.-.g.g.'.'. - ' . -'2'.- '-Ig-I-,'.'.:.:.j.:.j-1.3.1j.j,'.-,J-,-1-jf K vcr 1 x i ,L I I U I I I ' iq , W' 1 g 1 ':s'. r I :I I I s N 'xtraxu 3 ' '21, O , '-In .4 , I Jr' I 4 D v ' ' 1 51:1 -:tc-:':-1-: ' ,,',-- - ff' 1, .5 v , 'L - it , ' I' ,, 4.5, 72 .f'.f lf 5ffffffEQ5'1 1 WZ ,-.-27532525523 5? 59 ' . '. 7:3'5:7::':f:f:f'. . 7'-: S52 .1231-.. ' 15' 5525 rl'!', iffffggfffif' L , QuE52552fifffiff?5::ffQ:352E5555i555f5f555? 555 ' 3555, J as I .. ......, . I t g K xr . f if 1 R 631 We 4 fvww-.4 N, C Nt l I I f , 1169!-Liig F: f I Q I I -., 4 Wg if lnrlrr nnl l gig' N 'ff ,,,.,.,. I ' rr r A r i r r r I I ,,,,,i,,,,,,,,, ye, fu Wmf ,WG THINK ABOUT IT1 DAVE...AIl lD CAN FIX IT. THEN UE CAN DO PNC-l OR STARBOARD DELTA - HELL llJE'LL BE PILOTS AGAIN! l :ax A r ' n V AMSAH K.M. HICHOLSON LCPL C.M. BROWNIHG Long Beach, CA Plant City, FL X X i AIIVID 209 ......,,...,................-,...,-.sQ...1 ,......t.. -.-A.-.,...--.-..,-,,- M- A- ,-A-1--Q -- ,L-,W-,..V. .,F..........,,-,fv.-.....-...,.....,.. ..,,c....,q........-..,. .........-.---.....X , . W. ., , ATC D. MASON Visalia, CA IM-Z5 DIV O IM-5 Division is the avionicsfamiament part of AIMD de: partment. They are responsible for the repair and testing of all aircraft electricfelectronic gear fblack boxesy and weapons systems. They also maintain both nicad and lead acid battery shops for aircraft and support equip. ment. Along with the ship's permanent shops are the mobile maintenance facility vans which are placed in the hangar bay during deployment. These type of vans pro. vide support for the AV-8B I-lanier detachment in addition to the four different model helicopters used onboard. T0 maintain all these facilities and equipment, IM-5 division is manned with a complement of ten ship's company sailors and thirty-three embarked marines. IM-5 can be broken dovm into six separate work centers. These are Work Center: 610 1Communicationflxlavigationb, 620 Q Electrical fBatteriesi, 640 Clilectronic counter-measures! Cryptologicsl, 670 CPrecision measuring equipmentl, 690 Clvlicro-miniature repairj, and 710 t0rdnancel. Together these work centers provide a wide variety of experience! skills necessary to keep all aircraft in a flight status. AE QT' AT1 E. WEST ' ? St. Louis, MO lik' PQEQ AE1 D. SCHERER Long Beach, CA AT1 S. WILSON San Diego, CA 210 AIIVID AIMD WfC 61O's LCPL SLAYTON works with ATAN CLARK and AT5 PRICE. I I I I I ,tm .1 ww- ,B nr wc- 4 ' W LW. AT1 E.T. MOLINA Valencia, CA SGT J.R. WARD Cogan Station, PA CPL J.L. ROBBINS Fresno, CA LCPL J.A. ONOLEY Sahurita, AZ 1z -l'S'R.f 41 AT1 R. BACOD Bulacam, RP CPL F.l'l. ARMSTRONG Beachwood, NJ LCPL l.C. ALMACEN Seattle, WA LCPL P.D. QUIRK Cato, NY AE3 C.E. PIOGEE Stockton, CA CPL B.A. EWING Louisville, KY LCPL R.A. HOMA Langhome, PA LCPL KJ. SLAYTON Silverton, OR Y ' -V ATAN S.J. PRICE Newark, Ol-l CPL D.M. LOI-l Bismarck, CA LCPL J.L. MAGNUSON Hillsboro, ND LCPL M. ANDERSON Long Beach, CA mm.. V ATAN D. CLARK Bellflower, CA CPL E.P. MACIEL Azusa, CA LCPL J.B. NULL Atlanta, TX AT ---f-Q ASC G. SMITH P0rtaIeS, NM IM-4 DIV O , IM-4 Division CSupport Equipmentl is responsible for the upkeep and repair of equipment used to maintain, move, and support aircraft. They maintain material handling equipment for movement and transfer of cargo and sup. plies. Both sailors and marine personnel work in techni- cal fields of expertise such as diesel mechanics, hydrau- lics, electrical power generation, cryogenics, corrosion control, and administration. This division trains and li- censes aviation maintenance and aircraft handling per- sonnel in the operation of support equipment, and trains and licenses personnel to operate forklifts and other ma- terial handling equipment during UNREPS, CONREPS, VERTREPS, and other ship's supply evolutions. Ground Support Equipment division personnel, in addition to pro- viding maintenance to onboard gear, are tasked with helping support other ships accompanying PELELIU on deployment under the 'Big Brother program. AS1 R.E. CORWIN Greene, lA AS1 D. ANDERSON Fallon, NV AS2 R.M. HENSHAW Morganfield, KY 212 AIIVID GSE'S AS1 ANDERSON, ASC SMITH, AS2 PHILLIPS, AS5 REYNOLDS, and AS2 DAY. A l ,M gtgv AS2 CLA. DAY AS2 F.O. MASE Ridgecrest, CA Baguio City, RP 'imma ASAH R.A. MCRAY CPL E. POMAN Lemon Grove, CA Cleveland, OH AS2 T.J. ROBB Lincoln, NE 'lf nrt. V f , ASAA M.T. UTRERA Kailua Kona, HI AS2 R.R. PHILLIPS Perryville, MO 'I M gf ASAA A.M. CASTAPIEDA Vacaville, CA ASIS W.F. REYNOLDS San Jose, CA ASAA E.Y. DELEON Paranaque, RP Z! v GSE personnel perform maintenance on an aircraft tractor tow. AIIVID 215 Tehran -15: 1NlN, PIAN SEA 'Ni Tx.--X. .X- ,-N-,z ? I R A N 25 ..V.-X' fy .0 .I The Persian Gulf is a kidney-shaped body of water in southwestern Asia between Iran and the Arabian Peninsula. Arabs call it the Arabi- an Gulf. The Strait of Hormuz links the gulf to the Gulf of Oman, an ami of the Indian Ocean. The Persian Gulf is about 500 miles long and averages 125 miles in width. lt covers about 100,000 square miles and is about 500 feet at the deepest point. The gulf is bordered by Iran, Kuwait, Saudi Arabia, Bahrain, Qatar, the United Arab Emir- 6Q 0 Q ates, and Oman. The gulf region has more Q5 than half the world's proven reserves of petro- 9 1 leum and natural gas. Oil and gas from the QP 'vp . region power much of the world's industry up 7427 and eam the gulf states billions of dollars f 4, each year. . '7 -' flfkxvypg In ancient times, most tovms along the Per- h .,,,g,r+ C sian Gulf were self-govemlng city-states that ' -if UL F I thrived as ports and trading centers. During L Sv to C the 1800's Great Britain gained influence over 5 -- DW ,Sf CQ, much of the region. Some of the gulf states xy Abummd, 575' OF OMAN galned independence during the early 1900's, - ,Q but Britain kept control over the defense and UNITED Agp! 15. Mm' 1 Tgslgn affairs of the rest of the states. By 1, all of the gulf states were independent. Z fi-QQ'-'U 1 T J QCJH-',3'l-'04:jK flfffu 1 if 111 7 it A 'gf f- E S Q O - 14 '1 9 A ' -.:T5f T H E A R A B 214 ,PERSIAN GULF SEAM' MIDDLE EAS T Y' L V.-wr XG 2 Q5 MO VAR 1 7 3 XX X xx x X xNxX79 - , OX fm: A XXXQXXXX 1 V 59 Ky? 'o 1 x79 SIR BAN1 Z f 115 X Zaqiq lf.- M5106 6 '-- Sh In POIT: Lat: 24- :tiff 10 9 9 JIS' X 06 109 sta tes ff 103 SSI: U.AfiE. Abu X alifllaq hOl'l'lC habltants have Bm S519 J abal az Zannah mMcsfs 3.1-ff. Tanks ' Airfield 5s 7m 8M 7' 111 f 1 'L m1-1 1 Foul ! 2 ,.r . A , 5 nf , ' . DE-CCA ,48,, Z A B Y iTNITED ARAB EMIRATES11 1 rABU DHABN 1 1 RV, -Wav 1 ,1 1:4 f .,,f , . A Q ff-iff.,,,K , 1 pf 4 f fm ,ff Q X f f f f fyigggf .' 'nf ' 711, QE Q , - all fffikiim ,1 kim, x 1 2 A ww yin! W -M 'f f-' 'M . ,mffzffxf ,, 7 3 ffff-'4fg ? , V Mm, 1 A 'Iwi ' , ff fi, , ff 4 yy ' , f mf 5 , . v- ,, M iff I 1 r X 4 W., -'Ph-. wwf gals, 'ii w.ufff ' 3 n 1 r LM. , . .N ,,..- ,I F.-,l!..,L' ' .-A ,,,.,,..,. ,.,,, MA W, N U 1 1... ,. .... ,.. 5 ,..f- 2 Q u a !fu-L44 V U if I z y ABU DHABI 217 E 1 E s E 5 L 1 5, F J-uv. I xx rl I ABU DHABI 219 X - - - -' A - X--A.:-1 --f-., f X --. XIX, -:XF .X-,-,.-,-K .- X. . .- K . -.X-, K K KK, K. ,, ., .stef-y'55f1'?2' ITG'WS5Q77-53513-i2?j23ji1j?SGiYEZYETSJET g-E?E-j',,lq-XKgjKgf- Q-IK--K -Xa' K Ki- 1 KJ. K-E ., wr: yj js 1X51:K f x X 3-11 , . 1 ,K f K 'cf ,J , , Xff' , fi ' 2 f KEKKK-115..K,.KK,.K:KXKKXK,KKKKKKKKKKKKKKKKKKKKKKKK.,K,KKKtXX.K .K.KKK,KX.X UKKK KKK,KKKXKKKKK-:g,,K -,XXKKKK K ., KKXKKK K K,KK,K.K. KXKK,KKX X N , K K ,K K f, ,, KK K ,K K, K, , IK, , ,XL--IX-X XP-'fl-W- fSXa'X-'i-fbls.pw'-XY-i-zxXfwe Q--:ff TX- 1,531 ' . J-Y-fXX - ,X , 1 f ' f. f , f KKKKKXKK Lxx.x :KKK,K.K.K,KK,KKKXXKKKXKK-KKK.KKKKKX.KKKK.XKKKXKKKKK.,,KKK K,,. KKK. KK KK.KKKK.K KK , K K ,. K, .. K KK K KKX 3,,.KK,, , K, , if-.-.gg-, KXXXQ-KX.: 5-2-'Xf-Xj.,-QSQKX-,XX--K. .X-X--Q., 2Xa.:X.K-K-K K.-gX-i-XfiK.fK- KKK, 5, '- X.:K:f - f , K1 - f.,f , . --- -1-..X-X--X.--X1Xs:.XX:X'f-'X,f1:'- .f- -- wi-X-'---' - fa -.X rf--:K X H1 - 1 MX - 2' r-X' - - ,f H.: .J-vf' ' , , --if v ,f f 'x , fX-XXX2-X X 2-X --1.-..-:'.-mv-X,'fr4:'1.X-.X.,KX-.-f-X.-X.,X..f X -Kp: .XKK X .X.X V- .K . K. - - . K'KXf,K , ,K KM, K X , , ,, , , , K, ,K ,, , 5-wi :1X1:.1-X f X--X. ?X.fX-:K- X' ,Kr-----K-X:.X X-Kev -f'-1 ,XK3i..f.X-. Q-Xf' 1 -X - -Q, f - . wx , -' -, www- - ,, -,,,f,1, , , , ,. , - ' Sf QX, --K' QXK. -',X'..XK,sKX:XK .f ,5.XXK,-K.--K 5K-KK, .X X., . K .f 5 Q,--ff -, ,.K-K, ,, Kg., X, - . , K . -.K , ,KX , K ,K , ,,, M , ,f K, .,XK--X-K-X---:X-.,XXXXf -.-wi.. X.-X1-LQKK-:'K Xu- -i- -. XX KXXK,K..K: K. K. X K .K K K - ,K, XK - K. - . , K f - X ,, ,,. .- , Q. .K-KK K . ,,,,,,K ,K ,, , ,K ,. , , ,, IF- X-4.1 1-Fr-'--1'g-XXX-xzq, -f'-X fK - :K 'X vw- ::.Xi- - ' .fs H X .. V' . . - f ' -5 - f : ' X f -1 -,KK f : x,1X.-X'-X' T. Six 'X f XXXN hX -..:-:XY TKKXX- EZQKXK -K -VT, --X':'- Xf- -VN 'f X r -, M X','x fX s.,,'..,'HX 'Ku K 1 ff ' X X , .,,' 1,f',, ,- ff .G , g, 1 3 K.--:.X-EKFXK.-I -Xxx.. -cXX.i7?-'i'X-N ---.:'XK'-1 1-X-.K 113- X -X KX XX- K,-XV-.Kg - K, ,- -X 9 X rl ' V- K , - ,, ,f f., ,, , .- ff -'1'-uf:-x-T-SK--: -X, 2KY.-1Xf.X'iX-X--',,- ia--.-Wf. .gd-?-H-'--XXiXg, Iftw-,SX-nf' -' XS :KX-1, M. r X X- X Kg -, .-NM 7 . - ' 4- X f ' . ' x , K ' f , -f ff, f- 5 1, , x , , V, t'.-.KX -K Xi, - :Kg,:-f.-XX, 3K -, --K -K -3 ,.-.v,.,KKKKKX ,K, 5- ,' f ,-,Q 1 ' gf KK ,.,,Kf.3, .,g,, ,, if--X K'XK-.-2. Xf.:K-XXXK.'-:Xf--KX:-:.. 1-J. X - 'f ,- X z f- X ' ff , X- f, - f ff f 134 , .K -,., .XX x.y, , .... - ,,,, KK. KK - ,K KK . , K , KK K , K , ,K . , ,, ,, ,,, . Xi X-KK-K,KKy K f ,i -X4 ,,,K, .K jf K3 KK X K- f KX..-XKK.,KKKXK-K-XK. QjgKKXzKKg.-.XK rifjyjz K , K-KK, -K K KX yy.-,KK K, ,KK -mg , g KK , ,K K ,,, f, I, ,lf XKKEX.'5X.KKa K xg,-X,KfK5g:K,KK-K5fXK,-XK.1XXc,gj2.KK.XKKKKKQ-KK,,KKZK.K,K,f-,K-KXK-KX-.-K .X -- K-f , .XSD K ,. K - jf ,' .X ' ,f f ,,,gf1,- ,, , ' f f:-X- ,X T-' 'X-,-wx-K Kg.-,fKKKgK fK,- K,,'K QP -K X . - :K-, ,: - . K -' K . . 1, ,Il ' - -, f , all--5115 ff:-KXE X.gXKg-SK-1.-:,.K,.-. 'f..XK.: - K- . - . .- :KX K , f K, K K, . ,f 2.1-.-:-.-1 -w.'-X'-KK,-X X-.mf X- -,- .,--K.f-K QKKXK- . K . .K -. .. K- ., KK 5 ,f gX. . . K.,K , ,, .. KX. - XX. , K 1.-Kg:-K'K.gXKAX.,-Kg-1yg.f-.g--' K:--gr.-K,..KgfK -. -:K X -K-gKKX - -5- - -, f- - XK X .-K -K . :fu K X , , , , , KK f- ', . K, ,, ,K 1 .gg K Kf,K...XK .KX Xk- K KXX1.,KK X K. ,Xq K-5 ff-X .- . , X. ,-Kg. K-Kg X f .f XM: . ' -. f-- . f , ,f f , ,, f, f , , H V V - -..- -1 v-.. - - ---- ,K -.K ,X .XK .K,K K, -K , 4, X , K, , , , , -X ...K - K- -X K- X- f . V , KVK ,, . , -, ,, , ,.--KKKKXK.-KXXXKXXK ,KKK KKK . KK K , .K K -. , K .K, - ,K , , , , K, 4 , -.-:lf.X.--X-E.. X-..-X.-X5 Q' - '- .'.i:- KKK Ki , ve, ,,- - f , , f ' Fr lX. K. E.. -O-.f--. KK- K. is-r,XgKfK'f-X--X': ':. :K.gX. XK-K-. if Q.--X K , X , f , K, K f , -Xw X-- -X X'X-X X - fx-AX : Rf 1.'XXX'- x .. ' - ' , X. .f,-1 ' 'V f ' ' f .f ,. ffl? K 1'-X5 4 '- X X Kg 1 ' . f' f - K- . . -if-Xi-1 '-X fi- X'-511, . K- X ,, . K KK ..KKXKKKX K.-, XX K. K K Kgj K K,- KK -K KK K K, KK K KK . X , K - -,gl . ,if Xfl- , K .K -- X-KK - K'.K K XK :' . KK f K ,. K,KKK.KX.K KX .KK K .-K KK - K - - K - X. .-KK K 'K .1 F-K K .Q .1 .K 1. ' ,XNfx.. XK'- K. ,K 5 - .X-EKXX .-gf' . if .X x KK .K K-KK K K. K KKK. K . - , . XK . Kg. 'XXX- . -5 NO X X X N f 'ix x x ' -. .- f X N :Xp ,KX :X- X- ,. -M: 1-X .. --XX .X X.X K- -. N x K KXKKXKXKX XKK-K X K X.. . X -X :K X:-ff '- KK V X 1',.K-.K K 5 X- , 1.KXK-K .X ,.,X, K ' KKKKKK ,,..K. K KK K K K K ' - X K1-'1.1 KX. K jig - i Kx 4: A 3 'E XK1, K T3 ,XKK,.K .. X K. M XK X X K -'XX K .. K. - KK K'1y,.X,. .K .ITT b Si K K Q ' fr- X 0 - 5: - a ' -flfffi . .K -XKKKK K. .1fX5.f'KSXxK :KK , H K KKK K . K KK5iKKKs iff. K, R .iv N- -1 .fx -..J.'..' f 1 ,K K-,-X fp-iK,5 K K . K K K K K. KKKKKKJKKKK X FW.. .. K .KKK KK K XKKKK- i.K .K K, x- - K . '-Q,-g f x ,K - XX X XX- XX KX , X- KK - X- K KK X . X. X - -fX- .5 X . KK. X- . KX, K .. v-- il' .A, ., fx Q ,fn .- ga ,5 f L xl fi if 'Y' 1' Q if 2 'I Q, if I I PHOTO CONTEST 221 , 1 1 I A , . . N ' ' 1'1 I X! f XT ,.,Q , f , . 9 SZSZ, Q 42 A QZQQQCSVNZE GZ, Q5 WXVSQQQ QVSQSW ' NW Q ' 'Q R Q' , 0- , N f N : ws ga Qgvpwsgf 49 QQMSQWAN. ft 9 .gm ,Q Nfkym ,B N ,MA gd :A M9505 i ex Q 5 4 , 2 1 -1 w ww 3 XXQS f Q x W 'ANS N M Q iw V, A 5 WGASZEZF 32 Sf fx V ' iw Q my 52 if fx Sas ,se -QQ -fx S ,Q ,N M W W 'Q 'V Q 'Q Q X' - X 'Q 25 NA, V 4? QSQQQSQQ ee vfpmmag ev aw'f,wMQ gaww-5 my my Q5 V4 -0. N w K -. f Xi . ...,, A, .,..., , ,, f X Z X f 1-ff' -' 4 1 ,- of f QWWN N -.WWWQ .2 N, Vx ,, ,, f., , , . Q Q swf 25914 Sw W 'Y X www 2, -Q., 1 ' , 0 hw 4 . ,V .VXA x, v mQv .xakw Q. sfw 49 X? Q' AS Sv S' 0 1? X-asus QP S2955 Q9 SMXQXQE W, VA W 4a52X Ok 222 PHOTO CO TEST ' ' f ,i.nff .A ilk . if . J... PHOTO CONTEST 225 ....,s...g..... -.........-...,......- .. .,,.... , ..,.... ,.......,. -- -.....Y . . --,... , .... --.,., PHOTO BY LCPL HERRES 1? H O T O B Y C P L B R A D L E Y 224 PHOTO CONTEST PHOTO BY CPL SKIHNER 1-......-...-.. ...-..-.,,...,, .. ,.. . ,...,--...7..-on--...,...,-W--.... ..,,,,......-.,....,. ...-... SHIPBC RD 5 a Q . K Y 2 ? v f Q N I G H T M A R E 55 M, 2 Q ,.,, : i g, . QA G M C1 2 IX R O W I T Z 711, A Q LL N f f , Q 3 ' k Yrrv, vw .. 2--F..-.,.,...,,,,,,,-..7f.,,,,,,. ....4-...4-,.-.,,...,,,,, Y -4-.. PHOTO CONTEST 225 P H O T O B Y C P L R O B B I N S 226 PHOTO CGNTEST I I iI I I I I I I, I ,I I I 'I I I I I I I I I I I I I I I I C P L R O B B l N S PHOTO CONTEST 227 4,,,NN-M--at M W AK-I -'--H-,Nga-,,,,-,,A,,,-,,.,,-,A .,,..4.......,..-.....,..--a-e.----s-----'--'--F- A- '- H - '- 4' ---,-1.-,-..-.P.i.-2,.,..-..-..-r--4f-+-y--'.1...-.,,- .N-.,.,....-.7 1ff,vv..,...-.,-....,,S..-.,.,..,.,,.,.,,....,,,..,,..,,,,,, ANDID LT BAKER 228 mom CONTEST ....,. .....-.-,..,.....- ...,...,-.....-- ff 'f vein 1- K S5155 - ' ,s-knggwmtan ,,,.,.,....4-w-1'--ww. , vk- B,.,,,,,.,Y.,,.,-f-..,...-..,,,mr,-..-.,,..,.,,-..... -,..,,.- - ..,.......,Y--..-.........,..--.-f-..,,,.. ...i,.....4,,--...-.-...,.f,.-.... -..--v Mfr- ' 1--ff CAP'lN CRU NCH -.... , ,, . -, ,Q ,,,.., .....,.-...,...-...,.,,...-.. ., - PHOTO CONTEST 229 IN IVIEIVIQRY CDF: LT T.S. LARSON LTJG C.E. VALENTINE AMH2 M.R. BUTCH AD3 G.S. FINNERAL AT3 W.A. HOLT AN J.L. GUERRERO HELMINERON FIFTEEN DET TWO SEPTEMBER 14, 1991 250 MEMORIAL N w I r I ! , - -BJ 'Av' , H., ,.. , -,-...-- , - - W ------M -----W - . xo r th FCS upload MT 25 Phalanx clws for firmg. Scopes Ou 6 traffic ahead , 171-W -ffffw Y- ' ' --i 1 l A R 1 I 1 I , 1 I a aa a aaa aaa aaa a a 11 a aa a M M 252 ASSORTMENT x 1 3 I 1 ' o I o EWI5 FLETCHER loads a chaff canister in the SRBOC QM5 MILIAN takes a celestial observation. laumihef- L,-5 .. :1-...,.........,... ...,...-.-.-..., ....-,,..... 4. I Ii II I I I II I I I I I I I I , I I I If 5. ,H I II 5 II II ,N I .f I .. :I , I , I , I 'I If ,Ii I II, I I I ,I. V, 'II II I I I II . :II 1 . LI II 'L Ii ,I II' IE I,, I.-I Il- I I I I I ! , I I I I I I I 2:1 II If Il ' I,. I- I . II 1' If Ig V- , V II - 254 ADVANCEMENT I --' '-5 . - uf' M ff! - 1 .MA--I - 'i5gr'J1ii4iI' Lifj ' CAPTAIN CAPT WEISCOPF COMMANDER CDR TURPEN LIEUTENANT COMMANDER LCDR SPEEGLE LCDR CURRY LCDR ROSADO LCDR WILSON LCDR LARKIN LIEUTENANT LT BATTLE LT ROCHE LT BARNES LT KOZAKAR LT ACKER LT SONG LT FLORENCE LT SCHUELER LT ROBINSON LIEUTENANT IJuNIoR GRADEJ LTJG FANSHAW LTJG NUGENT LTJG CONEY LTJG GRIFFIN LTJG GUITY LTJG WEIDNER LTJG GOSSETT LTJG HARTWICK CHIEF WARRANT OFFICER CWO5 SANDS MASTER CHIEF PNCMISWD CAMBEL SHCMISWJ PORTO SENIOR CHIEF ABHCSISWD TAYLOR II. xg x ' -A Q 4 L Z ff 45- . -.-QI., .Isa f j ds ,W f. If I, I .L f f x f' f ' 'I I f ' 'fwfr ' I I IIL' lvl? E If lx , . j Y .. C? -S E ff, CHIEF ' I ISMCISWJ GOMEZ . I..- 4' I 5 .7 BTCISWJ MAINIINIIMO A jj I T I S' FIRST CLASS I , . A IC1 SMITH EM1 DAVID Em UMAU 1 DP1 RALL Ji, .-. BM1 SEALS I , YN1 URICII SECOND CLASS OSS PICKUP ESWS DC2 WEEKS OSS SILVER SM2 CLEVELAND MMS TAYLOR SM2 PINDELL AS2 PHILLIPS EM2 CHAVEZ MM2 OCAMPO EM2 JABBAR RM2 HARRISON BT2 BURNETT SH2 PAMA BT2 FISCHER BM2 JONES DS2 NIMS BT2 WILLIS THIRD CLASS AD5 AGUSTIN EM5 DUNNING OS5 JACKSON MM5 KING ABF5 MARQUEZ OS5 MILLER OS5 NEWMAN ABF5 BURTON GMG5 CHAMPAGNE MM5 GRAY MM5 HEFA ABH5 NEWELL IC5 OUTEN IC5 VILAR ABH5 BATEMAN IC5 BERMAN RM5 CRONK MM5 DAUGHERTY IC5 ECKELBARGER MM5 IBARRA MM5 KAPPEL MM5 KELSTRUP AK5 DAVENPORT MS5 ENCARNACTION AZ5 JACOBSON DC5 FRUTOS ABH5 HILT RM5 KINSEY BTCSIAWfSWI OROETA EMCIAWfSWJ SCANLOII BTCIAWfSWJ MATHIS NC1IAWfSWl SMITH SH2IAWfSWJ PAMA I AC1IAWfSWJ STROUP ADCIAWXSWJ KARANDANG I BMCISWJ WRIGHT HMCISWIKING MMCISWI WOJCIKOWSKI 1 I A EN1ISWJ PIULA oS1ISwp COURTINIEY OSCSISWJ TRAY BMCISWJ COINITI ENZISWJ DALY MS1fSWJ PACADALTEN OS1ISwI SPREWELL BTZISWI HURLEY EMSISWI IRIERRA MMSISWI ROYAL BTIISWB SCHENK ,V , 5- -1:-., ,,.-4 . I 7 LVN I' Qyxf ' 'T 'fe' ' ' 1 lx as 4. ,i -. QQ 'I ' ae ' fix' 1, ' L ,Q x.jf V ' -pw:-,azfygfld R N gg 1 ff' f,.. I F W-P '---14:T'i1 ' 'Nrsdf 1 ff I 3? 4 ,,- f wgtp- sq.-.15 Mk: .A , ,Aw Q? . -Q 'ka ri, I Oi! , I 9g V , 'N x ,W 1 an In x I v ... -I--l ffiffI'g 25R-V ' THIRD EAWS cLAssqcoNT.p PH5 WHILDON Q12gfg'ffQW7 DP5 STAFFORD MR1qSwfAwy SANTOS ABF5 MAGUICIAD ABFICSWXAWI AO5 EIERMANN ANDERSON RM5 STANLEY EWIISWXAWI TURNER MA1lSWfAWI ESRRIDGE MM1qSwfAwp VILORIA EM21SWfAWJ JABBAR ATCCAWI MASON AOCCAWI JACKSON AGCIAWI RIM AZCCAWJ WHITE ABn1cAwJ JENKINS ASIQAWJ DULUENA AOSIAWJ BATTLE AZZIAWI CALDWELL ABFSQAWJ RIVERA ASSIAWI REYNOLDS AEIIAWJ BURNS ADSQAWT AOUSTIN AMn1cAwp TEJADA ADIIAWI REYES ACZCAWI SHAUGHNESSY AC2iAWJ KJOSE ACSIAWJ HORNBEAK HM5 HUGHES SK5 LONAS SH5 PEREY ABH5 TONEY SH5 WOOTEN MSSN BEYDOUN EMFN BUDOMO ASAN CASTANEDA ACAN DANIELS OSSN ENTRICAN DPSN HAM QMSN JANS ICEN MACKAY MSSN RANSOM OSSN HESS AZAN BROWN ENFN HENRY MMEN SCOTT MSSN VITUG MSSN TEMPLETON MMFN SMITH RMSN WARD RMSN DOBBINS RMSN EDWARDS EMFN SHORT FN ESHLEMAN SN SOLANO SN WASHINGTON EN DAVIS AN EMSTAD SN ROWE FN VERDUZCO AN SULLIVAN FN TOBORG SN SHAFFER AN DIONEDA SN HOLDEN AN LUZ SN RAWLS SN SMITH FN CURRY AN WELCH AN NYKIEL EN GRIMM AN HUNTER SN MANALOTO AN SIMPSON AN GILLIAM FN HUNT AN MENDES EMFN MORENO MMFN HOLCOMB SHSN FERGUSON AN JAMES RMSN GILL SA CONNER ADAA CROSKEY AA EMBILE MSSA FIELDS OSSA GRIMES AA HUGHES SA LANGLEY ENEA LOPEZ OSSA MILLER SA STROMBERG DCFA VANDENHEUVEL DCFA DENNIS FA GRAY YNSA JONES FA BUTLER FA CALLINAN ABHAA CARREON SMSA CARRINGTON AA GOEDE EA GREENE SA INCORVAIA ABHAA KOESTER SKSA NGUYEN SA NICHOLSON MSSA SANCHEZ SA STEPHENS SMSA TOPASNA AA VALENZUELA OSSA VARGAS EA WATERS DCFA YEARGIN DPSA WILLIAMS BTEA BRAZLE AA BROWN QMSA DELONG DCEA EENNER EA HILTON SMSA MAXWELL AA MEISCH EMEA POOL DPSA WOZNIAK FA SHEEEIELD AA CLARK DCFA KING AA LUNDSTROM SMSA MCLAUGHLIN DPSA MERIDITH RMSA MITCHELL DCEA SPAGNOLA X fh M 4 .Q'3 . gf T, A J . S . G T ' 1 ' 9 5 f' '27 41 A ' rv ,e QI ,A I Q lfjf, .V 'tiff' ilafwwjiwfgfi ' 'YZ pg 'R ' -I I ,fx i,f '. .rf q w ',,' Fw W3 ' ff 2 f if Wfikbdif fs' -T s G f f sfi I A -9571.0 A EEE: fi- . S ' v . ADVANCEMENT 255 f- ...H v.-,,-.,-....-.- -- -.N-....-......-... ., . .......-.,-Q--.-...-............V - . i I 1 T L 4 'I as f , ' up W , , .. . ' ,v-H-H--,..Mw.m- 256 SINGAPORE T w i - , , V v i f l A v L Yi? l E i . t ,, Left- Sailors head out into Singapore for some well deserved liberty. Below- The lion stands as the oflicial symbol of the Singaporean people. Left- Singapore boasts its many eclectic shopping centers. Below- Besides auto- mobiles, bicycles are a favorite form of transporation. l Left- Next to l-long Kong and Tokyo, Singapore is one of the most modern cities in all of Asia. SINGAPORE 257 ....-....,-....A..., W, ........i-,......c....-.. - - - - -.-.,...,-.:..,..,.....,....-,.-..,,.--....,..... 7.f.L-:-,,-,-5.,.....fvY,.c0-,............-....--.,w,.....--vi.. - A- - ! l Q l f 'X . , f V1 Ay , fthe 4 l .clf , fb ff! Jr f v I . f Va If V We f x'xi ' .iqhYw Left- A beautiful Macau on display at the Singapore Zoo. Above Right- High-rise buildings form an accurate depiction of this modern 258 SINGAPORE city. Below Left- Mail Call! Below Right- DSI5 HOO- KANO and DSZ5 WEBB take in the sights. l 4 Above- Several marines enjoy a fresh coconut snack during their Singa- pore sightseeing. Above- A view of PELELIU's stern gate while at Singapore's Man-of-War anchorage. Right- Here is one of many mosques that dot the landscape. CThe largest percentage of Muslims in the world actually live in Indonesia instead of the Middle Eastl F1 ' 1 . x 525 , . W .,,, ,. ,,, f H ' Y -g ,,.Y3,, V- 240 SINGAPORE I 3 ff -Q- Kr if KC , X . I jiri U' ll' nf, Q53 f N A 4. -V 4 1 f X i X ' B 'T X A 'AYf?1s:zg:s XX A xxlix' i f , :5i,.-QN..:1.-NX5,7jA.gj,.5, ,A.,,..'1 I 'Xiu' 1 1 'rf-'fxii 1, Q, , 4 V T, .ell .. mcnav -A A ,, ff .FMQYSB . ' --fegfrf-' 'A --'A A '-AW . . . . - Qgwgk' 5 IU I 1 v' - ,..1,:4,,vA' ,Q ' .V A, . Qu. If .' - J,-, '- 'ff ni Egg 3g'wg,QjE qaakfvf' ygygg I , ff A . , R 32323155253 1151 bfxfgf. W , :BIG newer Exams 1 - 'A ., M H ' :Q A , - A . fsfsAw.fwp.8 91, mgwffz' X' :fm Y-101. -A .'-4 Q'T,5 1i-S ' . ' 'KK 1' ff' ' if is M 'gl Le'-we ' ,4ih1 'i5.5lEiFlVJ'L6Li.UM.Q' - fl: UH' -S65 ' 5255.75-lvsv In f 'A 1 I -'Mu -ff-wr if'--'i'r?937:'?f' E4g3Q,a,vfl5:b. If fl ' - fx-sffL.:a..,X. 'Vi QL QUI A fr,-5 f 1, 7, 9 5 N . ,fi 'CA - 41:355- fz b- v ' X A Q3 H E A A u ' . 1 4 3252? ,gf.ff'5g1: , XX , 'TES if Y' In 4, . -'A ' X??Zmf3ixf!ff,Egg'i3'?f19 ' ' 3 ' ifiigzii A , Auiitggy 'A 9' -' 3 ', Exam-'Krugman Q' fl ,J ' .V '- 'N d . ' 163 1 '4 4 T 7 , - Q- ' .-1 - U .1-flbffwig 1 P- - A X lg . ' We mf .. A 4- f- 5' --2 Q ' 9. ' X I.: F T yr I 1-' 5.51081 ,QUE YL, Q A l 1 st .u ,FX . ., 1 :M .5?:,.,, 1 'IA A , V. J was .r 'ff' .nf .. ' Q- 'X4 e f? if I .f -- ggf, if ' ,- - 'Q A4519 .nf Sgwfvgcw:-1-v-nr 33,5QFSBJQYI-ffxgixvi-xvWX'?'3?,ff1-zfffwf'-5 . 3 - fi-.. ' 'sf qmfn-f'gL'Lfg T H 4 , -- M . - .yg.,3r,,.,,-f. 4 fi-F I if-' 'gui Sf, 1 9- . - -wx -SX WIRCQQQAQESZ ,oo . .. , , ich h ff 'I .Wg 1 ke , ,H V 0 ,,,ff . , I' OSX J ' - 'FTA' 3'f?3,f' -f ' Ny 312' nf! . 'M fM-'--K?3- . . ' , I u .,.f qi 74.51. . 1 -. , P ,f gf. 1.:gl5,g3A5XQS1,ff? T hz. .0-3:.,:w,,,:t s QQZZQ' ' 'xx Q F.-ggff , ' .. .A Q ,, 5: , my , - v a 9' .,'-5:9- 'N -. -, Aj'-SO q,.g:g:f',, f ,-,, TQ., - . '3 Q , , - 3 A, 1 jg A.: 52935 wif-:,55?g5.g:-55,3 in A-X: wi ,-. ,, OH ' 5 5' . QUIT CONPLAINING... L F 1 - .1 - - 'N' A , ,ff--.,..'1g .-5-v -X , --'- MQJSERRY, covER U-P THE FREZEK, owe. Youwzz AN AVIATOR1 ,gf-.gm 5 -33 L D' bg EK me-f 'Ie' TUO1 YOU NEED FLIGHT TIME-. A 1:1010 ATE. ' 1 THREE1 PELELIU NEEDS ro PRACTICE WAKE UP CALL FROM HELL My 5:03657 1-115 cgfpee ANTI-NISSLE DEFENSE-. gwlbex 1595 77015 4 .4-fi ii . D O B A 9 3 gf p .. J.. 3' - -'Z :-31.11 5 ,f .ax . 0 o o . ' o Q ' I ' . ' C Q U xl b- 4 :1 N .0 . I , 1 11 K .-N, .4-74,1 ' f .3755 Eff: '-?1z ' 4 J'-AJ: -15111, 1 ., .5 -N ,5 T .-J' - ' . 2- ' Y .. H : E - - ' .e ' E! ' .Eff .xlf:L'i Nw rw! rn: rogymw mp AFT DIES!!- 1 -0, W9 AFTER AND FOLR BIG LEAGUE II IS B SO GO AVIATE. I xxx x , fj . A 'u 'J -wg Q, wfw-'K2:ff44s1.m:cuif,zxQQ4zfgp, 'fW2'i,.-. ,f 1 . pf ll - 14-f:-, Aw, -hgvz-mwww-is-,-is 12 imvf.-H 1 - '-sich:w4fA?nf:fwm1z'.,YL ,' A -,Ag ff ,354 -, fwglyfiif ,+!5i,s,w6f4i9:.y 9,1 -'wwf' www W- , ,,.p,,..f Q 2. H, 5 x,,'-- ',. I : ' ,H 0 - SLN ' W 7.4144 pm. - .' , '76 Q Q 35: ' N .A wrvzggifeyflffb- WM- . 55 - .5 5f11, ' f X s ' N 5, , , ,. ' ' , ,:- M 3 ..:.753s ' ,vt , 1' ' . ,. J gf- ,gt Q h , X , ms! , Z., ,1 H , ,f4 M1?gDgw,,y,.,iL, 4 fn s- ' f if AN INSTANT LATERMBOTH THE D-C-A. AND HIS TIME MACHINE ARE OBLITERATEDJLEAVING THE PELEIU HOT WATER SHOldER.DEBATE.STILL UNRESOLVED- ROKIEN . X A 1 NR 'MM ,lV0Wl131f'f1 vp! War, 0 1,6 ' Q g0'f75 75 06 MU dkf7d6Qt?4,6,! , wi 4 H -zf.,,x 1 - 1 ff 4 0 , 0 927 4 A Q, Q Q 90 M 6. . Y ,, . if2w1Y'P4'1rw.i.f We A AW. I ,,.,,,M Q 'ZA 1 , I O 0 . A , 1 S NnQ5 ' A 'lf- wgimv gpg. Q 1.1 QL. w 1 V 5, V ,, -gi . -ur' M EX ::.'f'.,E . .Q ,,- ' - f551j1g,v X XJM 0 REVISED EvAcuAr1oN Pfioceoukes N A I I v wt X . l , , .sei . ' ' K ' ,. - f' ' se, L 0 ' ' V ., -WifEW2S,?i2e5: ,irix-Afxgfr.,'?1M1-:Mil -11'-'55 - , ,,-v, 1, ,yfS'f5k9':rf,., . ,Sy ' TN Y-'iw 'wffszz 2 f JPKXQSH-'Q'f '+v:'l-fNx5W1:f4 'v'fAf':X' 'A 1 , , . ,f I+'-WN S?v'?dv'f4fK fv ' f '- ' ' ' - -ww -. 'V ' T 'T . ma' ' QQOU 'A' ' -1-Ar no C 7 USS p A -. 3 . ' ' . HV .fbf Q . . ELELIU '- , f ' ff -mi -mir '- . , Q-f , Q '- ' . ' 4' ' J Mrwklii- ' .cr--: -- H 55f'.'2 f'5 ' ' 4, 'N ' 'T 'L' 0 -f fkf' 55:52 INK'- '?4fWbf1fZPv 'f5NG 0 C' f 0' V J Af' ' sw N J 7 , X , - A . A A .fm .xo X f . f . A7 . V 3:87, X X Z 4 I , , , I 'T' .1 1 ' ,f W -i Favor- ' 1 Z g J!! I I , ' .3 A' f -l'-kit . lg 1 I I vitae, f xgigfx UHEN AIR CONDITIONING BOUNDRIES ARE NOT SET ff . ::.-ii-ni' -Xi -I 'E CORRECTLY - UELL YOU GET THE IDEA. , N , 9553- ggigdfy' 1:-Rigs ' 08 PATRDL DURING mum mug: faizf'-' E-j7::?.lJ7 . B, QE ' JAH, ,JH ,,,. .,.-Z- 'Z LL -Q ntk,a.!F 'Gi 'jim ..,. 25.1 x ..,.v.. ,'ix .. .fn N , 'fmqw Q : .A - - - 1. - -- ff A NAMES HAVE BEEN CHANGED TO PROTECT THE ' 5, GUILTY X .f . .h..DlD T9 QI cuncxmi' on ncen-sa FIREV ........-.......-- -- -....-.... -, . . . an FUNNIES 241 S X A I 1 U3 if EE U 'm'fffQfQ' 5 if f H+-MJ'Yff52iiW Sf V41 w '?fVJl1l'f.i I awww.-9 3, K x ix Q 1 WWW Q K J X 913 1':N J G53 M E ll iw . y yi 4:54 xgfx 'M E E EE , lik ..,... --.-5 5 A if N5 E LV N W-XKE A HGLEU E ml NE ' . 1 X L +1221 X Q 'B ff W L- 3- ...., . f r f 1 wg , - li 4, 0 5' fa Q3 m'-J Q Q fb ' X L , , , WWME ii A Jimi inn ,! 9 so if ' E X- I' 63, w' , 5 Q A If' I Mp. ' f f' E 'Q' N 12? f.. f 'N Xf j3fw A I ' Ep ., I 'N f'Y-E W X D529 , 5 V A,AA V. C: Ni N E 1 3 EE NN Q, f , N E522 7' ' J Q co? ' E-1 u if i QE V N ' E W E 1m E ' ' 'X Q MEAE, 5 552 4 C1 B U33 We 4 I I 5 242 ENGINEERING CDR M C TURPEN San Diego CA CHIEF ENGINEER LT B A ZELEZNIK West Mlfllln PA MAIN PROPULSION ASST Egtl LTJG A M NUGENT Billings MO MP2 DIV O E GI EERI G LCDR R W SPENCE Long Beach CA DAMAGE CONTROL ASST LT L BROWN Detroit MI REPAIR OFFICER ENS J A HARTWICR Palos Verdes Est CA AUX DIV O The PELELIU Engineering Department can take great pride in their tremendous accomplishments during GULFPAC 91 They have proven time and time again that they can and w1ll get PELELIU to its scheduled operational area on time Whether It was the llberty ports of Hong Kong or Singapore a tour ln the Per sian Gulf or a sudden disaster ln the Philippines the men of Engmeenng have always come through with results PELELIU s 600 lb steam propulsion plant remained in operation without secunng for the entlre six months of deployment During this time the Engl neers overcame many obstacles ln providing electnc lty fresh water and lntenor communications to all crewmembers on a continuous basis In addltlon they could be relied upon to deliver plenty of air conditioning refngeratlon expert damage control and radloftelevlslon service We salute these tireless professionals' f ffff fQc ff I LT M I'I SONG LT C S ROBINSON Palos Verdes CA Tampa FL ELECTRICAL OFFICER MP1 DIV O nm., may CWO2 R K HUGHES CWO2 RA SIMPAUCO Farmington MO San Diego CA SHIP S ELECTRICIAN SMMO ENGINEERING 245 X XXcNXfS XXX X F ' ' ' ' NQNX X - X . Nw NX X X 0 . X X X . . Q . 0 Y 0 I - 1 X O U O I O I I 1 X C Q Q u I 444 4 I , X fx . j X 4 . . VX X . V. 0 a u o u u Q X X I f W f o n Q Q Q X Vg X F Q Xf 4 , . I ' X . 4 - - X as gig V - V .4 - . 44! f , , , , , X 5 1 . 3 I Q -X 4 4 if . . . . E 4- 0 0 0 X C4 X K X X X . . ' - 4 X K X S4 -X X 4 X e o o s U O O O l U . . . . . . ' c I 1 . . 4 - .X .X 4- .4 444- 4X-44. 444X MX- MX 4X g4XX44X 4X 4X 54X 4X ,4,X .4 X q4X Q444.-4 4 .4 4 ,4 .44X .4 N40 5-44-4 X-44g 4 X-44 X .4 X- Sas I-4,-F 4- 44 we 544- X' -' f444.s1!X-4swfXX,4 S .1 .X ' X X ' ,X4 X 3.4-'. 4 44-Z4 fn . 4, .44Xf 4 j 4 f' Q44-J 4514-'i443.44j i4-4f44Xf'X4!X4 443 Nw , W-4XX4f,X4,!X4-' 4 .X 4-5 44.5 445 gf XZ-1 525. -, . . , - I ' . H V X A ' 4. 4.4X4 Q, 44 fy 444.04,.XZ4fff44.g,fj44 134.4-42.4 f4i4f4-4Z4i7.w5i44X9 In I4-' Z X-M803 57 . 4 ' 4 ' 'X4 'LW4 4 X4 I 4 .X 4-20410.71 I4 . L44 54XW?4Z?4, 4 44 f4 041.4-V4 .4 4 4 , X4-, Q4 ,V 4 I 4 W!44W.74 W? X 4 , 4- 4 V 4 7142.4-We 5 'X '4 M-'ff .JF 4 I f4 7144 75444 f 4 4 4 F i4y4,i'4 - f 4 ' 4 L7 744.-'W 4X 1' -1 5.4 M X'44.434Xk . . 4, 4,47 4-,X ,sgyg I 4 4 4514742 4 M54-:74'74 4 4 f 31445 ' 4 4-4 4- Xw ,S Xu. .4 4XM SW, 5 sf S 4 4..4.f 4- X4 Zqsh -4 4 X A 4-4 5 4 4 3 4 X474 352511 4 44 - Xa 4.4V,4,X R X545 4 A 'Mila 441W 4 L 4 f 4 4 ' ffl 545 . 'ihff 4 4 4 4 4 4 4 4 4 'f ' 4 f' 4 4 ' W X44 X 4 4:4i.4r 444-3 wiv Xof I 4 4 .X ' 4 , 4 ' 4 4 ' 4 Q4 f 44 44 f fy -W4 44 444-I 4 Z4 V ,Xhf 4-,.44,.X4-fsafzb.Qggww 4 4 , 4 f 44 I '44 4' 4 V 4 f 4 4 4 '4 W 4 '4,.4 ,Z4 ,.4- 444-fl443,fX44f,QW'4.4sW'4X 44s244X44- iw X4QVf4sf44X2.4s 04 , . 0 c 0 ' ' . . - , 1 I I . f 4- 4 44 4 4 '4 4 4 4-W 4.44X4Xf,X4X45 , 4 I I, I M 4, 4 V. ,.,. 4 4 4. .. . 4 4 4 'f ' 7414 if I I 4. 344 Z 4 fl 4 44 4' 4..4X4U4' ' 4 ' VKX 4X'fj 4 ' ' fi '4XXnkWF Q44 4Q44w 4 f' 4 4 1 '44XX4-QWY4 4 4 4 4 I X 254454 44 - - ' I 7 4 4X.4XXZ4S7g4 4 42 4 4 fi 44Xf'7 4 X WSW.- , ' 4 4 4 4 '4 4 wi I ' 4 f f 4 X- 'F T 4 4 ' 4- 5.4: X4 X 4 I 4 4 5 f . lg 4 -44 4 ,4 4 f - wk WSW 4' 4 ' J sz , 4 X Y x w4,X 4x . . 0 1 ' ' ' ' l 1 ' I I sl I 4 -WIP... MIVICS W.M. CORTEZ Sacramento, CA A DIV LCPO it ENC I'I. GOLDSWORTI-IY Byron, CA 244 ENGINEERING DIVISIU There is onlytone word to describe GULF- PAC '91- HOT!!! Of course, A-GANG was there to keep things cool. Air condition- ing, refrigeration and steam were in great demand during our deployment and were essential services provided by A-GANG, contributing greatly to the crews comfort and morale. The ACSKR and STEAM! HEAT shops put out a tremendous effort in performing these duties. They, also maintained various f'hotel services yCi.e. laundry .machines and galley equip- menti, emergency diesel generators and ships service air. Numerous' air and am- phibious operations occurred during GULFPAC f91.r Auxiliary Division person- nel, being one of the major supporters of these operations, often spent long hours manning and maintaining critical mission related gear such as aircraft elevators, small boats, deballasting compressors and the stem gate closure machinery. The HYDRAULIC, ENGINE, and AMR shops deserve great credit in keeping the ship at optimal readiness condition. Thanks to A-GANG, PELELIU was the coo- lest ship in the Persian Gulf. 'I xy NJ l Q4 bd MM1 nf. ALMANZOR Mm R.F' BROMUHD Ewa Beam' H! Brownstown Townshis, Ml Combustible Class Extinguishing agent Woodwork, bedding, A clothes, combustible stores Explosives, propel- A lants Paints, spirits, flam- B mable liquid stores Gasoline B Fuel oil, IP-5, diesel B oil, kerosene Electrical and radio C apparatus Magnesium alloys D Fixed water sprinkling, high-velocity log solid Y water stream, foam, dry chemical, co,,' Magazine sprinkling, solid water stream or high velocity fog, foam. CO, ifixed systemi, foam lAFFFl, installed sprinkling system, high-velocity fog, PKP CO lfixedi. ' 2 gzip!!! UNFFFJ, CO1 lfiX6dl, Water sprinkling Syglem' Foam CAFFFQ, PKP, water sprinkl' ' velocity fog, CO, Ifixed systemlmg System' high- CO, lportable or hose reeli, high-velocity and low- velocity fog, fog foam or dry chemical lonly if CO not availablel. 2 lettison overboard, low-velocity fog, ' MMCS CORTEZ conducts repairs to NR1 EDG while in Dubai UAE. A-GANG at work fixing the conveyer system- , W i'9'5'?IH! W Q . 3 Q ,......, MM1 O.R. CASTILLO Bell Gardens, CA .r MMI D.P. VILORIA Seal Beach, CA vi. '43 'Q EN1 F.F. PIULA Apia, Somoa ru, A is K iRR L gs iz, .Qi , ,Ali q 45 MM5 M.A. CARLTON Fresno, CA E MM5 J.A. CHAPMAN Lake Havasu City, AZ 4 f 4-5-4. n I ,f , ,, 'X ,M b K J fl fl f 2 f X M, 7? J yi ff ff 1 4, ff X . 1 ., i, .X V! ,SZ , ,f!,f? .fbi hi... Q EN? M-K UMALI MM2 w.s. MIDKIFF MM2 CLA. PETERSON Ballllagf RP Middletown, NY Port Toumsend, WA 1 if 1 Q MMFN J.S. BROWN Nashville, TN EN2 DALEY and MM2 BRIONES work on the AC chill water pump in AMR. - MM5 C.M. KELSTRUP MM5 R.J. ROBINSON MM5 C.A. ROYAL Three Forks, MT Huntsville, AL New Orleans, LA ENGINEERING 245 ' f'.'-ff - -f- -Y g---vu -1-2,1 Tv-.1..,-1..N.......mw.,-fv rf...-....,... ,..,.,..., , 1... I I 'WX 'X1sS'wx0' 5RsQ' .Q f4.,,nQ' .xx-1 5 , ' Q4 , My ' xx., 5 f'-Q , , -X , -,X X , A ws, .,s: 1- ' X X X N A xx Q X N NQ Q5 .S f wig? .+- s , .YQ HA. X x .-V . rss X. A s N, xx A A ,,,,, -X ,S .. , Y A 'M X :sf s A 'xxx N 5 J,-jf V5 12,5 A Q Xl Q, S XA iSS f 5 my A Y X 7 I N XXX X Q X se X : Q. K Q-:agp , .A wxs , A my X X 'Bi 35 X! EN2 B.A. BURCKLEY Denver, CO E115 L.K. HAUVER E. Long Meadow, MA 3 1 1 , EN5 D. MOYA Detroit, Ml 246 ENGINEERING V ? f I 1 - . - L1 ' 2 X Q N 5 EH2 P.R. CARINO EH2 O.A. DALEY ENZ5 J.B. VANDIERENDONCK Bagig, RP Queens, HY Kewanee, IL Q i i MM5 CARLTON stands watch in AMR. X Q E, A A E Xl - A - , A W.. ' E . Vi? X A ,W , e Nw S swf.. I W sf' ' sig :Ky is X 'E Il K' , - PM . ' M. 4 A A Y T Q4 xx E115 TJ.. SANER EN5 C L WHITE Shenandoah, IO Houstdn. TX FR RF' GREENE ' BOSCOD, MA H- - -v..qW,ug, vo - , .1-,f,..--X.,---- E N E' ' ' ' ,, - E H 6 Q Z EN3 R.M. BROWN ENI5 C.R. PETERSON FN K.T. FLOWERS FN K.M. MORROW FH MD, W1-UTEHEAD Los Angeles, CA Monticello, IN Pa,-is, TX New Orleans' LA Gulfport, MS NC 3 A ' A , K Meeting of the minds in A-GANG office. EN2 DALEY working on AfC coil in AC8rR shop. ' ll ENFA D.W. HENRY Los Angeles, CA -4, FR T.R. PARKER Fairhaven, VT FR D.R. CALLINAN Cambridge, MA U. U 5 ,IYIP 5 ENFA CLA. STANKE ENFA C.W. CURRY East Troy, Wl St. Louis, MO ENGINEERING 247 D D l Top Middle- ICFN MCBRIDE ordering parts from Supply. Top Left- Leadership at its best! Middle Left- EMFN SMALLS taking control in Aft Steering. Above- FH HILTON stands watch at the con- sole in Main Control. 248 ENGINEERING v E D1 Electrical'Division, ortE DIV, is the largest division onboard,PELELIU. The nature of their job allows 46 Electricians KEME and Interior Communication specialists flCl to venture into every aspecttof the ship, from highatopthe O8 level in order to rig friend- ship lights to deep down in Main Machinery spaces to adjust space announcing sys- tems- EMS and IC men do it all! During de- ployment, the Motor Rewind shop rewound V26 motors for the entireiAmphibious Readi- -ness Group. E Division personnel also work hardin keeping the ship's electrical distri- bution networkfree of grounds. ,PELELIU is equipped with 764 Interior VoiceCommuni- cation System -CIVCSDC telephone units, The lCf men ensure these and all ,extemal phonesin the PELBELL network maintain sound clarity r and trouble-free operation. Congratulations to the E Division teamifor anyoutstanding QULFPAC '91!t EM1 R.L. ABAT IC1 J.C. BRICE Los Angeles, CA Magnolia, AR ,, -xc ICC J .D. DOXSEE SilvuS, IL IC LCPO EMC T.J. SCANLON St. Cloud, MN EM LCPO IC1 M.D. BURGESS Ontario, CA mg Zwgnyan , W-ML., y -am, ! ef A .4 3 V 2 2 E - Z' EM1 Lo. DAVID EM1 E. FRANCISCO IC1 o.L. VARNER 'Cl R,L, SMITH IC2 J F BEHM Bompam' RP La 'Wada' CA KSHOQQI ID Long Beach, CA All over Mi gif 'Q IC5 ECKELBARCIER doing IVCS CirCuit Card repairs. EM2 R.P. ENCOMIENDA Baguio City, RP EM2 J.D. CHAVEZ Salt Lake City, UT 41 lf Wiliam. EM2 CLR. FELD EM2 D.L. JABBAR Long Beach, CA C8rlSb3d. CA ENGINEERING 249 u i EM2 R.A. JONES Granville, OH ICFN NGUYEN, the master! f fly!! ff! N ,J If N4 ,,,.,1 WW, A 5 V ., : , 1-mf K es S- fsr - K f , - iff? I Z I - L 782 lv-97. , W ,, y A fy Q? ., gf f Cyn f , 7, A31 .yygv ff W ff, 1' f f W f r ,f , , ff f fn f WV f Q: I EMIS D.A. ACUARIO Zambales, RP ICFN MCBRIDE and IC5 SELL take a break in Forward lC Room. EM5 S.M. CONANT Omaha, NE 250 ENGINEERING ,flin- Y E 'fi' V 2 A E lC2 S.W. JORDAN IC2 J.L. MCCLINTOCK 'CZ R-L. PEPPER Apalachee, GA Norwalk, CA Walhalla, SC IVCS terminal ElVI5.M.A. Dunmno EM5 QE. ELSTOH EM5 v.D. FIGUEROA Blrmmgham' AL San DieQ0f CA Los Angeles, CA 0 IC5 D.S. BERMAN IC5 J.S. DEAN Flagstaff, AZ Buffalo, NY 'alma A I I I I IC5 R.n. ECKELBARGER EM5 LP. GIBSON EM5 A.R' GUEVARA Overbrook' OK Springfield, PA San Pablo City, RP s I I 1 EM5 S.A. RODRIGUEZ Puerto Rico IC5 C.S. SELL Phoenix, AZ EMI5 C. SMITH Los Angeles, CA ICFN WOLNEY, 'II hope I have the right print? IC5 BERMAN, i'What's this knob for? Mg!! 4 li EM3 M.W. STRAUGHTER Compton, CA EM5 R.C. MARTINEZ Pangasinan, RP EM5 c.L. sHoRT chicago, IL ENGINEERING 251 Y . NV --c -,..-..--.-.....-..............,....,. - f-rf--N ., 7.--,W I-v-,,...- -...fM....,rvf,-mf,-...-.,.,,V , ,W ,, - V Right- EMI5 SMITH cleaning his shop at the end of the workday. Below- EM5 RODRIGUEZ trouble-shoots the Burner front console. Bottom Left- The EM Friendship Light Crew on the flight deck in Hong Kong. ICFN J.W. MCBRIDE Blackfoot, lD lcrm c.E. oursm East Rockingham, NC EIVIFN M. SMALLS St. Thomas, VI ICFN A.G. VILAR Fresno, CA 252 ENGINEERING EIVIFN IVLA. CARTER Frankfort, KY EMFN R.J. DAVIS Moultrie, GA fm , -1 , f ,, 5 x ,fga ,1-y 0,-,f 5 P3 -59 2' ' w if, ., v,,I v,l, ,, , .X gl, aff ri 7 'W fl 5 Q Z f f X Wx W ff! VZ! X X X Z, , 3211 X ff Q W ! fl X , f 11 f fzf W? K, f f y p f X aw,-,f Q ff, . ,.-- ,Q ' f My W 5 , I i , ? x I I ICFN E.G. WOLNEY Louisville, KY ICS OUTEN repairs a broken IVCS handset. ICFN J.L. CHERRY Washington, DC rm 11.5. TORRALBA Bohol, RP X X f I EMFA S.Ci. POOL Thousand Oaks, CA FN C.D. ESHLEMAN Lancaster, PA L., ..,- ,.A. , .yr inf, ...- .. - EMFN J. MORENO Sun Valley, CA .l...--... , ,-. ,, ..,,u?,,nqwas-1-fr-,,1.':C,+--- 'A' f Q- 'sf' ICFN D.V. NGUYEN San Jose, CA EMFN M.F. POWERS FN C. VALENTINE Farmington, NH ' Dallas, TX . ' Rn '-di .N wwf, N 4 , M ., fy Wi , - Q , ' - QQ? '- 5 , , W ,, ' P T- i xw 4 'N 4 . ,, s '23 We :Wi-'-Ri' ' X T f..fiif..f, 'I- -,f W -, -fa'i.,,f1' N ' , lg, ' W9 I X 0 I C -f - ' F I Q X X K Fa? :Q -V V -f f' K J Q. 'N I . N ,ix , N ,. ,, , I il x X , tw 4 S . mx. Q5 fx, . A - ,M 4, ,wav Q QI , X ,Q . - I X. at 5 Q M Xa,-S fa ' s, hs -wt ' -f -AC.:- w iv 'NJN V 1,3 xx. 0 K Qs If i f , Q 1 5 :NM S V 'sz I1 - W-if T E E AL W, X ' L? N: ' 7.6 WNV fxix F Sm! ,ss 2 1, Qff' mi . Pg. FM, I ' it - Q -.: 2 X, - , is 5 Q 9 X. jj ' X4 'ft-. f Ks f M. A X , tr, ,.. X, , f 5 X N ? i5X FA J. VERDUZCO San Antonio, TX .I it .X tt ,, 5,05 . X Q N, fe ' C13 N C L ,, ' V, k ' 1 , ,, -yi i A 5 A Sl F f N I FA D.W. HILTON Gastonia, NC ff .g:J,,,,A I , .mag L W , E W , if w fi Middle- ICFN MACKAY pausing for a photo. Right Middle- EM2 ACURIO and EMFN TOR- RALBA rewind the 44 AfC motor. Above- Combat IC man. ENGINEERING 255 R DIVISIO E 'N 1 ,ff T 6663352 L . 1 3 1 1 X 3 3 P 5 4 Il E- x fs 9 -4 ' ' fe. ' ' If b f- Qipwqxm S ,Tn U. 5 .2-M LW A occm ER. YODERS ' 2 if 1 Astoria, OR I , bij R Div Lcro Z' 3 if I l f Xi gl J Q,-1.-.-'S' -L Dcc R.R. KELLER .,,,,--5-9 f S Kingman, IN ' ' , I . I A 'ff HTC R. MEADE 1 -- , -J ' , J, .. RAINBOW CITY, Panama UPPER DECK sTGNAT. moss sureizsrnucrune oecxs Q., 922 NAVIGATING amuse MN DECK Fonectssns oecx FANTATL 555350058 Y ig ,Z lst PLATFORM DECK E ' -:Q STERN I I' - - STEM q ,P -: AFTER PEAK TANK ENGINE ROOM FLAT INNER BOTTOM HALF DECK rms Room FLAT sorrom TANK ronwmz PEAK TANK Talker Tlfl Hose Team I I 02 Hose Team Scene Leader Investigator Messenger Fire Party Support Group and Equipment Nozzleman iOBA MANJ Nozzleman tOBA MANJ Hosemen Investigators OBA Tenders Plugman Foam Liquid Men CO, Men Access Men Hosemen Investigators OBA Tenders Plugman Foam Liquid Men CO, Men Closure Detail 254 ENGINEERING Electrician and Kit Hospital Corpsman and Kit Foam Equipment Operators Hosemen Oxyacetylene Cutting Outfit Pumping Equipment Firefighting Suit Men Dewatering Equipment Desmoking Equipment Flame Safety Lamp Combustible Gas Indicator 'ISQQ l DC1 R.A. TERRY Mira Loma, CA M- T MR1 D.C. SANTOS Olongapo City, RP HT1 R.R. PACHECO Los Angeles, CA A HT1 T.P. SCHMTDT A Philadelphia, PA ...,.-.. .. -,..,. ,,,.,,,..1n.,q.-5 v...... ,A -- -----H ' During times of need, the Repair Division is one of, if not the most visible divisions onboard PELELIU. R Division is comprised of Hull Technicians QHTJ, Damage Controlmen QDCJ, and Ma- chinery Repaimien UVIRD who are distributed among the Pipej Shipfitting Shop, Damage Control Shop, ERO9fCO2 Transfer Shop, and the Machine Shop. They assume responsibility for all damage controlfsafety equipment, plumbingfpiping systems, and hull structure of PELELIU. An integral part of R Division is its emergency response team, better knovim as UThe Flying Squad. This team of expert firefighters are on call 24 hours a day to respond quickly and decisively to combat any tire or flood. Also sewing as a Rescue and Assistance team for other ships, the pride and professionalism of these individuals is evident by their motto uNo job is too tough! DC2 WEEKES says, HDamage Control is not for wimps! Va an Wa HT PRUETER is hard at work in the Pipe Shop. DC2 NEAL takes a break from the pa- pewvork. DCC KELLER and the guys of R. DlV hose down a burning trash bin while in the Persian Gulf. 2 i DC2 J.D. NEAL Lovington, KY lla, DC2 C.D. GUILD Clifton Park, NY DC2 w.E. STARKS Fort Wyane, m MR2 B. CHEELY Yucaipa, CA i X , bf HT2 C.L. CIOLDIE Rialto, CA l DC2 O.R. JOHNSON Oakland, CA DC2 R.L. WEEKES Mentone, CA MR5 R.L. PENNINGTON Houston, TX ENGINEERING 255 1 ll N l DC5 s.1.. SMITH ' Lake Wells, FL :ws L V- S ,YW-Q' of if WW W fff ' f f , ' Yw wi B f,,zf,ff gf ,fyffy My ffyyff A r WMM fWWfM,fWffMWW N 5 N1 wJ Q if ,7,,.MfWf,f,f,fgf,mf ffm ,,,,L A. ,A - or Y, ,QL , f,, ,,,, k,,f,, , ffffyl .X f . fs fQWff,fZf0W4fQWyW,fZ K .. Q wffWWfff0ff6f7f WWWOW 1 Q E 0094,ygfgffffwowfffy or X -, fs X f , ,fmff fwffr SX f X - X -, - 'f X f '. ,S f Wfff!fff4ffQXf!f5ff ffff WW W -5+ I ffgwf zr 1-m7f',ffm,fff, ,ff M yw 4 f' ,, fi S, 'MW' Muff!-Wffffffffff WM-A 1-ESS NNN W A 'L MWQWWJWWyf7Qfyf4W7lQ?W N 4554, 1 fm ,zfM,fQf,fff,Mff,yfyQf V ,www fx we ,1,ff,f,zf,f Mffymfffffffyf W . i ' ' V vfjfwfffffflf Mfffydf Q T' fvfffz,w2f,4W9ff,fwwf M Mm 79,4.W1,4fWz,M,ffWfff,5fff, W N WWQMWQW-,W6WyQMw,fW fy! ' 1 MMV W L ' K -N ,f f f f ST DCI5 C.M. HURST Fresno, CA ,A x L DC 5 M. FRUTOS Houston, TX 4 , -, - f- ,-ff' fwfwfzff f-,w,!,M Xffff, fM ff! W ,W ff Z?6fZ,WW,Wf5WfffWffZM906 , ,, f2WZffff9f!W!9 M 7 Z7 W W5,W,,.,,.W,g, Wfwyf MCM M ff, -f rf. V-f.,w,f,W-M3 fffwfmfyxf W W W M ,fM,,f,f,, My f X f , , ,., , .,,f, w WWWyMQg4yOMWfWwy,f!,!,Mfff, ., ,, - f L X-Wi-Mrffvwzfffffyf HT5 5.5. PERRET Not Pictured ,- ' 2. -' f X-4 f V f , 2, ,4 ff ,X ,, ff' 0 f ' X4' 0 f? 2 7 Y ff Z O f f s 1 , f 7 f f 9 X , 2 ' f' r 7,2 f1,r,'f,,f f 1 if-,if ,Q , f swww W xww X , fl! ff 5 f ww . X . i4 I wif! HXMAQ, MZ, ,K , .WX ,fg',,f4 ' .4-, X , ff' X ,, -f, 2, .f , Z AMW, W ,Mez 'fiff ,, 2' ef 7 !W ,Q ,, , , , ,, , 1' 7 H , 9 f, ,V 6 I , 527 ZX U, Z, ,f if ,, , , ,, X My ,, 7 ., 4 1, +2 if ff, W X V V , ,,2f,f- 4 ,, f w f X 74 , 7 ,guy fzfvw, ,g, f ' of f 35 4, ,Z 5 WM! g,,, M J! ' f f ,417 f, iw ,vi ie , ,, ,ff,, , f , 4, V N S , W xg N ,Z 4 fff, , , f iQ, ,f ,Q , ff f fyiyZ,zfff f,fZ iff yf Wfff fi f M2MQ,,fffQf M f f 77?Z7ZfZfwff,f f f f n ZZQ4? f?,ffZ X 7f fy' !!fW7Z74?7! ff f ff Zzgffzzi if nr, ff X M ZQZf?? V W W Z fx Zmwifff , ,f ,,, f H ff f f M w,a,f, f Ogfw ff f ,f !,!wff 7 ff ff W if f Vlwff wfhyf fZfO f f jf ff 12 Q4 f f f y , f ,ZZf,Z,Z,ZZ0yZ7 X X Z 4, ff f fwwfff f ff fl if Z5 Z Z7 W77 if ff O f x20 ff f W X ff if f w f Zz fgff f2,f , ff,Z ,, W f 2Z4f2Q??f5W5f ffi ff f f 4 Z?Q,,fQ4W fyfy fof ff, Qgfywjgf jZZ?WWfZfZW9-ffwfff' ' ,'f fx ff, ZZZLZZQVZZZZXX f f 2346 M ,ff f 7f4M',Zf,f f iff f ay ZZWf9QfWf ff ,107 f f fyffff f ffffyyff f f f fff f K ?7?ff,4f Zfi4f7fff, f f7f4! ww ,az ,f ff , 22 Wx! ff Wj? yyfff f ff X fa f X f !WWf ff!! f iff f QQ f f W Zfiw Z6WQ77Qi,Z1ff4f25o!V Jw ff ff fe 7 f7?,f5Z! !fQ,,iZ7?f!fQ7 X f, Qgyfff 7' Zf4ZZf!WgZ0f Qif2zQZfQ,Gf W f wf f ffffZ774?fQff ffjgffff W f X! f f f 1 fx ffff fy, ,, fW ,M yfi? ff Q! fQQQZ!,,f ,ffwa,gfffj X4 f X f Wfff fdfigfff f XXW 'XM f 457 W f fiff ff f f .f f L 9 . Mx fm, J, A-film,-, , ,f ,,,,, ,f ,,,X-mf-,wi f -f - . X 3,1 ,- f ,nr gf . Q 2 ,pa ,5 y XJQ? 4, -4 4 f 4 DC FN SCHEXNIDER ' drill. IS fead Y for a fire TOD- DCFN KL AASEN r Above- echarges C0 1600 yet? DCZ5 Fru tos 2 bottles Wonders 0 . T0p. whether lt'S Abov xxwerre d rovmin 1,1,f I I , 5 I WQ,fZ,X,,-4,w,M,-Qf , y Q ,. ,Lf f e- Proof that l'I'l g and W? Can't Set S use thelr heads. , ,X W , ,um ,,f4A.,rQM,wM,M5 out! rl . .'1:-my 'w-NW, , NW WX 4 - W, W -. , :sk in ,-5 gg - , , e f L, QNNQ - ,Qs ,MI ,Vw f, X x ,QQXW r,q,x.5x X' 3 K , , X xv, 0 S eee, , L U if X LL, . f 5 Q- Nw i Q, X Q 1 4 nn, .V df 1 , , X Q ig 9 . ,, , S f L A . f I 4 R Q 4 1 X , DCFA P .1 sm - - GNOLA L nn M DC y , A B in QE. STEVENS r OS on, MA DCFN l - . L . M A BEL ' Stuart F L , L germ c.1.. ommom ir, D0kane, WA J L We 252 W1 gn, F? 2?- 3-n rn 5 rn I1 25 2-fi 53' 0? Pau 0 PE S cn 35 -n is S23 oc. P. 3 0 :ap O -1 -1 IE 5-1 25' o FP' 3? 'fs 3' :U 7 cn : -I 'll 2 O E' I O :- on :J O O 7 r 7 I , Banning, CA ...- ,.. 1, 2 .uf , .156 u W ,C 5 7 'ff 'Q ' '5 5 r fafii - V Vrfrr ,f., ,V Q A I f MWQWQI f f, 'k,, . '5 ,, I 5451. W Q ., vig AV I t A lf' J If 'V I i' ijrh I 7175 Pigffef ,A , , V Vvrvv E nn g f n n E n n , Q0 Top- R DIV leaders discuss trash buming with CO. Above- DC5 Artw k ' , or provided by HT5 PERRET and HTFN DAVIS SMITH on Watch in DC Central. i.'z Y 5 ' DCFN M.J. VANDENHEUVEL HTFN TJ- HACKWORTH DCFA D.A. KLAASEN DCFR K.W. YEARGIN HTFA KS. BURCHELL Westminster, CA 00059 Cfeekf SC Pike, CA San Diego, CA Eugene, OR ENGINEERING 257 IVIP-1 A BTCS C.T. ORGETA Lopez Quezon, RP MP-1 DIV LCPO BT1 M.l'i. MATHIS Long Beach, CA MP-1 Big Daddy 258 ENGINEERING 9 I MM O BT C 63 MP-1 Division IMain Controlb is the home of the pit snipe, the Boiler Technicians and Machinist Mates. They work around-the-clock, inport and underway, deep within the ship, providing fresh water, steam, electrical power, and l'FLANK bells on demand. Steaming in 'port and star- board' watches often in excess temperatures of 150 degrees, PELELIU's Main Propulsion team I the true Engineers J striveto ensure the ship reaches each operational area ON TIME. In co- ordination with Auxiliary Division, MP-1 person- nel deliver a variety of important Upublic works services which enables PELELIU to function as an autonomous city. 7 I I l BT1 EA HARRIS MM1 N A MONTIFOL Y' - - - - CA MM1 J.M. REIBOLD MM1 W.S. PEARSON Williamsburg, VA Honolulu, HI Riverside, CA Depauw, IN A 4 ffg-.. 'fits MM2 R.L. LOCKE Mt. Carmal, lL BT3 T. GARRIT Chicago, IL 0 Nl BTI5 J.G. MORAN Minneapolis, MN ,R t Vi K N' sv, L X ' 5 wt ' K ' x 5 MM5 D. Roomzv Mayo, FL L -41 Q , X V BT2 H.T. MONCADO Manila, RP ld. BTI5 S.L. BUCK Grove, OK MM5 C.H.WONCr Monterey CA BT5 A.E. DOHES Sun Valley CA BT5 CLR. FISCHER BT5 B.B. CEZAR MM5 D.L. TAYLOR Holbrook, AZ Bakersfield, CA Northbend, HE f9' When things go domm in main control everyone gets involved' ENGINEERING 259 4 f , - fig' xv! I f. S S 2 Y Nfl . . I . , C-,. . M-N NX , E., MM5 E.D. OCAMPO Long Beach, CA Q1 BT5 J.T. DAVIS Spring, TX I MMFN T.G. MCGOVERN New Prague, MN MMFH R. VILLANUEVA Quanah, TX 260 ENGINEERING xfw' EN5 FLOWERS standing watch as Throttleman in Main Control. , , I 1? 4' 9311255 Ei' 1, gifs M .-1 UHOW WE LOVE THIS AfC ! -KSN 'ru' lug If bv f-endm.im- I S I , The MPe1 takesea break. q S S 3 FN D.D. ROBINSON BTFN J.B. HERTRICK Midwest City, OK Oak Harbor, OH l22lEJxgdPE'IirER NgIuZ:oG.D'I12?MlTH 1 n, .-.- - -...,,,4f,.--1 5. F.-...Ay--'--F - ' A - '- Q L-, BT2 FISCHER at the Bumer Front in Forward Main Engineering Bro's just chillin'. Machinery Room. MMFA P.L Provo, UT i L , T u hi A FA C. ZEMANY Fairfax, VA SCOTT FA D.E. WATERS Belleville, lL L 5 ' NMFA KS. LAMPINCI MMFA T.l.. HOLCOMB MMFA T.R. UMATUM Smlle for the Camera boys' Randie, WA Redmond, OR Long Beach, CA 'QCII l FA P,s, ARCHER FA 0.5. GRAY FA R.s. SHEFFIELD FA S. JAMES FAR-fi. FORBES san Antonio, TX Long Beach, CA Colquirr, GA Macon, GA Elllsvlllef MS ENGINEERING 261 Steam, STEAM and MORE STEAM! GULFPAC '91 will be long remembered by all hands who work in the main machinery spaces. Operating the 1'lavy's largest boilers to move the ship through the water and supply powerflight, the BT's and MM's of MP-2 4Aft MMRJ perform one of the toughest jobs onboard. While temperatures topside soared in the Persian Gulf, dovm in the holes the heat was unbearable. In some places the air tem- peratures reached 150 degrees. These PELELIU 'ipit snipes worked long hours both inport and underway. While the rest of the ship took time out to relax during port visits, MP-2 personnel could expect little relief since the boilers still had to steam and turbine generators still had to roll to provide necessary hotel services for the ship's crew. Thanks MP-2 for your dedication and sacrifice! In- WRITUETT------' -MTN--I : emma Enom: u smut Mmm une smnrr ' V I . I Q SHAFT BEARINGS I Q PRESSURE I , Q .. - 4- MAIN runnin: ' qu l f REDUC-non - : , sm - Clegg:-I srnur srsnn runs 1 1 . . mopmia aenmns nenmuc I. .... - .... .. ' - . fE.I X nuu BASIC PROPULSION MACHINERY ARRANGEMENT T0 STACK X F T0 SJPEHHEATER . ,T 1 I A fi iii ' -... I lfjihf lv NT T s.. -N ,I L' If j iff Y I j ,Vf,If1W!I17f1'f,'! In I, r1.lI' ,I 1 ,la I U!! H II 1' 1 IIAII-III, III ll ' I I A urenusrrs I I I' U ' '-,Hg I '-.,, fFg,ig 'vi I 3 U X wzf X ty, sniff, N I' II 4 I I'li'II,- IIITAII1 I' X- 'I II. 1' 'LI-E ISI' I E, 5'-:Mal il 1. D I -.' ' I ' ' l I 5 Sbzzitzzzfi ' Nl. '. -Ilia, .iIiaI1,liill.IIuI I ff' , ' ,:f . ' , . -' ' , 1 - ' . ., ....l,....,, scneen naman! rd-4,-:nf I H A . Q VYVYW U '- A IQL-X A. WATER DRUM D. GEIEIIATIIG TUBES B. SIDEWALL OR REARWALL TUBES E. STEAM DRUM C. SCREEN TUBES F. DOWICOMER Top Left- BTC MANNING CMP-2 DIV LCPOJ says, lf I move this just a little it will keep me cool. Above- BT5 MACDONALD hard at work again or just getting dirty? This 4 Q I , , ,iv 7 ,Q ' Q x, VM. , is 7 :ff 2 1- 1' 7 f ff ' .Wy S7 ff H 5 sf 'cf 'f mf f ,A Ni lv? ' X4 - ' Sf 1 ., 5 BT1 A.B. JACKSON MM2 J.A. BRIONES BT2 D B GO BT2 R M FITCH BT2 F F MIKA Com to ,CA ' ' ' -- EU5 P n San Antonio, TX Bulagan, RP Rancho Cordova' CA Pago Pago, Amer Somoa 262 ENGINEERING a. f- -q'lj,k,k,.,-, A. '. .-...-f,.....---f--f--qm.q - 'fs-apn.-une--'-- 4 ' '--' ' ' ' .-, , V ,- 1 I 'X f ,ja aasrc stun CYCLE mmm- P . ,X f B hm, gi X mm X1 gg Q in iii - 'ii SE ff ......... T!! w as I nga -1.- -..::-'S Top Lett- A meeting of the minds QMPA and MP-2 DIV OJ. Above- l've always wanted this painted 'Q -J MM5 J.F. COFFMAN BT5 M.P. MACDONALD BT15 J.C. HOECK BT5 P.A. MARTINEZ BT3 D.A. SMITH Ft. Lauderdale, FL Las Vegas, NV Davenport, IA Bronx, NY Baltimore, MD 'S w. MM5 M.L. Kino MM5 T.M. BROADNAX BT3 R, cfxsmmo BT5 J. HOLMES NM5 NH- TIEU Detroit, Ml Memphis, TN Brooklyn, NY Brooklyn, NY San Ffaf1CiSC0, CA ENGINEERING 265 ....,.--1-v,...,.-....,..,..-..,.....,-..,......,.-Qv.-,,- Q.. .. .........-.ff Lv- ,.,, - -.,....,......-vp., f-.. .,.,...,X-....-.,..,.,,... X-, ,...--.-. 1. , - '42 N ffl is sff'i5b,1'4s f , gtg : QQ' ,fi ' 2 ,Ev-S 3X:5.:gg 2,157 ' 5 ' X X N YM XX X X f Xgnsxxf 'X N SE X X N J Xss Rx XX XX X Og X X X X X X QX Q X X XX XQX XX X Q P X X X A X X S X X X X A f X X W., X , - f S XX ' SN Qws -N , Y. , of QE . N .XX ':- if W:-n Nm if' - X59 157.05 1 f. X i' X ' K TXT' ZJX ,599 V . X Xp L f , x ' X J 5 fl w Q f A f ff, ,f ff ,ft ,f 1 X ,, any ff , ,Q if X Mm M.R. SALLEZA - , it 5 ,F 6 Quezon City, RP A J 1 Huw, x I , f x, . D , fi A , f FN HUNT takes that smoke break. BTFN EDWARDS checkin' out the heat. BTFHA-MiWALLSQ ' ,e X L, X ' X, Q , X, Detroit, Ml an ke V it if t A wfni V, X, MMFN E.J.glEA ERA X 1 ff El Paso,TX Vi A ' N 1 Q , Ms , 1 if mmwwg X X X f X X A N0,.X.-f,,XX N , X .XPNNNXXI 'A X ri? fx N f , , N f f X X X f XX , X 4 x X5 X X W X N X' x X N X FN M.D. JORDAN BTFN R.E, JOHNSON FN J.J. LEE MMFA M.W. GRAY FA D.R. HUNT Chicago, lL Firebrick, KY New Orleans, LA Humboldt, TN Louisville, KY 264 ENGINEERING Why work when we can smile! ------v - f.,,,,, qua, -, 1 .J ,H .,,v,, Mr..-V . ...H .,..- CAC in ,1. A ,'dij-Q.,-1-f-5.---.. h L,b - . ',g.f',ff 5- ---5. -4 .342-2, '?'f:a-1--'aa-eww N- - .,-.1-Y-' ,'.. .' ' -.JI 21: 1, .-w :A in-'Jn' -'3' ' 7 . - gg ,-fy 3, ' f .--two 1 K3 4 ,-:ff - - ,qgvy r- Q. l .-v -I 1' . .ti-,537 , ,- . ,- n - 1 -,.A.v:t,5, ,., ,f--'45 '--r. ' X, 1' 'fih -rc-K.f'7w,,'fQ .3 ' v. . X F' .3eQ.,,7.--Qlxz, x - -,. -Q. 'F f:-12:-. ein- ..-... 'TF 'WSF- . - , -,,-..,::--' h V ,f, '.- , x X ' A 'P Xl. C, LX' MSI' D 7-.,...--- X . . '- '75-..'j:-WW, , . , 517424197 ' N. 1- .F . .-I-,Ji-1 -4 Lg! - '. -4 1- 1' , l' Y, 1 ',:-u-., ' V A ,Si-I , .x-' ,. ' 1 'J- . - .. .' 4 1,1 --nf ' . x. '. ' 1-Z9-tw, , l '.:,P. X .1,-Q' - ' E - . -' X rffsb 54 U .5fQ,':5 - 5, ,, '- -' .' i . fs- 1 112- - . ': -' - ' - ii-C5 A ff f : .5 151. je J . .- ' 4 Q ' ' 2' . N j A:-'11 gzfg X M I-'4 Q 1 'sf 1: ,t s-. .5 '- ? . -1 . V4 .:..,- 5 Liga 4 1:74 .. ,--, 4 Rf'--Q Z , 9. ', QF ., -5 ' ?Q.':fg 13-Q1::,'?Q 21.12 X., --L 'f1 'Q -5 ',L24Qf,g'j:S-- N 1'- AVA '-Sf' l' .f 1, .. '1 .555 .1L :?. T'---' ' I'-y,,sZ-ff5,-.5 .X - xl --A ff .wr -'F.?', '.'g-9'-X - ,---X'--. , .- -. . ' - . Af ' .. Q .T V-1.3--,.,,,..T, .7-,, - V K L is- Qi ful '- t 254174 3 ,c th -3 f!.?1q:-.,.,.'-.,,'..: A-.-5, V fl: I - . .uh .3--J:-ly:-, '53, A 71, bw, -f .5 , .L-,.,eAT4' N,-'-951' ' G1-Az, - J1-r,...r n--,.. 1- fiig :zh- L . .M ,W 4- .,'. .. I I, ' '--':'J'!..'-rl-2 -'7 1 gmac M' -- ' ...-v 'Q gf uf 1 i-.Ffh I 0 .,-, H 'iii 'TQ - -4,5 ,jvf '56, N,qi,,, E A ,.,f.i5a1a:,jf-' -.rlzngg -,- -.-119,-gn. mf- . ., w -f- -+:-. , ,I .4-A:j. - .he-x:e 'f' ri- -' Q X Q N 7-Tffbii' wf- Q N Yyxyu f x X. BT5 MISKOLCI at work in the heat. E '-'ui 5641221 I 1 4 :Y FN N.D. WRIGHT Long Beach, CA BTI5 M.W. ROBERTS Long Beach, CA if fa-5 .- 34:1 f 4 2 E BTFA T.M. EDWARDS FA S.A. TOBORG Flint, Ml Long Beach, CA LTJG NUGENT checkin' out the crab. f 6 5 FN J.N. NAPUTI Sinajana, Guam FR E.D. BRAZLE Elderhdo, AK ENGINEERING 265 I I M I, I I I 'I , I I I I . I l , , I I I X I ' Wig I il MMC R.J. WOJCIKOWSKI I , Paulsbo, WA MP-5 DIV LCPO , 34.17 1 S, I 52 I JE, lg 266 ENGINEERING II! I. ,rr lvl MP- Simi? BTC A.M. SIY Long Beach, CA MP-5 DIV O MP-5 is the smallest division in Main Propulsion: it's composed of the Automatic Boiler Control shop, Engi- neering oil test laboratory, and Engi- neering Logroom, The division is manned by nine BT's, one MM, and one yeoman. The ABC shop is responsible for the corrective and pre- ventive maintenance of all pneumatic components relating to the prop- er automatic operation of the boilers and all supporting equipments to the main engines. The OIL LAB is responsible for the chemistry of the boilerwater and feedwater. The OIL KING, who mans the Oil Lab is responsible for the quality of fuel oil and lubri- cating oil. The Engineering Logroom is responsi- ble for all engineering logs and records and all pertinent correspondences and messages the flow in and out of the logroom. BT5 ABEL taking a boiler water sam- ple in Main Control. BT1 F.T. SCHENK New Richmond, OH MP-5 cnmum' in me on lab! O I Q . BT2 w.w. HURLEY Lusby, MD lu-ms. BT2 E.A. MANALANG Laguna, RP . 'Ruin Y v fl? YNI5 D. MALVEAUX Lafayette, LA 33, N BT5 M.R. VELA Ridgespring, NC ..-..,fi....-.-......-. - ---gk .,,,,51u'-'assay-vffi--+ ' f ' , , T f' l Q f :mini Y 'Y 4 ,-4 V B-I-5 JDJ. ABEL BT5 L.J. BROWN Watertown WI San Antonio, TX ni.. Y v BT5 D.W. BURNETT Will0wS, CA BT2 MANALANG QABOVEJ and BTZ5 BURNETT fBELOWJ are conducting one of the many functions of MP-5 Division, Boilerwater and Feedwater chemistry tests. lu- ,. , ,...., ... .......,..,.i.4. ... - -.n....... ..,.......,-..--.-A- agaf' f Z 43 Z ENGINEERING 267 COIVIB The Combat Cargo Office functions as a special staff to the Commanding Officer, under the di- rect cognizance of the Executive Officer. The Combat Cargo office is responsible for coordina- tion with embarked troop units and appropriate department headsfstaff officers in the prepara- tion and execution of plans for the embarkation or debarkation of troops, the loading and stow- age of troop cargo, the unloading of troop cargo, the billeting and the messing of embarked troops. The Combat Cargo office also liaisons with embarked troop units as prescribed by the Commanding Officer. The Combat Cargo Officer is Capt. Corbitt. He is assisted by Master Sgt. Hardgrove fAsst. Combat Cargo Officerb, Crun- nery Sgt. Tuche 1Combat Cargo Asst. - Well Deckl and Staff Sgt. Hawkins fCombat Cargo Asst. - Flight Deckl. Ship's platoon consists of 48 embarked Marines from all the MACITF elements and are guided by the ship's platoon sergeant, Staff Sgt. Crocker. These embarked Marines proved to be the muscle of the combat cargo body throughout this arduous deployment. i'We here in Combat Cargo want to wish our Marines the best of the best, Semper Fidelis! CAPT S. CORBITT COMBAT CARGO OFFICER not pictured T CARGO I QL QU ewx ffffwf. . sis- ' z'ae'- V 'Kaul' Pllnpllli 1. :luv s'Q. 4 25.4.o.fl A I .Arfgffaxxx yfhivvi . 6-Mixer 4 in ,, 7X1'7n24. 4 ,n X Q-9 .. ff 9 Q, I - 4 9 V N V gi ' ., A 1 3 goo-7 1 I 1 9' ,I I Q f .4 v 'ff'-ff' 5-' 0 ohm 4 V! r l ovsor E. w. 11ARboRovE QYSQ1' D, F, TUCHE ASST CC0 CCA-WD A GYSGT Tuche takes a walk doum his domain. sscn' J. J. rm T T CCA-FD wkms EIS?-lg 511+ A. CP-OCKER cm. w. A. STANTOHX CPL B. A. ALBRO PFC B. N. MooREs Ncolc . . , PLT ADMIN PLT ADWN 268 COMBAT CARGO ' LCPL F.P. BASSETT BLUWPNS scar rs. Boch 15TH Mau PFC J.M. CAVALERI Bwfc ,f ,,., ..w..- -V-.-1-.A - qvqatvn-vz'.'f..-T'-Y--Pi ' ' ' 'A' N LCPL S.C. BENTON HMM 165 LCPL s.d. BROWN BLTfC PFC T.A. CHADWICK MSSC1 ,f Loaded and ready to go Heavy equipment heads for the beach ,MAJ ,. - WL, Women, children and teddy bears Tired Marines retum from the beach WM JT N4 if I , cus CPL D.D DANIELS LCPL A.T. EDDY LCPL GP- FU LCPL J.L. COOPER LCPL M-5 CR'5AFU ' ' BLT c M550 HMM 165 BLTfWPNS BLTfH'3'5 f . . ,....... . ..4.... ... . ....... ... -,-...C....- ........ - - V- , -- R - COMBAT CARGO 269 1 1 I. ,. 1 L IU P . - - - 'd . 1, A big bird for a bug load. CPL FJ, HAMMON Step HQN UP! me Uckets for 3 U eo HMM 165 Mvrrruuvuag Km CPL F.R. HARDY V 15TH MEU ,,,,,,w'-W' L M K N 4 L 1 1 W A ,.: I I i fig W 1 i 3 L 3 LCPL J.R. FRENCH QM HMM 165 fig!!! 2 LCPL T.A. HALLOWELL I HMM 165 l ,.: Q, M LCPL EM. HEEREN CPL w.T. Jones HMM 165 15TH Mau Cr: PFC B.A. HILL PFC rm. MA BLTfWPNS BLTfC CH-46 in action, the Navy's workhorse. LCPL CLE. noooss CPL w.A. MCMICHAELS BLTfWPNS BLTfWPNS 270 COMBAT CARGO '11 A 1 e LCPL VD. MMS LCPL M..J. Moams 15TH Mau cs BLT!C LCPL S.E. PETSCHOW MSSG LCPL J.A. NA BLT fnsrs LGPL DA' PRUDENUO Bringing home the groceries! USS Roanoke dehvers the goods Msso if LCP1. cm. RADCLIFF BLTfC LCPL F. Roomourzz LCPL o Roomourzz BLTXC HMM 165 Bl-TXC ,.,.,......-.... -...-.,...4.... - ........i......-.............4a,. gllikflzllgjg SMITH A quick trip to the hospital. CPL F.N. THOMAS 15TH MEU LCPL s.s. smrri BLTfl'l8fS E 1 4--.,,,-, CPL W.K. SPENCER MSSG Mother Bird hovering over eggs? l'lun'y up or you will miss the bus! 272 COMBAT CARGO LCPL B.L. WILLIS BLT fWPHS IVIARC0 DET MARCOMDET is responsible for supporting field communications like these CAPT D. PIXLER Red Bluff, CA MARCOMDET OIC MSCIT R. CAIN Cleveland, OH COMM CHIEF ' A III, The Marine Communication Detachment KMARCOMDETJ is a , 'i-s iffy Fmall Permanently embarked unit of Marines tasked with assist- ff? Ing the communications section of the embarked Landing Force I irqs Command Element in the execution of amphibious assault oper- J,J My 59 ations, contingency plans and training exercises. Similar to Kitty ! Combat Cargo, MARCOMDET provides PELELIU with a year- i i' O round Marine presence on board. When not on deployment, MABCOMDET personnel assist the ship by performing specific assignments. ssor J. FEI-:NEY Albany, HY RADIO TECH IVIARCOMDET 275 ...C.....,....,,....,.C., -----M---.- In the days of wooden ships and iron men, life at sea was harsh, at best. The sea took a heavy toll of lives. New seamen were always needed. Recruiting 'green hands' was often quick and brutal with many new recruits taken unwillingly by impressment gangs. Shortly after 'weighing anchor', newcomers were in- doctrinated through a rite that was intended to sepa- rate the weak from the strong. Since these new sail- ors were considered soft and rather useless, they were called pollywogs after a new-bom frog. After the ritual and their lirst few months at sea they became uShellbacks . It took a hard tough back to endure the work and the punishment meted out to them while at sea. Thankfully those days are over, but the rich tradition of turning pollywogs into shellbacks , lives on.To be a shellback today two basic require- ments must be met. You must be on the ship when it crosses the Equator. The other is to complete the Wog Day r ceremonies. Above- FC5 Tess, one of the Royal Babies, accepts a Marines' kiss, Below- Wog Marines converge on the tunnel of slime . 274 WCG DAY FCC THOMAS, Pleptunus Rex, Ruler of the Raging Main presides over his unruly royal domain with Hall-seeing eyes. Above- The Royal Doctors give this Wog a shot of their special med cine. Below- Ceremonial bathing cleanses this slimy Wog. lil 'ff 'NY'x7hi5'if'1QrtiQ' - A Above- Lunch Time!! BeIowfBelow Right- Wog cattle are herded by many Trusty Shellbacks . .' The Captain receives a summons from King Neptune that his ship is infested with pollywogs and must be cleansed before he is allowed to continue. On PELELlU's voyage King Neptune was portrayed by the crewman who had been a shellback the longest. On PELELIU, this honor went to Chief Fire Control- man THOMAS. Davy Jones, King Neptune's emissary is the next senior shellback. This honor went to CDR COOK, the Operations Officer. The other members of King Neptune's royal court are chosen from the rest of the utrusty shell- backs. Each pollywog is given a subpoena to appear before King Neptune and prove himself worthy to be a trusty shell- back. These tests are messy, odorous, and generally more fun for the shellback than the pollywog. Should a pollywog be reluctant to join in the general merriment, there are always some shellbacks around to urge him forward. At the close of the ceremony everyone is satisfied. Shellbacks have enjoyed making sports of their less-salty shipmates while tired pollywogs join the ranks of newly ordained shellbacks. This means next time they cross the Equator it will be their tum to initiate new pollywogs into the 'mystery of the seas'. DS5 MITCHELL, the Wog Queen, stands between his fellow Combat Systems Wog Queen candidates. l'ORRRRRR!!!! , says the Wog Dog. WOC1 DAY 275 y 1 A V, , , ,..,..,.....,,......V..- ,...,.... ...,.........-.-4... -........... . v..--.T,,v..v--.-N,-,---..u.,-..f--v. M-...h,,.,- ..,.....- ,......-,..,,.Y....,.--:,.........,-...,,,.0.w-,..,-w-.....-.-V -- , , , . ,. ........-............ I OOO O Oi 4 ee L .1 R - 1- I I c, 1-V 'ZZ ' I X W ff 6 , I f ,, , I I I 2 I 2, 'J I ll I Ww..,.! .fi 1 fx I 1 THE HIGHEST COURT OF. THE RAGING MAIN. ' Skipper Wog Queen Neptunus Rex Wog Queen Davy Jones 'Q IV E I I Z A' Ei ' -Q 'I II Q I , I .2 qffT'1,L1Zfj?'A.N 1 - If A Y: .I 1 :JJ I IL' Xi' L' 4 I TB I 2 I ij 'wifi 4 Z Q 1- 2' u 'IH Jff I Nr' X- 'NIH ' QI 'FQ '5 11' - -'If' II I M , X, .. 1. I X Qing ' -YTQIIPII' - -II ll qifwzxg h um-7 . I 1 I 1 ul Jig 5.19 ' , 4 639 'EI z, DOMAIN OF IMPERIVM NEPTVNI REGIS I1 ,, .,..,,.f-, ., . , , .,,.--,-,, ,,,. .M -.. ....,,,,- W ,. W W ,. . MW. ,..,1.,,,,. M, I. 276 WOCI DAY 4 MFE C'-'NEB F 5153351525 Qiii Nl J PORPQIQSES, SHARKS, DOLPHINS, EELS, SKATES, SUCKERS, CRABS, LOBSI ! Wai an 2 Mwmgw 71997 , Mere KQWWPKHWKZ 10474611 Wm: 0 QGIZYKIKIZE Me 3 16215553 lie Jairf wifi and Cgcew Zfexew lane 666123 ALSO BE IT KNO WN! ye men zafoaqa fklzzrn fo I14eJea ad meh, cya :gg 3 Q1 1 HAWNG BEEN FOUND QUALIFIED TO BE NUMBERED AS ONE or oun ng U l9 1U11 53251917195 Uf HT? BE IT FURTHER KNO WN: Plaid? mam cozm-zz an rfaffm Jageclfi fa Jima the fan on , '-.E ' A E, 3 T , , -an DISOBEYTHIS ORDER UNDER iPENAl , A S E EES SE S SE S JE' 4 ' 1 fem , E, Zia? M His J1u5Es'rY's SCRIBE 1 F .,....KmK es Cwog Queenlbogb CAPT Levien COL Murray CDR Cook SGTMAJ Brown BM2 Davis SGT Burden ABH1 Barroga DC2 Weekes SGT Koelling Royal Judges QFLT Deck! GMG1 Nylin ABH2 Forbes FC2 Koenig SGT Brooks CPL Guffey SHICSWD YU BMC Conti CPL Thomson Von Sgherr CAPT Haskell LGPL Davls FC5 Schaff Colonel Murray was commissioneda 2nd Lieutenant upon graduation from the United States Naval Acade- my on June 5, 1968. As a Lieutenant, he served 1n a variety of billets at the Marine Corps Development and Education Command. While a Captain, he WHS HS' signed to the U.S. Naval Academy. As a Major, he spent eleven months with the History division at Headquar- ters, U.S. Marine Corps, where he co-authored UThe Marines in Vietnam, Vietnamization and Redeploy- ment . Upon being promoted to Lieutenant Colonel, he was assigned as the Marine Corps Senate liaison officer and then later as the Executive Officer of lst Marines. From this position he became Commanding Officer of lst Battalion, lst Marines. Colonel Murray assumed command of the l5th Marine Expeditionary Unit KSOCJ on April 12, l990, and was promoted to his present rank of Colonel in June of 1990. Colonel Murray's per- sonal decorations include two awards for the Bronze Star medal with Combat the Purple Heart medal, two awards of the Meritorious Service medal, the Com- bat Action ribbon, the Vietnamese Cross of Galantry with Bronze Star, and the Vietnam Staff Service Honor medal. Colonel Murray is married to the former Cather- ine Ranieri and has two children, Kelley and Brandon. CCIVIIVIANDING CFFICER 15TH MEU E I IQI IQI IEIIKI ,.., 'own , QS 4. -.-mg. , 'i '35 2 il 1 tix - f J A III IIIIQ The Marine Expeditionary Unit, or MEU for short, is a Marine Air Ground Task Force CMACITFJ comprised of l,000 to 4,000 sailors and marines. It is nomially supported by a reinforced infantry battalion, a reinforced helicopter squadron, and a service support group QMSSGD. The MEU is forward deployed Qattached to PELELIU ARG, as the immediate response unit for the Pacific Fleet and Com- mander FMF in supporting amphibious and power projection operations. The MEU can also deploy on short notice by a mix of tactical and strategic airlift forces for contingencies in defense of fleet commander's objectives. MEU's are continuously deployed in the Pacific and Mediterranean Ocean areas, with peri- odic appearances in the Atlantic, Indian, and Carribean Oceans. The MEU is task organized, trained, and equipped to conduct a wide variety of conventional and specialized operations. The MEU is ideally suited to limited operations involving quick reaction long-range amphibious raids from over the horizon without elec- tronic emissions, during periods of darkness, and under adverse weather or sea conditions. For sustained operations ashore, the MEU may serve as the forward element of a Marine Expeditionary Brigade QMEBJ. ' ' -:f'i:T'5?,., 4 1 IE! 1 bf' IEE EIIKIIEI ii' 280 MARINES A ' I I ES? 4-f 4ZVQ5. . -MAIL Q Q., 'Q 7- 4 .. , ,, The united states A Marine Corps, older than the Republic itself by a year, is as familiar to the average American as the 4 effi, A flag. The Marines symbolize, more than any other part of the A N .. natlon s armed forces: discipline, valor, patriotism and M . ' .M ew , I . .! military virtue. Their presence is felt beyond the barracks as u on A the fleet and the battlefield. In Washington, they perfonn a , - ' ' X Lot ' , .,, . sux on , ,gt ' . unique ceremonial role and are the President's mu i ' s clans. gn nnv. , Around the world they guard United States' embassies. The Y , .1.p.1.1.1.1. characteristic distinguishing them from the rest of the American military, provoking a melody of emotions that 'T ffii W ff - - encompass reverence and disdain are shared b , , y all mili- gg tary elites since the time of Spartans. The Marines are, as ff' they say, looking for a few good men and they mean it. With a strength of almost two hundred thousand men and wom- Wm. en the Marine Corps is neither too small to be v , o erlooked, or worse still, absorbed by the other services, nor too big to Mei' lose its special identity and flavor. A separate service under J the Department of the Navy and answerable to its civilian head, the Marine Corps still enjoys a considerable degree of autonomy. The only component of the armed forces whose existence and minimum size are prescribed by law, the hw, - 7 ,t af' Corps has its omm budget its ovm head uarters bases W I q I 1 K Q! training facilities equipment and so on. Its military boss and godfather is a four star Marine general who is a member of if the Joint Chiefs of Stafb sharing equal status with the Army, -y W AXZWZ Navy and the Air Force The Marine Co s is structured and - YP equipped for projecting American military to hot spots '7 W around the world. Its uniqueness, in the United States and throughout the world, lies in its integrated nature as a fight- .7 -i' 4 0 ing force. Larger than most nations' armies, the Marines have their ovlm infantry, artillery, tanks, aviation Cfighters, reconnaissance, helicopters, and transportsl and supplies. . w With logistical backup from the Navy and Air Force, the ,A Marine Corps has a formidable reach and devasting punch. ff Colonel MurrayfMisslon ..... 280 5? CHRO LOGY CE, BLT, ACE, MSSG ..., 284-288 g.,y g gl? 3.1 f.,:2.fTmQT..2mf Articles of War ..... .... 2 89 ,fri, .2 Q'fffM f ': ': 'f'm U Action shots ........,.. 290-2,95 L3 an on mmm 4U1n:GonTA0l f if QSC The Marine Corps Hymn .... 299 ff ............304 A ,Z In memory .... gy 2 g s Desert Safari . . , . . .306 A 'MA' Uniforms . , . .... 314 zf iiill Liberty call . . . . . .315-313 MARINES 281 tl'- 1 -I - 1 .rx x Q 1 of Miiwrimmi ML fx mx 1 - f7 of - . N X My ! G' H Top Right- COL MURRAY runs with the troops on the Flight Deck. Center Left- COL MURRAY plays some hoops with the men. Bottom Left- COL MURRAY takes a tum at feeding his boys. Hf'Wf Q 5 f::J wlfiir'NJ , - tx M .WM X t ff 44 :fr ' Lt? :sm-N LXKYM . cl.. ooo cl tta , t al l l t Ho 2 f Q Y 3 4.3 .......... NX ,W 1 ' 'l K VX X F ND-I i S ' 'Y A 1 I l if-5' N 3 X XX P4 ' V14 N C-J gp Z ? KJ NC? 1 ai 1 1 ' N M A i f Q QM' I N , if , f YQX? X! K fi 'frm' f T! f ,iff 13 f X ff X f XC P f . ,-vi ff , ' X s if f O 1,1 f Q XZXQU ff if 3 I ff! X fit f'f ff 1 f,f,2xF aff, f 57 E F 'ki f 1297 Ziff! Z, ' WL if aff X fff f l Lf fff, !'ffffC'.!14!f ff, K J' ,fi 1. lf ff f .' 1 . The Command Element provides the com- mand and control of the other three ele- ments ofthe MEU. The CE may include spe- cialized detachments such as an air control detachment to provide a limited direct air support capability or specialized communi- cations detachment. 284 MARINES 21 xx xx xx xx 3 ff-451-i-3, G lx, I lk 'WH' wx SJW' Mlddle Left BLT 1 9 standln uard on the beach to ensure Airs Colonel Pratt was commls sloned a 2nd Lleutenant upon graduatlon from the Unlted States Naval Academy ln June of 1970 Iils first asslgnment after attendlng The Baslc School was to the 2nd Battal lon 9th Marines until De cember 1972 lie then was de tailed to the Manne Barracks Washlngton D C where he was promoted to the rank of Captaln ln July 1974 After graduatmg from the Infantry Oflicers Advanced Course at Fort Ben mng Georgia ln July of 1976 he assumed command of a nfle company ln the 5rd Battallon 7th Mannes In November of 1976 he was sent to Southem Lebanon QUNTSOJ where he worked up until December 1979 He was subsequently promoted to Major and attended the Armed Forces Staff College untll June of 1985 From June 1984 to June 1987 he conducted special operatlons overseas ln support of natlonal Intelligence objectlves Promoted to the rank of Lleutenant Colonel ln August of 1986 he attended the Naval War College ln Newport Rhode Island In August of 1989 he became the Executlve Officer of lst Mannes and assumed com mand of BLT 119 on February 16 1990 Colonel Pratt was promoted to hls present rank ln July 1991 Hrs personal decoratlons Include the NavyfManne Corps medal the Leglon of Merlt the Mentonous Servlce medal the Jolnt Service Commendatlon medal and the Navy Achievement medal Colonel Pratt IS mamed to the former Mananna Moore and they have four daughters Ablgall Sarah Susannah and Louisa 1 BAT TAL, Q m1 Cf? 'w- P7 1745? 'fflll Z' QNX ' f Q Q 41 6 safe passage for the troops coming m by sea. Above BLT ,N 9 If 9 Personnel work their way up the ROCK m battle forma M UOTI On the Island of lwo Jima. MARINES 285 ik-.i . K L , . i3i 5 ull ' ' l 5 1 '-Klux I 0 eg' ' - -l 'R , N 5 5 Q . ,X . V ' xl A . . . . 215 X ' S X' I , . ' V f . ' K X I , ff l 1 l . 1 Xl X fillx A lf .,,f:,..,-LA J ' - .i xv- X' X . . , . 4 -J: . S Yi Q- . 'V I gg ,.,-,,...,,,1'w. - Q -' ., - - -' F - to become a U.S. Mllltary Observer Crroup member if f ' I - I ' , g ' iffiiificp e A A f ' I , . ,j,,, I I I . I - X . . . N I . 0 I Q . . I I : ' . I I I ' ' 5 I yr I ,E , My ' ' ,, 'kyggw ll Q . f 1, 7' I f V 'FT' 'XX F A 2 I T 7 f ' ,s,J . 5' l A L, 5 1 A ' 1 ff ft zyqzwzzwaaaaaaaazawwawaazz 0 E T Q9 x ,M wa s Y u a MM X A 0,2 ,X I 1,717 ,f ,fus- ,AA fp? - fislkfuyeg + ff ,eq ff X if 1 ff I fi f y fi g f o A X 0 Q . o 7 X X A my W . M it 27 Q X4 X ff X X Q ,Z ' sc 75 454 vs EN- -,.., f A ,M sfg -'L W vfk- zwx Uk, T ZZ fs X 'll V c, a a . .-f- L A a ,' c ' 1 4'S: . '3?7i4i Qfffl ', f :ff :ff?ff x,':,f A A VY,., ,.'Lf:Vx, . g bf F A,V-, V!lV I ' f' f H- A ' 'L if A T1 'A' 1 ' A- A f ,: - 1 il' 'l 5 'fQ 7if2,ii'3T Q , i spla iiis f , V M ' ' p -J i-11 1, X , A -34: 4vL, i' Q A 1 i XQ l i i ,l.-ti. i, or-c, The Air Combat Element QACEJ is comprised of l'lMM-165 Marine Medium Helicopter Squadron augmented with four types of heli- copters CCH-55E, Cl'l-46D, Al'l-1W, and Ul'l-1NJ as well six fixed- wing aircraft QAV-8135. The AV-8B l'lARRlERs are actually a detach- ment of VMA-515 Marine Attack Squadron based out of Yuma, AZ A '?i 1' .. X V 19- rl A ' l H ,. X fl , ill V' . ff lll Uxi J X Q Buufr : I i n-Q lg ' Q, l qw p . i r I . ,X K 5,-' fi 7 ' Formed primarily from the Force Service Support Group. The MSSG contains all the logistics special- ists necessary to keep the ground and aviation Marines and their equipment functioning. Included with their ranks are medical, dental, engineering, communications, maintenance and many other I technical experts I l l l l Q L. Z 'TP ', I - 1 -' 7 MARINES 287 l l s H- WN -N im 4 H k .NMA - i Warm.-sk A MA mmol I- K Q 5 A0 R--...N . --A V Mn Aww-W--W---Y A,-.WA wk-W W, ,..-.,,,.,...,.,,,,.-........,,.,............-,..,... M .. .VN 7' 1 am an Amencan Iightmg man I serve ln the forces whlch guard my country and our way of llfe I am prepared to QIVC my lnfe In thelr defense ' w1ll never surrender on my ovm free wlll If ln command I w1ll never surrender my men whlle they stlll have the means to reslst lla Mgsfxq' lfl am captured I wlll contlnue to reslst by all means avallable I w1lI make every effort to es cape and ald others to escape I wlll accept nelther parole nor speclal favors from my enemy lj'o 'o9 'is Y -.L f I fr L l-ELM Si' ' I5 l 4-fosasw i llgnftaqxxb 5 Q ' mv f- flgf 0 1 ZA QQMPER FIDEUS .9 sv 4 lfl become a pnsoner of war I unll keep fanth wnth my fellow pnsoners I wnll gxve no Informa tion nor take part In any actlon whlch mnght be harmful to my comrades If I am senior I wlll take command If not Iwnll obey the lawful orders of those ap Dolnted over me and w1ll back them up In every way 'MIJA qu , 'bm..1.'+lur'U 3.-Sv as Zi 0 'IIIIIIW i--v 'Hams 4 X, When questloned should I be come a pnsoner of war I am re quired to give name rank serial no and date of blrth I wlll evade answenng further ques tions to the utmost of my abnllty I wlll make no oral or wrltten statements dlsloyal to my coun- try and nts allles or hannful to their cause X I I wnll never forget that I am an Amencan lighting man respon sxble for my actnons and ded: cated to the pnnclples whlch made my country free I w1lI trust ln my God and In the Umt ed States Of Amenca I MARINES 289 -- I Q gfftf I ' A -9 0 s JI v 1 I Q4 , Ganga ' ' g W 9 A A A. n I? 2 f V , x 'F I f L, Iyul I ,u,, I I 5 a , I I I I II I X fI1 I 0- A If 5. 0 I ' rrrr i I IIII ,, oo , ,I I yyfyy I X , I I I 1 H 5 nhl 55 rf :JE li I 7,,a.m,.C ffm 9 ,., 7 -,-' 5 2' :IH ', r P 290 MARINES Top Left- A Marine standing in front of a Combat Operations Center tent. Top Right- A group of men deciding if they should assemble a tent forthe night. Center Left- Assembling a gen- eral puipose tent is as easy as putting together a plastic mo- del kit provided you have all the instructions. Center Right- Okay you guys, just hold it there, the steaks will be com- ing from Pendleton any minute now. Bottom Right- Let's build a garage tent for our new L.A.V. 25 vb... VI,,In,w,,,,.......-.-..------uv-wmv ' wr.-f,,,,...-A -.,-A L ..-..,....,..,-..,-,-.,-Y A If f.. .,.,- - . W -,.. . , ...HN Y M ,.-v,-..--1 -.-..,,. H. w 1 , 1 1 , V I f 1 x e I ., f 'M ,, 4 WI' , 2-f ' I 3 - f .3 '15 , M f . , f' '-'J V' X 1 f Q 5. f ' ' 1 2 qx , W... b if 1 , 1 1 A ' W, ' v ' lr. .qu in f' Q ' f lawn 'Z ,, ..A,,,3.,,,. 1 M 1 , ,Q . Y. . M, av., ' W. X ? ful' fi W ,X 2 ' M Q, . 7, , 2,4 If ,f V. :, 1,,e, K ff eng W Q 4, 'ry ' f' ,, 57 V' If M W, 3 ' if 'f . f ' fn -Q 4 f 1 W W aHM'fZf9 if 2 i 11.1456 , W if f X -fi' X' -Nr Z Q ,... Q - MARINES 291 X N X X .wk X Sxi .. .N ... 'gxgf-XX A. X X. W Q X ggi.. 1. fi . . .,.. ...X N f m .X WL ,Q N . X . X X Q X A E X X X- x N 5 .. 1- F . X Xwwkx NX .x kg x XXX XQSX f 4' 44g-fuuQ.rli.uu:W!'Ti1-V-'vii fl308'-'ffm '- -N Li sl MARINES 295 x , -ls.. --.......- . '-'1 .,-, W M.- .,.v,F......,,-..,-.. ...M .M ...,.., , Www. , 294 MARINES ,., JQAQX I-'ie , 4'?f sf n s A Marine has the enemy in his sights with his M16A2 semi-automatic rifle equipped M2055 grenade launcher. Below Left and Below- The Squad Automatic Weapon lSAWl in action on the firing range and in the field re- spectively. MARINES 295 i 'w:Q?-IEW... nz Q wr - .Env T. ' L .. A w? WE. . J. , 5 W x ax W N n 3' . 15 N 296 MARINES 1 ,A ' M- , iw- vx AA 4 W- 44, Q.. 42 W 4 z -. ' XF' 1 W, K X,h:32:,!?. M , , , 4-sul K ' ,...' + ' M-Q A .A - :+. .-' :A .J-A fN Z, f -x-'lx' . V . . 1-. -gi - -A. . fm? ' .' . i. 7X '75 -5:4 wx - . .5-3' P5 PQ , ,Q-Llfri , Q . ' .gg-T12-'.L,r '..j.2-f if 2 - . .. , -. . uf' f H - .:.Q5f.- gr- - -.vu - ..'-':.- tri? f' - . f -- Lf- 11 'f,1 JgN!.v- Y ' Mr. QQQ.-1.j,g.,1,,-..-4 . Q.. - 1 SJ jail Lt' ff' '-.s-r,,,- - '. 1'h,., x fp 5 A ff-3 if ' fra-hh!-' 1 .'ff n fm-1' - SPT' -fax IP .as-:sv , 4. .g- .- pn .gsfx-,gf .. , , 7,-.-6. 3.3 Si,- -fiifef ' . , -'51-11 -, ' --it gf-' 33'??'l':4' ,- ' -u:'.i'1f' 1- :PF 212 .n.1. PJ3 wif . ,5 -. fi CQ' ,Ag 45 - wp.--4 X , snr' . - .-Q p.- -:wfr 'fr ' x -,r':k!s.. , 7- - ' ,: 4 HM . -i 4 .. -. :- . 'f246'J 'QA ,..'- ef ,au gi: 'sf .-5: Egg., ,A-1. , Iva, D ,-', fx. l U .-gfvl-25,31 'RW 9 vrk ikz-g..R1'f, - yi -,g-e. . , 53 fir.--,-L33.,?.,, ' .Q Em, :x,.,A,f,i ..,-.1 -1' g ua - .35 5. .0 .-Q .---fx - .- ,....'- - ., . ': 4 . ' . f1i43.?'2f- fe- 5:99 -7' ltiig. ,ybtf-' -Q 4 ,.:v,. ' X-:'.r : H+, Aw '-qqgp S. ,gy v, H :if -. eff- f.--rr, gf'- .fwzlm n.,:4, .J 4- '7,:.,..- .1 , Q ,ik .h R5 4 2 - -. . ,- ,g7'1 -fn x.-'1?-'d-',,N- -J ' 1'-X3 51 vi f :ly rf '3' JZ' -N.:. f:-.-P -:1 aff fb.- .a gr,-1 ws .. ,vgqj ,--:fygvv-:I gc' Na 5,51- .fnfybi 'Q .--'qu-'?'Srgw-.'.2f2ffp 1' --9 wr 'F- riff '?'L':l55:-:Ti-'5V'15 :Y '13 f .7 I' 745 533' f?J-SL lf ,L4'Y -'iff-Fff-4-'+vb2:1':7QM?C.5?Z', 4-. gif 'f , 'Ei-14.-7 N.4-r f?-1Lre-ri-T-'brx- ug J,.:q,ggf-A-. : Q2 u.. 1. .g.: wt -,g-f', AM gn-mc,-.-'-' 1,-.wr -Q pgf.N'.- gg - 1- ,vii R+'--?':-'.:':'f w 'r 'f-N-'mg-,-.N vt' ' S-'T 5 .Z-35'.'1'Qf5-vi 'PQflZT3:','5gS,fg95-v' gx. '13 -.vi . .w.tv.ee,-.w2qd,1fGiQmf+A2: L .Z 4M,3s..5s,.5..x., ,X . ,? . ,,k T A. ,Q 2 , ff. i 4 U I xfvg ...ng .xx YN - Q ?f'fi is fl ' 3' X - on ' Q 0 4 in ww fqju, 4? . ,aku 'Y 42 , , K WE. XV! Q 0 ml,v,xXXQ5 M 'I . f ., ,A iiqg I 11 'Biz X 17 lx S uh n ' A 1 XX. Ja., f , w, v. gf, ,hui 4.- 5- ' 4 I 'Su 4' i J I . M K S 11v'.axxxi 1 T ull 9 , ' 14 ' Q WN f' , I ic. 'M ,hui 5? Q. ni T 5 IJ Al J .N g 1 1 .N - 17 N 57. 2- 4 ' Z' , ff 130. Q Hg vf '64 'fs xx f Q M A AW' ,, f 4 1 572 MARINES 297 fs? in ,xwwy wx N N44 fu-n Zh , xxx? I 1 u , 525 ' Marin ar'1':f,s, 3. 298 MARINES I N - V.-:...,g,-,,-... ,..,-,.,.--,,-....-.-,if f-: J -f :ff WL -A--M ' f ' ' J-' H-EL' A ' 'SL' 'HJ' ' ' ..,.,,,.....,.....,.....,,...,.w.,,. - R X nllill , .1 , .Q M 1 5. ready and my Bird is 1,- I to the Persian Gulf -, 1, 1 5' Four Amigo Ma- ' - -In :yi I l I lf. -mlm, :gb :' , ',' O 'K X X I 500 MARINES K- '-il .ikrg 53 X- X. Xa-NQQXXXXX X NW xX x? v'f X w-XX NA X N X E WX Xxxk X W YN XX XXX XQX Xxm Xivxx X X XSS X fx X NW N X X Ki Ei N XXXXXX X XXX. XXX HXXX rrr, r.rrr,,,, i XXX XW XXXN ....rr,x,. 1 rr..Xr... , , ,:.. Q .,,,, X MX - 1 Y FNXX. if iXLlrQ'..?195'-fix if uric N X-QLNY 511 ' ' W I XX 'X C' N X U . . N .X X 1:12-.-.X X, .X -- X-XX X - rg, --.Qt X XX X FX QQNSQ., r x an .XRS Q WXXXW K NLW N S. XX W X X XM, W fx f, ' X1,,.sf.T'-O' XX X XXXXXXW' . X y y -A XXQXTXX XXX? 'X' XXQQKS -'Sex X 'X N-.QXQVXS X ' QRS 1 V X 1 - ' ' ' TX 9 .5,-'QX As 'XXX N WS 'Y x X. Q' QX X . XX X XX XXX XX M --,-, X X- - ,.. XX-X-X ' Y Nw g XX. -Q XXX,xXk'X J XX1-XXV Xlgxx ,X XQXXXXSQSX XYKXM X X X , XXX XX XX .XX X ' s XX X,1.XXX vw y' X X - ,AXXX-.XXX UTXSA X X X 5 Xk Y N , -A wx 2 XXX X X XQ XN wg 5XXX2r -X-X ir' X5 X: Xv- HX X,-X -X X XX -VAX .XXX X XX X NX X -N XTXXQX XXXWE X- XXXXS xwecyx 1.1 X XXX 'XXXQSB wx X XJX VX XXXQXXFRX X X P X Xi- X X .X-,A W X XX X -i NX XXXQMX 'XX ' XX XXX MXX X- X X .XX x M wr X rf-X X XXX Q--fg? wk 5 ' VL XXX N 5 'XX 'fix XX X 4 fXXXXX,f1iXXXX' XX XXX XXX Xjlilw fkfm 1.95 QXTX QfW'XC'X ik W X XXXL, . X' gXSN.rXXXX X XXX XXXX., ' X L M X X X - X XXXX ,XXX 1 X XXX, XX X NXXNX . AX r. , - Q 5 1 I . , I Q I. I A Xe. if we-. ' 2. E-'sg LF 4, 'lqkm . M 131, : , A img - ' 41,-AQ, . 511:51- ,1 Z 1- I Q .uf-'IN sf' J- I z Jk- . 15 A1 ' , . 1 . . im 'Ol 17 Q 'n , MARINES 501 Q.-v-f .....- Mu., X 44.-ex ',-Q59 1 .3 ,' Y H 'V ia '.. i- 502 MARINES gr' W 1' -' - . ---WV,.-,.----,,,,,,.,, ,, I K I ,,A,w N. ,M AVN xw V. '33 , Q ,. fgggefzx f .V Q Q 4 ' xA W N I 5.5. f Q ,, , ff . wg.---' 1 ,, MW ff MAH MW! 5 .Qi f if K , . , wr r:-'- , - 2 Eli I D r E , K i MARINES 505 i J I 5 F il 1 w 1 3 l 5 5 5 H if 504 MARINES Qlggiliglfaflffim Top Left and Top Rlght COL MUR RAY promotes BLT 119 CO LT COL PRATT to the rank of Colonel Cen ter Left CAPT MYERS QPELELIU COD and CAPT WEISCOPF IPELELIU XOJ take a plcture wlth the new Colonel Lett and Above 15th MEU stands nn formatlon for the promotnon cere mony 2 Q Si iN 3 IIIIIIIII L , E 5 S if fi ir ,4 - li' ' I ,E ,i. flf' , Mr r zigsgggr iii! c a c wi MQ N N N N Q Meg f I ' Ms N NEA ,I ' 'iii NH-2 f, , r , M in W r J r , 4 iii? ii ' ' Ei VL if 506 MARINES , . - L? .J ff 1 ef If F , f ,. V t . If 1 - . f ga WAY TO G0 NELSON FOUR MORE AND YOU'LL BE A CAHEL'ACE This page is dedicated to wild life that sailors and Marines encountered during training exercises in the Persian Gulf. 5'- X f 9 lim The ofliclal mlsslon of the Corps lS establlshed m the Natlonal Secunty Act of 1947 famended m 19529 Marmes are tramed orgamzed and equipped for offenslve amphlblous employment and as a force ln readmess Xe An 9, av MW New MARINES 507 N . x ,QW 11 I x .- - I ,ZA VL ,f A . . . . . . v . . . ,,,, -T....r , I . . . I, 3: Q ' I I . X vs, . . . . 0 P -fe xx O U ll . , i -L i ,z k 9 Q -1 f f' ft' Q, , 4 f 1, 4, e ., HQ A h 1 5 ' 1 Z hi ' 'b x 0 V V , kxikfgfjfgf 'XA' Y up ,, .QD LSC N ak 1 3- I f V I L X lr A ' ' N..'-11:1 W1 ' - ' e c Y X13 - . uf, ., 5, 1. fc ' N ' K H. 2 ' - A , , X A e. X. 1, x X 5 I 1 , L and Marlne Corps hlQhCSt Congressional Medal of an act of Congress in the Congression- Service Medal tak- for heroism in who gratulty. In 1942 the decoration to its of heroism on the and shows a caravel crossed anchors and the is appropriate and commendably narrow white center stripe. AAP zfuw, .XS mln- , , .. 1. ti-I 357, , , A ln 45,-pai 'Lu r 'ii 1 508 MARINES A1,k,..,,.,-A-.!,'n.'G,4, ... ---x ....,,Vu-, ,1, 1-. Y pg, 3-. ---'-Y '- -' - '--'-fd'- - ' 'W' ff f-A ' ' -4 ' '- -'- '--A 'U' ,N- .MX f -NXQQ, N.. I rj, W, ,Mu ,, ,,.,f,MWf1. ,fy My If I X If 7, ,M U my 0 ,-,f ,W 9 -W ivy-,kay , ,. ns . Agn, 4' . by ff' ' nm , 'Mr V Ili , ,,. ' MARINES 509 W fU.. S. A f !,. I 1 wgmwww f QV? 3 Z x , .U f gf- f , . , if A g Z f 7 ff , A - , ', Q 'mf ,A ',f X , , ,- y , ff. Z. E A gf, fwlwwwf Z Xiyf, M, , . fy., . ,, F031 mums , .59 ' f 4-www f zz: wx ' 4 ENLISTMEN 417755 A more modem recruiting poster em- phasized Marine traditions. On 15 June 1775, with the enthusi- astic sponsorship of John Adams, the selection of George Washington as commanding General of the mili- tary forces of all the colonies was very rapidly approved by the Con- gress. Washington quickly discov- ered, on inventorying his available materials, that the total supply of gun powder for the Army was ninety kegs which worked out to nine rounds per man and nothing for his artillery. ..r .fl X' f xvxkx ' Nj f ,. f,-f mf?-, gf! f V 5 , 4 X , f 1' 1, f fi wg, ,fhfiki Niki ' ' Q . W 1 Q? 7 X ff 4.19-fa j A -ff ,.,,L f ' ' ,ifaf-f3'f5ffif5if,f3s 53637 , , f , '1 ., if 1.7, ,Y U94 ,,,K-A., Nsfapzgq , f , A --gm 4' ,fyiyzg -f5g,v5g,.j,, MVMLK-ww ,f qw , .wwf M , f.,,L,,,,v M ,mam -Ami, ,iffy - X cl, 7 if f K fl umm, M N, , ,, ,- 9- f W W wi, , S. ,NL swf -4 1920 I V ,fm , f Q53 ' Qhghipgw,-. .Mu .-Dfw g I- :ig ' ,nfs-43 HMQMJ K-'UN' ,, ,, ' N , ' ,QQJBQ-ff-1.5-f ,mfs 1, - ff 1257, nw- 5-Zn, Al- X, A My ,Q 7- .. -wifi f,..' - 4 X, ' - ' f M mr ,,,.,,, ' 5f,5- ' ,..,:..,,,.L,.-,M .5-,ag ,.,:1 gg., i- .mf -wr, hr 1, . , ,f , vm ,Q-4, ww fggfffjx ,f l , J. ,,. 1 54,5 Y , Q ,. if 1 ,MPN ,ff Llff w A x f ?'!,i? f-Civfg fin . Q 14 fi ,, 0., 1 ,-gs Q Q-, X 7 T '7 if . -- f gig 7 1',f - M , ., . R, 3 Bl g!'j,?7I,3 . Q ,..t E ei'-,A f ,, it 'i Vi, -gov-5 1 MMA Q. -,Q-M in 215224 QQ: 4 J QWNQ WM., i,Wi 5,095 , .Q f x Ib - ff , . .A ' ..,,5.., -vw '-zayfxtw ,X , fu K4 ' . 7, Q Wgf.,-H . N .7 W., wwf A? ,.,.,,,, ...neu ....,.,, ' 'iw' 3 -W i..1,.MM.w. uuwm-ww WN , I .. H-R .Q , .ali -New ff'-I' Dress Kabovel and working uniforms of a Ma- rine private in 1847. 510 MARINES Hats 1878. Clockwise from top left: field officer, full dress: company officer, fatigues: all officers, undress pattern, full dress, enlisted men, fatigue, enlisted men, undress, bandsmen: full dress, company oflicer. Out of the War of 1812 came what is perhaps the most incredible saga in the history of the Marine Corps: that of a 25 year old Lieutenant named John Marshall Gamble. Gamble was in charge of a Marine detachment aboard the frigate Essex, commanded by Captain David Porter. When it sailed from the Delaware Capes on 28 October 1812, he would not see America again fOr almost three years. Off the Galapagos Islands, the Essex encountered and captured three British whaling ships. Captain Porter placed cannon and crew of 14 men aboard one of the ships, and used his authority to commis- sion it as the USS Greenwich. He placed the vessel under the command Of Lieutenant Gamble, making him the only Marine in history to captain a ship in the United States Navy. ln July of 1815 Gamble demonstrated impeccable seamanship when he closed with and captured a dreaded British raider, the Seringapatam. That October, Porter left Gamble on Nukuhiva in the Marque- sas Islands in charge of a hastily built fortification, three British prize ships, and a number of prisoners supported by just 22 American oflicers and men. To the great nations of Europe- France, England and Spain- the winning of independence by the United States in 17825 was of small importance, and they demonstrated this attitude by continuing to treat American merchant ships as though they belonged to a colony. Particularly flagrant in this regard was Great Britain, despite US trade with them: in the words of President James Madison to the Congress in June of' 1812: The mood of the Congress was not with Madison, however: Though they authorized an enlargement of the Marine Corps to 1869 officers and men, the Congress failed to vote an appropriation to make the increase possible. The Corps had not re- covered from the Jefferson imposed reductions in its size, and when war against Great Britain was de- clared by the Congress on 18 June 1812 the Corps consisted of 10 officers and 485 enlisted men, with less than half of them on sea duty. And though the popular slogan for the war was 'Free Trade and Sail- or's Right,' the American navy consisted of a mere three first line warships. -.f tif., .A , -, 1. 7 Above- Leatherneck. A leather stock of the type worn by Marines until 1875, which gave the Corps its nickname. Right- A Colt revolv- ing carbine used by the Marines during the war against the Creeks and Seminoles in 1856. Q at W 1 Q' - 4 MVJYAPI .5iLrwNAvz,u1 Jf MN!.llfi Among many concems of the first United States Congress that met in 1789 were attacks on American mer- chant ships being made by Barbary pirates in the Mediterranean and by French privateers on the high seas, the privateers were unleashed by their govemment as a way of harass- ing sea commerce between America and France's enemies, the British. But so pressing were domestic mat- ters facing the American legislators that not until 1794 did Congress get around to authorizing the reactiva- tion of the Navy and the building of six frigates. Another two years passed before the necessary funds were voted to constructing three ships, the United States, the Constel- lation and the constitution. All three vessels were launched the following year, 17971 by Congressional act each carried a Marine detachment consisting of five lieutenants, eight sergeants, eight corporals, three drummers, three fifers and 140 pri- vates. Since there was then no Ma- rine Corps as such, the Marines were considered part of the Navy crew. ZW ' 1 i mg! life Z A E 2 5 A H if ' WW.Wf:' ,VIEZ Y l 2 1 5: 5 I ii gov gr in . i gel! ' Q53 Ml! I mn S0 'fi il me 'ffi PM is in all hi i Sd il 1.x M, il. fi in HJ X n North gained a strategic foothold it would 512 MARINES maintain for the rest of the war. The concept of the Marines as an amphibious fighting force was strongly encouraged by Naval Flag Officer Samuel F. Dupont, Commander of the South Atlantic Blockading Squadron, and together with Marine Major Reynolds he organized a 500-man battalion to that end. The group's first objective was to be Port Royal, South Carolina, but unfortunately, the Marines were given an unseaworthy boat as their transport, the side wheeler Ciovemor, and it foundered in a storm on the way to Port Royal, leaving the Marines unable to join the ac- tion. ln March 1862, Reynolds's battalion sailed to seize and occupy Femandina, Georgia, only to discover when they arrived that Union troops already were there. Next they departed for St. Augustine, Florida, but leamed enroute that the Confederate garrison had abandoned the city. At this point Dupont decided there were no missions remaining that called for the special talents of the Marine amphibious battalion. The unit was broken up and the men assigned to various ships' detachments. However, this wasn't the end of frustra- tion for the Corps. In August 1865, Major Jacob Zeilin was sent with a battalion of 500 Marines to attack the nine fortifications guarding the port of Charleston, South Carolina. Zeilin tried to expand the unit to a regiment and train them in amphibious tactics, but found himself dissatisfied with the results. He was re- placed by Major Reynolds, whose first action was to reduce the unit to battalion size and then to provide the men with further training. On 8 September 1865, a Marine unit with sailors attached attacked Fort Sumter, the most celebrated of the Confederate-held strongh- olds at Charleston. In a night landing from small boats, the action went badly from the start with many of the boats getting lost in the darkness: the 150 Marines and sailors who got ashore and were part of the unsuccess- ful assault took deadly accurate fire from the Confeder- ate defenders, with the result that 44 Marines were killed, wounded or captured. The battalion was taken out of combat and sent to a rear area camp for rest and rehabilitation, but a sickness swept the unit and added to their misery. In early 1864 the battalion was broken up and its members reassigned. The problems of the Corps at this time were many and pressing, not the least of them being the bittemess that existed between many members of the 'old guard' of staff officers and the younger line officers. These arguments visibly wore Clovm John Harris, the Corps Commandant, and his death on 12 May 1864, was not unexpected. Secretary of the Navy Welles seized on the event as an opportuni- ty to 'retire the Marine officers who are past the legal age, and to bring in Zeilin as Commandant of the C0rps. There seems no altemative.' This Welles did with President Lincoln's approval: every Marine officer senior to Jacob Zeilin was retired, and on 18 June he was appointed as seventh Commandant of the Corps. xt fN -,lf xi - X iq., I. ,XX 6 gt MARINES 515 IPI SERVICE DRESS UA PARACHUTE ENSEIVIBLE CIILLIE SUIT I'SNIPER 514 MARINES CD 53 S n rn U :v rn cn cn Ui UD rn sv S 0 rn U :vu rn cn cn fi IE -In '-if ,. qw ,5 3 ay. - ,, ,. I ll . . . 3- E2 s Q50 'Q' I I . N 1 l -:I I Q ll 'fb '5. 5 N fv A sexi! 695- elk' 'S 1 fu . X-'- ff'- fx- :fs-15 DESERT UTILITY JUNGLE UTILITY FLIGHT SUIT ENSEMBLE FIELD UTILITY RECON ENSEIVIBLE sxxx .v N11 Q, X . X NY xx xg X Q X Nw X N NXSQX X Xxx , NN Km i O X5 4 X 'T' +4 x ,wx . . MARINES 515 Wa-min.-.3 'NRWNTNXF ls xS 6 Y 1 ts f 4 2 516 MARINES f ,Mi f 5 ,, , , A,,, .. Q, f?i ,fi,fi'f , X, '.s9',, I A , ,g if Q, Q, . : :va-9,2 W I Z' ' 5 if 1 KN W V P V W 9 f , f QW 4 J 42255 ff f 2: , 59 X gf . - 4 A 1. A , .w? ':?5- V 2 4 -may :. -: W f , 7'i?. 4 - .N f ,f:?I. - ' is ' ' 'S -X A I ' 3 ZX , .Q xr X, QM 1 3 -- ' - '- ' F . -41 f 'W J 55253 5113 4 X W Q. V 5 ,, QQQ4 MQ 0 E 2 , 4 4 w N 2, X , Qi P! A fa N X10 ' Q QV: 14 , A, A 5 Q , Xe '22 Y NA Af S X X Q13 V .. - 4',, , - N2 ,Q S W W e -'A'L 5 X 1 swims? Eff Eviww i 1 We fm , A Xi fe Af 5 .:. ,fx-gyzww 3g9O45v2 .x X., 4 xgyg Q QCQQX 3 we Ni iz W i X-V' Q5 . Z wx We Z Y fa v fig x AX5' g Q , ' e wmv? ,A Q. QSVQ X X x , by x f!'7'. ff, f Y 1 .ms . A 19 cl r n esgg tes Mar ne A 'gf - I Uniled Sla lvl I 1. ' A . .3 f I , 'un 3 IW MARINES 517 ..... ,,. .,..,,....,,.........,........,.........- .-.. ....vi-4----bf-----f---- '- 1 3 Zz, 518 MARINES T ' --..,,.--.,.,-A-- ,r...--,,,, ., mu 'vm Mow- V. ....,---.,...Q v..-......,-......t.. M: i.- 1 V ,,- , F 1 1 I Q ., rf., .ues-Y -'Wye A Marine is devoted to honor jf ENT OF TXEYQE A person who will show no fear XKSNT OF' 0 I 4359. 55 Put a weapon in their hand and they 4 .9 jf E 4, Ge will defend our land from sea to 4' ,tw LQ 'Q 56 shining sea. if .5 f ,Z 54' Q 1 rf. Q H .1222 E, fii??' 9' ' If I ,-.-. 'ZZ 'QSNX , is l 'S Q W s f AM, :JIIILS ' 993 9 5: if Semper W 1pi5f'T Always A -T -Wiki' t 0 nghm f CJ ,I A ,,: ..- Ne! gui, 6 1 .1 N081 at ,F 'Z qv Q xx 4155 MP-Y' ,af Wifi 'fo S PN' Xxx-X ,www , , 4- 1'-9' . 'Arcs of X133 FJ-del-13 ' J Falthflll MARINES 519 R r illlllllIlliiiiiiiiiiEIIIIIIIEEHHEH!!!asnn!!!!unn---....................., ' ,,f!:ff.i? . fi ' f -fr my ...gf , . ' I f ,, M fff Y , , V ,V f gy A . I7 rKXZ f ' VM . ff The PACE program was alive and well during PELELlU'5 A large number of the ship's crew took advantage of this opportunity to achieve their educational goals and enrich ' A their lives. The PACE instructors were civilians from par- A ticipating colleges and universities. Personnel can obtain if an Associates Degree through PACE. A Some of the courses that were offered included: History, 4? English, Sociology, Psychology, Introduction to Business and Business Macro Economics, Personal Financial Man- agement and Govemment. This Command would like to extend a special thanks to all of the professors who left their families and homes to f educate our sailors while they were deployed. J N IR ' 'if' V , PACE STUDY 'Q----+- ' ----.---.- i PROGRAM EOR PACE AFLOAT FOR A COLLEGE BETTER y A ' ...gg , , , 4 1 V4 V ,W Vg., Q, g,,,:f'.,3-,4..,,:yg..f.':wf.:y4.f.-f.,'f:- 1 .7 .. Q--Jr. f f f f f f f f f 1 f f ff f f f J f f 0 ff 1 f f f f f 4. L W .,V 5 i 1 ? 3 4 X JXQ zyr- W?,C .7 M ri 120-4 -,A ff . f.-,W , , : M W- ' 'W-Z 1,1 fr W4 ,WU , My ' 'W W. ,T ,fy v ,W W Ziff. my. 76 Wfff. WMA . y f Q A 45' l Quai Mr. Dennis Smith stresses the importance of higher education. l . EDUCATION FUTURE . - I i S E 1 V 5--X f - 9 .f f W ff , 1 sir' i 7-Z 1 -my ' 53 i A ' AF XM, WX i ,Z 4 , 7 M f, , way fm I i KM um , M , ,X ,,,,.. fy 0 ,X 2.-WMM.-w W, fz.,M'nf.f 2, 3 5 H, xx 250 PACE r iiniluliimax I I ' I Mr. Leo Mathier has his claSS thinking about their future. WW cccc - I GULFPAC 91. PACE fProgram for Afloat College Educa. i,, tionl provides college courses for shipboard personnel, A tj a N HWS ANL worms WS W 1 Fax 4: 'N- 9 Long 1157 57 w Q26 xx Prone ussiarz A ,mom f FS! .751 figojl X f' 'fc ?' 5 5 xv!! 3 xii!! HQ f ffkf K -fx' wa 9 ,N 9 l l ooo so 'i ii if l f I E l S 5 ll' lx AU l ,l all l W sg lift 'l ,g m il ,ll ill I l l l ll K ll ll ll ' :Elf Vl l Ill 'll 25' lil 4. ,.,, QE? wif S.. Elf F F111 V EH' I 5, -... img: , Egg? l ini l 5 ,, 1 in 'Q ' , f , v Q, E f l W 2? l , yi, l I sri - il ll at l l r S lg , 1 ,f ' ll 4 l, it H i in ll fl ll 522 HAWAII A typical winter clay on the beaches of Waikiki. Welcome to Paradise! Above is the Hawaiian island of 0ahu lflililll- --- i-. Waikiki's many beautiful beach hotels and resorts -gl ,. -,.-....,f - , , - , --,-- - f - ,f- - 44445 il 111' '!' ! N Hawan s famous Aloha stadlum IS vlslble near PELELIU 'S---- anim-1 f JL ,12,.,.,-... The hlstoncal museum USS Bowfln SS 287 rs one of Pearl Harbor s many attractions 'E 1' is USS PELELIU Sallors enjoy the Sun and the Salllng Captain of a catamaran gives tours to USS PELELIU sailors HAWAII 525 f ' ', W ' f , -T' 1 I M I A ? , 3 ' ' - . , , , f . , , X .., . . . . , L .. . .W- .. , ' M1 ff ' , z ' -4. ff 4 '--,. 'fan--f'4'3f'i'7 Y ' I f f 'Jil Z' ' ,f,,.fr'vuu .2.i,,:vmf --H . , -,ww-vvr7 ' W we-1...: 4'-451' Wi S' ' P Qsniil' W U l A A A ' , , ,, , , ,,,1 , I . . , I I I . . -e Y l ,vv , -wr 'rd .fn V H X , wv ' ' 1 . ..., , , It -,,... i E' I ,PKK I A, ' A K' V 1 ' T 4a 'Q AL' 4 -V 72 g l I V A f ' ,. N - - lv, ' J 1- f- ' L-2 . , N' Q . I ,I .lx ,titty , M H A A V-If K yi I 1. . , . ' A 1 ' Y w rl . . . . . . . . A it - M- NV 4 www-in-v-A Mingus V A- 4- Y WA... ,ad th A VMS, .x-J.--AW.,-MAN Y-5,-,a ,,,,A,,-,..,,,-,,,,. ,,.--,,V ....,... .- '-----f-1-f-Af.-f-'--- -'-- '- -'A '-'W' ' U IR IZ 0 N The famous battleship, USS ARIZONA, was constructed in 1914, launched in 1915 and refitted for war in 1959. At the time of the Japanese attack on Pearl Harbor on Decem- ber 7, 1941, the ARIZONA was moored at Berth F7 near Ford Island. In the ensuing attack on Pearl Harbor, the ARIZONA suffered several direct hits to her superstructure and hull by bombs and torpedoes. She was strafed by enemy aircraft machine gun fire and then at 0810 she received her death blow, a bomb struck the main forward magazine exploding deep inside her. The USS NEVADA, the end vessel in Battle- ship Row , made a quick dash for open sea, but was caught by enemy aircraft and had to beach herself to keep the channel clear. The USS CALIFORNIA was also struck by many torpedoes and bombs which resulted in a devastating fire. The other two battleships, USS WEST VIRGINIA and USS OKLAHOMA both received multiple torpedo hits leaving them floundering at their mooringsg Each sank minutes later due to progressive flooding. The USS ARIZONA memorial stands over the re- mains of the late battleship and holds spe- cial remembrance to the many lives lost on that fatal day which will go down in infamy . 524 HAWAII sm... , H . ' I OR,IA fl - - '- f- r, .ups-x+, . A . .---Y. Months of planning and preparation came together in I-Iawaii on Nov. 18, when PELELIU amved in Pearl Harbor to embark 186 l'guests for Operation Tiger Cruise '91, Fathers, sons, brothers, cousins, grandfathers, father-in-laws and uncles of sail- ors and Marines of PELELIU ranging from ages eight to 82 became honorary guests for the transit from Hawaii to Califomia. This marked the seventh time that PELELIU has conducted a Tiger Cruise, the last was in 1990 upon retum from WESTPAC '90, This Tiger cruise was significant for many reasons. It was the first time the Marines could participate by inviting Tigers of their oum. Four of our Tigers were veterans of the battle for PELELIU Island in 1944. Retired Brig. Cren. Click, held an informal discus- sion of the battle with interested tigers and crew. The Tigers had a very full and busy schedule during the eight day voyage back to Califomia. Each day was full of activities, from Marine Corps weapon static displays to actual live fire demon- strations. Tigers even got a chance to shoot M-16 rifles! It was really something to see some of the eight year-olds shoot under the careful supervision of the Ma- rines. VMA-515 and HMM-165, the embarked squadrons, flew demonstration flights, shooting guns and dropping bombs. A Tiger 'lSpellex was held on the flight deck in order to photograph the words Tiger '91 formed by Tigers, Marines and sailors on the flight deck. Each Tiger received a copy of this photo to take with them. The ship's guns, the 5 inch 54's and CIWS, got a good workout as the Tigers watched their impressive firepower. Every night was a special snack night on the mess decks and wardroom. Pizaa, cheeseburgers, milk and cookies, beanie-weenie, hot dogs, and of course ice cream were served at 2000 to coincide with the nightly movie. Sunday moming was free for religious services, but was quickly followed by a traditional l'Steel Beach Picnic. Tigers joined the crew in eating chicken grilled over charcoal on the flight deck and other picnic goodies. Skeet shooting and driving golf balls into the ocean were also enjoyed by Tigers and crew. That evening, a Tiger Talent show highlighted some pretty talented youngsters among PELELIU sailors and Marines. Everyone had a wonderful time. Bingo was one of the most popular events with the Tigers. Two Bingo games were held as part of PELELIU's efforts to raise money for the Combined Federal Campaign. Some of our lucky Tigers left us with more money than they arrived with! , ,,- .. TIGER CRUISE 525 , .ag M K .S---'52, X, W, VV ,V . 'Qi .X Q ff 5 Ks? .,.. ,L .., ,Al , . Y 31 Q.. fd-fp 4 x A 1 ,A Z, L' .f l -'- 'l 'Q - f- QA f' ' '- .I 54 aww W, ' I T'1,C : I , jd' 5,s X nkX.g,,,-A 1, ,f 1 Ifvfikjig i jf--:L ,vb '23 ' . - 1, .,., ' v ', f f'f2z.:.'1 -'W-'--'--' .pw M--QE ...M 5, ,M ,fin i , ., V' 3, V, , VIZ' nv-hM....... 17 1 -1.....,-W' In -.wxlskv E . nfs' ' , .em fs , ,.,,.. , .,f A ' Q4 ,K - f' 'ff I i . ,ff . W QQ, AT , ff Vgfzfxd V . jf g 4, u. ,V , Mfg' ,,., 'rv- A 'U 1ff,.,g.,Z . H my 'V A-1 , , gf ,f 1 . .J XWMK .,,V ir. , 'vu - A '-'Vff W1 W f ' f..:?1fje,1'2i,,'!Q2,m , , . .,,, ,W. 4, ,,,, My ,bw , '54'V32-2i?'195ii 'iff , k I Wy VA Wwmrf.-fwqqfayb 'gms--411151 A 'hw' if '-'Q ' ' - ' W-Y W-fig ffv' ' Q. f vf--- ' 'Q , '4 ' '? Q4LQNunQ+.4,- .-.. 4.1.-.-. -f 4--'- V n kg, , .af .rm 1' Q.. 0 1- fln f, ,jg ' 4- N .- -' ,W -.. ...Q I V I , . ? f 4 t , yi llrfgqv .35 L y ,V JH' ff' ff H ww . V. ,1 , W S, ,Q . Nzf. lx ,fg Ir wyxw.- W 'W' JN, 4 , if . n J r K ' yi.-x Ni 3. 4. i gin . A y ' 5 C , . ' 4 1 , , .. , f Q:-,sm - wg 5 :.f.-fit' 5 .'f1':.1q5 , I , ' X . lfzi 9 44 , ' A I 5' A me ' M ' I' 5 'K MA i V -, . , II, . V KN V l , . 1 5 N .. f W , --s-.p.. 4.4 , ,H17 J ff' 7 ,lil -': , ,Y ,W H- , V .Y , --an---4 -- ,. ---...K ' .3 f 'ff J 1 V ,J 1 f 1' Q, E . ,wh il Fl TIGER CRUISE 52 ,,!,,,L , , J, ,, --Y Y xv - T K - A: -- - ff' ff ---f W ' ' 1- --eau.-1 , X ' .al--' .-K,,' ' 1 ' -.,.,,3,f-11-v , V A .34 2 A ,, 4 VV,, ., . ,NP .i , fix? swf' A- ,,,, If , Au yd!! J W ,UM k .Km - ' W fr Q -' 732 ., in fM f.ai :- f ' 1 I1 528 TIGER CRUISE Q ' W f' ., , 01-.. 1 ,,-- igl ,, f,1i:?,k:l:a,: 13- K Q, 1 f f:'f'7,, L A L ' ' wf'ff1 'fff '1 V .,y:.,g,ff X I ,g-tffff ' I N, 2 V M , 1,1,1jw 1' v f ' W.. fm, , -A ' - ' -,A- Sway G ,, x A-W-. -1 .1 1-:Qui Q ff wi .fuk 'W Q -msg 3529 - f 1' ,,,.,.F1f :H aifa nl 1 Q , 'iff 5 ' ,, Af , -Q, ' ,7'5,f?3ff? wiw-, H' A ' ,. 'faiff E ' f '-4-L ,W f ' ,, G J. JM 1.7, ji .V Y I , !,.,3, , lm, ' - .. , , , , , 2 K, f Yuan-if ,. 3, F Em ? ' -W-f ? :':ffr: .zf lo W 'A' : 1lQ 'T 3.1 .... .4 A. ,,,..V --wx,-A-,.,,-,, ..- ..r.:. V ---A4.f-.... .W V V: 1-f fx- ,.. .. , V ,- - , -.-. 'SQA TIGER CRUISE 52 f.f'Wf wwwwffjw Q fijjawfyy zjdgyy COMMANDER UNITED STATES NAVAL FORCES CENTRAL COMMAND To the Sailors and Marines of the USS PBLELIU 5 HFalr winds and following seas to a very successfil and reco d , breaking Amphibious Battle Group Having departed the Persian Gulf you take with you the gratitude and respect of the entire Naval Forces Central Command for a job well done Your superb efforts ....,. X V f Wfffff ff vf vw! f! f f ' 'ff ff 27 I X X , , f ff fhf ff f ' I I X were instrumental to furthering our efforts to build a collective and participative security structure within this region You have demonstrated the continuing effectiveness of our amphibious capability during seleral well planned, well coordinated and professionally exetu ed training opportunities You left a great record here in the rideasf region Sea Soldier V in Oman, two PHIBLEX events at Al Hamra first to train with Saudi Marine Corps, rirst to get involved with FACC OPS and real world contigency plans in support of UN, first to control both joint and combined CAS and the list goes on It has been an honor and indeed a privilege to work with you in this challenging dynamic and internationally important theater Your presence helped reinforce our ongoing resolve to promote peace and stability to this troubled part of the world The impressive performance of every Sailor and Marine in the Amphibious Battle Group reinforces my strong belief that our Naval Forces will always be at the cutting edge in defense of freedom All of your Sailors and Marines exhibited unequaled readiness as they tackled a myriad of challenges in one of the most arduous environments in the world and perpetuates the long standing traditions of the U S Naval Service On m1ny occasions your men distinguished themselves as superb ambasadors of goodwill for the United States, during their port visits in serveral gulf countries Their brief visits were well received and will leave a lastin ositive im ression on the citizens of the gulf well We look forward to working with you again, Godspeed RAYNOR A K TAYLOR Rear Admiral, United States Navy Commander, United States Naval Forces Central Command A G COMMANDER THIRD FLEET To the Sailors and Marines of the USS PELELIU: 'As PLLELIU sails east to your west coast homeport, you have my deepest admiration and respect for an outstanding deployment and a iob well done. You should take great pride in your accomplishments and contributions in safeguarding our national interests in the Pacific and Southwest Asia. Have a safe voyage home to a well deserved reunion with your loved ones On behalf of the men and women of Third Fleet, welcome home JERRY L. UNRUH Vice Admiral, United States Navy Commander, Third Fleet ,......i , , ' . , l . . . ' 9, P ' 4 ' P ' ' ' - done. Best wishes for a safe and speedy return home to loved ones. . . . ll Q V X COMMANDER AMPHIBIOUS FORCE SEVENTH FLEET To the Sailors and Marines of the USS PELELIU: HAS you depart Seventh Fleet and head towards a well deserved homecoming, the men of ARG Alfa can feel proud that their presence made a difference. From your significant humanitarian effort in Operation Fiery Vigil in which you conducted extensive evacuation OPS in the wake of the Mt Pinatubo eruption eruption to your amphibious assault presence on guard in the Arabian Gulf, the Sailors and Marines of ARG Alfa displayed unparalled professionalism. Your hard work and dedication to duty were a key and essential in helping preserve peace in the region. My best wishes for a safe transit and festive home- coming.p DENNIS R. CONLEY Rear Admiral, United States Navy Commander, Amphibious Force Seventh Fleet 550 BRAVO ZULU L CCDIVIING HG E Whenever a naval ship goes on an overseas deployment, it sadly leaves behind man families and Y fnends. This signals the start of a six month period where lives are changed. Crewmember's families d l'f 'th t th ' en ure 1 e wi ou em. Wives, girlfriends, and kids get used to not having a husband or daddy at home to help or love them. Before the last line is taken in, the men of PELELIU are already thinking about seeing their families again. But until then, the crew depends on a lot of mail while they are away from home. Finally, Uchannel fever sets in when the mission is completed and the ship heads home. Sailors are eager with anticipation about reuniting with loved ones. Suddenly, the day arrives, I-IOMECOMING! As the ship nears the pier, you can hear everyone hollering and screaming with joy. As soon as the brow is across, families meet with each other, tears are shed and a lot of hugs and I love yous are shared. We did it! We're home at last! Q V7 1 f 5 cfm., ,,xL..- , .' , -,A ,rn , gl fig.: .,.- . HOMECOMING 551 552 HOMECOIVIING 63 This Marine is pointing out what coming home is all about. iw - V i v I 5' ' ' 5 A l can never remember which hand you salute with! 1 X '-W1 x. it,-Q V W ffxiqqru 44? mx HOMECOMING 555 v 1 I ....,. ..-. .,- .........-....v..4... mr... ,-mn-MH,WWA-,,-0,7 Nivea, nh-Y W, ..,,.,L,...,.,.,.,.--,..-,..........-....,.---. 2 l F 5 ix H Q . Q i E I 1 V I A 5 , 1 1 , 'l , Z, H ll If v i 5 w Ei if , A W N -N T ! w i X 1 L 554 HOMECOMING V- t r , ,f...v....,....f-.---..N-Y :pts 4,- mv 5, .,,,! f,n.',fw 1' f E W5 F ,T ,I A fi: ' ' t w 15v' gg ..-..,. ......,...,......... mr... I 'E OU , ., my ma-Q, 1 s, ,ag i . I , Families wait in anticipation as their sailor retums home. HOMECOIVIINCI 555 , . I VX XX H L K f K, . I f X J 5 I I l I, I, O ,VVV I VX I I Q I, I L I !X X XXIXWXXL XJX! X ,Xfiy UL, , ,X mm,' ' M I I f , , f ,, ff ', - ,f fV,ff'7W!fmf,f1 yf,if H- I I ivff 4 , f . , , hh f I f I f I I I I , X ffffff,4572,'Qf'C'2y,f3'f,wf ff, ffffvki , j A 'IX ' f N ', K ,. f,V, ,,,, I ff , , , 1 f I , ' ,X ' fy H ff KyfjffCVXfff!Xxfjf,'4yjQZQQ'C,f X f- 'ff Z 1 A ,',' f 4 f , , M f' vf f, , f, 'f V M, WX f mf XT fX,ff'! fffffff uw ' ' ,X X' j f X Q, X fhX ', f X f f , n ' fXfXfCXQXMX,f,,Q7XfOffXfj77fXK,fffXffX:fM,fX,ffMW , , , , , I H I , , , I I ,f ff ,X X I ff, Vff f'ffffffffvffy ffffwfwfffffOfffW! -- - - . f'ff N f ' .3 3 N M .,, ,.,. , , VV,, XVXV 0 . X V I If X X X ,f ,V !X f CX N! Ol DIV: fTop ROW L RJ OS2 OSBORNE, OSSN GRIMES I , OSSN HESS. fB0tt0m Row LfRJ OSSA MILLER, OSSN COO- PER. v 2ND DIV: BM1 SUTHERLAND, BM2 DAVIS. 556 LATE ARRIVALS , f X X I X f XXXXfyMff ,'f 1ST DIV: CTop ROW LfRJ SA BANDEROB, BM2 GAIVIIVIAD, SN WASHINGTCN, SA BERKAVICH, SA SHEFIELD 1Bottom Row A LfRD SN PEREIRA, SN PERLUNCIHER, SA MAHER. MISS GULFPAC '91 ,A , A --A--vm --.. ,..,-w,.,,,,,,,-v.,,,M MM-ww ATE ARRIVALS q ,Annu , ,.,..f-,-A M-G 0 av.,- MEDICAL: HM2 PRESTON, HMC ELPIDAMA, HM2 WHITE, SRD mv: BM5 PRESTON, SN ZELAYA. HM1 Sims' V1 DIV: ITop Row LfRJ AR CHAVERA, ABHCS TAYLOR, ABHAA KOESTER, ABHAN RAPOZA, AN PARDU. iBottom Row LXR! AR WADE, AR LOPEZ, ABHAN RIDLEY, AN SOBLEY, AN ROMERO. CS DIV: SMC BRIGHTWELL I l LATE ARRIVALS 557 1 51, 1 E1 f ii i 1 2 E 11 I I I I I I Ii II 7 I!,f 'Ii , I , , , CA DIV: lTop Row LjRJ AO2 DENNEY, AOAA SILVEUS, AOCS I RAUER. 4Bottom Row LfRD AOAA SIIAFER, AOAN DIAZ, AOC FI I DARBE. QI E1 I I E I el Il . . il H If H 'a .31 I2 'f i H fx. 3 , I I I E I. I wwf If' J ,III I I I Es, s-2 DIV: fTop Row LfRJ MSSA LEE, Mssm FIELDS, MSC I I POLINTAN M55 ENCARNACION MSSN SANCHEZ CBottom E ' ' ' IA Row LfRJ IVISSN NCIUYEN, M55 WILLIAMS, M55 ALVAREZ. 558 LATE ARRIVALS ff f ' ycywf WWW v , fa , 4 f'f'f,ffff',' X X f!ff f ,' . f f zf ' CL Cfjf ff Of I CR DIV: RIVISA MITCHELL, RIVI5 JOI-INSON, RIVISN PHINNEY. MP4 DIV! ITOD Row LXRJ IVIIVII5 HEFA, FR ALLEN, MMI CIARZA- IBOtt0m ROW LXRI FN JACKSON, FR DILLIPLAINE. -Inf., Jw,1MkMM.,,,. wqvmawu14.,..gp.K.,Q11aQ3c,4,,.,.,.--f-.,.Q.qqyn-'l WS-rr-,.-.f-v--..----.......--.--,....,Y--w,-..,-.---v...-,,,-- --....,--.-.-..,....,.-.,--,..-...-.-........--....,.---.- .fn-A .....,4...- LATE RRIVALS E DIV: ITop Row LfRJ EM5 MARTIN, Em vnasmcrx, EMFN CI DIV: EW5 PERALES, Ewsm ALBE, EW3 Tmsu-:Y. IVICKAY, EIVI5 PIERRE. IBottom Row LXRI EIVII5 EDWARDS, EIVIFINI MARTIN, EIVIFINI BUDOIVIO. V5 DW: AA WADE, M HUGHES. Amo: CPL SAN FILLIPO, A55 CRQSS, A52 RITUA, A52 BROWER, CPL CASTILLO. - - .-....... ,... ,-Av.. ., A.,.,...... .........,........,...,.....-......,.......,,.,................ LATE ARRIVALS 559 TE ARRIVALS f 5,4 DIV: DI-QC ABUTAN AIIVID: AIVIS1 BIASCAN, AIVIS1 REYES. f . gs-wwf W If ff we-WP wfsz sw 2 for' WS'i?3 'Tf G X Y Q QMS fi - - -. , .' ' ,L . X J .' IV 1 5 1 Q I A I , '. Ns 1-- , .of . - . is 4 I ' . ' . , Iss Sag - - an 11, si Q- -' .. I - , . MHS ' ' - FS ' - 1 - 1 ' Kilim . ' - E55 55225: ' ' - E1fWE33I: . +1 1 15,17 .I-, .- f -Of' ' --Q. I 'IEW nw--25 14-A.. IKUS5 , .'.' ' , j ' ., - I 'Q I I f QNX A -'--- V . , , .-AIN-:NIM-Q' ' 1, fmmwil 3 I 2 ..., 'MM The good news is your on the PE- LELIU, the bad news is WE'RE IN THE GULF and THERE IS NO AfC! R DIV: DCFA KING, DCC KELLER, DCFA DENNIS. 540 LATE ARRIVALS L TE RRIVALS , .f,,- - S-8 DIV: SKC IVICALLISTER, SK2 NAVARRO. CE DIV: ET5 WILKENS, ET5 SIMPSON, ET5 PERKINS, ET5 BRCSCH. S-5 DIV: SI'ISN VERGES, SH1 AVILES, SH5 WOOTEN, SN A DIV: MM5 PACHECO FERGUSON, SI'I.'5 WILLIS. LATE' ARRIVALS 541 ,,, , -Y-,.,,,...A ......,..,...,.....- ............--.- .,.-..--., TE RRIVALS N V-1 DIV: AA ZAPIEN, AA RAJACIUKGUK, ABH1 BARROGA. J , E r CD DIV: D55 STILES 542 LATE ARRIVALS 46 AIMD: AA MILLER New arrivals load up their gear on a CH-55E bound for PELELIU. ,. ,.- , V,-- LATE ARRIVALS I QQ IVIP-2 DIV: BTC LAKEY, IVIIVIFN HENKEMEYER, BT5 IVIISROCI. CF DIV: FC5 RABEL, FCI5 I'IOLTZ, FCSA LUJAPI. AIIVID: AT2 ELLERBEE IST DIV: SR YEARY MI'-5 DIV: BT5 SMITH LATE ARRIVALS 545 115,118 CAHW,R. 275 A 148 CALDERON, J. 126 BENSON 278 CALDWELL,C1h 176,205 ABAT, R.L. 248 BENTQN, S, 269 CALLINAN, D.R. 247 ABEL,JJ. 266,267 BERGH1 204 CALZADA 279 ABIVA, N.A. 157 BERRAVICH, J. 89, 91, 94, 556 CAMBEL, H.O. 159 ABUTAN, W. 540 BERMAN, 115, 251 CAMPBELL, J.W. 76, 108 ACKER,RML 179,191,251 BERRYHLC. 54 ,CANLAS,A. 124 ACUARKLI A. 250,255 BERRY,LJ. 40 CARABAJAL,N. 116 ADAMS, E. 174 BERRY, S.W. 185 CARASI J-C 147 ADAMS, O.R. 153 BERRYMAN, J.T. c61Qg:ll:lF60fPMl4 5512 ADAMSON,T. 111 BEYDOUN,F 1 -- ACIUSTIN, M. 165, 208 BIASCANI R,P, 206, 540 CARLSON, R.C. 194 ALBAYALDE,J. 128 InERMANN,JA. 180 182 CARLTON,PLA. 245,248 ALBE, F, 191, 559 BILL, D. 165 CARRE, M.L. 55 ALBRO, B. 268, 279 BINOHAM, E.C. 78 CARREON, A.E. 151 ALFORJA, I.J. 121 BIVINS, T.L. 147 162 gtggilikg, P 153 ALLEN, D. 1 5 BJORGO, J.A. 189 195 , . . ALLEN, E. 558 BLACKWELL, 4.5, 88 CARRINOTON, R.L. 201 ALLEN,GJX 88 BLALOCK,lML 149 CARTER,DJY 90195 ALMACEN,LC. 211 BLOUUYIKF 147 CARTER,G- 165 ALMANZOR, N.F. 244 BOCR, T. 269 CARTER, M.A. 252 ALSTON, R.W. 40 BOERICIHTER, A. 182 CARTER, N. 155 ALVAREZ,T. 553 BOLDHi.L 114,115,278 CASEY,R. 125 ALvEAR, T. BOND 159 CASIANO, R. ALVESHLA. 222 BRADLEY,P. 106 111 CASKD,R. M 11? AMEND,P. BRAND,BJh 150 CASTENADA,A.. . ANDAYA,AJL 154 BRANDENSTEHI 204 CASTERLHLICO. 158 278 ANDERSON,D. 212 BRANSCU,D1L 24,42,175,181 CASTHLO 175 ANDERSON,EJ. 152 BRAZLE,ElL 265 CASTHLO 559 ANDERSON,KIl 158 BRESHEARS,KIX 155 CASHLLO,OJ 2 ANTHONY, E.S. 146 BRICE,J.C. 248 CATIPON, EM. 151 152 APPLlNC1TON,J. 78 BRIOHTWELL, J. 557 CAvALERI, J. 269 ARCHER, P-S. 261 BRIONES, J.A. 245, 262 CEZAR, B.B. 259 ARMSTRONG, F-li 211 BROADNAx, T.M. 174, 285 CHADWICR, T. 269 ARMSTRONG, R. 26, 106 BROMUND, R.F. 244 CHAMPAGNE, R.M. 175, 191, 279 ARMSTR0NG,MJ- 155 BROOKS 279 CHANEY,L 26 ARMSTRONG, R.T. 106, 188, 189 BRQSCH 541 CHANEY, M,J, 188 ASDEL, D. 79, 80, 81 BROWER, R. 559 CHANEY, v. 125 ASHER,D. 128,175 BROHRI 279 CHAHTHAVONG,OIi 150 ATERRADO, LB- BROWN, A.L. 159 CHAPMAN, J. 176 AUSHN BROWN,AJL 154 CHAPMAN,iA. 245 AVILES, C. 541 BROWN, F. 174 CHARD, C.S. 186 187 BROWN, J.E. 205 CHAVERA, J. 557 BROWN, J.S. 245 CHAvEz, Ev. 159 BROWN, L. 245, 267 CHAvEz, J. 165 BACOD R. 211 BROWN, R. 116, 174, 176 CHAvEz, J.D. 249 ' BROWN, R.M. 247 CHEELY, B. 255 EQggE?i?'M11 152 BROMWLS. 269 CHERRY,JL. 255 BAGUETO 175 BROWNINO, C.M. 209 CHESNUT, H. 175 BAILEY' M' 40 E25,?'1 '8 ii? E2IiL'Yf3SD.a? Yi? N1 . ,.. 222221 E11 111' 117' 118' 192 BRYANT, D.CI. 40 CHRISTIAN 75 151 BALCH R.R. 76 K' ' - ' BUCKLEY,RJL 191,192 279 CLARK 105 gggf,gIg9gP,, 89, ggg .WMO 9,9 CLARK, 186 888,188,941 192 BuENvIAJE, E. 187 CLARK, B.C. 152 154 8 888811, L11 449 BUENVIAJE, E. 114, 175, 182, 185, 184 CLARR, D. f 177 8 8881881011 M11 52 BUENVIAJE, E. 52, 55, 54, 98, 105, 106 CLARK, D. 210, 211 8888084181 279,542 BUNCH,RIL 155 CLARK,RJk 149 8888011 11,1 52 BIIRBRIDOE, T.C. 199 CLAY, D.S. 195 BARRYISP. 151 BuRCHE,D. 180 CLEVELAND,A1h 200 8888, D181 189,181 182 BURCHELL, R.S. 257 CLOSZ, P. 125 8488811111 289 BURCKLEY,BJL 178,248 COEFMAN,J. 100,101,104,111,177 8A88K1118, 155 BURDEN 279 COFFMAN,iF. 285 8A18MAN,G11 148 149 BURGESS 279 COLEMAN,MJL 180,182 881118, 1,1 A- 189, 181 BUROESS, M.D. 248 COLHOUN, D. 162 881118, 8.8. 25, 88, 89, 177 BURNETT, D.W. 267 COLLINS, D.M. 208 848201811 149 BURNS,MJ1 204 COMPTON,G. 162 884891981 159 BURTON,ER. 154 CONANT,SJL 250 8881.1 118 249 BUTLER, C.S. 190,191 CONDIT, O.E. 205 81911, C14 198 BUTTERWORTH, D. 116 CONDITT, J.S. 95 88112 M14 174, 258 BYRD, R.J. 207 CONEY, J.P. 154 BELL, T181 150 CONLEY, L. 88, 174 BELLO, R.N. 71 C CONT' 279 544 INDEX 0 I .5 .I ,S I I I 1 1 I . CONTI, J. COOK, D.P. COOK, D.P. COOLEY, R.T. COONROD, J.D. COOPER, J. COOPER, R. CORA, C.N. CORBITT, S. CORNELIUS, C. CORNELIUS, C.D. CORRALES, L. CORTEZ, W.M. CORWIN, R.E. COSBY, E.P. COTE, P. COURTNEY, B.W. COVARRUBIAS, J .J . COVELLO COVINGTON, D.W. CRACKER, G. CREASON, C.C. CRISAFULLI, M. CRONK CRONK, G.A. CROSS, R. CROXTON, W.K. CRUZ, R.R. CRUZ, S.N. CURRY, C.W. CURRY, C.W. CUTCHER, W.L. CUYUGAN, A.A. DALEY, O.A. DANIELS, D. DANIELS, J. DANKERT, K.A. DARBE, T. DARLEY, J.IVI. DAVENPORT, C.R. DAVENPORT, E.A. DAVID, I.G. DAVILA, C.A. DAVIS DAVIS, D. DAVIS, D.T. DAVIS, J.T. DAVIS, K. DAVIS, M. DAVIS, P. DAVIS, R.J. DAVIS, R.L. DAVIS, R.R. DAY, G.A. DEAN, J.S. DEARMIN, S.A. DEBOER, J.A. DECAIR, L.L. DEJESUS, J.O. DELEON, E. DELEON, E.Y. DELEON, M. DELONG, J.D. DENNEY, R. DENNIS, J. DENNIS, S.M. DENNON, L. DETERS, W.R. DIAZ, C. DIAZ, M. DICK, R. DILLIPLAINE, DIMILANTA, E. 160 67, 251, 275, 276, 278 98 121, 122, 125 D 174, 176, 245, 180 279 40 68, 72, 75 204, 268, 64 195 157 151 165 125 246 188 182 65 90, 91 180 1751 115, 180 142 212 88 269 556 205 279 174 81 118 244 212 145 127 54 81 278 184 268 194 269 278 196 559 278 152 155 247 127 197 154 247 269 175 189 558 208 152 189 249 156 279 279 556 260 128 124 162 252 186 257 215 251 150 162 185 159 125 215 116 84, 85 182, 177, 115, 189, 145, 558 540 185 117 209 27 558 144 558 126 DIONEDA, R.V. 143 DIXON, P.M. 40 DOBBINS, C. 199 DOBBS, J. 132 DOLLARD, M. 165 DOLORIAS, R. 126 DONAHUE, B.R. 54 DONES, A.E. 259 DOWD 175 DOXSEE, J.D. 243 DOYLE, M.P. 185 134 DUARTE, G. 165 DUARTE, V.J. 155 DUFER, D.F. 40 DUKATZ, T.B. 144, 162 DUKE, B.G. 152 DULUENA, A.C. 204 DUNLAP, T.L. 180, 132 DUNN, CLC. 151, 165 DUNNING, M.A. 174, 250 DUQUE 279 DUQUE, M.C. 155 ECRELBARGER, R.H. 165, 249 251 EDDY, A. 269 EDNALINO, A. 125 EDWARDS, B.R. 199 EDWARDS, C. 79, 80, 81 559 EDWARDS, T.M. 165, 174, 264 265 EGGLESTON, D.E. 85 EHLERS, F.C. 54 EIGINGER, K. 125 ELDREDGE, M.L. 145 ELLERBEE, J. 545 ELLIS, S.L. 40 ELMA, S.F. 154 ELPIDAMA, F. 557 ELSTON, C.E. 250 EMBILE, R.E. 149 EMSTAD, K.O. 147 ENCARNACION 558 ENCOMIEMDA, R.P. 249 ENSIGN, D.C. 54 ENTRICAN, M.S. 72 ESCOBEDO, G.A. 81, 177 ESHLEMAN, C.D. 255 ESRRIDGE, S. 157, 278 ESPINA, P. 126 ESTEBO, J.P. 90, 95 EWING, B.A. 211 FALDEROFF, M.R. 81 FANGON, B.C. 151 FANSHAW, T.P. 92, 162 FARMER, J. 119 FEENEY, J. 275 FELD, CLR. 249 FENNER, A.J. 257 FERGUSON, B. 541 FERGUSON, R.A. 55 FERNANDEZ, D. 152 FERRER, M.M. 150 FIELDS, C.B. 40 FIELDS, N.C. 180, 181, 182 FIELDS, R. 125, 174, 558 FIGUEROA, V.D. 250 FISCHER 259 FISCHER 261 FITCH, R.M. 262 FLENTGE, W.J. 40 FLETCHER, S.P. 192 FLORENCE, G.J. FLORES, C. FLOWERS, K.T. FORBES FORBES, M.D. FORBES, R.N. FORTE, J. FOWLER FRANCISCO, E. FRANCO, F.M. FRANKLIN, T. FREEMAN, J. FRENCH, J. FROST FRUTOS, M. FUCI'IS, G. GABA, J.R. GAINES, B. GALLEGOS GAMMAD, A. GANNON, C.L. GARLAUGI1, S.A. GARRIT, T. GARZA, E. GEIERSBACH, C.E GEIERSBACI1, R.A: GEIST, F.A. GIBSON, I,P. GILBERT GILBERT, J.D. GILBERT, L. GILL, J.L. GILLIAIVI, T.C. GIRALDO, J.C. GLASS, S.L. GO, D.B. GOEDE, E.J. GOLDADE, M.E. GOLDIE, C.L. GOLDSWORTHY, I'I. GOIVIEZ, D. GOIVIEZ, T. GOODWIN, R.L. GOSSETT, D.I I. GOYETTE, M.E. GRAGG, G. GRANT GRANT, J.B. GRANT, K. GRAVES GRAY, D.E. GRAY, M.W. GREENE, P.F. GRIFFIN, B. GRIGER, E. GRIGER, S.J. GRIMES, E. GRIIVIES, R.A. GRIMIVI, M. GRITTON, B.W. GUDE, B.A. GUERRERO, M. GUEVARA, A.R. GUFFEY, J.S. GUIGAYOIVIA, M.Q. GUILD, C.D. GUITY, R. HACKWORTH, T.J. HADDEN, T. 188 128 247, 260 279 145 261 162 278 249 65, 185 207 174 270 229 256 269 145 125 9 89,94,556 256 187 259 558 278,279 186,187 181 251 279 55,55 107 197 149 89 205,204 262 149 185,186 255 244 89 165 69,70,71,75 67,177 115 158 94 155 90 279 261 264 247 128 26 102,205 556 194 91,94 98,99,185 88 177 251 151,152,279 207 255 174,177,190 257 42, 158 INDEX 545 HALL 127 KING, D. 115 HALLOWELL, T. 270 ISE- E' IBARRA, E.J. 232' KING, MJ.. 265 HAMMONDS, K.B. 206 INEORVAIA' QC' KING' R- 540 HARDOROVE, E. 268 KINNARD, T.T. 80, 276 HARDY, F. 270 KINSEY, O. 197 HARRIS, S.A. 256 KJOSEI KL- 78 HARRIS' T.F. 75 JABBARI D11 249 KLAASON, D.A. 256, 257 HARRISON, A. 195 JACKSON, A.B. 262 KLEIMANI D-li 80 HARRISON, 'I'.A. 195 JACKSON, B.C. 180, 181 KLOPE, D. 64, 117, 279 HART, KW. 18Q, 181 JACKSON, D. 558 KPIOLL, IVI.I. 157, 180 HART, S.R. 77, 175 JACKSON, LW. 157 KOELLING 279 HARTMAN 55 JACKSON, K.E. 95 KOENIG 279 HARTWICK, J-A. 245 JACKSON, MJ.. 154, 155 KOENICL K-E 188 HARTWIO, T.M. 197 JACKSON, 9, 174 KOESTER, T. 162, 557 HASKELL 279 JACKSON, S.A. 72 KOPAZI R- 102 HASKINS, L. 165 JACQBSI D. 115 KOZAK, TE- 95 HASS, T. 205 JACOBSON, J.R' 205 KOZAKAR, J.M. 67, 177 I-IATHORN, S.I. 88 JAMAL, R.M. 151 KROWITZ 102 105 HAUGE, S.A. 40 JAMES, CLE. 147 KROWITZ, J.E. 160, 222, 225, 226, 228 HAUVER, L.K. 169, 246 JAMES, KIL. 72 HAWKINS, J. 145, 174, 268, 279 JAMES, 5. 261 L 78 111123 JAMISON, D.W. 152 I - - JANS, E.R. 84, 176 HEEREN, E. 270 JAPINOSKI, 6.A. 190 Iigiggg 'RA' 106' 185 HEFA 558 JENEWEIN, T.M. 102, 107, 197 LAMB ' 278 HENKEMWEYER, C. 545 JENKINS, R'D, 195 LAMB D A 80 HENRY, D.W. 247 JESTER, S.R. 77 LAMO'NT' S 206 HENSHAW, R.IvI. 176, 212 JOHNSON, A.T. 72 LAMPINCQ 115 261 HERMOSURA, J. 5 125 JQHNSQH, D, 175 LANE T ' ' ' 208 HERRERAI J- 89 JOHNSON, DA. 52 LANS1,.1g1 S D 14,1 HERRES, M. 108, 110, 111, 115, 224 ,101-INSQNI D110 186, 187 LARKIN ' 79 HERTRICK, J.B. 260 ,101-1151501517 D,R. 255 LARREA ' 157 HESS, B.W. 72, 22, 75, 556 ,101-INSQN, CLR, 154 L A115011 80 HICKMAN, B.J. 55 ,101-INSQN, J, 125 LARTER 'S ' 106 108 HICKMAN, P. 162 JQHNSQH, J, 558 LATTA ' 147 HILL 207 JOHNSON, RE. 264 LAVER11 'R11 55 HI'-Lf T-E- 148 JOHNSTON, C.6 205 LEM M'A ' 92 95 177 HM' DP' 146 JONES 279 LEDERSR 'P F 188 169 HILTON, D.W. 251, 248, 255 JQNESI D, 95 ' ' ' HINOJOSA, O. 180, 181, 182, 220, 221 JONES, D, 175 LEE 558 HLASTAVA, M.J. 82, 85 JONES, D.A. 92, 94 EEE' J' 174 HOATS, R.P. 205 JONES, RIA, 250 LEE' JJ' 264 110116251 G. 270 JONES, R11 158 LEE., S. 177 181 HOSCK, J.C. 265 JONES, 5, 162 EEE' ET' 187 HOLBROOK, CL. 257 JONES, S. 102 LEEPER, J.A. 54 HOLBROOKI C11 205, 205 JONES, W. 270 LEONARD, M.L. 70 HOLCOMB, 1 L 110, 261 JORDAN M C LEVIEN, H.A. 28, 29, 52, 54 279 HOLDEN M P HOLMEN LG HOLMES J HOLTZ G HOMA RA HOOKANO S H HORNBEAK W HOWES B G HOWZE M L HRICKO K M HUGHES HUGHES HUGHES HUGHES HUGHES HULL HUMBERGER J A HUNT D R HUNTER K M HUNTER HUNTER R HURLEY HURST C M HYLER R 546 INDEX 108 175 191 186 151 265 189 211 258 174 208 192 245 151 286 187 64 119 256 119 JORDAN S W JOSEPH J E JUAREZ E M JULKU D F JUMPER C P KALAS M KARANDANG D S KAUFMANN P G KAYA KEELEY F KEILLOR 250 115 90 95 90 92 174 121 204 190 278 KELLER RR 254 255 540 KELLEY KELLEY W KELLY B KELSTRUP KERKER N KIDD R 225 165 101 245 118 KIM DW 76 108 175 KINARD N 92 95 174 175 KING D 150 LEWIS J LEWIS J S LINATOC V LINDSAY S LITADA A LIVINGSTON E LIVINGSTON J G LOCKE R LOCKE RL LOCSIN EC LOH D N LONAS BW LONGCOR AW LOPEZ G LOPEZ J LORFING B G LOVELESS CJ LOVELL D LOWE J B LUCAS E L LUJAN W LUND D L LUNDSTROM C M LUZ D A LYTAR M K 157 174 151 122 127 151 165 259 278 211 155 187 557 197 92 95 162 189 545 196 149 165 147 55 - - , . . 264 ' I E ' 1 - . I I I 0 Q I 1 1 ' .I .1 I 1 1 I 1184, 1 . . 1 1 I I , , K , . . 77 , , , 40 , . . , . . 55 , . 1 - - , 9 7 , , , . . 64 , . . , - - ,0. , , . . HUGHES, J.J. 209 KI-:CK, 0.0. 206 LOPEZ, A- 125 ,R.K. , . 81 I - ,w.O. 55 I - 89 , . . 2 , . , - ,, . . 154 , . , . . 95 ,K.w. 95 ,C.IvI. , .. 52 , . , . 27 I - , ,P.J. , . , . . MA, H. MACAOILE, D.E. MACDONALD MACDONALD, M.P. MACIEL, E.P. MACKAY MACINUSON, J.L. MAGUIGAD, J.K. MAHER, F. MALVEAUX, D. MANALANG, E.A. MANALANCI, R. MANGONON, J.S. MANNING MANUEL, B.K. MARINO MARQUEZ, D.A. MARQUEZ, M.I. MARSHALL, J. MARTIN MARTIN, A. MARTIN, C. MARTIN, L. MARTINEZ, L.C. MARTINEZ, P.A. MARTINEZ, R.C. MASE, F.O. MASON, D. MATHIS, M.H. MAXWELL, R.L. MCALLISTER, J. MCBRIDE, A. MCBRIDE, E. MCBRIDE, E.T. MCBRIDE, J.W. MCCHESNEY, J.P. MCCLANAHAN, R.L. MCCLINTOCK, J.L. MCCOLLUM, M.J. MCCORMICK, P.E. MCCULLER MCCULLER, J.J. MCDANIEL, G. MCDANNALD, D.CI. MCDONALD, J. MCDONALD, W.R. MCFADDEN, B.E. MCFARLAND, M.S. MCFARLANE MCGOVERN, T.G. MCINTOSH, R.A. MCKAY MCLAUGHLIN, M.T. MCMANUS, T.W. MCMICHAELS, W. MCNEIL, H.T. MEADE, R. MEANS, W. MEISCH, M.J. MELOTT, M.J. MENDES, J.G. MENDOZA, A. MENDOZA, E. MEREDITH, J.L. MESSER METRA, D.M. MEYER, M. MEADE, R. MIDKIFF, W.S. MIKAELE, F.F. MILLIAN, IVI.G. MILITAR, E. MILLER, J. MILLER, R. 176, 155, 165, 114, 117, 248, 250, 252, 189, 205, 270 204 262 265 211 255 211 165 556 267 267 124 145 262 199 177 55 154 124 180 559 118 559 80 265 251 215 210 258 201 541 81 71 72 255 279 72 250 150 77 278 70 165 195 204 80 209 90, 95 200, 152, 155, 165, 175, 55 260 71 559 201 175 270 206 254 95 149 257 148 162 165 154 55 154 165 254 245 262 84 125 556 145 MILLER, R. 165 MILLER, R. 94 MILLER, R. 542 MILLER, R.E. 71 MIMS, V. 271 MINER, G.M. 231 MINOR 175 154, 165 MITCHELL, J. 184, 135 MITCHELL, J. 275, 276, 278 MITCHELL, J. 218 MITCHELL, R.T. 187 MOLINA, E.T. 211 MUNCADO, H.T. 259 MONTGOMERY, C.L. 195 MONTIFOLCA, N.A. 258 MONTRY, M.E. 208 MONTVILLE, E.J. 96, 98, 105, 106, 114 MONTVILLE, E.J. 52, 54, 180, 185, 184 MOORE, A.R. 175, 180, 182 MOORE, S. 158 MOORES, B. 268 MORALES, R.B. 147 MORAN, J.CI. 259 MORENO, J. 255 MORIARTY, C.W. 151 MORRIS, J. 174 MORRIS, J.B. 70 MORRIS, M. 271 MORRIS, R. 117 MORROW, K. 176 MORROW, K.M. 247 MORTON, C.M. 154 MOSER, T.R. 55 MOYA, D. 246 MULLINS, D. 162 MUNIZ, B. 118 MUNLEY, P. 119, 174 MURPHY 278 MURPHY, CI. 91 174 MURRAY, T.P. 279, 280, 285 505 MUSGROVE, J.L. 207 MYERS, C.E. 146 MYERS, H. 94 MYERS, H.L. 95 MYERS, R.T. 154, 171, 175, 176, 177 MYERS, R.T. 65, 82, 174, 228 MYERS, R.T. 251, 275, 276, 279, 505 MYERS, R.T. 16, 17, 18, 19, 62, 64 N NAMOCATCAT, F.S. 52 NAPUTI, J.N. 265 NASH, J. 271 NASH, S. 117 NATIVIDAD, E.S. 129, 150 NAUCILE, J.E. 180, 181 NAVARRO, J.P. 144 NAVARRO, R. 541 NAYLOR, J.R. 95 NEAL, J.D. 169, 22, 255 NEERING 75 NEERINCI, S.K. 70 NELSON, N.L. 90, 95, 94, 95 NEUWEILER, M.J. 55 NEWSOM, S. 116 NGUYEN, D.V. 250, 255 NCIUYEN, H.X. 155 NCIUYEN, R. 558 NICHOLSON 176 NICHOLSON, K.M. 209 INIICHOLSON, L. 174 NIELSEN, J.J. 129, 155 NIMS, C.R. 134 NORMAN, J.A. 188, 190, 191 NORTHRUP, S.F. 195 NUCIENT, A.M. 245, 265, 265 NULL, N.B. 211 NYKIEL, R.A. 147 NYLIN, V.E. 190, 279 O'DELL, J.T. 154 O'NEIL, D. 162 O'NEIL, T. 271 OBRANOVICH, K.T. 150 279 OCAMPO, E.D. 260 OLIVAS, A. 180, 181 182 OLIVER, L.R. 209 OLSON, K. 271 ONGLEY, J.A. 211 ONGLY 105 ORCIETA, C.T. 258 ORTIZ, M. 146, 162 OSBORNE, B. 556 OTERO, L. 89 OUELLETTE, D.A. 154 OUTEN, C.E. 252 PABLO 278 PABLO, A. 124 PACADALJEN, P. 124 PACHECO, F. 176, 541 PACHECO, R.R. 254 PADAYAO, J.B. 155 PADEN, W. 162 PALMER, D.CI. 190, 191 PAMA, E. 127 PAMAN, J. 119 PAROU 557 PARKER, T.R. 247 PARTAIN, R.E. 77 PARTEN, H.W. 80 PASCUAL, A.A. 54 PASCUAL, V.B. 154 PATRICKA, J. 40 PATU, H. 128 PAUCIH, R.H. 165 184 PAULLIN, L.J. 204 PAYAN, L.A. 55 PEACHER, A.W. 150 PEARSON, W.S. 258 PELTER, C.W. 260 PENCIILLY, M. 69 279 PENNINGTON, R.L. 255 PEOU, M. 154 PEPPER, R.L. 250 PERALES 559 PEREIRA, S. 89 556 PEREY, H. 127 PERKINS, S. 541 PERLUNGHER, M. 90, 91, 94, 175, 556 PERRET, S.B. 165, 256, 257 PETERS, F.A. 55, 55 PETERSON, C.R. 247 PETERSON, CI. 176 PETERSON, G.A. 245 PETSCHOW, S. 271 PFAU, L.D. 185 PHILLIPS, J.G. 185 PHILLIPS, P. 174, 198 PHILLIPS, R.R. 212, 215 PHINNEY 558 PICKUP, W.P. 68, 71 PIERCE, G.R. 78 PIERCY, A.T. 40 PIERRE 559 INDEX 547 PIERRE, L, 174 ROCNE, P.c 174, 200 SHARP, G.R. PIGGEE, G.E. 211 ROCRENBACH, C. 89 SHAUGHNESSY, J.M. PINDELL, C.D. 162, 200 RODREY, D. 259 SHAW' G- S M PITTMAN, T.A. 175, 180, 181, 182 RODOSKY, J. 162 SHEARER' - - PITTS, A.J. 147 RODRIGUEZ 278 SHEFFIELD PIULA, EF. 159, 176, 245 RODRIGUEZ, F. 271 SHEFFIELD' P- PIXLERI D, ' 275 RODRIGUEZ, G. 271 SNEFFIELD, ES PLACE, A.A. 70 RODRIGUEZ, J. Q5 SHEFFIELD, M. . POGROSZEWSRI 278 RODRIGUEZ, J. 165, 177 SHEPPARD, . POI'IL, MC. 54 RODRIGUEZ, S'.A. 251, 252 SPIERIDAN, J.c. POLINTAN, E. 558 ROEDL, P.J. 55 SHIELDS' D' POMAN, E, 215 ROGERS, S. 125 SNIELDS, D. POOL, S.G. 255 ROLAND, R.D. 148 SHIELDS, R.L. Pom-O 279 ROMERO, Q, 557 SHOEMARER, S. PORTO, A. 126 ROMINES, M. 85 SHORT, C. POWERS, J. 118 ROPA, T.F. 155 SHORT, C.L. PRATT, N. 285, 505 ROSS 251, 279 SIKES PRESTON, D. 557 ROSS, R.T. 40 SILTMAN, D.W. PRESTON,J, 557 ROSSLI 145 SHVER PREUTER 255 ROUNDY, J. 177 SILVER, J.J. PRICE, 8.6. 71 ROWAN, D. 96, 100, 117 SILVEUS, T. PRICE, S.J. 210, 211 ROWE, J. 165 SIMMONS, K. PRUDENCIO, D. 271 ROWE, T. 165 SIMMONS, MB- PUMPNREY, R.v. 40 ROYAL, C. 176 SIMMONS, T. PURNELL, C.N. 55 ROYAL, C.A. 245 SIMPAUCO, R.A. RUBE, M.A. 195 SIMPSON, GJ. R RUDIO 278 SIMPSON, J. RUCRER, G.E. 150 SIMPSON, J. RUSH, L.E. 92 SIPES, J.R. RABEL, C. 188, 545 SIYI AM, RADCLIFF, G. 271 SIZEMORE, J.M. RAJAGURGUR 542 SKINNER RALL, D.L. 155 SKINNER, J. 105, RANAY, RM- 89 SAGATU' M- 72' 165 SLAWNIROWSRI, T.A. RAPOZA, K. 149, 162, 557 SAHL, E.M. 71, 75, 251 RASPER, D.J. 159 SALAS, E. 26 SLAYTON RAUER, M.R. 180, 181, 191, 229, 558 SALLEZA, M.R. 264 SMALLSI M' RAWLS, I. 158, 165, 177 SAM, F. 176 SMELTZERI M.A. RAY, C,G, F.I.7. RECR, R.D. 147 SAN FILLIPO 559 SMITH REDD, C.G. 208 SANCHEZ, R. 125 SMITH REEDY, RK, 181 SANDOVAL, J.L. 207 SMITH, C.D. REIBOLD, J.M. 258 SANDS, w.M. 145 145 SMITH, DA. REX, RQ, 196 SANER, T.L. 176 246 SMITH, D.J. REYES 278 SANGALANG, P. 124 SMITH, G. REYES, C. 124 SANTIAGO 279 SMITH, L. REYES, E.R. 206 195, 196 SMITH, LOW. REYES, R. 114, 115 SANTOS, D.C. 254 SMITH, M. REYES, w. 162 SATTEREIELD, R.J. 155 SMITH, MD. REYES, w.c. 207 SCANLON, T.J. 248 SMITH, REYNOLDS, R.T. REYNOLDS W F RICHEY D M RIDLEY RIFE R RIFE RJ RIKARD M RINESMITH C H RINGROSE G F RIOS F RITUA RIVERA E P ROBB T J ROBBINS ROBBINS 212 188 189 147 215 279 557 156 277 71 190 225 226 96 110 111 ROBBINS J 99 M 100 101 105 ROBBINS J L ROBERTS M W ROBERTSON A R ROBERTT G P ROBINSON C S ROBINSON ROBINSON RJ ROBLES 548INDEX 147 179 151 559 208 15 227 115 110 211 265 198 245 262 SCHAFF M J SCHARA TJ SCHELL RA SCHENR FT SCHERER D SCHEXNIDER M SCHILKE RA SCHMIDT T P SCHNEIDER SCHNEIDER J SCHNITZLER W SCHOENFELD G B 189 116 279 208 155 266 210 256 278 54 117 80 81 SCHUCK BA 80 81 175 SCHUELER S SCHUELER S C SCOLARO KJ SCOTT P L 196 SCOTT S 114 116 117 SEDLACER RG SEISON B SELIGMAN R SELL CS SELLERS SR SHAFER SHAFER D 250 180 R.D. I a 5 I ,RJ-I. ' - - ' ' - - ,R.w. , I ' . I I I . ' IS' I I I ' ' ' ,S.L. ' - 92 ' - ,S.S. , . . I v I T.D' I ' - ' ' - - 54'2 ,w.M. 72 ' - ' ' -- , . . 54 , . . 64 . , ' ' ' - ' , . 89, ' - - 154 ' ' - SOVERN,.J..L. 64,176,185 RIvERA,T. , . . , , , I H , , , , . . 88 ' .' IJ' I I 1 I ' ' I I . . ' , '. . 40 , .I ' ' ' ' ' , . 6 I e . - , . 0 I ,D.D. , . . 95 ' 179 278 145 197 261 118 198 271 160 251 558 182 SMITH SMITH SMITH SMITH SMITH SMITH SMITH SNYDER T B SOBLEY J C SOLANO J SONG M H SPAGNOLA PJ SPAINHOWER SD SPARKS BA SPEEGLE R B SPELLMAN T G SPENCE RW SPENCER W K SPILLANE W SPREADBOROUGH SPREWELL G E SPREWELL R STANKE GA 172, 152 78 165 149 556 94 174 261 165 150 175 200 69, 70 162, 174, 180, 182, 87, 145, 114 175 251 148 557 187 69 71 558 27 157 158 245 151 541 187 105 266 146 224 106, 107, 111, 127 64, 105, 177, 185, 184 205, 248 251, 252 174, 150 186 158 115 175 176 187 148 175 I 210 252 195 176 257 54 95 260 265 146 212 27 175 545 272 198 249 175 278 256 272 196 557 177 245 256 155 257 87 91 147 245 272 117 91 94 165 247 STANTON, W. STARKS, W.E. STEGER, J.A. STEPHENS, J. STEPHENS, J.I. STEVENS, C.E. STEWART, M.W. STILES STILWELL, B. STORY, M.A. STRANKO, M.R. STRAUGHTER, M.W. STREIB, R.F. STRIEWE, A. STRIEWE, J.G. STROMBERCI, K.J. STROUP, J.W. STURM, R.J. SULLIVAN, R.M. SUTHERLAND, C. SUTTER, J.E. SUTTON, G. SWANSON, D.J. SWATZKE, J. SWINDLE, Y. SWINFORD, R.L. TAILLON TAILLON, S.G. TALBOT, S.J. TARNE, R. TAYLOR, C.K. TAYLOR, D.L. TAYLOR, J.F. TAYLOR, L. TAYLOR, P. TEJADA, M.A. TEJADA, R. TEMPLETON, R. TERRY, R.A. TESS, E.K. THIEN, T.R. THOMAS THOMAS, D.R. THOMAS, F.N. THOMAS, R.A. THOMAS, R.J. THOMAS, W.CI. THOMAS, W.G. THOMPSON, J.G. THOMPSON, R.A. THOMSON THORN, M.A. TIEU, A.H. TINSLEY TOBORG, S.A. TONEY, L.F. TOPASNA, M.A. TORRALBA, N.B. TREEMAN, M.W. TRINIDAD, E. TUCAY, C.T. TUCHE, D. TURNER, M.A. TURPEN, M. TURPEN, Z. TUYOR, R.D. TWEED, J.M. TYLER, B.L. UMALI, C. 6 188, 189, 274, 275 25 268,278 255 148,149 174 95 256 155 542 160 40 194,197 251 206 26 82,85 90,95 40 186 148 556 40 206 150 90 124 186,187 279 159 7, 74, 142 55, 162 146 259 89, 91 146 557 206 165 150 188, , 276, 274, 162 254 278 55 175 152 271 151 52 189 278 151 80 279 148 265 559 265 148 201 255 50, 51, 55 151, , 191, 124 152 268 192 245 26 151 52 55 162 UMALI, M.R. 245 UMATUM, T.R. 261 URENO, J.L. 155 URIBE, J. 162 URICH, C.H. 159, 273 UTRERA, M.T. 215 V VALDES, J.R. 207 VALENTINE, C. 255 VALENZUELA, J.L. 154 VANDENHEUVEL, M.J. 257 VANDEWARRER, D.L. 62, 74, 80 VANDIERENDONCK, J.B. 246 VANHORN, R.T. 40 VANHORN, S.A. 40 VARGAS, J. 75 VARNER, G.L. 249 VAUGHN, L. 180, 181 VELA, M.R. 267 VERDUZCO, J. 255 VERGES, R. 162, 174, 541 VERSNICK, S. 559 VICRERMAN, J.W. 187 VIERYA, V. 115, 117, 118 VILAR, A.G. 252 VILLANUEVA, R. 260 VILORIA, D.P. 244 VIRDEN, J.A. 208 VISH, S.S. 156 VITUG, A.J. 150 VONSCHERR, M. 279 W WADE 559 WADE 557 WALKER, J.L. 207 WALLACE, T.C. 25 WALLS, A. 174 WALLS, A.M. 264 WALLS, D.F. 152 WALSH, T. 116 WALTERS, J.L. 196 WALTON, J.R. 95 WARD, D.M. 199 WARD, J.R. 211 WARNER, J.R. 52 WASHINGTON 556 WASHINGTON 94 WASHINGTON, A. 75 WASHINGTON, L. 174 WASHINGTON, L.J. 95 WATERS, D.E. 261 WATLERS, R.L. 146 WEAVER, T. 125 WEBB, J. 184 258 WEBER, R. 179 184 WEBSTER 278 WEBSTER, C.D. 81 165 WEERES, R.L. 255, 279 WEIDNER, B.J. 126, 129 WEISCOPF, C.E. 505 WEISCOPF, C.E. 21, 22, 62, 65, 279 WELCH 279 WELCH, C.A. 148 WELCH, S.G. 55 WELSHIMER, T.L. 75 WEST, E. 210 WHEATLEY 175 WHILDON, M.W. 52, 55, 54, 81, 278 WHITE, C. 162 WHITE, C.D. 69 WHITE, C.L. 246 WHITE, J.E. WHITE, M. WHITE, M.C. WHITE, R. WHITE, R. WHITE, R. WHITE, R.F. WHITEHEAD, M. WHITEHEAD, M.D. WHITLEY, T.J. WILBURN, D.R. WILCOX, J.D. WILDE, B.W. WILKENS WILKENS, J. WILLEY WILLIAMS, C. WILLIAMS, D. WILLIAMS, J. WILLIAMS, J. WILLIAMS, J. WILLIAMS, J.E. WILLIAMS, J.O. WILLIAMS, J.R. WILLIAMS, M.J. WILLIS WILLIS, B.L. WILLS, M.E. WILSON, E.E. WILSON, L.G. WILSON, R. WILSON, S. WILSON, S.W. WINZER, J.A. WOJCIKOWSKI, R WOLNEY WOLNEY, E. WOLNEY, E.Cl. WONG, C.H. WOOTEN, E. WOOTEN, E. WORLEY, T.M. WOZNIAK, B. WOZNIAK, B.S. YANCY, D. YANCY, D.W. YANIK, M.A. YEARGIN, K.W. YEARY, R. YODERS, L.K. YOHNKE, M. YU, R. ZAPIEN ZBORIL, P.A. ZELAYA ZELEZNIK, B.A. ZEMANY, C. ZIARNICK, J.L. ZIPKAS, M.F. ZONE, C. ZUCCO, F.J. .J. 159 95 204, 218 557 115 94 146 165 247 159,M 165 54 162, 180, 181 205 541 187 278 174 558 279 81 72 204 180, 185, 184 190 196 541 272 95 71 150 122 210 115 159 266, 278 251 165 252 259 174 541 155 129 155, 154 90 95, 115 192 257 90, 545 254 200 126, 279 542 69, 75 557 174, 245, 265 261 92, 95 208 70 144 INDEX 549 CRUISEBCGK STAFF f , - x 'L' - S SPECIAL THANKS TO A DSI5 BUENVIAJE RM5 CUTCHER ABH5 MYERS RIVI5 SMITH AZ5 CORA P111 LAMB EWI5 TINSLEY P115 WHILDCN --efsox.. , .A -- A , K ff' ...----.J I U , X 1 A X K. FZ? ,f fl 08 VA Q - 4 'T l AU-'K 1 9 ZW m W ,S - 40 52 f ef 5 j J fl wx 3 f im 6 1 is 1 Ex 1 H 1 8+ X H 1 L ff Q H. f uw J 3 Bmw, IZLWEEES 'W ' Q M F Ea as-m. aa 338 1 4 f A gg M, F X W LN Q, V533 Modes 'N j , E f lj ff I ' - fl fi M 2 T959 S' ls-va. mm. Q igxw Q53 41,5 fXlCiC2Qor1,n,EUa 550 CRUISEBOOK STAFF ' ' - -inn-wmv-.---,Y-v---'v' Ve. 9 , ! ni ' sei H, VK L2 I i F ggi' 5W'3-- 3 lg 1 fg F. J, Q' fry Qhm? x . , 4 , Exa m g , 5 Q , J Ll ' XT t W f-QP i H , 55141 aka: 5 gf ,J 0 W Q ' ' dsnnw , JN? Q 'V rg f f ' Ls 9 v QA ,W Q, A Q jf J Q may 5 E L f an - 32-'Q 2 Q v - K P Q 2 2 W Q HT U no M H X W 9 ESQ cnznncas if 3 Www .4 1 1 WW X-Q, 2? X' Jn L is ,W T 1 OX 1 ', 1 I I k 1 If!-L f f afii Yu MU SQ577' QW Lnveeu , Q. CRUISEBOOK STAFF 551 ii lb K 2 E . 5 B -,A , ' Q 4, , Qikfew L 'K M ! K X S is X, J , 3 6 N-,ft ,f A ' 3 ff e f N ELQTES X-fi bi mt S X K.. 5 3 ' BT I 7 T fix W , , ,V A ly BZ! -'Q MIMEK ,Z-'Z-Q an EC- LCH51'on 552 CRUISEBOOK STAFF My ' :1-an W C! uf, E EEBWWJEM X H3 2 Rutk R I -X W , I ,- ...-- 1 Q X vb xg mf Ni' 1 .Al -f , ,1 G' QQ A E mf lf! f 2 ' '- uf as K STRQN V it E32 frm HA QS 9? iii Q 1 Q -1' mu NEBSER 41-3 in HYLIEK of g ' , Q , f f , K AV , ' af 55,7 fi X 5 M! 'GJ H ,,, an Q M Mfr -, I A f ---- -A K6 4 I' 7,1-4. HALLQ, DN 3 x .S I 3 5 5 I Q Q Q 3 I X 1 f 1 1 1 1 2 I , . P I U, J 1 -I 4713. f Q'1 ,f'f JA WA' iff I :A I Gail, .fjhgff f , 35911117 x ,claim 231' ga ,finffl KX iv-X ,f X h O 1 I 'J ,P 1 44 1 f H e,y 'M I 4,l! - ,V ,, a v u, , N, as ex 'nw' 1 1 1 ,I ' . x ,W J ' ,W X V .15 ' N YJ e 4 'f f , X- N 7,151 ll! ,I gig X X 'w'5J5 l 'j'!Jf, .. KX Pi , E7 ,QW JW qv Wm W ! .ffWl'I7 M M' mmf! A' .x J 'JJ - My Rx ,Y ,' ' I' f X gl' ' 4 Imp, Au ff' T fx , I 5' .1 lll bfilxl . H Il li l UI 1 2 ' ' H ' x L '1 W W Xxx 1Y,ki lax- -? tx H 1 'il' 1' ' Q k l i i 4 i I r Aida peopfe who made thi5 CFUISG book poisiblef 41 .0 fk . J 7 7
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
