Palo Verde High School - Olympian Yearbook (Tucson, AZ)

Text from Pages 1 - 318 of the 1968 volume:

QI mpian Sixt -Eight Palo Verde High School I320 South Avenida Vega Tucson, Arizona . Volume Six PALO VERDE Q-an xcuicw 5 T5 21 , 1 5 pn, r- l A-I? 5 ,. ,.,.1. . H W 'sf j J' ' 5, ' 2 in l V W W. 0 W U N we 5 up M' -'ilu O W magma 7 5 P -m.. --'-A ' e Honor The game Thou pIayesT5 for he who plays The game sTraighT and hard, wins even when he loses. -Hugh Fullerfon 7' 4 Students Developed Inward as , M TT V ' : ArT is noT an end in iTseIT, buT ' gu' ': , T a means of addressing hu- T 7 , , maniTy. T --MP Moussorgsky E 0 0 o fl Feelings of Spirit rf' 7 fi J 1, 4 i' I! if, 1 53' 251 1 l fl, My 55 ive 5,3 E . :gil 1 iii K. v g 1 2 X xi i? I li, f f fff it 5 f i W. -mmmw .A f2k?f?lilAfL'ff1fiiaiiQ??ifQg Wisdom is the principal thing: Thefe- Let it rise! let it rise, till it meet the sun in his fore get wisdom: and with Gll Thy coming: let the earliest light of the morning getting get understanding. gild it, ond the porting dcly ploy on its summit. -Proverbs lV:7 -Daniel Webster 5 Contemplatlon of Success The rnanner of your speaking is full as importanr as The matfer, as more people have ears To be tickled Than understanding To iudge. -Chesterfield In Things perraining To enfhusiasm no rnan is sane who does not know how To be insane on proper occasions. -Henry Ward Beecher Brought New Horizons in Reach oooooooo 2, i Such sweet compulsion doth in music lie. -Milton Science and cart belong To The whole world, and before Them vcinish The barriers of notionolify. Goethe 3 X af' :L 924, Q' ts if . Qw- V 1 ' vu- 3' ii Viv + we H .t :I , . . A . f 5 If 27' w , A td, A' . ea, W : 55' M , Km I 'fax S5 fa? 1 Us-M 9, L8 Y. Y ' . W, 5 .- , - .. K .ix ' 5 I . ' Y 2,1 l , Q if ' 3 Q. ' f, 2, 4.! 'l1i3':'f' N - fur! , f '. Y 'ikfk N . HW ,. fy ,af 3' . wxf ML.- QR-a: il, ,SI ',j1f' 2:,',,ii!! ll '5 .rg .,v.. 4 M , . fin- Us , 121 'rg - tg.. . . if .N , K , K, '54 'S-. fn,-.- k . ' M ', 4 ' X ' 4-'w ' f ,Q xy . . P1 fp . .-1 xg! . .. 'I' ', 'gf' ' mv., W,Qs my 4 '+A '72 'X-Pl? '!i:Z7i XY! .B'Ei'3,f7'3 '+- ,,, ,,x.M465, X fi R, M ,g 1. Q-J?-' , gj,1Hl'1'fQ . 3 , .f M X '- i?1f,,vx9 ! 5 K Vw 3, .MQFNW N .', ,,'A . ixlvke- A . if: 1 tx' 'MAJ . f 5151 3 . 'XL-' . WL ,wr X 1 ' 4 Q .I ,mx 3 .A 1. -fi' .f-, ' VX .l'. ff ,A 'V Kf S . wrgsa -5 . ,.i?H ', 'ww' it ' A ,A MLA' 5 'Ig'-:Q x iv, -'Iii fy ' -:HH X f, ff, ,fig 1. ' ' - v 1 Fax 'JLUA I QE 'fgli' . V q 1 e 'fx I A .1 ja, I f' '- ,-1 , .-f .N . 'uh s II t , . ,fvguv , K.,- - 'UB .A .Q ' ' fs'ff, 9',f -if ... f YQ 1'-va.V! L ,I l'- I I '.!5pi,X .V -,iw A - - . w. 4 'ff' 'ei 'L . ' W- :g?f1'i:w'. ?,,1'f 'i'f?f - f Q ' 'f fb nuff! -'fiu .' inf J 2 1- 1 ,f ,f 'X , ,Q N . ,. if fo. .xv lhilm - 4 g 4 f Y 1.L- fk,li 1 it wi' S . 'Lf W 'l K, , 3155, -,Q f-' ,, .,,,:g wal lg .-'ff A ' Y ,f .gnzggyu L ,4-4, Nz! 7 G A ew .fn M :- L,.,,: W k X ,A 'Pfmviiiw 'X -W , ,X Z A 1 'WWL iwwmwmfw' wwwmwwwf iw xy 5- ,- ww W An , v W ggi? ' H- . ? l ,iiggi LE' .uv yy 'Q Y gm A A MLQEMEEQF ,ma , ,VW if EQQEEQE j15Q?E5i a??2i?f?f - 242 1,31 :,,,gff.i 225??5Q?ii twpswl Wed A Q1 'ig JM. , ,. .3 ,zl H 3? sf' 'M in F b J M V .Fw Q ,Q 'Y -of NNW 'Ns Q, x 4 1 1 w 1 A x 5 ., X ? X5 AJ: 1 47 Facult And Administration He that would govern others, first should be the master of himself, richly endueol with depth of understanding and height of knowledge. -Massinger E , Dr. Robert D. Morrow, Superintendent of Public Schools, addressed the School Board in a meeting. He and his staff kept the schools running smoothly. E Superintendent Dr. Robert D. Morrow worked with his administrative staff, Mr. Allan Hawthorne, Dr. Elbert Brooks, Dr. Thomas Lee and Mr. Hugh Summers. School Board, Principal Concentrated on School Board Members, Mrs. Walter Hafley, Mrs. Harrison, headed the board meetings. Current prob- Bruce Dusenberry, Mr. Soleng Tom and Dr. Harmon lems of District One Schools were discussed. District One School Board members were elected from the local community to have policy making decisions regard- ing education. They devoted many hours without pay for securing the finest edu- cation possible tor Tucson Public Schools. At regular meetings, financial reports were given and school department re- quests were discussed. The board was also concerned with the building of curriculum. Mr. Conrad Quenelle, Palo Verde prin- cipal for the past three years, was for- merly trom Tennessee. He attended Maryville College and did his graduate work at Duke University. He later re- ceived his masters degree trom the UA. As principal, Mr. Quenelle kept long hours. His regular school day was from 8 a.m. to 5 p.m. The foremost duty among his many responsibilities was to arrange a teaching schedule to provide the best education possible for the students. Mr. Quenelle stated that, he has never known a better student body. 7 iw c , xv 3.-Qi-1 I , I ii ' -t, f, In . I I .n al. . A if rw Appoinlmenls and meeling schedules for each week were discussed by Mr. Conrad Quenelle and his secretary. ' School Needs -I . I A i ' 5 ' - a4,55gQ.'if . ,ii , , W is Principal Conrad Quenelle offen checked lhe fool'- ball field during lhe aflernoon before a home game. Mr. Conrad Quenelle Iefi his office after a hard day of administraling lhe ciIy's largest school. 'm--..... 14 As Assistant Principal for Student Per- l sonnel, Mr. Guirl had several duties. He supervised the counseling, guidance and registrar staffs, was responsible for co- ordinating the administration of national tests, requested and approved all scheduling of standardized tests and helped to arrange meetings between col- lege representatives and students. Mr. Guirl organized procedures providing for student registration and as his final duty of the year, approved student eligibility for graduation. Assistant Principal For Student Activi- ties, Mr. William Kemmeries, coordi- nated activities of class officers, ad- visors, school clubs, and had the difficult job of enforcing school regulations and policies in respect to all student activi- ties. He planned assembly programs, athletic programs and published and distributed daily announcements. Mr. Kemmeries was responsible for the or- ganization and maintenance of the bells and public address systems. He helped Mr. Guirl, assistant principal for student personnel, and counselor's offices. Mrs. Grant assisted him by . to keep the school running smoothly. Assistant Prin ipals Aided Student Projects Mrs. Foust, Mr. Kemmeries' secretary, kept the bulle- tin board in the attendance office up to date. iq! its' xii is ski -1 I an 5 is fa U . 1 P' v. .if lk N Mr. Kemmeries discussed plans with Senior Class gested at advisory board meetings were taken to President Mark Canright. Proiects and activities sug- Mr. Kemmeries' office for his approval. Mrs. Mary Hall and Mrs. Betty Perkins, secretaries for the Dean of Girls and Boys' took care of the paperwork and were the receptionisls for the Deans. Girls' League sponsored several activities during the '67-'68 school year. Mrs. Cox attended meetings and was responsible for approving club proiects. O O O O O Deans Supervi As Dean of Girls, Mrs. Cox had several responsibilities. All social events were approved and cleared Through her office. A monthly calendar listing school activities was published and issued to all students. Serving as faculty advisor to Girl's League, Mrs. Cox stressed that girls be well-groomed and abide by school regulations. She counseled with those students who requested her help concerning prob- lems at school and at home. Due to overcrowded conditions, the Dean of Boys' position was held by Mr. Slawson the first four periods and by Mr. Evans periods 5 through l2. The re- mainder of Mr. Slawson's day was oc- cupied with the iob of Assistant Prin- cipal at Sahuaro High School. Both deans were responsible for the discipline of boys. Conferences were held with parents of students who needed help. Mr. Slawson was in charge of the assembly schedules. Both deans super- vised many of the school activities and had charge of hall monitors. sed Various School Activities Due to overcrowded sessions, parking was often Mr. Evans discussed the various parking problems, difficult for students and faculty. Mr. Slawson and especially the excess traffic after sixth period. Counselors Helped With Schedule Changes 4 ' .- C mi g a 5' - QM . Y I JR, ,,,. g . JANIE EARL CALDWELL BITTINGER Counselor Counselor -,.. . Vk l affi x 'L WILEY MURPHY RUTH PINKSTON Guidance Counselor Counselor ig,-sm ,ew 1 X 1. MURIEL CARLTON Counselor 5 2 . ll I LEON SWART Guidance Counselor M s.,,,vi sk i. 5 DUANE DEARDORFF Counselor i f i n .3 CHARLES TRAISTER Counselor Gun Club Qi for i CW, JIM ESSIG Counselor Junior Class . R. My i -- ri C' T JUANITA M. WESTER Counselor Counselor Mrs. Juanita Wester assisted Jan Fleming dents individual attention, counselors were relieved concerning personal problems. In order to give stu- of some duties such as College Applications. Despife double session difficulties, counselors managed To be available whenever possible. Each counselor was assigned a cerTain number of sTudenTs To guide Through Their high school years. AT The beginning of The year The counselors helped wiTh regisTraTion and schedule changes. Schedules were ar- ranged according To vocaTional plans and necessary course requirements. All sTudenTs were required To Take classes in English, social sfudies, science, maThe- maTics and physical educaTion. Those sTudenTs planning To aTTend col- lege were encouraged To apply for scholarships and admissions, keep grades up To par and Take The PSAT exam given during The iunior and se- nior years. STudenTs who wished To begin work immediaTely aTTer gradua- Tion were placed in vocaTional classes. Achievemenf TesTs were given in En- glish classes To discover weaknesses and capabiliTies. Counselors also arranged for TuToring when iT was needed. AlThough careers and classes domi- nafed mosT conversations with The coun- selors, They were always willing To help wifh personal problems, as well. Miss Trainer, a student counselor for Mr. Deardorff, discussed problems she had encountered, with Mr. S i if i iii . zii Miss Bittinger encouraged Betsy Hoar to look over college handbooks. Counse- lors assisted students with college and vocational plans after graduation. Guirl, assistant principal for student personnel. Student counseling helped Miss l Trainer become more acquainted with student-counselor relationships. , , Counselor Mr. Murphy gave instructions to students taking the American College -uname:-nov-as Test. His iob was to assist students regarding colleges and scholarships. Mrs. Dawson was kept busy making counselor's appointments for the steady flow of students. She was also in charge of the student cumulative folders. English Class s Explored U e of Grammar A S , E xx ,, U f --::' ' L' T -H' W ,Q is 'I , T: 1 If assa as a -1 e . A I s ff- . xv ' . as J 'M ff- 'iii Q f H aQ.,1 5. ' M E 1 f .: H 't- 'l A Ivl I i X MILTON HAROLD NANCY GERALD R. DIANNE BAILEY EVELYN BARAL BEULAH BOYD PATRICIA AGTE ALCUMBRAC ATWATER English English English BREINIG Department English English Human Relations English Chairman English AFS PRISCILLA DRUM MARILYN SUE MARIE L. RUTH GARDNER English DYE FRAESDORF English Girls' League Journalism Television Post Production .:-: zif. .:-.s A fvia -.VQ f T u a- i,yL A LA S J - . it x, 3 During class students were given time to ask ques- tions concerning the novel they had been reading. in 'ails K QX in I MARY JANE HUNT English xi 3 L up i .4 Z. DEXTER L. JOHNSON English .fe , Mqwgi R Gi? -f A MAXINE B. KELLY MARIANNE English LIEURANCE English wg, .qi E 7 E3 lf i'i - ' 'E X DIANNE CHRIST English LEONARD HAMER English sill? :Ez V a. JUNE M. LINKHART English W , 'f..k .lf In Mrs. Gardner's iunior English class, students Lance McQueen and Janice Foss discussed the grammatical errors they had made on their assigned essays. l sw ,lst Library facilities were used by students for independent studies. Available to -4' the student body were sets of encyclopedias and other reference sources. N 1 fi 6 it li 6 F2 is X 21 K ,Q 5 N . I . , .,., 2:7 and Literatu re English, serving as our basic method of communication, was a required course for all students. Freshman classes concentrated pri- marily on anthology, forms of literature, and the elements ot poetry. Sophomores continued the study of correct forms, then proceeded to explore the novel, short stories and plays. Through team teaching, iuniors, under the instruction ot A m e r i c a n history teacher, Mrs. Harcourt, and English teacher, Mr. Roy, followed the develop- ment ot our country and discovered how American literature related to it. Awareness and appreciation ot world literature was gained by seniors. Mrs. Warren and Mr. Agte's senior English classes again participated in team teach- ing. Seniors expanded on learning to organize their ideas. Dennis Rust gave an oral presentation to his speech class. He learned technique in public speaking. ig an f M1 Mr. Silverburg's senior English class acted out the his daughters Antigone and lsmene, was shown the play Oedipus Rex by Sophocles. Oedipus, led by way to Thebes by the chorus in the background, BOYD MEYER DON R. MILNER SUZANNE DOROTHY M. PHIL A. ROY Algebra Debate NYSTROM PUTZ English English Speech English English JV Basketball Forensic League Spanish .El ',-' 3 ' :.. 1 fi 2 L mln K i, . ' 'M -ii , A . r 'vi .. ' x V f-.gi . ., . ,-42 E S 3' 5 s srs , -s -sf' , Q M' A . K I L K A . . I ti . .Ai .. E , .2 1 A L W ...V 5- Q A . . . .. CYNTHIA H. A. ROBERTA H. ANN SOELTER ANTHONY SCHIESEL SILVERBURG, JR. SITTERLEY Speech TABONE English English English Forensic League English Spectra Ski Club Scope ANDREW F. KATHLEEN VAN ELINOR WARREN L. A. WHIPP tozisk Home English English English English Sophomore Class ...wmv , :,. ' f E L L ' Vgu ,V J, ,,g, , if 1, in V A A H V g . X - ' 'R' American history teacher Mrs. Sandi Mueller assigned visual aid proiects to her Social Studies Department Offered Knowledge s 53 T, .Y Q J. R. ALVAREZ American History Latin American g r l Q- V il' sf J I kg' . -L 'W' f EDWARD R. REGINALD BARR ARRIAGA World Geography World Geography History World History J' 'T 3 1: K. e t I 1 . A . 32 we k . , 7 ... lbi. A Q-5, ' .5 5 .., I ., L 4 LARRY BOOL R0l.LlN E. COOK W0fld l'l35l0YY World Geography Model U.N. Gglf JV Football A 1+ ' ' , 's .1s..,c.. 'WM . sm .. 'Q Hr st on 5? .yt E, f JIM DICK Department Chairman Oriental gi. . 'li its-f ' I? ur , ff L L. TOWNE C. BISHOP American History 5- K is reef . 499 WALTER GOODWIN World History Civilization World History Yo uth-Senate Program 1,5 , 7? ,s f Y if 41. T- 2.-L - +5 fs If -:1sSF- 15 fi , Q 1 5 xt ,. as 7 9 ? revises tctaxrt Mr. lsmay passed out o test to his world geography class. The course was of- fered to freshmen and sophomores as a social studies credit for graduation. Classes in history and geography were required subiects in the Social Studies Department. To graduate, a total of three credits in this area were required of each student. Freshmen and sophomores chose between world history and world ge- ography. Juniors were instructed in American history, while seniors were guided in understanding the nation's problems. Standard textbooks were supplemented by maps, films and slides. Visual aids gave variety to learning and class par- ticipation was often encouraged through discussions and oral reports. The Social Studies Department sponsored the United States Youth Program. Written tests were administered to interested students who held elective offices. Students with the highest results were interviewed in Phoenix. The most qualified were then sent on an all-expense paid trip to Washington, D.C. Students desiring to further their social studies background were offered Latin American History and Oriental Civilizations. Juniors and seniors were eligible to be delegates to the Model United Nations. They were chosen by faculty members on the basis of their knowledge of and ability to discuss af- fairs of foreign governments. students. Junior Karen Gordon made a scaled model of San Xavier Mission. VERNA E. VAN F. HOWE BILL ISMAY J. N. LIVIERATOS HARCOURT American History World Geography American American History Lettermen's Club Wrestling Problems Varsity Football National Honor Society If K 1 ki 1 I 1- - . . . K s s 55 rf'-M f 'ft . .. R I sit ,r ss-A ' sr ' . 0 World to the Student Bod W0l'Id 9e09fUPhY students -If-Ifkle DQWWYCO and took notes on the broadcast. Mr. Cook adjusted the Roger Lee listened to a European radio station and control knobs of the radio to get better reception. Miss Flavia Botteau visited Miss Nowels' fourth period American Problems class. She spoke about racial relations during a question and answer session. E Oriental Civilization teacher Mr. Dick led students in a discussion concerning the war in Viet Nam. SMITH MINARIK SANDI MUELLER IDA MAE Q. R. M .MG American American History NOWELS Problems American Problems tist -o if V'--. it I sss, .N iiig ap or it or , .i , g in X yy y , I ---- I I i,i. orro DICK PALM CLARENCE J. R. DONNA American History ROSS SANTEE Varsity Football World Geography World Geography MILDRED M. CLYDE D. JOHN TWEEDY SMITH TIDWELL American World Geography American Problems Problems QQ git: A 3? Vfffa.: me ' I fliifff i f World History V , ss , .5 5 'B t W 03' is ,Q ' X112 gm . - I 5235 Q ., S with L' as Q ME 35 e 5 W' -1 . - Q tk ' -e sg? .- ktoo o P 1. I .rt if S -1 ' is rlqz- - ,f -if 1,14 wg, ,1.ae.q .s,t .... H .cw -V JOHN O'DELL American History Varsity Basketball 9 ' 'I M. - sw .i,..w- :iff y-ffl' 1 ' few' - ale -.,.-' ' Sift. il? . 4,2 . ,..s ,i ' ii A PAUL L. SIEVERS American History FRED A. WEISS American Problems +1 , - , ' ' i ' in Mathematics Department dded New Course NICK BALDWIN RICHARD A. LOIS BRUNER JEANNE DAWES WAYNE DIEHL E.D.P. BROWN Algebra Algebra Algebra Geometry Algebra General Math Geometry Calculus Physical Science E.D.P. Geometry General Math Stage Crew Club General Math Titan Service Senior Class League ARTHUR D. WILLARD R. ROBERT HALL GERALD HALUCK G. CLAIRE HAWN DROEGEMEIER EUSTICE Basic Math Algebra Basic MCl9l1 Algebra Algebra General Math Consumer Math Geometry Basic Math Geometry General Math Athletic Trainer General Math FTA Mr. Everett Queen used the overhead proiector to explanation. Proiectors were a device used by the show his math class problems that required further Math Department to add variety in teaching courses. Analytic geometry was offered for the first time by the Math Department to advanced students. There was a wide variety of additional classes ranging from basic math to college algebra and calculus. Data processing was also of- fered for those interested in computer math. Basic, average, high and college level classes gave students an opportunity to study within their own range of abilities. Algebra and plane geometry were re- quired to enter most colleges, although only two credits of mathematics were needed for graduation. Television was used as a visual aid. This method of teaching gave students an opportunity to acquire a better under- standing of the basic principles of mathematics. Team teaching was also utilized in first year algebra in order to use room space more efficiently. Reasoning ability was stressed in the three contests sponsored by the Mathe- matics Department. The Santa Clara Na- tional Math Examination, the Arizona State Math Test and the National Math Test were given to interested and qualified students. Mr. Williard Eustice explained difficult concepts of mathematics to his second year algebra class. in Analytic Geometry for Advanced Students HOWARD M. JOYCE HOWELL BILL KUSH HODGE Consumer Math Algebra Algebra Freshman Class General Math Geometry '--.,, l 3 335A if My Ei t 5 af ii 'X '-r, T l illh l DIANE MODICA EVERETT QUEEN JOHN RASCOB Algebra Algebra Algebra Geometry General Math Exploratory Senior Class TeGCl'IiI19 z. W 1 - ii . , gygy f lg Q A CHARLES THARP MARY GLENN Algebra TRACHTA Algebra E.D.P. General Math Girls' League VIOLET WEEKS Algebra Geometry Math Club ED MAXWELL Department Chairman Geometry A-wiv -5 2 1 'H H . 1 fi JEROME SEILER Algebra Geometry Sophomore student Walter Taylor was assigned a proof concerning the diag- onals of a quadrilateral. Walter explained the proof on the board for his class. JERRY WHARTON Algebra E.D.P. g::1':::zcIub Math teacher Mr. Rascob aided his students with individual help on difficult problems. Algebra classes discussed the various lessons assigned to them. Courses in Biology and ef? V X ' Am.. i .- L :.- 2 ' .1.: . A -V':o ooo ' oo o . 'moo omo.Lh Io' : ' 'io' o oo + A s i ,oo , J ,,-- --A. A:.- , I LEO R. AUSTIN CHARLES M. JOHN C. DURAN GLEN A, GEISERT Earth Science DAVIS Biology Basic Math Physical Science Biology JV Football Physics Judo Club For his biology students during the school year, science teacher Mr. Paul Hatch- er planned several interesting exercises on the use of the microscope. Chemistry teacher Mr. Ken Pearson gave additional instructions to student Dan Fox. One ofthe many experiments Dan worked on was a distillation unit. Biology teacher Mr. Johnson organized many pro- planned was a very detailed frog dissection. Mr. iects for his classes. One of the several experiments Johnson killed the live frogs for his students. i l To help clarify their various lessons, Chemistry teacher Mr. Lowell often lectured to his classes. Physical Science Were Offered to Students Both biological and physical science courses were offered by the Science De- partment. Physical sciences included classes in physics, chemistry, physical science and earth science. Biological courses offered were fully laboratory oriented. One or two labs per week were generally administered. Aprons and goggles were worn by chemistry stu- dents during labs. Advanced students were offered a College Level Chemistry course. Five stu- dents from Rincon High School also at- tended these classes. College credit was given upon successful completion of this course and passing of the advance place- ment examination. Students were urged to select at least one course from the biological area and one from the physical science area in completing the graduation requirement of two years of science. Biology classes spent much time throughout the year conducting experiments. Students Jim Lassiter, Tom JOSEPH HAMRICK PAUL W. WALTER A. RALPH E. WILLIAM KELLIS Biology HATCHER HOLLIDAY JR. JOHNSON Biology Biology Physical Science Biology Chemistry Science Club Intramural Track Director J iff 'gr e 1 -1 ' ,. 4 . 1, ,,,. 1 E - gi, L.. , f V .V i g A gy , Q Vgi, J g as g p . tt t r ' a Hi 'si is A ef' i 'F fl' Rf? J I2 5 if ff f gil -' PI 'eip -gt I gf t-s so w sf , ' 1 M f 5 3 A L I 1 5 k t A A. ,I ..w-Xa., . .A r-W ms ,,:. i Y :,' fLkf ,. .ss sst. . . sr 'C 'i'. rtt P 'i - .-.- Sis' JAMES A. ROBERT K. JACK MIGNERY EUGENE H. KEN PEARSON LOWELL MCCONEGHY Physical Science MONDEAU Department Biology Chemistry Biology Chairman Chemistry Earth Science Chemistry ICBM Weight Lifting Club ARTHUR D. MERRIE SADLER STERLING L. RICHARD R. JIM WING RATCI-IFF Physical Science SMITH SOMMERFIELD Biology Chemistry Earth Science General Math Physical Education Science Club Physical Science Physics Lettermen's Club Freshman Class Chess Club Varsity Baseball If I .. ...,' . ... fr i' . . K-yanija-i.E::. sy? 1 K .. ,A I 3? I 5 'fy , , f V E' 5 i' i :S . .i. Ni i 0 5' 1' .. - M ,' L is ,.. ' 7 fd' . qu . . so C Clark and Bill Johnson worked with chemicals while Cher Fry used a microscope to examine slides. Mr. Kellis assisted biology students with a series of experiments on the evaporation rate of water. Six Foreign Languages Gave Student Bod PHILIP N. ARCHAMBAULT Spanish Deparfmenl' Chairman French JAMIE M. COOK R- LOUIS French HOPKINS Junior Class 5PUnl5l1 Frosh Basketball HERLINDA AVILES C. A. BUNKER Spanish RICHARD L. McNABB French Russian Russian Clu b , s fiiw is f ii M I M ' T ' X W img is JOY A. CHAPMAN French German AFS s. A. oc6N Spanish Fifth year Spanish classes sludiecl novels of the language Io gain experience in all aspects of grammar and speaking. Novels added variety Io the course Second year German sludenls pradiced repealing in a series of repelilion drills. Such drills were de after their Ieacher, Mrs. Chapman, as she led Ihem signed fo help improve lislening comprehension Mr. Shapiro taught Hebrew siudenls differenl sym- g, . . K bols necessary for wriling ihe language. - F- ,K X MARIE owen Lois scHNAnER NORMAN i. DOROTHY STONE DOROTHEA M spanish spanish sHAPmo I-win STUESSY Heb,-ew German . ,sis C u -- ' 1 ': ,,, - , si i in -- is fm s is i in g ,.,. lwfiig, ij w fi W' F ii i' ' ,... je iw Qigi 'j',f?:? :-.. Wide Range of Choice Russian, Hebrew, Latin, French, German and Spanish were the six languages offered to students by the Foreign Language Department. Oral work and continuous practice in pronunciation and grammar constituted much of the process in learning a foreign language. Supplementary devices used in the department in- cluded the use of the language laboratory and tapes of vari- ous exercises. ln addition to the language, students gained information on the culture of the country they studied through basic sentences and dialogues. Special difficulty arose to students of Russian and Hebrew. An entirely new alphabet and combination of sounds had to be mastered before reading and writing could be developed. One of the few schools in District One to offer these two languages, PV students were given a wider range of choices. The student body was also given the opportunity to study Chinese at Tucson High School. A Russian Club was formed this year under the direction of Mr. Richard McNabb. Members went deeper into the cultural aspects of the country. They were given the opportunity to sing the songs and eat the food native to the country. To be accepted by most colleges, students were required to take two years of any foreign language. First year French classes learned to coniugate verbs in several different tenses. Students practiced pronunciation through dialogue and drills in class. wc, DM, I. W 4 Third and fourth year Russian classes were combined because of small enroll- ment. Mr. McNabb stressed oral work to develop students' fluency in speaking. Latin students were each given a chance to recite before the class. Oral work enabled them to gain a better understanding and fluency of the language. c is oys Participated in a Unique PE Program P Weightlifting was one of many courses offered to group participation, exercise programs were stressed all boys in physical education classes. Through which developed students' agility and coordination. EDWARD BARON Physical Education Frosh Track Wrestling ROBERT FORD Driver Education Health Physical Education Swimming staffs L. F. CAMPBELL Driver Education Health Physical Education GLEN HARCUS Department Chairman Physical Education Frosh Gymnastics RICHARD H. COOPER Driver Education Health Physical Education DON HOLLEY Physical Education Frosh Football Frosh Track sf WAYNE G. CORDER Physical Education Cross Country Track D. LEE HUBBARD General Metals Physical Education r '-f'i'f P me . . P tetete -r '- i ili rm, if S sc. ri sry. g ' L . , l V ,... . if t is 3 e r . L V ' - A , G 1 ' ei., 4' . ,fs A .-I- - - ,,,., :gf n V 121- ' ff f- ': ay ROBERT JONES. MEL KARRLE BOB LANS L. R. WEIMER Pl YSlCf'll EQUCUYIOI1 Driver Education Physical Education Physical Education Afhlellf Dll'eCl0f Health Gymnastics Frosh Football Physical Education Tennis Frosh Track Courses in Boys' Physical Education were designed to show progression in learning. Each semester of PE had a unique group of activities, decided upon from such aspects as the student's year in school, his needs and abilities and available facilities. Freshmen usually took courses which were not offered to them in iunior high. Beginning gymnastics, wrestling and archery proved to be challenging sports for most freshmen. Sophomores and iuniors were offered a wide variety of activities including soccer, weight training, field hockey and volleyball. Interested boys who had taken prerequisites progressed to ad- vanced classes. Courses were usually interrupted once or twice a week for boys to run the cross country and the obstacle course. Boys who participated in any PE class were required to run the cross country for a specific time. This included running around the track and school. Boys learned how to play a correct game of basketball in physical education. Rules and techniques of the game were taught to the boys by their teacher. 4 + .K New . - 1 . s 'Q c .kg ,T I ll Class s Offered Chance for Team Sports Physical education classes gave girls a chance to relax from academic sub- iects as well as giving Them the neces- sary exercise for physical fitness. Several sports were offered from which the students chose various ac- tivities in individual, rhythmic and team sports. Teamwork was stressed and taught in such sports as softball, bad- minton and tennis. Advanced and be- ginning classes in modern dance and tennis were popular. Classes in bad- minton, hockey, speedaway and gym- nastics were offered. Advanced gym- nastics was taught and girls wanting extra practice were allowed to use the gym after school hours. '5 'l v c . sfitisrzls- Q' K' we ,sfo s , 1-Q-:,5,:55m Y gi::f 4P' 'ls' . , scgggmf 39 -ss:- taxi,-swiirir-1' -f 313,-2-fzlaiiwlzrfzis srlfffffzlfzgki-'tx ' sxkizie Tennis was one of the most popular sports included in the Girls' PE program. Susan Bernal and Pat Constant practice was necessary for girls to improve their gymnastic skills. Spotters Karen Holth and Linda Wallace looked on as Robin Robinson prepar- ed to begin a routine on the uneven parallel bars. , . it n. , M r k pi ' I -VVV J A A, . .-. f M.. .sc ' P' . effr rrst of ' f . r.ir P S ,. , y ff .. f R if V. . f to X Y .-,- fmt: six' K - f w. W., , -,,.s,.,s9 BEXTA BAKER PATSY L. DOROTHY DAVIS GENEVA SALLY HARDEN Driver Eduwtivh CASWELL Physical Education FLESHMAN Driver Education Health Physical Education Capricians Physical Education Health Physical Education Gymnastics Badminton Physical Education Volleyball Archery Laureen Malas learned various serving and return ESTHER A' P?gkg'liNA' MP?::,i:?gN strokes and skills necessary in playing badminton. HILTON Lewelling executed some of the many receiving and Tennis serving techniques they had leamed during class. Health Physical Education 1 , , , FHA , j iff' . sig -rv A V227 -A 2,,.fQiiw . as , .v .. , as .. sa X., rg- .... nh c f Q -ev 'Ya QL, Mums I . , ,... U f i La- , JOYCE SPRINKLE Physical Education Health H,, -. fm Z 5' 7: 1, KAAY STRANG Driver Education Physical Educqtiqn Physical Education Pep Leadership Golf Club - ., :'.. f -,sv 5 ff KATHRYN E. YOUNG Department Physical Education Chaifmun Pep Leadership Physical Education 1' 2 , f me Qtek! f 2 .K - '.- is vz, 7:3411 Sffcrig 1:22 . , sr-?sfw2.s aiimtf mvxigi-51111: A student in stagecraft worked on a thatched hut in preparation for an aftemoon drama production. N VV AP A Z , i i 3 2 Q ,, .. .Q LITA BRATT WILLIAM T. WILLIAM B. LANE D- -IUSTUS FRANK Art BURGESS JR. IVESON Beginning Cn9l'nl KOWALCEK Ari' Club Drama Beginning Vocal OYSUHIZCHOHS Art Stagecraft Mixed Choir COHCGFI Chi'-til' Nationol Treblettes Jvbileers Thespian Society Art students were taught the method of silk screen printing. After the stencil was cut and adhered to Creativit Demonstrated Thro Beginning art classes gave students an opportunity to explore various fields of art and to develop their skills. The use of live models enabled beginning students to create more realistic drawings. the screen, the squeegee was used to force ink through the screen onto the paper being printed. ugh Fine Arts Music, art, drama and dance were the four divisions of the Fine Arts De- partment. Classes offered in this field allowed students to express their origi- nality, creativity and individual talents. Often different divisions worked closely together in presentations to the public. The Music Department included band, orchestra and choir. One of the high- lights of the department was the pro- duction of Show Stoppers by the Con- cert Choir. Besides performing for the public, students in the department were educated in music theory. A wide variety of classes, ranging from drawing to commercial design, were offered in the area of art. Much of the work done by art students was pre- sented in exhibits held throughout the year, Both beginning and advanced drama classes presented plays throughout the year. Outstanding dramatists were given the opportunity to ioin the Thespian Society. A' I I A7 lat S ate at V :V 'ggsf ' .K V 3 .1 CELESTE NORRIS ROSE MARIE WILLIAM E. Department PETERSON RICHARDSON Chairman Stagecratt Band Aff Drama Music Theory Stage Band iita 514: gg 1 z xy 6, spa Q 5 S qi' f V Qs' f 5 I eww .N 14: .,, 'f'-f .V 31 'Q . - ' gftigzi,-f-. I as 3 ,Q is X I ...., , e, 'I' x If 1' V K ew fi 5 M, ,K in F. 5 I , 1 JAMES D. STEVENSON Orchestra Mr. William Iveson played the piano for the Mixed Choir while they prqgtiged After marching season, the Concert Band, directed by Mr. Richardson, practiced the Messiah for the Christmas Concert. The Concert was held on Dec. 13. for an exchange concert during second semester with Coronado High. Senior Jeff Hillock practiced the fundamentals of proportion and dimension in a morning art class. Drama teacher Mr. Burgess directed Kevin Owens duction of All My Sons. The moming drama class and Paul Mears in preparation for the spring pro- presented the play in the Little Theatre. 9 f Mike Sisk worked on the engine of an Oldsmobile trial arts courses gave students an opportunity to Cutless in an auto mechanics class. Other indus- engage in actual work experience at school. Senior Randy Newell studied picture-taking styles and techniques during a morning photography class. Woodworking was one of many courses offered by the Industrial Arts Depart- ment. Mr. Kanouse assisted Bruce Atchison and Robert Smith on a proiect. Senior Richard Altuna sketched the basic layout of an assigned building in ar- - , 151 we chitectural drawing. A model gas station was provided for reference use. T a p T T so ..'... R R 'f T . ,ail Q s ' ' .' Z , 1,'.: L 53471 '27 :.' .1 5' 'EE , : Ei: R ' V -QIAQ ,Z , A , M :ll :QV A it A H A euueuusue H :- T -':- i'. f ,W ,.., .,,. 1 R A R tske 'tu 'u .,.,a te . T t ,,. e A .. . sutt r -ts.. n 1 e r eeoo T R . ' it . , R f R T :t. T ',nt R if ,-1 t,Rt iizli ' ,R tw'-fl 1 -1,19 ff '- iq, 'i'M'R'S 'KVM Rf' 'J if: R I. 'jing ., W:-wRRW5i V ,.,. 1 5 37, , 3 . iw, VL V L '--. , Q x,,: fkkk E , .L,. Ar .. ggi f,.-::--,. 4 -I ..:- ' of my f-,. Rf - Qv' ..,'f,--: 2 sf' H Y'R' R -V - ff '- bvl' : kk V , VL b y I ., ., L K , . +41 Q 1:. ' 'i , sunome use wlu.lAM R. neu. JAMES A. GAYLORD E. LEoNAno JIM Locker E. moo I-YNN KANOUSE Graphic Arts Gene'-gl Mem., msnopp susn cHEDseY nAuNHElMEk Electronics Wwlwvfkins Olympian Sheet Melqls General Metals Drafting Graphic Arts Graphic Arts JV Baseball Advisor Machine Shop Rifle Club Photography Driver Training VUYSHY P09759-'ll Photo Pep Club Publications Driver Training Titan Lite-writers Welding was one of four nine-week sections offered in the general metals course. These classes gave students a basic knowledge of the fields concerned with industrial arts. Other classes included machine shop, sheet metals and electricity-electronics. General metals was a prerequisite to advanced classes Industrial Arts Offered Extensive Program Industrial arts classes gave students an opportunity to de- velop manipulative skills for future vocational use. Through this training, knowledge of industrial processes was gained. General metals was a prerequisite for many of the courses. lt served as an exploratory class that gave students an idea of various fields concerned with industrial arts. One year of gen- eral metals consisted of four nine-week sessions including ma- chine shop, welding, sheet metals and electricity-electronics. Printing, photography, graphic arts, woodworking, auto- mechanics and drafting were other industrial art courses of- fered. Drafting classes consisted of mechanical, machine, archi- tectural and pre-engineering drawing. Pre-engineering drawing was offered to seniors. This class was accepted as a college credit at the UA. Most subiects offered beginning and advanced courses and were open to both boys and girls. Students who wished to further their training enrolled in career classes at Tucson High School. I 3 I ili , . T' plillll I ' f Q r r s . 'N if to Q- , ' ! ', Q K, Q f ' , r.. K ,,,,.' y , RONALD I. RAY A. RICHARD L. L. W. SPAHR MABEN MCKNIGHT SOUTHARD Mechqnigql Auto Mechanics Welding Department Drawing General Meluls Chairman W00dW0fkI'19 Mark Varvir used the printing press to produce programs for a drama produc Rifle Club Auto Mechanics tion. Tickets and programs for school activities were printed in graphic arts. .pg Students Sue Noble, Janice Rinkle and Chris Mc- Donald did their daily assignment on the full key ES S 'Es- WILLIAM H. ANTRIM Marketing Merchandising Cooperative- Merchandising DECA GEORGE H. HOLLIS Business Automation General Business Personal Typing , Q 3? . K r I :- QT Tigris S 2 3 .1 1' x iii L I R A' SUSAN SHOEMAKER General Business Shorthand Typing 4- 1-sr, I XIX-I s...f We H.- calculator in business automation class. They were taught the use of all business machines in class. at ' 'K ,W '35 . , ii fx fl is-. NN, 1 gg J. THOMAS BARBARA ULA MAE BRADY DAVENPORT DAVENPORT Typing Secretarial Business I-CIW Notehond Practice General Business General Business EXpI0rGl0l'y BUSI- Bookkeeping ness Training Typing MARION J. WILLIAM A. MADGELENE HUDSON MCBRIDE MORRISS Marketing Typing Notehand DECA General Business Shorthand Typing . ., f If: :..-- ff L if ee :',- f-1 . 'Ns 5 yt. , , V . . sg-,if 5 V ' 15 , 1 - if ':, Z ' I I I ' L T Q ,- , iw: I x l. -: .. .,, it fi I ' A CALVIN WALDEN WANDA L. VIRGINIA D. Bookkeeping WALKER WILSON Personal Typing Cooperative Shorthand Office Typing Education Typing 44 JOHN GLOVER Clerical Practice Business Automation Business Law Typing Business Machines ROBIN F. NELSON General Business Shorthand Typing f we .. s f'ii' inns Ti 2 AJ' iw , , r '1 L .. 3' i K-ff -. fl . ALFRED ZAMMIT Department Chairman Office Machines School Work Experience Shorthand Department of A wide variety of courses were of- fered in the field of business education. An opportunity to learn new skills and to gain experience was given to anyone interested in business. ln the area of secretarial work, stu- dents had a choice of classes including typing, shorthand, notehand and book- keeping. First year typing classes stressed speed and accuracy, while second year typing developed technique further. In bookkeeping, students learned how to fill out income tax forms, balance books and keep office records. Cooperative education students were able to obtain regular iobs through the Business Education Department. Typing, shorthand and secretarial practice were prerequisites, and students were chosen on the basis of clerical tests and inter- views. ln office machines, operation of the electric typewriter, the voice transcriber, adding, calculating, mimeographing, and ditto machines were taught. Mr. Glover demonstrated the correct usage of the typewriter and ways to improve speed and accuracy. I M mw...sM..e,.,f Business Offered Wide Variety of Courses Senior Gail Gilbert operated a ten-key adding machine in an office machines class. Students used various machines to complete daily class assignments. Through DECA, John Hanson worked at Kinney's .M ,,. -SP4 - 'nf Q-ab l Anne Colville obtained the job as secretary for Coon and Chonis Architects y through office education, a program that found employment for students. Shoes during the year to gain valuable training. Betsy Upham and Harry Lodge operated a cash return customers' change quickly and efficiently was register in their merchandising class. The ability to one skill business students worked to achieve. Mr. Stiles helped Maggie Williams use a phycho-physical testing machine. She had her side vision tested by one of many devices used in the department. .lunior Karen Kelch used a dual-controlled car in Drivers' training. This was an extra-curricular course offered to give experience in actual car driving. Safety Rule earned in Driver Education Driver's education classes were taken by sophomore students. It consisted of a nine-week course taken during the phys- ical education hour. The main obiective of this class was to inform the students of safety rules while driving and what can happen if these rules are not followed. State and local law enforcement of- ficers spoke to the classes. Slides and films were also shown. The Arizona drivers manual was given to the stu- dents, and a week was spent on study- ing the pamphlet. Textbooks were used, and the stu- dents were taught about automobile in- surance, the parts of a car and how it works, and pedestrian safety. 'Stadt i , li igffff, - 2 5455, - ri-ff gf wr '15'E !ti'ls-' .ti H 1':.- N' -11 .,-:sz :- if-:..: ' if 1. 3? L C. V. STILES Department Sophomore Margie Flanzbaum used a drivo-trainer driving. Movies shown to students in the machines Chairmen machine which helped to prepare her for actual car enabled them to acquire better driving techniques. DflVel' EClUC0li0l1 Domestic Courses Taught in Home Economi ir gi rt i .B eip FW' Qi rr ' -.3 V 3 .rs L11 V 'K W5 ROSELA E. MARY PLATT MYRTLE E. CHARLCY BARBARA ARVIZU Homemaking SHREWSBURY STANDIFER WHITAKER Homemaking Homemaking Home Living Homemaking Department FHA Chairman Cooking, sewing and homeliving were offered to students interested in furthering their ability in Cooking was one of the many skills that freshman Donnel Sperduti learned in home economics class. housekeeping. In sewing class, girls learned tech- niques in making and designing their own clothes. Mis. Homeliving, a coeducational course, was one of many offered in the Home Economics Department. This class taught students to handle finances and other phases of home management. The rest of the year was spent learning to cook. Guests spoke to students in relation to various problems concerned with prep- aration for the responsibilities of mar- riage. Homeliving was offered to seniors only. Freshmen learned the basics of sewing and cooking during a year of beginning home economics. Many girls continued on with advanced classes. Secondary courses furthered experience and tech- niques necessary for family living. Senior homemaking, offered to iuniors and seniors only, included an extensive study of marriage, raising children and family relations. Girls enrolled in tailoring were re- quired to make professional looking suits. A good fit was important and was accomplished by cutting and fitting a suit of muslin before the pattern was cut in wool. Homeliving was offered to both boys and girls. gins, Harry Lodge, Jerry Stump and Dave Droege- Cggking was one of the main features, Danny Hug- meier worked together in preparing Baked Alaska. 37 Library Offered Use of Books, Tapes, Film like K Seniors Janis Henry and Clark Canright used the catalogue supplied students with information such card catalogue for reference in the library. The as author, title, subiect and location of a book. A student waited at the magazine window while a helper looked for the Octo- ber Reader's Digest. Various magazines were available for study or pleasure. Student librarians for the '67-'68 school year were selected in three dif- ferent ways. Some librarians were vol- unteers, some were honor service stu- dents, and several were hired through the Youth Corps. Librarians were in charge of approxi- mately 16,000 books, over 500 records, 400 filmstrips and several newspapers. The library carried educational filmstrips and a 520 slide collection dealing with the history of art. Three newspapers were received daily, along with several college papers. Each of the different reference items added greatly to the efficiency of the library. Readers Guides were also avail- able to the student body for use in lo- cating magazines. Magazines, periodicals, and encyclopedias were available to students for re- search work. The Iibrary offered a place for studying before and after school. . rsriil ,,,,- if A s t , A sr ' r . . - i'V L .., ' ' .--1 JESSE A. LUNDY WILLIAM M. Dol-ORES POWDRlLl- Librarian MITCHELL l-il9l'Ul'lUI1 Librarian Mrs. Huisinga, secretary in charge of attendance, helped with phone calls during her working day. an-. Mrs. Anna Nord, the school nurse, talked to Marsha iw' l'9C0fd5- This, Glens with Ulhef lmP9 Wnl duties Reed concerning information needed for school med- combined to form MVS- N0fd'5 bl-'SY Schedule- Both S ssions Aided by Nurses, Secretaries Secretary Mrs. Kyle readied the Public Address System daily. During home- room periods, speech students read the announcements to all classes. fe! Nurses Mrs. Nord and Mrs. Zempel cared for the wide as- sortment of iniuries and illnesses students complained of dur- ing the year. Mrs. Nord was in charge of the morning session while Mrs. Zempel was responsible for the afternoon hours. Health records of the student body were kept up to date on in- dividuals ancl filed for future reference. Girls assisted the nurses in tasks which kept the office staff busy. Attendance secretaries were responsible for the absentee procedure which involved issuing admits if students had the required excuses. Through the registrar's office, senior tran- scripts were sent to the college or university of the student's choice. During the summer the secretaries mailed the schedule cards for the following year to the student body. Following an absence, students were required to bring a written excuse to the office, where they obtained an admit to be signed by each of their teachers. Custodians, Maintenance Men Kept School in Bookstore attendant Mr, Brown pulled a book from the shelf which he was going to sell to a student. Mr. Roy Cole assisted iunior Steve Gunning in buy- and supplies, the Bookstore handled money col- ing supplies at the bookstore. Besides selling books lected from various school activities and proiects. Before participating in after-school activities, a student stopped to buy a sand- wich at the outdoor snack bar which was open from 11:00 a.m. to 1:30 p.m. Night watchman Mr. Banning took care to see that the school was in proper order after school. This included relighting a pilot light in the kitchen. ' ' Mr. Olvera trimmed the hedges in the patio outside and in order was one of the many chores main- OO 0 n N I O n the cafeteria. Keeping the school's lawn areas clean tenance men were responsible for during the year Custodians and Maintenance men kept the school in good condition, while the Bookstore and Cafeteria served the student body. Textbooks were bought and sold in the Bookstore. School supplies and tickets to football, basketball games and other athletic events could be bought by the students along with club pins. Tickets were also sold for drama presentations and concerts. The Bookstore was open from 6:30 a.m. to 5:00 p.m. ln the Cafeteria hot and cold food was prepared by the kitchen staff. Among the variety of snacks sold were hamburgers, milk shakes, do- nuts and fruit. The six daily breaks kept the staff busy. Between each break the tables were cleaned and the floor was swept. Custodians worked during and after school. They kept the classrooms, halls and cafeteria in an orderly and sani- tary condition. The custodians also cleaned the campus grounds and gym after sports activities and dances. Most of the repair work was done by the maintenance men. They kept the school in good mechanical condi- tion. The night watchman began at 6:30 p.m. His iob included checking doors and windows and examining heating and cooling equipment. He reported damage or broken property T Th h I Morning and afternoon students took ad- minute breaks. Cafeteria help served students sand O e SC oo ' vantage of the cafeteria services during their 'I2 wiches, beverages, candy and ice cream daily. At the close of each school day, custodians cleaned the cafeteria for first were mopped. The custodians also set the stage for assemblies, tidied hall- break the following morning. Choirs were placed on tables before the floors ways after passing periods and took charge of classroom television sets. awww ff 1555535 Student Government and Honors The only orthodox obiect of the institution of government is to secure the greatest degree of happiness possible to the general mass of those associated under it. V -Thomas Jefferson .,..,. Honor Society Officers Selected in Sprin NATIONAL HONOR SOCIETY OFFICERS--Patty Bryers, vice-president, Jeff Lovin, president, Pam Ken- ady, secretary, Ellen Hale, treasurer. Mr. J. N. Livieratos, National Honor Society advisor, and Jeff Lovin, NHS pres- ident, discussed some of the activities and services planned by the club. Eighty-six students were initiated into the National Honor Society. Stu- dents were chosen by a faculty coun- cil on the basis of scholarship, leader- ship, character and service. A 1.8 grade average was necessary to be eligible. Honor Society was open to anyone meeting the qualifications. The goal of the Honor Society was service to schools, pupils and com- munity. Special proiects included plan- ning a traffic pattern for the student parking lot, ushering at Tucson Sym- phony concerts and meeting college representatives. Honor Society mem- bers served as guides for open house. Besides discussing business, the Honor Society had several guest speakers. Parties and open-houses were also planned throughout the year. Honor Society members paid house- calls on new seniors to answer any questions they might have had con- cerning school. They also tutored stu- dents having difficulty in any subiect. National Honor Society officers were elected in the Spring of last year. Mr. Livieratos was the advisor. Tutoring was one of the services offered by the National Honor Society. Patty Bryers and Suzy Lamm planned a lesson for the student they were to tutor. 1. ff -sm. A l' we We ,Q 'Sr 'Q 53? 1 Q 2 2 ew 5 ,S 1 L Tom Duddleslon Fred Emerling Richard Gilman Roger Givens Ellen Hale Leonard Hamer Gail Hanson Sleve Hazen Liz Heimpel Susan Hogan Sandy Hopkinson Mary Mike Johnson Mike Kaplan Nancy Kearns Pam Kenady WVY'-:rn-N L Qritiv- 39. f, 'Q 'l-Q HL, .,.. , Jeff Alford Janel Arveson Rollah Aslon Karen Babinski .lerry Bangerl Daryl Bever Bonnie Blecha Mary Bockman Scoll Bramblell Donna Brown Jeanne Brownlee Judy Bryan Pally Bryers Sleve Burns Donna Buller Carol Lee Cacioppo Kelsey Caples Kay Cliff Elena Davis Tom Dielzman new 3 47 I 32 , ,V Q ww, A me E e T35 li E E' fmwb 'Una ru. f 'Q HE? ,K wi an e F ,,, L .L A Linda Mohr Pam Morris Bill Mueller Kay Musser Scott Niel Vicki O'Dell Don Oppenheim Doug Porter Misty Premovich Connie Price Mike Price Fritz Rademacher V ,' ,- Joe Reichel Dianne Roberts Patty Ryan Sallie Saltzman Sherry Smith Frank Stagg Sandee Stark Debbie Stolba Pat Kenady Gloria Kenski Linda King Karyn Kingston Kathy Krietemeyer Gail Lamb Susi Lamm Jeff Lovin Craig Ludtke Kurt Lundstrom Betty Martin Frank Martiniak Jim McCullough Bill McTarnahan Mary Misenhimer ?Fvu,,,, Honor Society Members Chosen b Faculty Dr Whitaker, scientist for the National Aeronautical and Space Administration, spoke to Honor Society on January 8 about space exploration and the moon. Diane Summers Christie Tarbill Pam Teeple Lynne Thomas Peter Trinca Dan Turner Betsy Upham Babs Vetterlein Joanne Vining Shirley Wahl Richard Walker .lan Wheaton Audrey Wilkinson Melinda Woitasiak Kathy Zimmerman Dr. Whitaker's lecture was accompanied by a series of moon slides. He ex- plained each one briefly to show the society the importance of such work. 5 Wfifvf ,fgfs-.L 9 x ,QE if X Wx ig 5 xv as 2 Y 5 9 , , ,gg K 2, if X 5, K f ,1?!'lU- , R ' org, f M V l we W 3 M 'hawk , Z www, Top 25 Seniors Selected After 7 Semesters As a member of the varsity golf team, FRITZ RADEMACHER spent a great deal of time on the golf course. He was a parti- cipant on the ICBM Soccer Team and a varsity lefterman. Fritz was awarded the UA Alumni Association Outstanding Junior Boy Award and was given a Key to the World pin. He was an alternate candidate to the United States Air Force Academy and a member of National Honor Society. His interests out- side of school included bowling, tennis, basketball and chess. Fritz plans to study Systems Engineering and applied mathe- matics. JOYCE DRAKE was a member of the Exploratory Teachers Program. She taught at an elementary school for actual teach- ing experience. Joyce plans on teaching advanced math on either a high school or iunior college level. She intends to maior in math and secondary education. Joyce is planning on attending the University of Arizona for two years and then transferring to the University of California at Berkley. She was a member of Homeroom Federation and she enioys sewing in her spare time. LINDA MOHR plans to enter medical school and wants to specialize in gynecology and obstetrics or pediatrics. Her lib- eral arts maior will be in physics or chemistry. Linda had a grade average of i.O for seven semesters and as a sophomore she received the NEDT certificate and a Latin certificate and medal. She was a member of National Honor Society and was also a news editor for the Post Newspaper. Linda was en- rolled in a College Algebra and an Honors English class. Out- side activities in which Linda participated were sewing, swim- ming and reading. Varsity football kept JEFF LOVIN busy during the beginning of the year. Other sports he participated in were varsity base- ball and intramural basketball. He was a member of the ICBM Soccer Team, secretary of Letterman's Club, and held the office of president of National Honor Society. Jeff was a dele- gate to Boys' State and he received the Harvard Book Award for Most Outstanding Boy. Jeff enioys bowling as a sport out- side of school. He plans to go into applied mathematics in engineering and also into systems engineering. Literature and creative writing inter- ested GLORIA KENSKI. She was a mem- ber of NHS and of Future Teachers. She took an active part in speech tourna- ments and worked as a student library assistant. Gloria received a general resi- dence scholarship to the UA. ln her iu- nior year, Gloria was a nominee to take the National Council of Teachers of En- glish test. She plans to maior in English at the UA and become a teacher in sec- KATHY ZIMMERMAN was enrolled in college level English during her senior year. She was a member of Honor So- ciety and she received a Key to the World pin. Kathy was a National Finalist for the N a tio n al Council of Teachers of English Competition. She plans to maior in English at either Temple Buell College or Southern Metho- dist University. Kathy's outside interests included playing the piano and the gui- tar. She also worked part time. National H o n o r Society member JEANNE BROWNLEE was Student of the Month in her iunior year. She received several literary prizes, the Sertoma award and the Key to the World pin for scholastic achievement. Jeanne was a member of the Girls' League and Broth- erhood Councils. She also participated in forensic tournaments. Jeanne plans to go to college and maior in English. As vice-president of National Honor Society, PATTY BRYERS ondary education. Q fe sr an r ee , DON PORTER moved to Tucson from Flagstaff in his iunior year. While in Flagstaff, Don achieved a 1.0 grade average for three semesters. He was enrolled in a general business program of study in high school. ln his iunior year, Don was initiated into Honor Society. He was an active member of the Folk Club and spent many hours practicing the guitar. Don plans to go to college and maior in business and public ad- ministration. Outside of school, Don enjoys participating in many sports, especially basketball. was kept busy organizing the tutoring services of the club. She was an active member of the class advisory board for four years. ln her iunior and senior years Patty was a varsity song- leader. She received a Key to the World pin and was a mem- ber of the Honor Guard for the Class of 1967, Patty plans to maior in marine biology at the UA. She particularly enioyed discussions on relevant topics, and continually hoped her teachers would allow students to participate in the learning process. -4 V m - f B 1 5 - 4 Q it ti 2 .. .. KIRSTIE WILDE was a member of The pep squad for two years. In her iunior year she was a songleader and in her se- nior year she was a cheerleader. Kirstie took an active part in Senior Class advisory board meetings. She received The Out- standing Junior Student Girl Award from The UA and The OUT- standing Junior Student Award from ASU. She received a NMSQT commendation and plans to attend either Stanford or Antioch. Kirstie's outside interest include tutoring math, sewing and playing the guitar and piano. KAY MUSSER was active in Student Council and held the office of Senior Class councilman. She was a varsity cheer- leader and Faculty Forward, Student Government and Honors editor for the Olympian Staff. Kay received a Key to the World pin and the Marshall Foundations Scholarship to the Univer- sity of Arizona. She was a member of the Honor Guard for the graduation Class of 1967 and she participated in Honor Society. Kay plans to maior in Business and Public Adminis- tration. She enioys swimming and hiking in her spare time. Scholastic Abilit Earned Honors for Seniors Hiking and backpacking in local mountains and in the Si- erra Nevada was a favorite activity of CONNIE PRICE. She also enjoys writing poetry in her spare time. Connie attended Anytown and was a member of the lnter-High School Brother- hood Council. She was president of the Human Relations Club and was a member of the National Honor Society. Spanish and mathematics were her favorite subiects and she received awards in national contests in both. She was Organizations Editor for the Olympian and hopes to attend the University of California. T ,SN-t A Ywsa rc. N s rf H-is -tl? DARYL BEVER took an active part in Russian Club, partici- pated as a member of the varsity wrestling team, and was a member of National Honor Society. He received a Key to the World pin and honorable mention for the Santa Clara Math Contest. Daryl received a general residence scholarship for the University of Arizona and the Reasseluer Math and Science Award. He plans to major in mathematics and go into re- search in the field. Daryl held the office of president for his Methodist Youth Fellowship group outside of school. Jubileers and Concert Choir were two classes in which ROL- LAH ASTON participated. He held the position of treasurer for the choir and was enrolled in orchestra and Stage Band. Rollah was a member of the Arizona All-State Chorus for four years and was honored for receiving the highest score in the state during his senior year. He was Optimist Club Student of the Month in his iunior year. Rollah plans to attend the UA and maior in either business or music. In his spare time Rollah en- ce K f ioys playing basketball and baseball, as well as the piano. As a member of National Honor So- ciety and Chess Club, BILL MUELLER was on many committees. He received the Key to the World pin five times. Bill placed third in the state in the National Spanish Contest and received an Award ELENA DAVIS worked as a lab assistant during her senior year. She enioyed working with balances and making solu- tions. Elena participated in Judo Club, DECA and Junior Achievement. She was a member of National Honor Society and she received a general residence scholarship to the Uni- versity of Arizona. Elena was enrolled in senior homemaking and she felt it was good experience to learn creativity in life- like situations. She plans to go into college and maior in pharmacy. Elena's outside interests include drawing, bowling, reading and sewing. of Merit in the National Math Contest. Math and science were Bill's strongest subiects. Bill plans to attend college 1' and major in chemical or nuclear engi- neering. He was a member of the Honor Guard for the Class of '67, 5 . Athlete JEFF ALFORD was a fullback on the undefeated ICBM Soccer Team. He also participated in other sports in- cluding golf, baseball, basketball and football. As an active member of National Honor Society, Jeff often tu- tored fellow students. Planning to at- tend either Stanford or Willamette Uni- versities, Jeff plans to maior in a liberal arts course. 51 s is - , 1 Q, . . . U, 1. 1 Q ' .xg . J . ' Q' V - . ,fl E31 B I X lla 1 L .- 'ic ss . 3 ' ' . f- . u . 2 . 1 ae., F .L i . A A '. W C I P , S ,., - 5. ' . Y 1 4 .2- 1 gg-. W' ,W , .. f- gym-N ,4 I '.?f?' ' . ly- fr I , Vg:-w..z- qiwsj w . , 1- - . fr A ' .spar . ' L . uf . . I W - , ,Wir L F A t S A .wi-L... . f . L .MV.f:32'wmf4 55,4 Q.M..!n,..7. .ish I I 3 -13-gafifgcf -I-55...-sf -Y' 4 I '- .. I . V., f f - -.1 Ms' ,, -i,'n-.-W .1 . Try kj if :fc 7,15 ., K f -W I' .sf . V .. 1 r gym - .f.-,figs 4 -' ,' 7 s - f -- KELSEY CAPLES enioyed Spanish and mathematics most during high school. She was an active member in National Honor Society and was an Honor Guard for the Class of 1967. Kelsey plans to teach and attend La Universidad de las Americas ln Mexico City. She wants to maior in Spanish. Kelsey enioys taking pictures as a hobby. JERRY BANGERT was a member of the freshman basketball team and partici- pated in intramural basketball. He took an active part in Honor Society and Pep Club. Jerry received a Merit of Scholar- ship to ASU and was third alternate to the Naval Academy. He plans to maior in psychology at the UA. Jerry enioys swimming during the summer. Athletic PAT KENADY represented Palo verde for two years on the girl's gymnastics team, receiving her letter in her iunior year. As a member of Na- tional Honor Society, she received a Key to the World pin for scholastic perfec- tion. Pat enioys sewing, singing light opera and participating in outdoor sports. Her plans for the future include attending the University of Arizona. As a member of the varsity gymnas- tics team, KURT LUNDSTROM spent a great deal of time working on physical fitness. He was a member of the class advisory board and vice-president ofthe Russian Club. Kurt participated in the speech program during his senior year. He was awarded first place in the Math Division of the Southern Arizona Region- al Science Fair. Kurt spends much time as an eagle scout and he enioys playing the guitar and drums. Kurt plans to at- tend college and major in physics. DAN TURNER was a member of The varsiTy Tennis Team and Took an acTive parT in ConcerT Choir. He was a parTicipanT in LeTTerman's Club and ICBM Club. Dan was iniTiaTed inTo The Honor SocieTy in his iunior year. He received a scholarship To The UA and plans To enTer The field of public adminisTraTion. Hoping To become a nurse, JOAN MACH would like To ioin The Marines aTTer graduaTion from college. A horseback rider and member of The Tennis Team, she was acTive in The Na- Tional Honor SocieTy. Joan received an Award of MeriT in The NaTional MaThemaTics ConTesT and won Third place in The Senior Division of The ShorT STory LiTerary ConTesT. Dan's ouTside inTeresTs are bowling and music. Holding a Key To The World pin, PATTY RYAN plans To major in daTa processing aT The UniversiTy of Arizona. She enioys all sporTs, especially skiing and horseback riding. She was a mem- ber of The Ski Club and NaTional Honor SocieTy. Before moving To Tucson, PaTTy received The Eulson High School Ac- TiviTies Award. A member of NaTional Honor Sociefy and The Chess Club, JIM MCCULLOUGH was enrolled in college level chemisTry. He received an Award of MeriT Tor The 1967 MaThemaTics ConTesT and was a parT of The Honor Guard for The Class of 1967. Jim plans To major in sysTems engineering aT The UA. He enjoys many acTiviTies including bowling and fishing. Fico Rodriguez, exchange student from Columbia, Chuck. The rest of Fico's family, Dr. Schwartz- was interviewed with Mrs. John Schwartzmann and mann and Jim, are not pictured. AFS Welcomed Fico Fico helped AFS by selling bonds to Freshmen Julie Spotswood and Evelyn Stuffing. Bonds were sold to raise money for next year's exchange student. Rodriguez to Tucson American Field Service exchange stu- dent, Rafael lsidro Rodriquez, lived with Dr. John R. Schwartzmann cmd family during his stay in Tucson. The Schwartz- mann's sons include Charles, la senior, and Jim, a i966 graduate. Rafael, who preferred being called Fico, came from Cali, Columbia, He has two older sisters and an older brother. Fico's father is a Columbian senator and his mother manages the town newspaper. Fico said that he did not speak En- glish very well, but that he had im- proved when his family hosted an American AFS student last summer. Literature, journalism, philosophy, physics and mathematics all interested Fico. He also spoke French and German. His favorite sports were swimming and water polo. Fico hopes to pursue a ca- reer in nuclear physics, and is especially interested in studying in the United States. After a short orientation in Miami, Fico flew to Phoenix to meet the Schwartz- manns. 5 ,. ,i. t. ig eff r ' . A SP'E'.r ' Foreign exchange student Fico Rodriguez danced to the sound of The Heard at a dance in January. Fico added Columbian touches to American rock 'n roll. Student Officers Learned Through Experience Student Body President Steve Burns contributed many hours of outstanding ability and effort to the betterment of student government. As president, Steve was an ex-officio member of the Senior Advisory Board. He served as vice-chairman of the Student Progress Organization of Tucson and attended that organizations workshop. Steve attended Boys' State and the Arizona Association of Student Council workshop. As a mem- ber of Student Council, Steve worked on the Milk Fund, Canned Food, and Cystic Fibrosis Drives. He was chairman of Public Relations for the Student Council, a member of Honor Society and a candidate for Homecoming King. During his sophomore year he was Spirit candidate for his class. As Student Body Vice-President, Richard Gilman served as President of Homeroom Federation. He was Associate Editor of the Palo Verde Post, sports correspondent for the Arizona Daily Star and a member of National Honor Society. Richard was active in the Student Progress Organization of Tucson and was an ex-officio member of the Senior Class Advisory Board. ln addition, he was also chosen to be a delegate to Boys' State, Chairman of the Honor Society Homecoming float com- mittee and a member of the Senior Forum Board, which ob- tained guest speakers from throughout Arizona. Richard or- ganized the Muscular Distrophy Drive and the Milk Fund Drive. He was chosen as the first Student of the Month. Pam Morris took part in Student Government as Correspond- ing Secretary. Pam attended the Student Progress Organiza- tion of Tucson workshop and the annual Student Council Con- vention held in Phoenix. Pam was a member of Honor Society and Vice-President of Girls' League. As a member of Student Council, Pam was chairman of elections. She attended Girls' State, was a member of Tri-Hi-Y and was a delegate to Model Legislature for that organization. Pam was also editor of Stu- dent Life for the Olympian and a Homecoming attendant. X s Karen Shields participated in several activities. As a mem- ber of the Student Council, she held the office of Recording Secretary. Karen attended the Student Progress Organization of Tucson meetings and workshop held November 4 in Tucson along with her fellow officers. She was an active member of Tri-Hi-Y, a varsity cheerleader for two years and was chairman of Spirit Week for the Student Council. Karen was elected Homecoming Queen for the '67-'68 school year. During the summer, Karen worked as a lifeguard at the Pioneer Hotel. W O Student Coun ll Organi ed Spirit Projects, STUDENT COUNCIL-FRONT ROW: Cathy Cox, Freddy Brahms, David Brahms, Emmy Creigh, Pam Morris, Betty lazares, Kay Musser. SECOND ROW: Mike Larry Epstein shined Mr. Kemmeries' shoes as Errol Berk brushed lint off his sweater during the week of special courtesy extended to the administration. Emerling, Mike Polivchak, Jon Findley, Larry Epstein, Pico Rodriquez, Karen Shields, Mark Canright, Steve Burns. Not pictured: Errol Berk, Richard Gilman. Steve Burns, Student Body President, opened a rally by leading students in the flag salute. The pledge was said at assemblies throughout the year. Titan Week Activities Student Council planned several proiects during the '67-'68 school year. The proiects were of interest both to school and community. The council consisted of the student body officers, class presidents and class councilmen. Freshmen orientation held in August, the Milk Fund Drive, Club Week held in September, all pep assemblies and Spring Sports Week held in February were sponsored by Student Council. During Faculty Appreciation Week held in February, the faculty was treated to free shoeshines, apples and car washes. Plans were made to revise the student handbook, es- tablish an official school ring and paint the goal posts. An outside campus clock was planned for the school. Members were invited to a Student Council Convention in Phoenix held December i and 2. For the first time Spirit Week was combined with Titan Week. Titanics games were planned which included chariot races, tug-o-wars and Spirit Ball competition. The chariots were entered by individuals and clubs. The classes also com- peted for points through a penny count and hall decorations. Spirit Week was held January i5-19. The sending of constitutional guidelines to Sahuaro High School was one of the community proiects planned. A year- book and newspapers were sent to the school Palo Verde sponsored in Botswana. Student Council accomplished all of their planned activities. The organization was one of the most active Student Councils in the history of the school. Council met Monday of every week. Adviser was Mr. Kemmeries, assistant principal in charge of student activities. yu I' Members of the Student Council painted the PV goal post gold and blue. Painting the post on the field was one of the many council accomplishments. Student Council members met each week to discuss The council consisted of the presidents and council- future proiects such as Spirit Week and elections. men from each class and student body officers. ,WV .ue-A une 5. H+ ..........-Q, .Mb N Sophomore President .Ion Findley received a pur chose order from the Bookstore for his prolect. E Ken Maxey, Mike Reeser and Jim Buck weighed Drive held December 4 through 15. Four thousand canned food contributed during the Canned Food fifty pounds were collected by Homerooms. Student Federation's main purpose was to link the students with student government and administration. Each homeroom elected a representative and an alternate to present their ideas and views at Federation meetings. For the first time, Student Federation sponsored the Muscular Dystrophy Drive in October. The canned food drive was held De- cember 4-i5. Cans collected during the two weeks were donated to needy Tuc- son families for Christmas. Volun- teers worked at the Christmas Center on December 20. In January, Federation sponsored the kiosk built in the patio. lt was designed for posting club news and the school newspaper. Rodeo Week, held in February, was one of Student Federation's main proi- ects during the year. Among the week's activities were the Rodeo Dance and ci float entered in the Tucson Rodeo Pa- rade. The Rodeo King and Queen were crowned at the dance. At the end of each month Federa- tion selected a Student of the Month, chosen on the basis of leadership and school spirit. Federation Linked Students With Government Under the direction of Student Body Vice-President Richard Gilman, members for the Fiesta de los Vaqueros parade. The float was pulled by members of Homeroom Federation spent long hours after school in making the float of the ICBM and consisted of the Rodeo King, Queen and attendants. ,gs-If Senior Mike David used the welding machine while working on the kiosk. The proiect, sponsored by the Homeroom Federation, was built to post news. President Richard Gilman spoke to Homeroom Federation about Rodeo Week, a Federation proiect. This activity was held during the week of Feb. 26-28. Federation members Dee Dee and Mindi Ligner col- lected donations for the Muscular Dystrophy Drive. ' Mr. William Kemmeries studied the student activities president pro tempore, and Barbara Button, secre- calendar with Tom Quayle, Homeroom Federation tary. Mr. Kemmeries was advisor for federation 1 9 State Anytown Delegates Attended Workshops Bob Fabel, Ellen Hale, Linda Billings and Richard problems were discussed by the students. The work- Fabel were delegates to Anytown. International shop was held on the Prescott campus .lune 11-17. Girls' State was held at the University of Arizona while Boys' State was held at Northern Arizona University. Repre- sentatives were chosen by members of the faculty on the basis of leadership, character and grades. The purpose of State was to turther students' under- standing of American democracy and citizenship responsibilities. Participants were assigned to a po- litical party and were given a county and city to represent. During meetings, local and state officials were elected. Delegates to Girls' State were Pam Morris, Kay Musser, Vicki O'Dell and Kirstie Wilde. Boys' State delegates were Steve Burns, Richard Gilman, Harry Lodge and Jeff Lovin. Anytown was a human relations workshop involving students from all Arizona high schools. lt was held in Prescott. The four students representing Palo Verde were Linda Billings, Richard Fabel, Robert Fabel and Ellen Hale. They were selected on the basis of an essay written on why they wanted to attend Anytown. International Problems were discussed during the week. r Z l Boys' State delegates, selected by the faculty, were Steve Burns, Richard Gil- Girls' State delegates Pam Morris, Kay Musser, Kirstie Wilde, and Vicki 0'Dell man, Harry Lodge, and Jeff Lovin. The workshop was held on the ASU campus. attended a workshop designed to teach mechanics of state governments. 0 Model UN was an organization cre- ated to show how the United Nations works and the difficulties there are in solving problems on the international level. Canada, Iran, and Botswana-a province of Africa-were the countries represented by PV students. Each year different countries were assigned to Arizona high schools. Fifteen students qualified to serve were involved with the organization. They were chosen by teacher recom- mendation and by application. Only iuniors and seniors were eligible for participation. Students were presented with a cur- rent moral or social problem in which to investigate. They took the viewpoint of their respective country and examined its history, geography, social and po- litical status. Members attended Arizona's Sixth Annual Model United Nations Conven- tion on December 8 and 9 at the UA. MODEL UNITED NATIONS DELEGATES-FRONT ROW: Cai Klassen, Cindy Ettinger, Margaret Wilkie. THIRD Ellen Hale, Sallie Saltzman, David Singer, Lillian ROW: Sharon Marmon, Randy Sammons, Tom Dud- Rich. SECOND ROW: Leonard Hamer, Ellen Tighe, dleston, David Carter, Eric Chaison. Model United Nations Convention Held at U Model UN advisor Mr. Larry Bool assisted senior Ellen Hale in selecting infor- mation from books and magazines which she was to use at a model convention. Mr. Bool, Model UN advisor, assisted Lillian Rich and Cai Klassen with select- ing maps. From these maps they prepared material for the model convention. Scholarships, Awards and Honors Presented Kay Musser was the recipient of the Marshall Foundation Scholarship. She Scott Bramblett placed as a semi-finalist in the National Merit Scholarship received the UA scholarship on the basis of her exceptional scholastic ability. Qualifying Test. He ranked high enough to be considered for the scholarship. Seniors Bill McTamahan and Ed Nordquist received principal nominations to the Naval Academy in Annapolis. These nominations were received on the basis of their scholastic ability and good citizenship. Each year scholarships, awards and honors are presented to seniors with exceptional scholastic abilities. These awards not only bring high esteem and recognition to students but also aid them with the financial aspect ot their educa- tion atter completion of high school. Several tests, including the SAT, the PSAT and the National Merit Quality- ing Test are given to students throughout the school year to determine their scho- lastic aptitude. Those seniors who score high on the tests and are active partici- pants of extracurricular activities often receive various honors and awards. Among the many honors received by students for outstanding achievements were the Marshall Foundation Scholar- ship, principle nominations to the Naval Academy, the National Council of Teachers ot English Award and the Op- timist Student ot the Year. Other awards presented to seniors in- cluded the Elks Leadership Award, Na- tional Merit Scholarship Finalist and the i968 Betty Crocker Homemaker of To- morrow Award. Recognition earned by these students was the result of determination and hard work all through high school. if to Outstanding Seniors c ' R if WW' .ii 124 'Q wi is 4E?5 Kathy Zimmerman received a scroll of recognition in Achievements Awar s d Senior Richard Gilman was the recipient of the Elk's Leadership Contest award Competition. Scrolls were awarded by the National Council of Teachers, in the boy's division. Richard was the fourth Titan awarded this recognition. Karen Bonham and Danny Huggins were chosen to On November 'l5, a banquet was held, and par- represent Palo Verde by the Optimist International. ticipants Karen and Danny received certificates. Betsy Upham was the winner of the Palo Verde Betty Crocker Homemaker of Tomorrow award. 63 , i L , , , ,W , ,- .1-,, L ,fig Q, , 1 ,,,, ,,.. , ,, .,,,,, f , -.. ,f,,,.f.--.,..-,.-.-,,-..-A . .. .,,,f .,, .--,..,, J ,H DMA., ..,.. ,,,..,., ,... .Bmw.mM.i,J,,,-.-4,,, , 4, ,,. -.,,,,. . . . ,-f , , .,.,,., .,..., -A . ,A,,,,,.... ,.,,...-..-, ..,, V ,A , , Student Life r The giffof goiety may itself be rfhe greatest good fortune, arid, the most serious siep foward ema- furify, - - ' Irwin Edman A complele double session caused halls lo become overcrowded with sludenls during passing periods. .fx as 1 ,M 1 l Y ? Ke L2 Q . . pw in Halls became deserted during class periods. A slu- denl rushed fo class afler the tardy bell had rung. Qi Dressed in shorls, iackel' and lie, Clark Canright had his senior porlrail laken al Sanders Sludio. September Marked the Reopening of School s Girls' l-90900 SPOHSOFGU-'l N19 fifS7 miXeI' of file YGCII' OH FI'ldCY, 5ePfembel' 3, in Before the homecoming game, Girls' League members decoraled lhe goal posls the boys' gym. Students danced to the music of the Boslon Fire Depdrlmenf. with gold and blue crepe paper and Alhambra's posts with their school colors. Palo Verde cheerleaders led the Sf'-ldenl b0dy in cheers and the school song at duced. School enthusiasm and a winning spirit encouraged the Titans to a 7-0 the first pep assembly. The Titan football and cross-country teams were intro- football victory over first-ranked Tucson that night. Even after school started, the bookstore was contin- line to purchase books and school supplies required uolly crowded with long lines of people. Waiting in much time and patience for these Studenti- Summer vacation ended for students upon the reopening of school on Sep- tember 5. On September 6, boys' and girls' assemblies were held. The student body was shown the proper dress for school, after school activities and proms. They were also shown the wrong way to dress and how not to act in school. An all-school mixer sponsored by Girls' League was held in the boys' gym. Music was provided by the Boston Fire Department. The following Friday, after the first football game of the sea- son, the Committee played at a dance that was sponsored by the senior class. Varsity cross-country and football teams competed against other high schools each Friday and iunior varsity and freshmen teams played on Saturdays. September 25-29 the annual Red Cross Drive was held. Money was col- lected in homerooms and the room which collected the most was awarded a free period. A S5600 goal was set by the student body. Girls' League held a Father-Daughter Dinner on September 26. Girls brought a box supper for themselves and their fathers. 'Show Stoppers' Was Presented in October OCTOBER opened with a victorious Homecoming football game against Al- hambra. During halftime, Karen Shields and Bob Schock were crowned Home- coming Queen and King. After the game, The Heard provided music tor the Homecoming dance. During the rest of the month the Titan team battled Salpointe, Douglas and Sunnyside. Four Cross Country meets were held in October against Tucson, Amphi, Douglas and Sunnyside. The Sophomore Class sponsored the dance after the Douglas game. Students danc- ed to the sounds of The Boston Fire De- partmentf' Senior Day at the UA helped to ac- quaint high school seniors with universi- ty lite. The day consisted ot touring the campus and attending assemblies, a barbeque and a university football game. Presentation of the Fall Vocal Concert was held on October 19. Included in the program were the Mixed Choir, Jubileers and Treblettes. Concert Choir, Jubileers and the Ca- Showstoppers, presented Oct. 31 and Nov. 1, preclcms presenled llshow Sloppersu Cll' included selections from My Fair Lady, Paiama the end ot October. Players Jim Werner, Joe Babinski, Doug Rhodus, and Art Allen formed a pyramid to show off their Errol Burke, Tim Walsh, Dan Crobbe, Steve Gunning heads which were shaved for the basketball season. Game and Showboat. Tom Ripley received standing ovations for his solo, Old Man River. i li' V I Wmczmfeimwwm .c Carol Cacioppo and Bev Shumaker congratulated Jacque Hines, P.V.'s third Miss Teenage Tucson. i vt , During the halftime ceremony at igx if Y in Nz Homecoming twirlers performed a routine with fire batons. The entire stadium was darkened to give the desired effect. 0 Eggs Can't Be Beat was the theme of the National Honor Society's float for Homecoming on October 6. The society won first place in club competition. so T este S gt 1 if 5 T i. wi? N32 ii x ii Homecoming queen for the ICBM float, Bob Deppe was especially careful with Titans stormed onto the field, breaking the run-through before the football his makeup for the Homecoming Pep Assembly. He required experienced help. game. The run-through was made to spark enthusiasm of the crowd. Homecoming Assembl Held for First Time With the firing of the gun at the end of the game, upon the game they had played. The Titans beat the Titan football team congratulated one another Alhambra by a touchdown and an extra point. A giant football along with goal posts were used float. The seniors won first place in the class float in decorating the Sophomore Class Homecoming competition, held during halftime at the game. After being crowned Homecoming queen, senior Karen Shields received a traditional bouquet. A special Homecoming assembly was held for the first time this year. The as- sembly was held on Friday, October 6, in the stadium during sixth and seventh periods. Sophomore, Junior, and Senior Class floats paraded around the field along with several club floats. Home- coming royalty was introduced and Bob Schock was crowned Homecoming King. The enthusiastic pep squad led the Titans in cheers and songs. Members of the football team demonstrated several plays used in the game. That night the Titan team played a victorious game against Alhambra, with a final score of 14-7. During halftime, class and club floats were iudged. First place for class floats went to the Senior Class. National Honor Society's float took first in the club float competition. The halftime presentation was high- lighted by the crowning of Homecoming Queen Karen Shields. After the game both students and alumni attended the homecoming dance sponsored by the Junior Class. Music was provided by The Heard. HQMECQMING RGYALTY 325m 525535 F l 4 V I Mark Canright Harry Lodge Pam Morris Not Pic. Mary Hanson Student Activities Filled ovember Calendar On November 10, the Freshman Class sponsored an after game dance for the against Rincon. Students were required to wear tennis shoes. Members of the student bbdy- The ClCInCe WGS held in The IWYS' SY n Uffef U Winning Same Freshman Class decorated for the dance and hired a local band to play. An enthusiastic crowd cheered the team to victory at one of the last football games of the season, held during November. Attendance was good at school sponsored dances which followed the games. NOVEMBER started with the final per- formance of Show Stoppers, a musical show put on by the Music Department with the help of the Capricians and Mr. Burgess. November 3 was a holiday for stu- dents, while teachers attended the Ari- zona Education Association Convention at the UA. A two-day vacation was also given to students and faculty for Thanks- giving celebrations. Band Day at the UA was held Novem- ber 4. Bells and Bows was a concert presented by the cadet band and or- chestra in the auditorium on Nov. 21. Athletic schedules were full with the freshmen boys' and girls' tennis teams playing against Pueblo, Rincon, Sal- pointe and Sunnyside teams. Football season came to a winning close and cross-country teams won the majority of their meets. Cry Havoc was a drama production put on by the afternoon classes. lt was held November i4-lo. November's cal- endar closed with a fashion show pre- sented by the Home Economics Depart- ment. 'Roaring 2O's' Motif Chosen for Senior Prom Seniors and their dates danced to the music of the Four Sounds at the Senior C0Sll-'mes of that Pefivd Ol' f0rl11Ul Ulflfe- RiCl1UI'd Gilmvn, David Cflflel' and Prom. The Roaring 20's was chosen as the theme and couples dressed in Ellen Hale were responsible for the programs printed like newspapers. i i WMAWW L4,,. ln between dances, seniors talked with other cou- with pink tablecloths, candles and dishes of mints. DUI! Huffel and Debi Kemph waited for an old ples at small round tables, which were decorated The time period was the 1920's during prohibition. fGSl1i0I1eCl CGI' to take lhem lo The prom. Gary Freeman, posing as a bartender of the 'l920's, served Seniors and their dates root beer and ginger ale at the Prom. A speak-easy atmosphere was Seniors worked long hours making prom decorations and preparing the cafe- teria for the formal dance. Plans for the prom were made after school. created to follow the Roaring 20's theme. The Prom lasted from 9 to 12 at which time the speak-easy turned into a cafeteria, and 'I920 became 1967. Underwater was the theme of the Senior After Prom held at the Tucson Inn. Couples in semi-formal dress danced to the sound of the Floaling Opera. Choral Groups Presented Christmas Concert Jubileers, a mixed choral group, sang songs around a fireplace in the Christ- mas Concert held in the auditorium on December 13. Portions of the same .1 f ff program were again presented in assemblies for students December 18 and 19. Other groups included Mixed Choir, Treblettes and Concert Choir. Mr. James Foss was presented a plaque of appreciation by Steve Burns. Mr. Foss was promoted from Bookstore manager to Examiner for District Number 1. DECEMBER 2 was the date of the annual Senior Prom. The theme was centered around the Roaring 2O's and music for the prom, which was held in the cafeteria, was provided by the Four Sounds. Basketball season started on December 5. During December the Titans played Tucson, Phoenix Union, Amphi, Douglas and Rincon, ending the month with three victories and two losses. During the two-week Christmas vacation, the basketball team participated in the Miami High School Holiday Invitational Tournament. Eight teams were involved in the tournament. The Titans played Aio, Globe and Superior. They defeated all three to win the championship and a first place team trophy. Morning drama students performed The American Dame on December 5-7. This comedy concerned the history of the American woman from the time of Adam and Eve to present day. ACT tests were given to seniors on December 9 in the cafe- teria from 8:00 a.m. until noon. The test, given four times dur- ing the school year, was required for all college-bound students. The annual Christmas Concert was presented by the Music Department on the night of December 13. Choral groups per- forming in the program included the Jubileers, Treblettes, Mixed Choir and Concert Choir. The program included a selec- tion of Christmas songs and a presentation of Handel's Messiah, which was accompanied by the orchestra. Also in- cluded was a brass ensemble and the Men and Women's Ensembles. Portions of the program were presented to the student body in assemblies held on December i8 for the after- noon session and on December 19 for the morning session. Canned Food Drive Was Held in December Joanne Vining and Jim Adams appeared as Adam and Eve in The American Homeroom Federation member Jim Buck helped in the weighing and colleclion Dame, a comedy concerning the hislory of American women. of canned food during 'he Canned Food Drive. The drive was held in December. Q X ,A-sexi, fa WWW ,M X- 7 ,if 494 A if Eg!! if H A pm 4 U-,gg arg ,os J ,egg iw it we Ddnny Huggins, Stephanie Gannon, Allen Lowe and Patty loftis, members of ration competition. Students from each homeroom decorated the doors in true Mr. Silverburg's homeroom, worked on their door for the Christmas door deco- Chflsfmus SPl l'- MV- 5llVe bU'9'5 homeroom look Sewnil Place- Senior Rick Riddle, 'filth YOFCI1 in hand, dashed Tug-of-war competition was one of the highlights day evening, January 17. Ten male students, Ground the fwtbvll field to begin the eVel'llS- of the Titanics, held on the football field Wednes- representing each class, were pre-elected by their S tW kA t' 't' H' hl' ht db l't ' Spirits Dave Hill and Jerry Stump wore togas on basketball game days, Tues- Races, piggyback style, were held between four couples from each class. As day and Friday. Representatives trom each class dressed up to promote spirit. the start gun sounded, students dashed to their destination 50 yards away. c if U O 1 ., ,Y .qnlv 5w,,aw I gf-l'3 3 W We-Q F? '-8 ,JS- S Spirit, Enthu ia Accented Week's Events Members of the Junior Class decorated the science hall on the Friday before Competition was stiff between classes to see who could collect the greatest Spirit Week. Their theme, Wheel Succeed took second place in the contest. amount of money during Spirit Week. The S718 collected was donated to AFS. sis' S 5 4- if an K 3 Q 1 -'Q J lJuring Spirit Week each class displayed its emblem bearing the motto Winged Victory, placed second. Mark Canright accepted the spirit trophies for the in the school cafeteria. The sophomore mascot, The iuniors earned first place in the competition. senior classmen at the spirit week assembly. Spirit Royalty Mark Arneson Kay Musser Spirit i i Patti Merrill Joe Babinski Not Pictured Rene Ruiz Attendants Sharon Graham Donell Sperduti Mike Kee Semester Exams Ended Month of January 5... EMM' Z . . , ...We , . Q, 1 Z' ri uf -,Ng , ' '14, T 'F V A total of twenty-eight songleoders and cheerleaders, dressed in traditional backed their varsity team during a double overtime with Sunnyside High blue and gold, led spirited spectators in basketball cheers. Students loudly School on January 16. Palo Verde won the game with a score of 63-53. During basketball season, members of the Letter- order to raise funds for their club. The refresh- -I-Hon Spirit Week highlighfed The men's Club sold cokes and popcorn to students in ments were sold at halftime and before the games. fi 4. S . ',, rn' W. V nr! ' month ot JANUARY. Activities for the week included an evening ot Titanic competition. Several tug-o-war and chariot races were included in the ac- tivities. On January 16 through the 18, the Drama Department presented Cry Havoc tor the public. The play was put on by the advanced drama classes. Spirited students had several basket- ball games and dances to look forward to during the month. January 16 was the date for a game against Tucson High School followed with a dance spon- sored by the Student Council. All interested and advanced students were given the opportunity to audition for the All-State Band, Vocal and Or- chestra, on January 20. The auditions were held at Rincon High School. Semester exams were held January 23 through 25 and brought an end to the tirst semester. Council Promoted Facult Appreciation Student Council members gave apples and shoe shines to the teachers for Faculty Appreciation Week. A car wash was given as an added courtesy. -'SW mo.-so 'HQ February 5-9 the faculty was recognized for the work and hours they devoted to the school. Fl'A contributed their efforts to Faculty Appreciation Week by washing teachers' and administrators' cars. Week Drama students rehearsed for the production of the play All My Sons. Prac- tice sessions were held out of class to improve acting and dialogue technique. FEBRUARY brought the close of basketball season. The Titan cagers played their last five games and defeated Sunnyside and Catalina, but lost to Pueblo, Salpointe and Douglas. A dance sponsored by the Pep Squad was held after the vic- torious Sunnyside game in the girls' gym. Music for the dance was furnished by The Renaissance Fair. At the end of the month the cagers played Douglas in the Divisional Basketball Tournament held in the Catalina gym. The Douglas Bulldogs defeated the Titans 53-50. Student Council promoted Faculty Appreciation Week held February T2-16. The week consisted of Marvelous Monday, Terrific Tuesday, Wonderful Wednesday, Thrilling Thursday and Fantastic Friday. During these days various services were performed for teachers. The Future Teachers of America washed cars and Student Council shined shoes and brushed off clothes. Shiny, red apples and long stemmed- carnations were also presented to teachers. The Titan Marching Band participated in the All-City Band Festival on February 15. Four Tucson high schools attended the festival which was held at Catalina. Homeroom Federation sponsored Rodeo Week February 26-28. Federation promoted all the week's activities including the Beard Growing Contest, the Rodeo Dance and the float in the Tucson Rodeo Parade. Western clothes were the style for both the school and the dance at which the indian Chief and princess were crowned. A four-day weekend followed Rodeo Week to end the month of February. MH Rodeo Royalty Announced at Annual Dance On February 29, the cheerleaders, songleaders and twirlers performed with wore uniforms which followed the western theme of the parade. Students were the marching band in the Fiesta de lag Vuquerogu parade, The cheerleaders given two days of vacation in order to attend the rodeo parade and festivities. An annual event of the Rodeo Week festivities was period of three weeks to grow their beards. Bob the beard growing contest. Boys were given a Deppe received the first place award. Rodeo Week, sponsored by Homeroom Federation, was held February 26-28. Various activities were initiated during the week in celebration of the Fiesta de los Vaqueros. An annual activity for the boys was the beard growing contest. Throughout the week girls were allowed to wear western pants and all students were en- couraged to wear Rodeo attire. On Tuesday, Mexican music was played over the PA system during breaks and passing periods. The stu- dent body was also serenaded with traditional Western music during the daily announcements. Indian feathers were sold on Wednes- day by Homeroom Federation members. Students danced to the music ot the Shallow Color of Liquidated Time on Wednesday night. At the dance, the Ro- deo King, Queen and attendants were honored and the winner of the beard growing contest was announced. The climax of the week's activities was the participation in the Fiesta de los Vaqueros parade on Thursday. Songleaders, cheerleaders and twirlers marched along with the band which followed the Homeroom Federation's float. RODEO ROYALTY RODEO ATTEN DANTS RODEO ATTEN DANTS I 2 ,w 5 1 Z 1 i 1 3 1 gNpm,:Q.ffa.f, wfzg1w,w.fwzzarsiwfxiw:,:Azf'mwmw:QmAmasm,QnLm,y- ' x wnwmmg mmm' M mrmmmwmmnm1.wLmw.:a1w2wsnmL.Q1r2,:mwmQw4,6,v...g.3M,ww ff .MNA mmm ,V , ,im .:L.., -AW fi,-.2 X V'--,.,.f. ., -. ,--.. ..:,Q,.. .M f.,.-.,,-,,,'., ., .Q i l l l Sweetheart Safari Week Planned for April ' On Bermuda Day students paid the price for bermudas shorter than two inches above the knee. Checkers for the day waited in the hallways to fine violators. By April, the days were warm enough to find an their 12-minute break to sit on the campus lawn. increasing number of students taking advantage of They relaxed from their class schedule. ff Barbara Button tagged Bob Stanbrook as her escort for Sweetheart Safari, a week including a box supper, an evening of croquet and a semi-formal. Regular assemblies introducing Sweet- heart Safari week were presented to the morning and afternoon students on April 16. During the week girls treated their dates and the couples attended a semi- formal dance sponsored by Girls' League on the l9. The theme for the turnabout week was Alice in Wonderland. Each class elected a King of Hearts. They played giant checkers with people of their choice. Other activities planned for the week were Bermuda Day, complete with knee checkers, and a box supper held on the Senior Lawn. A drama production, the Chalk Gar- den, was also held during the month. On April 8 and 9 a fashion show was put on by students in the Home Eco- nomics Department. All clothes modeled in the show were made by the students. An All-City Vocal concert was hosted by Palo Verde April 25. A Spring Festi- val was presented to students April 26. 93 t'ff1'4imsgiewv:Yww::-ww W , WW Sw WM w I QQQQQYQAS 'L ,gs . X 111 f- - ..N:,h,,,F,55,, . .mi M -- Q, .Am A Q W,., MM-1i:i?:EfHsXk f 1:4 f22f?rE'f'5a sw-2? LeHermen's Sweetheart-Kirsiie Wilde Afiendanf-Karen Bonham -H557 Attendant-Anne Colville f 2 ff-6 Alfendani-Suzi Davis Affehddhl-Debi KemPl'l Graduation Ceremony Climaxed End of Year June commencement exercises marked the first step toward tomorrow for the ledged srholarships with thoughts of ioy and regret. Most graduates in.. 801 members of the ClU55 of 63 Grad'-mfes fefewed d'Pl0mf-'S and CCRUOW tended to continue their education in Arizona or at out-of-state universities. During the months of MAY and JUNE students concentrated on gradua- tion and semester exams. Semester exams lasted June 2-5. Graduation was held during the evening on the football field June 6. Lettermen scheduled their dance for May 2. The dance was semi-formal and was held in the cafeteria. Sweetheart for the dance, Kirstie Wilde, was chosen by the lettermen. On the 9 and 10 of May, seniors pre- sented the Senior Show to members of the student body and the public. The show was made up of comedy sketches, songs, dances and a short film of school activities throughout the year. ACT tests were given May ll and ad- vanced placement tests were given to seniors for college placement. The 14 through the 17, the vocal and instrumental departments presented their annual Moonlight Melodies concert. The concert was open to the public. A District Band Festival also added to the musical enioyment of the students. i E i S 5 Q z f s S .w SA W 5 K. . - - -- f-'f- , Nm,mmmmmvmpmszmwwwmw-myWm.Qf..wmwmmmawM.m v-..f, Wwyw-:11::W1ff,-,Mmfm-.Wmw1.WN,..WW,w'+--W-fmmmm gf- Organizations In activity we must find our ioy os well as glory, and labor, like everything else that is good, is its own reward . E. P. Whipple Yearbook Staff Presented Olympian, Sponsored ,is A 'Q' ASSISTANT EDITOR Mary Wiggins On November 8, The Olympian siaff handed ou! pictures io freshmen, sophomores and iuniors. The EDITOR-IN-CHIEF Debbie Slolba classes and indices staff was in charge of organiz- ing and scheduling These pictures and all reiakes. WiTh The help of advisor BurdeTTe Bee and The coordinaied eTTorTs of nine sep- eraTe sTaTTs, The '67-'68 Olympian was presenTed in June. EdiTor-in-chief of The yearbook was The mosT difTiculT job. She was respons- ible for seTTing up deadlines and making sure all deadlines were meT. Copy sTaTT members were required To record all im- porTanT social, sporTs and academic evenTs. Planning of The various divisions which comprised The yearbook was The work of The organizaTions, sTudenT life and sporTs sTaTTs. IT was The iob oT The TaculTy forward sTafT To organize The faculfy phoTos. The classes and indices sTaTT was responsible Tor The senior and underclass picTures, and The layouT sTaTT worked on The de- sign oT each page. AdverTising and sell- ing of The yearbook was managed by The publiciTy sTaTT. The '66-'67 Olympian was given ouT- sfancling raTings by several difTerenT Na- Tional Yearbook AssociaTions. ADVISOR Burdette Bee nnual Signing Party ORGANIZATIONS-Pete Blechc, Connie Price, editor. FACULTY FORWARD-Debby Burke, Kay Musser, SPORTS STAFF-FRONT ROW: Tom Puckett, Ken Jacobs. BACK ROW: Vicki editor. O'DeII, sports copy editor, Nancy Lenches, Barbara Carr, editor. r :v5W CLASSES AND INDICES-Lynn Slagle, Nancy Yerkes, Mary Jane O'Day, Cathy Bonewell, underclass editor, Janet Arveson, senior editor, Amy Weber, index editor, Nancy Hawke. STUDENT LIFE-Chris Sanli, Pam Morris, editor. COPY STAFF-FRONT ROW: Janice Chlopowicsz, Aida Asliazaran, Nancy Kearns Al' lhe yearbook signing parly, sludenfs exchanged signalures with friends. The annual parly was held in the boys' gym afler the '68 Olympians arrived. OFFICE MANAGER-Carol Lee Cacioppo PHOTO-COORDINATOR-Sue Allen BACK ROW: Susan Hogan, Sherry Campbell, Linda Garner ART AND PUBLICITY-Gordon Chaidez LAYOUT-Pam Allen, Roxy Price. Photographers Illustrated Campus Activities Photography staff members worked closely with the year- book staff to produce the '67-'68 Olympian. One of its maior goals was to improve the quality of the photographs in the yearbook. Members of the publications staff were also called upon to take pictures for the Post. These assignments consisted of action shots of sports, organizations and social events as well as other activities of special interest each week. In addition to the work on the Olympian and Post, the ser- vices ofthe photography students' were used when needed by all classes, departments and school organizations. Classroom teachers frequently requested the talents of the photographers when pictures of special classroom proiects were desired by the students. Photographers participated in various photography contests. They were awarded prizes for participation in the photography section of the Arizona State Fair. Awards were also received for entries in the National Scholastic Magazine Contest which is co-sponsored by the Eastman Kodak Company. These awards were given on the basis of photographic technique and originality. Several members of the staff entered the city high schools' photography exhibit. Graphic Arts and Photography l and 2 were required by photography staff members before applying for a position on the staff. The publications staff consisted of 15 members with Mr. Leonard Chedsey as advisor. i PHOTOGRAPHY EDITORS-Sue Allen, Olympian photo-coordinator, Mr. Leonard Chedsey, advisory Bill Brewer, Olympian photo editor. 1 .,. .W 1 'iv it , ...M .. . ,K s.w.s......,,,g x .. .. 5 s -2 Photographer Howie Hibbs checked out equipment PHOTOGRAPHY STAFF1FRONT ROW: Fred Swider- Hollis, Gail Steffe. BACK ROW: Lee Kington, David necessary to take action shots of school activities. ski, Bob DeYoung, Howie Hibbs, Bill Quimby. Miller, Howie Ingham, Dean Jacobson. SECOND ROW: Patty Loftis, Cindy Miller, Judie Post Staff Produced Weekl Issues, Achieved EDITOR-IN-CHIEF David Carter Nineteen students were chosen to work on the l967-1968 Post staff. Al- though there was no set grade average required, a prerequisite of one year in beginning iournalism was needed. The system used in the production of the Post allowed for an editor and an assistant editor for each branch of the paper. The staff members were given assignments by the editors and as a result, obtained complete campus coverage. To include more up-to-date news and photographs in each issue, the Post was printed by offset this year. This method also saved money for the staff. The i966-1967 Post was awarded the National Scholastic Press Associa- tion's First Class Honor rating, winning 3735 of a possible 4000 points. The newspaper also received 936 of a pos- sible iOOO points from the Quill and Scroll international honor rating. ADVISOR Marilyn Dye Tl? POST STAFF-FRONT ROW! l-iI'lClU Mohr, Kflslle ROW: Linda Billings, Ellen Hale, Richard Gilman, ROW: Don Oppenheim, Calvin Reynard, Peter Trin- Wilde, Cal Klassenf Chl'Y5Unn TSUS'-'Vis' l-llllun Rich, Rick Childress, Mike Land, Eddy Lawhecd. BACK ca, David Carter. Linda Mills, Elaine Krueger, Shirley Wahl. SECOND Total Campus Coverage Shirley Wahl and Cai Klassen, members of the Post staff, delivered papers to classrooms during fourth period. The publication came out each Friday. ,. 5 .rkrkkr W .I ,Y ,.f,..M.,....w a..,.sTk i- A -. K K E ,- 1 -,'- tm 2 -i l a ws , -2322? zf',,+jg5 vt P057 EDITORS--FRONT ROW! Linda Billings, news ROW: Richard Gilman, associate editor, Don Oppen- edifofi Shirley Wahl, business manager, Linda Mohr, heim, feature editorp' Calvin Reynard, sports editor, copy editor, Cai Klassen, circulation editor. BACK Ellen Hale, assistant editor, David Carter interviewed Terry McDonald about his work as a disc iockey at KIKX radio station for a Post article. Dean Jacobson took the photograph. Kathy Martin, photo editor of the Post, had the difficult iob of scheduling photos for publication. BAND--FRONT ROW: Carol Post, Chuck Eger, Ed Gochenour, Betty Corder, Nan- cy Hartman, Karen Benson, Debby Burke, Shelley Frederick. SECOND ROW: Andy Peters, Scott Roberts, Kathy Seale, Lisa Malik, Josh Richardson, Kay Johnston, Kathy Gunning, Margaret Leedom. THIRD ROW: Tim Santeyan, Carol Kleinhesselink, Bruce Tost, Dwayne Kinne, John Cornelius, Joe Hartnett, Tom Folks, Mike Kuhn. FOURTH ROW: Gary Gilbert, Scott McKinney, Bill Higgins, Verna Warner, Martha Flaming, Ed Meinel, Gary Anderson. FIFTH ROW: Lloyd Drake, Leo Paluska, Steve Owens, Cathy Cleven, Ken Estes, Dave Ashcraft, Randy Deeming, Bette Faires, Terry Finefrock. SIXTH ROW: Martin Ward, Eddie Peters, John Berry, Bryse Bradley, Jim Deckard, Dave Dugdale, Gary Nelson, Rod Campbell. BACK ROW: Donald Fish, Twirler Jim Vactor. Band Participated in Eddie Peters, a member of the Titan Marching Band, practiced to perfect his skill on the tuba. Six years of superior ratings have been awarded to the band. DRUM MAJOR-Rodney Hammil FRONT ROW: Peggy Blattel, Gail Kircher, Misty Premovich, Janet Berger, Lynne Casey, Debbie Fegan, Delores Durham, Cheryl Faussett. SECOND ROW: Donna Rhoads, Sandy Wiley, Avis Voda, Vicki Stone, John Rognlien, Mike Printz, Vir- ginia Maykulsky, Bobby Phanton. THIRD ROW: Jerry Bokowski, Scott Patterson, Liz Hoehn, Beth Schewker, Dean Brown, Deborah Cummings, Deborah Wilkins. FOURTH ROW: Ray Misick, Cathy Geisert, Gene McCullough, Dick Walker, Tom Smith, John Dame, David Carpenter, Richard Levandowski. FIFTH ROW: Joe Nuckols, Jon Findley, Dallas Kassing, Kim Varvir, Dave Cole, Jay Parker, Dave Elliott, Bill Warden. SIXTH ROW: April Antonetti, Brad Bennett, Janell Tharp, Tom Bethune, Dave Gardner, John Hoarn, Gary Boam. BACK ROW: Twirlers Gail Lamb and Sandy Kostroski, Phyllis Moore. All-State Band Concert, Moonlight Melodies A superior rating at Band Day was awarded the Titan Marching Band for the sixth year in a row. Band Day com- petition included a representation from each of the high school bands in Tucson. PV band members presented several for- mations, the most popular being the famous floating TITAN. Lending a musical accent to pep as- semblies, fo o t b a I I and basketball games, the band members accompanied the songleaders and cheerleaders in pro- moting spirit. Extracurricular activities for the Titan Marching Band included the Veterans Day Parade in November and the Rodeo Parade in February. Moonlight Melo- dies and the All-State Band concert were other annual events. Prerequisites for the Titan Marching Band were cadet band and advanced band. Requirements for band partici- pants were excellence in marching tech- nique and musical sound. Band mem- bers worked many hours to achieve these goals. Marching routines were practiced on the football field after school on Thursday nights. BAND OFFICERS-FRONT ROW: Cathy Cleven, vice- Dave Cole, treasurer: Margaret Leedom, secretary: president: Donna Rhoads, president. BACK ROW: Mr. William Richardson, director. 23 ASSISTANT DRUM MAJOR Tom Smith Orchestra Ended '6 -'68 School Year With l I ORCHESTRA OFFICERS-Carol Hetrick, treasurer, Randy Sammons, president, Anna Nussbaum, vice- DIRECTOR president, Jeannette Burkhardt, secretary. James Slevenwn ORCHESTRA-FRONT ROW: Anna Nussbaum, Randy Sammons, Brooke Sam- Sanborn, Jan Christianson, Regina Pugh, John Denker, Andrew Peters, Sandy mons, Mary Jane 0'Day. SECOND ROW: Carol Hetrick, Steve Sheppard, Nagui Jones. FOURTH ROW: Sam Aston, Jeannette Burkhardt, Linda McCoy, David Maghrabi, Elizabeth Reyna, Robert Drake, Linda Garner, Delores Durham. THIRD Pinion. Darryl Arndt, DeWalt Love, David Griever, Ed Meinel, Martha Flaming. ROW: Donald Schmidt, Alicia Vitale, Harold Feldman, Jerry Lo Cascio, Deanna BACK ROW: Arlene Feldman, Gary Hollenbeck, Dan Duperre. Moonlight Melodies Concert, Baccalaureate Seventy students participated in the '67-'68 orchestra. The students were chosen in the spring on recommendations from their previous instructors. Both the band and the orchestra presented an evening con- cert open to the public on November 2l. ln December the orchestra combined its efforts with those of the choirs to pre- sent the annual Christmas Concert. The program was per- formed in an evening concert to the public and to the students in an assembly during school time. In March all high school orchestras participated in a city wide concert and more ad- vanced students were chosen for an honors orchestra. On March 29 the orchestra traveled to Scottsdale to perform at Coronado High School. All iunior high schools in the Palo Verde district were guests at an April concert sponsored by the orchestra. A district con- test was held during the year for solos and ensembles. This was followed by a state contest. Tryouts for students which comprised the All-State Orchestra were held at Tempe. The orchestra ended the year with Moonlight Melodies and Baccalaureate. Orchestra students and officers met seventh period with in- structor Mr. Stevenson to practice and plan for their concerts. -.,...-e Adding musical depth to the Music Department's presentation of the Messiah, David Brueck played a kettledrum in the Christmas Concert on December 13. FRONT ROW: Nancy Armstrong, Holly Hamer, Elaine Meinel, Margo Blackwell. Cullum. FOURTH ROW: Gary Anderson, David Cole, Cathy Cleven, Terry Fine- SECOND ROW: Cheryl Faussett, Carolyn Francisco, Janet Blaylock, Rocky Es- fl'0Ck, Rod Campbell, Don Fish, Bruce 570719, R0llUl'1 ASVOF1, l-YH MrCGrver, Ml'- parza, Rosanne Love. THIRD ROW: Vicki Stone, Cathy Geisert, Beth Sheuker, JONES SPGVGYISOH, difeflof- BACK ROW: David Brueck, Darien Handley. Robert Scott, Kathleen Fay, Brad McFarland, Dan Blanco, David Zeger, Jim Mc- Singers Rick Firth, Dennis Sneath, Randy Lewis and Rick Franz sang WouIdn't It Be Loverly in the Vocal Department's presentation of Show Stoppers. Competitive Auditions DIRECTOR Lane Justus CONCERT CHOIR-FRONT ROW: Linda Campbell, Liz Hale, Nan Reese, Debbie Johnson, Barbara Andrle, Nancy Cox, Cindy Eustice, Cathy Stouffer, Debbie Knight, Carol Lee Cacioppo, Linda Crane. SECOND ROW: Verna Warner, Susan Laughlin, Martha Sutton, Debby Lenhart, Debby Matthews, Janet Romney, Kathy Marcek, Karen Thomas, Sue Hogan, Judy Tudor, Jolene Turner, Sandy Piper. THIRD ROW: Rick Franz, Bruce Jones, Dave Britton, Bruce Greenberg, Josh Richardson, John Torreion, Larry Garcia. BACK ROW: Rollah Aston, Steve Pierce, Derek Schull, Mike Miller, Bruce Cramer, John Dees, Scott Westfall, Dan Turner. Were Required for Concert Choir Selections Concert Choir members were chosen on the basis of selective and competitive io s T st, auditions. Students were required to into-A T C- show ability in sight reading, blend, melodic and rhythmic dictation. On October 3l and November l the choir p r e s e n t e d Show Stoppers. Excerpts from My Fair Lady, Pa- loma Game and Showboat were tea- tured. The production received special acclaim from several Tucson authorities. In February, Choral Classics was presented iointly with Rincon. Later in the year the choir traveled to Tempe for a concert with Tempe Union. Other per- formances included the annual Christmas Concert, the All City Festival and Moon- light Melodies. A high honor which students worked to achieve was membership in the All- State Choir. if' llii as su, , ..,.,M, ,. 55, 5.1, .X the CONCERT CHOIR OFFICERS-FRONT ROW: Linda ing secretary, Shirley Robold, librarian. BACK ROW: Crane, SGCFSNFYI 5'-'SCH Laughlin, historian, Cathy Tom Ripley, choir manager, Rollah Aston, treasurer, Stouffer, robe chairman, Christie Tarbill, correspond- Rick Franz, president, Larry Garcia, vice-president. FIRST ROW: Jody Immerman, Margarita Martinez, Jeanette Burkhart, Cathy Chandler, Cathy Bonewell, Pat Lotz, Betty Martin, Vicki Stone, Sandy Wiley, Carol Wiley. SECOND ROW: Janet Arveson, Shirley Robold, Christie Tarbill, Susan Markle, Susan Barnes, Elaine Mize, Carol Raymer, Melanie Jacobson, Geri Joseph, Linda Caffarella, Lisa Malik. THIRD ROW: Rick Firth, Steve Roberts, - '.,-,.,, K . - Tom Ripley, Dale Suter, Randy Lewis, Bill Brewer, Dennis Sneath, Bernard Eichenberger. BACK ROW: Brian Whiting, Lenny Gradillas, Steve Hazelbaker, Roger Lamb, Chuck Brisley, Tom Weston, Marshall Coulter, Craig Sebree, Bob Manternach. .lubileers and Mixed Choir JUBILEERS-FRONT ROW: Lenny Gradillas, Shirley Robold, Christie Tarbill, Margarita Martinez, Nan Reese, Linda Caffarella, Jolene Turner, John Torre- ion. SECOND ROW: Verna Warner, Randy Lewis. Dennis Sneath, Linda Crane. THIRD ROW: Larry Garcia, Janet Arveson, Karen Thomas, Sue Hogan, Susan Markle, Rick Firth. BACK ROW: Rick Franz, Rollah Aston, Roger Lamb. Gave Students One of the highest honors for any vo- cal student was membership in the Jubi- leers, the advanced choral ensemble for both boys and girls. ln addition to regular school perfor- mances, the Jubileers sang for various service and social organizations around Tucson on request. Sixteen regular mem- bers, one accompanist and five alternates composed the group. Mixed Choir was another vocal group for both boys and girls. Members of the choir were chosen on the basis of audi- tions which included sight reading, in- tonation, quality, and rhythmic and me- lodic memory. Versatility and musician- ship were also important factors in their selection. Treblettes was an all-girl group com- posed of about 30 members. With other choral groups, the Treblettes participated in the Fall Concert, the Christmas Con- cert and Moonlight Melodies in May. The various vocal groups also presented student assemblies throughout the year. Music ranging from serious to popular and from the Renaissance to contem- porary periods was performed by all three of the choral groups. MIXED CHOIR-FRONT ROW: Barbara Heald, Marilyn Conclit, Karen BeDunnah, Benhase, Cindi Fullerton, Karen Raffensparger, Debbie Johnson, Cathy Cleven, Cindy Cook, Roy Metcalfe, Jim Carr. SECOND ROW: Linda Green, Renee Smith, Ed Seflghff Dave cole- BACK ROW: Paula Sfhfubbef l-ols H0mb0l'f Sallie Fflff, Jill Carson, Mallory Kinseth, Max Nelson, Tom Monasmith. THIRD ROW: Lynne JI-'dY Tudf-'ff SUSCI1 Martin, Steve Cfflmeff Cl'Gi9 Tl19ff0rd, Sieve TGIOGC. an Qpportunit to Displa Musical Abilitie TREBLETTES-FRONT ROW: Susan King, Cathy Winans, Jayne Dickerson, Liz Rey- Berry, Susan Robold, Margaret Purcell. BACK ROW: Debby Neathery, Ann na, Kathy Thrasher, Monica Brooks, Nancy Haverlack, Karen Bogardus. SECOND Shepard, Doris Baumeister, Liz Taylor, Sherry Fry, Diane Mark, Karen Oster- ROW: Nancy Wisely, Joy Cooke, Michele Basie, Pat Stewart, Hope Miller, Debbie man, Cheryl Richards, Michelle Bailey. FRONT ROW: Mike Chavez, Randy Lewis, Debbie Freeman, Marcia Semlow, Dyan Scherer, Sue Sellars, Colleen Skiles. SECOND ROW: Mark Gilbert, Ralph Spiller, Ellen Tighe, Mary Ann Wiggins, Roberta Miller, Marilyn Waitt, Carol Athans. THIRD ROW: Neil Nichol, Bernie Weger, Bdrbdra Parkin, Carol Wiley, Annual Drama Thespian Society was a national or- ganization of high school actors and technicians. The Society's goal was the advancement and improvement of stu- dents interested in dramatics. Students worked approximately two years to earn enough points to be eligi- ble forthe Thespian Society. Points were given for work both on and oft stage. Students were then elected by the other members of the organization. Since the Thespian Society was an honorary ac- tivity, participation was not required of drama students. Activities of the organization included work on a proiect chosen at the begin- ning of the year. Members also per- formed in the productions of the ad- vanced dramatics classes. Smear ssira Thespians were required to take either dramatic arts or stagecratt to earn the necessary points for initiation. Pins were available to all members ot the Society. THESPIAN OFFICERS-FRONT ROW: Bob Schock, ROW: Sallie Saltzmon, president, Bill McTarnuhon, treasurer, Ginny Spencer, vice-president. BACK secretory. NATIONAL THESPIAN SOCIETY-FRONT ROW: Andrea Veuls, Gayle Griebling, Sckin, Shirley Glynn, Ginny Spencer, Ethel Foxslein, Christie Tarbill. BACK ROW: Sallie Saltzman, Scott Carter, Bob Schock. SECOND ROW: Ande Ackerley, Jim Sydney Elliott, Babs Vetlerlein, Chris Gutchel, JoAnne Vining, Bill McTarnchan. 'anus- il ..Q,ff s'. .. ,,53Q5m m 2g, E51 . . . ,. 3, w Q ,ds M. fs my A y 1. 2.,W E: Mr. . aw -1 .... 1 qw,- W Na r-smefk f ,i . -:-.,.5,.m f. .Las ' -- ' ' 9 in P M, , r ag: , rc af W t- --v:.1f:e ' 5 fs f f-WS? .' , 53: Z I 3?f3ff?a?:'if2' , - fi,-5Q'3lf'l53??5'W JIQMMQQXE i , , 1 , 4' k 4- ' 2ww,,.., uw, . aprieians Expressed Tryoufs for The Capricians were held in The spring. Girls were chosen on originalify in choreographing Their own olance and Their abilify To perform cerTain dance skills. Modern dance was a means of expressing an idea or com- municaTing an effecT. STudenTs sTrived for Technique, polish, dynamics and design in Their dances. MasTer dance lessons were also given by naTionally known choreographers oluring The Capricians' sevenfh period class. On Sepfember 23, The Capricians aTTended a workshop at The UA. The workshop was open To all high school dance groups. Capricians performed in a sTudenT concerT in The LiTTle TheaTer on February 3. The Young Choreographers Con- cerT was presenTed in March. Les Pieds DansanT, The Ca- pricians major producfion on May 2, presenTed The inTer- medicife and beginning dance sTudenTs. The Capricians pracTiced daily To gain grace and perfec- Tion in Their movemenTs. WiTh The help of Their advisor, DoroThy Davis, The Capricians choreographed all of Their producfions. Exercises were also conducfed daily as warm-ups To give The Capricians as much agiliTy as possible. Rona Clancy and Jan Merchunl slrove for lechnique, polish, dynamics and de- As a member of The Cclpriciuns, senior Polly Kiser was required To work many sign in their dances. The Cupricians worked daily To alfain These skills. hours on form. She used mirrors To help in perfecting all of her rouiines. ruff' . pgk sygi ' - '. '-: T' .T : M.. V- -. . V 1 -- ' ggi .. is fr, .. -::. ..,. . . r .,.. . ,, T '- - - v- misses-M1 ie' ' ' H 'f .- .. .T sr. .,,.. ,. g 3E??s2fsff:ffZsi2ijgif2.221f2?ei?55?fi?si21sf?5?'T5wEeg,,,, ' ,jj Mswisffsigsfi-225225245gfgggigrgamitgfngggpefiwsfzefzrefze, ' -- iflvgsszssu-1115,1-,f..1. . M -sizes:efszzsrzfssgsvgsvfQfrisisu --H23,21ffwflsrsfzgegfe fe , swf -W W -ff-.rims-i.,.,zg 2 Q?eggs2f'i5?iss11s2g,ffggi'f1J:sg:::,,f:,.fwgizgfg1Ui v1,1f513f'v 3-5-gg g:-1111.f,,s,:sfZ5r5,geg5Q3Q ' 1 f' - sf--H5 is-frggqg,-5,-i g.-1 K fzQg::se1f,m?::gf2f:1fvfffimszzfisvziagsi 1151.1 1 - - - 1 - Twig, -ff-Q1 Sr-1 wc' , .. , 1-:sf -. V ,. T, , ses,-,News1f,.,,.S,1.ae1f T . W - - ,- -,M .wx ..ce.m-2w.,,.M..,, . . we , ,. , , .,.,,..,,,.,.,.rc,...,,.,.w, Impressions of Objects With Dance Movements ADVISOR CAPRICIANS-FRONT ROW: Janet Merchant, Cindy Dorothy Davis Mina, Kathy Martin, Rona Clancy, Jan Wheaton. BACK ROW: Kathy Petersen, Patty Kiser, Liz Heim- pel, Adrienne Greenburg, Dian Gish. Jan Wheaton and Kathy Petersen practiced on danc- ing techniques during their seventh period class. Capricians Rona Clancy, Jan Merchant and Kathy Martin choreographed dances for Les Pieds Dansant. SONGLEADERS-FRONT ROW: Teri Giambruno, Debbie Stolba, Suzy Lamm, Bar- ston, Nancy Hawke, Debbie Kee, Lynn Smith, Belly Lazares, Bonnie Norton. bara Carr, Patty Bryers, Jackie Ritter. BACK ROW: Terri Frahm, Karyn King- Songleaders Participated in Halftime Activities- t ADVISORS-Mrs. Kaay Strang, Miss Pauline Jordan. Q 1 Songleaders led the students in Stand Up and Cheer at the pep assembly on September 15. They also boosted spirit at football and basketball games. .,,. V g ,M . . I . Y . 1 ' L , N 'V .' SONGLEADERS-FRONT ROW: Carol Lee Cacioppo, Candy Smith, Carol Nielsen, Kathy Tindall, Betsy Hoar, Suzi Davis, Barb Mitchell, Patty Loftis, Debbie Debbie Knight, Tanna Yerkes, Karen Gordon. BACK ROW: Leslie Anderson, Hopman. and Pep Assemblies to Boost the Titan Spirit Enthusiastic spirit and pep of the songleaders was the result of a great deal of hard work. During the summer, songleaders practiced two days a week. Under the supervision of new ad- visors, Mrs. Kaay Strang and Miss Pauline Jordan, the girls were given several requirements. Gold and blue pom pons were made at home filling many hours of the songleaders' time. Head-high kicks were perfected along with a new routine each week. Song- leaders created bench cheers in coordi- nation with the cheerleaders' movements. After school started, songleaders worked two hours daily acquiring the definite motions necessary for a good performance. A designated routine was established for the school song and extra practices were called if routines were not polished. Participation in the first pep assem- bly, September 15, was the official start of the new year for the songleaders. Pep leaders Leslie Anderson, Janice Foss and Carol Lee Cacioppo cheered as the team scored again. CHEERLEADERS-FRONT ROW: Carol Sharp, Pal Wheeler, Joyce Meibohm, Tam- Ligner, Barb Bradley, DeeDee Ligner, Kirstie Wilde, Lynn Pepe, Wanda Fuchs, my Vukovich, Karen Shields, Kay Musser, Debbie Hoxie. BACK ROW: Mindi Janice Foss, Marsha Griffiths, Amy Weber. Student Body Enthu ia m and Cheerleader Amy Weber enthusiastically led a cheer at the homecoming game against Alhambra. Clapping to the music of the Titan band, cheerlead- routine during halftime. The break gave the cheer- ers watched as the songleaders presented their leaders a chance to relax and sip coke. 4 4 N Twirlers, Mike Boys, .IV Cheerleaders Were For their final performance of the football season, tine. Sandy Kostroski executed the difficult spiral the twirlers used fire batons in their halftime rou movement to the song The Rain in Spain. Fiery baTons flashed in The darkness aT halTTime shows as The Tour members of The Twirling squad performed. The group worked closely wiTh The band as They developed Their own original rou- Tines. Pep assemblies, TooTbalI games and baskeTball games were maior evenTs for The Twirlers. Two oTher imporTanT evenTs were Band Day aT The UniversiTy of Ari- zona and The Rodeo Parade. GymnasTics and school enThusiasm were The mosT imporTanT TacTors in The performance of The mike boys. The Three boys chosen aided The cheerleaders wiTh The use of a microphone and a mini- Tramp. Eighf girls were chosen To lead The STU- denT body in supporTing The junior vars- iTy Teams. JV cheerleaders demonsTraTed Their enThusiasm, abiliTy and pep aT iu- nior varsiTy fooTball and baskeTball games. Cheerleaders were a major sym- bol of school pride and spiriT. l l Mike boy Kurt Lundstrom made an outstanding ef- fort to promote winning spirit at football games. Major Symbols of School Pride and pirit Ck. JUNIOR VARSITY CHEERLEADERS--FRONT ROW: Twyla Stockham. BACK ROW: Debbie Goodman, Peggy Engelke, Julie Vining, Kathy Greer, Celia Riddle, Robin Batiste. Jeannette Smyth, Mi? Cheering at the JV game with Catalina, Debbie Goodman climaxed her cheer with a C iump. l 'X EZ TWIRLERS-FRONT ROW: Sandy Kostroski, Kcthy Pelusi. BACK ROW: Gail MIKE BOYS-BiIlStrodtbeck, Kurt Lundstrom, Rick Frunl. Lamb, Ann Hubbert, Jill Vactor. f l1-u. '- NL 'L 'liz PEP CLUB OFFICERS-FRONT ROW: Cindy Olfe, vice-presidenlp Marsha Griffilhs, presidenlg Mary Gradillas, secrelary. BACK ROW: Dave Croleau, lreasurer. Members of the Pep LelIermen's Club members earned money for lhe club by selling programs al all foolball games. Joe Babinski and Keilh Ridgway parlicipufed in lhe proied. Screaming and yelling, Pep Club members cheered The varsily foolball leam on lo a close vicfory over number one ranked Phoenix Alhambra. Pep Club involved both boys and girls from all classes. its main objective was to spread spirit at games and to get the whole student body to ioin in and cheer in accordance with the cheer- leaders. Girls were required to wear a white long-sleeved blouse, a blue skirt and white gloves. Boys wore a long-sleeved white shirt and blue slacks. A homecoming float was made. The theme was Lions Turn Kitten and Go to Pot. At regular meetings, hand cheers were practiced and spirit signs were made. Lettermen's Club consisted of boys who had won a letter in a varsity sport. The purpose of the club was to raise money to spend for minor things de- sired in the athletic program that could not be obtained through the department budget. The annual Lettermen's Ball, a semi- formal dance, was held on May 3. LETTERMEN'S CLUB OFFICERS-Clark Canright, ser- vice-president, Jeff Lovin, secretary, Mark Canrighl, geanl at arms, Harry Lodge, president, Jerry Stump, sergeant qi arms, and Lettermen's Club Added to School Spirit LETTERMEN'S CLUB-FRONT ROW: Chuck Schwortzmonn, Tom Gustafson, Alan Espinola, Mike Culshall, Dan Turner, Hogan Smelker. BACK ROW: David Mc- Shapiro, Ted Phillips, Bob Vucasovich, Art Allen. SECOND ROW: Tom Stoops, Neal, Fred Emerling, Jerry Jones, Jim Skevinglon, Mike Bingham, Brock Tella. Fred Swiderski, Mark Arneson, Rick Riddle, Bill Ball, Dave Cutshaw, Larry ICBM Established Physical Fitness as Goal ICBM was the only club of its kind in the city. The goal of the International Cult of Body Mashers was to promote physical fitness of its members. Several requirements had to be met by the students to receive an ICBM sweatshirt. A few of these were a hike of 25 miles, a hike to Mt. Lemmon, and wrestling for five minutes. After these tests were successfully passed the mem- ber was then eligible for his personal sweatshirt. One of the main activities of the club was their soccer team. The team had il official players and practiced three times a week for two hours. The ICBM club held a Faculty Soccer game November 22 in the football stadium. Half of the earnings went to send a boy to camp while the other half went to the club's . ICBM OFFlCERS1FR0NT ROW: Bob Schock, vice- presidentp Dan Fox, soccer captain. BACK ROW: Z,.......... Mark Arneson, presidentp Brock Tella, Chuck Schwartzmann, treasurer. 3 l 4. 'Ls .. treasury. ICBM Homecoming in Bob Deppe as for the '67-'68 James Lowell. ..,.., .,.,-- entered a float for which they christened Queen. Their advisor school year was Mr. ADVISOR Fritz Stud Rademacher kicked the ball to a team- The game was played against Southern Arizona James Lowell mate in the first winning soccer game of the season. School for Boys. The score was 6-0. s 15, MK! BOYS' PhY5iCal education Classes learned PYUPGY techniques f0l' lining W9i9l1fS- students and ioined the Weight Lifting Club to further develop and tone their Many boys became interested after taking the regular class offered to dll muscles. Meets were scheduled against high schools throughout the year. Judo, Weight Lifting Participated in Meets Two athletic clubs at P.V. were the Judo and Weight Lifting Clubs. These clubs helped to develop physical as well as mental fitness. Balance and technique were essentials for both sports. Judo Club taught students the art of unarmed self-defense. The object was to get an opponent oft balance in order to trip or hold him. Tactics used were those of non-resistance. Balance, strate- gy and skill were important in learning this sport. Judo was not a male sport only because more than halt the club members were girls. Girl members ex- celled in balance and coordination, Judo Club participants competed in several local and state meets. Mr. Austin was Judo Club advisor. Mr. Mondeau was in charge of the Weight Lifting Club. Only a limited num- ber of students could participate in this club because ot the lack of space in which to work. There was, however, a waiting list in case vacancies occurred. During first semester weight lifters chal- lenged Catalina in their first meet of the year. Later during second semester meets were scheduled with Rincon and the YMCA. The boys in Weight Lifting Club also published a pamphlet telling students about the activities of the organization. Rod Drake, a member of the Weight lifting Club, trained with the toe raise in preparation for a meet. JUDO OFFICERS: Lynne Thomas, president: Bill Holl- man, vice-president, Pat Collins, secretary-treasurer. EDITORS-IN-CHIEF-Lillian Weinberg-Jamie Davidson ADVISOR-Cynthia Schiesel wifi! sys, rn, :N Robert Ralston, a member of Spectra, did art work for the 1968 Spectra maga- zine. Pictures drawn complimented the short stories and poems in the magazine. Spectra Displayed Superior Student Writing Spectra, in its second year, was a showplace for superior writings. The stu- dent-produced literary magazine served to promote a better understanding of literature. Essays and articles, artwork and pho- tography, poetry, and short stories were the four categories into which Spectra was divided. All artwork, photography and writing were submitted by students of all classes. Representatives from each En- glish class were chosen to introduce work at Spectra meetings. Fifty active members met every Monday night with their advisor, Miss Schiesel, to collect and edit material for the 50-page magazine. Entries for Spectra were iudged twice, first by the chosen representative who gave the material a grade from one to ten, and finally by an editorial board. Names were replaced by numbers for fairness during the iudging. Two chief editors, four class editors and ten editorial editors were chosen WR . . f e . sPEcmA eoirons-rnom now: Kerry Kettenbach, poetry co-editor. BACK Row: Cindy Tarblll, secre- 0' SP Clic' essay co-editor, Jamie Davidson, short story co-edi- tary, Jean Bingham, art co-editor, Karen Marks, tor, Windy Marshall, art co-editor, Mina Gerall, poetry co-editor, Jane Cheney, short story co-editor. Three Programs Broadened Student Interest Scope was an organization that dealt with topics of interest to the student body. A typical meeting usually included a speaker who was well versed on the topic of discussion. The purpose of the organization was to broaden student interest in areas of great concern or mere curiosity. Meetings were irregular, depending on availability of speakers. Tucson papers, the Daily Star and Citizen, offered advanced students of iournalism additional opportunity to write in the section of the newspapers reserved for teen events and honors. Most high schools in District One had iournalism students participate in this program. Certain days of the week were set aside for the reporters to enter their articles for publication. Responsibility of deciding on speakers for Senior Forum and contacting them to arrange a convenient time fell on the shoulders of the Coordinating Commit- tee. Special guests included former Sena- tor Barry Goldwater and foreign diplo- mat Curtis Kamman. 'QM , SCOPE OFFICERS-Cai Klassen, president, Davidson, secretary. Jamie Governor Jack Williams was greeted by Vicki Gar- land before he spoke at the Senior Forum in No- vember. SENIOR FORUM COORDINATING COMMITTEE-FRONT ROW: Barbara Carr, Patty Bryers, Linda Billings. BACK ROW: Kurt Lundstrom, Rich Gilman, David Carter, chairman. I .3 TEEN NEWSPAPER REPORTERS-FRONT ROW: Don Oppenheim, Arizona Repub lic reporterp Rich Gilman, Arizona Daily Star sports correspondent. SECOND ROW: Peter Trinca, Arizona Daily Star reporterg David Carter, Tucson Daily Citi zen reporter and Tucson Daily Citizen sports correspondent. Girls' League Sponsored Sweetheart Safari GIRLS' LEAGUE OFFICERS AND COUNCIL-FRONT bell, Sue Laughlin, Fanny Campbell, Cai Klassen, ROW: Karyn Kingston, president, Pam Morris, vice- Jeanne Brownlee. BACK ROW: Chris Kelch, Chris president, Karen Kelch, secretary, Mindi Ligner, Santi, Rose Sepulveda, Cyndi Button. treasurer. SECOND ROW: Anna Zoback, Nan Camp- Every girl in school was a member of Girls' League. Service To The school was The organizaTion's main goal. Several projects were compleTed during The year. Girls' League sponsored The firsT all- girl assembly. OTher acTiviTies included a FaTher-DaughTer BanqueT, The TirsT school mixer and a MoTher-DaughTer DesserT. SweeThearT Safari Week was The main evenT sponsored by Girls' League. Dur- ing This week, social sTandards were re- versed, and The girls asked The boys ouT. As a special service proie-cT Girls' League m e m b e r s made ChrisTmas presenTs To give To people aT Devon Nursing Home. The organizafion was re- sponsible for insTalling Tull-lengTh mir- rors in The girls' resT rooms. Girls' League also awarded a scholarship To a girl needing financial assistance. r , H,i.sw-wire, GIRLS' LEAGUE ADVISORS-Miss Mary Trachta, advisor, Mrs. Emily Cox, spon- sor, Miss Priscilla Drum, advisor. With the aid of Mrs. Corcoran, yoga was demonstrated at the January 8 meet- ing of Girls' League. The club often included guest speakers in its meetings. Donna Celenza, Bruce Cramer and Ed Seright rode on the Red Cross float in the Veterans' Day Parade. RED CROSS REPRESENTATIVES-FRONT ROW: Eliza- Virginia Rdm0S, PONY Duke, PM Wells' MVS- Ul'-1 beth Reyna, Shelby Guess, Helen Seright, Wendy Mae Davenport, advisor. BACK ROW: Jim Hawk Greene, Linda Kopman, Sarah Chiasson. SECOND Mike Long, Mary Mixon, Mike Ancharski, Errol Berk ROW: Lin Houghton, Hope Miller, Steve Wright, Communit Projects Sponsored by Red Cross Forty active members, picked from their homerooms, made up the Red Cross. Interested students participated in club ac- tivities for four years. Anyone was welcome to attend the meetings. Officers for the club included a president, vice- president, secretary and treasurer. Red Cross took second place in club floats at homecoming. The same float was entered in the Veterans' Day Parade and received a certificate of recognition from the American Legion. On November 16, Palo Verde's chapter of the Red Cross gave a party for pre-schoolers at Our Community Cen- ter. The organization was established to improve neighbor- hood conditions. A professional Santa Claus was at the party to entertain the children. Gifts were bought for the school with Red Cross funds totaling approximately 350. On Decem- ber 20, the Red Cross gave a ward party for patients at Davis- Monthan Air Force Base. Members made cookies and home- making students donated nylon bags containing useful items to the patients. Other plans for the Red Cross were school chests. These chests were made up by the shop classes and sent to new schools in foreign countries. They carried globes, dictionaries, scissors, chalk, paper, pencils, a yearbook and the name and 'address of the Red Cross. The club also planned to visit various nursing homes around the city to sing and entertain the resi- dents. A speaker was scheduled to speak on overseas Red Cross Clubs in the spring. RED CROSS OFFICERS-FRONT ROW: Jim Reyna, vice-president, Helen Seright president. BACK ROW: Liz Reyna, treasurer, Mrs. Ula Mae Davenport, advisor, Hope Miller, secretary. Members of FTA enioyed having refreshments to- punch in hand, they discussed various techniques of gether after a regular meeting. With cookies and teaching learned through articles and speakers. FHA members helped to entertain multiple sclerosis patients at a small party sponsored by the club and held in the basement of Wards Department Store. Future Homemakers of America was a national organization formed to help in- dividuals improve personal, family and community living. As a service to the school, the club made the Titan costume. One of the proiects sponsored by FHA was Good Health, A Valuable Asset. A film was shown to create interest in the problem of malnutrition and 5127 was collected for UNICEF. Other activities included a leadership conference held at PV, a Christmas party for the benefit of multiple sclerosis and a family picnic at the end of the year. Future Teachers of America gave stu- dents an opportunity to obtain informa- tion concerning the teaching pro- fession. FTA members learned the quali- ties, traits and aptitudes necessary for f successful teaching. At the beginning of the year, FTA of- ficers attended a workshop, and in April the state FTA convention was held. Before Homecoming, Fl'A members put finishing touches on a huge cardboard book. They dressed in children's clothes and carried the book in the parade. is we z f F F' 1 Q s . 2 1 fs J gf? X mtg .W it Q, fr T Needed Skills, Experiences Obtained Through FHA, FTA FUTURE TEACHERS OF AMERICA OFFICERS-FRONT ROW: Nancy Smith, histor- ian, Colleen Johnston, president, Barbara Dickinson, secretary. BACK ROW: Members of F1-A eheeked shoes in fo, 'en eems G pei, before q dance. The Bruce Greenberg, treasurer, Ken Freehill, vice-president, Babs Vetterlein, pub- money went to the organization that volunteered their services for the evening. HCHY Chairman- FUTURE HOMEMAKERS OF AMERICA OFFICERS- treasurer, Diane Yaskanish, chairman of public re- FRONT ROW: Debbie Gibel, vice-president, Miss lations, Cindy Roth, chairman of degrees, Pam Barbara Whitaker, advisor, Sue Wells, president, Wagner, historian. Jan Spray, secretary. BACK ROW: Meta Morris, FUTURE TEACHERS OF AMERICA ADVISORS-Miss Claire Hawn, Mr. John Rascob. Educational Tapes Prepared by Speakeasys Members of Speakeasys made gold and blue flow- reeds wenl in The club's Treasury To aid Traveling ers To sell during Spiril Week, January 'l5-19. Pro- expenses for a speech meet in El Paso on Feb. 24. Speakeasys was The new name for The Tifan Forensics Service League. The purpose of Speakeasys was To raise money in order To supporT Their many acTiviTies. There were no officers in Speakeasys, bUT insTead, Three commiTTees headed The club. These were The general busi- ness, finance and preparaTion of Tapes commiTTees. TransporTaTion and accommodaTions To and from speech and debaTe meeTs were provided for by The Speakeasys. ln order To promoTe beTTer undersTand- ing and appreciaTion of fine liTeraTure, Speakeasys prepared audio Tapes, au- dio-video Tapes and reader's TheaTers for English, American problems and American hisTory classes. Awards were presenTed To Those who Took parT in forensic TournamenTs and school drama producfions by The club. STeps were Taken To acquire leTTers of recogniTion for parTicipanTs in These Two divisions. it Z-jg jijgg: - f Mm - x,ggg.-.--gljwfy Q Dvuaeglg Speakeasy members Toured Palm's Morluary To raise money for a Trip To El Paso for The speech Team. Speakeasy members Ginny Spencer and Andrea Veals pracliced a drama for a coming speech meeT. Members of the Titan Litewriters observed entries in the annual Spring Contest. All photography students were eligible to enter the club-sponsored event. Martin, secretary. Stage Crew, Litewriters Qperated Equipment Stage Crew took care of lights, sound, stage props and curtains for all school productions and assemblies held in the auditorium. Members were trained by the more advanced students of the club at meet- ings and work sessions. Seniors usually taught the correct the younger stage help was chosen vanced and active Nicholas Baldwin group. Litewriters was use of equipment to crew members. Stage from the more ad- ones in the club. Mr. was advisor of the organized to further students' knowledge of photography. Those in advanced photography class- es and photo publications were eligible to ioin the club. Guest speakers often spoke at regular meetings and the Litewriters had oppor- tunities to visit a movie processing plant and Hollis Photo Engravers. Club members took colored pictures at both senior and junior proms. The Litewriters also entered state and na- tional photography contests during February. STAGECREW..-FRONT ROW, Ed Sefighf, Carl Sghnei mons Scott Patterson Dale Stenbakken Frank Arai der, Jeff Mague, Alan Shapiro, Art Goldberg, Jess IG Norm 5l10llIl Sotomayor. BACK ROW: Mike Mulvena, Chuck Sim TITAN LITEWRITER OFFICERS Bill Quimby sergeant at arms Mr Leonard Chedsey, advisory Sue Allen president Leason Kmgton vice president Kathy DECA Gffered Experience in Job Training DECA OFFICERS-FRONT ROW: Judy Scalise, secre- tary, Colleen Cate, class reporter, Sandy Guard, class vice-president, Janice Holbert, class reporter. BACK ROW: Nancy Sparkman, class vice-president, Mike Lowther rearranged a bookshelf at Save-Co. found employment through the Distributive Education Audrey Wilkinson, historian, Mike Machen, class vice-president, Patsy Conkling, class vice-president, Charlene Smith, class recorder. He and other students Club of America program. Ss Distributive Education Clubs of Ameri- ca strove to develop future leaders for marketing and distribution. DECA pro- moted an understanding and apprecia- tion for the responsibilities of citizen- ship in the free, competitive enterprise system of the United States. Students submitted an application and were interviewed before being ac- cepted into a distributive education class. A cooperative education class was offered to seniors. This class, offered on the morning session, allowed students to be involved with on-the-job training in the afternoon. Marketing was the prerequisite for the co-op classes. lt instructed students on basic business principals and included directions on how to be a polite and helpful salesman. During National DECA Week, Novem- ber 5-ii, the purpose of the club was publicized. Money was raised by spon- soring car-washes and through the sale of calendars. Q . x' Nanci Sparkmen inspected a dress at Steinfeld's department store for possible construction flaws in the garment. Nanci received the iob through DECA. Dennis Sneath, president of Titan Service League, assisted Mrs. Bruner, the TITAN SERVICE LEAGUE OFFICERS-Cathy Chandler, vice-president, Dennis organization's advisor. Members served teachers both before and after school. Sneath, president, Susan Markle, secretary-treasurer. Students Received Varied Job E perience Cooperative Office Education was a program designed to acquaint students with the business world. Classroom ex- perience in the morning and on-the-iob experience after school were offered in the course. Seniors who were at least sixteen and had taken two or more years of business education were eligible to apply. Ac- ceptance was based on clerical tests, interviews and approval of the coordi- nator. Students spent two or three days a week in class participating in group training. The remainder of the week members worked in a class model of- fice. Students received grades from their employer and their advisor, Miss Wanda Walker. Titan Service League included stu- dents from all classes who assisted teachers with school work, enabling them to spend more time with their 4 classes. This was done on the students' own free time both before and during study hall. Members served as hall - - - COOPERATIVE OFFICE EDUCATION-FRONT ROW: Klastow, Terry MacPherson, Anita Quinn. BACK momlors' Typlsts and 'Gb GSSIS1-amps' Shirley Dickens, Kathy Petersen, Vickie Vogler, ROW: Shirley Harbison, Patti Tegtmeyer, Kathi Kel- Patty Kiser. SECOND ROW: Walter Young, Sharon ly, Carol Hansen, Stephanie Gannon, Laura Pascoe. Russian Club Promoted Cultural Participation Each weekly meeting of the Russian Club was devoted to a different aspect ot the Russian language. Advanced and beginning students of Russian attended the meetings. Students practiced various l K songs, danced and played games. They nw also made typical Russian costumes and food from the country. A variety of , speakers were invited to speak and W ,X c - show tilms to the Russian students. Several projects were planned by the club tor the school year. One ofthe more outstanding activities was the presenta- tion of a program tor iunior high school students on the Russian language and culture. as 'wvi' Otticers of the club were president RUSSIAN ci.uB orricens-Kun Lunasirom, presi- Nqbb, advisor KL-'fi LUWSTVOYT' and SSCVQTUVYWGUSUVEV dentp Christie Tarbill, secretaryy Mr. Richard Mc- Christie Tqrbilli f I-urn?-uv..fi.W,Er 5 ,Q T , -0'--ci,.i...,mM M yt'. .E-t TWU members of the RU.55.lUU Cl'-lb Plfltfed the 50 -llclkaias Others 5009- Af' meeting as did students clothed in the cult of that country. Singing typical Instrument of Russian origin, the balalcuka added a special effect to the club Russian songs gave club members practice in speaking the foreign language, N AFS EXECUTIVE COUNCIL-FRONT Row: Mrs. JOY BACK ROW: Sue Markle, Jim Sakin, president, Steve Chapman, advisor, Cheryl Zoback, Janie Taylor, Lopez, Jim Buck, Randy Sammons. Sarah Chiasson, secretary, Mr. Milton Agte, advisor. . ..,.. .ra 'fl - .QQ :f i Fico Rodriguez and AFS members counted pennies that were collected by classes during Spirit Week. AFS, Human Relations Achieved Hi h Goals American Field Service was the or- ganization responsible for bringing for- eign exchange students to the United States. During AFS week in November an assembly took place at which ex- change students talked about customs in their countries. AFS Friendship bonds were sold during this week. At Christmas time, American Field Service members sold Christmas cards, and during Spirit Week in January, a trophy was given to the class contributing the most money in the AFS Miles of Pennies contest. Mr. Agte and Mrs. Chapman were the advisors ot AFS. The obiective of the club was to promote understanding and friendship throughout the world. Promoting interest and understanding of human relations and social problems was the main goal of Human Relations Club. Guest speakers often attended the meetings where social problems were discussed and films shown, such as one on preiudice. The main event ot the year was a trip to Phoenix, during which club members attended the West High Fellowship Conference. Human Relations Club advisors were Mrs. Powclrill and Miss Baral. Mr. Haynes, from the National Association for the man Relations Club. Bob Fabel raised a question Advancement of Colored People, spoke to the Hu- concerning functions of the NAACP. Quadrille Team, Ski and Gun Club Developed Members of Ski Club used the rope pull to ascend the slopes of Mount Lemmon. Foggy weather did not prevent club members from enioying this winter sport. n e e r Vs: A , W Z . - ., 1 I in ,.. - . V l M,,,.,s4wf Plentiful snowfall atop Mount Lemmon during the winter months furnished Ski Club members with ample opportunities to try their skills. Movies of famous, world reknowned ski re- sorts were shown at club meetings and provided members with inspiration to participate in inter-school ski meets. Com- petition with other schools was one of the highlights of the Ski Club. Equipment was paid for through various fund rais- ing proiects initiated throughout the year. Mr. Silverburg ad- vised the Ski Club members in planning annual activities. Quadrille Team was the first organization of its kind in Dis- trict One. Approximately ten girls with interest in horsemanship formed the club. Mr. Diehl acted as their advisor. No experi- ence was necessary for ioining and practices were held every Saturday for two hours at Pantano Stables. A standard uni- form was decided on and was worn while performing in shows exhibiting riding techniques. The only requirement for the girls was the ownership of their own horses. Gun Club was an affiliate of the National Rifle Association. Movies on wild life and conservation were often included on the program of monthly meetings. Dues were two dollars a year and provided the club with guns and ammunition. Prac- tices were held at Tucson Rod and Gun Club, Sabino Canyon and the University ROTC range. Various marksman ratings were awarded to participants who showed special skill in rifle shooting. lung At o monthly practice, Gun Club treasurer Charles Collins and president Tom Dietzmon demonstrated correct positions which led to better marksmonship. Greater Skills Through Continuous Practice ,V is ,,,k L F, . Q, sf All ,,.V . ' A' wr' , lj r, my A it t i,,, iff? ' T 'Q,'V1 Saturday, February 10, proved to be an excellent day for enioying winter sports joined local ski enthusiasts for a day on the slopes. They were able to practice Oh MOUNT l.eh1lTl0tl, f0l' SIIOW fell Cl' d mdXll11Uh'l in The CTBC. Ski Club l11eI'l1beI'S new techniques fhey had learned and wgrk on individual diffigulfigg, QUADRILLE TEAM OFFICERS-Sherrell Curtis, Vice- president, presidentg Claudia Park, secretaryg Nancy Rau, Good horsemanship with synchronized movements Team. Their first public showing was held on the was demonstrated by members of the Quadrille exhibition field at Pantano Riding Stables Dec. 16. hess Club Promoted lnterest,Competition CHESS CLUB OFFICERS-Mark Freehill, president: McBride, advisory Peter Simpson, vice-president. Steve Bernhardt, secretary-treasurerg Mr. William Chess Club members practiced twice a month for their tournaments. The 25 ac- tive members of the club elected Mark Freehill as president, Peter Simpson as vice-president and Steve Bernhardt as secretary-treasurer. A state high school chess tournament was held January 27 and February TO. Each student played six rounds. Eight members ot' Palo Verde's Chess Club participated in the state-wide tourna- ment, earning iOth place. Several other tournaments were planned by the club with other city high schools. One ot the competitions planned was with Buena High School from Sierra Vista in the spring. The high schools also planned a city-wide tournament in which tour players were selected by each school. This tournament also took place during the late spring. The students in Chess Club established a pyramid rank- ing system tor the regular members. Advisor Mr. Richard Sommertield stressed that the main purpose ot the club was to promote interest and to pro- vide continuous competition for the game. i i at Chess Club members Joe Bentz and Mark Freehill discussed a move with Mr. Sommerfield. The felt chessboard was useful in demonstrating methods of play. Junior Brad Thrush concentrated on a difficult move in chess. Club members played with other students to further develop methods of defeating opponents. Math, Science Math Club was designed for students with mathematical interests. Meetings were held twice a month at which in- vited speakers discussed astronomy, mathematics, engineering and com- puters. Field trips to the UA and to com- puter labs were among other activities planned by club members. Frank Martiniak, Richard Poppen and Steve Weber participated in the inter- national help session tor state exams in which they prepared exams to aid other students in studying for national math contests. Steve also served as repre- sentative to other high school math clubs. Mrs. Violet Weeks advised the club. Science Club gave students with sci- entific interests an additional chance to express their abilities. Advisors Mr. Rat- clitt and Mr. Holliday invited guest speakers from Davis Monthan, Kitt Peak, the UA and Bell Telephone to speak at the club's bi-monthly meetings. Guests discussed their respective topics and often showed accompanying films. All club members participated in the local school science tair, which they sponsored. 2 2 ' 3 . i l ,gr ag: fill? 1, lin! f i ix Steve Kvtvrvffr Rifk Kina end Steve Weber worked with bvmjns magnesium- MATH CLUB OFFICERS-Frank Menrnrek vrre president Rreherd Poppen pres A5 membefs of Sfleme Club HWY were eXPeCfed to Pa C'P'-'le In Such Protects. identg Marion Kiper, secretary Mrs Violet Weeks advisor Steven Weber representative to city wide math clubs Clubs Hosted Guest Speakers SCIENCE Cl-UB OFFICERS-5fePhen Cosfelr Pl'09l'0m lntosh president Sharon Sladek vice president chairman, Mr. Arthur Ratcliff, advisory Malcolm Mc- , W-,512 Lift- ir, 5 if E Q5 qxgg 7 5 ...s ii ,T ?.-Z, Art Club was organized for students interested in art and design. Members Will Goodman and Ray DeNogean made silk screen prints at a meeting. Stage Band, rt Club Through lecTures and field Trips ArT Club members were able To broaden Their awareness of arT acTiviTies wiThin The ciTy, One of The ways in which The club served The school was by making posTers for oTher organizaTions adverTising coming evenTs. IT also gave sTudenTs wiTh similar arTisTic abiliTies an opporTuniTy To work TogeTher. ln January, ArT Club members spenT a weekend aT MT. Lem- mon To skeTch The scenery. An arT aucTion was held in April enabling sTudenTs To sell many of Their own proiecTs. The aucTion was organized To raise money for a Trip To Phoenix lafer in The year. STage Band meT weekly for Two hours and was open To any inTeresTed sTudenT. AlThough anyone wiTh sufficienf inTer- esT could ioin, The band was composed primarily of advanced band members. Members of STage Band were acquainTed wiTh differenT Types of popular music, Thus preparing Them for performances wiTh professional organizations. AcTiviTies in which The club parTicipaTed included iunior high school assemblies, The fesfival aT The Universify of Arizona and performances for organizaTions such as The Golden Age Club. The maior evenT for Sfage Band was Their annual per- formance in The Senior Show. They performed as a piT band by accompanying The acTs. ART CLUB OFFICERS-Mike Rich, chairman, Mrs. Lailita Bratt, advisor. Artistic Art Club members made sketches of the school and its surrounding scenery from the desert. Wh . Q, eveloped Instrumental and rtistic Abilitie STAGE BAND-FRONT ROW: Bruce Tost, Errol Berk, Lisa Malik, Chuck Eger, Weidler, April Antonetti, Rod Campbell, Bryce Bradley, David Dugdale. BACK Mike Kuhn, Tom Folks, Mr. William Richardson, director. SECOND ROW: Jack ROW! Rollah A5'0l'l, Bill Wflrden, Dave Cole, David Ashcraft. ,A 4-, -1, Stage Band members rehearsed many hours prior to their concerts. Jack Weid- ler, xylophonist, worked on a number to prepare for an upcoming performance. If , fx ms N L we Rfbvw. Q ' wa- 2Xe'llliS7? - 159.5 , , ,-5, K -ff' ,1 . J -- . qgw 'Q KL if R ,, 3,85 ,-,L ,. . V' M- . wzf1.Zii5',.?'7 r K ' si. M W A W., -sm , V W N ff? .ifev qf ,Z x fig igifiggrkl ,N , ff ' ' fwsflfe 'i 5-if 5? tt 5 t t mh .,, W,.l, , V 2: W M5 ii Q A X +9 5 ,Jw 'V 1' + 3 ,K AS A' f at ,f:fL+1if,:. nw ,.' M-. W t kv :feivf . .:, . 4 .... , to it Sports Victories that are easy are cheap. Those only are worth havingtwhich come as the result of hard fighting. -H. W. Bucher Mm Wgwwm WW State Champ, Tucson, Fell to Titans 7- Titan fullback Mark Arneson managed to trip up an onrushing Sunnyside ball carrier in the Oct. home game. The Titans defeated the Blue Devils 14-9. Titan defensive halfback Roy Dwiggins 1231 attempted to catch an Alhambra ball carrier during the Homecoming game. Palo Verde defeated the Lions 14-7. VARSITY FOOTBALL TEAM-FRONT ROW: Mgr. John Brugrnan, Jeff Lovin, Bill Barker, Joe Flores, John Vucasovich, Larry Espinola, Roy Dwiggins, Mark Arne- son, Carl Riney, Harry Lodge, Scott Davis, Tom Stoops, Ted Phillips. SECOND ROW: Mgr. Alan Shapiro, Kevin Reis, Pepper Smith, Craig Ludtke, Jerry Stump, Defending State Champion Tucson High School was held to just 80 yards total offense as the Titans defeated the inex- perienced Badgers 7-O. The Titans gained control early, tak- ing the opening kickoff and driving 68 yards in ten plays for the only score. Halfback Harry Lodge crashed over from the six-yard line with Larry Espinola adding the extra point to close the scoring with less than five minutes remaining in the first quarter. Lodge, a senior, gained TOO yards on 21 carries while fullback Mark Arneson picked up 53 yards on T2 carries. A highly rated Pueblo team came back from a 7-6 deficit to upend the Titans T3-7. Palo Verde got their only touchdown on a Pueblo fumble that was recovered in the end zone by Jim Arneson. Pepper Smith converted to put the gridders ahead 7-6. Pueblo came back in the second half with a 75-yard touchdown pass to put them in the lead once more. The Titans threatened to score again when Steve Gunzel intercepted a pass on the Warriors' 30-yard line and ran it back to the eight. Pueblo's defense held and spoiled the Titans' hopes for victory. Fullback Mark Arneson scored twice and gained T52 yards as the Titans defeated Amphi 27-7. Arneson, a senior, was on the receiving end of a T4-yard scoring pass from quarterback Jeff Lovin in the first quarter and ran 25 yards for the Titans' second touchdown in the last half. Halfback Harry Lodge and Lovin scored on one-yard plunges to put the game out of the Panthers' reach in the fourth quarter. The Titans racked up T4 first downs and 241 yards total offense during the game as compared to the Panthers' 6 first downs and T08 yards. 4' O O Earl Vlctorles Brlghtened Season Hopes . A A Q 3. Jim Arr1eS0l1, Clerk Cdnrisht. Mark Cdnrishf, Bob Suarez, DUN Harrell, Dave Thompson, Bob Vucasovich, Bob Bolt, Bob Schock, Rick Heinz, Dave Droege YO'-H191 Ed N0rdftUlSl, ClUY TUYl0rf Rod Drake, Mer- Fred Swiderski- BACK ROW: meier, Tim Walsh, Roger Townsend, Steve Gunzel, Mgr. Kelly Knop, Mgr. Tom Mgr. Walt Bailey, Mgr. Don Ranne, Frank Stagg, Bill Orinski, Jeff Bailey, Jim Weber, Mgr, Mark Best, Mgr, Steve Wright, Alhambra, the number one team in the State, was stunned i4-7 before an enthusiastic Homecoming crowd of 7,000. The Titans dominated play from the early moments of the first quarter, moving 80 yards in ten plays to establish a 7-O lead when quarterback Jeff Lovin scored from the one-yard line and Larry Espinola added the extra point. Junior Tom Stoops, playing standout defense, recovered a Lions' fumble in the end zone for the second score. Alhambra's only score came with l5 seconds left in the first half when they completed a 22-yard touchdown pass. Outplaying the Titans defensively, Salpointe toppled the gridders l-4-O in the B League opener for both teams. The Lancers, recognized as one of the top teams in the State, block- ed Titan Scott Davis's punt and recovered the ball in the end zone for their first touchdown. Capitalizing on a Titan fumble at mid-field, Salpointe moved in for their second score of the game. Palo Verde's only serious threat came late in the fourth quarter with Jeff Lovin and Harry Lodge leading the attack, but the drive was hampered by penalties. Seniors Jeff Lovin and Harry Lodge accounted for all but 27 yards of Palo Verde's total offense as the Douglas Bulldogs fell 35-27 on the Titans' field. Coming back from a i3-O de- ficit in the first quarter, Lovin completed a 34-yard scoring pass to senior end Ted Phillips and Lodge ran for 41 and 6-yard scoring iaunts as the Titans took a slim halftime lead. Douglas came back with a touchdown on an 85-yard run, but senior Mark Arneson scored twice, on a 15-yard pass and a one-yard plunge to clinch the victory. Titan quarterback Jeff Lovin iumped to avoid oncoming Alhambra players in the Oct. 6 home game. His efforts were to no avail as the pass was blocked Varsity Gridders Finish Season With I4- Reserve halfback Roy Dwiggins came off The bench To score on a 30-yard Touchdown run as The TiTans dumped Sunnyside 14-9. Palo Verde opened The scoring on Their firsT series of downs, marching 50 yards in 8 plays before Jeff Lovin hiT Mark Arneson for an 8-yard Touchdown. The Blue Devils came back wiTh a field goal and a Touchdown before Dwiggins cuT loose on his run. ln The fourTh quarfer, Dwiggins inTercepTed a Sunnyside pass inside The TiTan 25-yard line To insure vicTory for The TiTans. ln Their final league game of The season, The Titans fell To The Catalina Troians 14-13, ending any chance for a league TiTle. WiTh a lead of 13-7 in The final 90 seconds, Coach Howe elecTed Mark Arneson To run up The middle raTher Than punT on The fourTh and one siTuaTion. The gamble failed, however, and Cafalina prompfly scored The winning Touchdown on a 30-yard pass play. The TiTans' scores came in The final Two quarTers wiTh Lodge running for 8 yards and Lovin going in from The 40, ln The final game of The season, The TiTans dropped winless Rincon 14-7. The vicTory was The sixTh for The firsT winning fooTball Team Palo Verde has had. The Rangers opened The scoring in The second period wiTh a one-yard Touchdown plunge To cap a 71-yard drive. Palo Verde came back To Tie The score as Jeff Lovin ran around lefT end for a 10-yard Touch- down. ScoTT Davis inTercepTed a Ranger pass in The Third period To seT up Mark Arneson's winning score as he drove over from The Two. During The firsT game of The season againsT Tucson High on SepTember 15, TiTan ball carrier Harry Lodge l32l Took The ball inTo The end zone and scored QuarTerback Jeff Lovin broke Through The Douglas line for a long gainer ThaT Coaches: Dick Palm, Van Howe, head, Lynn Kanouse. helped seT up a TiTan score in Their 35-27 vicTory over The Bulldogs. ik, Qagfi S4 3 fi, 'l ,Aw sw ' V , my fuss ,1 ' gf-,ziria A 1 2.25: , . V -fx H A few 1 wi? H R Q is Qu S 21 Q., X 5 X sr Q ' 'S , , wif f .EE,,.. .,.... Q Q 5 , Y K A T X S . W jf bsianii s defe 5 p S - Qi Bi fam: , 4 My fs! 1 iff? Af L JV Football Season Ended With 5-3 Record JV quarterback Jack Gardner raced around left end in an attempt to score against Pueblo. The drive fell short, but the Titans whipped the Warriors 38-0. Under the direction of coaches Rollin Cook and Don Holley, the junior varsity football squad ended its season with a record of five wins and three losses. The coaches looked for particular athletic abilities in each individual so the boys could be developed as future varsity players at Palo Verde. A very good attitude was shown on the part of the boys and every- day a great deal of effort was put forth on the field. Out- standing members of the iunior varsity squad included Dave Britton, Rick Davis, Roger King, Steve Knox, Bill Ramos, Rene Ruiz, Mike Rice and Jack Gardner. - ,- .-,. off - - .-- - .-c. 5, f ',z's r 7'1 r if- - .. --f n ig' Q-sg .-,, A U , 51, e f f . 'Q ., . - - f'-we - Ke: , . s ..,. , , .,,. , y , .. .-.W .,,, .e ., .. . i.cs.ki,,,.,Z5g .. F' ' V 'M' A 'i1fQ.gf'fl.f. Q,ff'l2'f'7X-ff'fi, . - f , HT H , Q ,..,. iJ, ,T,H,,,A,,. .,'1 as A wir 5 W ,Q .5 1 5. ,A . ,W Fwy ri YHQV- - 1 .T .,,. M 1 . L' s ' .s , 2' Ls. ,fxsgw re ,rf f of ej gei fgfi ,H c.c.,?.,..,.,,::,. ei-3 ,,gf:,f,9 . , 3- :-':'.:,,wf:.e T , if-1 . s, . so tr, J , as ... ... , Q, if K gig,-r l f rf K ,!f s -r- ' r- :Lf ,, N 27? c1,fQ, 'f . ,ref-I , . tvs 1 s. 1 4 9' - if rj' '1- - , M. .3 y,- . , ,-i .., s, . ,sf V ,e.,,4M-5? ,,,. .9 .J - r Q F R ii' '- - e. Q,:'. .L I E M Q 2 egg, . -r oY1f v-f'1t-iii' - M 'Y-if' -' V ,. ,.II?. .f',,. V Ei'3Q. .4-rise. WM' f'f 1-E ': ' f i ,1- ,., M. swfssw fe . ,. , We . ,,.. ka . V f ,iw .I ' 'wwf 1 J A -W ' Q - A - - . 1 . . , . W, .c W , .,.... . . . 1 ,,,, , ,, :fi 'tffim J -E, f . 7' Driving hard toward the goal line, Roger King 1381 attempted a touchdown during the JV game against Salpointe as the Titans defeated the Lancers 43-6. Junior Varsity Coaches-Rollin Cook, Head, John Duran. Freshman Coaches-Don Holley, Head, Larry Weimer. JUNIOR VARSITY FOOTBALL TEAM-FRONT ROW: Bruce Heller, Darrell Biester- field, Carl Lopez, Steve Hall, Bob Wright, Rene Ruiz, Roger King, Dave Britton, Bill Casey, Stanley Schmidt, Bryan Bowman, Bill Ramos. SECOND ROW: Larry Leggett, Bill Farley, Jack Gardner, Steve Casey, Rick Davis, Robert Epstein, Stanley Schmidt, Steve Knox, Denny Hitchiner, Pete Manns, Cliff Alexander, Mike Goosherst, Gary Harrell, Robert Fitzgerald. BACK ROW: Rusty Spillers, Mike Rice, Dave Curto, Steve Flint, Mike Toland, Mike Bradley, Lance Mottley, Tim Brown, Gilbert Cancio, Bill Johnson, Steve Jennings, Mike Brown, Carl Gaidorus, Bob Matternack. FRESHMAN FOOTBALL TEAM-FRONT ROW: Mgr. Barry Gerber, Mgr. Kim Var- vir, Steve Lopez, Bob Kuhn, Mike Addy, Randy Sillik, Don Kwart, Dennis Thom- as, Bill Biggs, Tim Santeyan, Randy McNeal, Bob Phanton, Steve Fila, Mark Kelly, Mgr. Gary Lombardo. SECOND ROW: Mgr. Mike Cossel, Mgr. Kevin Kelly, Jerry Bridgeman, Mike Smith, Pat Cereponya, Rob McCann, Mike Reeser, Jim Buck, John Locognina, Scott Lewis, Henry Acevedo, Jerry Maldonado, Ralph Marble, Rick Vanderford, Greg Mills, Stan Dietzman, Mgr. Doug Hitchner. BACK ROW: Mgr. Dick Payne, Altie Labor, Mike Young, Kim Conwell, Fred Fox, Fred Pascoe, Steve Ginthum, John Olvey, Roland Youngling, Bud Droegemeier, George Whitaker, Tony Lopez, Bob Trower, Ken Romero, John Trausch, Tom Tatum, Bob Ancharski, Troy Reimer, Mgr. Dave Sternfeld, Mgr. Burce Johanning- meier, Mgr. Mike Myers. inning Season Posted b Frosh Gridders Learning The fundamenTals of blocking, Tackling and run- ning was The main obiecTive of The freshman fooTball Team as They began preparing for compeTiTion in laTe AugusT. The Team, coached by Don Holley and Larry Weimer, accomplished These objecTives as They came Through with a winning record of five wins and Three losses. Palo Verde ended its season with a defeaT aT The hands of The Rincon Rangers in Their final game of The season. Looking forward To possible posifions on The varsiTy nexT year were Rick Ranne, Rob McCann, Bud Droegemier and Troy Reimer. An unidentified frosh Titan attempted to recover a fumble during the home game against Tucson High on October 7. The Badgers defeated the Titans. tm' A emma.. M. .Q-....M es.: sb if , B 5 K .: ' - '- M.. f ' , K , . , efrrzggi, r ,, - ,, , W- 1 Mer- , ,3 A' A . ,L 0 .5 fs-wykriy, ,xi Y, 'nf' L Q0 ' we ' xr? si' t f f ,A ml 'T' at ,fryw M352 1 V ' ., ., T fssmg, Y 3 .ei Q9 X ,,,e , , ,L Y, f' 'L evr 1Le,g,e-L T as 'if'Mt- A if T - 2 W T'-'ke , ,cf,c.y E ,, spy? Frosh player Troy Reimer eluded a Douglas defender and headed for the goal in an attempt to score against the Bulldogs. The Titans were defeated I9-0. ' N, ,,j1W , 5 , U, gg 5 Ae 7fA1Lk,f 4,4 ,Vu in ' :am if H H f , Q in m L Q. Q N .AN I . , .- f , A fm A Qi Basketball- I 96 Varsity Basketball Team Completed Successful Season With l3 victories against 9 defeats, the Titan basketball team completed one of its most successful seasons. Compet- ing in the newly developed AA-B league, the Titans won the divisional title with a 5 and l record, defeating Sunnyside and Catalina twice and splitting with Salpointe. The high point of the season was an upset victory over Phoenix Union in the second game of the season. Union went on to win the State Championship for the second consecutive year. Palo Verde swept the Miami Christ- mas Tournament defeating Aio, 67-52, Globe, 84-43, and Superior, 75-55. Joe Babinski and Gerry Brooks were hon- ored by being placed on the All- tourney team. Babinski was named captain. Titans honored by the Star All-City team were Babinski, second team for- ward, Brooks and Steve Gunzel, honor- able mention. In a poll taken by Tucson coaches, Babinski was named to the first team All-City Citizen as forward. Players voted forward Doug Rhodus as most valuable player on the team at the conclusion of the season. Doug, a senior, was also the most accurate free- throw shooter on the team. Babinski set a new Palo Verde record as he averaged nearly T8 points a game. Brooks led the team in rebounding with 209, an aver- age of lO a game. Art Allen led the team in assists with 70 and was also a top defensive player. VARSITY BASKETBALL RECORD Palo Verde Opponents 81 Tucson 84 62 Phoenix Union 60 5'I Amphi 49 80 Douglas 67 65 Rincon 37 54 Pueblo 42 45 Maryvale 49 50 Amphi 43 59 Rincon 68 63 Sunnyside 53 52 Tucson 54 66 Catalina 53 47 Salpointe 49 74 Sunnyside 66 46 Catalina 42 56 Pueblo 59 67 Salpointe 62 65 Douglas 77 159 Gerry Brooks iumped to tip in the ball against a Tucson player as teammate Joe Babinski watched. The Titans were defeated by the Badgers in overtime. Dan Crobbe attempted to make a iump shot against the Catalina Troians in a home court contest on Jan. 27. Joe Babinski got into position for a rebound. Tucson Took Opener, VarsiTy cagers opened The season wiTh a loss To Tucson High, 85-81. Ahead 73-67 in The final minuTes, a sTall was aT- TempTed, buT several sTeals by The Badgers Tied The game aT 73-73. Tucson Then pulled away To a Tour poinT vicTory in The overTime period. Dan Crobbe led The TiTan scoring wiTh 21 poinTs. Joe Babinski sank Two Tree Throws wiTh 34 seconds leTT To upseT defending STaTe Champion Phoenix Union 62-60. Behind aT halfTime, The CoyoTes rallied To Tie The score and in The fourfh quarTer The lead changed hands several Times unTil Babinski scored. Doug Rhodus led The TiTans wiTh 16 poinTs. Scoring The TirsT goal, The TiTans held The lead ThroughouT The game wiTh Amphi To win 51-49. Junior Joe Babinski was The leading scorer for Palo Verde as The TiTans raised Their rec- ord To 2-1. Babinski scored 11 poinTs while senior Doug Rho- dus picked up 9' poinTs. Douglas ouTscored The TiTans in The firsT half buT The TiTans roared back in The second To win 80-67. The Bulldogs led 44-28 aT halfTime buT The TiTans came back afTer The half To ouTscore Douglas 52-23. Joe Babinski led TiTan scorers wiTh 25 while Doug Rhodus conTribuTed 17 poinTs. Steve Gunning iumped for an inside shot in the Palo Verde versus Amphi game. His shooting ability assisted the Titans throughout the season. Titan Cagers Defeated State Champions 62-60 VARSITY BASKETBALL TEAM-FRONT ROW: Tim Walsh, Steve Gunning, Dan Crobbe, Art Allen, Jeff King, Tim Ryan. BACK ROW: Steve Gunzel, Gerry Rincon's Jim Crawford scored 30 of his 42 points in the second half as Rincon defeated the Titans 87-65. Ahead at halftime 41-34, Palo Verde scored only 25 points as compared to the Rangers' 53 in the second half. Joe Baloinski scored 24 and Dan Crobbe finished with i2 to lead the Titan scoring attack. Jim Werner scored half of Palo Verde's 34 points in the first half as he led the Titans to a 54-42 victory over the Pueblo Warriors. Gerry Brooks scored T2 points and iuniors Joe Babin- ski and Dan Crobbe each added 8. Werner, held scoreless in the second half, finished with a game high of i7 points. Even though the score was tied 25-25 at halftime, Phoenix Maryvale was able to build up a winning margin of four points during the second half to defeat the the Titans 49-45. Joe Baloinski was Palo Verde's main source of points in the game. Hitting mostly from the outside, Babinski scored 21 points. COACH John O'DeII Brooks, Doug Rhodus, Joe Babinski, Jim Werner, Tim Walsh, Errol Berk. Titans Doug Rhodus and Gerry Brooks tried to block a scoring attempt by a Pueblo Warrior and get control of the possible rebound in a game Jan. 5. ' ' V'l1SF ' 'i'F3RP NRi1 i'9i 71Q7 'Z' 7 Titans Won Division Race With I3-9 Records Junior Joe Babinski attempted lo make G T2-f00f Rincon Rangers. Getting into position for a possible iump shot in the first basketball contest with the rebgund were Jim Werner and Steve Gunning. Palo Verde took a 14-11 lead the first quarter and went on to defeat Amphi 5O-43. The Titans built up a lead of 19 points and were not threatened until the Panthers pulled within three points with a minute left. A last second free throw in- sured the victory. Gerry Brooks led the Titans with 16 points. ln their second meeting ofthe season, the Titans fell to Rin- con 68-59. With Joe Babinski scoring 19 points and Gerry Brooks controlling the inside, Palo Verde took a 31-28 halftime lead, but in the fourth quarter, the Rangers began using a full court press which enabled them to win the game. Palo Verde opened the Southern Division by defeating con- ference foe Sunnyside. The Titans built a lead of as many as 20 points in the third quarter then coasted to a 63-53 victory. Doug Rhodus scored 19 points to lead the Titans who led by 10 at halftime. Joe Babinski scored 13 and Gerry Brooks 11. Tucson High, led by Ken Ball's 20 points, scored a come- from-behind victory for the second time of the season as they defeated the Titans, 54-52. Joe Babinski was the leading scorer of the game with a total of 22 points. Gerry Brooks was sec- ond for Palo Verde with 10 points. Joe Babinski came within two points of breaking Palo Verde's individual game scoring record as his 31 points led the Titans past Catalina 66-53. Babinski scored 15 points in the second quarter and picked up 11 more in the second half before he fouled out in the fourth quarter. As the ball bounced off the rim, Joe Babinski and Gerry Brooks battled a Panther for the rebound. Doug Rhodus shot a 15-foot iumpshot in the Sunnyside game as Art Allen watched. Successful outside shooting contributed to many Titan victories. Were Defeated b Douglas in Playoff Game Junior Joe Babinski dribbled the ball past a Sunnyside cager as he attempted to drive in for a layup. The Titans defeated the Devils in a double overtime. Palo Verde saw a nine point half Time lead diminish in The fourth quarter as Salpointe upset The Titans 49-47. The Lancer victory came when a field goal was made iust as the final buzzer sounded. The Titans were plagued by a large number of fouls Throughout The game. Joe Babinski scored 19 points. Two overtimes were necessary before The Titans defeated Sunnyside 74-66. ln The first overtime both Teams scored four points. In The second one, a three-point play by center Gerry Brooks put The Titans ahead for good, 67-66. Dan Crobbe had 18 points for Palo Verde. Doug Rhodus scored four straight points in The final minute of play as The Titans defeated Catalina 46-42. Although ahead in The Third period, a hectic fourth quarter had The Teams ex- changing The lead until Rhodus scored. Rhodus led all scorers with 12 points. In Their second meeting of The season, Pueblo defeated The Titans 59-56 aT The Warrior's gym. Pueblo forced The Titans into many mistakes by using a full court press and a Tough zone defense. Dan Crobbe led Palo Verde with 19 points and teammate Joe Babinski had 9. Dan Crobbe led a second half rally as The Titans came from a 35-29 deficit To defeat Salpointe 67-62. The victory avenged Palo Verde's only league loss and clinched The AA-Southern B League Title. Joe Babinski led Titan scoring with 24 points, while Grobbe added 18. Douglas built up a 39-32 halftime lead and Then went on To defeat Palo Verde 77-65. The Titans pulled to within one point in The Third quarter, but six straight points for Douglas put Them in The lead to stay. Joe Babinski led Titan scorers with 17 points while Dan Crobbe had 14. ln the fast-moving game against Tucson High, center Gerry Brooks and an op- ponent fell as they tried to reach the ball. Spills were frequent in the game JUNIOR VARSITY BASKETBALL TEAM1FR0NT ROW: Mgr. Chuck Simmons, John Hurley, Jack Theuret, Carl Lopez, Curt Cannon, Keith Ridgeway, Mgr. Junior Varsity Took F Bob Gutierrez. BACK ROW: Paul Newton, Dan Ferguson, Jon Findley, Rick Heinz, Sam Young, Peter Manns, Barry Schur, Bob Kingston. irst City Championship lt's pretty hard not to have a good season with the caliber of players on this year's iunior varsity basketball team, com- mented Coach Boyd Meyer. Placing first in 4AA Conference, the iunior varsity won i5 out of i6 games. Among the teams defeated were Catalina, Salpointe, Pueblo, Tucson and Sunny- side. Keith Ridgway was top scorer with an average of 15. Barry Schur and Danny Ferguson were next with 12. Rick Heinz led in rebounds with an average of ll per game. This was the iunior varsity's best season yet. J. V. coach Boyd Meyer and his team discussed the strategy they would use during the game. The Titans hoped to improve over last year's record. Rick Heinz out-iumped the Ranger center to tip the ball to his teammates dur- ing the December game in which the iunior varsity was victorious over Rincon. Frosh Cagers Ended Season With I4-4 Record FRESHMAN BASKETBALL TEAM-FRONT ROW: Dave Coulurier, Jim Ferguson, Ralph Mallhews, Ric Ranne, Joe Ballard, Mike Polivchak, Bud Droegmeier, Roland Youngling, Troy Reimer, Barry Gerber. BACK ROW: Sieve Zienlarski, ieiniem. Junior Varsiiy Coach Freshman Coach Mike Gustafson, Dennis Thomas, Ralph Oli, Richard Ranger, Mark Hanshaw, George Whitaker, Scoll Rumel, Rob McCann, David Payne, Mark Olbin, Kevin Kelly. A 14-4 mark was posTed by The P.V. frosh baskeTbal1 Team as They deTeaTed everyone on Their schedule aT IeasT once. Mike Polivchak esTablished a new frosh scoring record aT 211 poinTs. OTher key performers were Bud Droegemeier, Roland Youngling, Joe Ballard, Troy Reimer, Ric Ranne, Ralph MaT- Thews and floor-leader Jim Ferguson. Season's highlighTs in- cluded a pair of hard-foughT vicTories over a sTrong Tucson High squad and a 59-44 Triumph over rival Rincon. Many of This year's Trosh are considered ouTsTanding candidaies for TuTure J.V. and varsiTy clubs. Roland Youngling l421 helped Buddy Droegemeier i501 as he scored for The Tilans in a frosh game which was played on Palo Verde's courfs. Boyd Meyer Lou Hopkins Frosh Tilan Scoll Rumel look a long shot al The basket in hopes lo bring Palo Verde's score up Iwo poinis during a game played in PV's gym. v w xi 4 ,QL 'P as 'nffa vm 8 an - . J Q ,- Q R U... . . AA ' . hx, N, I S54 . - .A . v .. -. . l'l , . Q 1 ,. .Lu Y 4, A . -. . ,.1 A ,it X , A f - ,Q .'.,gS K gwx. Alxdtl 4 Q 7 Ai. Q. A vi LQ V J Q., 3 , 'SHS-as, i, X, ' 4 4- VV' ,Q-fef . 'ffm Q , 2 X Q N sua . v. 4 1 ' . . M! J fr. k ig, Rn if-. . i , :' 8 si ,wk wif S 'W fr S M ,K 5 wg, B 'Pigs ., 2,3 ggi: V? H Ji kg M iqwvgr ' W: W W 3.1, Q 'ix if 4. , f .55 W5 , 'f' .wars W-4'-1-.f' . 'Y I ,YM .'l.,ni g ,KX ,xi tn' ,qw , -1,. K., , un 5'w 'S.7 ,td + r , E xg 1, , .L x. -ff Q.. ..i - . wg, ,uf Q 55- f .2 If 1 x, .5Q A A, '?v.A,',', -, Y in Q3 M, My I . M Q x.Li- Baseball- l 968 Baseballers Began Tough Season At North Phoenix Varsity baseball had several return- ing lettermen to add to the team's over- all experience. Returning pitchers were Dave McNeal, Mike Bingham, Pepper Smith and Jeff Lovin. These pitchers were backed up by iuniors Morris Forrey and Andy Hassler. Catchers for the team included seniors Ted Phillips and Mike Wilner. lnfielders were first basemen John Polaski and Tim Murphy and second basemen were Randy Hirshman and Jack Gardner. Returning letterman Art Allen was shortstop. Tim Walsh played third base while Jerry Carillo served as utility in- fielder. Harry Lodge, Bob Valenzuela and Danny Huggins played outfield. All three were returning lettermen. Other iuniors an the team were Todd Simmons, Keith Ridgeway, Gary Perkins and Bill Bavaro. Coach Wing looked forward to a good season and the divisional tournament. 5 L L A. it s A1 1 is L s COACH James Wing VARSITY BASEBALL SCHEDULE March 9 North Phoenix March 12 RiI1C0n March 15 Pueblo March 'I9 Amphi March 22 DOUBIUS March 23 Wes! Phoenix March 23 Phoenix Union March 26 Rihwh March 29 Pl-l9l9l0 Mg.-ch 30 Phoenix Central April 2 Sunnyside April 5 Tucson April 9 Catalina April to Dovsles April zo Amphi April 23 Salpoinie April 26 Sunnyside April 30 Tucson May 3 Catalina May 10 Salpointe Q 1 Y 1 Returning Lettermen Aided Varsit Baseball T, WW, ,. . , - it . ,,,.,,.,.,.,... , .W .W M , , I , gg. , . , . ..- fti, , gf, 5 he - 2 o f . e iffy ft ' ' 3 9 4 . V . - 3 I g, - A ' f . --- , ' 47? ee,, , A V . 1 . ' . - ' q it ,. A . I K . I-'st'-w g r., V'-sifgfsiisf 'MT vi c H, , .f I ' Y' if ., , .1 ...,,..s. ,K , . :ws , H : -Fife tfefeciwfe- 4-f-fa. 'VFi'.sS'it:.' - . ,M Tw-L ' eff, - Q vw f .:,J....-xml males' 5 L-'fa if .gl 'Q ,, V t . . I , . M nfs-H-ns1f5,6.sQ',,,',wa-.wif r 'f V. .. . ,, , . . John Polaski, second baseman, and Danny Huggins, outfielder for the Palo Verde varsity baseball team, practiced during the afternoon for their game. ei -iw!---h,,.. Art Allen was caught between first and second base by infielders John Polaski and Randy Hirschman as he attempted to steal bases. These seniors were first Varsity baseball fielder, Randy Hirschman, caught the ball during a game. The team trained many hours during the season to strengthen their skills. Seniors Harry Lodge, batter, and Ted Phillips, catcher, prepared for the varsity baseball spring season during a practice game on Palo Verde's diamond. string players. The varsity baseball team was preparing for the first game of the season with North High School which was held on March 9 in Phoenix. ful.. i VARSITY BASEBALL TEAM-FRONT ROW: Jerry Carrillo, Mike Wilner, Art Allen, Dan Huggins, Steve Smith, Keith Ridgeway, Gary Perkins, Todd Sim- mons. SECOND TEAM: Ted Phillips, Tim Walsh, Jack Gardner, Bob Valenzuela, Harry Lodge, Tim Murphy, Jeff Lovin, John Polaski. BACK ROW: Mgr. Dennis Second baseman Randy Hirschman reached for a fly ball over second base. The varsity team played against the Tucson High Badgers on Mar. 12. Marsh, Dave McNeal, Richard Smith, Mike Bingham, Morris Lorrey, Andy Hass- Ier, Bill Bavaro, Randy Hirschman, Mgr. Tom Dietzman, Mgr. Steve Eddy Mgr. John Norine. Dave McNeal, pitcher on the varsity baseball team, demonstrated a wind-up during practice. Style and hard work was important in pitching winning games. I Junior Varsity Team Faced Stiff Competition in Fred Free, iunior varsity baseball player, worked on his fielding during an afternoon practice. The team looked forward to a successful season. A JV second baseman tried to tag a baserunner on an attempted steal from first base. Practice games were played before other school competition was met. JV Titans opened the baseball season with a home game against Rincon. Coach Lynn Kanouse hoped for as successful a season as the previous one in which the JV team made the city championship. Catchers included Dan Couturier, Dan Fer- guson and Dan Long. Marc Richardson, Don Fehr, Whit Weeks, Tom Fitzgerald, Joe Smith and Fred Free were the JV pitchers. Playing infield were Jon Finclley, Dana Wohlers, Rene Ruiz, Bob Clark, Jack Feret, Ken Zobel, Martin Reed and Steve Gil- man. Outfielders were Steve Casey, Bill Casey, Pat Hubble, Dave Elliot, Steve Knox, Carl Lopez, Jett Rein, Rusty Spillers and Tom Paul. Junior Varsity Coach Freshman Coach Lynn Kanouse Ed Baron JUNIOR VARSITY BASEBALL TEAM-FRONT ROW: Ken Zobel, Dan Couturier, Rene Ruiz, Dan Long, Steve Jennings, Jack Theuret, Mgr. Jeff Rein. SECOND ROW: Pat Hubbell, Dun Ferguson, Steve Casey, Tom Paul, Bill Casey, Rusty Spillers, Marty Reid, Mgr. John Splane. BACK ROW: Steve Knox, Whit Weeks, Carl Lopez, Mark Richardson, Joe Estep, Don Fehr, Dana Wohlers, Fred Free. Frosh Baseballers Learned Advanced Skills FROSH BASEBALL TEAM1FRONT ROW: Mike Mullaney, Mike Marsh, Kim Robinson, David Denomy, Steve Vasey, Jim Sealy, Gary Lombardo. SECOND ROW: Mgr. Kim Varvir, Mgr. Bill Lacy, Dan Handt, Ric Ranne, Randy McNeil, Coach of the freshmen basbeall team, Mr. Ed Baron, ex- pected PV to have a strong hitting and defensive team this season. Practice started February 5 and the first game was March 9 against Rincon. Starting line-up was Steve Filia as catcher, pitchers David Payne and Bob Lacy, Ralph Matthews as first baseman, John Lacagnia at second and Doug Eichner at third base. Randy McNiel played at shortstop and fielders were Steve Vassey, Mike Kee and Don Kwart, All players on the freshman baseball team added to the success of the team. A member of the freshman baseball team slid into home base. The team played practice games daily to improve their hitting and defensive skills. Steve Fila, Don Kwart, Mark Olbin, Mgr. Gordon Vernon. BACK ROW: Mgr. Pat Wells, Ken Romero, Ralph Matthews, Bill Biggs, John Lacagnina, Mike Kee, Doug Eichner, Fred Brahms, Mgr. Jim Zimmerman. A freshman baseball team member hit fly balls and grounders to give the defense a work out. The team practiced each morning during baseball season. l P 5 5 - ..smn +s ' , 7 sw-vfwmiw H, 4- r,,3 , .4 A f. .419 . -7: V,,,',, , umm , A ,. x . .. ,-.. Track- I 968 Varsity Trackmen Developed Greater Speed and Skills Under The coachmanship of Mr. Wayne Corder, The Track Team developed inTo a sTrong Team by The end of The sea- son. They aimed Tor Their 1967 record of 8-O-i cmd Divisional Championship award. ln The sprinTs and relay squads, re- Turning leTTermen Carl Riney, Tom SToops, Gary Denomy and Harold Feld- men demonsTraTed Their speed. Fred Emerling, Rick Childress, Bill VicTor and Tony Borbon were The Top one and Two mile disTanT runners. ReTurning leTTermen Harvey Vander- ford and Roger Townsend ran The 880. The 440 dash was run by leTTermen Dale Mow and Dave CroTeau. Top long jump- ers were Mow and Roger King. ln The high iump, reTurning leTTermen STeve SmiTh, STeve Gunning and Barry Shur showed Their experience. Pole vaulrers were Bill Barker, reTurn- ing leTTerman, and John Vucasovich. Hurdlers were Bob BolT, ScoTT Niel and Joe Nuckols. STeve Gunzel and Bill Orinski, reTurning leTTermen, along wiTh Dave Young were discus Throwers. ShoT- puTTers were Gunzel, Young and Phil STellies. Wayne Corder VARSITY TRACK SCHEDULE March 6 Amphi March 13 Tucson March 20 Salpoinie March 27 Cafalina March 30 Division I April 3 Sunnyside April I0 Douglas April 17 Rincon April 24 Pueblo May 3 Alhambra Cindermen Strove for VARSITY TRACK TEAM-FRONT ROW: Dale Mow, Gary Denomy, Bill Barker, R VV:k VK Carl Riney, Steve Gunning, Rick Childress, Bill Victor, Phil Stellies. SECOND 31? ROW: Mgr. Bruce Jones, Harvey Vanderford, Steve Smith, Joe Nuckols, Harold .lunior Dave Young, a newcomer to the track team, showed much strength by throwing the shot put. As a cinderman, Dave was also a discus thrower. Larry Espinola led in the low hurdles during a daily work-out. A great deal of stamina had to be built up by the team before competition could be met. Q A... 5' an My Vucasovich Pole vaulter John Vucasovich cleared the bar after a trial iump. practiced daily to improve and maintain his style and desired vault height. First Win of Season Feldman, Barry Schur, Tom Stoops, Bob Bolt, John Benge, Steve Gunzel, Scott Niel, Bill Orinski, Dave Young, Fred Emerling, Mgr. Tom Hawkins, Mgr. Alan i Shapiro. 1 Varsity trackman Dale Mow improved his broadiumping skill by practicing during seventh period. A good running start was necessary for needed speed. 1 ,sw-MW ' ,Q-nf-M' ,Mw- Four top varsity track sprinters practiced their take-off from starting blocks for few seconds lead over his teammates. Track squad members practiced for the 100-yard dash. Junior Carl Riney got the quickest start which gave him a the meet against Amphi which was scheduled for March 6. 'l75 JUNIOR VARSITY TRACK TEAM-FRONT ROW: Jim Brown, Gary Earnesl, Tim Brown, Donovan Scott, Darrel Weitzel, John Vucasovich, Armand Sperduti, Clay Taylor, Dave Croleau, Bill Farley, Ted Robinson. SECOND ROW: Chuck Collins, Tom Gustafson, Bob Clark, Steve Hall, Steve Cardenas, Mike Tansey, Mike Brown, Jeff Carter, Bill Johnson, Rick Davis, Jerry Locascio, Charles Hull, Joel Larson, Fred De Porter. BACK ROW: Mgr. Phil Shapiro, Jim Thomas, Dave Henry, Mark Thomas, Mike Rice, Errol Berk, Clifford Alexander, Gary Harrell, Carl Gaidorus, Jim Arneson, Rod Drake, Eric Heinz. . . Track Team Anticipated Good Season JV track member, sophomore Bill Farley, broadiumped into the varsity pit during a warm-up prior lo a meet against other high schools that afternoon. Under the direction of Coach Wayne Corder and Paul Hatcher, the iunior varsity track team looked forward to a successful season. The team's first meet was held March 7 with Amphitheater. Outstanding team members were discus thrower Mike Rice, high hurdlers Mark Thomas and Cliff Alexander, low hurdlers Tim Brown and Darrel Weitzel. Top shot-putters were Mike Rice and Gary Harrell. Leading in broadiump was Bill Farley. Joel Larson, Jim Thoma and Chuck Collins were leading two-rnilers. Other outstanding runners were Tim Brown and Bill Johnson for the TOO-yard dash, Tim Brown for the 220, Bill Johnson and Gary Ernest for the 440, and Steve Cardenas and Rick Davis for the 880. Team mem- bers strove to improve last year's record. Junior varsity lrack members began the long distance run, each one striving to be in first place. Mr. Corder kept the boys on a strict training program. Frosh Cindermen Anticipated Good Season FRESHMAN TRACK TEAM-FRONT ROW: Dennis Thomas, Mike Addy, Ken Cruz, Raul BazurTo, Doug Hilchner, Mark Ferrer, Jerry Maldonado, Bill Luce, Darrell Jorgenson, Jim Ware, Dan Rincon, Jerry Weinburg, Bill de La Vergne, Tim Sanleyan, Fred Doison, Bob Kuhn, Greg Mills, Ralph Marble. SECOND ROW: Greg Weilzel, Rick Phanion, Roberi FriTz, Ron Crider, Tad Simmons, Doug RiTTer, Allie Labor, Ray Zaiaczkowski, Mark Kelly, John STuTz, Leo Paluska, COACH Larry Weimer Melvin Vuke, John Larson, Jim Reed, John Haas, Jeff Schrader, Ralph OTT, ScoTT Rumel, Berry Gerber. BACK ROW: Mike SmiTh, John Olvey, Roland Youngling, Bud Droegemeier, Tom TaTum, Charles Houghlon, Bill Gordon, Richard Ranger, Fred Fox, Tom Benefiel, Joe Ballard, Mike Polivchak, Randy Larson, Jim Buck, Bob Trower, Roy RaTh, Bob Browning, Jack Johnson, Tony Lopez, STan Dielzmann, Mike Myers, Mark Fisher, Randy Sillik. Coach Larry Weimer TaughT The freshman Track Team mem- bers The basic skills during Their firsT year of high school. ShoT- puT and discus Throwers were Mike Polivachak, Joe Ballard and Buddy Droegemeier. Spring runners were Mark Kelly and Doug RiTTer. Fred Fox ran high hurdles for The Team and Jack Jackson ran low hurdles. Freshmen runners for The four- forTy were Tom Benefiel and Richard Ranger. OTher disTance runners for The eighT-eighTy and one-and-a-half mile were Dan Rincon, Darrell Jorgensen and Melvin Vuke, OuTsTanding pole vaulTers were Mark Kelly and Jerry Maldonado. Coach Weimer expecTed a good season for his Team. Freshman Track Team members lined up To iump The low hurdles. Coach Larry Weimer clocked The cindermen To see how fast They were able To finish The run. Freshman .lack Johnson concenTraTed on form and speed in order To improye his Time on The hurdles. He combined abilily wiTh hours of prachce To win. Junior Steve Lewis held the lead as an approaching Catalina Troian strived for position during the Palo Verde-Catalina cross-country meet held on Nov. 2. Sf' L1 '91, ' fel kg K - me Am 5 G COACH Wayne Corder ln the cross country meet against Tucson High Titan harriers Dale Mow and Bob Clark paced each other as each attempted to improve his time. Cross-Countr Team Led by runners Fred Emerling and Harvey Vanderford the varsity cross-country team compiled a successful 6-2 record during the regular season. The Titan harriers placed fourth in the state meet. Medalists were Vanderford, fourth, Emerling, seventh, and Rick Childress, eighth. In the interdivisional, Emerling, Vanderford, Childress and Bill Victor led the team to a second place tie with defending State Champion Sunny- side. Emerling placed fourth, Vanderford and Childess took eighth and twelfth respectively, and Victor placed twenty-first. Leading scorers for the season were Emerling l1.75l, Vander- ford 11.881 and Childress l3.88l. Vanderford broke the Titan course record set by Emerling in 1966 with a new time of 101482. Against Catalina, the team of Emerling, Vanderford, Childress, Victor and Borbon set a new team record of 55:34.2. The JV's were 7-1, while the frosh squad's record was 5-2. VARSITY CROSS-COUNTRY RECORD Palo Verde Opponents 18 Pueblo 39 1 7 Amphi 43 21 Tucson 34 17 Douglas 39 29 Sunnyside 28 19 Catalina 36 30 Rincon 26 16 Salpointe 47 ww Ml W . C , C ' i V it 'V ,Lili A Titan harriers Rick Childress and Ted Robinson led the way over a rugged 2.1 mile cross-country course as Palo Verde defeated the Pueblo Warriors 18-39. Placed Fourth in State Championship Meet Titan cross country runners got off to a quick start in their meet with Pueblo. Fast starts were essential Consistent speed gave varsity cross country runner to the team's success. With consistent efforts from l l . the team, Palo Verde defeated the Warriors. Fred Emeflmg the rvtms vf flfsi on the 'enm- CROSS-COUNTRY TEAMS: FRESHMAN-FRONT ROW: Doug Davis, John Larson, Rick Chitty, Marc Ferrer, Danny Rincon, Tom Seitz, Mark Thomas, Jack Johnson, Steve Garrigan, Fred Dotson. JUNIOR VARSITY-SECOND ROW: Mike Tansey, Dave Henry, Darrell Weitzel, Larry Barrett, Joe Billings, Mark Foltz, Charles Collins, Joel Larson, Fred De Porter, Phil Shapiro, Tom Gustafson, Jim Thoma, Ted Robison. VARSITY-BACK ROW: Mgr. Bruce Jones, Fred Emerling, Steve Lewis, Harvey Vanderford, Bill Victor, Bob Clark, Rick Childress, Tony Borbon, Ed Argraves, Mgr. Tom Hawkins. I 4 4 x J 1 4 VARSITY WRESTLING TEAM-FRONT ROW: Andy Kleiman, Jon Shaffery, Don Crim, Warren Lind, Jeff Estes, Pele Jorgensen, Kim Acorn, Dan Woods, Mike York, Mike Redding, Allen Lowe, Daryl Bever, Roy Dwiggins, Greg Knox, Clark Emerling, Gary Welch, Dennis Pike, Richard Ruff, Jim Musgrave, Jack Hame. Canright, Mark Canright, Dan Harrel, Mark Arneson. BACK ROW: Mgr. Jim Junior Varsity Wrestlers Placed 4th in City Mr. Bill lsmay coached the varsity wrestling squad to a lO-l season and a second place finish in the AA-4 divisional meet. Seniors Allen Lowe, with a record of 9-i-l, Clark Can- right, 6-O-l, Roy Dwiggins, 9-2, Mark Arneson, lO-lg and iunior Dan Harrell, lO-l, were the top performers on the team. Seven members of the squad represented Palo Verde in the state meet, while Lowe placed fourth in that meet. Canright and Dwiggins were named to the Star all-city team. Coached by Mr. Bell, the iunior varsity wrestling team ended its season with a winning record. With eight wins and three losses, the JV grapplers earned the standing of fourth in the city. The team was victorious against Sunnyside, Tucson, Am- phi and Salpointe and lost to only Pueblo, Rincon and Cata- lina. Outstanding individuals named by the coach were Don Woods ll27l, Mark Muse ll38l, Bill Blackwell llO3l, Guy Davis ll8Ol and Larry Simms lheavyweightl. JUNIOR VARSITY WRESTLING TEAM-FRONT ROW: Ron Wlngefi David Bl'Ul'll1'lS, Leggett, Eric Schroder, Joe Hartnett, Mike Schultz, Mike Jorgensen. BACK ROW: Bill Bldrkwell, -l9fl'Y l-GCUSi0, l-CITY C0551 DUVl'-'fl Singer, Cliff Ml'-llwlllfr Alex Larry Simms, Marshal Coalter, Eric Krutzsch, Steve Cassey, Steve Kelley, Carl Lopez. SECOND ROW: Joey Arriaga, Joe l-lart, Steve Knox, Glen Zobel, l-0l'l'Y Gaidorus, Guy Davis, Gilbert Cancio, Bill Johnson, Mgr. Jim Pratt. Freshman Wrestlers Had Successful Season Bob Browning, a member of the frosh wrestling squad, started from a standing position to bring his opponent to the mat. The match was held at Palo Verde. The freshman wrestling team, coached by Ed Baron, com- pleted their season with a record of 7 wins against only l loss. The team practiced long hours in the morning to better themselves and to possibly gain positions on the varsity wres- tling squad in the future. Their record included victories over all Tucson high schools, with the exception of Pueblo. ln their only non-conference match, they defeated Flowing Wells by a 55-O score. Steve Fila and Tony Lopez went undefeated for the year as they led the trosh squad to second place in city- wide competition. An unidentified Titan wrestler attempted to roll his opponent in an attempt to free himself from a hold. The meet was held in the Titan gym against Rincon. s COACH Ed Baron FRESHMAN WRESTLING TEAM-FRONT ROW: Tony Lopez, John Lacagnena, John Trausch, Steve Fila, Bob Browning, Tom Segundo, Randy McNeal, Kent Heller, Jerry Maldonado, Tad Simmons, Steve Maxey, Gary Lombardo, Don lvy, Gordon Vernon. SECOND ROW: Ralph Marble, Dave Denomy, Bob Trower, Don Hardt, Rick Phanton, Ray Caldwell, Gregg Bossard, Jim Buck, Doug Pulsifer, r Tom Kircher. BACK ROW: Bill Luce, Bob Fritz, Randy Sillik, Rocky Esparza Mike Smith, John Olvey, Stan Dietzman, Frank Coghan, Ron Crider, Fred Brahms, Bob Kuhn, Mike Addy, Chip Eisner, Harmon Thompson, Bob Glynn, Mark Mc- Govern, Rick Vanderford, Jim Zimmerman, Bob Ancharski, Don Kwart, Mgr. Mark Young, Mgr. Kim Varvir. Varsity Netters Chalked-up Consistent Wins ual Senior Hogan Smelker, a varsity netter for four years, kept a close eye on the ball as he prepared to return it back across the net in a singles match. Chuck Schwartzmann and .lim Skevington both went for the ball during a meet with Tucson High School. Schwartzmann got the ball with a back hand stroke. With many lettermen returning from last year's squad, the varsity Tennis team expected their finest season ever. Coach Melvin Karrle thought it was one of the best teams ever at Palo Verde. Returning lettermen expected to help out most were Jerry Jones, Mike Jones, Hogan Smelker, Jim Skevington, Dennis Rust, Charles Schwartzmann, Mike Cutchall and Dan Turner. According to Coach Karrle, Catalina should be the only team that might prevent the netters from winning the state championship. Jerry and Mike Jones played first and second positions respectively. They also combined for the top doubles team. ' , Chuck Schwartzmann and Jim Skevington, members high school. Skevington returned the ball as his COACH Melvin Karrle VARSITY TENNIS SCHEDULE February 3 Casa Grande February 6 n Salpointe February 9 Catalina February 16 Bisbee February 20 Amphi February 23 Douglas February 27 . Rincon March 1 Pueblo March 5 Tucson March 8 Salpointe March 12 Catalina March 22 Amphi March 23 Douglas March 29 Rincon , March 30 Bisbee ' April 2 Pueblo April ll Casa Grande April 16 Tucson of the tennis team, played doubles against another teammate anticipated their opponents' next move. . . ,. lk 1 3 l i f Q n -- K C it SES - 1 V- , ' XE? W - 'wflm fur. .' Fefe filf N A .f -s:f Vfwi ei 91' V. ' fi ' 4' , ' I L , y -g e - ff .P K , K 5' W 1 E ,yi gall! . K' Kij ' .e - . fr 5. -e c - 5. . 4 - -- ., , V V x . . 1 if 1 V- for f - 'H 3 asia, p y ry N, f 6 ,, . if oft V V , T . G V 4, S A V ,D . f V . fx . V V y C' wlffif' is 5 fi were -- H V , VS ,ePwX,g?:efiV-- en.. . -.ssegwv ,H . . 51 5 V V - . Hu i4X.f'ff5iQQ5: ' . fi' ' Vi 5 , T'!YW V'l'7,.,.' ' '.::::::.,-I' f-'L4 if K - 4.-sf' V Q V 4 - f i We - - - -l '- - 297 ' V - : 3?-fi- ,4 V V- -3 1 . '-0. V , 'ei it R VV wwf V Y 'i if . 5 . so y rea em l . V 4 U ' ' - ' ' 4 X f ml 2 ., +f-+- . N rel fs fi V . -,FX . 'igiig 5 Qi, V 1 . W, 7 , --V151 el 1- V.f.S?'g,,.,VN,, 4. fl , 'f' 'TWT 1 , 3 . 5 . . - f-fig.,-'Z VK ,iiffjjii 1 Aj 5 . f??tE?'-iiif? V W .5 ., f ffnff' if -'Wir -. 5- elf V' K L Twx, U pf My egggfiggg V' A 4.1, A jfi -2-rxf's . if , gf: . A , . Q we QM 4. ij, i ' it i ' -Q f K f fqA.,..f3,,rV -4 f .3513 ' .f . if is -A 1- VV K 5 rf ' f Q . if-I f - f V? V 2 V C' . f f 3 V Q ' ' ' K 4 ' .. a f 2 Z S w : , if . ' ' 2 1 s + e:eV..f'fi -- ,sez K K' A Q- , : - my , imp. 7 59' ' 3-fi ' 1 .V - New 5, se.. . , .ss 4 . Q. ,ff '+... ':, . 'F ,rg y . '- Hifi' ' ' F '- - . fe ' ' - y 12 1 M . 4 , - -g wg, Q W Vw ' ' ' 2' EL,Ve.,:-W' .f f .V. 1,.., 133 , - 1 , :QQ Y K. f V. ' T T 'Tiff Y f -4 SQWTQSE SQE' J 7. -..-f ?i?2'if ' 5 K' 1 ff' .V , 5 .1 72 +C -- 1- ' -I ' 'K ' 5 1 N5 ' ' V -ff- + iii--Vi . V5 Y .' + v fi ' '+ 7 + -'i'Yr7 i'i 3l 'Vy ' M -4 f .re ' V- . t V. . . if Q .V A . ww 5 K if Vt' 'l - . 5A9.J ' A., ... A ,, ,' ,.. fi- X f ' .... -Y f V- he A -- se., ' 1 f1'+-w b-V .. W. -- - f 'V 1 ..w- A -Ve A V V i . f Q ' VARSITY TENNIS TEAM-FRONT ROW: Jerry Jones, Hogan Smelker, Mike Jones, Dan Tumer, Charles Schwartzmunn, Jim Skevington. BACK ROW: Randy Lewis, Tom Jerry Bokowski, Tom Bethune, Mike Ancharski, Dennis Rust, Gilbert Lewis, McGovern, Mike Cutchall, Leonard Gradillas. Netman Jerry Jones worked for an upcoming match with in the afternoons to improve his forward stroke Canyon del Oro. The match was held in March. zjfij 7 .lunior Mike Jones, a member of the varsity tennis team, attempted a back- hand stroke in order to return the ball to his opponent at a practice match. JUNIOR VARSITY TENNIS TEAM-FRONT ROW: Steve Donner, Rod Povis, Ken Mike Kuhn, Phil Lee, Gary Russell, Rod Brummett, Bill Lindamood, Jim Marvin, Sunley, Rick Arendell, Mike McGovem, Eugene Bergman, Chris Wehe, Randy Greg Cutchall. Schloatman. BACK ROW: Gary Givens, Bob Kemph, Chuck Eger, Ray Matthews, Tenni Team Recorded 6-0 at Mid-Season Coach Mel Karrle planned on an undefeaTed season for The The Team defeated Casa Granda, 5-O, SalpoinTe, 7-O7 Am- second year in a row. AT mid-season, The JV Tennis Team had phi, 7-O, Douglas, 7-O, Rincon, 6-O, and Canyon del Oro, 7-O. a record of 6 wins and O losses. Coach Karrle felT ThaT The Mr. Karrle lisTed Phil Lee, Leonard Gradillas, Delbert Lewis, resT of The season might prove iusT as successful. Dennis Rust and Jerry Bokowski as Top players. Varsity netter Dennis Rust went after the ball as his partner, Jerry Bokowski, Delbert Lewis, a member of the varsity tennis team, delivered a serve during backed him up. The tennis team played this doubles match against Catalina. a match with teammates. A strong serve was essential in playing a good game. Returning Juniors Strengthened Swim Team Mark Fentnor, the Titans top diver, practiced his proved his form by working with the gymnastics diving technique every day. After practice, he im- team. Mark was in his third year on the team. VARSITY SWIMMING SCHEDULE March Tucson March Pueblo April Rincon April West Phoenix April Tucson April Catalina April Rincon May Camelback May Pueblo May Divisional Meet COACH Bob Ford Distance swimmer, Peter Strong, proved himself the city's best in the 400 and ' 200-yard freestyle as he strove to help Palo Verde regain the state title. One of the leading backstrokers for the Titans was iunior Joe Kalt. Joe practiced the stroke many hours to improve himself for city competition. VARSITY SWIM TEAM-FRONT ROW: Mgr. Steve Wright, Joe Kalt, John Ball, Bill Blackwell, Mgr. Walt Bailey. SECOND ROW: Tom Fitzgerald, Steve Garri- gan, Mark Fentnor, Peter Blecha, Sherman Miller, Brad Siefarth, Paul Marble, The varsity swimming team and its coach, Bolo Ford, looked forward to a successful season. Led in distance by Peter Strong, sprinting by Ken Jacobs, Dan Spogen, and Larry Ep- stein, in butterfly by Steve Garrigan, and in diving by Mark Fentnor, The Team hoped to better last year's season mark of 6-3. Coach Ford thought Mark Fentnor stood a good chance Ta capture The city diving Title, and he expected the freestyle relay Team of Strong, Jacobs, Garrigan and Spogen to break The existing school record in that event. Steve Garrigan, varsity tanker, participated in the butterfly competition during the spring meets held throughout the months of March, April and May. Randy Mathews, Dan Spogen. BACK ROW: Peter Strong, Larry Epstein, Sam Young, Bill Ball, Brock Tella, Tom Duddleston, Ken Jacobs, Mike Fall, Scott Westfall, Rob McDougald, Coach Bob Ford. Senior Tom Duddleston, captain of the swimming team, and Ken Jacobs dove off the starting blocks during a team practice. Both specialized in sprints. 'Ulm JUNIOR VARSITY SWIM TEAM-FRONT ROW: Mike Mulvena, Dennis Bouchard, Keith Porter, David Singer, Mike Siefarth, Scott Harris. BACK ROW: Jeff Wootan, John Chambers, Stan Sherman, Pat Siefarth, Paul Cate, Peter Simpson, Mgr. Kyle Payton. JV Tankers Worked to Fill Varsity Positions Junior varsity tanker Peter Simpson dove from the diving block beginning a freestyle sprint. Simpson had hopes of making the varsity team this season. Junior varsity swimmers for the 200-yarol medley relay were Pat Siefarth, Scott Harris, Paul Cate and Stan Sherman. Peter Simpson swam the 200-yard freestyle while John Cham- bers and Mike Mulvena swam the 50-yard freestyle. Individual medley swimmer was Paul Cate and divers were Dennis Bou- chard and Keith Porter. Dave Singer swam the IOO-yard free- style. Pat Siefarth swam the IOO-yarol backstroke and Peter Simpson swam the 400-yard freestyle. Jeff Wootan swam the lOO-yarcl breaststroke for the JV team. Paul Cate a member of the JV swimming team worked on mastering the back- stroke Paul swam the individual medley as well as the backstroke. Golf Team Stressed Fundamentals of Sport COACH Rollin Cook VARSITY GOLF SCHEDULE Flowing Wells Rincon Douglas Amphi Salpointe Douglas Catalina Tucson Sunnyside Flowing Wells Rincon Amphi Catalina Salpointe Tucson Sunnyside February 12 February 16 February 'I9 March 1 March 4 March 1 1 March 'l 1 March 'I4 March 1 8 March 25 April 'l April 16 18 22 April April May 2 May 6 VARSITY GOLF-FRONT ROW: Craig Sebree, Roger Snider, Arman Dirtadian, Bernie Feldman. BACK Seniors John Shanley and Rick Riddle, who have been Palo Verde's top golfers for four years, led the squad on the course during 1968. Coach Rollin Cook stressed the fundamentals of the sport to the participants. Steve Brady, Fritz Rademacher, Mark Covault, Craig Sebree and Arman Dirtadian were also listed as top members of the team. Varsity golfers opened the season with a match against Rincon High on February 16. Their aim was to outdo the previous season's record of l7 wins and 2 losses. Meets were held at Rolling Hills. Junior Arman Dirtadian, a member of the varsity golf team for two years, pre- pared to sink a putt in the March 18 match against Sunnyside at Rolling Hills. ROW: Steve Brady, Mark , 2sfi21fii1gg, ' F W was - . wa .. is . I K , V zssfiede-w'f 'G' - , ' '- ' fi? ' - sis-' Z ' Q .. Q 'ix , 1 -21195 'A S . r ,..:,. 51391552 'sf f it ...,.. - ff-s. . fxwsfimsaiq t so .t .. sis-M ,,, V.-i -I' . itissztzfasiffs mx , K -: Q-',fs'-'-yi , 954553 Q s sf Ms. ir' es W A st ,Q ,if . --,..f.. it-2, 21 Wt. ,, t . N.. . 5,e.gx,,W , 1 is v s 2 ' - ' F 91 XXL, 559551 I X Q 55 Covault, Fritz Rademacher, Rick Riddle, John Shanley, Jan Minich. 5 V i 'swf 'Fin +. .Q in 'ir W2 r' JE' Aw' it ii- ' .1 xixl VA' LRF QW i on ig. spalsawwf-A W J .Q 'me msg-,., , , ' -at..-: -5. i'- -:,, ,.'- .:-2-as-2 c,,. .,. I , . Us , . , ,-S2.s?,ss1t1 f . . a t ta's.:i: ' w M,3f:,,,,,,i.g . .. .W .V .. , ,. iziggsggsggwi, , - ., -- sxzz A: zm-'if - 'H ,' , we .tw V M Si :sw asm I , --ss as .. f,,.. -f-. sie- .. . I I .55 . Lg. -.sf -. ,wisp -V V. ,W . ,, .3 V ' , ' -1 3 . -, 1 .s . , . -, e f 1 -:pre - , ,,,wgge,.,-5-fee...,::. ,,-- 4iF:--,,,:-gg5.:,:fs.- ti. H-.:::g3i1' :?e2p '.s'. , .1 if V ' - 'f - ' f .- V . - -- .. ...: ..,. .... 3- . -- - . i.. . 1- -- it :-- :' ::---swf-+V--.ess2 fits-5. mf- ,w ww g3,4t ..,-f ,,, V 35.235, ,, 'V K wg . , ,. , b .. f'eg 7,Se is ps? Q 1 - :L .w-1 'I' ' 0 :..'S1...113::.. 1- :i .. I 1 . -V, s ' View-':,sh :H 5, A , i . , ' :V My ,gy gigrlssfh ' :g f ft'-I fs , . gif S i ifqgssfgeirzgs- '1L 'S':tiliififisgffifs-liifwigg S S ' MJ - - .. .F-,..s,.,,1. 'M-f,f.,,: . ,gs ,a.e.fi.5a.i1t 3 efs.fa1Qa.,ws1s'i,-,M -e w' -' 91 5 'ii mijsifs- 5 at 'M'fste?tL,sy4s?gsggS:sff ' , , Q ,Q S if sm,??Qf3: ' 'QQ' , in X 5 sagem:-1 21:-S21 ., Elifgzw. ,fs .seieass at s?wi2sE2iffs?S?.2 as?iet3ggss?ssi,5se2Lwfigsig,gQm,f:seam if-v,-1, gf--sim 2 sz:fffge2s2i,,sje?2geg siasavgzsiwxitf,f.w,gg,'.-ge,f.:7p:1i1- H...Li-Qi-fm-::.s'i. . fi:.f-mzis . -..W 2 ,. -,..swe1Qti:.fs7ef2':e41 U. ...MMS ..c,..-VW .7 ss. f--H. as H - U-was w'WfsfsL- sM9fw- w.1t,-fe., .,. ,sm W.:-if fs- fs't-w'f:z.',w f:-it1 ::sf'e.s,fs.'.s.f-,,.1:1 -1 eww swam' .sLi'szi..5e1': ,iffwtmf-iii Q 'fmt' sfzssgsfwfsfssiiszfisgg 1 1:-'agsziss iestgsgsgse?sg?1siiss 1' V' lewQ'k' lsaimaisss' iefiswv Wwe'sm5m,gMev1it..Qe:m,,.m,5gs's1lsggzas Q, -as-sisfesaisf .usfiwfssfilftlfx.f'-wwwsww' A, ...M 'Weave as.,.,s'.Mii.,.ie..eGm., , -casa-si. i,eAs,1s,.e-W,ie.wwaWfwasses-.ef gsWs's-ve.is1' ,Ls Mstafiw-V si.. , asia., awliwe-'s.Qa.a..gatswwiwsiefsstst .isfmfgiieitwastwagsiiettgsapifsevs,gefiew-flzgfstmfs , felsfmfssi imfamfsxwt'ssxfsfum W'wwstiw,1s it-s'sa,skw:s A. as -esxesismi-sfis..o.e?'esf.. .s.1..e-so , 4 my tw., , were s,.sm-w,,,.wsMs5gp3.s.if-.,,,ms meaning. . ffas'ez'.mwwfsfzftaii.s.weisfzwfsse-s.swf seesste . ,K dt' fs, 2-is ters-tifs? .S-gage e1:eg??ee'a,.gs S Q ,.twq:g5f,3-sis f 'ww'-M H.s1gi,g7w1..:gggs1ew,Q,s.5,gf'sgi5,mgsggsslfs 'Ls if is. ,Yoga w+s1,6swme.,af1.g..'-.g.Z.gQ:1e.glsisiiie .3 if t3gtt?w:sgTi?sfffeFes11s .. of .f . swwkasses.,s,m',s,?se.fwW.s uw- www' gif? pm 'iff 'rw 'MM:snowsw-.'Mef:i:s': 'r1'1stff: wife 'W .rzasfwr'si.sfs az11' 1'2:stf1w:s!5'3s,1'e' ,fsssssiimevfwiweszrs . .stg'Snis:wLrH-w's2ss?9:tf M ,ww sei .,s4m ...ei1gfg,te?as,sm-aj-ks'segss'sf'ss.e92' we- -fi fn' emviswvisis'mwssztsmitsat .mms i,,I,2,g57 23,35 ,,cfsh,,,,,,,gp,5.,,5,3,,.,gwF.5ig .,.,,,:i,,,Ww,.,,.. ,.,,m,,..s fe1igg2m:sts1afs. fff- s..WAs..s..s.,, 1 st, Www, ,mis te. ef-safe, -s.ef',.,.wwe4e,si'sf's-m..s -s, Ma .ss Ms'-:N ffm: ,ww fi'w:'w' ew .V -'ti msi.s'tf -S'fsif,f's'1-QW :aim we -fm V me-fs gait 'ewvtf Pm., -we-ez' ff -mf'fw'fw'm smswaw 'refute-2 tgfftmsmaleri. M-are sm! 1 wmises E ses. cgme.ss,,, ,,,f,of.,. swgwsw i ,g,,,,q,-S.. ,Ms,sQh,,,.Ws.q. se.e.,Ss,New-to.,,e.s.f.f9t.if1'w'o't.mis.as'ss,gsf,M fs, mc f9fs??35w V sg+tSPQstfg:wQEasaw'e,ff .eggs .i ,,9w5,,5m,4e1.1.e.,,3:fs1Q5w,1s,5a4:e..fs,,.s,gggisis WM A iff... V' N ., ,aefwwxa ,iiimstseg .s,+im,2ztM,em7.' Mfmtsasf'News-f'-','1ef:':c-szatfwaxtsdsf'meiifssfs-S -' if g?Q,935 ,i55,t,t1'ets1i,wgigeggiezs pi. 3,?ie,gs,,,g5ek,g'Qs wg. ie'wtm.eFs,a1v1sfe's-awakens' mw.svf:siwf 1s' ,wsfewfafi ' , tel e,m,ws,,g91ioxw'sums-..m3. ,gihemm baimgegw .m,??iW.,,g ageigsgowseviei:s91,5aY?2fs,1i:5vs?'s5fs'ammwxei V 'A zwfsei i2f'5t,ss sl'fgJ:ffsg,gg'fett'feAs2f.sMv1 tf -eij,t5fMvQw':ss4sfaa':s:steam' sssts'fm'svfq2w:.'sf'Hiya msnwsaertenif ' ' ' sigwsfgs -,fi,,ygs,fe,'gg4if4s..4wXgesgtggwnfgszi qs.,wgs.s,gs1:2-'Q:gwfeW1eegw isfiiis:.fe2t,f,'s.w: yyesgngaziggfsgiiiisfga' Q-ff we 'Wseisfsagsfssgstat'gsf2ssS.i:!'?,fS 5gsfti gigs'.,S-'ii1iss2g,.:if22fft:f?2?Stsf21fsw1Q-few-sf ia. f , ss .ssessisggspssagiggesssgifgwge.' 'es-sfistgsfmfsteswssgsfsilggtnmtgassf gfsfisfszlsws,f:swIzzifisflssiifsffisffetiitt Q sf, We 'reissue i Q,,'s,,3gi,,,i'msg,,gsa.sL ' - . Q' W it new Y' f misss.e,.:12fwsfs...f5Q 2 'L' mms' i'1s2H?zvtieS.i:,1 , - , 3. ' ' H . , so .. ' f g iwvsf' f ,A f,1sm,m'i.:i A ,wgss ,, - ,Q . , . . '..sfgmsM,s.W,Wgcg as 'vos-M A .awe-. .. . A . saw s -- . . . ,.. ',s.sw.a.--iwffawf-'fm isa, -' is ,gas we . .- , , . ff . , W is-as , .. . . fe, -f...,+igpssw 's,Vwere-eQ'sf - vi an K. sa. L ,K , . , , . . . ga-ttf... ., , ,s .,,. s..,f,.e.. . ., .L . ' :t -- at AsiifsafewisIitassfiRe2Mst2sa4aiess.srwmaseEs5af:zs.s ,Q ofQszeQifs1ise24isQme5itisS5sfsa.ss5sss?ws'5:assatQitQ-essffgii Senior John Shanley took a practice swing before tee Rolling Hills golf course. The Titans lost the match b ing off against Rincon at y a score of 210-213. G mnasties Team Mastered Skill , Technique Varsity gymnastics team member, Bill Strodtbeck in a March meet with Pueblo. Starting in March, the COACH Bob Lans VARSITY GYMNASTICS SCHEDULE March Maryvale, Pueblo March Phoenix Union March Sunnyside April Al'CCldld April Pueblo April Amphi April Tucson May Rincon May Catalina Varsity Gymnast, John Aitken, worked out on the high bar before the Mar. 22 meet with Phoenix Union demonstrated perfect form as he executed an L-hold gymnastics season lasted until the end of May. Senior Bill Strodtbeck, a member of Palo Verde's This was part of his routine which he prepared for varsity gymnastics squad, worked out on the horse. meets with other high schools throughout Arizona. In training for the season's tournaments, varsity gym team member Mark Feng- nor executed a flip on the trampoline as part of his routine in the boys' gym. Varsity gymnast Randy Newell coordinated the movements that were necessary for him to perform a handstand on the parallel bars in preparation for a meet. Led by all-around gymnasts Jon Aitken, Kurt Lundstrom and Steve Meinhausen, varsity gymnastics had a good year. Rick Franz, top man on the tramp, was out with a knee injury part of the season, Joe McDowell, Mark Fentnor and Bob Cain worked the tramp. Bill Strodtbeck, Bill Jensen, Randy Newell, Aitken and Lundstrom competed on floor exercises. J Newell, Aitken and Meinhausen topped the high bar. Top men 5 in tumbling were Jim Adams, Jensen, Aitken and Newell. Aitken, Strodtbeck and John Kososkie worked on parallel bars with Strodtloeck and Meinhausen on the side horse. VARSITY GYMNASTICS TEAM-FRONT ROW: Mgr. Dave Bennett, Bob Garcia, Bill Jensen, Steve Meinhausen, Bob Cain, Rick McCourt, Jim Adams, Steve Robin- Mgr. Mike Sisk. BACK ROW: Kurt Lundstrum, Bill Strodtbeck, Dave Ward, Jon son, John Kososkie, Bill Patze, Gary Phillips. Aitken, Richard Franz, Randy Newell, Mark Fentnor, Rex Ingham, Joe McDowell, FRESHMAN GYMNASTICS TEAM-FRONT ROW: Tim Burns, Steve Skarsten, Paul Duttle. BACK ROW: Dave Bonewell, Dana Cude, Dana Dick, Scott Soland, Pete Frestedt, Mile Billings, Dale Gray, John Hawk, Ken Patty, Gordon Fentonre, Ron Wright, Dan Cluckey, Mike Burns, Clayton Cross, Don Weinzappel. Freshman G mnasts Were Taught New Skills Freshman Gymnastics for 1968 was coached to a victorious season by Glen Harcus. Dana Cude, Bob Garcia and team captain Dale Gray were top men in tumbling, with Gray, Don Weinzappel and Pete Wright on the parallel bars. Gray was one of the top rnen in tloor exercises along with Dana Dick and Cude. Gordon Fentmore and Dave Sparks topped the high bar with Dave Bonewell and Sparks on the trampoline. Wright was the leading man on the side horse while Mike Burns worked out on the rings. The season started in March and continued through late May. Freshmen were taught gymnastic skills such as the scale, executed by Dana Cude. Gymnasts acquired individual techniques through long hours of practice. Freshman gymnast David Sparks worked out on the even parallel bars as varsity gymnastics members Randy Newell, Kurt Lundstrom and Bill Jenson watched. Girl's G mnastics Squad Stressed Perfection GYMNASTICS TEAM-FRONT ROW: Becky Bowling, Marilyn Hansen, Margo Blackwell, Patty Martin, Nancy Wilson, Laurie McCourt, Debbie Remington. SECOND ROW: Marty McMillan, Kathy Murray, les- Pam Kenady practiced a yogi handstand while she prepared for the coming girls' gymnastics season. lie Buchholz, Sue Howard, Dee Dee Ligner, Joyce Meibohm. BACK ROW: Carol Sharp, Pam Kanady, Linda Bucy, Linda Wallace, Nanci Tregonis, Pat Kenady, Yvette Puff. COACH Miss Peg Casswell Girls' Gymnastics for The 1967-68 school year was under The direction of Miss Peg Casswell. The Team was chosen in late January with practice beginning for the season soon after. Choosing of the team was based on The gymnastic ability ofthe girls. Many of The Team members spe- cialized in one or more areas That They were exceptionally skilled in. Trampo- line, uneven parallel bars, balance beam, horse and tree floor exercise were some of The events in which vari- ous team members were iudged olur- ing competition with other high schools. Debbie Remington, a member of the Girls' Gymnas- tics Squad, executed a shoulder mount on the bal- ance beam in preparation for her competitive sea- son. The girls practiced their techniques after school N. Vg, 1. ow 33.553, es. . ar. . ...Q-.W . .,g ' 'rare' 52 2 .1: -' ,Q . ft- if , A :..t .--- tt , t:-.. :ef:.- .-ts.--at .' :L-:s,:.asg5:.. is 7 r. -Til? f:' .-'i -- .t Ilftft' -- 'if': - if 'mf 'i if' A A t H 'Ye :L 'kt ra . e.. .e A395225 ,tt-P2 . ru - .X . i3tee7cs,1sf':ff ,,gg5fsfs.gsue5.53f,ttiagaesrew R, g.N.ge2gr.,5gt3egft- Q P .4 me ee 1 Q. .L 9. Plrffyat N,I ifX?SS lf? .slit-.-8 as + K 'U e 4 ew 2. e. .S e me ,Y P ,E we gexeefsg ,Herr ,gsm 1. zwsg , fe .rt A 12. 15 V' 'sq sf... 4' A V 2 r - 'ferry . 5, we . A ZJYK il rf 'F 2. X se its X P Kp A , fr 'ss x l MM .x A 'l 9 v- 3 Q i -L A x 'E 5 5 at -U , . , 1 l 'fl' ul 'Il' 3 s 5 7 Dev S V' Q gf r x ,Pg 3 . f H .J 5 gli as - z. t t ef r .... - ' Y X . , ., e i M-3. V ' . F GlRL'S TENNIS TEAM-FRONT ROW: Robin Hilton, Patsy Archie, Cheryl Zobach, Debbie Kemp, Bobbi Hardcastle, Sue Eisenhart, Judy Bryan. SECOND ROW: Nan Campbell, Debbie Duncan, Patty Wright, . . , , 2. e.,.sf ,, fr- .. -, ewes .. - . . . .H..53,.,3. t5,,,.,,,g, .r M, as getits2rJP1f':r'zfgfv Y9r?5f?SKtM mr Qggazvl ww: rf' -Us 'N 'fifse:.,?'s3552wek1li2sae ergvssirf ts- w,gf5,M5.ssirfussesfceffrsss. ..,, -M ,,.. .2 ...,.,-es, .. ,rs .- , f..,f..-sr.. e.q,.,.w..,,, r , . . ., ff, 1 ' 1311-,g1.i5'5f'ssss5,g,ggweat?'aQ,..cv.. .. ., if jjfgi' 5- 5f.5?:j?5Qgigf',Q,jgizlzgk-,L1liL:l',i ,Q ' 5 g Q . 'X ii' T 5 it .N f A 'Q 5 Yi ., T? L . V. r. V 1.5 it 5 QQ: W rf at ii . t . 5 . 1 1 h - -, W i ,Ak ' V r . l if :Tw 'A , --- is . T W , . ,.., .... . .gi ,,,:E . A tlfwshly r ., V ' M' A 7 Barbara Button, Joan Mach, Judy Boye, Sharon King. BACK ROW: Coach Mrs. Ester Hilton, Jenny Mikel, Pat Moguem, Carol Erven, Gloria Hansen, Gale Walden. Under the direction of Mrs. Ester Hilton, the girls' varsity H 'F-semi 5' ? if and iunior varsity tennis teams represented Palo Verde for the sixth consecutive year. Two matches were played with each opposing school on different dates throughout the sea- son. The divisional tournament was held April l9-2O at Cata- lina High School followed by the state tournament at East High School in Phoenix. Members of the squad practiced daily to improve their strokes and serves in the advanced tennis class, offered for credit to qualified upperclassmen by the P.E. department. Sue Eisenhart retumed the ball durin a match a ainst Am hi as teammate 9 9 P Judy Bryan got into position to back up her partner. The girls practiced each afternoon to leam many important skills of the game. x '5 -' M1 I rilit I :shit Vgfy 7. Girls' Sports Coached by Miss Geneva Fleshman, the girls' volleyball team wound up the year with a record of two wins and seven losses. The district tournament was held at the UA while the state tournament was hosted by Palo Verde on April 6. Karen Babinski, the out- standing team player, was chosen to represent Palo Verde on the all-star team. Advisor Geneva Fleshman guided the girls' badminton team to a rewarding season as she taught them the special skills and coordination necessary for a successful game. ln an effort to perfect their serves and strokes, the badminton team put in many hours of practice after school. They opened their season on February 8 with a match held at Sunny- side High School. -1144 H of i 'Re M , ,W W N -. M K , N . wr as Q.. y 'T ... M . . A A ., I my 4' W., N I N l'i' 4 we Robin Hilton, a member of the girls' varsity tennis team, prepared to execute a MT M' as ' 'W .WN M- forehand stroke to the ball during a practice match on Palo Verde's courts. 4 .. , W in 4 N fe .,.. N W mc' sc, my Mm r ' , may 1 c M W N. . T Offered Challenge , Encouraged Competition Sophomore Carol Post, a member of the Palo Verde badminton team, prepared to serve the birdie during a home-court match against the Catalina girls' squad. BADMINTON TEAM-FRONT ROW: Cindy Wester, Karen Babinski, Kris Walden, Linda Wilson, Laureen Malas. SECOND ROW: Linda Grabowski, Monica Brooks, Carol Post, Lillian Weinberg, Barbara Trisler. BACK ROW: Karen Raffensparger, Dorothy Hoff, Nancy Morris, Lynette Crain, Miss Geneva Fleshman, advisor. VOLLEYBALL TEAM-FRONT ROW: Ellen Fain, Karen Babinski, Nancy Morris, Linda Wilson, Cindy Otte, Roberta Hardcastle, Roberta Porter. BACK ROW: Mon- ica Brooks, Pat Wright, Sharon Thomas, Connie Niel, Sally Milbrandt, Gail Mal- Iins, Miss Geneva Fleshman, advisor. Junior Cindy Otte, a member of the girls' volleyball team, returned the ball to her opponents during a game. Cindy participated on the team for two years. Classes Thus we are men, and we knowl not how: there is something in us that can be without us, and will be after usy though it is strange that it hath no history what it was before us. i -Sir Thomas Browne EW ff Senior Float Placed First in Homecoming Senior Class advisors, Mr. Richard Brown and Mrs. ings. They also helped by supervising activities that Diane Modica, attended all advisory board meet- seniors planned including the Prom and Spirit Week. Seniors started the year by entering a float in the Homecoming parade. For the third consecutive year the class of '68 placed first in the float competition. During football season, seniors sold spirit ribbons each Friday. A car caravan to Catalina was sponsored by the class in November. December was highlighted with the annual Senior Prom. Much time and ef- fort was spent in decorating the cafeteria where the prom was held. The Titan Shield, a senior bulletin board, was kept up to date with articles and announcements pertaining to se- niors. A cannon with a stack of 68 ammuni- tion balls beside it was the class symbol. Working on the Milk Fund Drive and sponsoring two after-game dances were among other activities performed by se- niors. Aiding the class during the year were sponsors Mrs. Modica and Mr. Brown. Classmen ended the '67-'68 year with the production of the senior show, pre- sentation of the senior gift and the grad- uation ceremony. SENIOR CLASS ADVISORY BOARD-FRONT ROW: Marsha Griffiths, Patty Bryers, Fabel, Kurt Lundstrum, John Hanson, Russ Gorter, Dave Hill, Dave Carter, Bob Ellen Hale, Mary Gradillas, Anita Quinn, Betsy Upham, Suzi Davis, Anne Col- Schock, Rick Riddle, Ed Nordquist, Clark Canright. ville, Chris Kelch, Leslie Anderson. BACK ROW: Steve Burns, Jeff Smith, Richard Kim Acorn Teddy Adams Ralph Adamson Steve Alcorn Jeff Alford Anne Marie Allaire Ari Allen Susan Allen Wanda Allen Leon Alley lass Richard Alfuna Cheryll Anderson Emburn Anderson Leslie Anderson Niels Anderson Linda Angevine Patsy Archie Cathi Ardrey Frank Arduine Ed Argraves Dana Armour Mark Arneson Pat Arneh' Pam Arnefl Jane? Arveson of Tom Ashcratt Rollah Aston Annette Atchison Alan Ault David Ayers Sue Aylsworth Ken Babauta Karen Babinski Marla Baird Bob Baker I968 Mort Balcom William Ball Jerry Bangert Bob Barnett Max Barnett Ernie Barwick Byron Bass Robert Bazurto Thomas Beddow Karen BeDunnah Margie Bender John Benge Brad Bennett Eva Bentley William Berry if 79' :hw ,B , .:,. . S , i Scott Bower Dale Bowman Cindy Bowyer Karen Boyd Scott Bramblett Bill Brewer Deborah Britton Susan Britton Barry Brock Lynda Brodigan 4-154' u ' Dorene Bertling Daryl Beyer Linda Billings Karen Biondi Stephen Bishop Tom Black Margo Blackwell Bonnie Blecha Lois Blumer Mary Bockman Cathy Bonewell Karen Bonham Patti Borge Joyce Bouton John Bowden Senior :Niro 'Www' Gerald Brooks Donna Brown Paula Brown Jeanne Brownlee Judy Bryan Patty Bryers Bob Buchholz James Buckles Robert Buckles Richard Buethe Nanci Burkin James Burns Steve Burns Donna Butler Linda Butterfield Class Senior Day Registration of the UA began al 8:00 a.m. in the Sludent Union. A barbeque, as- semblies, and a post-game dance were sponsored for the seniors. Pam Cannon Clark CanrighT Mark Canrighl Kelsey Caples Linda Carnahan Barbara Carr Silvia Carrillo David Carter Rodney Casebier Nick Casey Michael Cassidy Colleen Cafe Glenn Celenza Gary Cerender Michael Cerepanya Barbara Butfon Wayne Buzzard Carol Lee Cacioppo Scort Cameron Linda Campbell Panny Campbell Sherry Campbell Aida Campos William Canady Ruth Cangiolosi Class Q 1968 Darrell Claussen Lenny Clayion Janei Cleveland Marilynn Cleveland Kay Cliff Anneeia Cochran Bob Cole Nanci Cole Richard Coleman Ben Colpirts Anne Colville Anne Cope Sieve Copple Wayne Cordery John Cornelius Eric Chaison Cindy Charvaf Amanda Louise Chavez Sarah Chiasson Pere Cinauemani Kay Cipares Les Cirzan Jim Clancy Rona Clancy James Clarno 5 Doolie Cosner Terry Couchenour Gary Coulbourn Rosemary Cox Bruce Cramer Hugh Crane Linda Crane Jamerson Crim Tom CurTo Mike Cutchall Dave Cufshaw Susan D'Alfonso Dian Daniel Steven Daniel Nancy Davi ie- ' 15 fit 'WINQN M if Senior Michael David Denise Davidson Elena Davis Scoff Davis Suzi Davis Teri Davis Tom Davis Linda Dearih Denise DeBreceny Jim Deckarcl Class Joyce Drake Stephen Drew Goyle Drewes Ken Driggs Dove Droegerneier Thomos Duoldleston Whit Duclen Janet Jo Dull Roy Duttle Roy Dwiggins Bob Dennis C. Roy DeNogeo1n Wendy Denolf Gory Denomy Robert Deppe Steve DeShozer Shirley Dickens Shoron Dietz Tom Dietzmon Joyce Doepke Duane Dombroski Carol Donohoe Yolondcl Dorome .lclye Doverspike Carol Dowell ' E Qiwiifif ' 7 f li etccr f Q 5k,,:I:7 fffV1,'.gg,g .,t, f 'fQ.Z : sll:,.75- f 7 Mr. Minarik laughi' American government in his American problems classes. Seniors were required to lake Ihe course as one of their social studies unils. Diane Eddy Donna Edwards John Edwards Sieve Edwards Wanda Edwards Eddie Elder Sydney Elliott Barbara Elms Fred Emerling Sieve Eppsfein Larry Espinola Diana Estrada Cindy Efiinger Bob Evans KaThy Evans Class of Richard Fabel Kathy Faussett Kathleen Fay Sharon Felt Thea Fenimore Barry Field Steve Fierro Barbara Findley Terry Finefrock Bill Finkelstein Bill Finley Michael Fisher Marty Flaming Patricia Flood Joseph Flores l968 Terry Fogle Daniel Fox Skeeter Fox Ethel Foxstein Terri Frahm Deborah Frame Rick Franz Sally Fraser Kenneth Freehill Gary Freeman Tom Freeman Chris Freund Sherry Lynn Fry Wanda Fuchs Bob Gabrial Marilyn Gagnon Shawn Gainey Susan Galaz Mike Gall Stephanie Gannon Senior Diane Garcia Irene Garcia Larry Garcia David Gardner Vicki Garland Joyce Garrett Marilyn Garrison Chris Gatchel Jay Gerstel Karen Gibbs Shirley Gibbs Richard Gilman Roger Givens Carolyn Glasgow Shirley Glynn Arthur Goldberg Franne Goldstein Rick Goodman Pat Goosherst Sherry Gore Russell Gorter Ronnie Goulet Mary Gradillas Gail Grady Michael Grant Class Patricia Green Adrienne Greenburg Phil Gregoire Marsha Griffiths Jeff Grimes Janet Groh Sandie Guard Steve Gudas Brenda Gutierrez Ann Haffey Robin Haggerty Ellen Hale Liz Hale Barbara Hall Lynn Hall Lenny Hamer Sara Hammer Rodney Hammil Gary Hammond Dave Handt Carol Hansen Marilyn Hansen Gail Hanson John Hanson Shirley Harbison ii - .Q Class Roberta Hardcastle Kathee Hare Jim Harrington Thomas Harrison Nanci Hartman Kelly Hastings Jim Hawk George Hawke Reed Haythorne Vernon Vincent Haywood Steve Hazen Steve Heath Don Heideman Elizabeth Heimpel Janis Henry Mary Ann Herin Edward Hernandez Bob Herriford Howie Hibbs Jeff Hiblos Dave Hill John Hilliard Jacqueline Lee Hines Jim Hinkle Sue Hinierman of I968 Randy Hirschman Ronny Hirschman Beisy Ann Hoar John Hoarn Susan Hogan Janice Holberf Emmei Holck Cheryl Holmes Jane Holsinger Sandy Hopkinson Debbie Hopman Deborah Hosley Jeff Hossman Sanclee Hounshell Ann Hubberf Bill Hudson Marta Hudson Jenny Huerslel Charles Hueria Danny Huggins Sandra Hughes Ronald Hull Sharon Hurley AnThony Hussey Greg HuTchison Senior Tom Hyde John Hynd Juanifa ller Mike Jablonski Dean Jacobson Joseph Jansen Mary Jasfer Bonnie Jedlicka Dan Johnson Debi Johnson Greg Johnson Lea-Ann Johnson Mary Johnson Mary Mike Johnson Pal Johnson Suzan Johnson Veoa Johnson Kay Johnston Francie Jones Jerry Jones Cynoly Jorolan Ed Jorgensen Genie Juarez Mike Kaplan Geri Kasen Class Randy Kaiz Karen Kaufman Larry Kaufman Nancy Kearns Debby Kee Christina Kelch Kathy Kelly Kerry Kemp Debi Kemph Pamela Kenady Par Kenady Gloria Kenski Paul Kerchum Dennis Kern KeiTh Kiekelousch Jeff King Linda King Karyn Kingsron Lee Kingfon Patricia Kiser Cai Klassen Sharon Klasrow Deborah Knight Greg Knox Terry Koeppel Class John Kramer Lynne Kramer Kathleen Kralzer Kathi Krieremeyer Elaine Krueger Barry Kugler David Kuhn Bill Lackey Gail Lamb Elaine Lambert Susan Lamm Joe Laningham Kevin Largenl Bob Larkin Gayle Larson of l968 Patty Loftis Stuart Logan Thomas Logan Mike Long Patricia Lotz Marie Love Jeffrey Lovin Allen Lowe Don Lowe Michael Lowther Craig Ludtke Kurt Lundstrom Robert Lutgendorf Dixie Lynas Bill Mabry Linda Later Gloria Lawrence Betty Lazeres Andy Lee Margaret Leedom Diane Lenhart Barbara Lindley Jim Littleton Linda Lloyd Harry Lodge Ken MacFarland Joan Mach Terry MacPherson Pat Mague Robert Maldonado Kathy Manns Kathryn Manville Dennis Marsh Betty Ann Martin Kathy Martin Patty Martin Susan Martin Frank Martiniak Dean Mason Kathy Mason Senior Dave Mathews Jerry Matthews Ron Mauldin Rick Mazur David McCance Lyn McCarver Martha McClernents Michael McCool Jim McCullough Chris McDonald vfms 'fvk Class Janei Merchanf Denise Mihalik Sharon Mikelson Palsy Milbrandr Barbara Miller Buddy Miller David Miller Hope Miller Linda Mills Cynthia Mina Bob McDougald Scoii McKinney Leslie McLellan Mariy McMillan Barbara McMullen Mary Frances McMullen David McNeal Nora McNeil Bill McTarnahan Chuck Meade Eric Means Paul Mears Candy Medlin Joyce Meibohm Elaine Meinel QW' William Mueller Linda Mulholland Sherry Muller Jan Munich Gary Murphey Sean Murphy Kathleen Murray Michael Muriaugh Kay Musser Don Nelsen Bruce Nelson Cathy Nelson Rodney Nelson Phyllis Newell Randy Newell Mary Ann Misenhimer Quinton Mitchell Mary Mixson Elaine Mize Linda Mohr Joe Molina Pam Morris Lynn Morrow Dale Mow Gary Muehlloauer Class of I968 Minna Nussbaum Jeanne O'Bannon Linda O'Cull Vicki O'DeIl Harold Ogden Don Oppenheim Shirley Orrh Georgia Osborn Arr Gwens Daniel Padilla Sandy Page Debi Pallo Claudia Park Kafhy Parkin Laura Pascoe Adrienne Niblefr Neil Nickol Scofr Niel Susan Noble Ed Nordquisr Melissa Norris Bonnie Norton Roger Norton Larry Novak Joseph Nuckols sv-21 Laura Piscitelli Linda Plimpton John Polaski Doug Porter Charles Porter Karen Prather Steve Prchal Misty Premovich Connie Price Elliott Price Mike Price Chips Priser Tom Pridgen Yvette Puff Margaret Purcell Bonnie Patterson Joseph Paulik Bev Payne Deborah Perry Betty Pertile Kathy Petersen John Phillips Ted Phillips Richard Pierce Bob Pierson Senior Class Joe Reichel Kevin Reis Debbie Remington Elizabeth Reyna Henry Reynard Carolee Reynolds Ken Reynolds Donna Rhoads Doug Rhodus Carl Richardson Joshua Keith Richardson Rick Riddle Joan Riedell Janice Rinkle Mike Rios Charles Qualls Thomas Quayle Anita Quinn Fritz Rademacher Edilh Ramirez Virginia Ramos Don Ranne Pam Raymer Marnelle Redmond Rick Reed Richard Ruelas Patty Ryan Tim Ryan Jim Sakin Sallie Saltzman Fred Sanchez Tom Sanchez Gail Sanders Kathie Sanders Mitzi Sasse Grace Sayan Joseph Scheerens Dean Scherer Karen Schmidt Jane Schmucker Jim Risk Jackie Ritter Dianne Roberts Todd Robinson Rene Rodriguez Rafael Rodriguez Gene Rose Joseph Rotello Fran Rothman Bruce Rothwell f-in Class W Robert Schock Jerry Schoenberger Craig Scholer Ricky Schurig Charles Schwa rtzmann Kim Schwimmer Chris Scoft Elaine Scott Marcia Seloest Ann Segraves of I 968 K K .. .. C ,rerfaei C K f A ,.. :faaw - .. 56 ,xi : , , Y get 2 it Q a as 3 gil 31231 s sag' F fjgfgff Egger 2 5 ffniffzg if aah: ff? U? iw? l. mf S.: 15- ig ht f 2:5 N 51 ffm ff'l'39'wl L' ron W A -ggi wen WRT? 3 j i, i ,M ,sy , i Z., ,, John Seidenabel Helen Seright Susan Shaffer Jon Shaffery John Shanley Carol Sharp Patricia Sharp Reuelene Shaver David Shaw Kathy Shelton Rena Shelton Karen Shields Charles Shipley Marilyn Short Nancy Shott Linda Shugert Claudia Sidon Eddie Sierras Esther Silvain Diane Silvernale Dan Simmon Bucky Charles Simonson Mike Sisk Sue Skarsten James Skevington Pat Skiles Hogan Smelker Janice Smith Jett Smith Peggy Smith Senior Randall Smith Sherry Smith Steve Smith Tom Smith Sue Sollers Michael Soloski Ninfa Sosa Barbara Spargur Nanci Sparkman Ginny Spencer Frank Stagg Basil Stamper Bob Stanbrook Sandee Stark Morris Startzel Gail Steffe Elaine Stevens Carol Stewart Debi Stewart Debbie Stolba Cathy Stoutfer William Strooltbeck Jerry Stump Bob Suarez Cecile Sullivan Class iT '-v-fl -rt? Christine Sullivan Diane Summers Charles Surlin Kris Swanlanol Bob Swart Fred Swiolerski Stephen Taber Christie Tarbill Marla Tatum Jim Taylor QW' FM 1, Pam Teeple Patti Tegtrneyer Brock Tella Diane Teto Karen Thomas Lynne Thomas Jinx Tidwell Kathy Tindall Lois Tindall Debra Tipton Class Jett Toresdahl Roger Townsend Kevin Trausch Leslie Treadwell Peter Trinca Barbara Trisler Bruce Tucker Torn Tucker Judy Tudor Dan Turner Scott Ullery Betsy Upham Henry Valdez Shirley Van Asdlan Ted Vance QMS of I968 Mickey Wahl Shirley Wahl Melinda Waitasiak Richard Walker Carol Walton Frank Ward Martin Ward Linda Watt Kay Webb Amy Weber Lillian Weinberg David West Ray West Janet Wheaton Dale Whitaker if Harvey Vanderford Mark Varvir Andrea Marie Veals Babs Vetterlein Bill Victor Alicia Villasenor JoAnne Vining Vickie Vogler Rick Volner Bob Vucasovich .zu 'ii Randy Whife Annabelle Whifing Randy Wicker Sharry Widener Mary Ann Wiggins Kirsfie Wilde Carol Wiley Sandy Wiley Mary Wilhelmi Margaret Wilke Bev Wilkes Jayne Wilkins Audrey Wilkinson Sandy Williams Micheal Wilner Senior Corley Wilson Karen Wilson Nancy Wilson Tom Wilson Juliet Wing Renaie Wingard Ellen WiTTer Randolph Wohlers Danny Wong Mike Wrighf Class Cheryl Zoback Bob Rognlien Localecl in lhe center of the school cafeteria, the Senior Table was used as a place lo lalk during break. The fable was reserved for seniors only. Millie Wright Steven Wright Jean Wrye Lois Yauger Tanna Yerkes Brenda York LoreTTa Young Walter Young Yvonne Young Larry Zeiolel Shar Zeiolmon Marlene Zeigler Brel' Zepp Larry Zientarski Kathy Zimmerman Miki Anbharski f Qilfbara Bradley g k Er roI Berflg Vice President i f SQ cretary C0 uncilma n k .- - A k A PM , syn.. X - ,L -. ' . ' . . K. . ' . ' Q 1 Ak 1, ff. Junior Class Sponsored Homecoming Dance During The school year The Junior Class planned many acTiviTies for Their class. Work began even before school was in session when The Juniors spon- sored a preschool mixer at Rolling Hills swimming pool. Members of The class parTicipaTed in several important evenis, such as The Milk Fund Drive. The class also planned a dance over ChrisTmas vacaiion and a midnight movie later in The year. During Homecoming week juniors helped in welcoming graduaTes by sponsoring The Homecoming dance afier The game. A conTesT To selecT a class symbol and moTTo was The main acTiviTy for iuniors during Spirit Week. All Junior Class advisory board meeT- ings were open To class members. This enabled any member To offer sugges- Tions and commenTs. Mr. Essig and Mrs. Cook were The advisors. ln The Spring The largesi proiecT of The year Took place-The Junior-Senior Prom. Class members spenT hours decoraTing The caTeTeria wiTh crepe paper, murals and other decorations Junior Class advisors Mrs. Cook and Mr. Essig work- The CIUSS- Tl eY offered helPfUl SUSSESNONS and ' ed with the advisory board in matters concerning supervised all activities Planned by the wnwrs JUNIOR ADVISORY BOARD-FRONT ROW: Susan Eisenhart, Sallie Farr, Debbi Nilo, Barbara Dupey, Cathy Cleven, Lillian Rich, Chris Ann Tsegoris, Marcia Semlow, Anna Nussbaum, Cathy Hillock, Mirldi l-igner, DeeDee Ligner, Betsy Fuchs, Nan Campbell, Nancy Hawke. BACK ROW: Leonard Gradillas, Mike Jones, Tom McGovern, Debbi Burke, Tim Walsh, Jeff Wooten Dave Cole Carl Riney, Janet Berger, Randy Sammons, Dave Singer, Chuck Knight Susan Laugh lin, Todd Simmons, Karen Kelch, Mike Rich, Ben Freiser 4 ,tcm me-me L. me,,mf:,: af 3wfi?e5sag515zQ5izaz:a.v is ww is-me W V, ,fr-11 get s2i,mws:.fzefie U, eieezexviw-ee-lewd isifiefisifi lf! gasses! Jie. YL zfisisigmasggiisisggzwf Psa if we M1215 S ffff??7 i 3, P, L, .gg ieiffif 'fsfisifii 2 22 Ee '22 E535 -- :1 Wersi me oasis if QI? ' X Vg Y W, em mg ,Hi gsm Qs? we is-95 M52 HM Q + ,,,, me faswie Q15 1 C uri'-X' f mv. ,l-args 1-1 m ..'-live? . gzgitf. .fr S ' A' H ' Joe Babinski Steve Baggin Gretchen Bailey Jeff Bailey Michelle Bailey Sharon Bailey Walt Bailey Barbara Baker Chris Baker Bruce Bakrow Bill Barker Steve Barlow Larry Barrett John Barringer Katherine Barry Tom Bartlett John Baumer Bill Bavaro Richard Bazurto Judy Beard Barb Beattie Gregory Beck Gary Becker Arnie Bell Richard Bellinfante Cathy Benge Lorraine Benites David Bennett Gerald Bennett Phil Benziger Janet Berger Errol Berk Kathy Bernard Steve Bernhardt John Berry Ande Ackerley Jim Adams Jean Addison Noel Addy John Adkins Jon Aitken Cathy Alcantar Lawrence Alexander Joe Alford Jim Allen Pam Allen Diane Alvarez Fran Amato Michael Ancharski Charlotte Anderson Debbie Anderson Gary Anderson Barbara Andrle April Antonetti Frank Araiza Diane Armour Nancy Armstrong Jim Arneson Greg Arnett Jackie Arthur Aida Astiazaran Carol Athans Sandy Azua Junior 'gugigfigi gfcbamifggizismifsxgii,isssisiewsfg gzgggwyggfiiji I W K any ww! HSS Barb Bradley Bryce Bradley June Bradley Janet Brady Steve Brady Ken Braylon Gayle Breneman Dave Brink Rick Brisley Ginger Bronson David Brooks Elaine Brown Michael Brown Richard Brown Bob Bruce Jim Bruce Jon Brugman .loe Bruins Leslie Buchholz Roger Buchta Joel Buehler Scott Burchard Debby Burke Lisa Burkhart Ruth Burnett Arlon Burns Barbara Burrill Patsy Buller Candyce Buzard Sandy Buzzard Rick Caber Linda Caffarella Kenneth Cal1o Bob Cain Ana Callahan ,,1. , A.,,. .,. ,3,,,s.,s,111,.., .. ,, 1 K S 51 111131 1 K 1 .1 11111: 111,11 X , 5 . X K3 i S, ,fs 3 1 1 1 1 ,,..1111, .. .11-1 .1215 , .., 13,- 1.,, 111111151 1315. 1, 1 2.1213 2 ew is E . ,,..,,. .. ,..,, 1, :-h,, 111,.11.X1121-111-111 :f: 1 -,-,--, .e,..e1,.11.111f21121111.-11,11,11,s1m12Ff- 1.11111-f111111111111111118151 1s11y111s1ge1gg112'25 ' 1 2 Vicki Besecker Mark Best Tom Bethune Carol Bezy Darrel Biesferfeld Pessv Bisss Joe Billings .lean Bingham Mike Bingham Michele Birch Ronald Black Dave Blackwell Peggy Blattel Pete Blecha Bill Blessing Jerry Bokowski Bob Bolt Arnie Borbon Tony Borbon Lauren Bortnick Dennis Bouchard Linda Bouse Candy Bowers Becky Bowling Bryan Bowman Guy Bowman Yvonne Bowman Lyn Bozarth 1 .-,., 11,1 W t,,g 1. I - 'L 111111, 1 -1 Q , , ,. . T , 1- ' . -1111. 11 1 1 11 X 15,1 . , , , .,:t- 1 - 1.11111 '1-1111,1,1a, M - ,Q-1-1 111: .1, 12, 111 '1- -1 fe ' 2 , 11 V 11-1,-1-1,11 ,.,, L, L3 2 1 ' 2 - 1 1. 111,11 ff? 51711121 1 ll 5113111 EEZ -' , ,.h, -1111 , ,, HW f 1 - fi 'ff 11.121 1 X 1-1 2 111-1 em-1,811 11, ' 1, 111- Li -1 911111 'M if , 1 'K 42 3 '21 1511111 +15 1 V 1 ' 1'1.- .1 1 1111. ' W-'11 bf15E5f1??.:9E.L1 21ii?5iY5gYig1ffiT5e1T5, P' 1.41151 '1111111111142ii1,'1 1 ff-- 1' Wfzfisif feesiiiifififii11119 Wi115Si21?sfiiS1i11g11 2 S, ..,1,,11 51 11 119513, . 1-1,1311 ,,.11ge1ia1ie-21.2115111111,,kV, . 3112525 p 915315211321 S 1 . --:y i tg-jf, Ti1Q511111 ii71i ' i511ff11 D 2 ,.111,1 111' it iI111f11if11 2. 11 2 11111-1 1 131.51 1111111111 .:Q.a.1 11, 1259 , i . 111211 1:1114 11,1115 711171, fiil .5 .. 2 2 11.21111 1111115 1111112?' i 111 ff., - . ,,:e1f 1-11 ,,., .1 s .- . we A 111 1 1111--1.-31 ,131 . 1, 1:111,1,,1:1., 11' 5121 '1 1 ., ,, . . 1311.-111152 .1 1155 '1 T-21-1 1111 11,15 V . 1215i 11 1-1112 -'-- 111,11 .11111,,1-111111 11 ,,., .1e1211ff1-1511,111,rwe11111L 1111 ,.., S 2, '22?1,,Ei,IlI1ig4 1 1111 -11:15 151111121 111,511 ,... 55111112121 1 '1 '515i 11f!i11111 .f5'Q1i5?1 ?2?27fl i 1 2 11511 -111,2 '3.,'f11'i s 1:1 '1111s1i11,i ' 11 51 111121121 21 '11 1 . -11111sS11'1 - 1 -1: 319923 . ' 1111! 1, 1 , 15 ,511 1: V, 1, , 11 f5g,2 jn:,,,,. .. . 12,5 ' fm T121 522.1511-11 5 5, '51 H1111 ' '1 2 . Pggi' 12131 ,jjzgigsg 121111 -1:5- ,,y 1,--, 21 1.-11121, 91 51.155 ,-111111, W e ' 111, 1111111 Hifi 11 N, 11.11 S 11 12121111512 , . 2 11 1 1 ' ,. 1, . - 1 1' ff ., 11111,111.1,,.,1,111,11,gg1,11,g, 151,11-11 1,1111 11- S1,11.1,,1,-11 1 11 11111111 ,115 11 ' Q' 1 211111111-11 we . 2 ff--f 1. A1 11 , , ., 1 1 1, .- .1-1111.1 1-1111.11,111 11212111115 -2 '1 11, 511-11,11121115'Q:11s, 1-11-11, 111 : 2111111112111 111, gf, 1: 1 121111151 '1:1511,11 11111,1e1,g1g111??e -- xc .. ,.., ,.., -, . 551 J? ' 1-111111.61 .: 11 1:11-11,:-1 . 152 .11 ligjsv 41: ,,..,, K ' 1'151'511i51-1,.- 755133151 '1w,gs1k2Q ii7V'L 5 ' V' V 5,.'1,. .,,,- ' i'.5L1' 1 D2-msg, IE, ?E152X551i'1,5f2i5 . sim 5 15111921157 fr: a 'l1'H1: WW 11-911-1 ' w1e1'11-,1.m:: .:. 1 '1 511111111 .:, .1 A- .Q,1.,,.,,. :gt , Q 1A , .. ,.,3... I, H , 1 15-1 +' -. ,,,k5g1 1w1.sW,, 13, 11 A Q 111111115 11 ,121-1.5 ,1 11151111 1 '1 ., 11114 Q 11 11 H ' ,M?21i11gg 11111 11, 11 1 L ' 1122151 1 5 11,1 I 121 111 111, 2 1 i - 1 T3 11 '11 P ' 1' uf' 311,11-1gS21.1,1121 r15s1wAi'11-17215iX5Qf5L1mf2.Q195jL5. H V 153 35g,4Q11fz.u1a 2 5 5 22411: 15521553 2 Wi' 1155553375 2 5iv'2,5a111s1V54Z1,f S 615352 2 411251151311,12,111-11s111y,w, 22 8 W-11L21:a1111 1 J 2 61 S 1151f111g:z1s111sieie11 S 2 111,131 22f,21,,1111-11,1 1a-1111111111111 c 3 2 2 2 , S T2 8 22 S f T 2i11e2g51g,g1sf1Qw1xf 2 is H 9 ,, 1 e 2 ,1,1e.-1.5, 3 2 3 3 S , ., 1,.M,,g1,1s1e1w 1 f 'S 2, 2 S1 S 2 2 111151125 1 Q ' S so Z G 2 B 51 2 S f ,,.. ,, , 11 1:11 2 112, 11113. q,,,,11,. 21 M1 1 955, .1, g511i1,5131111? V2' 1 n 'aiffv -11119 1,2 S., ,, 2251133 11111111111 Q v Sf - 5 1.1 315 . 92,11 1,1 13.333322 ,1isi'1 17115123 ,. 21211 : : i21.i,.. i' mi 'Mil f ,:- 'iifiiifi ,,11111se2 11.1,w11'11S1 1 1 :1,,f1zw1e1 . :HVWK1 1 1121 1 1.11 11.1111111111 2 ,111,,,,,s11, ,. ,,.,, .11 . .1 , L. - 13, me 1 ,,.1,, 111,111 e,1s,1,iq5g:1 '1'1-wg - .-SN 111111,-1,1 111 911 11,fH,.1,1211 g15, 4 -311335 11 1 11--1 1,111 3 1, ,QW . . f 1 E4 0 11111FQ31131111-1, :',. 11 x it 1191- .1 1 -5. 111211211 3 1121, 11 ,, 2 12 .21 i1 1g1 :,,.1 f1Q? . - 1, 1 1, P1f .1 'z11lI1Y ,'i,:11'1 111. .1 i11i111E1s1,11,se ,WW 11 1. .1 if 211111meg ?1f1111111,'1 12511 1i12,11g21 ew - ..::..1:1 f-11111 1,,11.1,11,,1 In ,.,, U 3,51 ,,,m I: H ,: ..111 .1 ,.,,,,3g has 3, 1e,,,5, 5,7135 11111111111 12111111 1, - 1311121 511111111 , , 1 is ,11,,,?11 1 1.1 1 2 1111 1 ' ,,11s.,,1, 1. . , ,,,,,. . .,,, L 1, 11, . 13, 1 Q 1911:11:e111e1 ,, ,, . 3 5,1 .1 ' 1 1 1 1:3311 11 1, 1 .. 1-111, 11 ,g -- 111,11,,emw 1 1 1 E111 1: . ,11 11i455Q2711Yf11E'111' 2 if 2 5231315 5E151i7lf'1E,'51f.?E55 ' ' 5511i5.17?lfif?E 15115 ilfli kf2,,151f1j1 1 - -- - ' 2 2911152155 1 - 1 2 ., 2 5171 1 1. '1117' lifffff 1'i1 .ggeil I1 E ' 1- 511111 1 1 S 1121, f i. 571 1:-1152 2 1.5 11 11,11 ', ggg,5b1,, 1g ' 131121114 wQ11g 11,,121 1li21gf21 12?-WLS ,:1P2411fS1Tf ,I-1111 1111111 11111 '1121m w I ,2w21.s1, L1211,11,1 11,.1z x f 511:11 1111115 111111113 1 2 , wi 1112111 17512 ' in 14 111 2 i22L21i7f15Q?sl1f 5 S 2 '1!ii2E' 11111351 11111 151112, 1 v1,21s11: 11,32 1 ,11,11,11,111.s3g1g,3,,,,:w1, - 1 111111g1,?5gv15. . ,. 2 42115351121 1I1,Vi1i1i 119221-,?21I51,1'1E?21Qi1 1,1f?Ef1gfL1il11i 1 7112,-,S if 1 Q, ' 53 ,51f1,,11211. .. . 115,11 1 11111111-11 111111111111-11.-1,111g1 1 111111,.ff1,f1, 111711, 115111 , 111111111 1 S 3 114511 4e11e3111?11111f1 P11111.:1121 s111,11- , -21-221111111. 11,111 15111, 1.11-11,1 , ,.,, f,,,1, 5 1. 2 11, 5,1111 111111151 111.a1je1W2fgf11e.111, ,, . .. 1.1 111131,-11,-1, S, ,, 1, ,,. .1,11,111,1 , ,, ,, , SM,- 1,,,M,: , -'Z 1 111151.21311-1 , 1111 -11 '1,51.1 22 , X 3 1 ' N ami 11 A 1 21 11 ' ,11 .f11,11,5,111 11 1111-1 ,1 e1g1,1-,515 12 -1 .1 ,221 1? 11,11-11111111.11 11,1111 1,11 ,111111,21,,.1 A11 1- - , 1,1-11,1-1,,,,. 33111, M 1. . . .L 11,1511,,1,1,1111111z1:1,,1 ,,1,,z ,f1,11111m1 - ,1 1 1 , 15 -11111111.,11,,,1 1 - 1 1 '1 , , 1 ., 111l1fif,1ei.9'1'?,e'1fi3iT1 1i7q 22 'V 1 . X 1 1. in ,W .f., if -an . ff , T . ,L,,.,A 4 . 1 .... . A - if J D J J' PA-. - t gL, X '- . . Q1 L 1 . AQ V FCI- ,. i .. K N I KL I '..-- ,gp AK-, Z L LL I Q. - if 9 t fe is f T . E gf ' KL V H :,.- A x. A L I iff: , if f . 'ni' igg J . X Vrk .,,- K I I .Kk. i E ' A : , - M Z 5' . J :':1 Q :KD H iiiislr I .. H . :K-i. ,f ,, ., , . . , i e if yffvfs l A T 2 , 'l 6 X 3 'it lily is .,.m..e .ef eww. as Qie?eYeP3.f2Qs we Q- .5 fm-fs eww ' K ,.f M te. W N, . 5. , ,M it , . Q 1, Q- WN it .xg 1? -1 K tt s rg . ,, My : l as i . .lb ' - nga' - AF .bimw-.4 . -eh ,win tm ' x t f .. .e,,.,3,..w.l.., . .,.. ,. , . , .. ' J , :ff .- - f ww --:Hams at--as -wifi Q- f-55521. , Z ze - . .1 I , ' -- ' iagsggf cxzf-ser' ,iggfgf fig-sggvi 13. -Z Q .c,. gg .gig - ,. . - -'- 14 ea1e2?.Q5EXiii 'fi zraseiffif 1 2 f- ...QQ f T.-11 'V ff.. , if -XSL -J 1Ni7 A-rcsgaieelsilsfff-QQQ ieisiiisisw' li . 5. i -'75 mi M , . ., ' K'k A . jg- fiiii -jg W' ' .195 .. H .L-ff 2 - V 1 . l- if A of 'Yi' ' H. 5 ,.?i.,g .,, A . V t flqb J , P' ..,, ' -- . .- 14' . 'fi . . fi-.- - -V E ,li h 1 .lk N x:- Li Q H- emi 7 .Q y y Nd J 1 bij . 1 J Q .5 Catherine Clingan M P M Virginia Clor ,L L it - K Rogena Closs 1 -.3 , . ' Steve Cloud F174 y -iL-' ' J z 1 Nevin Cloutier P V i-i ' fy ,Z Howie Cobb . Y' Z iv A .. . i x X. ' J Dave Cole ,N A K x M y . P X x L' Steve Cole Sybil Colgin Charles Collins Patsy Conklin Arlene Contreras Allan Cook Chris Cook Denise Cooke Joy Cooke Cochelle Corcoran Teresa Corron John Coston Peter Coston JoAnn Courtright Mark Covault Nancy Cox Paulette Craig Terry Craig Cindy Crist Dan Crobbe Debbi Crosley Xg f 'I T . r ,V2We. :: .5-H ' W' y. sh . I - A - in ie M l ili . I is J 2. . s el A to J 'Yi I X iike . 'jill l'li -Z 1 ,. - rilrrl 4 . lrit A ' fy fi i f y y .'A:,.-: V .y . 'Z fi' 3 .iff lzi' it .Q 'lp 2 Q sf? Q - l V. A bf 7522. Y 1 K' i ' . . - e-' 3 Andrea Callaway Debra Callaway John Callicoat Jana Campagne Debbie Campbell Nan Campbell Gilbert Cancio Sara Caples Sally Capple Patrick Carano Pattie Carithers Jeffrey Carlton Maureen Carter Cindy Casey Alex Castro Donna Celenza George Chamberlain Cathy Chandler Lorraine Chapman Terry Charleston Lorrie Charvat Jane Cheney Gail Chesin Rick Childress Janice Chlopowicz Kati Christensen Nancy Christner Jack Church Michael Cichinsky Bobbe Clapp Bob Clark Emily Clark Tom Clark Tom Clark Cathy Cleven Class f-rj? .vs if :lx Q X. X ix ,ff , kmifw A is X ., . ...: it . f.fq1-g- 555 at ,- ,A 3 V- .7 f if . 6- ,S Q ofl :f4iT1+. aiiifilizzn im ,f'11c,-1 s1 . w,.f-- --+' ..'f -::, x: '- ' SEQ rxiswls E S 2 P4 1 3 S . iii vga'-W-fl' wan fiziifk.-,I11f:ff2Yf5f5f52Q? 'L if . .,., ,, 'YQ 495, fs ,, 2 M2- EQ ge . .Q Q ffi sy ,. Ip: f x , 'E 55 HEI f- 74 ,5714 . 5 Q W , 5 'S D2 af 13 Haig i xx 1 4 Q 12 5251 '-: ' 322211535-Y 1 A. 5- -, Q ::15f:.. rvsfa sszzftiw 21 ,52 A2123 'L L, . Vli, , 5,1Ql 515355525 ff. if -A . 3 , img vgigw. Um Az., , ff- ,, 12291 W wif , M., .,,A V, 1Qffsgig4a?g5112ff2Lw1m Q w,,,.,,. v,.. N615 mmm M. i fwgiixi am X ,mn 921511 QA Q xr A k if ggi 5 15 :H : ::' 51I ' ew 'Q X 3 ima Q Q Q-2 Q X 2 Q F 5 2 X if fe' sd as P Q ik N as 3 Q H Q 4 a 5 EJ is E W S R1 P9 si 9 'flag ,Q 5, E rg ii A 6 of 9 js X K , ' Je P 2 K a Q Q2 gf 'H t 2. . J ,gr 1 . Q X 1 415 s X 2 11 if- .,.f, ,M 2 w,fmw1,. , E, . - ' -M zsvfsalsx, ' .2 , Am, W A ,.,,A.,.g, V, WX 3- H ,mm :N .21 .. , . A 2 mfsnfmey :W -ww W A ,E ' K Q 'W is x LG, sf '2 s. sk PQ? azxa 2X 1 S 2 Q ,E 5 3 mei 3 'Tn 5 an R H 4 'H H Smal wisfisww z ,- .S , may 1 2 in Q xx 5 Y S V -9. M55 , Q K QM Q , is ,vw JI , 5 SPN Y 3' ak 969 Barbara Drenske Roger Drew Debbie Driggs Marilyn Driscoll Marie Droegemeier Pele Dufek Dave Dugdale Barbara Dupuy Debi Dupuy Larry Dullle Steve Eddy Jill Edwards Patti Eggleslon Bernard Eichenberger Pam Eichner Sue Eisenhuri Tom Eisner Kathy Ellelson Gary Ellis Irene Ellis Stephanie Ellquist Glen Elmer Mike Emerling Charles Encinas Arihur Engstrom Larry Epstein Carol Ervin Jim Eshelman FE ff 3 Q33 X 4 My S .4 Z ff,. wk ,. . , --' gh ,gh Q X Q 3 Wg 3 , L, , ,,2r B ... 'Q S N2 ,rx 'Q 53 5, My ,H aa fT19lZ??iSiE'biiififiiie5?Q?7?EiifEE5i1 2 S-'fe- wsfms, ..y,.fQ, af K wg-'ww -f -M f,f..ff,, .w 5 s M 5 ,Q 'Q x Aw f wg 9 3 Chuck Croleuu Dave Croleau Jerry Crowe Loren Curtis Dave Curto Terri Dakutis Chrissie Dame Juanita Daniels Jamie Davidson Connie Davis Geraldine Davis Guy Davis Judy Davis Rick Davis Carol Dawson Ronald DeGeer Suzanne de Ia Houssaye Charlene Delamore Kathy Dempsey Mary DeNogean Rick Deppe Lupe Desiurdin Mary DeVries Karen Dewberry Dorcie Dews Bob DeYoung Sherryl Dickens Marilyn Dickerson Barbara Dickinson Louis Dion Deborah Dix Keith Dodds Denise Dombroski Danetfe Donley Lloyd Drake 5'-my1:-myfmmswgsflsgszgsevswim S R 5 3 S 2 S' X 3 Y 22 L' 2 'S fw1,f1wgif4 A ez mh 1M,,,g, 2 2 , ,V swam Q 1 - ?i,,?5MPS,fv,.gg, ,, ::,, g 1' -,fmmw fggzmf, . M.,. tkiih-, ' ' Q 2 , e, L 'k 8 JK 1 9 -x P 2 H S Q K J. 1 x . ,K X a an x 2 fs I Q , +35 3 if A-ff :12:si:g ,,:-M, 5:1555 5, :ara :5.'5f. i -Q'ei11f:'w sam 11 131, M .,. M , Y , M5 , T S' 4,5 S ,W-Neff-m Q 4 1 1 Q v JK ' n 5, ,. .. 11 ,. '. ,- 1-f,,. Q ,rg .X .,..,, . m-457 -mi 1--if-zai .-H: . .: mwffggg f,g,5: 421, ,A ,AW l ,Q M,-,,..,.. ,2 S X gig ' 1 115132 15 Kg, Wimim , f S ,,.. - ,,2.: ..,, , 2 2,.. -. . i fLff2QsszAssgfff'ism1zxgsvzgqgggggllgf573, Sfwvlw' 2.121:fs1:4sQf:1:- MM, 1, .M QL 2 'L ME? 2 '2-2 Aw ,L .,,.2,. , ..,2. ig f M' P 2 if Q S 8 S 'V K 2 H S2 fx 1 S S S w 5 Q Q 433 ss., , S 2,5 9 2 gf ,, K3 S 2 P Q Q is S 5 ,Q 3 S 2 2 A 2 as S , . 2 S 2 gs-is , 2 4 Y VW ' ml -5 . li 552 , Q QM .. W .2,2.2 , ,.. . 'Y 'Q Q X A551155 ff? 'F S gs mf 34 Q Q S an X 1, w K 1 25 Q L. F S 6 E ,H , M3 Y 2 'V 2 2 3 S Z E af if 3 9 5 ESX 4 f fi S 5 X. X 1 3 Ag S if, 3 L Q P 2 w ,A.w,mL fs-. ., ,.,,. fwgq Aff 21 -an Q my 2 . Q h21Q1ym.v Q :: u ..., man-W '. .. . Q M Ia-,, .: . gf 5, 1.--, ,: n, ,,..,e fm fx af 'R fg ls isfgi g. QA my W ligggw HSE 7 f' 2 W ' 55255 - Q R Q fix. , -, . I ,.., ,2., Mwg- 5, L W 2 SK X .. ., 2-.2 NW , ,.,,.. .. N Km Msaif f zs bi 2 2, S Hsi,w5L:gf iw:,,. .S S, S K - 'f2:f.:::wiA fne 1, aw ff Mamiya Q 2 A r2,, W, .. ...,,. W --2 35 M iv M g w,,n QMS izfw:-nf :1 :IRQ mffsn -vxg,3'MQn -. -,, 49 K ' ' I 515355 ' H 'E g:::Qf?Ef!:Ifif4kiff .iliiiv 9551283 WH YV- gfmm ., ., .,,. ,,:, k,,,,,,,,, ,f if ,il T V' cms, 3, 1: rm 4 'w:.M,. .. ,L .wlssf i fYfw1gwgB2,1g .V 115595. ww - .w::mg: WN, .f-mms -' ,.k,. ,.., . 2... , ...,.., ,K5,L,w,, grmm 4,133 ,.,, 2,2. fx ,.,,. W. ,. H, fzzszzfu -an mfr: if wx-1, 115 We, N, ., S ww- W1--W 121121' 5Lf5Ef?iE'i?Tff3ffic7fif 5 al? 551552 W a?4a2i:f?fs51'4W2g 5 - S S H 'SMH Q,MHW.,1,1,.m mw,w3w1w-V . 6 3 ,:m,.g1.:2,. ififfsiffi .5?:':',:':lE::i:-' ,I X .fi Pf , L J 9152? 'f .- - p.q,,,,gff S ffm I fi isa' 'gilffl' 392514 5 'S wi: L, ? K Q ,pw 1z'fw fb:fgSWD,Q :my 2 J ,. , L f VVH5 U iq S75 'S'1'. ' ., Ltkjtgjqgjgsxg ??Q5iEQ'f,II, 1 713' it lzhggjig, 41 -1-if -mg' Q X in D ,, W--ff-'QASXKQ yew 'ww 'S 1 - 155195 ' , 1, f7fff:ga,J4ei44e1ffif2 . fx giyujg ,,513,5glgg, , f4.4:e5'z5:25eQig ,5m 592 -,.,f 1 - ' Z:E f- ::-' .1...'t, . . 5 X 2 2 .. , 2 3 - sg : lf sfQ1iez,f' ,i k - 2- fiesf ffw fs? QL W, 4.3.5 my 513 1 Q :Q 111.-in .-,A ,..,.w Um :-- :- ,. , S f A in . .. .ms .W ,.,. ,. , ., 3, 3 59 ' fiesifeifffii klfwfiz-112 we 1 7a:uPufm1e' Ylsffeaqlgshi a 2 zeezgsvzgsexgs K A Q Q, , erfeiwisl Ss:fm1f1 ,Q ,Y 6 Q, lm,,,.v, Q M M , 'Q as in 5557573 47 '9fib'E :ASTYQPZQZ fa P 5 f .N 2 25225221 , 2 , 2 91 izlzgisikiw sgg ,:f1-151.22 1 J a iifiilfiiliai l gli, 'vkgggs ,jj5fi5451f' ML h1'f-179752 ills? 1 , ,xc,gt,jgj5 S2 Qfi.iiifiwi2i', Q , Q Q W2 Q' 22Aiz.:,Q1qfq1gSgfigggfg gs eff,-Zsfiyib as! is AK E-55f3TI12TQGi1 J fx V CfQIf:T1m71v9ff'ff'-'TTSSQ V 'lg-513311591 X v,L,, ,W gf ',.1,, .E -w,gg1,e5 W 5 as fig at W dj Ja 4 .1 , A,,,A.v,A.,,A.7, .. M M 1 85,53 ' E:3'1:::,.. . ,. - 'W my W- . Kqsmyf 3 WEL 145552 Dave Estes Jeff Estes Cynthia Eustice Beth Evans Robert Fabel Steve Fahlberg Randy Fahr Ellen Fain Beverly Farmer Sallie Farr Cheryl Faussett David Faust Nina Faust Jim Fay Bill Fee Debbie Fegan Bernie Feldman Harold Feldman Mark Fentnor Scott Ferguson Jerry Field Greg Finefrock Richard Firth Louise Fischer Donald Fish Sue FitzGeraId Jan Fleming Charles Flynt E Xvsyeyismggsfgekfggge fi-M12-Qi 1 92151 ?i 1:f?z.1s:--.r . t ,,1.m2,.Xg,a....5,,t 5.3,. 2.2 1 5 1 l gg, ,za .. .Q-LQ .. If, .. ., f ':??.::' ,gm ,:gg5i,Qf?5g .... ,:5::if ee. Qgififaieeisietz '35 41:1 ?3mi's5'izs ,., it .. A,X,A,. re., W?re1ss1P4iZf1 ,.,,sr,s.s. ..,. ' ' 41 ig Wixitff fftll 51 ,lgimfiiiii e,21r?'12g,s'i11. , wig 1 gee Q32 mme L 2 '. .211 132 135 12 121 , .1 ga., g1es.g,1t211 93233553 4123231.91 .., 111 - M112 2 :s ki 11 -15, 2767455 fgegsseii 1121 q,1212sfs 2 9 5 S-We 4 Enix? W ziizszsw S 2 4 , 3 ,.., e..,. . 1 5SEbi?gSiE6Fk5?? ' 1511 ,..K-- :.11- 111., 1..1w1w X. 1 vw 'Q' 8 L Q 2 5 S 2 Q r gg S2 t 'S 5 Q 21 ss Q , 3 E L 5. , Y, W' 3, Es '52 122, in r A K, 44281 K X ,21 Ieeiikg g E l3gL25g25gg1eSsi r fz. X1 B 'Q wife. 1 .323 E 52.5 22 Q WK . ,813 em f ,B W1 as S 3 E S H , 2 rf .XE is we Q is 91 fe Rt We f X 8 1 is s, .S .1 M Y Q W X my ,K .2 we gf S i 1 sk we ft s Q 3 Q . . . ., 22 . K 2 S 2 2 'Y S f PFH31--V1 -1 w1s 1as,1sa:szf2 -itz? 11--t -fs U. , .',.Q7Ql9,.P giggqggggggiggg12,,5fgg5zm.?2w12 Ksgzr, P fs-mtm1. 25551?-222521,51was4we1if11:1af11i3Si'E1i.5Zffif2b122f 412111215 Y ifsiiisiffiiifj .mggggsws-tsgf11i:f' e v -:tm:1s111-.11f2r2,tt Q-w1.-1121 E.,-1.21.19 1 1- 1 51 1 ,., ,11.,1r,-.1,,1f -112,111,.11 -1 -'-'. .. 2 1 , ,Q2.gyw5,i1Q2. ,.gQ1gg,5..11X,g1,-2.f,11,11,. K .,KK, ,. sf-.mm fP1af,.11.f11.f1 .-fi-. ,,..f ,.,-f ,f I 2 .,. K R2.,.2,1.,.e2.1,. ir 1.s.f2.,..t12 213,112-1 E 1 , , we-21Xfs11sfaf11tf aaieefeiss ..,.s1z:11,-1 . . ??i5i112S?1i,v21,11si1.s ' 3 1 11111112111'1511f'i1f'1?11 a t-11211 f35?33skf5igeP1.s11,.1iftf1 1. egsgssgs -11 .2 22 X . 115111111 11' : fa 1 W. .. ' ,2 1 - -1 2 S.. few.-1., 1,-1.t '1 2 1 -.1111 -gag 1,55 is: 1- 1 K2-.1-K1.,K 1- -3,552. 11 11519169 - mrs - ..1.. .. 12 Q' . 11.1 11 1.21 21-L1 1553.21 . - 4, .1-.1-ffimsyiifgg F- 1 Km... VK,.rK., ,.K.. Km11,,i ,1.g.s.5512 1 51,2 1 1.1 15,5523 111155-2.11 2113 R - 11. 1 'ff i2f11f1w ff1-1-sis. - 2112'11i:1?ii'3111.-1.H1ff.' 1.2. 1zs1,2,,X1-11-fr.s11 S2 , 1 ,. -,M1121 2-1311141 ..,' -19 Kg..-1.--11-11...-1 11Q.111.1.t:1.4.51-1211-11 . 11ga1:ff:g21- - - -gs-1-1,.111,. -,gg 5 igs12111Q5. ,2 - r11w.-1 - -1 :s,,: ,Z 4111-12121- ffv-ae-i t -1 2 21,3-K. fr. . 1 21s2aH'ls1J1s,gF1 :. 11,4-v:r2.t 2 X ff 111.-:1i-161111 1 1- . - ss2s.sw,51sg511g12g1wz:z.1:sgg12- X 2 S .,KK,1. 2112.21 -1,11-1., 1 11 111,51 -K, K- .5 1--1--11131111 12 lr.-1--121. 2 .3 . 11, . . - 2.1,.- .W 11111 xgggssgiigw - fa K-51--.S 1 . .. . ggi-KK5Ky . -11 K 1--1-,1-11-1 .. .. 1 . -11-eg,-1 11,5 K, '?LE'3iiiiFf'f - . sgs1.s1g121-A12111117 w e we f11 .-i-1:11. 111e,1 .11 1g 1 i511-1.-..-' Hilfe-1111 11 -.12.-- ,-11., ...... .- ' --1531.211 - f1s-.,'E- 11 ee , 2 1ei11g11'1 g1S1s1ezf1 -' fi.-11251 1 ff -1-11.21-1 -1...,'Kg- 8 . 1,1 1.11111 -:wmv - E513 1 1-1 - 51- 2 if K + a-1 1 A 1,251 . .gf 1-1'H.a:. J - 12-. . N1 .. -1-.1' W, -- Y. K. . , .neg -11,322 5 fr- .1- , 1 1... t 1' zi11sf1.1,-111.-1--- 11 gag . . 11211 , :111sf?f1?TW 51. Sify K R57 S221 - W' 1 2 ' -111411. Z1-Y-Q1 1 141 1 - i 1 Q 55: T111 K K 517 fffff' 6 553131 il-I 31751 1. 2215 5 .1191 -' -1 1 1 - Q ::..GEl.'22a11 1. ,. .,., H1111 1 .1g. -P1 1' tif'-.111 . 2.1 1 11 -w.11-L-1.-Q ff 1 -f3isis esSz2Qsa211gWgw -5152222 . '.11??! ta '-aF'1'a::1s-1-eil. 41: ' 1? ew- is , 2112 1412 51231 1 . . -,:,-- W' ' 1 -K Ziff? ri - fe K .1 .SHS 5211111115 11 1 ,. . - -. -1:1 we 1, --rr- 1, .4 - 1 1- 2215-s-15 ..1- L1 , 21 2 - .1 .f. 1- 11. .Q ,211 J.. -f . -2 ,, -- .rf ,. ,. . fr 1' 1 ,1 - i ' 1 ' ?feis1iQs21i f1.--11.25. 1f1 Y--if-19'-f s:1'.1 -fuss 2.-1.521-.ieL.-1 iiisws, 1 2.. ,.gp 111,s11 12.. . -1 1211511511 .w,-Wws- -1.2?hQ-1 - ,1 1,-11--1--15321. Q 11-19-11 1 fviititfe TS:-fe2i122:4 Qss11,.3 f 1:fx1:1i.s1K12f.fs-1.1 ' 11 -si. 1111551 -1 r's1x:f1111'11r1-N411 1 1-111.-1312 1151111 55111 Ievgsw .1135 . s2,.s11111, 51,-1--'fs . ,. .1-51353 1 11 2 w--t.g1 - 11 K,.K. Kp- 1-1.11 1-112. 151- '1.-1.1-11.11Q mf ,1.,...:sgaa. s,. 1, L. K. ., an 1151 - -1.-11,1v11,- 1 .1 W2 1 ' W ' 1. 2 11 1' 1 1 1 1' 5.2. 2 1, ,K..,,,2.., .TQMK ,V .1,K. . ,.P,..,U 1-I-:-H A. 11, ..'1:. :: 11'f Q f 1 Ne w .Si - 55,3 -- .511 .Q- f-wt,-1.,2- :!?3S?3e..1.1 1- 1,f1f1.--92-Lew -' Y -is .f - - -1-.2 1' S- -fs -15-115 -.M-me - 1. . 1 fe S ,111 . -M 1- 2-11,1 . y.g1f'f1 111 1 -1 1 1, . ,. M 1 1 1 E- -,.K.- x... .. . 1 - . zzsffwllgif-533'N1-U1-tsilsartszxezrfw-5' 1wr N 2Sf1aat:zz1Qx:sz,m.::s1':s11'z1 111:51 1s1.f,..:w:r-1:41-1' fi211s11ir1ss.Q:1l:t:xtt 11st:v.:7g-w1:r1s11:'l-1195,12 ecxgszgutfszms 'wf:1:?:5:rzQ1'zas11s11:1s2 sf-if-3911-515-N-11A rsfizsf 1A1w1fSs1rss' 1 1 . --Arn Q T K - 2 11'1fi'1CY-11-iii: fgsgmw J 2 1 , - T K K .,.m1m.2.,. -113-151. 115, f.f1s1sv1w:1:' - 1'-wffsfsfifff M512 -A' 1 1' 5:s??Ssii?6:5?igg 21x?z.f12r1. 1 1.11 zgsffzgw sw- 1. . .1 1112 1 . me .. - . 2 1312122 52131121 v X , 1 , ---- 3 1521--1K 11 1313, 5 1.-115--152. 11:5 1 1121'1we -' 111 1.1111-A QHQ122 : - .fr 2. .. ' :. -H.. . 5329 .wr-1. 2.22.15 11 12112.11 .. . Q-.ts 8535511 2 -.-1s1J111 1f21421f 121,12 2- . -1- :-:m.... - -' .. 55.151 1 pb..-- :' we , 1111 512111 fs112gf1. 2- ' S25 -'12--:W 55111 ww .sz 11 ' - 2-1 ff ., ... ..f. -:1- -' .mm 2..m1, f 1 iff .. - ' 1121-A .. . K- 21121-se .. M- 1. 15 Nr. 2 -- '1 se Q31-211 H i -:I fZ '1-. 1: F-1 .1 .1 .11 21:55 -.get s: '1:- . 1 '.. .. 15512521 :M-EQ ii: :se -is-1s 1 1511 L21 l-' H145 ' fegsei 1111125551 111 -1 155115 21 :.,.n1,.s 215511 so -' ' .,. -1 g1,. 191 Qg agag S 1 1K 7 ...iii Siafivi-fs P1 :iff -1 -'1: ':..-sw '51'l1ii2Qi.i1 . 1..g ,. 5s31Hff 'I S 1s27fe1Sezi1E'f'7'i,,.e'1i 5 21212.22 51. 1 1 11. -Q:7! i?f9N TWS . ' sazesriafef ' e11s115e5 i,s? '..a, 'Z?:'. --2. 43, .3,K..,, ,ggvgqsm-:'-rQ::.11issz1.We - .-21-,1f1y1g1q5j55j gggjggglv' zgggey .fs .1a.,b ,, L, s Ls1g:Kf, seek .. rss- ,.11?1,-5,155-31 111 ' 1 1--:53f555':. f 131-212215 Q--13 - 1.-ff 111'1111f r --1.-1-1.-ef-1-1.2121.51-13 tw.-1-1.-11 2 1 -1 1--1 11,1-f,.-1,--HK. .,, ... .,..11y fax :a. 1.sm,as- -My - -1'1raai':: 2. .. 14:11-11 1311111511 --1211-,1:-.U-, 1-ef ff-ffl-M153 --agsggggi-gg,,.,,, .1-11-M-11-1 - ,,f1.f,s-W.--11-me N 1 1 -1--13-1--2 10 1, 535-1521 .- a ....5.5.,1 .gg' is-.11 11 1 Nw!- S' -f 4. ..:... ' f11-5 5: 2111 151-1-115--'Q 1, KK 112V11:sQgKs11g1.1 K. .We ,KWhKS,5E351 - ew.. K ,K H . - ,M .- --v .. S 1 K -f11,j11,.1,. ., . .wwe-1 .- ..:f1. 1 P' . 1 'f11sf1.e1f 'ef -Wg '- - 5.1. ix 1 1 Q - 21-so-1:21 --122:11 , 1-MRL : Q I Q - me 1111 Junior velopment and how the colonies were governed American History was a required course for iuniors Mr. William Alvarez lectured on the interests coun- tries had in America during its early stages of de- John Gould AAAASWXQAQAAUA 1 Q3-52-552 A. Steven Folks Maurice Forrey Janice Foss Mark Freehill Debbie Freeman Steve Freeman Ben Freiser George French Edward Frias Rebecca Frias Ann Fridell Ann Fridye Wayne Fritschy Orlin Fritz S Penny Frost Jerome Fuller Paulette Furnas Barbara Gailiusis Jock Gainey Louis Gall Janice Gallagher Jim Gallopes Rosita Garcia Jack Gardner Linda Garner Kay Garrett Judy Garrity Pat Gaul 355 A A AA AAYA S AS A AAAS S isis A A ,A QA A AA ,-,,., A,-,A ASAAAA-v 2- A AA WA SAA . ,AAAAA . ,, .,,,, AAA, A , . ' .JAWS iS .A -A AAAAAAAA.-A2 QNZQAA-AWAAASA . . A ,,,. . 'AAA-Auf -- .e :A if if A Ni., X i, AAA 'Ty ' ff A Pi S Wifi 3 ,581-ab? V733 .ga 4' 'S 4355 A IA..?5i?3 . -A -AAA. Aft? 95 SA ,A w Ai 'Si S A51 A A-A A A :ska All s AA AA Af,,AA, S,S ., Ag -.AAA ' A-WS 1- A A WS A ,A A A A AS- get AAQA A A AA. Q 5 , A AAA 6, fAA:A 4W .f A' -AA.r AA .. V... AHA A .AAA -AA W... A Wifi-AA'i -A -5 S A SA A ,.A.g,,.A qi AA we AA A ' - A Aw ff A ii- A. A 3 A A Eg, at Q1 , . 5. Z We-A .A-A A, :A N f A 2. wang?-AAAA AA -:Gad-5323, 5 A .A A AAP AAAAAAA-SQAAAA AAAAAAgAwAAAAf AAA ZA K E fare. .A 22 . 511-A-.-A AA, AE, HAL iw.. ': A5311 31 A H f3A,g3'ffexss A ---eau ' .UA 'S-eg-ii i ig: ?'is?5T'ssA ?Skf'i AAQAESTSYAP 1v1eyfe1AseA1 1QAzAsAAAAA,AA A AAAAAAAA-gwg.gS e -. AAAAA A?AiA,Ae-AAA A .r':. iii' A. M Sw K AAA lg' iii -vA bA 5 ww A21 'I ig? H. QAA 2 A ...A AAAAA AAAAAAAAAA -AAAAAHAAA AMAA. M, r.cr. A. A AWA.. A X 1fwYAe? 2ggeA1e?-A ..A:e1eSgAAfA- f ' A453 A AAAAAAAA-,.A,..AA A -Sn rzAAAAiAA. , ,.. , A Ag :A- Yau AAA. ., .AA . A A AAA- .Ag ape W fLAeAAgiQii3s?iE'A iAAA:fA - :SAAQAHAQAAQA AAAgAAeAAzAA A be tiles? AAA-A: A V S RAAAS? 5 1552. AAAA-A 13171 :'g.Q--i .f.i'- My Skis E --A.sA--,A-.f'..AAf A kA.AAAAw,gA,-:AA A-A A A A A A-A :A-'KlA:A.Am.A,AAf'.AAA-AA . -A AMW AA1fii:JiiiLii.A-S -A -,..- A f .AA :,g.. All SAA A---T.A-AAfA.,A-pf,-i'.f,-Az'A..A-Sr.2Ali-',-'vA..A-Aw'A 3 A,A AAA, A iit- A ,, iz is A A A A AA .AAAAA ,,,, . AA -ASAAA fA:'3.AA., . AAAAAA,vgAAA7AAAA. ,V , -1.1.5 -ag. A. ee 5 A S A A La A i My AA BS A z A A5 r A . ' sf V 'A A- WTA A YA A A4 -AAA S A S W' 5' A A A WA A A A S Q , A AS S A--AAS --31 . 1 S SAW .. AA -AA' AAAMAAA A: R A A Kf:?'7AAA','f . 'A4'25'f3?ii-t:AA'5-'G ff S A fs' i5F 9:5 AL A-AAA AA-AA A AAA ,f ...AA ,.,,k A AA A .. Q , ,AAAA-A A AAAM, ,AA S AAN ,Assn 4 5 lf sl' S if 5 A+ A AS q, I S' A? SX JA Age? SAA .A r,:.: A S fan. ASA W -. A A k-k, ,i,.AL',A - uv ww S , A A S, S S S Jia A wg A S 5 A fa A 'W '55, A A. .A . A A A si ii-A 'ss AA at A AAA 5 S SA A A , AA , A. A A .A -A15 -AAA-AA-1 .AA-Aw -A-. AA A A A A A i ' 3 S A. .ASA A 1'-'A-fAZ1E'2i7',f A A Jr . LA . s A.L.1A1 ' AT' J.. 5.15 I' W' -' - is .A-wb S 'S Girlie- , W'i ii 'bf5'fA-Wgq i ',':.!i'- . . , ,:r---..1:. QA:-1A. ,. 'AA Ai' ' 'i 5i:i,- ' -- 32 AA if A A- AA - K.,-A-ig AAA 'ifiii ' EA A f S Z2 ' - S 5 ii- HSA -if 1 S f , .'a:gf' SEA ' --rg , .,-A,-gAiAA:sAAASffw' .Ave - 2 'I I , -:mpg-2 , , ,AAA ' E- P' 1 ' AWIAAAAA-QSSAAAQAAA'-S' S AS A.A-A-we-A?Y'Q:LAA ,x , QW' A fi if ASS mme-Li S A 5 'MEA S QASQAAAAM , ff-AAf, .A' - 'S , G MA A ..::'51,ALSE7im:' 'V A' 5 --', -- ,. A- I X A AA1'577Qi5 A -i '. !. . AA - I S2115 -S '-+- A4 S, AA A A A S A A Y A A S AAA A JH wr S .... A W, ff. A A , AA -AAS-AA.A.w A A AA A AA A A .A .QA .AS A V AA 5 A ew . A , A ,AMAAAS AA A A S AS A S A AS K A S A S S AA ' A .A -,-AAAA S . . AA -AAA -AA A - S fr-- 'FAQ-. i W S -AAAAAA-AAAAAAA. A. QA AA-gAAAA----AAAAA A . , -, .A Ag-.A .1 is .. - AAS: A 1 QA .- . , ...QL 2 S .,AA. AA .AA,, , -AA ...AAA A AAA AA- ,,AAA A -A,A A S A S ...E i.5'7klqf5i5Z'.gr5 7- - k AAA -AAAAA . S S S A ,Ag S +A- ,A A , fi ff' Ll S 'A ' S -S ,AQFAAAAAA A S A A .AMA - S .,, ,ffl AAA I - UAA - A ,fgAA W A ,A .Q AA A A AA SAT A AAA-5A gA.ASSA.A -'AAAIA A A NIA, , S A AAAAAAAAS S S A S 1. i A A AA -1 A. ,' . .. 6 AEA ' A A ZA-f iA-A? s-TA Aizfiiiig' ly.. 1:1 5537! A 1-' AS. --mesi A-if AA .,A.AQ :,-1-SA .AAA . .'A'A .s1Y'.'A ms-i!! -- 5.0. fi -Wi ' A init .,A A ' M' I A-A-7521 88 A A H A... A: ' 1. ..- 7 'L g'iAl5f:5lA A- 'TQ ' 1 :51 A A .afisiii -A ii A . A A ,-AA -'Q-13.2 , A if--Lg-f.:A.Aie:-7.13.A--'A S Q S A 5-Azjkzi A 5 A A A ff, S A A:L-SE:7.AA-Wi-9 A A ' .AA S AA AAS A K A 'AHAJA-A S-S..AAA A A V A,,,.A , AAA,.i . A A -AA-2' 71A-SAAA A' '- A - A, , S A -A ', A ., A A A ,-'AIA-AS NA JA PMA 'Ai Ai A A A--Ag2A1'A-5 21?A.sA' ,. 115. ATA-2.A. A SSALAQ ,,,f.' A-ff giA.A-f .AjzAA .AAA-A--13 -5 h -S:fAA S- -Au:--g,. g.A-vg-AS -SAAAASQAA-S :A ,AAA-:AA R. T , wg K , . r ,A AM M, . A -- AA ' ' ,-1AAA.' AA,gj- '.iA-JAEW1' Q1 ,:- ' 1 , AAA - , - A AA A AAA ,AA ,, ,, ..k,, A ., , .5 .,,A- , A , , AA.. A AA,AAA K , ., EA ' AAS,-A-.1AA:L.A Aw A -A.f5i'AvSgf '1 - ',-A-AAAA73 aw- - A S ' 'si ' ' AS:-AAAA f V 11 S ...A ...A A 'A 'AAA--A H55 31 ,., :-B A A '75 L' .' mf .. .L-Avi 1, ,-WL .sf -A A IA-Asfllif-kiiilkiil'' 515' 'S ., 5-WA 'lialiiikim S fTl:'lYA-5-.A ' A12 AA:A,A-Aziz-AAA I Azhar S A Aff -AA.',-AM,-M. ., . Q A.z,A3:ZAiAgA 5 5 S A V A A X A gA.A-Q,fS: ',- A A rff 'ff A-151-16 AA-ei: ,, A,A:AA.A, A --:A-SAA . A-'f1L.1A-s .. 'AfE. '2..A'r , AA5t t'f'-HA AA A1517 A' ':AAes Af'A A-21.5-iii i - A AAAA. . ,,A,,--S -Ar .A A ...A -A .,A. . A- AAAA AA.wS .-- f AA AAAAAA mA AA- . 'A-2g:L. i.f1'AfAff' S A. '1 - .A - '- :5: A -AA AAAAAfy M fAi?AAfSg.A'A'-A'S? fi-Af ,- :A , ' v1AA-A-Af-A-AAAA-1',AAAA A-'AAASAASS -A-SA - ' A :AE A513-g,iA'A2LAA warn?-Agzigzf ,A A ' ' -, ,, -AAf.'A-QA K -S AA:--AfA.AA S S S -A AAA-A , A A ,A - A IAA, S ,A A .LAAVFASA ,AS Ari. P-2 1 Af Ai'7'.iA- AAA , A AA.AAAA,.A, ?A-X Rn A in ?11g1L.g2A Chuck Gearhart Mina Gerall Rich Gerber Teri Giambruno Debbie Gibel Gary Gilbert Mark Gilbert Linda Gilman Sue Gilson Pat Giorgio Dian Gish Dave Glinski ' AAA AAS Se S A A X A. S A sa A Y QA an A. Ek . f A AA 2 A A A. 1, Af! H ,cg .A AF A S H3 AAA25 ff' 1-AA Aw 2 A. A AAAAAAAAA. AAAAAAAAAAW .AA , , AA AA A 5-A 5, A 3 A A A A We jr A M 3 SEA A A A A 5 A .L uw 2 v Ax A M A 4 Ama HA .Afi agk 'i 15':'.E?: Karin Godbehere Bob Gonzales Cecilia Gonzales Joe Goodman Will Goodman Bob Goodrich Karen Gordon Michele Gordon Jack Gottlieb Linda Grabowski Leonard Gradillas Craig Graham John Graham Danny Grant Deborah Grant Paulette Graves Kathy Gray Sue Gray Kerry Green Linda Green Bruce Greenberg Gayle Griebling Gayle Griffith Pal Grundy Mike Gunning Sieve Gunning Steve Gunzel Tom Guslafson Debbie Hale John Hall Louis Hall Sleven Hall Diane Halphen Lois Hambor Holly Hamer Diane Hansen Gloria Hansen Kafhee Hansen Richard Harding Rebecca Hardy Shirley Harper Daniel Harrell Tom Harrelson Lynn Harringfon Sue Harris Neil Harry Dexter Hart Mike Harfer Vicki Harler Sherrie Harfke Kevin Haslag Andy Hassler Nicki Halch Barbara Hauer Thomas Haugh Bob Hauser Nancy Hawke wif' r , p SS: s xi X it 'Aki if , gg, , , g s. , ll ig. -,,- .V ,.N.4,.z .w:f51..m.-1 M-. .Q- sxfsiifIf.sie-Qctlfvfiwi-ffsfsifsg.. , I -me:.5A111-exs.faak::,p.4.e.?,.wa5.',-:Z .,. .V . fisfxswffffsf- fesffw zziszgg-im , ' Si fwifcfi fans vi zwisszfzs .- ' me ML - Si smile? - . . -- . Fw I . 5 ,Q X sew 53 Ng 22 1 , 'figwgl x 'ig ,eg Q , if Sa 1 4 GJ 3 ggi -f N 7-.M . , . . Y Ms U. ,Q W gm X R Q is 5 i we ' Y ei .W 'Sip is HQ wefm..1..m1isg.mM fm- A 1- .f,- 5132242sisgsgssgezjqgmism. ssf.sfg.ysz:izf i i sfiews .M..ms,-.m,sme --W QL. 2m.,.Vi-.41 New V ..i.i.1,g .fy .1wf.3x S N 1. V iggfizgw, Niiiiiil emi, .xzm ,mah ,. .. , F . my-.fi X rc 2 S is 3 2 Sx Wi Q K b K igfzggfgg. ,nw L K K Ex f, as . Q '- gglj 5 ' qi V A 5 fi- ,..... - , if E. . LS -V-f., . f .1 -I fi -' K: 1 , 72 xgw 'i wi ' ., -, L 7 ' - A s I W I H lx ., 2 . J A I . A H. A .ed N ' 5 .1 ,f-f--2 ' ' 'Vi . 1 M' 5 M? 5 ' 'V , g fig. p .. e.s,,'2f- 5, A fe., Zi. . M A , 5 Q3 . ' 'fir A .QL K- , f A , ,. , 3' si ,f ,Q . . :ya . K+ , -' - K 'Aw . 3 A A - is - . K . S s - i -A A ff ff . A V 1 5.1 .K my N-if . i ig.: 1' M . . .,... . S 7 i 6' .. . .., A .. , Liz 2 ,+V .. X of 'lbiileese eff -' -2 - 5 - ? ' - - P 525 2 fi' J Ez: .i.. ,.., Q .L ' mf - - .3 6 T25-ii? 1 f-11, f . . 4- vw ' fszffifm vfiftsz X .. 2 :M , - 1 i. g gi K 1 157 . 352 Aww eQgfQsggU 1.ii1i22 ggfffw. i -.4525 - f' .,. - . ' D' ' -- .,.... f Q - . ,1 ,fggm f - I- - 1 eeeessi 5 .-v.w?1'2iZ 'i W igs L ' A ' i , 2 , ' ' 5 -ww Q 'weiffziii i fgi ' :. V. 7- ' ' V . ,,',. . 1 ' 12, 5 f. 515 . ,Q . 1 X 5 G my A i D' ' , xy: ii' ii'ii e ' . kickin 5 ...... , . no 'S an 6 S - M A,-rx Tom Hawkins .Y , . Y-' , ' 2 . , Doug Haywood 5 gg,-5 . S ,ef 4 . Sieve Hazelbaker , -sliig . is S ' Jea e Heard .V J d He kenlivel E, .jig f fl!-.. A g . U Y C Y i ni' ffll -1 L ' . S' Karen Hedsfrom .i-.i , . ,. . - . Q , A f. . . L .-.' Eric Heinz ' i--. f . ,V 1 I -Vi' 4 7 5'i 5 H all W N X A L V A - 'll' M V - - Bruce Heller S' 2 G Ann Henley ' '34 . P, Mark Henrlkson c . ..r . . f si. - . Donna Hefbeff .Wee if ., - ,'Lk . , .- ., Z . . - H Heredm J 1 S Yolanda Heredia . r. f . W A ' 1 Debi Hersch ,imc -.3-1 ,-- .. 9 5' I Wah Hicks i -1 ,S . , . G00l'99 Hill Sm' H ' G Cmhie Hi 0Ck Denny Hitchiner -'kfi-. A -9 .- 12.52445 EZi3e1f.iif:f5 -. ' 7 ' V315-27' . ' 29, - gal - Allen Hodgeg ,J 5 iff -1.2 Mark Hod9e5 L I if L . H H H i i K Vernon Hodges ' - 'i'- Qfv ' -.22 . , . 5 , K ' . ' , Q ex . A Bob Hoehn H . G . ' ' ff. Dmnne Hoffman 4 fi . U -if ,K .K K' f ' A : ect Paul Hoffman . g 'S A X A A M i js -37 1 Slave Hoffman ,A 1 g g S sem Houck D my X ' I -3 5 5 Paulelle Holley 5: J K 3 'ir ls' i .. .A ' Judie Hollis Bill Hollman Patty Holly Lin Houghton Linda Houghton Sue Howard Deborah Hoxie Pamela Hrometz Warren Hudgel Bob Hull Nancy Hunter Wendy Hyman Billie lbach Philip lmatong Jodie lmmerman Nancy lpsen Zac lzon Frank Jackson Joe Jackson Ken Jacobs Karen Jacobson Larry Jarrett Bill Jensen Dave Johnson Debbie Johnson Gail Johnson Joy Johnson Pam Johnson Colleen Johnston Sandy Johnston Barry Jones Bruce Jones Michael Jones Paula Jones Pete Jorgensen of I 969 M7 7- 1 1 - , .- 7 ' , 'Y file-J75g.eii ' 1 ' 'ii Qi:E7di712flEf: . Q : ,, ... g, 511.-v, :. : 72.4-,1f7 :g,., ,..::' -,J 291452-f7T1s f. , 5' 52.-113:-5 ' A:f l', ,,, .. ., , K , ef 'V ' 71 . 'Z . . Viiiffs. mf- 7- - - H yt--gg t Lf 151, zuffzgf, -5 . D 1 , ,,. - 7..,.,s . - .. 3- 1,4 g -- . :.- :. 7, ,.s,..:-7 M-7' :si:'-7.--,. sg.. ' 71,-1-'7 7-17,-1 -L-2 vEzg:1g'l?T- S .gm-7, 71 .- . - . 555 'fe ,fmjj. .7 -,.f,1i.e 11 .e -' .- i -5 -77.4 gi1f77.1,f7- Jw Pai.-f7 7 7 -1- 1 fu, 7- M- ,f-7. .Az f--7-M-.::7z'7 -wg-wer -1 Q- ,-1113 grit- 71717 :-wsifr, ' L--7vf'-f42 2 '- 1727 wenif 1 1 - - y-- q '-i,7.:2w:- ,-Egg, gg .wg . -7- 11.7-3-5 - .-7 f V me? ' 7' 2 V 5.5 , -- -.I 3 71 '5',,f1'ii 7- -V' s-sv,- 7 - 152- 55 7' 55 '5'E:5 7 4' :.:?iE. fl:-wt . ' 17:75 , -,. :: ,Vw ., .. ,,,.t e , . .. ' xr., ,Q f - 7, ' f f. f' E?4 . .ns k x. . fi? , r 73-7,-,w-7- - ..-,.., --7--777-s,.f:-7..-wv-'efw 77 -' 7 W, 1-11, ia -27e7..Qs.e1fy1 wgs-sf-W7--eviliifwileflfimz - ., . .. W Iii, il4QQVZL11Qi'if-Wlilisgfi-2.1,ifzif-T?-Tiff:-is-3 1 -1 1 7 7 52: 'Q 77 Nw- 75.2. 7,..,w -iJs1i u-7,-fe , ffl sffsffm -' . - xs7f5.,A.7L.az.ss:5Q1sn ' 111 L. . --3.1: rf .-gb 5 :. ,Mgr -Q 5. ,mg 7- 7, 1,131 ,H,--77.53 ,Eg U M. ,..N.,, 'Wi 7 7 'I'-E '-H521 32-77.57 5-fini 'g -i ugsfigif, ' F 1 ' 7 - ,3k:..kME,..-QQ,,',:, . ' - ' ,554 -gig .s7,. gL,.-. jsf,sfe., W- 7 . 11 - 1,1-11.7-,vw , ' 2-f x 27,9522 Jw .- 7e:7.z:L77 :ein 2-25.17-fl --77.57 is: U-77-Sv7e2i,,r s sr-7'--A427 ' -- ' 1 1, - ,ey eg. E7-5,3515 f fg1,ws77'-V. g v gfikwne ,,5e'::g5:. :..:2 .QW . . 7: 7 . ., . L. . 7 , 1zf:e.:.e, , ,M-, GV .,,,Af,f-7.-w,,::,A.,.gq,g-,,.a ,Q-L75 ,.qe15'Ls'V72V rw.:'A-V-Slisifisfff-213WW9'L::7'l2ifLf751iiz?.21LH7 5 V557 3.9 211-:Qfs5.32.'i1f-af-'7 fi.:,1f' 2-V7-2-iSS1Qi'1.'7l 7 5T.i1Qi11fQ17 iii-'fn-3i91i5f1iS X5?.59?fie5ix'J7AbVi?i'g,Qf1i537HMI-1i1Qj'7gfH.f,1zs' fig ..5'--7 M733 7224-:-:gif ' I-QQSZM-2.2-15731,M7x.ai' ' M' 73, -7 z.s22.Qf.sms -aa, Zi--7.+77L .-,522 Rfvxf.. 7- ta... 571527-15557 15'-' . was . We -- - - .. Q11---7, spam: fiililii . A ffl , . 1. r Q.,-,-K7 , 9 w,. M ,..e. Q15-17 A,-7, Q Seq,-7-.QA --: 1,-7:3 gg--75 .-1.9 7,-gf7 fQ11vf7,-7.5 ieffa-25221552-r4saw7 ,.1s2':?i- 21.512-P 1.2: eu f -- 'rw 5182: E. ,, '-P -- , -7 ,. , . Y915E1Ti5iu 2 Q 7,23-jg--if.:-711555 7775-7-'QG',E 'eww ff- , 9 ,: ,iii-3.53 iggjiq-W7-2.523 -Z :::':.i 5251.511 V: 'if-51Lie?iLW5-5'?LS9Sfs?g .. W4 Q5-:illiifsiii -z : 11- Q 7 - -,.- 'iii-:ig-- . ,s:. .f,Qg17.:e1-n,-55. ,.'fs3f 7--71-22.15555 'g2:s23Lii.s' QL ':gH 2,13-L2.i7i35iisg7gae7se.sig 7 K - si -, 1 ,, 7 7' S 1 - - . ,. .-,E 17--gg Wig., gg -I 7.-,ggA , ,. -.mr .fs 7 . ,g5gg::': fesszieimf,-2 453 :':f:, :3- .7-1. .2 'Y 7 'V 4 - 2145-Q-ii iieefeiie ge gsi ' ' W . - iliififll-'77-' - 'ifw-75211ei2i ef-efeiiaf--2 - -sf5.c27.e:':- Helen- is-77'--7.5 iemfiffmsf :Q--mswiiss w-my vimfi-fl use 7 ffen g-, 5q.wgff.g7 - Q-57 --ttfec' .gezwmssas 7.fm,.s,7 :fem-17 me tene- Q37-192.42 .. .. - gg ?-wrzisefiii . . . - use.. -9-sgvgs 352794522 ,, 5122912 ,, .- H, Qi:-7,-'7 f re is-Z--Q fi-'S -- 'A:E:f'7'7.'- uszifii- -2154 , -7' 'Q 7Y-if--7 'if'-H-if igtgiggs Ewflfglggi fi-ing-fg 2-5, 1.4:- Q ',-7,11-w 5-14-5132 1-U'--M57 'was ' E655 ig 7-7v..i.fii,,. 57:5 :V-fTX1Q'l719:f VSWLQEL ciyi-7?-37'iH :i '5-'-.. 315345511 ,,.w1-15553, 55. i 12 -ii. ical 7 elim? f '5 537' I-55.51 fail iif' 2 7'--UETQ 5 rif,L 1' -V' .5 ::':.,E.f'E?5 . 'iT2lS1'7 F' '7 'JV' 75355: msykfeli, . , 353,455.57 . ,f -:- MMQSE- ff.w,..:,. g' - gg.,-1,3 +::...s. a-. fz7..77. -fig 1----w..-77 gig eg? -gms? -- my 13, : -I 1 , 1 s f U-Q-e.QQ.s2ei 2s2L5fgeL .z,2?si2g?gf-efexfili-ff --fi . ,srgiiafw 7-fw--2?T5??.flL9sL,77-' Wi:-ff--' iii? 77.5117 We 92--fe, sim iiffi isa- M135 Q15-in-f -7-732 We 7-721-TU 12215 W-f:,..,..- F7-,.-Ng, -ti :f .271-gm, ,nw fs 71-1 7 --,977 :fi 7.z.,,,-sf , ..,,-7,-,. ,KS-7. 5,7 ,,.,,-AL.. .M 7...,,. -is-W .1-L, - - 3- .773-777 Jew ., ,- ,Eg -my A. qw, ,7,,,..y 4Q-,7s-- 1 -1 , sgeierezes, .. . . ,Q . . : 4 ag5?Eg1f1sf7-fwfw ew ,7 1?Zl:3::g:5:7-G - -2... QA 25: .Sig Qggm z1i5xgg5'g?iE 'Rf 595 :Q7 fi iiiwfg- .' 1 1 A -s7jig.1i71fi1fQ5:.7 i.: ,:', 5' iiivg- , ,,3,,- 533.15 75: s35Qige32Q3j7T .5 ar if 11131017 -JSQEDME 5251511 s -e,f.9i:5'7 VV.-1 I 1 P -4 ' ii' ' gLi5,gfgg1-57: m s ezggiwjegt .em-3fi , .. ., g2 ,Z 7 at fiiiififf swim s- ' - ' 5-1-.LW -. ii 77-z-1:-gy qi, 5-7,-,.:g-y -2,-g.i7gg?g7zs,7-if ' ,i-j .,::,,,aa7 '., 7 0 P ' 7 . 7 7 -ewes Wa. MM .. ,W -e... -- - .f ,,f- . , , -- . ,tm--.1 n 3 :51-..:m,.,, .5 :. ,-..::,.. ,- 1 -- '7,,- Q.-fz..'--.7--7e7., 7: ..-g- 7' ' -7g1:1,--iw s- -.,.7::,,g:-,..- ., .,7,.s.e ' 1 W' I ' im., - --. 1 .ey .-, -3- f,., 'JE' ,-. -1 ...J Quai.. ,fQ,fsa,, i H.. . 7 3' L7 7, , me ..s,7.-W-.M ...,,. 577.-ws.,.m .f, W-.w,m7sm-.--S -.1, st ,,-s. ---- , .,..- ,,-,. 77.3 -f--,. e ,, --.. ., , 7 2-72-7117 ,..s.. .--.-73-J .-, -.-.,. , .-,. .,..-s ,.s,.s,. wc., ,N.,..., .,.t,,., 1,.,.Ms gs,.,q,QkfaW,m ., ww, W,w.,,,.f.,u,U,,,.b,g.,w.,.m. yxmkm, 1,.,.,A ,y:5H,,,..,.m MSM w,,A:SV,S.L.,W,,,V, MM,,.. .,.,.,,fJ, ..,.,,.-,.-,7..- . -.U , ,w.s7f77, ,.,3,.v 1 --1.7-.---7.7. fee- f7.m7,m7t 'Y ' ,. xegffiy -f,,g -13,2 2,55 -' if ,JI35 Qigiifiwtlrri ::-,, . 315:55 :SZQQ5 55-Wgxsqgggf ' sgxigslg 72 15149371-5151 V271-5?i1T?s5i17Z 315313575 'xv-59?rf5'5f il-33511371217 7I?f7E77lff-ii. :Il-149i 'UT 'f':-in-P' -- '. ' EST- . . ,,.w,.f ,, ,gn ktae.,.,,.,., A ,hmm A M, .7 My ..e.m,w . We -155. - 41 - H- -- eg 5-'Ss'-73 -ggz2..wgv fn!-Mr? 1.5171 -7751 iissszxeftis- .: -77. fswikxi 123527-27-QW 055.74714 we-aid? 1 ' 7- . 1 . -- ' ,, F Q- ' . MW- Q 7f:1. e- 7112. - -7-Q 75 ,gseisiw-fvesz. 2175- ru- gf:rs7-,f1e..sf ' H -'-'77 , . 3 '1 we 731-silisiiz-22 -15,-1 :-f':a-'su 7-7.g:geg,gg,.f:z,s 'L-7.-27.2111-2'.w7-1. :fs 15.1 .Nix iw mfvh ?i: 7'l-7191 :fi- 'A -,W-7 asf 935-.mM,5wLf,. ks.. ,E f.,i,Q.,s5Q. a we-ffgf -fm:1wz-G-1.1149 ' 71vz.:4szm-2222 51: 17'.f-57-fe-7.41,-me aim - We lg-,zsmv-3 1fs..s,sq:Q7fef EI,55w3..Lwh,..,3..Mg , W. :m..M,:, mm. .,.,,g,m.,A 5.5,-,i,,g ,,,, e 15-1s.1Ym.,e., ,.s,..7,.,, mg. .. .-,-77.47 ,.--71-sm-7..-77 . .me t,r,-fs-LQQQ7-M fffwfe Q- -.4-77516-A m??m,W5 .V ,M W. ,,.5,.,,3 .L Wm, ,rr,,.,,.. mei -7 -.W,f.g,fE- 7eQ.,,M,,e -. , ,,..--7,- 7-- Q. ,7-ff,m,7-,,Ma17- .. wwfcaf .Q-e.e.sfgg,mg,Ss,7 ,,-e n . 4.75.77-7... .K ,gq,..e,. ,.q,,.,-U 57, - . 7 is--.leaf -fskggfmm .f-fm-7,x,-:7817s,wife: 7- - -mn--7 7.-77. W ,.. .. - f- nu: .77 .- 55,5 .gg-73 ein., - 7-izssie, - --gam- 5- -17-fsxree 7--17-7 :: . ,- ,., ,7 ,., 7- I ,fee-sh. .1-:sex .: 127- g-Kaz. , ., 7g,A.5,f ,-.sqm V is QM ,-7 A 74 ,..1.131,177,Q,9?,r .. ..1--.5--:ew -7 :ss fa- - A 'J-:, -.H 7 ' 7 7v-7 MA' -7 -U71 :-.:- We- 9 7. ' . .1 S 1531- iss.:Ei?5fi.1,i..,77-'i.Q':7-77 +-1f.fQ5K2i-H - . , -fr -f5g.k ggsgg-fw- ' A gfsegsifggiisv f-'ELK 552,522 7: - . 25.2 , -'.,,f ,-gifs'--,' 5 azz N 7:53119--rr-1 'X '9-'7- 47--',LSilf'.s' -- . X - W- ,vii F T. L' A ' V... -- , .. '1 1'f- 3, , 77xr4srexLs's,. -IST' :s--.sqgggf kgfiimss 3137 r -,- ' - if 1 - ,EH -r ' - ii QT fe5g4ef:f27--7z.:.:f7- 7 au-77-ge, -- 3 fm-fzszi. u-c.s:2Es7..f,.e-.7-eu. Q W- -- 7- 7222- -- .,Q-2 ' -32ase?4s2ss,e3m 7 21 i 23 If 2 2 :3xw11y:iggi353i55?5,51gS715615?f2:ViSw-fg555i4-- fiiiiiiibfisi-521.123 jagyxlz-5 2311-iki sstzsgefi-f,-5755 ylgfwbet-77:--7,7 .sw-.f3, 7. - .. 7-we-:ww-F7-Y -'71f1vswi4S1:s7s1: 55-ffr..,..2-we-7 :fi7'S1.i51fStJf 1'--qef:'4z.5f2t.1z2 ,zas95 'Z-59497 'H' -'WWTF' iii-WY'-55175 25555453557 : -miie . 0555221275 '. ':alEf,: ,aussi ??5::w..fz1:t X 7'?--5129: I2-1-F7--'91 213552155 . 97557125-' ' s -I ' LU':'fy- .:m,:1Q1:' --7,-H7 .:-:.. 'IQSTNLSY .,J,.1 fi-.f7?fi27 5.39735 MRP. . 3. .f7 ,A-Leg S vs Q 7 3 e we X , ,S ,G 2 fume S we 7,1 .5 J E W if 7 S I rg ,, 275 A 52 , e 2 5 7 X Sm 4 Q 3 K Q92 fe 1 xx K 1 -.fs--v 515-51521 2-5231 15,,zyZ,Wf11 Q-7-77-wg-wma,,.., . 'S is e ,J 5 e if . 11 5 sm 2 S 73 ,Q -2 ,.. .---, S.,, ..--,. 1 --' ixifeiiii qi. + L' -i : E551 N M qs 2 Wig, E fs. so 4 5 P Sv .s as S 3 as x S' 5' ae -H e11,,..7- - 8 1 W 'f-xii' 1 2 S sv Q- V '57,L71:5i11fsWL:nil5g- ' we-.e,77e., 725252.15-.fe f,'7gssz?3f sw.. 45 Q33 ig.,-v Ml giffgg'gg7gH7if , 7gS7 A we we ss. we asm, ge Q we 7. ,3 fs.. 1 ' 332212 7 , ff' S .a,w,.f, 15-+..5.s M ,r. , . 177-- ,..77.e7.S7x,-vw S N Pilgliiii' wailriigf E511 -2. 1: 7 1. -W' gswsr 7:fL-sw .we -7 . .M--W ' -.24-P ig' 711,715- wr-.ss7e 3s 7s7-..7-f -7 7. ..efmf7se eg-S33-iw iizgfxfl-Q gzglf 7 . ?452Li7Q4Q7.4 csf77.fPg,w. z3f'isi' , iz , esgfe5psz.feri. 7.37, 7f.sw- 1151-7175. msg Szggfwgsgszufie --M-7.7.73-.5 3g7ggQz:e,1f71 ge7g.7'f-wwegll-fgfi37 -- fi' ' 'if?13f 5 e,ss7 4 ' fa .. .1 e U- 7 ,, , n 8 H .Q el.. W M Geri Joseph Nancy Kacin Glenn Kahler Chris Kalman Joe Kalt Harvey Kaplan Janis Karp Glen Kassing Andy Kayner Danny Keaton Sandra Keith Jerry Kelleher Steven Kelly Pat Kerth Kerry Kettenbach Patti Kettlewell Marifrancis Kidwell Ann Kiernan Harry Kight Candance King Richard King Roger King Sharon King Susan King Tommie King Gail Kircher Linda Kirk Linda Kisinger . j im ,rf 9' EZ . ..,. x 5 2,9 -rp if A , 513 'F . t' h z 'Z' f ' L L - so L fr? 1 L W' I f . .1 1-W . ' - ,: 'f ,SK X t -mfg 7 ,..,kv :E :ZQ A X . A' . . , ' L QA EQI A l L riii L' .rL., I I . . . K . -kL. i , V . y K ,g LY'L:1 I L - . L7L' y A ' of L :I mmwm bglgg L ' r it. r . csy r .. l r r Members of the International Cult of Body Mashers, ICBM, had difficulty with their Home- coming parade entry. Danny Fox, Chuck Schwartzman, Chuck Meade and advisor Mr. Lowell tried to find the trouble. 1 cicti :fl L wi - L :el f if . Tom Kisro Denise Klein Denzil Klein Gaye Klein Bonnie Klisch Chuck Knight Kelly Knop Carolyn Knorr Larry Knox Tim Knutson Linda Kopman John Kososkie Stan Kramer Valerie Krueger Steve Kutoroff Steve Laemmel Frank Laguna Roger Lamb John Lancaster Mike Land James Lange Mark Laos Dave Lash James Lassiter Susan Laughlin Irene LaVioIa Eddie Lawhead Arlynne Leach Junior ,Vx 5222 2122221 12 Q I Leger' 122222 -gg WFSH2 W IS ' 255 w 155833 2 'if' 2 22 2 We wif . X 2? ESQ? s22sf?2e.2 -. 52g2g1.,g 2f2 . Wm? 222222222222 122 is 12 2 Q2 22 21 1 1 2,2222-12222222 -1 . ,,1 222122222 22 22.2 fi, 2 2 1 15355 2 'a1 '..,...11..12 22 1 very? -- me 12222111 eww' 221 f1'9iiff3SHgs1?'geZ2 122215Kii222S222222222S2?221Z22m.12-1222 2 .w,A , 22 W 11 M94 .- -, 1112 2222223222 - 122222222 .12.11... 253321223 1 1 N, 22s12,9q1.212, ' 222122 2-2:2511 .. --1221229112212 . 2252222 222222271 ,2 52 .2 ,121 - - 21 1 1 12. ,,L2,,u 3 2 15512215 , 55 2 as3311Es3QL5.,Li21 171112 -11 1. 1. ,1 .1112-2 12: 2 ss51.1.2v122112 -2 2 S1 H 222 221255 21,22 .1 ii:51YS?1s5E 1 22 aa 222 S: T gs, 2 Z S91 sw' S 'G 22222 Q 2 mf '22 W 1 S ES 2 11 1 22 gi H21 .S sm 3 2 9 232,12 5,22 ,,, 2 2 fc sf 52 A2 2X2 2, 2 2, 21 W 2 -nz M Q 2 822 r 2 .VAL 1-11.2, 2215.111 9 fssie-'S ,v.: wi22r'5 'S'LsvWE'v:9zxissS'3'21129isaViQE5fi,2'f5 1 1 .21 151212911211 222. 11112-21 -1-2 g2n1M,g22225 f n 2g22,g112?'2ggf2222222g2:31 552121251222g21i122.2?22?I2f2:fa2f2g1ei12 2 fi 152212-H 523 12 2522125352212 Zifssw we 2:2 -- 2212 22222521 22sf12.m221f221221 - 1 2212,1,2.12111U22.11.21- ga A We 1 5. . . 1 . 2 22211 1 1: 21251221 . 1 1 .1,.. 5121.153 3211293 , 2.2 .212 1 2 ,,.., -::- 1. ,, A:,,.g,,AhD,,,.. ,1 22121222 .. 1233221 2 21.12122 121 2. .2 ' - 'Sings 'g11':-. 128212-32212 2151g21 212232,f2 22 ..,,.. 2 ,L 2, 2,2 , 1 ,,.g2e?g1.2 25?222gg'Qge5'31 - 12 2. ,1 - a32222121Hsf:i1 Sw? 1 92 . 2152252123327 ':,,,g52g:51,,- 3721512 11:12 2 2122211522 22.111s511212,11 2 12. 1 11. 22fff1...:1 11122, 1,527 11 1 , N., .. me R22 2 2 25 2 si? -X. 52222 2 222 , .3 2252232 it iii 2? 2 me 2 'A git 1222 2 X12 Q22 E if 222 225 221 22 S2 22 2221 is 2211 ,H E 35? 21 22 52,22 1.f2zs11,.21f1..1111.q, 225121222 2 E'E:21?xS6?5k9-El1l,- lass Janis Lynn Roger Macaulay Linda MacFadden Mike Machen Jerry Madison Nagui Maghrabi Laureen Malas Gail Mallins Chris Mangels Marie Marcantonio Kathi Marcek Karen Marconato Dennis Markle Sharon Marmon Melton Marshall Windy Marshall Sherry Marlin Stephanie Martin Virgil Martin Gloria Martinez Margarita Martinez Mike Mason Andrew Massingill Virginia Mathis Debbie Matthews Randy Matthews Ricky Mauldin Deborah Maxcy Vicki McCaslin Linda McCurry Douglas McDonald Joe McDowell Caren McEwen Kathy McFarland Marvin McGhee 2 E we sf 32 128 5 2.3 22 2 2 2 2 sr 23 Suse in rx 22 4 si 22 2 5 ir 2 'A 5 S 1 2 .2 2 212 1 , 2 2. 1 32 2 29mg',::.1. ..e?1-ff ' :11slf2r :,.. . at Q 2? 2 2 S N, 2 X2 ffm 25 6 52 SS S 9,2 2 2X Us 5 H 222 E 5 21 22 -2 Y 'X ,2 11 2 , 1 1. ., H22 1 '22 wig 31 3 22 2 1 8 22 2 2 2. .. A 111 ... I 'x ,, L 9- 2 2 2 2552 0-5 W2 Q51-1212 'rr' .ff .:s1 . 12512 2211.5 ,, .2 1 1 5.gg.1s'f2 A ffgz,. f,,i212?12 A s ZR 421 VWQQ2 K3 22 22 2 2 2 1 , 12. 3 K , A, 2' 5 22 2 5:15112 22 21 Eiigff 1. ,1 1 161 1 2 2 2 2 2. 2 22 2 DQ , 2 2 2 2 2 2 2 .2 1 W 213 2 2 2 22 2 3 3 2 at We 2 2 ,aa 1 ,,., 21.252, 2 2. 2 1 2 2 2 A 'D 2 e 2 s My 2? 2 2 ep gf' H2 2 2 2 at 212 2 2 2 1 ag E KX 5 1, 22 2 5 2 'G 2 11 Claude LeDuc David Leist Raymond Lekawa Nancy Lenches Richard Leschinsky Bonnie Lewis Henry Lewis Randy Lewis Red Lewis Rita Lewis Steve Lewis Tim Lieser Dianne Ligner Mindi Ligner Jeff Lilley LeAnn Lind Warren Lind Carl Linkhart Debbie Linsenbigler Wendy Lipari Bob Lockwood Johnny Logan Donna Lombardo Alex Lopez Rosanne Love Margo Lowry Margo Luscaleet Fred Lutz .2 ., . 21 22212221 1 22221 1221-21211121 121 2.22112 222222212:122221112 -21 11:v:2122f'w211211m21 12221ff12121212S1w1221221222121-21-2121211221ff1211:21112 - 11 121 11,-.11 1 2 1.221e2121211121 21121211 1122sf2112,2211221 211,221-f112-2121,112,.f12111,21,.21,111,12,111121212121 'fif53?9512222??2?i5W235i5ii2W5Z?f2FSF22ff 551522-f1sz421s?i2i?12?21:121142151131511?2ffs112m 'fii4S12f.21,-211:121121-1f121,11.-:1'f-11sff:1115111111.-,112 i 2 121- 25422322,22122212?1s?i2gg22g2g21gQ2f9i2Z22i2'f22212f'12 12522N115H11f112v12g?QG11f111112-:21521w12121wf 22222221212212,12112f:2zw2-11:22 r1.a112,1:f1-211,,1121,1:.1111111112111111 112212212,z222.22212121: 112111 j22Q,g?12121s1g22f5g52a2 Z ?g22?kz5g22'?22120? 1 f12 21222s125?22?2f1 N 11 1 12,2 22.2 2 11 ,11122111 11 . 21--22112 3212152 222W22,112,... ' 212v12w221f2 f.12f2,121-fwvlw 21211211-s12 12:11211. 1: 12112221.1111 - 1121112-112212 121,212-111 2 21221g!..,,,.2,1222, 1222252 A2112 2512823121211 2121221221221 11.-111112.21-1211 121 12 1 2 1 V1 r.1e1f21m1 ...EM 7, ,122 1 ZW .2 -WH ,, 72145151121 1 1212-122-.21.h 1 1g.w1-y121rg15. ,.e1 2. 1 , tw., V , . 12225212-121 V.. M2342 ,:m1,g11-, Qfifiioifii' 5252325 1 155 28 1 2 ' ' 1 H 8 22 K 2, 2E 2 2 A . 1 2 22 4511 1 4 ' 'Qt' zxnivlff 5213? 'r?:I : A215151 ' 51'i'1f' P7122 fiiflisfs 11i 5E ?:: Wfiwxi J 1 1 3533215231 4: , 2g21rs1'Ps J15g,5g1Q, S1 .E' T ,.11 2 2.121 , .. My ,-2 2.522 .x ,,12 -h ..-Q 922-1s1, 1 11 2. 221 2, 221--212 11 1 ,,.21 1 1 2 2 22,. -- -- . . Q21 vm.. 1. . 1 .1 2 . 2 . , 22 ,1. ..1. ..,, , 21. ... 21., 11,.. 12. , 2, 2., 1,,. .2 2211 .... 2 , 2.2.2.2 1, , 2 234,251 2-21 .. 2521.22 22 2111. -21 121212 211112 ys2q2,11.: .. . ?'2-2 f . - 2 ,1 1 22, 2222221211 1..--f. -12 1 - .1212Q121221 211-P111111,,1 -1 . :- 1 2 135211212 211 .112 21352 1213 213 222122123 21311152 11:1211:'12,2, 1 ag 21 232112122 52 222:- 1-I 33.115111 5511121221 X 22 ,2 2 .-231:21 S 2 211191 22212 1+11211 1-.a 122212: 2ff ..2,.:121 -1':..a:, -1 .1 1,'fsv'f121: ...X 2,-:.,,--1. 1221122112 -152g1g:, 21, , 11 2 .- 1121212212211 222221.15 -1212f11511 .21 2 12.212, ,,.., ,..,1. , 1 123222112 . , , . , .2131 2 1,12 ,. ...... ,..,, , 121 , ., .. 2,.2.22N,1 2 ,, , .22 ,,1,,.,,1S. ., ,1 111.. . . 1222122222 2121. .,, , ,. 1 --,-., 1 21.2112 2, ,,..1 121,121 ,1 21 -2.. . ...11 1112 2, 1 2 , 22,221 12,122 212 ,,.,12,1222,2 12. 21.21 .. 2 '-xxzlsb 1 . ,W -P5112 1: ,- 1s1421:w111 QV- 'W iner' V: 1 1- H. 1, . 112 P 129'sa1x151f1' 'J '11- 1- 054 .. : 92 -1121. 53112 111 1x1.11 - . V .. :- 2 V A .1151 - V, ,- a5's2rR3YP51 1 1812- 1 :: 1 ,:- :1 1 715511191 Rim 21118, 1:-1571 1 51 .2 .12,. nv' 12-215 L Kiwsfar- 12?ff1r' .1 TJ1S22?21fm'?l2 2 12555 122' 1 2-:-.-32 1212 12 f?ss11212125f11g11-P1 ,12 1.-g1g:1'SP?12.1N .: ir- Q 2. 1:,,11211,, 14S2'if2'3w52?F35Z12 1efff12 1 1-fc1111f22.g21.g11g- 51 P21151 2 2111112251251 12-f2211f111?fg 2fNS'ifa512 'inf-11, - :112?12,12221-12351 2 2121. 221: H 2?f212222s22121h.,221.a2,2711,5 i2qg222.222212,22 -211,1 23. 71 2122122.21221 2 2 , 22 1. 2, 2 5221 12 . f222,222212,2 fig, -- 1222.2 2 2 2 ,, , - fs212.w2s?21?fQg2i2,22z221a2 1 'H :2111:111f11f'22 12v1212f12f1 K' ' 5 . 12255155 :V WM ? ' 35 fwgr QTY? 1255955 1 ffl? i 11,121 . 1 '.11SF1ss1'12t 5151 .' : Y -:E fi :I-2-2 A . 1 ,2 WPS? ,Q-125i:efg5j '. ' V141 IP1 - y' Rimini 2225 5655 ..iE:ii1: 1 ' fs. 12: 222151212 .211221f12':' -f111s1 ,: -11,-122225212521 11 212 12 2 21 2 A W 1 11141 ., wx . 1222121511 2 1f2,1','21 1-Pff1g122'2 . 12?121gPm1gw2 2- f-1 1s 2 22,'.1f::l 2 1 - fm 12212 121122222,1222122 -1 . -1 12112112 ,. 1, 11 2 1.21f.1211..,221-1.,. 222122121212111212 2 2 . - 1 11211121121 12221121 .1222 2.. 1 -- 1 221- , x 1. sf ,, 1 1 2 112. 1-f21:421,1121.? 2 A ,1.222e22121222- .22. 2.1..112.12212 -- LY 259 .rm X K T 'bi :L 'NT' Q 11 3. is Qfwi 545 'if' l . Y Z ' l we , e w - ef K ezj . Qu: p4,,. fl, SQ S K N, , is J 'V M ax? 5 ,QE M, 'X J flew ii. - L A 1. Q, 5 1 , 1 Irving Mindes Sherry Mishkind Barbara Mitchell JoAnn Mitchell Lynn Monka Tom Monlano Mary Montgomery Buddy Moore Debbie Moore Gerrio Moore Judy Moore Liz Moore Phyllis Moore Sandi Morey Keith Morgan Rosemary Morris Michael Morrow Pal Morrow Ken Moulis Maureen Mulrow Heather Munday Tom Murawski Michele Murphy Timothy Murphy Jim Musgrave Barbara Mustakes Vickie Naliwski Pat Nava Gumie Needham Bill Neel Carl Nichols Lance Nichols Mike Nicholson Connie Niel Carol Nielsen 'lg A K f. :if 1 ef L Y yy I -,1 ,, A o ii 0 , 3, s J New X I JS, X , ia 1 ' - V ' .:fl.u,, ,.jm q fre S J-. 3,55 f. w-. 1'.,ti, cia'1'5 ,.f ' 1 F : K . - :S fi 2,55 f y if fx 1 ' ' .Q . 1? Q ,-,- K M ,Ii . x D X gs, 3 L 3' he , ,,, S S get ,gee ' S , gc ,Aw QM , is 6+ R 1 ., .mmm .. 5 Y Asia-f-,v.' q ,el . , 5131 . -f me- - N wif 5: 3 ia ifj 1 S M if Y A 4 we 4 lm S91 'N , lg' 8 e. .V ,Q A ' 3 ' J 5 fvl f x sf X 5 as f i y -gy KLAKKKK '. K K' . A V A M - L A f i'l?f'2. 1 '. ,. sk I Y is ,asf ,, fm : if fur 'HF Linda McGlothlin Tom McGovern Malcom Mclntosh Nancy McKim Diane McLellan Lance McQueen Karen McVean Steve Meinhausen Helen Meltzer Patti Merrill Robert Merrill Debbi Mers Michele Mersereau Vicki Messing Chip Metcalf Roy Metcalfe Susan Metzger Joseph Mick Jenny Mikel Sally Milbrandt Edward Miley Debi Miller Frank Miller Jeri Miller Paul Miller Steve Mills Dave Milner Tracey Milner Class ff 'Z'-H lg 3 , 'ff V' we if , ,Q SL fe 23 9 - : 1 5 ,L is Q 'Q L ., f fi gg I ll Q ' H A 4, Il lx is 7 2 a gf ,f 4 Q HQ Q 'fe if ra X , we 1 M vm C . 'S 3 . 'ii is if 5 1 gg , B of I969 John Paulus Wendy Pearson Edward Pelc Kathleen Pelusi .lan Pennock Lynn Pepe Art Perfetto Bill Perkins Gary Perkins Jim Perry Ray Pesqueira Eddie Peters Lauren Peters Judy Peterson Kathy Petitti Janet Peylock Bob Phanton Dawn Pierce Steve Pierce Susan Pinter Sue Piper Bill Pirollo Donna Piscitelli Kathie Plett Chip Plowman Mary Ann Polivchak Pat Pollock Betty Popovich Richard Poppen Fred Porter Kathy Porter Keith Porter Roberta Porter Sherman Pratt Deborah Price x 277575 4511! if I, , 1 i ., . i I ,.1f,1 f gQffQfg,,-f J ,. 1 e W. ses . ,k,k . .,.,,.. . ... 1 . gs' . 515 'F fx 55,5-,kg,u-,--,?fe:- - 'fZ ',57f:' ' I: W ' 2, 2ff.ifa,':f,1: ,1., '1ffffL,.,, 11111, 'P x 'J Fi, a will ,sid 2' iii' sf? Z, ' v ,, fr ,zz li ' 2351 liz + ? f 'W ga 3 J f gnu -2 1119 . .. , , lj X Q ,x 1 as :. rl. W p , :yp i yy i r y yiyyy gygyy y 1 ,sei we , s3f1,.,w .f J J ,g gzsfz 1 N sz! 'F' Je if v. ' 'I A if 1 5 s 44' Q c e mi 1 s Jr 4, Q 1 sf S+ is ff se if 3' , me Q S Q3 2 2 'rf- :gs e i ,Q El: N . K af' i Q S ,ee W wx ' swf ,,. .,, mei 'vw 5 ,.. W. ,K iusiwmwa 4 N E , Q. ,ff ya, .W X s Q 1 4 l T' P X, . 4 M, f . ,mf fs' , 3 , , k 3 35, wa ew .- -2. ,, ,.....:s .. ---- . - J I ,m i ,sw f V, 2 J we .. W ew E M.-5,7 K ,v ,, . , , ,,m.:,, 3 1 sf , ,, . ,. , . ,I a- ggqeees, Siva et nazi? ee Me. wsgq K M: Jmfm ZW, . 1 52' 'gi , :ff f :,:,w 'Y ., ' 1' iii Q. t A A, W - :f'.'jjaE3: 55:1 CIT f, 1., U., ,f 5115, . i 'J ' gf ce, .f L, . , ,T-I-g,..7,..l , 4 , f, f Q J V ,.N,:'. .. ::f :: :: - ' N- f wi, f - - Q I if A fi 5 y J f J 1 Zriififl f , , , -' l,'G:'f'E 35?i9?L4,l 'MET ,I 452' '7fwz,,,ff55 5i?Eh, W 5 , I F' ' .eiififs . , ,liiwfa ,ia ' filixw., , ,ef-'QF' ' , i. ,,jiN575 'K 9 Ilyzw k g ' '. li A l i if V 3 51, 2245 157' '1 J 1, ' g , P it ew , S 1 we f ' X 1 w L K 4 i K 3 i ,1 fsfwess ie isgeewge-.Q', ew meveenea f ff fm??lLe:wsv.es siefkiigsf? .1Sg,L.,Zgnxsf'L A, ' swgsl is mseeisgf igfslefeggf sssteqeg www feeissf igwz-ff-2,121 M ,.,,L .,,.. c.,, . . , .ei,.,,,.i 553.5557 filkiiz' - . 4255115951 wsfixmsv' 1,-vriQg',V z1e,asuS3ifsi 5w1sssse,9, gf:,'fe,e Asge?'e:s.: . glwm-sepia. cfs 7 ' e v'12w+:v11ez1 ssif6gs1e5N' 5.sS2i5 ,. .,:. .:. ' - 1 if 1-.fm ,, ,2,, .. . E., .L ,, , B Q fe,fsfefge.efggegfe-ess , , m:,m,.e.g, ,,-.m.l,s,. 2 2 S Ki - U? 1 ilmfe s 'ld isfi is ,, , Q Q X J 2? W Q 5 if , fs as in 1 ?,.s:zie?mW TE-fzillzllffsfli YQQS WIQ5 ps Lfzggz? 4-ei ' 'K YL!' :' i'S:'??:, ' ' JZ ' ZIVMKAWS' . , , Q x f jg ,Fi me ,ii ?Effi s5-5f?l2'E7'-57'iffirsliifhfE?fQ?7F:gS?7l7ilf3'7l.5 f. , ..,-g,,Q,..:-rw f Debi Nilo John Noble Ellen Norford James Noriega Mike Northey John Norvelle Linda Norvelle Debbie Nowocin Anna Nussbaum Merylyn Oberheim Pat Oleksy Betty Olsen Candie Olson Darlene Olson Bambi O'Malley Mike 0'NeiI Jerry Orcuit Wayne Orenduff Bill Orinski Kathy Qrrison Vivian Ott , , if if 5 IPL gg W S is Cindy Otte Dave Owen 1 GWY Owens Geoff Parker 1f5ii2E 7 'S'5 557 Jay Parker we K 535 9' 'ASA vii . n 41.5 Dennis Patterson 5235 '-525 1 :H al iii- - , Bill Patze t . K, ,.. z . ,. Ji. H I FXS: ' '. 'Q' ', IE f ' V32 1 1 I 1 1 r'-i J' ' , U M I 'Y X 3,-.gi ,.,... ' 'flu . Q 4 , J. 1' , ' ,, ,.,, . Q, 'gif ' 5, .M ..' , 'lifi , ' .e , S KZV,.i,.,, 1 Lgzgm .,,i,,ux V E' I V., .Q Q-Ei. . ,.h l K s,f,f iwwifi' :S .2 ,.,, K 1 we sk N , , I ix J I ., ,, 'G 'lf , Beth Prowell Karen Puckett Ann Quebedeaux Dora Queen Christopher Quihuis William Quimby Karen Raffensparger Ann Rafferty Flory Raicany Glenn Rapp Coco Rarick Mike Redding Richard Redman Kathaleen Reed Michele Reever Randall Reeves Tim Regan Frank Reich Hector Reyes Sylvia Reyes James Reyna Calvin Reynard Mark Rhyner Lillian Rich Michael Rich Cheryl Richards Ruthee Richards Deb Richardson . , K I Wie f 5 A in xiii K ,Eg L gli V . 7 .s , 5 f A ia f. - . K ' get J -f' rf. e as it 5 fit M 4- 'Z' T5 awe R N R we I S is :Q A l Y R f R N3 ,W X ,. .--gg In E , ,,. Q A M, K irr K My . rm K if ,Vk U n : t, , 7 , so . .,,., M H A -'i li 2 . Y - QV - if Y e'.', , f ' y i ,-'i . l -W - - gf- ev.: we - ,se - Q , is Q . A .. Q is. - 1 l R ' A r e e 1 it I , V ' 2 'L if fi 0 iii ,I A 3 I K -A r ei. N V I 'ggi c, f f A as E R Y , 'T 5- ' 'fi 1- - R i 5 V- f 'av' 3 R ' gi 5 WH? R ., 1 55 e vii 5 ii X , R ', if is i I 4 ,lg is W ceel e J u n i o r we K3 . Cars were decorated by students who entered the ball game. The pep squad, who led the procession, encouraged spirit with cheers and school songs. car caravan to Catalina for the November 2 foot- Judie Rogers Darla Richey Bryant Ridgway Maurine Riggle Kathy Riland Carl Riney Dale Ritchison Nancy Rivers Jacki Roach Mary Roberson Steve Roberts Christine Robinson Dian Robinson Robin Robison Shirley Robold 'Sc Leslie Rogge John Rognlien Sandi Romero Janet Romney Diane Rorbach Cindy Roth Nelson Roush Rhonda Rowe Gretchen Rubendall Richard Ruff Ronald Runion Dennis Rust Debi Ryan Class f' .. -1, 'Q' fy . fy 1 J ag ,. fi ' X 31 . 1 Y . . 1s1i1s1Q 1 A ' 1 111 11w,11ia+ie -' : 1' ' 1 if?-ez E- 'Y' ,' if -1 1 f 121 '- - 1- ,5-111, 1, 11,,,e1 1 ,1.,,-1,1 1 W11 - - , . r 'y 1 lem 1111-1 ,113-13 .M We ' 1 - ,111 ,: 1 , si. iiyii im - 5, km -Qiaw 317 ' , U1 5 In 5,11 , 4? figs, , - 1 1 'lie' f 1 ' 0 75311523 4121533--in-fwi541212?535511411511g1a1fe3'1.-1 235492-fvzla-1595245115655 fiffiisii'iifeil-liifzf Qs1Mi'He:ff9ifi?f?Wa6Yt?i'i?3f?1e?iQi:eii51f 1-R71 1 w'l11,z 'f, 1 7 ' -f 11 wa, NZ?-1511512 111315411-wx as 111.111-1s exif . r , fe:ef 41221-151 Nw 1 . L 211111221119 1 11wfg1111e 1!Q:f9i'?e2g14ez1 Milan- 3551115215191 M e-111 s:::w11- 11s1v:' w 1- A 1..1s:1wiM wigaztiff fifiarfw . Hwfia ff1e1lw- -- -T . wfrl .111-1134 11-1:12-1 , 11-11 - 1--1111 211. -- ,W,11,x1,g .1S11,z,5..,, 19311111111 521111, sgegee 6111 -1211621 .. 1 1 1 , - 1, , 11 11111, ,, .1 , t1ei,:se' 1111. 1 11 , , Leia, if-211-1 I 1, ,. - gy- ' - 1- 1-1 R - 1, 1 - - .1 ' - , 1 I 1511151 .1-f - - 1121 511119 511111111 A-'wif .. 221.---M1521 Stgwafe 1.1--11.1 1 11 1,1111 5.1 .. ' . 11 1,11 .1 1 1 , 1. , 1 1 - 1. 1 -iw 353355135 Q 17 431 71512 fzfiii' M2452 ffigfii lleiis giisgglm h is-'?Li11'is49i 251. 1565555953 311551 Ti? f i FSS 11:i,- nl '1 ' 11 i' ,.: will :rwzw ' ,isamsw we ' 11121 5221: rgfwi 1gQg5Q,1 ,i2if:-was if jill : -'11 '-fi 1 1-11 H 'a 1, 1 1 1 , Y1 1. 1-we ffm 11311. 5 111- 1-.11-'Q 11 -29231111 .1511 211.111 - 211 13151551121 , 111 2 11,1 21 ' 1 f' '1 , -'13 -, QE, K :af 9 5591211 i. , ii ::,1 2213112511 f Tim! -1. iflllfi 11 1,1215 if-J.'tT',1 '4l 1 ,-V - 7i1': ::1' 131141, 15.1 11151, -11525 -L, -:f ww 2 1 15- 1- '1 12291-2 9 ' 1 ' ii . YL 4 of 1 A 4' E12 ' T 'aw Q .1 1, . Y 1.5 YQ 21-112 ' 1 1 V Q M A 111 2 v 153' fm-215 - , -fi 1 ' - L, . V11, 11 .. :L ,- 125 ' - ii .111-'11, i,-1.w- 1 1 12 1 1-11, Z 3' - , A 1, M. 'HA 2.4. z. . 1 1. 1 , ' - 1 1 12:5 1 .- of ft , ,, ,. we ' 11 .i,11f-1 1- if R f Sr, ' - , y -K 1 , kiyy 2 V1 Y K, , ' f7W5fK':Qfll1 M -3' 'W 4 if 1 1 ' V,11 'fc :gh - Y- 1 N -R Q4 1 1 'fl kiky ' L gg1,s3,1g fi'L1fV'1: s 1 -11-'f1 11f1? 1 as 1, 11,51 3'- 11 if 1, 1. 1. . ' ' fi K H K A ' 1-L 1'ii 1 ,- filth Q lilikzl 1 f , gig Y' 'Q' ' 1, - -sf 1 . L- , .fr in 1 1 'aff' if Y 3 Vg Q 'We I N 3 5 .. , -wr gk f -5331555 ff!fQ 4 J' g f 54 Z 1 A , 'aw an FW fy ig: A 1 , 2 li 1- wsiv . ,I 1I,,al:QL QU 7? ll - llQff11.?lXfl ,1-1 : , 11. 1 ,1 5 1 S1 f 3 Z1 1.1:- X ee sf z . 5 5 ,M , 1 , S Tl 'li ,-iv S1 fu vu 1 1 as S ,, 1 1 1 511 -1 1,f'f1T A 1,11.c- 1- 1,gg 1,, ei 1 E? ea? 5 ' lglllll 'sw 1 ,E ilu 'V ' 1 if Q mi - Joe Ryan Mark Salcido Suzanne Saltzman Randy Sammons Linda Sanborn Art Sanchez Bertha Sanchez Hilinio Sanchez Margaret Sanderson Chris Santi Mike Sargent Joan Sauer Judie Scalise Robin Schaefer Beth Schenker Dyan Scherer Sue Schildmacher Donald Schmid Stanley Schmidt Dyanna Schmitt Gayle Schneider Jack Schnelle Patricia Schroeder Margaret Schroer Derek Schull David Schwanenberger Karen Scott Billy Sealy Craig Sebree Charmaine Segundo Sue Sellars Marcia Semlow John Shaffer Mark Shannon Alan Shapiro S Joe Shapiro Robert Shaw Terry Shaydak Gail Shelton Rina Shelton Stephen Sheppard Stan Sherman Chip Sherrer Julie Shinevar Norm Sholin Geri Shopf Brad Siefarth Cassie Siefert Gale Silverman Todd Simmons David Singer Doug Skarsten Lynn Skevington Pat Skidmore Colleen Skiles Craig Slavin Richard Small Candy Smith Char Smith DeEtta Smith Janet Smith Lynn Smith Marri Smith Michael Smith Nancy Smith Renee Smith Russel Smith Stephen Smith Tom Smith Dennis Sneath 42 1' we fn? if-X 3 if A he Kg ge wi K K: y yy it N gp Z by his s yyy. . H . L ,gi . V ww, :v:: Hg. kg t Ya I sb iz. fig ef' .V J G f' ,-' ' 1 . . ' ,. . 5 5 kt : X Lgzl Z 'v-,... g.:?, x . fn ,...,,TkSr .. is 1' ri 'll S l i wee K X f . X S M S . fi 1 J 2-fn - ' . it,i W' . W S XISI, S ' X ' - --I 2' . S :S - . S V S 1 it - . S l eee 1 Q So if J S it S ' 'S t V J 'wig if jf' . T- ,,.. f ' ':' I I ' S- A J E ' 1 j .. .... H - - - S - S 'S . 'Q if ., S S ' - eg . 3? ik, 4 ev ' ir I E ii if , . E 4 Q LL A . i if . S 'f H 31.5 ,.. ikpy ... . -f .1 -S-on 3 , S' a, 'S-fy S M ' Y . J I .'e' Z . . yy I . , J. f 'S -:..- ,.,, . ,... :.:::-- ll J on X - - SS S i-. i S -, -1:5 gs Ng? , Q, S . W: .1 'S : J. S Si 1. S S 23- . S V , 2. M 1 - it Q T 5 if S A S K - fm f SHSQLJ 1 i S ig Sfs 5 S . S S lp' S. so S S . S Si S V S . G .S-f 5 . - X w -ji 4 . L gpg. 2 i if . ' . TS S 4. N . - we S- .. -SS S 2- '.' f . S ' TP S--S2 E S i f av ' 'N , 5- S - . . 'S . 'SS S I Vi .S . 'fx SSSS S S .SS .Z 'BQ yssn 1. yyy S' . S y S fy .gg k L V. .e, ' -2 : 1K :ig K .fy v m . .1 if 'A' i :Zz .swf f. 632, 4.7'EL6'5?ii 'TS fl: 'QWEQV 1. e. :,' J R 'Ml 1 S5 SSSS S 1 J 2 nf' 1 fi2SPe3f..5fr1 SmS3a ...,,,S ,. Sk .. ...X-5. .5 .. 3. S in B it J fl ,w,,1 Class of 'M Scott Snider if Ginger Snyder . if x . John Soelle 3 li P . ' my ' Carol Soloski ' .Nl ' ., if Linda Somonick Rick Southard . . 3 Jon Spanhook A A M X X K A g. Armand Sperduti ' - A A fS -- M L- SSSS S Marvin Spross . S . .Q - . - - riff 'i , S IS' P09 5lUCeY law .I S S S S V S Asss :e e . . if f HW 5 '9 'd 2523- S 1 - b iS--- H. Q ' Cynthia Steadman ' 1 f . linda Sleele , . .Q ke iye. Phyllis Sternfeld W q we ' s 'S 1iS'i:..SjV.2gg .--.. i.EQgjj.p' S . 5 Phillip seem-ss S' SSSS Y f f 1 if Baffv Sfenlwkken ' l e We 5'e 'e 9lQ5fl'..ZiQiS?5f- 'ii les X . S Sl.S 'JSSSJ J Y Joe Stevens Q1g:1,sfggtggjn S,.- -.gfw . - - -k,' . SS'. g'-5 - ,- wisq K U M , - g : , K , -S S-SyS Sq ek -- ..y.1-.' . . Jerry Shllson if .5 e stone ' ' I-fi g .1 is S ,k.- KSS. 5413 3 fd' i 1,-l ff-we l .i- ! Tom Stoops . ' -- Debbie Straub - SS S S Ellen Straus Peter Strong Steve Sullenger Jim Swafford 1 S - - John Swann N -5 P5 5- .- ...... A N -Q - . X 1- , Alan Swazey Songleaders Debby Kee, Betty Laz- eres, Jackie Ritter and Patty Bryers did a bench cheer at Homecoming. 1 5 gif-:eL?s 131 mm 5- 1. 5?-'ff A . H 31. we 1 ' lg, 1 wwe--sg 1 we ..-11 11 -- r 'fmt ' 45 - 411 Wfxeli , H ' ' 1525 1 R 3 21e,g+28,ge1 1 - Q1w.1w 15. - -mm- 1i 12 ww. Us LQ 1 ,.,2s,,. 'Tres 2.51 gj ilkx' F1-.5 1 zgigggggmg kz - 1 1 g X 1 S ggige2.12 ?e1s,1 e111 ers-1,-we : 25?2.1rf'1.-111J'F--935 1 zxfiissgei A , isairiisiegs 11.l.1Qg1f,fq1:-1,L .- ..,-1-111-11 'Q-.--1-11111 -' 3:151,.fi-W--:11-1--.f 525 ' iff is X 2 is P 3. ii gh 1 so -1 iii :iw Us Q K g asia W if if 1 111-ev. f 11.13111-Wes. -1-wggggeff sw: MS1Ss1ei231i13?1:S,353.sf+,i-f11112Ss51-MJM- ...,. S. 9. W , H -Liv le . 11 f5?Z?i51Es.f eilkfwifiiliwf' i ,. - .. fp 114.65 5 New Q ,f .,,. rw- M. 11-51.-e1-11- 11,91 -1Q1..:: 11 3-gefggigsesfgg 3 52.1, w -. -img an QVQSQR1 ' - ya, - . Qui-T5 ,Mes . -.-.P 11 11 -11-M,-i,, we H 11 ., W -1 15 mzwgeyfgsiusias, -mwge Yvfiitigiistki , ,W , 11151, 1.Ms.1.t. .T f U'-135 1- is .Q ft. . 5 qi. ,sei efggwgssyag 1525.3 X Z 57555: si?-SEQ? I 1: H s A r 1 r .,,,,1m1f, 7,3 xis?7'e:1 . - -- S e Q S N Q? 1 . Q se fx we-A-1 is 1 tk, 42 S, wa S, Yam Q is ,J 6 , 2 S rv W tsl BQ! W 3 S pies 1, X N K fm 'E 1 ,... W. . M as 11 ii X 3 We-53 is ,si .3 653221 1 H 5 11 Y, mlisgi 25 if 36:32 E by as at ESYQQESN at 1111 1 fm SE so ,eg 3 E M 1 N 5 S Q35 si Q 3 ss Je ,Q 5 1, lg -4 gg 2 s.f,.1q.,.,m1-1.1e111g11rs.11e . Q 2 -e1-we 1. 12 1 we-1: S Y rg if mi Q ,2 M ,sm -1,11 11-. 5 ,iw- NE1 - 1 - -w .g11sf:Q-.1511 1-51-P11-QAZMEQ-ef'ig.:-eL1z:-12 S ,1. .v, , . ei vos sg A WQKQ S 5' 55 'W il Sm. . . em S ss. gxw gl st , 55 S 'G 35 , Y 1,5 5- .. s Q , 2 is kg 1 X Q. ,X it we , Z5 ' X i '11-k TQ U .F l X 4 r ' 'E mx Y, . , 1- ,f,. 3. .15 1 . - .. , x S x 6 - -: . Z5 ' DQ 1,1 .V., Q ,.,. It T ,,,A,. my 7 1,e.,, . ...., 9. . gm. 2 ,. L ,Lew K K 1 W? . Jwk ki 1 1. X. ,mwgg 5 1 - -s 5-12,-1 WM, 1, Wg.-.k.f .1 1' 1' -ji it 6 5 Q '1 f 1 1U 1 essex-page 111 4 9194 11-2 iff S 5315? , ,wg an f ' 1g-ex 5 ' 5 . rays .1 up 2 k Y . 9 x RWM K , 5111: j Zh i , Q1-'t'fi75i'11ibi ' if 5 e 11 ' 'ifsvifg 15' fs .-1 wif-'F-1.vvf1e .- . S- 1.1-QQ1 ,,-. v ' ,H S Qi J .1 C s -Q 1159.112 , Q V121 H 1 5 S -2. f-5? 1' 2 FA 759 fix .L 1 L e H142 -A-1 mr .. . E1 .Z gs ' J , J Si- '5 f?Y: fi yi- 'J 2 'ff 1 - L58 - ' T - 1 111 .. 241-5 ii if, ' rss, , ' 31. , 111- Q5 iw i1 i 1 '4' 1-iw.-s - Q-14:-12,1 yi S ,iS5?59iQfE s-H .5 1 1 il ' . . , ,- 1, 2, 15--Q1 - E534 s2w?ii2:3.si5i4-1 -aww 1. 1 '- 1211.14 11 ' ....1, fl? 'V . ' . -pw W. +21 -ii-51 2 ef- , 'ez' ' if 5 W' fiif gg? .'- e lif ? T12 .. 1,2 1' 111-2 31,-5 11,1 1' - ,1 . -1 51 111153 L,-qjfjzs gg , 1,,1 .1 1 1 f I 3211 ' 1 3 bs : ' I S' gg gawk ,in-,'1 Mike Sweeney Barb Sydow Vivian Talaoc Mindee Tate Aubrey Taylor Clay Taylor Craig Thetford Jim Thoma Shara Thomas Cindi Thompson Doug Thompson Jim Thompson Roger Thompson Walter Thornton Kathy Thrasher Don Throp Brad Thrush Ellen Tighe David Tonkinson Dianna Torreion John Torreion Holly Towle Cheryl Townsend Renee Townsend Sue Townsend Cliff Tracy Bob Trisler -ei is iv ag E X P ,N Chrysann Tsaguris Rene Tucker Pat Tully Jolene Turner Richard Turner Dave Underwood John Updegraff Chuck Urias Jill Vactor Richard Vail Val Valentino Linda Valenzuela Gary Vandeneeinde Cindy VanDeren Chester Versailles Isabelle Villegas Rick Villegas Rick Vondrak John Vosburgh Susan Voss John Vucasovich Tammy Vukovich Cathy Wade Jennifer Wagner Pam Wagner Gale Walden Kris Walden Tona Walker Q. x. 5 r , w , I.. .5 .awe , . gi SH.. : 7-cv. 5 ., .R g .2 ., ,jg J. 1- ., , , Q af, K . X - ! 'zsl' ft? 5' . M 'H 'H es , W4 s Ui! l t 'Q Q 5 if ,Q X 1 Ji H ,E N 491 nl ix Ai' -- R f . .. ' i...., -' fl- : iw - . 4 . . -: , I 1 ,,-'L Sl.: '-, Ri LR ,T Y Q , ' , , , i f WW N X S ,, ef gh i eg ri ,E ,i xi 'S 1. XR f V-srl 55 W Q. gs Y, My gf ' 'G if ...vga ., 7 E, f Rag e A ., Q 4 lg J JA ' 1 fe -sie 53' f . 3 K. 3 X '3 D, N. ,Q N . . ' . Y A M ,.-e 1 1 me g ,, . ww- . -, JR ..,. . r ' R iw Rf Tf .. R F iii if Q ii f 1 'e.'l fi.-7 ELiP ii 'Y 2 'Wi . N We if f f' xiii -:im R i . ' ' 1-QR. .--i f xiii!! .zzz izigf K R ' lii 1 rm-:fs -Lf g.-sa f f swf X my 1' I' K -it X A 6 .K ,... . lg , . r xx K S '2 ,.,1 r be X fl me ..'f x , K :MIX e ' s r a . . fr-. f Q . M 'V is' X fu 1- J M . L- Re - . ' 1 13' X 1 A .Wf 1 w m9' e- , i .cr ' f. f,..KE ! iii ii if . Q. K 'Q . I . .4 1 , .e A 1:a. .-iff! -. ' Z' .Q Iii' . J L' 7' A ,..,. X 'fi 2 - ' .'.. ' H . .-f' -fs: ,535 . .-,.-, -, - 4 r ua .fl :o5'l.E5Y,,2. f ' 'i Fffiiisiu - R ma: , ll lu R, e vtsc. -12 A, if A 1 323' A , 5 2 X 4' 0 I e Q X . W x gh x ly Meigs F ii 1' R ,f f , JU- ',, ' 'if R . er . , ' J 'i - J ' i.ie R ':' zii U I eei if R 5-If . - r . . . V-fi C . , , -,V-. , an . ,.-. - . , at . e... -. . .... . ., y eiei ilii ,Q iw' . H J if vt W i :ii I 5 A 5 2 at . .gs - ,:. r Q R WX? Q el f Junior Tim Walsh Tim Walsh Chuck Ward Dave Ward Verna Warner Kara Watchman Dwane Waterbury Jan Waterman Tom Weaver Mike Webb Steve Webb Stephen Weber Tom Weber Ken Webster Rock Weeks Marville Wehe John Weinkaut Darrel Weitzel Mark Wells Sue Wells Jim Werner Scott Westfall Tom Weston Patrice Wheeler Janice Whipp Linda White Stephen Whitlock Barbara Whitney Carleen Wiese Bob Wile Randy Wilging Debbie Williams Lynda Williams Walter Willis Lorna Wilsdon A portrait of student Patty Loftis was taken for a class assignment by a student in photo publi- cations. CI ss -. ,t,.' - s u 555,115.2 1 ' e L Y 93:2 :Q R, , e 9523 ei xx 5' 52 2 5 , ' 1-, ffi gfq 1 Ig tttt ' P - - -' - ,r f ev, .i ,g,-i,'w,fy, 112:53 leg- .,.: ::,:s:- xiii fQ,jlEl5f5f 'ie 7 'gg-gishzgi wi11,-1'?1,':2egQ f .. :iglze ig:,:4,'i24 ffzi'112'? If Y7'if.i. gi, .,,.. , . K K 54, -. I ,.,.,1.:::z - , ,Q ,. .,,... ' ' sz: ., f - W5 .. . 1 fe:-ff:2'si.1:fwf:fs wffelv fiffvfsi 7 1 ' .4 fr 11- 1: i'i' 5226 -f Q In '-f-wir' if 1 :f . 1 weig h, sm,-:fz:fif,'f11-HZEMQ Q- -gf , f zgsfif ., ,us 2 y V- z' 1 - as f'i i -f-125 2,11-'.-Kffzhil i , :if is fm' iii x r- 'fs g'f,1gff'ijiS 21SH2,'fi1.y,g3z 'ig1,fQagQj 5 , . 5, um. fi'AS,5M kwgg k I - ' In-fxs, e ww, MW ff , . . fS?i2l54.1s1-fl rzirifi iii .. , . ,mrmzgc If : ff' , 21112.11 'raw sw :ew ' sl sz , if - , , , 9T'5aiif'f' if?i:fi .l,'l -r sfisf7?z,f5f 3-5'f:V'21': ' : ' -'i: i'51'- 575 - fW':Tf1iiz ii5i4f?i.Ml'Xf593 ETH? k '1' ?i5,,f4TiiQ?5 , - gi2sggy?g , 5ez11m g,ggg ggjgigggz ii!2ffQ'w 19ff?gi1' f:, 1 ' 115557 ' ' f-fl ffiri. 3f'f,'sSL,ff11:fNH l, :vi f ' ,, ,. ?iQagifgf3f?f 'l?7lS?3?1gi :,.5 fQ 1vswsf:f ,:1 iii1'.-?faifs,1L-wa? 1- -1 :,f:1::f,-1s1,r.,iffrsfixgi 'ei-all efisgw fl 5 -:,, f,w,1', s -f:.f,,:fgsf,f -V132 fr .,,::,::,:Lev N- f'S---- 6, ., ii.. g ' 175,12 3, .. 'ie Mi ' Charlene Wilson Herbert Wilson Linda Wilson Steve Wilson Minette Wirges Frank Wise Debby Witt Christine Wood Danny Woods Donny Woods Tony Woodward Jeff Wootan Pat Wright George Wuertz Diane Yaskanich Nancy Yerkes Rick Yordani Don York Dave Young Linda Zebrowski Harold Zimmer Glenn Zobel Karen Kelch Carol Lindly 51: 55 af fa 31 a Q! 3 2 s 3 5 i Sophomore Class Sponsored Various Events Sophomore Class officers led Their class in all activities and functions dur- ing the year. The class of '70 sold milk chocolate candy bars early in the school year to build their treasury. They sponsored 'sw H , M dances and participated in the Milk Fund 'V',i M Y, A:,Z:,,,E, r Drive. ri .. ,,., Size of the Titan Victory was the theme of their float for Homecoming, October 6, which won second place. On the float was a giant football with '70 written on it. Sophomores demonstrated their spirit by participating in the Spirit Week ac- tivities, January l5-l9. They also sup- ported both iunior varsity and varsity athletic events. Mrs. Elinor Warren and Mr. William Kush served as the class advisors. They met every other Wednesday with the officers and advisory board to plan for future events and proiects of the sopho- more class. The sophomores displayed overwhelm- ing spirit by participating in all student Cit1Ol ClCISS activities. ren discussed problems of the class. They assisted activities. They also stressed open meetings. Sophomore Class advisors Mr. Kush and Mrs. War- the advisory board in all scheduled proiects and SOPHOMORE ADVISORY BOARD-FRONT ROW: Cathy Hall, Chris Asher, Denise Carol Post, Carol Orcutt, Pam Miller. BACK ROW: Myke Tansey, Greg Boam, Gannon, Susan Thompson, Janet Anderson, Ruth Tolley, Claudia Olmstead, Scott Carter, Bill Blackwell, David Brahams, Barry Shur, Andy Kleiman, Bob Martha Sutton, Patty Blecha, Brenda Wright, Gayel Bradshaw, Vicki Vukovich, Kingston, John Brownlee, Dave Henry. l,rzsf1Me,e1 B - Be iesfssggf ' - :memes Qiiiiitfl? mm it ,sfsesfis l 3:sa'mEe- . ww , we -1, 'BWP ,mei ., nf .-B.-, as .W B la .M ., pw fir f'B'wB 'zBBB ws, . 535 Bm 1 I., : .-...I-,, rm E s , 3 V y S 5 ifat fsf Sf siv e B fxul B swsfigegssezisilfa f'Bs?esfszi1si2si ,,A.., .., ,LL.,, M, .,f.Bf2-we f3B..sf.mgB. SEQESLWQQQB .4215 525557422 532453552 ,g f 927232.25 ssigssgsgsss :1.4SB..s,:.Bi 2232625 ,.ffB.w.QB,5 zt.f,..B .ft gsigsgf, is.1i BfssiB'. rfifi' 1fBP4:2?.1 21a2if.:x sa.-fv,,. as , B1 mm- ef.. --.f- - ., '1-TL?si2.f: Simi' 'BB X5 EE I S 'E Y gi S my ,E ' Q fic . B we m,t,.,..s, te. U,Lq.w.. , .,..L, ., . ufszxmaisz1:1-.s::ssa::sasfsz'zea1s:?2sB2zss?:se2e.' s.,,G.,E.,,6,. s.3,.iS.ss,. l3,,5,.5.lA MWWBB -.,, v'-., , mm-. -B -me -Wm ':?B :z:f :. mem. . ,S .,. , 5, lssfasw are se-tees B-..s13B..1-, semis New WW . .ff - eg 1 Bw S if 38, es Q S 2, is 3 fe, was sa Q 'A S B2 as 2'sBw2Plg??1Qz ezQE?s'g ,.vt..e5.,mEgg . J Q at if Q s J szgsszssgsf fmBefeBfmBBwBf,.Q.2B1 'sBB's:PzfeBP ..ts.,. ,.,. ,. ., . ..sfm,.. . .W wasstssf' 1.-is B B'1s.sBsfsn.eB1.5:1sfsBf'Bf1f-fwfrsew- Bwsvsfufiei tfsrzsm m.f:gfe1fszz:::.:zgfsz:m P1zeB1s7sma 1eat1: v'M BfBBm Pz35:75eisga35sgLg friissfffsi SSELELEQQ Qiiigig? fii .. vi i mf .set Mfg. , ,:,. me -E-. -i-we .21 :,,-W gsezziigsis a- ' BB'B1 S,5G tw 13: 7LQf5?cF51 E:' si 21 A552553 wwitgf w-1 ,xezszze 1... Bee . Bsibsie .'1-'SE If 'ffiEi1 ::.' .B ir. Bffsa.Bw ..wQ.? BBfe.fsme1QB,efmrmff...sme5f,D 1QB1etS1m:Mf.BB:efsmsg1s5eS.ews.Q. BBfeB.s1eef.feBf B f teB1e1mBfer ,. .,i. ,Ss wwf z..m.gz. - ,B 535321255 E 2-Ei :fm Tizsfiafififsiffes gle .1 f:B.f-kwgfws, ,.gsB.2,g xa55i,f7i?.e?'iS,f5'?is3s..,grs . :,.Q.v .ssxssyasaizszzsss fzgigsf .s4QsgQgws.4sB ' BB 'SB 1 i,.fs.M.ft,..a.f., Met. LN, .:sBfmfefmmBBB..w sB..swe:.sfs.-ezwf f1.m1fmB.:B.fmBs.XB11sB.t::.sBf.sB.sB fewffmezfffr' Bfmfe: sz. B1.sB.w1m..sB B.wBB.fsB.n ..,...., S 3 new BB. we .1511 iEei2u55?il335 B . TLS? hawzsstsa v 4: f ,: B: .msBfLBB.f MM . : ..,mB QHLQQLESQQ 252 Qs s 55 5 2 Q 9. , x,. . he wetgggpgfggigimwsfsgszfs.fXQ.3W ,.-img.Mg-Me..mtsP.,, sts WW :fsie:.B:zf1BB??fe.s1fmsf.?Qsf2tsfff.,.., wsswfwms , W fff51.s1.a.wsf .tS.em.f ffsstsffm .ie ff- est.-rms.. fsgsaszgie .SLE B fasfzgfzff. arms? tfasiggzs wif .fi B nsggfa szsesssw swat new fegszgfz. mes l- B W ,fy U A..- ,fi-.f mfs 23521522 - BB N 522521 xr.. , ms ew' 39153515 -5 e,1i.s, BELSTL .Mm ,, snags Mein f m-fvfs MMB QB .BB . ,: me A .1,,.., .,.. ..., W A ...Wt .. t ., 3. fasweessf taemzw sfgwg :egg :e.'l e,z:f iam fm..sfQff2e B1sfsfm 5225223124 it :wail B s 5?lE5?7E5?i5?il :'Bf' is 1 .2.....1. Q. , W1.w fi -...J .4-.S exe. . s,.WssXH- -- 7. - .MZ ,...1.f7 SSW-5 fiwfxf wwtsfszf 1. Za ' 1 3 A755135 A fiifflisl 7Q:fL5f1552a?f.V :if ff-BfQf?z 55 l:f.5YiLf5 B. B B- . ,iw f:sg:m::- BB .zsB'fzifffg. f2B'.a.zs Bee r-. X Bas-ee Hrfseswrei Bm B me inf 3 1 a Bsmsrasm Be Be B15 Hs5t5ls55?5e,S5m?wf?s9kfw Hviefiekie .effifxlsff Qfffims Q fX3lS'S'Jl mfmnwsfs f pf My B. , 2.1 wwf WBBQB-w.. w , fax-few' New 1112. M ,L .. Wim. -.. . ssslsfllmg115,21-'BQ-ew B tsxfmz .- gsfsaxmmm-sf-iea - ,-.twves -we ses... mm-1 -.msn-..y V. .MMM mlwm mm-5 Bt ,f 1..- fi.. ., ,W .L 7- ..,g.3e-.Q is g, .,2. Ms. 525W 'V . we we 42. V , . ,f5?2s,. i.a3ia,s3.sE,te?i5sfe,S,,t Qsefgmeesesl wmftteeew feW-.mmsefesmmm.fm-. Qmmw. New mye.t,e.fe . ,.,, .. 2.. 93555 sagem W-212: iBff.Bf.s4.s 1.2. ..21.21 .1 - - -- , ... .. . , .,.2.. . ,1 . .. ... .mytsh .ws femme .. - 1,.,f fsxieezi .' ml, ?'Bb3'B5s saws Bas. :mf .,, ff-.sbs smzfxg. . - . 22-12 ,MW-tg, -ls. sqm ew 7 1-W.. we-.I -. sig fzsF'm?l:45:s?. fsftiiidi 'E f:BB.B2B- .- -sf' mf.. 2221 3 2-.. L 122 2212.1121 1 .222 me -1-. S 3 as N S s , 1122 -..-2.1 222 t .-..2.112. t B E. .. .. X.,,2 ., Q Em sm 535525 . iH.,,.,t3..,3 .2...2 ,.2..2 5 ..2.. , F 2..2 ...2. f :W .. . . 22..2 22.. N. QB lffisfifi '2i Pi,i?ls??is?3L3?is5 'B' BB. wr 1.27 Wi: B.. :Bff.,.fBB. ..s..sB ,MB .LBB 1 aB BB 'iffiyvsii B' Bifbfl S sz 3 3 Q S K X R, 1 2 ,g,gXx1m.,f.-im BB. 21 ssfexwezef , 4f?.5E5' 95 ' ' 1.555859 g 1 . B B??aE?faf n':z.BB.':t.2BB B .-f B gl 51-.sf--.,, .Q in ,Q 4 ef. ,sf V . .. fmmsgswfg, A is B HB . se.sfes.s fzz B.: Bf Bmw ass.. . ..2..2. W. 3, . . 1 . :::,,,-.,B,- lex an , Q me S S S sexe as 65892 lv S fd X. , W if qw L... .Nm w S - SM. -Q. 4.2 . X S 2 me X Y. is gg sv Q S B2 X it 'al N Eli E B Q was Q .6 2 V, B1 'K K Q UEGBFYQY , Estesgfssim L - 1 1 mhmm new 'B H , M. . .. eye Ville B's ft: .5 USSZEBB ffms.3BfB. . -... A isslewsf-,BssB.,.s,.4e, sfeggefes ?'??ef'3Iks.k,fL5f:Bls Ei?P1?E5S?E .mm 5591955531 B1'1tk?'f6T:i? T l-9-2,2525 , Sk Q, mi sm QAM H 1 M fs W zxssgns em fl Q Y sm 1 fe 3 lg 2 Z H15 5 BB M: 2 Q Ps as 'V' X B gs 1 .fil si fi Qs T2 H 5 X AQ X I I ByteWe.ef.s,1emeB.sm..vt.m 2-- we . .ts,1etB.sef sB.sBe.s.se.g, H -V -V efteemseggfas -. sfwmm mwfe. fQ.mf.s1.s- swim ageme- .fws em me 1B-fa wwf ,-.f.1.1.e,. .W-. im . .. as gffB egg ,flea J :-., 5? EBV V151 65 il 53? is s22Nf?ei1' e1..i:.iie 'feifkffee we :sy WAY: , xi -1.fm:21s szB-.ease waxes sew . .sim 1:1121 . Bs: :ns :QB..sB.sB,'. :HMB . 1 B B 5- ,tg mmf s.e,.:B..QB2z.:,, -- -- B- i,..:B.QB..s mme. ti. , .Neem ww ,..fB.mB.f .fsLmsmQ.., 1f2..sQ. ,- .smwf MW- E .eww 1-. -.anew mesew fs.. Be , w.efB .ss . Wm .. mf A51 as -Us ,w.t1,. -sweet ,Q-H, Sz , . - . w,:sf.esgnx- is . 1 ' .,.,e,.s,,.,,. ,,-ff- V We M, M., V W -.W , .. .. W .... ,.Lm,, .WM fS..m,,,,,,.f ,W...s1: ,te.m.,m 2 . ,QM .,,.. , ,... ,, f .mmszwfw wmwigm, ee twlmaezw-eg Wswsrsflwrtszf W .2,.S,,.,, ls A ..,.. ,M.am., le . is R4 V My 92 . 4. R. . .en .. fs.f.ws?swB B fsvBev1seBfwB ?1w'fqBfWQw B M , . .f ' memes sa miata? mass, W- W-fees 9525535565 Mffgxe Q. we S5 --4' 11 .. -W setw. was Q -f ..g:2s::, 'B .SBWBNB 26555522 ,, ,,ss,:: '2BBM? :E1 12 2291255425 sftsef ifsmfagg semen f ,ez 1' ,B X.: 'si wzesiigs - . Y rgegsg gsgxeqy was , 55559 . I -- --,,:f swf. .. gf.. ,W of - . M t .. .t,.t.,z,.,, . ., , .L. ,W Wm.. .. .,.., , H ,V .. . Mg, ., ., ., .. ,S ,,.v . W ,.., H W 1, . s..... Q, - .s1,.m..f5f,. , . .. ,,.w6wg .e s .. 1 ,tm rs .. . ..-.f,,.- J , ll Q 2 . ff 'gg sggfwggssgs, l2zff..P3,.. tXgsfeQ:eqgf?ear!2g,, zft. s image w e , . ,, V- 3.13,-lens es. .. item Mgmt ff. A . . .. ...M LU,. Ks S- ,,,.fm.e. MW ,7- tg - LU,L . sl .ww . .,, .. H l fgwefaif ,. .L B 3, ., 5BswsB.ef SQfz2, ',:?B ,ggegiegsg S,lsg55gag:gBf ::3a--' .sgzgwgpigs : -H : ::..:: : ::-BB.. :ma-te, -V : . f.1-Ba-4. ,- 1 Bums ,L ,, -me . vm, .Ns .,. at X -V xl 4 H mf , .. Q: ,. .. . ,fs ,f :.1g,,,, H , R. Q, ns. , f '55 B -P ,Q Q . B ' -At Awe f 'Rig my .. ,B ,L M BB .. -.fir . tvvw , ' . B ,g,:,..-N , - . .. - . . ,K ,. ,swf V L , . B ww .asf 1' B 4. are M sa eiitxlileximnsli'B5s'JeiwL7s5'Bi7TBf3Si3E5?h 51'Ls9'h..1ie17Af'lff'NPfB37BlzB'BBI5if'f:'i'5:BIf'Q5 ff!- BZB:f'ZfViPZ:f'fffUBPi!ftt.fZB!UB:nBfU in Bit 2 B? PSYBNL B LE B. 1 31 5f1s9is:r'.wQS.li:. genggsgsegSigfqifx-5g5fgP2ggQg,ii?zsg,2sqf25gsBB isa12525-z2i4fBfi'-ssiisfisea.fmmf.sB. .f?sSs2.w.,BB?fsfsfsB.Lm,fQt?s?si1s3iis3B .EEk55is52atEegibftsifslisvilvlsalielisifw .tmmxmmnegw-1 ywsfmtmsf me-..sa.ftBas-.Bfx-.w...BB.e..5-..1 ,-.fs.e.mm.y1.Messee-..s-sumti -f fe1eee.stW, fBw1ggs,feB9fm v S . ,,.,LD. .,,., ,.. L .L .3,,,.t.,mr MN .... M x. .e,.s.M, ggfwgwwse f Be reffefssxgsfzfs Sfwr.sSfgsfg4 sy B .1f -wM,-.sz-fgfs- ,fs-.eww Sf-fwffiftgxtsg-.ez-.ti .mee ss - M swgmfsm mmm mfs-.W M-'.s-is-f -- s.tf..t1..sef 2z.51m.f. Wxsmw ,-fl-imm a V. V B HBP B '....s. ..,.. is '.:g:a:2sr:z we .egw asm . .. --Smit . Rgssmg- .feet .Em W ,. ., ,K - W if Bu.: .1 BLBHQQB. me ,.,- ts. 1 we .. B .QQ n asa-25,12 M few sf Use? WW QW mm msg. es. B ,Wye Bfi B' ,wi B - B B . W .-.gsf B Q. msg. gym we was ggrswssw .sw B215 asia.: H 'g .1.. 53251 mtflsg vm.. Sggingg mf . fm Bssfs - fm in 1 .. f: . ms me KB B2egfM?5gSgge ,sB gsm B ank V35 . Weiss SB? . . A5252 li? 1.p'1ByrH ' .' iii? 35755 llfilifiav? :Ts :lifflfi 55555245 K 12fB:a W, B55 ikgsigie ie 23,5 :gig yisgBsg'B 15542 wzggfil aegis i ggggggggg sas -eff.. we as ., lsr.-Bam .21 'B se., angie stems Sz wyfm A9315 . Bafgf ,:' V554 3:5 b cy : 5B g',,: ,BSA ,, .fm 151.516 MSB Lsft2..,,. Bu tt! xfxglutx BzaBi.1 g , B SSH. SSLSXBB l , H B' 1 lm sl ii' A . :f',BBf,B A: :',:5L5'E'BLf:,:: x:. 5557 A B ' -2-..f'-' 1-5 Him- 7' B ' ' B 159B f 'S Ep , - .W 1,, .S sw... . .M ts, .2 . -it M5 L .V .se..s.w,.,9s , at 5 ,sg - , A.-., tt V A X- - , ,Q-A s..,,.., ,, -- .-. - - gl . M- .W V-. - -ex. wk.. , , ,V K., Wwe. -. ss, - -- we ..l5g,.. , . . .. V W.. .1 -. Q.. . --ess-I 2. Q., M .. L, .,. ,vt .. me -. , ., .iw . , . . . mewmw-sQ--W f-1-, 111f-1 .J .v,f-1v1-111V1-1 we v11vf- W-.w...5..ys he-. sf-m..MM...t,.,,.t,.M.s,... s. ,,111,1111 t .L ,Wt.ts,Ms.fM,f2 ,111 Q, .w.g,.ff.f,z.e,. .,,1 M. M. ..m,ts,.t,. V A ., .., 11,1 W. 2, ,. ,1,1 ,W e:2iwsm-fe3sffWgsWsegPige.ff new.w.a,msW.2z.e.mme 1.X5?Em,..ms2S2w5sft'es:'?m2,W1seg,?.isegef2g,ssBfsg,flgf,i2fg5wMWX5,.. 1.m11tm-ffmm-.WW W We Z..7-,.if-.W-mt..I-.ws--f41.wz.?1. ss.fs-Mm,-.ml s .stesw1f.w.fE., 2:e.m.mts2x 1,,.,m,s,gfw-gsfs fs, mZifsxLfl'3Lf2'Bf9r f B -- 1 -Xf lqsfgf-2'-ASA-2 1',,55Xg5g9l,:g9g'?'B?'g'BB5M B575 BfWBf2!Q:2 fx B1'5ff5'f?2Lfw3'xfw f - B1 B.sLix319:1r2ZLlfv fsxrxeslasiisrs B' B B -sQg.sg3E':46e18ks BfWXfwBwB5! l ' Bsafgsfgsegll KB.2a7LwlQQsf'3B 5 5521 :M5': ?'B?'Bf?H5'Bff5ff ' mzreztsgffwt mwifxxzasv me 9 QQ-V , . . W, V mm. ,J ..mm.s .,W.gt.,g., ,mt ,mmm ggi. ,N mm effrffm- Wes. rwzsm , -is-rw efwls- ,.. . . .. .9L.,8..t 9...wl s,,.,X, .,s.t.,..,. . 1,11,11 ,B se mn ..M,.,. , ., . W. V , M355 , Mm, 1523525 ,meg wav busses - .s.fB..B,.s 5255? Bmw vB:v'Br- BWB9 .'B9l'B?5 B :Bef :iw .B :msg i:2':B.e:. 1 :: Qxsrixx irsisrise 'I-' -1-I' -Q if -tw. ,5:- ' ' fa. lien Alexia. ,.f, B -ww LHHXMXH - ..--B Quin xflwlav :A 2' FY., 5431191 sm ,,.s---,, - ....., wg ww, ..s - .:. .1 342115. BWMB .t,1,,1 .. sf .,,..., ew ., .. P, , , U. ,V .M ts . ..: ,111,1 V ,, . .,f.. .. J5,L A ::mB 'z. kf?.5P23fYB S29 . sfrssgri fgws-ezsesfXe2BfBBB BB.a ..1.srSime1e.4mSsf'2.25m ,J ,ggnseg easel .W s-e..P,-.L-as .s1et.- Sss,ifm21sfmf- fwfgwv: fg,wBfsfs Bfe safe-.safest 'ss .sz.sBz.sxsegse B ' ,.s wwes.a1ms2zQms1.:-312 N fteimsn 7 f9nw1w W 2 B-a w f BB:s:11e214s21f2is ff-ii?eifsB fi? 12sBe?is'?2sfm,3f g. ...,B1- as. 2.25515 Eggdefgw ef v 1sv,gB2: ,.f,.mw. 1 -1 ww B - MWQWNBB .ws E, .. 1.,1 M.. .. ..11, s,,w,s,.f2r. V.-1 ,Q -Mefm M- .R , W ,fm . . .- .s 1,11 1,11 E - . 2, we as - . H B K we are , 1 Q AM- .y isnzn 1.. , snr' BB 'B 'B 'BB'v X B gy-: if f 1 5 ww- V- K .sB:.ts..w.M,s, .ef -. -sz. . ., V - - , : ,,s,.m,.e..,. W. . g ., ....,, M.. . 1111,11,, ,, ,. ,,, : , f ,..-L,,,,,,.ef3.s1-35333333-,L .W . ,. Ms. 21.2, '. .',:s.-, A. , jk ,V B-.ssmesmst s,,4.,., .. - - . , . . I . IAwwBw+wBf.awxft,ti K,1.w.fi. .ff -sw ,lar . Bus em: . get 5 f . 2-a. . - . , . 4 .ww sieefs1.wf.31.w-gm.. M1 .W ,V 1 V . .W me Y ...... ... N .l,..W.t,,,M,,,,,,,,, ta. ..,,1 e,...M.M, We .. M ...1 we ., 1,11,,11,11,11, .ww Me.mee.tpms.s , sn , X .. , 1 ,A , , Q eBf.2B?mB1me.2B.21fmB.eB.eBwBB.t .seB..sgBes:ef:s-meen.sf.fffswe ESBBQWQWX q fsgegye-e-me 32 33232, ..W,,.,,.t,t,,,s,,.,W s..W.tm. .m.WMf. . an . semi .. .. . V 1 w,3,.Lm,g,s,M -W W,sm,M ,ewtfewe e w w fxzfemfez-fw.l mwm1ms,:. :. i nwwywm :H .,,,,.:,m ,:,u,,N,.:, www: - emma Bmw! Us -- . agwwm , Qs,XW, s . Wgmsgs . .fM,.g.,.. QWWV, , s.,W.5,,3 , gg iifftifime laivtziiilfst 5BsSBlfstiier QBBWQWS Hfigiyli' F9494 22..II..II. '.. wiv! ,W . ,111 V , 11,111,, .W .1 ,11, mme, ,MW . .... rims .-H . -same .mel .engage ,W WWW 5252525 news .. ?2e?I-Sie iiffiege f sfikie were ne-.fm -fum me 1,11 V-1,- N- .ffmwf E. wf - vfssvw: 28:12:11:-iv- B .Qzsevfsz aim B diassisn M SM -r.: -nn if Envy .we ,sw .. .see mmm ,Mg-N. ,,, mime :.B,5,1B-. ' mg B ating I wWsBfg wf B in mf ffsfsw -. .wfw BISBIW NEG- -:Hs s a: me ml. B H.--: 3 1i5S2s32EsiS P'.Ji4 2i tgfgiswfgs' -2. I' Q gs?ea1?evvm5 . ::: s .. , , sBB.sB.fwB.Bwmvs1. Bpwfm .:vsws:feB .,i.te .fwgfgf .,g'ggvieg5 555l,s3. -W.---. 3- ..- -:. - eww. .M-.ws new s w5,w5g -- ,1,3,,u, M ,1. W W sw W, .1,.. , , , . sms ,slr 11,,,1 ,M JS. .ef .. ...1 - .,.1.. .-... smmsm' :ln-W -it memes B1.Bwewst -:. 1: . .. ., gs: fm ilitnfstlfftiif '5iyis?s :: J VSSQBIQF B'Ltt stPLsnl5vl5 ' ts B5BB?'?,B .: 'wiki' , .Nwnsri -::?Ifllt':::.: :: 'L:.s.z l'!575'?'liBfBf 'SZ5L .3f4l5i1',tgfB 1255 'lxsfzwiffqzeyfiyl e .5 1sif'?lsi.Ef4ls 5555 B B':BB'x ..::.::l55..: V v:gBH:BB f'flfff1'5 37Eg53QS57f:5:s BB Qf5gB:gEB'.55E.B 55255 5s5Ei55EQ59f5QE LWV',.r:,'55E53Eg?3EQ55?g3I5t5I f55,f',.vfff'Qq. zfvltu.. ll ulsl B' Bal I wifi TBBLSSQEBLQIYBQ-22lBfBffgiS in',is:.v:':'?::ss:',,.B swief-:.fzfxg.f1 ' sB.:B,.BB V z5l9'ii?i .. :'S:- H . :wif 5 :E an H i in I ' If ei52flB?Ss? f 222 ,122 Be er s B 'E6T9kF' - ' . A gg ,Q -x lv 2 M 5m'8 L ll, YQ 2 ,, as Xa g is 'N' ' r BBB: is as 2 li m . x M r B , ww:.foefmfffBf1esfsBfMfsf,m1 f--- W .W A..,,.L s,frM..t,..s,.,,a,sm.t2.www imswzffegzgssfzssssei sass esges,3esgg.tsm.f ' as -. www 15142339 - 6952599339514 EHEMFQ S B may ,G .,A. V,A. . Z.f..g..s.e , ,,Wm tmszfasis B,f-WB sums mBeBsf3f fsessws .Wm F W ,,.. ,..m, Miss. t . lem... mlm , .. . L-LL .ss vfeiges Bfisasf gems, Bgssmsgf - gmt fee-sig . B wt wet . A ,W .M .L , .. . . . , sem - rm fmw f A ffm mass .sew ,.fem..f emB.eB.sf.tfB .. .. Q-fwfw .wssww ,...m fn wife. ., . .smsmffk ,ss ,.:,.,., ...,..,. '.,k .,,k:.. g ,,,, , L. f5lB ?.BB ,BB B'ff551121f.fl.f.gzfff's'1lBif M,W,.W,.,,,, .,. ,.,,, M ,M ?l5l5'i5QE5253YR3sl?35Hl5HNM 'mf gu5s,,g5.Qs15,, ., f fmmgwt W is ifefei .: .5 M Qauisilfaw? ?3?EY'm5? ,sw .3 gym LSEQQTEL ,maxi if fiiieifi fmt ,. K W 55' i?3'f3'?iT:. 'Y 1551255555211 fwm :M me .mn BB 393531: , . : .SZEWEESSW .K mm. . mlm m 2 Q 5, S PM S, 5 K X 95 S mf' X3 X fx 1 ,G assi 3 .sk E 4 lam xx Us S K 2 1, L' 1 E., nm .. .... , as + B Br A f , -eww? fmmwmms eswsyxexen. . mzszmmyws sifssgaesege, .. . walk, ggegisgsw varies K.,w:.e Q, -.,7 -is Wim. m.w,. . AVVK ,g,,,W,, 19' N55 aims- Msgzn Qiyfaltg ',. ,EEi sm is wwf img? ,,-if . 224527 E ?Qx n:... 3? Q X ,M Q 1 X we f 'G ff me f mf 1 ,f-.- ' B ef , B,-fvBzzN..s:1-B .fBB:B'fe .1-gp 'gB:..:zzBi.:... S ,, ,. Linda Adams Steve Adams Eileen Aitken Cliff Alexander Bruce Allen Robert Allison Steve Almgren Lawrence Ames Joel Ammon Brenda Anderson Janet Anderson Janet Anderson Janice Anderson Janie Anderson Laura Anderson Lisa Anderson Mike Anderson Ed Andrew David Andrews Cynthia Ardrey Darryl Arndt Linda Arnett Mike Arnoldi Joe Arriaga David Asbell David Ashcraft Chris Asher Sam Aston Marcia Athans Jack Ayers Becky Baader Richard Baglione . e1.,, ,, ...- .. ..-- , .. V. . ,,..,, ll.. , , .. - - s,.,,..s, .. .M , ,, i . B ' B GUY BUlleY ,. ' . eVln 0' eY si 1 - . . Keith Baird iililiigfs? S H iaiii? John Ball wwfw5'i.,..f2f 4 my Bm we s. .mm me X . ., , ms. kwa mem: .ff .. Q .. . Q. ,V .miie - Bl- H.: .1 . . W W W . y. .. .,. 'lf . .V . , . ., .. . .. .. ., ,wh ,.., .. .,, .. Q ...., t ., .. .. iw-exe. .. . .. n w A. s wf 5 Kurt Ballusl1 A B H- ' B l70l'lnY Baflid ' B . , ff. .B BBfifB:.1 B . , . B'-BEBEBB1 - - 'Bu i 1 .- 1 -- . . J .feff 5 2 ig B B B 1 ' .B '55 .J D V l B 'f'eld Michelle BGFSOS g..fz,.m g2,..s..wE.. .w,.sz.s .sf B.. .eB.f2zL.. .wi ggmggggp 355295511 ,g3gBkgsgBfgg1 BSeg,g5assegsf1sS .',.. sim fB:ffe:zizBB.'f . 5leUClI'l BCIYIOW B ,. ,, . David Barndollar B' J BuddY BWI' ,.., A J Rendell Bnfsness -f,.,B'3fB2g.f 1' B svg.1v1sQ.-,. LgfQ,sSz.2fL2!2L.B.z , 'rises 5122125625515 .- B B1 Ba 'B gif 55321 .5.,g:.:f' BB f-B? .. - B itil: - . Michele Basie I .ig .sim i My no N3 Bn . is V- fkgiw :ST I . Marc Bungie A B ' ' 1 Y ii.. - - X 5. B. B B . Q -2: 2 2 B 3 ji si,i Rohn' B 5le Chris Baum -I s. ,J , Doris Baumeister QL' B. ., ' 5' A Ha, B f fag. B- .fl , - 51.55 Judy Bqye ,. , g June' Becker - B ' 'N .B ..B. B Pe Belford A A B' 'B-l . si 7 ' it - ' B' . i . A 99Y . B. - BB gBg .. , .f ' -,sk f 'fam 1-as :B fir, Q. SK X - B . ,. BB BB ,e.. B . X, B12 B . , B . , , KI, Pell B 5 X V, B' B Rule Bell 1 idk 'fx ' By gf B .fa agggnig,-B -rs-'-B 'xv-va' -, ::+BwBQ1 Lynne Benhase if1B.,f..fg.i1xB1fBama,'. H A A H T ,. K- B A ' 'K Mliiiwi a tt '55 , .... B' F ye Benne , Ralph Bennett .f r a t f.. . ' my wi if B7 'B lr L. .l sfgfviif '.i fliizla V . Susan Bennett B' ' B' I BBBBB 1 '.BB B I Bl B Evelyn Bentley L.LAL B1-525. 1.53. s e q.. .A 'B.' -BLB B ..B 1-11:5 BB Ngw B C I K s,'. . 1 f--' . A 'mg Benlon 'LB2fzi:BBM21B '., BQ Y . 3' .'f ' B Bi' ' B Bw - B 1 B11 Bszsf - Eflflle Berger BB f A , , 4 ., . V . , B- BB ' BB2BfB'B: BB.B.B i1B'iB'1i2B'BB B .., Gale Berkr-on B A B . Denny Bemwdi ' V- SUS Bernal ., K ' .- ', :B 11' if - : Bi 'lwi'-' :B gr. .. ,B 'Li 1 -veg, Q S p f: CmdY Berry ' , .. . -B Q. , ,f B.BB..B sv 111 sz1.:.:e,. B ff.Bf2-gg , B B Debbie Berry v ' cziwimw' B' X f is2z1i,'.z3? ,, B 5fBgiQ1BB.f .- 'fs BBf- B 'BBI BBBYQBEM I .- , .. Pele BBYFY 'lg 'B . B ' V BB BB . B ...B - B'B' 3 David Bertschy B' 'B B R g ' Bas es .B-..B, l B' . B' -'.B.'-B.. B Lf 2 B--' Valerie Besecker B . , B -Bf 5. ii oB,oB . .- is :qi -B Bill Bess .. 'J' 'Blii M Wllllqm B9ll9l'l0n V V- - Sharla Bever my f B',B 'B 21- B , W , . 4 , ig' 1 B B - -- I f BB: . R - B: , - i ?.m.,, . -,Bk K .we -:xii .Bw 11355 Svndy Blnslwm BB . B ' ' W.., B- B Lynn B l'e ,..B iff- 5 B . . .Bfilygn :B if Harry Birnbaum . to B . - t ,B x ,f ' . ' ii ' B- 'B BBK, . . Joh BWP J TB . BB - . 5 Althea Blackman 1 , B ' iris- - ,fl-jg VLB. B21 sBx.'fi'fvzwi .Q B. if BB -af- f ' A B 'BJB' B. ' Class Cory Bruins Rodney Brummett Karen Brunson Cathy Bryant Brenda Budd Diane Burke Jeannette Burkhardt Carmen Burruel Dale Butcher Debbie Butterfield George Cambensy Wendy Cameron Roberta Cammarn Cathy Campbell Rod Campbell Charlie Campos Larry Canady Curtis Cannon Jim Canterbury Steve Cardenas David Carpenter Kathy Carr Randy Carr Jamie Carrell Cecilia Carrillo Chris Carrillo Steven Carrillo Jill Carson Jeff Carter Scott Carter Merle Cary Patricia Casadei ''L-WSWSQETYW'-LQS?fll21?7-Quik- Q-B L55-552523559-Q-liiillk-Tlgl2151?-kill Q Q S,.sQ,.. -, ..s W . be-J ,..- -s, ...- ,-sn.. ,- , .- .,,. .,,, ,,.a., 14-WQQZ-sei..--w QQ -Q-QQ..f--s-1--Q-l.f:4,Q-Q A -nz:--S7127 '. ,,:'22.- esigkiv- 27-if-152'-' Q -si filfilkv ll--,xv-r .bei-ri: 't' .. . f ffrgwl ,.,, .rA, l,., . -QQ--Q, .,,: Q-Q ev-f - , - . .Q --Q-Q--Q-- Q-Q-.Q-Q--, -,.Qf, QQ-Qu .--,Qm --,Q-Q --.--,B -f.QQ...,-- L.-,S-, --Q---.- -QQ.-- ,--, ,-e. A - Q ,. 1--QE-f-Qi-sails-' :x1fQ.sz '-T-L-ibiza-QLF' 'lggws-fi' QQ'-5:-27. -:H-Riff? 535- .. YF ' fl,Wg?.awg'iiQ -kfiifiizwz ' zeif 'Q Nfl- ,:eff'--W . siflpsy wflexJswegizfzl-Qztv'st?-fee. 5. Q2-31'avg-qv--QgyQ-.z'-ggvh, 35 -wQs,H3:s QQQ-wigs- nemssw- flaw-Bev ' ' QQ.:. .. w ww-'Z S433-s-ev' faxes,-if .. L.,,w,g' 97--'Q-fiwl Vpgih- i,1wQw ':..:-::f', Bw: Subli- 'liisii ii.. '5. ':!' 4. gglzizigf Qismlid !',..:f' wiki? I .. -Q--Q-Q-. . .,,k ..,., Q - -c c,r.N -,- ,, .r.,,. .Q, W,-.Q-U 2gfY??ae-. ' fe-wr-Q ' ,V S, we S, ,Q QQ J- we aj c Q EQ X V3 1 Q 5,69 QS: Q gg 5 S is 5 , -,W ... s Q' -:Q '- Q-M MQ--Q Q-Q Q Q Qa Q Q ,, ,Q 9 Q- Q S e Q Ze K 5 W -F H Q - 9 , ,- fm Q J? E Q of Qs .- - S S - is QQ - 5 8 S ,Q ,r W ,,.,,. M., P, c,,T V, . L- .e u-Q .QQ 'ff-fwiezlge :ge :- EQQ-QSM ,,,,-QQ-,Q -sifffii-sfisi ,, ellis- Q. Y sez- Q -- ew-ei MQ-QW ,ews 'sxbfeiiewi .A 55555329- QQ--fQQ-M QQQQQQQDSQQQQ.':gmQw-er-sw-env--Q Q W me ,W--QQQ.. . 535W wwf-5 fe H35 gs - Q QQ - ,BBQ-me .,., we 5 c J- - Y , - 355 . W. , f' .W-,. 5, f 1-. we ex ,Z Q Q., ,A SQ- QQ Q, it e Q cw Q r 1 ,H gg- S QQ Q Q, ,Q Q1 -S 'fig-Q S - 5 J sf le 91 ffl- Q av sv 5.5 ss- is is Q- QSMQQY -Q Q. -seem ,X-QQ-Q-. m swQeHgs55w jew? ew- Q--QQ-,ge-Q gmwfqek, , - M 55-QQ 1 - if? QQ? .ee -2-'QQ Q --qi , Qs-fw ez, , ,T .': zQ: .:f1 'T awk, . A-srjle. xi , fsfilife .. --Q' '. J Qf1?f2feQz --az--SWE-Q ' Q1- f Y W 55135 1 , ,-Qi? 3- 'A -QSJJJL' QV: - y -QQ -1--Q-QQ. Q '-QQQ-Q:.--Qg.--Q,:Q-- 1seefm:mfs2gge5gi-efis5-e- Q-Q-1--sf?-Qs Q-QQsQai.-ifsmgg--Q:g.Q Q-mm-Q:fQ-Qflf - -- -g-Q-w-w-- g-m-Q--.w,-Q- Q wie--2 1112-if? -gf ,te Q,-. ,..-- -: :Q-QQ -Q f Q-Q-Q -ins. - - 13:1 . '-.fem ,:-L few-vw'-QQ-t :E 511515 wg-gen: ifglay Q2-,gig 212 il- ,fag , ' me M-,Q .,, . L- --Q , - Q- Q . egg. 1- 51 ' -- fs- Q- fb 4 .. Q - .. ,: ,Q ,,, A:,, ,Q Q - , Q.,,, ,-,., ,,,, wi 1 ' .- the we -- -wg -7 , -is-wi. . W ', -'- '.........., s- .--qw 3-Q' -QW ..'- ',.,..-1.1.-M-'- ',' Sgfilfgqliizs ' . ii' .----Q - - .1 2 25 .---QQ Q Q - W S 1. ,- ah l S4 A we QQ - c Q we Q5 s a f ,w S Q. 0 s eff 5 1- gs Q Q Q , , 6?S? V ?? - ' ::'r: -wt' . Q ,,,l S ,:.::...V ..: I TWV' SWL- Q5-52-3 , f. -X .1 'Jil 455 991556931 lifiizwi Q Q. me an Qtfiif Q SQ W e Q -1 S-- Sf YQ Q 1 S S il J KQ- 91 9,5 se. I e Q Q if 5 of ek' ,ESQ-Q72 EQ. .S W WE- ak - 51459 Q as W .E , L Q- , QQ ZZ fQiwi1w?' W?-pg Qmew--Q-wQ-2:?k-QT?-is Q-asa-QQQSQQ :Qaegssega ' ew 'sexes-55111-' ' - .t-QW. Q Q,-W, . 'lv K .- -Q-Q: yu rilavk-W-M 91' -' S' 'f' - K :SQ wif-5-QFQZ--zS,Q - Q -?iW5iifsl - se- .3355 me img?-Q Hffill 'if if Ql-::l.1.Q,g-,Q Q,4Qg-QQ ,,. we Q -A -Q Q-S Q vb , Q we S N Q- - ,- s 2 ez S' as S ,K -A 5 5, e S Q S Q ,, , Q Q-2 ff QQ -Q-.Q- -,,f . .,,.. - .- -.-ww , MS .. 5 - Q ,- -. Q -we S- QQQL- .. -QQ .- Q.:.',-fi, -f,'Q-mf-.-5-Q-.,o,, .. --Q.--51 , ie, ,jk in - - - S s -:- ' Mi i 215115:-'f ff, S em- -,,,,.. --- 'gii , s Q fm cg Q S J 25136 1 S 11' Q 1 Q, Qiisimsiilir LW mil-us? l-Qf sq is .,, or -QQ -Q--Q-QQ-Q ii' .Q-Q-sQe2-tw new ' :QQQQVQ1 .- Q 5 A Q1 QTQQQQQ5 .,.,,,,t, Mitre- V15-Q-f fggm -QE-W..- ', ,,. 5551154552 , Q Win-'T ' -'ffilkfa ,z - Q iQ?iW wigs :ff ' , l -. - . of as Q,-f QQ Q - 5- Q 5 334- sail Q33 .- K QQ -,QQ S Q 5,5 ff Qf 2 i Qs 3, J .. 5 :1-gags.: A K iii- ilSVsS1Q?iii5Bi5?519S9fl,WSG2Eb?S5' S2 we-if begs-?555fei3ss5QQc,,s?f5gHf , 'Ev 513995 fig-Rei Q12-may - tibia,-5i?5?2iQ ,. AQQQQ- Q EQ- Se, Q- Q ,WJ 9-515 S 5 Qs Q 2 Q- 4 JW S a QQ QW Q- 4 -we Q W, Q ,, ur QQ g , Q 1- Q S e -- Q 5 -5- dw S Q S 4' x f Q Qe .ee-QQ .1-nz-Q,e,, 1--,.QsQfi-W..--,-Q--9 ,, N, Bill Blackwell James Blake Janet Blaylock Pattie Blecha Melanie Blesse Randy Blevins Melinda Bloomingdale Anne Blumenstetter Gary Greg Boam Boam Marcy Boas Margaret Bockman Kent Bogott Marlayna Bollinger Charles Bolt John Bondhus Diane Bonshoff Mary Borbon Lon Bothwell Tom Bower Cathy Bowman Mike Boyd Mike Bradley Gayel Bradshaw Chris Brady Diane Brady David Brahms Betty Brandon Adrienne Brian Les Brickman Sharon Bridgeman Bill Bright Debbie Britt Dave Britton Pamela Britz Arnold Brodsky Lynda Brooks Monica Brooks Charles Brown Darell Brown Frances Brown Jim Brown Joann Brown Ken Brown Linda Brown Tim Brown John Brownlee David Brueck -- , -Q , .1--:iss 'Q ,--5 'V -at-.. --ff! Q--get-Q M.', Q,' --2 ' g QQ---QQ! ff--qt -- ?2..a-1--.L-ii if 513- ' aj V L, QQ--QQ-Q' if---QW si-Q. Q-Q 1-- Q--:xii-5,1 .1 -x-'wif-tri, Q, Slilfilli' 9 Ql-Vg! 571 '72 ELI' 'P f-, 1f ST'i -' -:QQ ,, -1 .. ,. .- Tgmii mis?fEPffl i5W5l,,12,'3rTTLk?3Z 5'V'? fs-ZEQTZLQEYQZSIQK'955KWH'-Si:5Z9z5T5LI:QfI5i wie,-?,fQQQfgQ. f Y 1 Qeake fm es:-nee - 'f-iss-Q-4--Q -. - lf viii' 'f 25'- '. RQ Yi 2-lil? 5 H :. Q.l:'i S555 Sag guy la ,-ef -45 9133 ff-fi 21-5 --- --Q: .., -Q .5-SQQ, -- -mg 4 IQ-ati Q ' --i . if - 221,-f4l'.:-fziigsif,-t . ' -QQ-Lf:-QQ ! ' . 'f mm: -v?Q5i-Q-Mi W -simeem-1 Q-me --,.gygf-w i ts. 'uf' , ., s'-sfo, 'l-e:W:QEW7f.:fQ zsQf i e' T -my .,.. . ,, ,www .. ,. re,-,eezg me Mc- .. -, Q- Q .Q sxr3i-,.-s,-- , , : ., .Q Q, . -QQ-, ,.,,,,.. ,J skit! . - , , . 1.1.-,--QQ,,e -Q , QM- 5 Q22-Q - M,-ez Q -Qs -1 -,Q-Q Q Q ,g fj Kms-3 -'Qz.5.azQ ' fz- ,-'-M-SQ-' te .5 with .g - , 94 -fi'--Q :. : -Q-sL,w-Q ...,-4-Q Q, Q--tu., , SQ Qc --vials 52 QL QQLAQQQQ fill-- 'ii ,1 ,sf-' 55i. '..f . -a s ' Q .. 2 - t-, Q , QQ --.. . f fimsezeg'gm-v-gafrefzl-afic.Qii-:wg ... .. was-ea Q - 5-me-3 .Q- M - . ' Q Uitili V 'fm In 2. . - ,, ,, -Q iiwiiiiig -1,--QQ ' -!.s:'v'- ,1 .waging 'lifzdv Ska?- Q Q 'if' :Qw- ' ,if ,,-, X. .,,Q - gn EQ 5 Q e - j-Q me - Q..- .s,,,.Q,- ' -, -e'Q-:--,- -Q..-- , . 55.1 l ,-f , , was ' BV S5tL7g:: Ii' . 51 I' e ,H -Q-SQWQ., R eita? - c ,-QQQW. Q35-fs .5-ee Q - ZR - r is - yo Q E ,Q f mil' Q ,.,,. ,W ., S,,,-,W -Q Q tw if Q Q- Sf 'ix Q Q ,- . iQ-,.-MZ,-.--, Q, -,MQ-Q ,Q-Q.,,., W -QQ ,ws -QQ- 2 --HMV,-A--Q..--Q, --Q,.--- 1- , . -is-311- ' ,,, Q15-wg ' :Q-, . -we 2 . :,.:: tt, Qs'-E A is gf- ---,Q---HQ -iw '. 7 QQ-'if' 'Q Iii L 1545 '54,- . ,I Q if-Q, zfgiem- ,-Q--21.'--,,Q--g,- -s-xiii--gg Q, - -:. '. Q- - Q-Q--QQ ,. ,- ---. T - - ' QQ w e 1--z . - -:nf SfffQi.-- -'Q-Q--Q-5:--gs-3 ,, -Q-,ggi-QL.--QQ. sJ6Tif5fT? ':Q,TL-'Lili ': llifffif? ,iii 'W-Qz ifaiie--Lfi wg,2Qi'.Q-S 'H -:Ac 5 :- 'ggg - 1 - -HQQQ-i6Q'fs?u w?ieS1Qe?vgxQ an-si-Q-531-- Q A -eeige gQtQz1eQ,-W ' Vefflgevf' f -,.Q , Q ' e., QS,-wg: im viselft -- lf. . Q 'W j ggwf V' A W-- esss 5, se-122215 Wilfl'-Q Q 9 F wi' Q Q S 555 ig Q- S- Q W sf Q. Q - s sv 5' fi' lg if it , ij- , , - M, -5 - - v s. 3 sg'-ass .Q - ,Q Q Q ,Q fees! .-: .Q ,..,,. . ..,. :gig 5- -BQ,.,,: . Q- -rg , Y- Q- Q- 53 I 91 if me M5 335157 ' 5:..:- : Q-K Q ee?-3 Q-fy .- We Q-fig Q 2, S: , eff M -Q? Wm Qewftgsi, QS .S - I W- Q.,,. V-QQ---Qt--QB Q-QQ - Q--Q ,MW-Q f gg-Is?-QQS1,-s2'Q2w'f efwggsgeiiv- Qtr . . ew-a ' ww -:im-F ,ztesai . --fer mw - EEYLQTV -'2'.L:9?fl5S 5151? 252535 I-iii-:SL Q:- ' .M-.lyk jg:-Q21 .1- - -QW . -: -we J- .-,l m Q .: ap, ww- me -- , , Q31 -- -QQ-Qeees -QQQ:v . QQ ww- Q :-1 .es -QQ ,QQ Q - Q . QQ- -Q-QzveQzlQ-.Q r .. 1--QQ---s.. :Q .QQ-- -K g, S-SQ-Q k ww, , -,r-Q11 eat- 1- www-s Q- ,-Q- Y QQ., ,, , ., W .,,,. . ,mse-. -, . -Q , HQ- ,,.-- .Q ,--Q-Q ' - I asffi'-'Q 1, fi 'f 12-20538-Q33 .1 is-3 QQ '. Q mv, f sm., ig-'11 -'F : L -- A 5 , ' ,. ' :,Qii--,f12:,- --arg-,-1, Q 1 -1-,Qz S Q Bill Casey Lynne Casey Sieve Casey Marlha Caslellanos Josephine Celaya Sandy Chaison Alex Chamberlain Mike Chavez Jim Childs Roy Chlopowicz Connie Chris! Steve Chrislensen Larry Chronisler JoAnn Chuba John Chubas Debbie Clark Deborah Clark Lisa Clark Mike Clark Tom Click Sharry Clippinger Shelly Clippinger Tina Clukey Marshall Coaller Jimmie Coburn Gail Cogossi Danny Cole Jay Collier Charles Collins Herbert Collins Pal Collins Marilyn Condi! Palrice Confer Jeff Conn Russell Conn Becci Converse Cindy Cook .lanel Cook Barry Coombs Brian Cooper Paul Copher Tom Corbin Belly Corder Russell Cordery Bruce Corey Mike Corlies Bill Cornelius Trudianne Costello , .Um . Y. .MP ie, Coach O'DeII infroduced the frosh and JV bas- kelball leams lo fhe sludenl body ai' the De- cember 5 pep assembly. Class 'Q fl . uss . . f- V .. f J :J . JJ J , J V , .. sesy . J J J iff JJ' J 21V ,.-- QR! .JJ ' . . -' .1-wi JJ J- V . J , I KIM eff- X VJ fis, M VV faf fff T 52 . :'l's. ,. J F 5 ' .V Aix' 2 J J rsec J. ,VJJJ ss i . JJ 495212 J JJ 1 i'ii J il.' J. J :JJ ,l-1 J Jiyifv s J Wav' . . is . if I VJ V yy , J-ff Egg fi 3,5 Q 'f QJVIJ J. , . , , ,N W, . . J M oe,- . J JV JJJJ,g. 1l,J eoei 'YJJJJ J iw! J J J 'Jf .,JJJ V JJ V li- 54 - J J J JJ' 1 'Q VVV-.Jg VV V V ig., J 'i' J X 'fl is J. J Jf N J 31, , H V J V 2 J .-s ' J X .bisfiflffi 2 'i'- J 1? ,, , gk ,. ..,, g , Q . . . :ff JJ .J VJ3sJJJ,J W J .f VV V. J J J J -.-' -. V 1 .-f. +V J J ps J. VH' ,Q -J in VV J. V- Q kt.:-Keg? --., J V .V J V . JJ .Q -f . V .J JJJ: M gg LJ s.. .V . J JJ Jjk,,fVJ,, .J:.1g J ,k... J' i. zJTEi22iiV 'i J J L VJJ.JJjgJ,gJ . J 1. A .J. . JV. J. K. X JJ -J L--- -' , - J T J .ffl ... . . it JJ JJ JJ .. ' iiii JJ W I J JIJ Jl'f lf ? gf KKIK ii 1 N S T VJ i . V 5.5 A N 'J . ,. V l.-- iff if .JJ J A V'f'Ji .lf 'Y JJS J -oiii of J JJ J J . 4 Jr... Ji 2i?5iJfJTVfiJiV?z .'-' ffJ if51VJJi J' V J J JT . J A :jg VH 1jjsvgExgEJ A if ..gQlJJi.JJ MJ' J if Jeff Jf k J J . J. J ny J ' J J if V1 V 'J J J ., J J i J 'J J JJ 'J sa, JL 'J J 5 xlxt ff 1 'JJ J z.:.Ti612iJU: V 715.7 ' v ., L.,L .. . ix. ex 'v.:fETV Jin Z?issJ:.f.:2:'?J?V 3 V A ' Q . ii'-' VJ JJ V yy M A I g . J ik' V , 2 - V .1 -fa.. if V . is J JJF3 - J J sit. TJ J J , JJ 'J JJJJV . V . Jef ' J V V 1533+ :ZJJ ffJJ J - V s ? -f'-f. J -- J: Ji: En .sf1.V2V :-Sf: wig J kggnps, .J.J VW 'J E1 JJ z'Jf1,,.fa1 . . saga . 42.21.12 .21 ',J'. JLJ J , A '.,J J . , Jj::Jiggg, J .1 , Ja.. J JJ.. Jfggz k JJ J. Ay J J , ,J J'-J .J 'Q J' J. MJQSJJVJ .,JJ .QV Jeigvig N J JJ JQ FJ JL. Jiil fJ jf ' V ' .ff 4.51 .'-- Ji. V, M. 1 .1 . f,. Z., 231 s,.. , .1 .. , J.: V , J -J LJ 2 J Z. - J ,, JJJJ J, J JJ .J J... J J. V J . J J',,. JJ J' - JJJJ , ij.. J ,J.45w!!'s .J il ,J K' Ji V 11315 W. .JKJ - ' Jigs VV . J..JJ J J ' E fy JJJJJ JJJ JJ'J 'J HJ iJiiiJ'V1JiifiJ?J'Jii5JJJJJi? siJ,J1.-TLV JJ JJJ J J J J J' JJJ iJgiJi .. .. ,.., VJ y A VV V J . Ji'...,.V VV ,1J..' .MVK J. J' J fJ..JQ.J: JJ .,.'J'J .. ,... JJ. J ' J J Jk'. . 4 J V a VV W JJ . ' - J' J V J 'IJ -s JJ V,.lJ JJ' ii ,J JJ JJ . J. V J. . JJJJJJV V -VV - Jw, .-JJ' - J . J ar--.. My HL . ,V , xg-ggyggk - QV Q arg- E 5. 3 V 5. . V25 .,.. y Qi 5 . J, N V r-- J we -fa Q .:-H V. V: J aaa -J -1 J J.:i. if JJJJ' .J-J i:'J .WJ V J. .V J :JJ ,... i, if ? ' ,: J V y- X Ju g , J- J JJJ J J L. . , J A 3 4 VJJ. J J, VJ V . 'JJJ' J ' ' J J J. fJii12J24f-JJ -Jig, Jg1V:1JiiVff,J ' . ., . -- JJ.J -VJJV is iz- J-wgfaag wziq- i11egf3::g:.,JJ--1:1 ' . JJ.1V:Jf,J.,JJ 'JJ Jem-J JJJJ I 1 V- JJ . JJ .V J ., . , JJ.,V . ' -J .V J V ,V J Q J. JJ-- J JV.JJ J .. J J . JI 'J , J , 4415 JJ ,-.1-:,.V if -lew, J J.: J J we 2 -fi! , Ji . V J'Jav,. ,1..Ve .V-V JJ J as-Ji. '- Q ' -I 'J JJ J J .J 1 W V y f , K? Dan Couturier , WAIV, VV .1 me ----- f . , Dale cox ., . V , - ' s 2 QL ' Jim Crace . , V . e en ramer .if f ' ff- ' :w iv 'g :,.fxK:' , , ,... -wffezi V ' '11, .fs K 1 Z ,iff-Qi'Qi 0115 P , ' ,f MQW Crtlven . , K V' .4 . V .' . V K' . A g EmmY C e'9l -' :K'F'Vi!V View - 1 ' ' .' K ', K fy, 'K .ff 'eg 'Kew , K 5, A '-f ,511 . V Q ' X . ' ' ff , Teresa Cfelghlvh or ' V ' . ' sw Tom Cfslshfvn ,V A . L ..,,... ,,KW, A - -V -, Af-' V w V, V1-MK -KzsSiiSiff 2Q'',,.wS7Q!aiK4vK'-5K ,sail i K'v ..'--. K. 1 .flaxVli,-fiVi1j,Knf-2,12 K' ' ...' Els t..V Kifvi 2-'f. 73.3fzLi1f Drew Crosby ,k,L . ly.. I ,gi ,r,.. VV: H V. y . , ef.. .. Q,V.g,i1.V V t V ., ,, ,V.V 'K K' K K 'K ' ' ' K sharon Crosley ' iii YV 'Vi la '-ij ,' we ,L S 11 V Z Q . ' , L . Robefl cross 'i i i ,'.. fi? Lew if E 1 ,,'iYKf's 2 . if :vie 1 S' C I ' V ' .. ' ,L- K' We 'Um BY 'KK -'sf e,.f-'wig' if :f e .. 1- K'1--V1 ,,-f -f Ve V, ' K Ve, we .Lvl --fy ,y -.,,v f-ff 1 new- K..+zs -Im., k Ak 'se-, 35 3, . . ' , Linda Cunningham ..1V,,. --- , Vgifm by ,V g ,.Vig.,g V32 .,-L 1 'f,'M3,,i .,f, Wig, , - V S 1 , , Sheffell C'- 'l'5 5'f7'iK5't Msi i f I . Kf fi , i f! V K ' V 2' ' i Gre Cutchall V f If , - K V or M-ch:-el Dvlv ' 5 'xy' LV QV . Q . , ,, . U,,, ,..,, . ew :K fgKweV.mfe3pssg:av-fgwe5Qg,.,,. . i,,.i,M.g,VV . . ,V rl he . K ..,HV,7? Q Dqnny Dqmel ' ,, 'L,. Y . 9 . ' - ' 'K K S llfldglils ,,,.. Y ' K , K' Ed Daugherty V -- : V-. 1 - A , ' 1 V f . . , ' 2 ,'.L K ' ff GW' D V , ' . - ' . ,, - , Ga Davidson 'L-' ' ' ,K V' ry . V i n nnnP Gvfdfm Dem 1 1 ' V 1 Kath Da I - K, Ke Nw .fflf rm. ' ,..W ,.-, S K 9 .n , P S me W ,A 2 1 M 5e:neglLeDeCook , , ., -, V Q o n s :'i:K'f2z1ffg: Vw . iz? ., , ' 'fi - 2 S , , wif' V S V Paul DeGagne 2 ,V 8 . Q . ,, Tm' De e , . , Pelel' DeMars W ' Tom Demmf' :5'33'1l' K. 'VH T 553 efiJq'ig: '97-'1'-1? 9::i , 5 ',.C,'i1' 'fVV.iES z1f 'V 'MPX .f:,.gwL.sgKg5L Q,3'1 iii' ii' P' if Lrg' li-TQ K? S555 ju Ef5iV9YVl5fj'KK Hen ri V fiilf? ' 5 'V 'uf 545. 'kllgiif 9.'2V51'l5il 21233. S igkliki V V ' . ,- , Pat Dempsey W H -1,1 i, .-5 krky ,,ggigs,V-3, ::'.,A :54Q zysfrd , A , K il gg' .53 L -ftgf ,gf ,, .,., Vi 4 'K l-Uwfenfe De '0mY F f ofl9O Fred Denton Fred DePorter Elva Desiardin Daniel Deweese Dirk DeWitt Kirby Dick Maggie Dickens Jayne Dickerson Theresa Dills Bill Dion Armen Dirtadian Skeet Dodson Janet Donatelli Denise Donley Linda Dow Judy Dowell Tim Dowling Jack Drake Frank Drewes Linda Duarte Bob Duddleson Diane Dudley Patty Duke Debbie Duncan Elizabeth Dupuy Delores Durham Debbie Dyer Christina Earl Gary Earnest Roberta Eck Doreen Edwards Chuck Eger Berna Eichenberger Diana Elder David Elliott James Ellis Pam Elmer Lu Wynn Ely Peggy Engelke Kathy Englert Robert Eppstein Joe Estep Sharon Estrada Bruce Eubank Vincent Ewer Carl Fairand Rod Faker Tom Falkenhagen .mefV,,.,,.,s.vV.fV S P.L,msaev.1 gm' M M.,meQ.s- , - sstf- me-QV-W , vi53iQ9'3S?k'i 'Kefg4s2S?f: K' new . . esiziw f :ezfV:2 '2fS 11:-H ff' L' S1 N ee' QSM 9' Q warg so S S. 5353 16 sea 5 is 5 mx x 'S 2 523 S9 SM S ,,,,., . ,. 5,6 . less? 25 S jg' 1, 5- , 1? W . ii ' , eff. :vi ii ...A sQVsm,.5 ,wg -n:wswf:SiK -:KMQES Y iqe, ir- 1: , fit ey V -2 f,-..:'V121si. . ,:.:::a- .,.: ,Q , s .Sl X W Q 5 S1 A K .. ,ir 2-2 if ,,., .,., , gm. s Q W ' X S H K if. Vase-m.sQ,fggV 1. -Ms, S 1 is M Q 1 Q S f s PT' S is M, S , 5 4 S12 s W Q L 1 2x ,e s 2 2 S S r nv +L.: is gc .ki S 5 Q- V .K:eK ' 2. 23 5 . .. k , F P I'5.iff'TI' - .. - Q - feerwgl, ILT -I V V 'ffsii 'eff' K1 . V 1. , 5,.sTf',K 'I . 11i sS1 zs ifilEf E 5222 . Kg. il -V .,-'- ef -..-, V, ,, 'V ' ii' 1 - V V Ki fiTsswasKgg:gV.sQz1fsfliiiw,4QfYsKfisf2if N , ,..,,.V V, I S K VILYW-5EIi ?Sif' '1?',.,, ' fiiiisfftf .2'KiT QQ, QQ 2335753 .3 ,'V K' I ' :-I-H-,.. T.-I , vV'i1.1X,gee ' ' 'fl K, an If eg i i'.:'V5if V 2 En, 'N F aw'-Q i1Es'K.ef ,gcV.xgfV-QQKE Q . fi KE V ' Wifi' ' Lf, . ' - - 5119519 7'Tf? s'-iEQ',.:, .- 'f2V, e.r f1.V u.. ., 1 L. Z.,-eff' i V- M , iffy X , , '- 1. V-VL., .. . 4 si ,jg su, ,.,. A ., ,.,, ,, ,..,, k ,V,5.:5, jWKKg'Vff Z?5 5.g'f1? 'K eff: 5.5, W 5 f VwsuiELl:z14f21ffzjV,, Mg.-AWE K W :U A ,,,V V s,,. , Aw 'V-V,. s,V5-VV:..- W, S ,.VV..VV. ,,,,.c ,.. K H J, e HQ A' Q gf uf? :ff Z L .P .T , ' , ' 1? ' mv? , ,.,,. , eazsvl . . . ,, it 52:6 S Q. f1KfffV.4s.42sae5,Q x1.'e,11K.sVs V. 11552153 122 ,251 ...Q - .rms e. ,Va- S SL K We S x -'R .M il' ,U ,M -V,. .,, - s,..V, .. 39563 4 3 .S Q it Q Xi K K sw S 1 3 5 V it ek Q . 5 f .izgfeif 2 'V ,, fs., , V r-1 ., -. s..af.::.:. ,- me 'Ki if , , f . A ffm' 'Y-mx it--1 - , I A W fa, X AV- 1.5125 'Wk ' F' - .im ?7f':f-'. - K lg? ' if :'ZKlViQ 'YA VV ,' .iw -V '55 K Wm, ,g ig , wk., . ,.,.. .. - ff.- '--f:.l'1.f:1 . 'asia Vigil ' 7 .fi Allie '9Yi9fiS?1 ,g5.eET5f 5K5'Li2?Q?gE 34, I I 'w::,V,i-KVSMS szsif' We Se? Q-iii 3 ei S35 at ,..,.., .. 15,55 sg 'E all U, 154 Q ,Sify g 2 3 -3, lf, milfs . :QQQQQQYV .Nw X 2 2511445 Veer' 'K:V,, ..22lf:- 12214-L11 Tsai: Qi: Kigsgv 3 iililiie 5' Kf Sf glans? . ,A .f7- W 4 9, ,.ez.VV.Q:f,, zs,.f-ref, 2.-'.K.sK-szrem-we v:s. V,em-V.: 91 s4si4'7iv?1:5i'LasEi'lQsV ' -gsiliiiwz Ki2ifiQ?V,,isvsK'5'..,s1ex:4, few, ' Q S siszf1??bQSV?1.fg iw ' K' L:iE4i?T iklilisgqzzlfiizggeemgzi waz, ,, fu , as K ,sg::22S.s15Qsg K ifwffijf ',-zfaii 2-fl'iiklff7f'Vv.w2T 'f7w :gif H 2SK??ELiK5 V' 5 ffY1 TQiFf?:if5Lvj',j5.fs51i ::5:.g-:,::gg ' SS ii.:lifiYsil5igiYf5? V Hz We V , e :ee rl A if Q 91 we 40 mg :sis ? 9 ic we e is N K K iiggmgazibi Effue i M wg! 5. ,. -iff? Q3 E, ,S w..g .L,Vzf :fin i A .A ,I H.. .L I ,KK1': : 'i 3215 Y ss , ,f.., 'ii x -9 Si ,U s ggi. ,f-.M if as 5. Dan Falkner Mike Fall Glenn Fallwell Bill Farley Chris Farnsworth Virginia Fatkin James Faun Rynee Fehnel Don Fehr Arlene Feldman Shirley Felt Dan Ferguson Lori Fernald Charles Ferra Jerry Ferrin Don Fickett Linda Field Bob Fife Paul Fife Jon Findley Debbie Finefrock Diane Fishback Patricia FitzGeraId Tom FitzGerald Tom Fitzgerald Linda Fitzpatrick Margie Flanzbaum Steve Flint Patty Flores Tom Folks Mark Foltz Karen Ford Mike Forrey Mike Forsgren Kathy Fortman Richard Fossett Larry Fountain Deborah Francis Jeffrey Franklin Darrell Frazier Shelley Frederick Fred Free Kevin Freehill Verna Fridye Sylvia Fripp Carl Fuller Cindi Fullerton Kris Gabrhel agggggggg 151 411 r - x -. 21111 . 1 1 1 1 -- - - .1 ,l,. . ' . .1 FF - -F ii- -F i 1 .1 'X -,, 1 F ' ' i--' K 1 - F F ' A -i. FF -F A 1 .73 F' 1 F- F . .F 1--fa? . .K f K NK. ..1K.i.A11K1yK I K, . is I-A .i7. . 1' K -K K ,R f-L. :K ' . .51 FF-..gyj.1-,,- . F yyyy 5 FF FF g K M , 1 1. FF 1 if' f F ' 1 ,g1.11K.g11.. Pm fx 1 K,--K1., K- 1. 1-1.1?-zip - 1, -3 -1 - .- .- . 1. K ig? -kk. K .1 K-A 41.5.1 F .:. .F I .. ..K.1 . 411 V1FE11fE1.1 ,- - FF r ' 0 F ' - - AFV - -F ., .F F' eiee eeiee i 1. is? 1 F -1 , kv-zq K:-F1 F 1 K F Fx KK Xb. . . 1511515 K F 1 . F . F F F 'F-FFF Kg RK.. . .1 K ilif 1. 1 1 , ,. - r,,,. -F K. , F Fl.- 1.-,.f1 11K KK-Q1 -.r31KK ,. f, .-3 .-... we . ,--,.- -. F - A 1' .1 5 .-- 1 . - . . Q. ,1 'FY' .-.. . .-f, .il-ilfFii'T1f2i S2-YT' 1.1il11iQi. FQ' .11.f1 ' 2F ii 75 - F Q5 1,i- F I F K. . K, ' - it 1. 1-'iZl 1 .,,, 1 .11--11 - , ' F 'Fi-ii 1.252 F ' F ' - FF-F 1F F A 1,1,K, 3 - K A - F 1 FF F--- ' F 1 F Fx ' 2 222.51-Le -2 1- . -' ' -I K,-K. 1 .WFF ' ls K - - -F1 . FFFF 111,F FF 1 V- 1 F- F - Jw F 1 - -v.F i . -F FF'Fi1i1'f.iff'F'Fll 1-.l- 7 F 1 4.--'F 1 - . .1 'T Fifi- '--.i F Fi? .Fi1, - 1- S Q 11 1. ..1, . ---- 1. -F 'a j FFFSS 'SSF F' I F F F:v.v'.-1Fl.1 J'-lf' 7 1525 2-IF. -- 'WF FQSFLQ i ' F - 'V 'l V 5 .Keg 1 K K KK1K K 1 ..1. jg 1.5 1. - 1. A .1 K .2 f .. .Hr-F'f sv 1. 'ie ' F 1 . 1' F' .-v1 fs ' X1 1 1' 'X' ' F - -. ,ZW ---- 2 ,fl IFF FF X V' -2 - Q- 11 H1 QF .ll W E1 s 1 1 ,ff 1 - .F1.F SFSF Fi -.-- i.1. . ' - 11' - A . 'F ' QF f F511 -- F . F --F- i1 1. F . K F J 1 F - i F 4, 215 - FF H4 - - S F Sophomore Robin Gainey Carl Gaidorus Rick Gall Linda Galvin Frances Gamez Denise Gannon Mike Garard Connie Garcia Joe Garcia Debbie Gaston Tom Gaugush Bart Gavlak Ben Gaya Debby Geiger Cathy Geisert Thom Gelineau Chris Gerbais Renee Gerstenfeld Cyndie Giambruno Mike Giddings Gary Givens Patti Glass Mari Glaze Cindy Glessner Alyce Glinski Edwin Gochenour Glen Godden Chris Godshall Ginger Golden Anna Gomez Chris Gonzales Gary Goo Sheron Good Debbie Goodman Mike Goosherst Brian Gore Joe Goree Gary Gorman Peggy Goss Larry Goulet Sharon Graham Jimmie Gray Judy Greene Wendy Greene Kathy Greer Dave Greever Gaye Griffith Tim Gregoire Steve Gruber Mark Grushka Shelby Guess Kathy Gunning Richard Guthrie Bob Gutierrez Bonnie Gwaltney Mary Hale Cathy Hall Michael Hall Robert Hanshaw Bonnie Hanson Karen Harkness Richard Harney Beth Harpel Lyle Harrell Scott Harris Richard Harshman Joe Hart Tanya Hartman Joe Hartnett Judi Haslag Pat Hatch Kathy Haven Nancy Haverlack Robert Hawkins Dennis Haymore Michael Hays Barbara Heald Ann Heater Frank Hecht Chris Heilman Class -VVg.1Vg.'V - V1 ', V. I -1 it if 4' ci 5 Y' E ai' A 5 1 7 ::- :VL-:::5 -- Ee 1' gg- eff , ..,, ...I .N .:., VV 1,5 lin 5E, :. 'E? --: -V.::L . Q W... Mk ?s?11f1iEi 9'.s5e?ig - 6 f5,cVgVgfV11QQ.t-.Q-'1.e1V1. Q i1Lz21i1zVtZV2g313I.1i . 1 iz-bi7l5i!fl.e'e U 5' 1-.W MV :m fV2m wi Q ww Zmiii 1 sw V ,.. :E f5Ei'V.i 51 - - .-NP, I V . ' ' ii V-37 iii- . 1fbVS1-5ISwi F::H1.S - . .V . .. V V' V , 1. 'I ' Vi K' ' ' '?:5i455i1Qgg:fg- . V A, : 'V 1V. . V 1 V1 V H V .V . .V V. V . . . V .V ,,.. 1 1 . A 1. 1 V VV .V V: V VV 1- . - V V QVV11--V .- . .VV -V .e ..VVgeL1VVf1,V VV 1-H wi. 11. - V VV ,V V 11. 3VV ,VV. .qqge .QV . s..V..V 11 g,::,,s-: V ..V,gV:.g V .SVMMV V V A V V 2 '1 V V- 1 1 V.1V V '- ' -V - V ' 'V V lim 1 H7 QM.Vf'- all .- 151555 VJ '13 Q11V,..fV V1 1.-' 11-231,5 1 V. -jifff 1' 1 ,gt V K V-V: .- ke ..VVV V1 'V'1V--1 V, V- 11' 1V-Q1-12111 if ff Vff 1 1 . Vi'-TM 111V 1 awe VV .'ff?'1T l ' 1 V 1 1 'fl 'fi V1 .- es-155:-V.-V 51535, AV.V,k...g VK to-Vg-V..,.,.,VV.fg5f 5, ,1y14V:1 5 V, x -.fi Il Vvlu V. A 9, 5 1 Vw XVV -ww' V f , .V 11fSzw:Qe1.JV.Vs :ye -. -V V .51 - V .-VV-V1.z,e1122i1VefV1sV11. V 1 f+V Vr 1 V. 2 V V -V V .. QEVVLQ VI. S V Q ' .V ,,. ' V. V V V-112111 : VV 'L Us M 11'V'1 .. . ' 11 11.9 V K -V ' VV fl 'IW11 1 K V .V V91- ,f .' -a e-V' T 11 'f.,A..1- . -2' w V-1VVV 2 511, ,,..Ve 1' V' ' Q We . ' my .V .V V.,V.VVwi 's V1:11:11 VV1 V1V:p1V-' 1VVV1VV1-11 'if V eV1'1'mV. V112 . - -- V .K V , V.1,-VV: .V V11 V511 W2 : Q 1 his -121 V V' ' 1ffVz1V1V 73 5:2 V 1 ':1s VV-1.-1' :V i 11l' 5f VV LV- 1- '14 ' ifilif .iV - QV-f..VV' 17 V V VVVV-..VV1'1'111f-11-IV' 1':i?1Lf '.f 1 ,,ViV1Vgg. V. tie A 1 ' .V ' H JV 1, ' V ,VSV 3.223 - j 2 S 9 to 1.1 ,E ' - V - 1, VV Q 'ez -V1 . ' '1 V K V V s1'f-. 1'ijf3:n111o ' -V VQVK 5 is ,121211 ' V- .V V1 1' 1 1 f V ws' V . f . V. . V -V 12-'N V VV:-H--, VV., V,-1 4,-gg, , ,R , , . 2 f Vf- .'giV.1:-Vw V-V..V u a.. ..:V V VV V 1 VVV, .': ' - -V V V V . ,.., ' V - - .1 V . V. m . V :f1'V:1w1-V1.V: 11.Ve V ' iV.'VV',- V'VVVi V.1 ' 'V 1V.VV 1-21112:2V2v Vz -VV: . Vida 2 V 1-1 V V' V11 V V 1' VV VM. VVV. -1.5.1. L .V V, VV. me--.V .. -V.s1V V f.. 11 .V . 2 V. VVV VVVVVVVVXVVV-V. A ae f : 1' 1' 1 ' i.llf2liLW1i5Va'G:1 1 7V 1 V Qu '1 ,j.1V i?114Q17:V' 1 -ff V :V V.VV 1 11 . V ' .V f' V.. -VVQ1? .v iff V EEE :. S 'QQ Q' iff -9 af' ' 4 '1 ' i V '1 'QV 21V1VVV-11' V'F V'1QV' VV11 -1 '23 V. 4 V - ' ie VL - V 'V 1' ' . 3- -'ill . ' 1- VVSVL--Vow-We-11 4' - Fi-1 1 i ' V.f1 i-,f1 Vz-f V,-VV, . .-1 gmc- -'VL11V -5, z. V vV.-- 1 V 2: V V- WMVVJWQAV . X .VV.,V..VV 1VVVV .1111--V gif-1.VV1VVv1:111 1' 'fVV1.21111:-1V11V1':-VQ'11 V V ' V5i114'1aHV-Vf11 1 '1'lV111V2i1'1 ' S V .- 1 V SSS 11-v -Sw-VM ,V jay V WV?-:V wQfi1z1ViZ1i,g 1112? ' V S .1 S,.VV1,..gV.VV ' ' V, - ,cf 1 .- VV -V V55 . M, -:H maze? VZ ,- .Via 1,..gff sVmSLg1 1 21151 551'--flee: '. 11 -QQQVVVV ZLV VV LV. 211VVW:V1'- ' .' 17 11 Wifi YH? VV. 1 I-'ii ' 1' 15 li iff '.i:V V911 'lf VYMQVV-J ' F ' 77153 WA' .V 5532151 ' Af ,VVI7 ffm: Vi 5213413 .15 ' V V- ff' V J .V VV - f V-1Vf'f-VVVVQ If 11111 V--1VV V1V: V21 VV.fVVV VV Vfvr Vfaff Vi ve- V1VV 1.-Vx:-1 12V V'11'1VV1VV-Vs 1--.11fV.Q:V'1VVV V, VV1r1 V 1111-iVV'VVfeVVz.f V 5 iiigfiiiiwzle- xii' :- 11 9 ' W fE1.5Qi.f: i f-15112: iii? V V H1931 l ie: thi s -fggliiiig 1: VV1'sQ1:l-511 V K W V 58 R55 illzjji i VV-:',.V 1.--VVV.eVVxm1mVA.e..gg1ezVl fa- V sV11f , . 'Vie -,Vx V 4 VV-- me :Vw 51121- 11, -:V V .-'-. V:-,V-f 5s1'1V7fVV. V314-iils i svief V VV ':VV4 '- V-ww -V ,WV 'gg-14-,Q V-111523 so f f V.1gVfVqg1f'V1Vg:1V'.1 VV.1- ggQn.gge,3F,g,gs1:15 fs2 e f' V '4 iw V, ,f1..V.egVV,.-Wg.. ,, .. .. sf . 1 V VV i V.,. W 511:11 iV121V'21'-11 VQVVVV n112i ew2'ef5gsf,e,1ePVreeVVrmVg Ve V VV 1 11 X V John Heiman Eleanor Heimpel Donald Henderson Bill Henley Marilyn Henninger Dave Henry Nancy Hermann Tom .Herriford Betty Herring Michael Hertel Tom Hess Sherrie Hessick Kim Heston Carol Hetrick Monica Heun Jerry Hewitt John Hibbert Gene Hickey Mary Hicks Mike Higgins Janet Hilberg Christy Hill Randy Hillock Robin Hilton Karen Hinterkopf Debby Hite Dodie Hoff Donna Hoffmeister Billie Hoggatt Vinson Holck Mary Holdman Karen Holly 'V11.e.VV.VVV V..VV .-,V V.. c We 1 A 411 if 'Nc 5 H 1 , V, Hi'V.f 1fVV 1- 2:1 KV ' L x' 'VV.1Vz MSW' w'.V'V' VV 1l,-WV! XV-.5VV,e.mwV W-.Miz-XV -fm- er V or ba..sVfs-VHMVPVQQ ,V.eV-mglwfq m,.e,.yVV13V1eVV.mVV .sf 5Q1fXVH11sVlX.,s1sV1 .eV .2VeVV1fsvVV was -BV V wise -fijiliiw VW-.V-VV-V wifggwtg 9' ' ag' LV S S fs J M ,sf - , 5 Q3 vw Q we Q S 1 a s 2 1 Q 3 of S S Q Sf - S V, 3 V QQ? Frances Holt ' r Richard Holter V . VV V V V .V V V VV Karen Hahn VV VA ' V ...r A ag A 5 August Holzworth V V ,V , .. 3 -.f' . L' V fy . , VV Bruce Horn QVQ, V .Q ' . V A if V-3' g LV QV. Teri Hospelhorn ig V ,V '5 V V VVV i , ' Lf, Pew Howe V ,AA 1 .1 - I ,W ' 'T 33 3 V. M Biff A .f Michael Hrometz jg.!4Vgg- . V55 If 1' .K V Z r n: V - 1 V VV ., ,,- . V.,V r, V , V VV V Ben Hubbard B . e- , , 1 , -- .r - , e e -ug '45, e -Uri ' FLVVV .r , ws: , b 5 7 5, rf er- ., 7, .. VV AIA 1 it v, K3 W 2 eV-an . ffm sn.- ' er f 4 -e-. r. 5 Roberta Jancek Gary Jankey Terri Jansen Marcie Jarratt Steve Jennings Bill Johnson Camilla Johnson Doug Johnson Gary Johnson Gene Johnson Judith Johnson Walter Johnson Barbara .lones Bob Jones Doug Jones Mike Jones Ronald Jones Wendy Jones Mike Jorgensen Barbara Juarez Jo Juarez Karen Kacin Kristy Kalt Pac Hubbell B' 1-1J'l . fe VV ,V V ' Rhonda Hudgel Ve ..:. V . r . ff V V Laura Huena 1- 1 r G r B V Debbie Huffman r V1 ,V - charlie Hull A if reree .Q se i A 3' Henk Hull B E i n f mf' i i-ll Siiiez. ,fi rg l-W' Jf-ck Hume ' ffl ' X .bfi ilsr ex' ez Barbara Hunter I . V' Tom Hume' er eai' 5 V V- John Hurley ll' B K s.sla f - 4 aan Hurney A '55 fr reee 5 . V Edward Hulchiwn gg' f iels A Carol Hutton i-.l is V Q. 'L A .V V V V Jim Ibach Vsee ' J Warren Immerman A . V 6 Rex ln9ham r A if 'VEQ-fi' - Debbie lnsley V VVV V , V VV VV ' V 4 Andrew Israel '- QV B ': S gr.. - G Glenda Jackson V lb' 'wif A 5 ' V V3 r Vi IW' V er . Jean Jackson 'F a n B 4 VV i QXV ,. , 3 VV ' V QV A V2 V Penny Jackson ' V V g V V ' V lg Melanie Jacobson - V V - QV Q 'Y ,V i' if Sandy Jameson 5 V 'B LV, V Ven . V VV., VV -V V V V Pi V VV VV . - :-- n i'.'-' li 1-1 l-far ' YM' A f V wg iVV-- VV r V ' ' we A W ey r V VR ' 'X A 'A V r i Q li r B Q - 'Q of ' X ' iff!! l'.. ee ,ii Va? V . r VV V VV V if ,r QKVVVA V VIVVVVX VVVV VV V- -M Q --5 Y,,..,e .QQ Sift. '--'.. . V - ' gV '3iQ 3 V.V, V - -V . V V'.'V V QV . V A VV - - L- V - VV . VVQVV V VVV E p e-,. VVV J, I . T- . 1 7 .. ' aa-., ' A V ' M I' L. .V ln 1 5 15' r 1 V.: in e I 'fx f V r V G '13,4Vi.V V. Q 'B V J so VV ear .V S V 6 .- ,Q W i l 4' Ak.. V. .gg VV V K . ' 5- V . ,y ' -fi 'A ,,.r. if A . A511 W' V s Q21 ei er S5 ifaie e. B rr-r 2 X G. A if B A 'B V- L '.', A I . ..,V. fi 1 . V 'lf vii- .: i ,VV. f ' V .,VV' ,ny V -f - if - 1' - iw . izziff VV.'- V ,A A 1 V. V ,M 3 V ffm QVVV -- . 43315 jV iVj.l,V'-Qffpi VV - V V V 2 Jie 3V , -pq V V ,re-A -' ry5V. -fe V - Q . er . A ' .. ' B 1 -W a, V i V 'B V.. feg,1a3f, . ' i .4 . rj, w. 3 .1111 w. ' Vg, ig H Z-jg: Vg . Wa g -1 L gifi. ' K 1 ,V been. ..,, 'IB ,- M if .. A :Z f A IFLV, .F gli , . ' re, K - W. gf il he . r V. Vi VV ie ee if B r 'X' f 'S W 3 f :L X ie' B we ae er.:-M ' 4 x .r ' - ' A ,K V r , ,egg M. fc ,M- Q ' ' 1 K 4' n x r if H, . 'X r-if . ..s. r B V K . .eVre . 5. iil V B ' r . ' G G A -. . as . . . X0 na' 1 F?-a ' 15? V . l' I f K T in ff . K- '.,, 9.g Q: V V r VV f ' VV - - V .Q - f B 2. - .. .r. s sr f y M 1: A . -e 3 5 if air A 'V Vw 'Al - F JoAnne Karr Robby Kasen Neil Katz Tom Kearns Dee Dee Keaton Bill Kelly Dennis Kelly Bob Kemph Barb Kenady Debbie Kendzora Terry Kepner John Kern Robert Killebrew Bill Kimmey Jenny Kindred Jennifer King Bob Kingston Sandy Kinler Dwayne Kinne Joe Kintner Gwen Kircher Andy Kleiman Sallie Kleiman Dale Klein r W .V f' ..., X w Class Carol Kleinhesselink During December, the combined vocal groups and orchestra rehearsed for the upcoming annual Christmas concert. ofI9O V--V,f,. .- ,'ff,-'f-sew xg '. -- V, 7:25 V. -M g .. .',ig,-5 g iifmf E' V g et V-'V'377.i ' ' if Vu? S' l -'i'YJV:lVf:ffVi'iV : at A ,. fa, 'if ,Q i,,. , V ,AV,.A J 51:2 xg, S! 'L U ig. J V, V ag, 'ee '- -- .. si 1' ' L' 2' ' V V V V ' 'V 5 YQ, fi: Vif' -Vi J V. T-:W . V Dfw, We . -1 I Z -5, V - FV- - ,ye . V . VV. H . Q 1 V - gi g A ' 'f -gig . V, ' fff V .zmsezx f F J . i' ,,.. V L ' f,-k f f '-fifff i V ' X W -if , A :VV V - , ' Lb V L- V. at - 1 312 V-f Vg' - ' .-:V - -V VV . 'i,' -, ' . V csiis nrcr V f S - V - - ,K - 7' , . M. Vaiggggg-1Vz:L5, 'c K L if -,'k I 1' .V J A -if i 2V my , ,Q -V 1 i -V ..f:3'i -K ,V,.k ,ggi -g'3,k. , .VFSVSV ,Rf ' Vi ,-5 VV-VVM.g W vb. s S K 5-nw its N-S 6 2? A 7, SV 5 . ie ,, ,V ... , , --ffl V .V Ve, 4' in Q me gf 1 BX if E. ,. ' - ,riff 3 -.V .' if ' A -5- ' V ji' F fi' - ' + V ..,., V Q V . 3 ' W- V ' V V V M , VV ry., , ,.:. , . ,L, , ullz L LV.5LA,,,.. WM HV Vg J V , V V J ,ff V A iff - ', 'w Ks?-V42 , - . 'r-f45f'1eVV 'V 'V V V V V. ' L V ' ii V. ' V I ' ' ' ' V 'J ,fe ,VV 5 E Y , C ' J I ' , A A 'f V' J' , V ,y 'V , L- Q, Q , - , L ,,., V ' i - p f V ccVi V fV -.L,:rV2yfe V -- 537' . .V ,QV ' V .. , V VV - ,. H if .. V , r,L. l a h , V 4. :Er I 1 VVfffV,V x 5 Zig -' 5553:-V kg L' eg h L ' ,,, A ,. V . ' f 3 ' 'iii ' -V . 75 V ,. 'VV' A 4 V A QV- Z ,V V Vt - -Vs, , V V ., VV,VVV-K I k,. ,V ,, , V V , -VV, V,-eV. ,- ' ' - V V , 'V rmin zr rrf- -4152 .V V 1-5, x , V ' . ev ::5j 7 '- ' i ' VS: '-A ,Aimee V: V 5' ::. v' ' ' L M, 55 --V 'fE,Af:fiV ' ' ' V f V .- 'vit V VV '- V V' VJ: V f Vi:-i1 i f -g- 52 fviK'l-Vldffs V' ' 1? J ' 5 J ' .5835 ' ' .1:V ,'VfQ 1-V.-rg Q ,L ' A.V,gL,',g ..,V ' VVV, SQL.-. ,Q.Zf?Q7 'V eg' 5' -3 . . g V V WY :fi - 'l,'i'1i u,? -V IVV! iw gy I . f f e . A VV- 1 V V . V, L, ,S V.,,k E5 , .VV . It If ..,, ,V . V- - .- T! VV. ,:::ggf:V 1- - -.-vga' V- VVV -5--V .- Lrg. ,-2:V, '?:-525 .ii 'fi ,, - V . eggyrii-1.25: VV V . V-Vie, ,QV . V. V Vw V1.5 f V- :rf-.eff-:vi ' V ' e 5 eg? we ' ., 3 L62-WVV, V J - V ' ' -V K ,.V- VL,L ,W , V V VV ,... z V sg -, V ,.r-ggi? V7 V , 9 VV -3 VV I 3 Mark Knife Steve Knox Jody Koch Roy Koningsor Terry Koons Leslie Kopman Anne-Marie Korn John Korn Kathie Kramer Jackie Kruse Eric Krutzsch Mike Kuhn Kathy Labor Fred LaFrance Edward Lambert Donna Lancaster Cathy Lane Bonnie Larger Joel Larson Kathy Larson Lynn Layne Louise LeDuc Danny Lee Philip Lee Greg Lefko Larry Leggett Michael Leinen Meryl Leiner Patty Leising Debbie Lenhart Mark Leopardi Lenny Lethaby Brenda Lett Richard Levandowskl Pat Lewelling Allan Lewis Janice Lewis William Lewis Debra Leytem Charlie Liccione Kristi Lien Bill Lindamood Judy Lo .lerry LoCascio Linda Lock Missy Loczi Dan Long Tim Long , ' ' : - - M - - . :,,, 5. f ,,,,. M Me, f ,A , -- as :M M 1 2 ' -- ff.: - . '. . We -1 Mr .. ' 4155. , Mr 21,2 1 if A ' - ' M iki' M- J' riff gfM3,'.5i-if S ff,f',.i wi Q-M . - M M, - J- -nfl, r- ,VM M A jgzn k K gi 'N ag y jr 1 3 r :jf 55- -- . A AM A -1 few 1 ' -2155 3 V -jg 7. , signa ge '22 jj M ae.. .x i N 9 el I I J' M l' - f 7 M f an 1 IFE' .S - J. ' Mu: S -,M -1-12 7 5- is ni -3:-M QQ? . 1- 1 S-Q M gk g 3 gre' f - ,553 r M '- . - :six -1 M M J 24 A A iifagg, M r gk, ' S if ' M -- 122 ..,. Kwik ' ' K K f ' 1, 135 . - - Q35 S 3 A ' f . .... ...-. , My M, LM , M M J: rem. Wi e 5 gig. f.::1-5-... : ..., T ' ' . 'V L r- ' L ' M- A-fA, . . . ..-- :M f K : 2 A l M- .M .,, e. -1 fm W. -S W1 gli Mp- M 1 , M F . 5' or . ' - 2-A is . 1 M we 5, .Q . ... - A 7' . s- ' .L ' - r -- - 1 if. vs: . r fgugg- M -r ' I 25,1 - - -Y ' . Mi 1 ly m'.- ' MM ',mKkL ,,. M J M J' , 1 ii 'm', M' M ' J A H K ' ' , 1 MM J, ,k.,. M, M K .M 7, M., .M . M , . eeng S A K . . a - M S Ad' G ff is VM 123' W 'W iN AE yf 8 mf 5 gf I MM . :M ai .L ' Carl Lopez Genevieve Lopez Karen Lolz Sharon Low Anna Lowe John Luckow Daniel Ludwiczak Calhy Ludwig Magdalena Luian Diane Lundberg Linda Lulgendorf Pam Lynn Mark Machen Joe Mader Susan 'Madison Joyce Magrabi Jeff Mague Barbara Maher Mary Maldonado Daniel Maleske Lisa Malik Joanna Mallen Marvin Mandel Cindy Mangels Sophomore M ,Ms M H L ll J J L Pele Mnnns L 'I ii-.. - L ll ' '. l S ' Paul Marble D n MMG 5 L ,--2?M.Mf .., . M3 , J A5 A , Tell Mufgollu eirvi M 'F S 7 94g2?l Diane Maflf .Mn VVEA A. M g f . M ' fM .M . L' ' J Susan Markle J' - il ' V John Markovich I '.142gMglQ i,i fllf i'i.i iff J ' ' Karen Marks MMM., .,,.. S J J ,... :., ' J ClndY M5l'Ple M M ' J M Joe Mafsallf' MD.. M irs. f on . of M M . L S My g. R-mm M-rsh:-rr .,. M M A 2 ,Q - ' S U ' Brenda Mariell -M ,.. , Q . M 5 1 T, M .JM ,M M. 5 M 1' in .. ' ' on 'yyy ' 15555 ' ' ff' ' M r',- y W Lynnmane Marhn M M i.L L iii. Maffha Maflln fir M Z r is L CheslerMarIz if -M ::, A332533 7 4- .f 5 Q. . r . g , or 'fi if If 4-5 f ff :gl f .M 1 James MUNIH ' I M, M JM Gail Mason .visa 1 M M MQW Mason Sheri 4 Q M -M ffm M ' M Mike Mason 5 M5 KP S k k ki: s 'L ML 5 Pam Musgn , Q ..,gg f A A MM 4 YL ' !.ig M Bruce Master 3 M I .. ' .M x John Mathews L 'F . I if L M J .-i. ROY Meffhews . M Y ii.. L Vl'9l l M Yl'U'Sl'Y Renee MCCGHY f s.ie L Samuel McClintock le I M f5i.fi. i My Bob Nlfcloslfev Pal MCC0ll0n1 ' E isiri lllck MCCO'-'fl ls.' Zi' M 1 ie'io '-lol .l,.. I-indv may so S ire.o. S S .iuo es fvi.o . oeeea L .eou .oe.. rrsl.r f .rsi M S vraiess Gene McCullough fi vloe - M L T M Q yuuir ' L S D 2 S FM . Q. X X 1 f . .. - MM--- 13.-M QM - M Jim M:Dern1ol1 Qggllgalfi' HQ f 'fi' Q ' 3 Q Laura McDonald iz Eng.. - Ii .L-k V M f M Candy McFarland MMMM M .M-.. M M o' M 'Y M'F 'l d :LL is eevv 5 M ' M . V ' -r a Denise NlCGl1ee L M 9 - ii . i as .-f,- ff. f::' 51: ig-isis , .,.f ' r,3fi':fi1 ogy , M '- :QM , ,gf - 'isa--wp ff' 'lull' M'G'e90 ii.,' fi fi raai 7 fffl 'ii'i's MM ' Mike Nlflfee D f .rr.iMr. S S' Sandy McKee iii.i . Nlllfe NlCMlllln w M J' 7 M M ----- M . f1li?i?E1f?fh1f?:aMw?iif2?1sz.fs. -'.gEM'lY -ff? -' ' i i-15. 'ws' Q 11 A- .r,M.eirfzwrf'.:1i.-sae ,mMMeMf.2M.f .WM .......- IVIV e. . f,--, . i,...M .M..wMw. 2 eg 2 - fi W -, - 122511. E f . K -, 1 gf 2 B 3 K.. 'K 'W Y Ei -M M' life m J, W' QU M. ., MM,M3 M,.. M e , Mg, e l-fwri McMullen Lezr - C ll'Y Mcavlllfln -Q ..i ... -'Ulm Mflafnalwn si.. Miii ...M Ed Meinel V you PM. Mem, v L SM or Me Jingles Menrlww M MM.' .Mo'n -fiff M L Z iiii ' 15 ii Judy Mendenhall yyi yy M M 7f Dale Merilee A - -M M- f Mvrilyn Merrill M LMV J ' M Bvb Merrill 3 f Michael Mefssfw' z SLLMSS GGYY Mel! J WLJM iil' 'lli MMMMM. M lll- ff:d :AlVl l': SLMM ' Mfg v ' M .--'i- .. H M. I 'Y 'sue M. ri- lrrl 1 , X ,,,, H KL , Q 5 I Class Lynn O'Reilly Becky Osborn Chuck Osborn Karen Osterman Gary Oswalt Chris Owen Jeanni Owen Pat Owens Steve Owens Rene Padilla Kent Pageau Steve Palmer Kady Pardridge Jensine Park Barbara Parkin Bill Parks Tom Paul Pam Pauley Christine Paulik Dan Paulik Gayle Paulus Geof Payne Bruce Pearson Jim Peck Ed Pedley Tony Pellegrino Vicki Pernicone Warren Perry Andy Peters Joanie Peters Mary Peters Charles Petitti mf X ff k,,.. S5 T ' ' . W Q ' P . H .,, ,kk, l,., . ,, ,. . e,., ,. ..sw,, ,. , ., k.,k K ,S .s,k .,7.,., K ,V,V .Iggy-, .V Q , Lass .1 'Q gy W Sig iii ,Q ,.. X L M ' i 'ia -5 I 2 - .P-'f 3 ue. 5 sl S Sw ,JS S Sw el is .. 2 l ' fl 5 ' 5 ' ' -5- 52 1' ,. ,, -:.s,sLkwfL.., ., ,,,.- gg - IYV -w.fe:.s:f' -ig' .. : : ' WAS fgl A ' f . Q. , W in wi X sl 3 wg. f .. 1 M, - ., .,,..z: z:3 4 A , is jaw F, 5. ,,l,,. , Q. '91 K - L ossl Milf is 'fs'P ff 5 Lk wr H ky ef loss Q ' ,,l, 1 V V. K K VL K: lssl sssl P P . ffm' xi 512 . L52 Qi 'f+fE:iPfiH ,yhy ., 1 esl, , fTTii1 flf'21Ef2 42fi3i9i9. -' f i - ,i? f' 'll V M LS -1 1 g - 3 Q, MM 1. Cliff Mihalik Cris Miller Diane Miller Eva Miller Fran Miller Jerry Miller Margaret Miller Roberta Miller Robin Miller Karen Mills Dean Minton Edward Miranda Raymond Misick Robert Mitchell Pamela Molling Thomas Monasmith Bob Morris Meta Morris Joseph Mo-rrow Maria Morrow Dedra Mottley Barbara Mow Larry Mucklow Mary Mulholland Pam Mullinax Mike Mulvena Phil Munie Sue Munyon Matt Murtaugh Mark Muse Dean Narcho Lynn Nations Debby Neathery Mike Neighbors Doug Nelson Gary Nelson Leanne Nelson Max Nelson Jan Nicholson Becky Northey Ron Ober Julie Odom Gilbert Olivares Kitty Oliver Debbie Oller Claudia Olmstead Carol Orcutl Rolla Orlow sw ., eff..f,dsi ,sf . s,., wus, , A sei , 24.12-f 3 Leg f, ,.. .ws E ag 1 W, .g ag X L VW Q wg if S f me .L 1 uf f.-.fl 'fm S 5, K K, Q S 26 ii ia P , MQ. 1 L. 2 .A TW N'S.. V . ggigg-tres. V-5 A- - V- 59- : r S Q? fl . effing f X 1 1 5 X . . .4 ' ww 3' J 4 t. gi.. Q X A L A L, , E ij , V, . I A A my lt Q its VL ' ' p Y 9 - f - .V . .ff ' vi 'QI V.x u, . V H... . fr .5-f Vi K ii' . mfg K ' 5 P 3 'zo-fe . s f -wg , - V 2 1 4 S 6 viii as a 'Sf 'H x 4 me K A il 6 5 L . V V- . - QT 3 if 5 'fy 'Q Q s B 2 in is Qi Q V 1 Q A .. --'vii . fx 5 U- 'ff' W Z. -.: S22-E ' .. - . 'G . AKA- ' i . x v , fs-I tis-IQPZEV me..-Uz.:' j I . V -.,.-5: - + '. 53311 .Slew h's'3'?' '-iV-- L., Vai . IW. 1 ., 3,V 2 -., a-,,- isa.. W ,, 'ifggf 1 ' +P -VV . ,sc --W--V V. 8 V 1 Q V - - 1 -S21 eg-iii? '-- . 2 'f ,, L ifg - , 5 -Vg fu l' - . ,,g:r., , M y t .gi pw 1- V, -7 1 : L -, JJ V A 'V ,YS .qf ,F 2,,.1-rf. ' ' Vu ' -V , . wa? I ' '- : ',:?':. ?si,wTJ.f2vl ' VTPEJSQETZQE srvsfs-A932-if- ' 'ilipm ' 'V-ff' ' -if A' f.ex:m,l2t 1 1 - 1- Q 'sims-.1 -QV-.V --,f V dass.. -we-,ze f . . Mi ? :nikk i S i ' -We s. . -sri? ffi- if fig elf .T-fi' '2 gf: 2-:se as iff: V- 13 ,55 gag? f 'f V ggi, - - P ' -- . ,, ' -- . ,. - J V i K -i V - if 1- -S ' -. X 9, .X Lyndia Raines Nora Ramirez Bill Ramos Lavonne Ramsey Diana Rand Jeff Rau Rex Rawson Allan Redford Dave Redmond Josie Reed Mickey Reed David Rees Nan Reese Jerry Reeves Mike Reeves Jim Regan Martin Reid Jeff Rein Joan Reis David Reyno Mike Rhyner Mike Rice Sue Richards Marc Richardson Steve Richwine Celia Riddle Linda Ridgway Nancy Rinkle Patti Risenhoover Donald Rishor Darrell Roberson Dave Roberts Debi Roberts Scott Roberts Kevin Robinson Linda Robinson Michael Robinson Robby Robinson Ted Robinson David Robison Steve Robison Susan Robold Gordon Roediger Robert Roehler Red Roetteis Giana Romero Nanci Romero Kathy Rook -es. .fi J.. is ,M -X.. .-1. -.,V , e i. ' af '13 Vx - .,'J'f' -. Egg. :-' -:r -. . - f- . -Q.,--es fe- ses. SC fi' if - V V' Q f - V 4 -f -- -. . .A .,e,. r - ..,f f- .Q-1 we ---Y if .m3r..,Ff' ' iii' .fr .- V .sis-. - ., 'V-3..l Lgffjgee K 'P - - -w .-1--Vs-1 '- V , ,Q . A ,,,.n u,A ,., V . , V- -' ii f- - T- V- Q-'i iff- - V. f - - ifigkei-1-5 , .gilif JL 'i f jf: ,ffj-it . if?-. -' ' t..,, ,,..V Q, .H EA, . . -. ,-1. fe. as A V 3? ig,Sg.., W Ag,-V-V F in ww,-.-.VNV Gary Phillips Deanna Pierce Jeffrey Pierce Patricia Pierce Dennis Pike David Pinter Terri Plank David Poffinbarger Linda Pogue Christine Polaski Gary Pope Cathy Porter Kim Porter Tom Porter Nancy Porterfield Carol Post Charles Prach Terri Prater David Prati Florence Pratt James Pratt Joe Prchal Carol Presley Kathy Preston Roxy Price Debra Pruitt Tom Puckett Perry Pugh Carmella Pugliese Cecilia Quihuis Henry Quiros Marcia Raffler lass of f - -- V. V.- fs- .ss 11,,Vs.i-z .sa new :VVVV ' - - . V . - - . . - qggegg -- - , 1--iw ,. zfmgg 213-fe seen. .. 1 R eng. 3 .-g, Vs. su:-1 ginge r fi. wr-H. s N Wi? . N. 4 ' .., .j' -gf ,mn--if e'-re. N. - if - Q- f t. -5 . V. 1V.- 1--.L-V . me-Q ---A , ir ..., . A f, V K, gg,-,V .sr-V -.-Ve V. .. -ff- K Vg-QV 5 . . -- , - . few .e2?:VVV- -- --1 K V A -if .- -V -'ff -f we 13. 5.11-. A K ,T--..i'. KV .--Vim Vx ...P .V , ., .. -:im --ns E- 51 - j , . Q-.iff - -. K ' -X .Vi - L. 925-1 Qa.fTjge., f ' .as 4 ' .. V w- .. .. - , .- s 4 - -5 , . .. ,, .. i N . , .: zizgggg QQT T. 40' ,, fi. . ig, 1 ' F , 'K ilu r R e l S Q 1 kb , v J,...s-Leis new -2 f'X?lJ33S5fJ2'--MP' ' ' J- ..- -fV-i-...- '-'-W Q, V W, 'ws M Q 3 s A Q SY 1 ,V- c ' 4' V. . . L '. 5 - 1 'P-VM,-.fgst ,N ... ' mg' 3231 .1 - V V5 ' :' . A V -f .. s 1 Lv- , ' L 1,. ' -17' 1 ,Ji-f V- Y A' Q3 - ' ,7 -' V ' 'sf f if--L-if 'ff' ' ' ' K e . fur ' ' J T fa' : .V 'I . ss' - -if-A H .sf Q ,TV .gk as ijligf .V . . 5 rl- -f W-- Ve '- Q.. e t V QQ kg . T, f ...M-K -- .-V2 in H- 'x- igggi. 5 - PTI? 5 -2 5.59 2 i is ' . V.. f . X: , 1 A Q 355.55-f2E s .g g . ,fa LV .. ..... ii T ' nil' 31j!f1iiZ5'i 1-elsif! wifi- - . -Vs .1 1-New-L.. V, -mi --is it-.i-is-1, - V .i:.m,. N- .- 5.7-M333 4335, egg.-Q1 --wil -.Tris ef-VV , V , , c-.. asset? : J -. m,.q.,,:. V4 ,Q .sei-, 1--1 1 .. . V - M-JV ., U., -- ... ..,. g...:f.g . fe-fs - f M --fe sf--W . V ze-V fV ' . i sgrufg' i H,-Hg. E-A515 fi , :.' .g - -. qi- X If .-Q 4 51155. -.gm :- V - 1 - - ' , K A' we -w -' yi 5 vs' in ' ,Q L W I . F 1 5, :S , 1 'i ' ' L TV k . P S3 YE ti - . ' - 2 - W---. Q Wie-V. I . .kk. h uri, Q is 553 xiii V .U xiii . V .. ' .1- Nr 4 s 23 29: W Lexi VS .5 ,ai . 222 -Vi-V Q--+V V., Q Y Q, ig P 1 at K s ..V, .. V W--1--KV.. ,e-1gs,-.X-g,qee1gg5V- egg .,....,,V. ,.. .-,. .V... .. , ,ee-.Q,V.f. -...- V .' - ' ' -egwsv-Hffzfls-1 '..-V - , ' - -- - - . W' . e .M :xi - ' ' , .. f -' .. . 1 -' V' - - . W ii A 4 . . W, - sf Q- 1 .. Q.-1 - g-we V - 1 ' Vs 3- K' 1 VL -ink .1 . ' , .vis-H ' ' X ' -:ii .se 1 4 .ws .- 1 - .Q V '-2. 2- :XV .- ' wi.--'V Pef--mi-ff 1 . .. ' K - M - 'L gi A V - ' A . A :-We-fc? is -. .. - . . -VV ee-- -ws . - R -se W., 4 '. 1 V.r ' - ., - - I .. --gg- ,.- 4 .1 jill. Vg-.. -g , .Q - -, 'f K .Q ,,-- . fs I I - -5.- H 4.45 gg 1 .13 Vvgjlf ...S v V V ' .- k Sk' as V ' P 2. U35 S -'V-V , V 53, - Q31 ew. s -' ' - - 5 fe-g.. ' ' 1 .fg - ' ,,. - -f M -1' ' ,1ff.'- 'Li T l- - . iciii - .' W - - f i7'i - .ff-.Fifi M A- J 3' . i i ' 1 ,Q-.Zn V- -- -S ' ei c. !'2.L'Z'1y ee?-5' . .- rx 'W ' . . 90 Rose Sepulveda Edward Seright Naree Sevy Billy Shaffer Mitchell Shapiro Philip Shapiro Diane Shaw Mike Shaw Debbie Sheffield Ann Shepard Bruce Sheppard Jacki Shofner Sha Shopf Mike Shultz Nikki Shumsky Margaret Sierras Lydia Silvain Chuck Simmons Chuck Simmons Larry Simms Cindy Simons George Simons John Simons Peter Simpson Richard Sisler Yvette Skeen Sandi Skidmore Sharon Sladek Vickye Slonaker Patty Smart Calista Smith Cindi Smith Gary Smith Janice Smith Larry Smith Lynn Smith Robert Smith Teri Smith Jeanette Smyth Ron Snellstrom Ruth Snow Jess Sotomayor Debbie Southard Michael Spargur Dale Sparkman Libbi Spear Vikkie Spearman Mike Spears Jeff Ross Todd Rothman Rosie Ruelas Rene Ruiz Phyllis Rumore Robert Rumsey Don Russell Gary Russell Cookie Rutter Adrian Sadler Sandi Salcido Deanna Sanborn Belinda Sanchez Carl Sandberg Lynne Sanders Ricky Sanford Susi Schaffer David Schiermeyer Dan Schloatman Jeanie Schmidt Mary Schmitt Eric Schrader Paula Schrubbe Randy Schuler Steve Schull Barry Schur Jacalyn Schutt Pamela Schulte Steve Schwartz Donovan Scott Kathy Seale Mike Sees qgayisffwfr we , .. were V he V-V V . T ,Q V Q V. ,Vi i:, L, fx . J. 511 :'-: f 'Vf u f 'V 1: 4 zfhhwjiwf .VV. we Vfs .fw..veh V VV JA VV V V V - 3 he h -V V 3 ,V f 5 Vim Q-5v f fi ,1 fi he f' I 1 . A . , 'iv J J .Q I h V . y i - 'V V , 5 e J, . ., , HV 1, ,W , I X5 A lj JY f rf V' W xii? lf 'V' - 1 ' wh fmLf.,nVjh2-1 :Vs as Jw, MmY4V.,. A , .im , ,VRS E Vik . f, E? 5 I r ' .X .Q s 3.91 Sally Spencer Scott Spencer Ralph Spiller Rusty Spillers John Splane Dan Spogen Diana Spotswood Janet Spray Frank Sproule John Steele Craig Sternberg Cece Stevens Linda Stewart Pat Stewart Kevin Stilb Dave Stock V 21 I A S V Twyla Stockham . J V sandy Sfokes ul' 53.3 'N ,ff fllif - .:. ' ' 1-' :' 1' ' ' ' N fs, . gziiil , V lnzli V k.A,A A . M kV,' ' V M' V f , V hi QLVVV Vicki Stone . VV 1 V V R V ' ii hehehe Slrahun R ' J T . R rete Kvfhv Sffwd ' 5 thrt - ' tt V J V 1 R V J hhk 5'U'9e0 J tncec has 1 X . Q . Jhhh Svhdv If X, , V -Qfii V X V 'i x 3 V,r,,, . ,:.,,- ,.., xxx ' FXR V Roberf Suhny A A V rh'- J V J V V H VV . V Barbara Sullenger VV V 'J . V S - ' t 'i V WV - Joel Summers .. A V. :fp V .F Q VIVV ,rs VV Dale Suter V V V V. V . hh V- 1 --h' .W YJ A S M SW V. Akii VV VV , ' 0 ,ff I V M- V ' Sue Swazey s V .S tr V J gghgh VV VV . 31 :3 VV V 3 f, I f . V V 5V?!i,54g,,:5 lQ:'Q I . A V , ,: . ., C ll? ey , ,h gg 'h' V FZ T' 5 if Dehh-e Telly VV! V V ',k.k L ':.. , XA A N- I-any Tappan V V V, ,Q h V ,Q -,V V Cindy urban I ,f ' V f V -V A S45 . fi, Vf 5, Liz Taylor L Q' ' fki ' J V V gf, Y it it ,f T W 'A' V. .rg Walter Taylor 3 ,:L, , 1 .... V , A V T V X V V. ,V V V, .. ,. V , ..., V V V Les Tannen A Vg A V ? J ' VV ' X K 1 , ,,-y I Robert Teran V r , L XJ -A EX 3 53 . Junell Tl 'P V A - Tom Tharp V '. . f A V V . M J' .V V Jack Theuret V .QM Q, ,,- Q ' ' ,L M rf.. V I-QV V V Ann Thomas me Vi 1 -snug g. L MV :V fs., S Q Vg Edith Thomas is 1 V SS im tg r Mhfh fh--mf-S 231 ni : Y ' . V Vs A . Don Thomason , tb YV... V .. ,. V Q V VVV VV VV X .V if V V , V V V .V VVVVV Susan Thompson uh I if f J Li' h' Q . - 5 Telffjj Karen Tiderman Richard Timmins Ron Titley s--. . V ' V Mike Toland -i - me VN yi: ' V ' V V Ruth Talley Vi -V '.33f 2 . g' J V . T - K l xg Lynn Tomaszewski ., HHVV V . V . 'T V ' I, S ' 1 ' -f- 3 . V HUYVQY Toombs V 1 3 A L J ,. 'VJ Bruce Tost V K , V ' if af , F 2 Harold Tovrea 2 sf fi X Q ' , Nanci Tregonis ,.,.. V .,,, .Vi V Karen Trumbo , V V ., . V V -:ii-y. . 1' Kami Trumbull V R V . 1, W . cVVV V VVVV .V QVVV iii. 3 Paula Tucke' J ---- N M V' L. V M, L3 Sill- ,W It A ' A Bfendf' T 'e' J --:h- V f ' . gil 'J Gene T e 'P V V, V h .3515-1311 V --IVT GV! 'Vhh f X mwmw Voir hhrfiii wVti hhhh wwe RW gwwwwiffw -F w Linda Ummel 355 XXV 1 V 'gy TV: V V if VV 1 V5 Diann Underwood 'J J I A V J Vifffif i 'J ' 'J Jan Upham t V ' ' Q VVVV A - V V V VV VL clndl UP5on :Ti . 1: 1- ii' ' :V K in Q' , . 7 E 6 ' . , John Van Ascllan V ,Q J 46 K' 'l'kV A 4 V . V V - ' Mike Vance 1 f. 'VV .V S' X Jig V i Susan Vandenberg :: ' . VVV 5' V. 5 V qi- I Beverly Van Marter ' Q .. NV V Qs QV ' Q ' 'V Brooke Van Winkle ' V V Vi 1 A 'fi ' 1 DiAnne Van Winkle Bernard Varley Debie Vaughn Larry Vaught Debbie Vetterlein Julie Vining Susie Vitiz Avis Voda 'US V f x., V T Y 2 H. he lk :VE ,h . rf 1 - 'l E f ' -n A if P f T ' 1 5 Li, Q.. .2 . ' , V ' E X 4 'Q V ' f fd' .sf w x? i .2-. ' ' Wi V ,V V V VW, VV VV Mun 4 .V .. V, ji KV I 2, ' if .-: -.1 J ff ,,.:Z... X 'ia I Z ' 2,311 ,c on e-4 fl, lx df 2 f N' QQ J .8 X A 1 N v , , fr r N, V W I5 E ,, x l i 5 C 5 fs Xl' 2: . 6 ,C Q, J -M f ' 1 A,L,. if - I 'J ' ' 5 . J A ' ' 1 if f ' ' lwwifef 51 as as i 3 .,'L, f , 1 'f , ' , ,, l MQQL use - v F 1 K W 4 S -A , aff' , 1, fi , M ' 'HH A 12 255 1 ' ' 1, 'ffl' s '2 V. K Q i, ,K V Z, VV Vggjgr , 'skit M A 7 -K K ' f 32221 fi: Elm' - - ., 2 . ,f V I it J my iii., ' mm H? it ' llc-igil lil lei il' ' wigs 3 A gk ' ,fr es- W J V ,lf 1' V, V gk at - w g J 'l 2, ','i'i:f? rf. . 'iagvm A sf! I ...-PV. ' ig H435 M 1 is , 3 VikVgLg,L li - A ,Q ::: L'L'L li I Ali A J LS :- 7 f w X ,- g J . is ' J ' . ,J is - . rg! J Eg3fQf11e,zQ,lll . my 41 J sg Q, A f ' 25 1 'Egg-.?,--i.ik - ' 1 k,V, gg if is ' ,VA-- I 'Ziff . , LL-L 7 J ll X ' l ff 1 5 X .3 X32 'RX K i f--trigge r , , - X:--155 ss - is Y S J liesi . 'L if I , , fi 'l Q i C 1 J olsi ' J 1 , - -g,. '-., :l f g'.'gi - X I r ,. I - ' iff fl i' Zim If ' 7 ' ' ' f ff 91 4 V , Aff P Asif' f 5 Lilvf.-,w s-1-: J J 'Q f ll- -yik . -' 7 K 3 2 J ,it . 2-er-Qing Lf-. ,,sas,aa,g,g:d,:sl.,, - 1. V wif B f , f w . f is 1'f,3 gf23gs54a11g, 3 -7 ' Eg , , M ..,.. s A . Class Gary Winchester Ronnie Winger Shelly Wise Nancy Wiseley Dana Wohlers Mike Wolfenbarger Robert Woodrom Eileen Worner Candace Wortman Cathy Wray Bob Wright Brenda Wright Dave Wright Mary Wylley Peter Yates Barbara Yelliott Chuck Yoachum Belinda Young Janice Young Jeany Young Sam Young Steve Young Jeffrey Yount Jim Zacharias David Zeger Ken Zobel Kathy Zoeb Don Zucarelli Gretchen Voss Vicki Vukovich Raymond Wachter Douglas Wade Linda Wahl Rex Waite Marilyn Waitt Susie Waldron Joyce Wales Linda Wallace Dan Walls Barbara Walton Laura Walton Martha Ward Bill Warden Jim Warriner Clyde Wary Mark Washmon Vicky Weaver Whit Weeks Alan Weinberg Scott Weiss Gary Welch Steve Weller Jan Wellman Terry Werft Barbra West James West Cindy Wester Barbara Whitby Robert White Debbie Whitehead Gary Whitehead Brian Whiting Carol Whitt Deborah Wikfors Tod Wilde Thomas Wilhelrni Debbie Wilkins Janice Williams Maggie Williams Bill Wilson Nancy Wilson Rick Wilson Robert Wilson Sheila Wilson Margo Wilton Cathy Winans wal , ,H f e- , 1 SS ii sses S ls 1 1 Jiil V 1 isiliese f li Q N ,,,' . ., wg In Xiiff? J J ff ,l i so 1 J I iy, E LA aas be Q , J V J Jgt a 5 R J f S 'l 1 B , I F M it Sw V V T, 93 V L1 gay Ev 4' W A . A V :g f J g i 4, . Q, f ,,, J by lg? ., -L L ' ,. of Y , ' J ' ' 'ai J - ' C C W C 7 1 as T23 X ' A l V oall g k '. .1,7' J ' J' 1 7 7 Q ,gf Q I' ra ,S 6 W 'Y YQ sr . K Ia ' 'wi' L' L 1. aw' 5 :, 5, rf 1 f Q 3 'ics 'A ww Q5 If K I , . . lr' I. - , na I lx, 1 Qi 1 .p ' 267 gg. 'Q Aff! L A 3 A if as O T514 WWW Mike P FRESHMAN ADVISORY BOARD-FRONT ROW: Mary Jane O'Day, Jan Marshall, hart, Penny Haas, Susan Kettlewell, Bonnie Fee, Beth McClue. BACK ROW: Jo Ann Schock, Don Whiting, Ruth Walker, Tim Burns. SECOND ROW: Alicia Pennie Harcus, Jim Sealy, Debby Martin, John Lacagnina, Pamm Ettinger, Mike Vitale, Kris Preston, Anna Zoloack, Ande Johnson, Brooke Sammons, Sandy Ger- Kee, Jim Buck, Alicia Pappas, Steve Lopez, Mike Myers, Tad Simons. Freshmen Displayed Unity During First Year Miss Mary Lou White and Mr. Sterling Smith were bgqrd plans prior to meetings in order to assist Freshmen Class advisors. They discussed advison' student members in making important decisions. Freshman Orientation, sponsored by the Student Council, was designed to familiarize students with school pro- cedures. The program for incoming freshmen was held on August 14. Selection of class officers was held on November l. The elections followed eliminations on October 31 and speech- es which were held in the auditorium. Officers elected were Mike Polivchak, president, Nonie Reynolds, vice-presi- dent, Donell Sperduti, secretary-trea- surer and Fred Brahms and Cathy Cox, Councilmen. On November lO, the class sponsored an after-game mixer. During Spirit Week, Freshmen placed fourth in the Ti- tanic races held on January l7. Their mascot for the week was a hat with the slogan Tip lt To The Titans. The base- ment was decorated with hats con- tributed by the class, blue and gold streamers and a large paper helmet. Posters were put up in the halls, en- couraging attendance to the spirit bas- ketball games on Tuesday and Friday. Thirty members made up the class advisory board which was selected late in November. 270 Ginny Acevedo Henry Acevedo Phil Ackerly Candy Acorn Mike Addy Cathy Ahart Donald Aldrich William Allen Vickie Allvin Gar Amparan Robert Ancharski Charles Anderson Christine Anderson Craig Anderson Greg Anderson K. Anderson Linda Anderson Rebecca Anderson Warren Andrle Kathi Angulo John Angus Bonnie Antonetti Eva Araiza Rick Arendell Ronald Armbruester Don Armour Tom Arneson Cindy Ashburn Bruce Atchison Tom Austin Melanie Avram Cecelia Azua 4 5 .lm-, X X pw: .,,-,xl Qgcguf' iii'1 ,,-mti,ss:s-5.sfg.x5'1.:3jg,,s '3, 'V ik.gags.wrgqvLx5ig9z'r'.qwga:kViavtiyeggryi .WV .W , ,we.M.V,,,,...L.r,.V ,V. Q, S S 2 4.z,.,Afa.Q.wA 3.1.2.-VA.5.A fwAVVeA.f-V-V-Sime.-fzes1...V Ae -AwieizefwsV2a-1--aS1121AAfVa2SnSAP ,. A... .. ,. ,, ,,.w,, W., .,. .. t.,.M M .,,r,.,, .. q,,,. S., Vw, ..q..,.. R. ., is A w-f,.fA-.1 , ,VX,V3esfszwew-VVem.AA.g.21:.Af. A :m.sg.V.V Sf Wm.Az2.da2,seA A S ' ea..-,VAVQ S i iw A g.g1wgg.e Az.Agzei.sAefV ' . S we S Q -. -' -A-wi. A' ,A.:V,.',-:A .- .AAx,1e. A-. A. V4i..fe?' MASQAAQ - tiffffii. . - . .Q -. A... ., WSJ M. gag? . I 2 ,gs VAV AA...VA- V. .V . , . ., - Q, we ssg,V,,,,.- fiiZ.A1'.f.S: :me . -A ' 1. At' ' YSSX L A s if' ,1 'K S Af s 'vi-P FEV ,Vi96?tV'E5e za V 'AQAEFY wi-If' m f iaf mi-, 1518.55 4 ' ', V U 53 up ,gs S se' . 3111A -, S . L -..w,,.,.sA. 4, ggi Aiigzffi q zeizirz, .- A. , I '- ' ' AA 'AAiw. .:'fe?, -,' ,, --V S :A-A..-Ar ms gi. Q-1 -,g,..-- sfssx ls,-:-A s221.x,,g W As ,me f 15 21, V- AA S e.v .sf f A A':x3.i.uAA A iss ,img 425293 z, ' 2,csApfz2A.g4 .-g m-A fg gswgg S A 'A Mez , he ,,,.. .,,.. .Q , ., .l ,. , ,.. t. ss s.,,..,.c, ., .U 5.s.VJ1m ew., . . ,sg qfkhx Q, gems .s Swv . f.,.A Va ,I-Vfi.sA eAf:.AAg -,x-QAA.-at A...V.,,A -sAA.,.--5 V ,i...,.sL :,-- 4.sqgfig.e.Z11.sf , is :.--A PQEZZSQAQ- gefgZaeiez .xA1,s S., V , ..- ... A A . .5:,,Ag. t..g..MffVagfai.i, Ag 2- ,,...V, , . :,g.,.. , eg ...l,.g..g,, A .V.,,B,t.,, 1 - , ' '- . .. ' V if A 1: se , s.. -we A V .. ,V .. V. .JM .... , ., ,.V,,.wf.,,.V,A V, S f'wAiwisa2,Qge-2ggisAg.4a.VAsew, Am. fAis.geffAfs-,gg,.2..i,V .s,m.egi..q,1g.V.fi, ,:VA2.e-isa? V , S QS, V 2 A3 . Asfirwye Q c S iw gi' S' gl 1 Vp 5152.3 ' iifqlfxfttif f siggmegigiii ii.-'Yi1.fS.s55cfl1 Awg-W xii' E?i.2sSAi7.bAYfei. : ,:,' ,?f'.C,As Zs ' S ' .SA 1,:r.sS '1a' 's A iq-SAFS-eff? iffigiiili H561 iegxfii' ' xiii fx? XY ifivi-K-wsifw AAAL.-gA:,.,.V , -A2..Vzv'.1A. 1 c 1 Q ,.,.... ,st5f,13,' A ., :qw gs . A. VA ,. W A.iVsVAf5.s.eSV 2 -AS-1. -MAA ,?A.,.sAAA sw., AA SAV L.. b ,4 -511.555 -' . Hym n. .S ii fis:S1gsisg:V .ns - s KVW-Qs. se... Af2A.,eAA .A 7.5 S .egaem A- - ,.,., rss... -..,.V:. :.,.gg .,, z fwf gzg5.e,,k qE- ,ggi we-gm. ..,,..L...sAV s1g.efVA A.:i..,.g.QA.g. -ga.. V. A .1. SA 9.55, -s -9.5 1 A new, NAM th... QAAQA we V A A .A V LA 1, .WS'?kf1e sAAesi-,.. . sAfg we .. ew .Ai.2i.1 ,wif -' ?.fsAi3QAA23.s.. ,sirfg 1 af. ...M : gag 15, .mee A. S K V 1' ,gr 'g..gg.- :ea - --A iiiim S A' JAQVAQQ ' - if1.AgAY..Ag. gizfsifrg.. A -J.. S S A QMIAAA4 12.512 ww Mavis? . .A V lik fe A .. live: .. Q-3'.:r-SAY? '4' .. zafEif5. :i fk? ' win.. - 'Z' . :.' 1 5 in 1, .,E::i 5 21.5 ,QT 2'li7gg1,xL', -,s n Asi f 1, i ' ig f . - ' V . we . , - 2.22. , -sw - A AA .. .2 , Hia-'inf brits : iafif VfAeV.. sA. V 1 1 AA . ' A A.. A' A A .. A V A e ,, -f.,. A A S5 Q A S es, V- .,,,V..,st..ss,.s.. ..e,Aft.s. , .et we wee. .. V Vp 9 Q S ,.t.., we .4.. Ve-s.Vf.,se eyes.. ,fs -V QAM A. ,ew we 0.5, f . .. ,,., L s.w.,,,Q mfg ,,.,.,,.,,,. we ss A sm, .. .5 S , 1 .WAV E59-as ,:V.:..,. S.i fem, msg. .five ,:. N.. e.,sfS.s mm. . Q., S ,,-.ei-S AS A A . .5 sts. VMS? fe esAS1e2VsQe- - wi? . .. ., W - , ., S , ., .. ,. .ts .r ae .. . Le se MSW .S , ,.s, .... .s A .. .. ,K Vw if ,seg ' 95,9 es A?-i H .Y -' we ,a- .. . 5 .sm VW N V S-wee V .. -Vee. es V-f f . .ist S -V Am swat . :rf-s-. S .S 1. , ,., . .Q-W. me.: YQ.. ws sw .. -- -- , we. MV. - ., ,. ,,. K. fs. sm -:, .1 eww, .-.5-, . .., V 5, .snr Ve .M . aw wg: Sfsis .sv -at . .A .. 1 me me VL. S .A .V . AVS. K? :: msA:..fmf ,em - Ve A- P- W we .- ,, ,., ,,...,,, ww A ,- - . . G ASS. wg. .e e., ..g im,5 Si'A s1.5 ..g. A- view wi -4 ,,- Siiwiw - - s,: wigs Q92 :- .:-- ,nigga Q ' 'A . .,.g.eiA.. .saws w.-V':.,AAf A VViA.gs1e2 , .esese S sw ... 1-es AQ1sSSeSAfg w. , AAV2ieASsfS , 'ii A . V- A iafneemasf VA e A 1 V ,.5i,...s...V..i. 1. V V , , we-.ee ,eewfswz 'MA-Au .ffm WQVSASSSLAA r e.AAV,.,A. f.w.w.e A' Q ...SAA -Mfzfdem Vs. .. .. as-ewes ws, -- ,.effV-Vw gy . ,,., 5' A g,V.efA. ff K., .V .V Nm, ,.w1..V.V.s .. . .VVM-w QeAV.A-L 51 - . . .V. We MZ... Q., 9.1. . .Q . M eyj s ,. ef. ,L ,.,,. K VV,V.L.. ff. 21 ,. .ff ,VVK ..,E...e, 5,,,, , cw. ,.,.q... en. we.-,: -A e ., V, EM, As V--VV AAAQQAFZ. S , Af VAS'iiiAf..A 3 1551 A. . Q'f5 fmewf sw . .p e .,... 7 Ae . ,A -- 2 s Q .ew . gg . XV .., m..,,,V VA,f..V,r,,w. ,. g My ,.,, ,,,,.!,t,. V, , .f 2, we-fs.. .1 . ff - f.s,.-Sw 1-, it X 1 .,i A . is .,RL..,..0M55m45:h3sQ,5 . , . V.,iH. ...ue . KL .y 5 ,iw 7. , VL,qJ..5.v1L, V. L, fy, , :A.. gg.: eg ,:5.:,rg:.-,tif ,e:fg .:4 .g,,V? V. L .9 ,.., , We ., , . .- V . - . - A ..w..Va...,,...VV . . .S ef. ,.. . es .,. -- V 1 .--- .. .6 ls , - ,ees - H. '5 we '. .ms AAs'7xz.eAf :.VVAw:5 wa ,. . V. ,'A-, eww . e. Afz. 5 .: ,.AA..e'VV.g:Yk1..f'2.s' if-15 -.f .'.:sPQAA .12,:',I'V ' lA V-iw-71:2 ' w A-1 Y saws-Awrvewfe:feev.efVw.seV.e: 1.wwVVAwe,w.WwmsAa.V sm .2Vf1seMmg91gwvAe.e:e1-Awe. IQSWA s - eg 'wAezrAv-AAwA1 ew We i A wwfjsmv-r,.eAA me. f- V V -A we V 3 V w ,ste we ee. gf .ws-.ee V1 ev. se-ss Q e ,S-Aw sa st A QGSF, 'ES S me ,sz A- :.': Jw. - A ,Q-As if -- -5 fm W ifA Fig if l g. ::'. : . X191 if ' ', , MZWA A Es ' 'I A Z. A? :A .J:,-::' jig: - '-, :. 'A :fijfiz ' ' Lf' V- ei at ez ee Q F? gg U -. ---- . 21.5 ag V ..., ' s ims, ,sa we ,,p . . ,. . -V 5 f i t 1555 H -... 1 ,I --ff -1 .. . .... ,,. ,, . ,. ' , ez 1 '-- A -' .,.-A... 5-A 1.....,.,.X .,,.wM1,. V 2 A A2 em. .fs-.s.Vz, A .V-, X ATA A A fiisiisiiii A 5 ...-A :if il: Z: l::f:5i ?' ff 1 1 . A 1 A :K V, , L gxkm - EV . 3 . ,fi K .. ww I .L '. ., ,: K U f1,.' K '1- . I Lis! If -313,1 if . 4, 1 . ., Y, . ks A A .A 5 Se S VIA S . S s ,. Lis.-eaiQi?'t5Qi,'-.V. VL! 'Z ' A 15A -ff, ,. .. l'l1.lL1f'si 2i if ,,?,,.,, :i '.x'.Af1,,?I. .. .e e ,Q .. 3 V.VV . 2 A' IEE .. . . : .sw I ,., A N. A... A il ,A 5 :.,, 395' . .Lillfw . A,.:1,-1 , -V ' :A :, ' .f2'-i l , Aff W z iglljgflic EA? 'T ...L3i?l':A5TTLg1j .fc s z.:sAi' ' - L , 5 , 1. 2, B if J -.e:a 'f' A if. 11 Vi '.V1iAf A ' ' . X 2553 55 Q f e Q x - , . , . -5,231 L Qs - A EA Aw, V..2gs1gg?3QQV'.:fz.Sg3211.-ifgj.A:Q-A'-EVA22 V . iqfggsszis siisfiAA..sAA .e'.f73ggy, ,. lAii..i.'A ' J AQ11sAi. S,- J i-A1 AAAV. . Vs .. S - .fggwsf A A- M V1 wi ' xi 9, 5 A.. s sig? 4 5' 1 3 E is 9 We Vt? 11 S 'lf Eff 3 4- gg Z. X 2 -Q gg! g le Q V.. Q . ,.,,. A, ..,.V,.. Vee Vee, .,,. ..,..,, . Fifsvi-new .QA .fam Reg.. eq W me 1 , se s s s X . . F2353 . , We 3 -W' . 'i5?iLi. Freshman Raymond Babinski Nancy Baggin Vance Bailey Cynthia Baker John Baker Caren Bakrow Bonnie Bankson Lee Bankson Linda Barber Debbi Bargos Margaret Bamer Pam Barnes Bruce Barnett Lynne Barnett Dave Baron Scott Barrett Mark Barry Dawn Barsness Debra Bartel Gail Bartlett Chuck Bass Judi Bauer Marie Bauer Joe Bavaro Raoul Bazurto Charles Bea Paula Bearden Debbie Beardsworth Betsy Beattie Hollie Beckel Thomas BeDunnah Rose Ann Begay f V we .1 use 1 . a:V V2 -,.,V .AAA.e We . , .Q .. , . ,K ef S .Vg sis, :e '2 Ve1: f-.1 . 'A-5' Aa. iff is-1' I-- J fl., f V 1- 'E: s 'xii' 'If VE? ff, 111.1795 57 ' in . . -A' 1 X 1 A - Aimee ,V . -.V AX -5 .. JQQAA-rg. -,.: A- , . .-Ve . A' A wiv 'zu -K 1 - ef' uw , 'iei-:gs iTi5:'.1VtlS' . TIAA'..'T.. V Eir ::. : : Lexis. . X25 ' llxvt.,,g.4g V Sherry Beier Jerry Beitel Bonnie Bell Tom Benefiel Rick Benhase Danny Bennett Paulette Bennett Karen Benson Adelrich Benziger Larry Berkson Gayle Beverly Christie Bidegain sin Biggs Brian Biggs Michael Billings Susan Bingham I s Melanie Birch Sandy Bird Sherry Blacharski Charmayne Black Dan Blanco David Bleakmore Richard Bloomingdale Susie Blower Marlene Blulh Pal Boalwrighl Richard Bobbin John Bockman Kevin Bond Dave Bonewell Laura Bonham Lois Bonshoff Richard Borgerl Cregg Bossard Sieve Bouley Linda Bourbon Chuck Boulin Paul Bowden Richard Bowen John Bowers Frank Bowyer Pal Boyle Carol Bradley Donna Bradley Gail Brady Freddy Brahms James Bramhall Gail Brandenburg S 1 2 'f ' ,'..', 1 , -' .- E ,..,k ,rf ,.,, 5 .V ', 'V ,,c sa E if MQ E EQ A ,, ..-,V ,, 1 z 2 17' 921 iifei' f 15192 'lsifligsiisms ,LES ' WSWQEEF sggffgleiis' S225 .fwwxfv V 3 Q 'fifkfm iifz ?'! !l5'rQl?7 . 'l u g-Q 'X S26- we vw ci., fibiijf , '17 V- favsuasn ifnifsii'-1:1 21s11's?fl5a1em g : 2-gillaskwese iw fS'Fs4'Z:211se2 lei mats! 3 ,s l- ew is M2523 we E se S Sf :wg My S ,S if 7 S wget: M HSS? w 'L4'rL:'m,STSitis6 2 S f -wl:c:wf.51QS , - Mem? -- A S ' S, 5.51151 mf ifwsiifu We -I ewaiw . ' B f 125' fsgigff,- M I .- S N f 2 5 gf K, 3 X x - +A Ev if 5-1. l korea QW. ,,,sQMm.,,W,fA,, msw f: 7 new sa A .M W V, image: V' 225:15 :gage vases-:lf zwygz M1521 v m giraffes :lf A97Li7Q,i If : In F5553 fleimjg gezf lw Qeiirg 9?1'BicLees2 -: ewgesxe. ,f,,Mm,,.,M .. HHH A www. . .. wiiiiiefxz eklasie Aswmf We.c1?m W MTW WMS , i g sa3'15i'1E?-2519A fbi NWN viii?-V553 fe2Aw?lewALsf?EfS?'e2iTig5gfgMg ififfwi? :f . 53 H921 New 5 5'A5Sif sv s51m?Q , feei ,gelmegmlf , Wnvame 41 es SMT we . fer , , Q lf, xx 355' Agar' Hingis? be 5 eg Q ez, f Ks- 43 Sf? ' f z H my we 5 5 X .5 M 23 2 I S .ffm 5 S 2 K 'Q wie: if. IS., lifwffw, - Q, ,, S My ,.,, A L n,.L f . S Lime :.:- S, . -, , J. S .cfflfvfw ' , ,. li elf' -1 S e 1 K ' - 1 - 3 ,f se e m A fs1,.f-Wisriiiw N ilii eiiifw agii 1: ' , kg-ix 5 , .5 pw -1 --W -1 . JI H51 1 at 'I-fi Lis, ,im527E1fLsMs 'Lf jf' , :jj -H1541 3 ' Dis. i 1135 ai WET? SW ii 52515315 ' 1 -fn? f:, . 11.-wx-if we -W A, Q sw Em-2 . A-fp , ll 5 M.--1 we - , S f S.,.w --- 1-we-fe-f. e .1 ,ya-,ll 5351-5,,.w 1, ,zggci-,1f..f, ,.gqQf5gL-,.:e f m U,1 c:,l1 .onfeg f ' is 3 .. Q . A . -Y Q ,. ' ' 1:1 1, 1. QS ' ' w :gr e .1 Tgcirg li 'A fs v zseg ' Wi 1:lUff 1if-S, is ' wi , -- .3 I A , 'fv' f1y aQ6i1m V- U.,,. - S: , c,. my-mm .. K ,. X .51 vm Z A ,U - QM, If w-gg ,321 f w ,,gggS1isew, ,sszi??:f5e, ' 122:-f'Cr - I - I ..f:,. ,'.::f'-vii, t 1 -, , , f f- A- fs MM few-1 QW? 'L ' W , if 1 A 5 A' gi! vi: 'A-fi -wig , , 1 , . ' , 1 Z. - 2 , i fkwfgssiie S :giiezmsa ibn! iliggygql 7 1212515 S -file fffifs M4515 M122 L, -gfiiiefrslee Ng--' ,. .. Mimi Q1-2 1, '1 sz QSEYWSQ uw fr. ,1 Qsiwgzgs V M 111:-ef,-21 .4 ,,, U. ew: 4 m e ee . , f-f,4gcM 5,515-,Li ff , iam. ,,.: .,L. 1 .f- wa. , :W .ww-V -: I - Hmm fc-Q11--V-sac nw- ef fm Q L1 S f. V S if 1 -' Q W 15255515 ii' lie - :wzpiesfi q uegiwv SH W f -is 5 W f- W- V Q ' - U S2 S Ze - iw gg-zlizel gg , pgs 'xxx-V 'E-122-.ifeflfgeflgn Wig iii 1: ei: 222551452 wif ,wg 1,Lv .11. Z A lm , 5 E, ---VV.. V..1 T Al, V . 1.1, 1 - .V ie vvffsiwer .Zu my wf-su,-W ew w , zzwmewwslfe-i.2r em, -miwz: E:.fv:w'm-ff- - ,R Lime, 14 2: Q- 53,1 lg,f,,y, gg53ig2,QQ:fe q,.Q,-,lg rQff31s1:eg3gl,?l: Lliz :L K sagem- megfi 2 ,M- Q f-Izzff i eff-f geggqgszzmfzzzefu-,V Wfwxz- 4-ina -- WN:-952 A siifliiir .. -f,-wa-14, 1: :vga-V , eww . ,,.q-5,-,,.fgg :gg V gn . .:--,p u ww ggzx faqgwlm wfsv Qew,.Qgg-,.511f- siish-:z.4fH1f ' JM '- fv'f-W-' V WM ..,, ..11. U , ..,, , ..11. M. , , .M ,. .. W , ,S .M is ,, , . ,, , - : ff: yzfaztfffvzz-fi-1' . ., ' . w ,L--:f:z:, ' f1Mf .zgsszffwff . Eve.: ' c f- 755 ,EDSVQQI kwseiif. gf'-1 V fm ez ,-wggaie N- 111-mg ,3 43 gi ',,f.:,g,: 'i ir-vm' ' ' 5 5 - I' fgijji :.1Qj QQITQHQYF Yr' ' , I, f ' ' ' j ' - Q,-1A1ggj'g5'lLc , W5?A171Lg-gjg N iii 5 -MQ E, gill 'Wg ' 1' L -,IGQEU ff-: .5 5 ' Q , . ga .www uQ,,k,,., 7 , -Nh, ff,.,, ,- WW1ee4,3,:,L.m-aw -W J fs-k.Sg5.:1,l.Q :freaky,L::1s21L:m1f-15-me 1wf. ff-V' -q5:wLg5?,-qwgefugfs, gejgmiy' yi, 5,-V: ljjjq- : , vu-2,5 f ,151 we lfjqig-v,..::-v, 'fx Wgwxgewawgsz zgrilikjvye ' www, -nl. j5qmz4i.f'g:?L:aaL?f -Q fenliwgii' ff f -1 -W N' M e ,1c-fliew-wr kiwi Qaivwmffff S - 1:-'M 2, fsgfwv' S 2 wsimli'-fs:if,f, ,S B 2 , S, 3 S 8 5 sz ,, ' f Qsszgmw :si eww S new-e ,. ' . in ww mum- f T S .. ., aw , f ix: L si? - 2355 5 M 537 . ,.c,.E.c .11. . ,, ..... ,, E. Nw .111.. Q1 A . , ,W Mew, .... , ,W A - .-, ,ff ,, ' Y' my zg,,wg5 m , 1i: q g . ggi Wm.,kg5gfa,:s-wg sfW.1wg,a5f?iw -i wi 92ggezmwg 1:i'w ,1e 5, Q fbfecgiwi-ig-,team wwqggflff ,A qqfmgg u Nils: Nine Q, T551 Lixffpc, 1' EQQQLI1 A: ' .Q 'pf' Lssw' V xzmqjf- A-93' V, .fc,1sv,,,fz-' -'ij'g gg fe :Rvxisvr ijggm., -'-55:5 Q '- if 'Q me , 5, 21-lv Ti :ff NWT .wwiielffiifmiwv LQEQEQLN six :-' ig: V 5??iAWT15E37f5V5?ELF :EVE fha A , wifi ui Q 15S5E7i5?f?' l2t -: 5257515 55' es513ju4?1,c -7if5'Eg:?Elfi kifsiilbggjgv 'figjjjg ,. Tiki fSiki2:gMgL:s A51 L eg wa .. M f,..wg,, c .. 1,5g1r.:e'W w,?i3: . my ,535 -, s.Q,-Wagga, w1s::5:m1 M, ,-'-,,,a: A , H V , Q S, .,. Swede-f,ff1L:,L. ,.,,, 5- gy-me 1, 4 i, 131 - --.L , A - .., ,He ., ,, ,,,'--,, -at ' 1 ' wi r iki1'745ifQ:K?Eii:f.' ' --xi fm H1 1, V ' u ' . Qi Xe w ',E: . 'V ..1 :-':l:F ' Mile ,FS 5375297 gin, A -.l i . :j4',-Q ' ' - -X V L as wi- 51: - S W , - 1' Q f 4 .. f,,,g: B A -f Q if 1 f ,Z -,, . W Mewwsie- L Q. .- are m'231.1l 1 ,i: : ,1 'w1iEl1i'Z F45 .U S 'liflllikr D5?'1.sf:5'li53iL-?st11z3?fi3zIkS?s 5 ...WMSTV 1isG'1?LiES,1Qf' 'Liiezllssfkliliiiiiiiliigfcl 9' si?-4 Sr,lmJ1S-Qiilriiiifdimih fWf?'t75??E51LS4YS?Wf?ffwfiliiiiigmwwgxl-ggk M S f S W E We-P71 15-Iwsfei '-zz A ' J jglgv 9:i f'?i:ss:'r Li- v :2,.m-Waals izgssekiisxwwlsl' ' 'W -wxzwiif 5519- 'wawiii-H H-wwmtile ,EA A LQ-flf,Awla1'f5 ' A' M? ...,, , 5, A sfwwmgw 2 if H mv 2 asiiiwiilfm- Jie, if-S ' -1 H1 so-1 Msfliiew: Wz2f5e1w ifieiewif if mass lf3, ..wf if-we V 2 gwexm, - we Aamir., ::emgg,,1 vfsavf :. M' elf Jczvl w gsm Q-, ' : zwseiis ,seigiw 21' ,Q Mwrs ek ,A,f,.1,gQ1 gl f1g Imfefa Q 55751515451 ,, .s, Weew 2 ,I S l S ' S in Yfegzggyfsv -ffz1::E : 1 wiv-Je, fag .- :-155 : w ggf :.,2r' :,--,,g1,-:sl wfwiaig .. ii ,fi S .SH egsifff f1.'wf- :ssf5sss1s1i1 ,15 1 nf, Q :vig :vQi gg' :gggg:zQ egg ,ggsasmkg 1 , 215742. -remix by S 5,15 fl, wgaiifq-1 :Q,:5.a:: .mgqjfsiijiifgy gf V15 ,: - gggliywigilnff-21k,51f-fzr Vw., ki- .-: 35,59 ,,1I,,,gE:f. :: 1, . 3 33,4 ' Aitfm i: ' :5 i13L5:i,arA ijffiliitlbi ' ixisrdll x Ski i' sifffh . . f I sf . w1f,,5,,.e Q W .gm f2z:,,f,A.,r1-.,,.y K 5 ,ww ,: QW:,:1M1,:- sal : . W5,f1s: -we-S w LS,-ef W my ,.: :: ,. . '-H 13-ff: egfezwrliszg 1mQs,.:Q-K: , Q 1-gf f :. mf :-: 'sftwfg wi .- :- :fl-15? H fa: wg fmsaszg-qg gqa 5 . A 1-rf-K --efvizeifmcgw ff ,a-:w,:ssfs1'-- eilf ewi , lizzie: :sl . . : ' -. iw,,.s1WgQf5,g?Aw,:sl neg My - wi, at-Exim, ,Msgs .: . E kM,AxS1A?E,.:-!:'fWmwxx1ae:m Mgfsl be 5645 ,Ji-Q wp.:-2 -Liv mir swf f '-'V 4-villsfl-w -I 'f f 'I - f - 4 f-594511 ' - -- J Pele Brena Mary Brian Sue Briel Dale Brink Bill Brizee Lynn Brock Barry Brooks Dean Brown Joy Brown Carole Briney Kaihy Brown Jerry Bridgeman Margaret Brinton Charles Broderick Dennis Brodigan Valerie Bronson Bobby Browning Roberl Browning Ann Broyles Kalhie Bruce Wendy Bryan Eugene Bryan! Linda Buchanan James Buchholz Jim Buck Linda Bucy Mary Lou Buelhe Rick Bumgarlner Jill Burkhaller Julie Burkhart Mike Burns Tim Burns Leanne Burrill Melis Busboom Deborah Bush Sandy Bushey Cyndi Button Susan Bye Wannela Coho Joe Caid Ray Caldwell Andrew Camen Carolyn Campbell Cindy Campbell Karen Campbell Mike Campbell Marie Cancio Tami Canfield sf 2 Q .. , .Lis is 6 ,. XX we .Q ff if 535.5 iisgfsf Eg e f eiwyf- Q XX f p f. te - 3255, i?mX ' .zz : w.XX-Q Q 5i?zHr32' fe -' . ee .. X. 2 e 'fig X Q 5 y L5 sg? ke, ,, 5 Q. y X we we X 2 Wigs? l' 2 H.. X2 -5. 4 we .. X i 41 'lt ai 1 P I XX e X Q XXXX XXMQW fe- X 11Q,Xyg.pv SRX M , ep., Whey.. ff! 'il35L!!e551?5fl?XAr?S' E sS2'?egxig.ef.fmvfea:X iS '?i 3?l?i95iif53V?qQ'Li ...tM tfXXfi4 me 21 M., -eil Wm? -5 -,. ef. ef-. :- .X X 3 'x i i-'X' -s 'fi ir 'S szz:2aslf?A ' - . iffi Big? 21,3 S Qge? Z 3 ya 5 'Sei as P Em in x .L s 545+ A X gy Q1 2 M,.2.X,.e,efXe1eXe-.Xf.e,e..Xe-Xe f.. X. Liz Cafithers Bruce Carlton Bernie Carper Margi Carper Cathy Carrillo Rose Carroll Val Carsten Sherry Cary .loe Casella Barbara Casey Margaret Castellanos Sylvia Castillo Paul Cate Denise Cozee Cathie Cely Irv Cerepanya Gordon Chaidez John Chambers Wanda Chapin Renee Chapman Karen Chavez Barbara Cheney Sally Childress Kathy Chinnis Ricky Chitty Jan Christianson Cindy Church Sue Ciborowski Jan Cipares Ralph Cirzan Debbie Cisco Bill Clark Chris Clark Linda Clark Philip Clark Georgette Clement Karen Cleveland Mike Clifford Neita Clifford Stephen Clifford Doug Cloud Dan Clukey Frank Coghan Margaret Coghan Mary Coins Beth Colborn Scott Cole Brian Collier X ' J lf M 1? V X- r X ,fy-3giZyn5ef:vgg1'f4g:g:zegmggw . .X . X X . ,. X - X' melee fif1i?i'i'L59f'K? iffiS!f'f 35 'lt X so X 7 fTe'.g2,f L' ' 'ilisrifliifiiiee x 7.1. 1 V tffegfis . , - - .N X , iiwlwewi . egtgfgew rfyiby . 1- e -- . K S ,,,. f ' i -' 4 5 ' K' S 3 1 ' 'lf li ., V , lii55i X'K'ii ' 5 Hifi 57? K' YM ' '-wf i' 'Xe Siiiiw . 2 552 KK if .f ' X t . XX ' - . , 1- 1 I .11 as-pgffffegzgfg-. ?i,fei1sff'1f- , X ., ,, - V . . .X . . XXX, X A-f,XXX...XX1-.A Xe X., Nsqfwf ' H 1 A-wi f -1 H2241 i 113 1 W ig s -,?'s,.: . ,- X K . -,X.:.vX , .5 V., 1 . ' --A rw XV . -x .Q 1 . K K 1. gg. K1?f ' , w e K li f' 1215? .Ja , ' 5 - K ' X. lit ff Q! ' . ' if Kfili G ,352 . . . ,' G K S , Q, , W 3 ' ' . 'it-.I ,- .- B airmen W? . 5-42 w e , ,. X f - X - ,f,.,XV.?3i ey R, Xf A f . , X , - Asif 'A - Wvv A me .:.X.,XmY :fowl iff j, 'Rr X c f .SE X xefwtex , in l X34 lyf ' oi, ij 'X JS, ,. K K ,X Qi ... ,X J az? K tes .fitexw X EFI K ' N, ,rf VX . ,W x I -1 i ' Q W 'E X, . Q 1 N it 5. 4' K1 .... M W . t , S 1 .5 .. .. fe, 'bfi-Life , 2 .Eli-Si? J X .I ' X Qi.: N lg will ', - 145' -1 . :U if - I ifig , wi 51 S fi ,ef .5 ,X XX 'z- K ' he . . .J ... lie, ' '-.ma 9 i 'Xu-4: 1' K '7g'i'. 1 'X HX ,P . , .X ii 5 as Y 3 . ri .6 ve 1 1. ji?',ff ff: X -gh J fi 4 it 1 'i X. ,. K J. ,c ....- X N .,k. .-HX. x , Q K ' 5 gig.-izfu ,.g5. . ., A ,-1 y 5 s we .-- . we pe-. X11 'figliffigffi ' IX: fig . , axe, S . E- ..,. . fn ' K 1 A rvf i'-, .. isa. K' Wiliffsu A .ia -.iw ' 1. .4 4-nv 5 we iff? A Y' -ff 3 I 5 -1-ge fe vv X X .-41.-vw'-. gte?: efziiQX . X fp MTSEXX - - www' i K5 5fXs:Q1.i5X2.f11- PXif! f2ffii . , -, . .. be .-: K. .A .. .. . QQ' . QU!! XX . . fs-x -W ,.,' wr .-'LS A , Y X. .Q is z' ,g Q-ff-Mft -X -'migf 'ttfifl r-so.g.eff,'1w1w:3-Qs.: . 1: 1 ' ei- 5 X - 321' X-:sf e .few-2 , tilt? - -f Y-U1i'5?5?fHi:USY?f:1b-- . .. if . .: , X aa X M. K ,. .X vis? - -1 .ST .. '- J! Ksf' ' . f W ,XJ 'ii fillif xr M' -Xii f . e ifflf' If wi. 3 Xe ig f X f -emi '- 'W ei-iffi X.. ,,.. ...N . . , . . , . ,iffifi Y gj ' fad . X gen -Q .. 'Q .1141 .:f1l:?f iffilfe-11 1 722 Z2 To - i .4 . - 2 - -- 'fi '-ii??i ,E-gm. , J 1 2E.-f,2:f1:ffXr:Xf iiiisi.s? f2gl X. ff2f1X,Q:sigEX'Ri l... K 'X X 1 ar e ' K Siifliiifsa' K 'f2lfi.lf'Eiil 'A iiiiflli . 2 isl es. X.1ii1fXX ,g eff? f 'K . e .QI -emi X .fi f2f: ..fM fXf1 ff :fees f ' gfi1XXX X we WX, ce X 5 ' Ywf-iv: ...X 3 1 K 'K , .X if -f.mE...f:ff- ' iiizgj 55512 , ,ii 1 -if. 9' we . SLS? W 1 - - . S ff - X, Q, My ,W gs-gfqfg, J - f. i ye , 75, 3 , . T N Q ' f A. . fs -3 :- , ,Z ..-1 .7 :,gfz.fw-- . H13 H A , X 'A . . fa, K5 use , iw.. fXf:'i4f . a swf-rsf1Xw'.f'f? ' arf . owl. .M ' ,, ' in . ,Y . -fu, - if. 1 f 1 wzfSXe2af:'i1i-Wa . ' NKFW . N - - X 6 K 41'fwfNSg1wfeg - W-lf' X ,. 5 f. K-.ae ' K It-.. i 21551 e,f5gSt7Qi?4 J Q, y X. iam?-.V rr'-gli.. . ,waraas X: ' ,, .Lal . . ifeggfi' iss: 1+ 11 'A 'K - 52s?e'3s?,E1', fQLfi522 . f-tri .Q .tQ-- . ai '- A t -. Xe sea V, . F xi ,f . Q ,,. S 'N X X vm 1 5 Q 1 , , K s -.e ti . 1 X fi- N X, I Rx 1 N X .4 .Sigfgigf . x W... Us ,J . K xv X 3 Leger X Wet' . . X , 3 x X I X X X ,, XX X, gfjgt-.X 'Xzrlfwm f ii' K K XSQQISVE: - K'Mfws,, X- Q ,X XX ,..fX,yX X . .X -X 5533322353 X .. zedggeifi .X .X R fs Q Lf! ff vw ,xr 3' ,Xa X S -wfgzp. of 2. . X H .....y1X.1.1 - - '- Q ..r. W e 'sa -XX X X.. XX K Q S r x S2 1 X J , .. . , XX. swf -g2g5,f,,g ff ww f 'SX X vii QXX X E .2 Q X X3 XLS we Q- K E-51X X X S Xe 3 , ,XX X X dt. X, .XX X 'Q' XX X.. wi Y ge , XX., ,.,. an J E We . Tl K v Hp fl , f X im 1 1 3 2 5 ea Class of Noreen Collier Bob Collins Dennis Collins Maylinda Collins Randy Collyer Irma Colon Earl Colvin Dana Conwell Kim Conwell John Cook Lawrence Cook Rhonda Cook John Cooke Bill Cope Ted Corbin Colinda Corcoran Cortney Corcoran Gwen Cordell Nita Corron Lawrence Coss Michael Cossell Marti Coston Cathy Cottle Linda Couchenour David Couturier Mary Covell Cathy Cox Chuck Cox Lonnie Cox Melody Craig Lynette Crain Paulette Crain I9I V, rg ' NVQ l'.El! '::: l' .2 E552 V 35:51 Sifil-iiibfxgm mm -my isis V ,V , , VVMVVVV--V322 VVVVVVVVKV- ., 255122 'U i zbffgf?-92ZEs?'i SVV V I V WWS'Es53Zi2-5LE?'fL3?Qiiv ' MV VV -mggz VVVV VVQMVVVQVV ENT-3? V. VV X rj V: Y. Q Q VK , si 9 M sf V VV V ,wa Q un we V SV. V V 15 e , 4 2 V5 5 5 V VV V V x -ay V me ,VVWM . .. , S ar -5- V VVV VV V VV3wn:s-VVVVQLVVVVVQV-VV-1 V V VVVVVQV-V-E-QV .,A. V, D,ffA-' ,V VV V,,VVVvV gl VV -VVVV -:VV-VVVVLQQV Q Life. Fi,,V,, , S V QV- V 132 MV, ,fir 2' VV VV Q 5 Vf 9 S- Q 5- VV A Vw . .. . E, 1 ,. A VV V3 .V V , 2. 1 Vg VV 1 Y S V93 V Vs VV V VV rf S S BWV, as 31 sg -z V .V VVS 5 as VV H V wVVVVV ,p, - 511. , . ,, .VVVV - -V V VVVV -- , - V1- Vf.3,qMpVwVV15w-QVVVVV Vwpxfis MQFSEWQMFE'-wr! - 33-7 - gm, fm-VVVVVVVV Vw- VG Vifaasw--rs ., sesame - ' -VV ,VVVV wwf V,VV5r1-G., Www PW- ? D 35 1 rv -VW V V z V.VV::V ew-V1Q??'V2. VQ V VVVV VV -VQVVVV ga, VVVV. VVVV SEQ ivsik' V VVVVVV--V .VVVV P6 Z VV 9, QV V , -gs fm Q V ii V-V 5 ff-3 V, Q. V I V53 an 'G' r ax? M S V ll V EQVVF . M-k C V QQ? - I e rane -V . . 7 - EA Wulham Craven . - V . .. Ronnie Crlder siege . Cvrrrhla Crlm gi V , V 5 Cldylon F055 V V ,, , ' VV , V. V ' Sue Croteau - M R ben Crowe - 4VVV V , V -. - - -- V VVVV -- VV .V ' fikwg Kenny Crvr . QV V - ' f1ffESffTff2?e25V Q- F Dana Cude Anim V- ,MQEQQS V VQVMQQSQQVVVSZVV W ..-V3gEVVVV1kb VV VWVQE-Vwfgggg QSVHQVV E-LQVQVQEVQQQVV -Www -M V , VVV. .4 33 - 1 ,.-- W V -' .. V Deborah CUmm'r19S ,V QW Vw ' V . -if :Sli VVV.' ..-15: Vex-V525 Q rg VV 'ar:?fVf5 aff, 1552539 :3'?'., :V T185-iii ' JEEEV ll: :Q f:.f ..:QVV :. VV - 5:21.13 ,Vw VNS, -- -:Via V wg- ,- Q' . , Mlke cl-'llef V ' - Florence CYP'-an V , 'V Sherry Darley VVVKV VQVVWV VVVV :VV-VVVVVVV ., V: - . .. QV . -laanrl DUIEY , , V.'-V a7'wa:g?, . ..VV.':, V-3:-V , -'?', . V V V QV Q-VV, 'ff .,e-mp' . V F ?V' QV. -' ,g2V,gsV. :i.. .- . .--2' -V , ref' FVVP-Q-QVVVW .555 Wm. ,, -V :,. Vgez, '33-9?-V -. -VV.'--'f--V. -V ,6'- - if va- , - V V,- - ,V V -NV, 'M ,V.V,iV--FV :,, V- ' . V,,V , VV- 7VVzV:V. V V'V:.f.-..,, A V4,VV,,VVqV 5-.'V:,w-V . ,. Lynn Daly ' , -- VV 2 5 John Dame VV 'Y'3'EEi51i,S?5?eZiS,5?l .3 - fr?--V 75- r:VV?' VV5 V'343 2 ii- 7 35' i' -1-41 ' f: 'V ,-'71-Tf-79'-E 55,14 H MV- f 'VV K fig-51'E2YjV.-3 Vg-jS,qfVj gs,LVV,VfV5?iggzSgg, v--- QV. Hr - V- V :V -V QV 22 V V V .V V V V .VV ..,, V, V 1-A-1 - 'gi Sugqnne Daniel -- '- ' ' V , Terry Daniel V V. .. V VPN? V , VM-VV-V-fQVV - ,VV,VV,,-- VVVV -. VVVVVVVQ V f-f we.. 'rw-VV--V :V-VEVWK QVL---wwf-:Exam-Vw -WMP? -- VVVV: aww VVVVM rf-kv ..-fm-VV. A +.VaVV:, -- - flf-:ir - -aff wV2VVV3Vi1 QV-fm--V V- -QVQVVV. VVL-VPS ,V V4EVwg,:f-gg w,,V,-V ,ggi V:V,,:- .VV-sf--UAW AF-Vw V- .if ---VVV- Tom Daniels ' , VV . . KIM Davld Anlla Davis - . ' DOUS DaVl5 V . V V, June? DCVIS f M . D ' VVVQVSVQEEQ5 V , , VVVVVVV -,V-V-A-55,4VV3-,VSyl, Vi, H 5 argl avls --' -5 V W , -, .V VV1V,ig? 1,-V, -1iV:iQ!lVV'2-IV'f,3VV,gVV-V-Vxzgfifg-gg,-5115-Egf 3 VV QVQQVVSVQVVFyVV,Vaw,sV,iVVV3f:Vvg1-wi -VVV V,V.VVmVVVV --A--. VSV-,.V-IV.--:V:V. V V ,VV,V,..,,, VWVVWMV V V.V.. MVN W, V Vu.: M-W gf.-V-VV VVMV, VV .VQQV--V-AVVVVM-fx------Vp :Q,::Aq:4zeusV--V-A ,QV -wr --VV .Vasu-:MV 'H-QGMVQ' 4 Ie V -1' iw---v:.srzf.-4-WM 9' M-2? ffA .Vu V. 2: . .VV Emu :-':VVVVV5551ssE 1 r:'. ..'. 2Sf' A - V Rob DaV'5 .. Tom Dawes Qiifiiin Egger? .- ' ' ' 1 5 W C'm Dawson r - ' zV, - Nancy Dar Nancy Day Ramon Da y VV ' .V , Nam: Deaoe ,.?gVVV2VV,VV,f:VVVVVVVV ---VVVVV-V, V-VVVVVM ssfbyrvgz-V up wg V - -- . .VV 551 ,wF5'i,'l7E- 'xii-Slip .. 5125 Qiifii?- ' i5iliV?5fEf'f A -5,i1'E.5r1555VV ,::V:'3 '-F . '1 VV: WF' -1 175, ,V ' 'if I '59'.af-3VV2E':5j 13:6 'f1V.g,fyfVv .. ,:1S?i' V' J?- R dy D . ' V. ff V? V an y eemmg 1 ' -- V Mr V - A V - V. V. mm VW, V,--W-A-WVVVV--:VV-V ,..V VV- V VVVVVVVV ,.wvV--V:--VVVV,Vw:f VVVV,V:V,V.: mv-VVV-V,,:wV:MV1zVVVffV-fu'V,VVV Vee.P'aVVV,V:V ..,Vsi,VezVY'fsrfV''s-,V--,--f V A-F 1L.V 5 :V WH? sf-PF 5535-1'NSFKWSTQLV''f4z.gs,:11g? ?ibQE1f '33'?N?r4?E'15F ?521SVf ?'5f5iffi 225333395 : E .EE1E4,,ii' Jean Degagne ' ' ' - Nara De J'- '9l'e V . V' Brll Del-aVer9r1e , V V, Donald Del-aVer9r1e V Mark delesdernie l' V . VV ., V Jackre DeMarco V V - . V - - 1 ' V -V - QV wages?-ff 1- f2m1:fV?ff-- Piss-VVYQV -rm 'V -' ::VVV'-.. V- -r-:.':'.'r' ' V V , . .V . -- r' ' -- 2.5 - - VVVV. V-srkf-gmV - -33. Chns DeMurs r 1 7- ' . T' s ,. :f ' . , .V V.-V-V V , V -,WV -V :sw VVVV 2 V ' M VVMVVV QQ John Denker ' Y' 'gf V .V:-VV , ff ' . ', V FEIS' V- V mVV,,VVV , MV., ,.,V V V, ., V, -VV VV VVVVVHVVV-VVV.fVVfVVVV-VVVV,-V VV-- VVV,VV,.VV,V-, VVVVQ U -VV .VM-VVV-,V .VWVV-V VVVW VV 1, VW-VV :VVVVVVV-VGVV ,SVVVVVW ,VV,+2gvsV1 :mm V:?:?2isfV---Vi-Vw -wwfVVwV2ifsi,'s2 ' V , 'Z 'H V M VV V - K' ' - V D'-'Vid DerlarrrY - - - ' V , V Dlune Desl'-'rdm -. V ' ' -V , . . ffgssv. V -VV V Sew: ffeii ,gf- '22-'. ? 5225i2 -V-SW 5: Vi 'Zilla M V -. V-422:11 rr .leilhhe Desserres V V. ., 2 .. , VV V . - -VVV1vf fsi,2Vi 1V if V--' -V H- 2- v-VV V- VVVV- Vw -VV-VV, QVVLVVVVV ww-a'i-1VVV,VrV, 1 Vgwff V5-rs-VVVV VV,,,fVVV VVVV? VV M Suella Devrne .. Q,VfVm1MVVwVsVzfm,VVVV- V- -Vfszffw - -V V-V V Vgwer .1 my ggi-QQVVVQZSQVVVV-V ,VV, VVVVV:eV.g-5VV,,V,fV,V 3-: 3QVVVV1VV,. View. -, V- V em . --. '.1 3535-?5Vg -, -VV-9-aaqg 5 V1-V-tif-V1sQ1?'H sim 'v V,2Vifs,'s 52525931 ' V-.V-Z if 2' 525251 -F'-is- V. Y ,f?E'5A'2ev1 ,fwfeiserfgf?gg,fw2'?v 9,22-2-V-5 Vgzfgqgg gsfsf- -QVW rw Dona Duck V- ' V VV 1rYMr' IVlf5 ,,V::7? A215552 .59 XLQVYSAV V j l?,Vg-'iVigg:.V:s:-'L?fET?2fV'V'f :E Egiigaggjgf V I' 'lvl'- 3 -- 5'ijL,,Q -MlZ.iV,f - Q1 f2l 71f'9it4Vi. 355Igg,1Mm5343f.5,gkggP:V-5 V 'wail Vswyi 5, , - - .. . :: , jim,-1-ig-5g Vjq2.fg:3VLas V 1jY T' DV' k . V ' -V 'm Velinu Dicken V ' ' T tl D' k -V - 4 ' 'A - is ru y lc erson .VV .-: :VV Q. , 1- HQ 'P ' Q: i, f'W.,, ZS-Vi? eil V14 1 --1'Q,fwfwffiVfSV4f'ai VV11KVV--Ven-221-riff-izQV,iVzfee:-if-QV V2 feifa-wiwf VVV-Vw VV LV-21+ Jerry Dickey '1X11f6fWWfffs-V32'ew VVVVV:.Vp,gVg7fyV ,VVm,VVV-.VVVVVQM5 ,VV ,:,,---VV,V., ,V I aQssg5Q4e2rf:ivm:-::- -V-2Vrsg,f,.VV,Vff Vq5V:gggVgVVVaf -- -- QV-VV-Vg: V -VVVV gggg VV 1--VV V VVVV ,V V vV,5,g,7V-.V . . , V f Diana Dlers 1-.V . V Vfjl-7555. n Vggiliiifgll ,NVQ E- ,VVVVV 3' . PV T 11 jfj' .:.:',, 5 r5f VV,Q.j 'fE i 'klf3 Qfgtg'3 ,,.. .. ,. W V , .. Sldn lellmun .V VV-V W rrgwifizezii 'Vp 57 V r-:VVVV --3,g 41VirVy-ff?-QV r ' QV - . Barbara Dlsss A453212 ':m:w-- s:gffVs-VV 2 -V :Vgrgg -r VVVV- . Vg, .V,gzg-gVVVV1s1V:'-V-2' VV+1 VV,j- ,. VV-VVf,:VV4V --Vs VV -i ':ZV.' -'V,111 -- .V Vwar,-V-. Viffivfff ff 2iW2f' V . gfV,f12V 1i2Vv1V ,:Q 5255213i:i'EL5?ViV.,f1if'-- VHS, ':V,'::5- ,VVfsf2V2iV if. 'VV S' -J vi? ' Jiivfifkiiili - Vzrf 'i1', ' Mrilfiii' 5? gf e,Tr5i'5V-Vfili-SEV5 :-1 Alan Dunn IMWH--1 Vw VVVVVVV: fvvz x V V--VgV1Ve1f:12 .HVVQV-- f V1 V -V-if VV--V ,Va ,,,VVV,121' V-'-,s11Qs- 2- V- V Q--fV2V' -2--1--'VE - V H V ' -IVV V iii. .V--VVVg,Vgib.,M,? -gn? ' ,f -- VV-,legs - 11 W V,2V'i1Vi as Dean D0dd5 ' . . Shelly Donahue K . : ,V Y,-ESVWS fi' Y f ,,gg..V.w Q- -VV-VV VV Joh Do chan. 5:1 - ,Vs - VVVV. -- -- VV, 1 V V- 1 VV V.'V - as--4 V'-:Vr .g,,.ggVV.j-V,-1' 'J V. 'A ,g, --- f,V- - ' -V-5,1 '.,..Vw-rr -1 -HJVVVVV Vw VV' 1'-1 -- Vf 7 V , f- n n ' .VVa'fVaV'i2aV,VVV.gVVVQV'U fig' Vw, V V V -VV , . f 'NrfnWmfW+ '. 'liigy fi-VV VVVI 1-'V ,,VV,V,V ,,,,.,,. ,,.., VV.. . ,. V, V ,.,. . V V , V V , V Vs-922.-,V 11Vi1f'71f-i'27'T W l 5ffl- ' -- 1 Jvfkw DonleY ff:'ig215iV-21 jisifs-SVV igiaitiiigic ,'1VflVl2iZQ7fVf A :if - ' V - Q'Vf:??x?2fSgs?f Steve Donner , ' Fred D0lS0r1 QSYQEV-1: -i-V225 iw--VV V V fax-VVQVQV iiiV--1V.sVfrf-V-VM MVW - 4:1253 fV:ffVV-ez -12 VV 5312:-V'fV pf, -i VVV--V Qzmwg :VV:fVnV Dlune Douglas Mira- ...Vr f- '1.V-:ref V QV -EW 52?fVVS?a - 21291292 rr' sexi:-' fggesif-'ff 55:15, ,134 fm :V-VST! ' ei 5551955 -V421 -M y f 'V1 1 ,.VVV2' - LQ: . 'V-2',,V P Y D'W 9 5-gisggsgiggg ,V ggjjfqg- 'VVQ 5 U57VgV2z3Qjgg 1:12-VV , ZV 'TSQTS6'-5 7Ellii?'s-f- -Li l i?-V5 :.: ?5iL5V' l5flST5b55liii'e,a1A '::'3.. 5: VV fL5?r3I?lk1xM17-V-7,lV, Vgiizzsruw 2.1-,ff 97-V-w .li 555' '- V-4275 J' :-'VQF' lTlPH,i7l? ,SVV V W .4 33 A VVV-VVV ,VVVV ,.a VV VVVHVVVVVV , V -VVVVVVVVVWVV :V VWVQS-sf-42-:VV VV -M91---111 Bo DIC E 5,-V,Vm-v -ye, VV- VV- ,QV-,V-V V--V-2,,mV V wcsv V---V-2 1.3,-Q - af V -' may V'r'1sfz1:55VwV1iVV VVVVVVW- ' 1a2'wV.w11 NVV2-- VV-1V -Mvwizsaeii VV V vV VJ ' ' 1151,-53521-wr 'vsaifw Y ' 1 -L 'V Debra Drenske -ff 'wen fVV-S,V zwlw- 1vef'ei?x V :VV .V V . 'iii K--V--W ,' rs ' ' VV-- V gy , V f ' ' ,- QV.-V- V . V V QV. , , - .Q ' V -- Befkl Drewes ' QW, ' QQW, ,V V V V ,,., .V VVVV VVVQVV-VV. ,MV-fV,VVVVVVV.,,.V3-VVVVm,Ve,:,gfg:3V-VM: eezsswff-S1122iiriiw-frASV1i'2'fi,i?f iiiiiikifafiibiirE5??'15?i72efg?ZVViZb2?s'5? ?? W-Silafsfliixaf'Lis?-?iiE'E5if?''25-3155 r5U1TVfaf?iV-5 -:SWL5'i5f2V1Q1lV1 ' YW' g575iZWiEi.L:L412,516 Z:2VL55P2YiCEy' 555fgfffgiif'-'TJQLFElif?53fM3515155S5 ?'?'W55L5 559'55r5??552i3555ri?i3Lf2i5?f55 - N Arthur Droegemerer ' ' ' ., MUVY Dv ' Pam DU9dal9 - Vx- Ffseg -Sf-S f VV- - .grffiff V--VVVsff V FFS--V MV-:Q -' .. .. mv-5 -Q 4 -miie wig - V. Alb D VV ef' 'mf'-'rl S5Q?4fa'ff'Qi i!1'Lif72 Vf:, .:- ffifxis? 511 : ': . - '35P isis VV5i5fsfi5 2ViErL5i.V :sf ,,:i742'gSi' ,ggfggffgsgsiv 15233725 5 Vdiilgff fgagiiliissvi.-V 5 in 5fET19SZifrri5ii'f-93,12 'l V,4?'11EVi 1 .,V...5,.w VAVVVV,:V, VV Vg QVVSMA VVVV1--V VVV -... I -SSVVQ fam SVVVPQVV-::V?f-3V ,VVVV . ,W-V-VV-V VVVVVMVVVVV ,-,V,,,V Vw,Q,,,V VVAVMVVVQVE VV, -VQ5:Vq,V5ggVV,,, ,V,,V V13 V-Hwy: f M'ke D'- 'laP 4.15215 W- -V V,1:' - -wgm ,www ny: 3-5.422559 - V-315735 s1s1ffVfiVV-g '-V :: - -5fV,21:w 1. -5 Vw: 12v1.,V1:V??g-V 1:Ss1:V?-iff -2 T1Vrf Vf .V., :assi gVggr4w' -3 -1-'li7f,W ' f5V,i55.,H, QVf:gVg,5, wwiiqgg9i,:V ,f -- -- 5 Vwgfggg 533--3g.:t7:VV VV: -,gig-VVV1' ' Vglw RV-:arkf wf -wfmzrvg Mlke DUTIYI -V ,VV V HQVF-V 374 ' ' V XQ'1 V15 1 ,v?2:QS1Hsi1Ef V w s FEE L Jil-55 SI gifs-Q 2,5 . s ig Ysiiid x' envy' -eww 1 , M1 1-Vfs-2, f ,yen -V .rr W- EVV bz i 1Vf2zfVsz1VV-HSV ' --Wn f 4 -- M USUN Uhll . VV VV V V, ,. V D V - Dan uperre :,- V, VMVVVV Z, V- iw-VVV, .V.V 5 sz mfslligf , Vfg 2fsi'sf- , 4'--M 6? -- Vnifi A Rgn Duffle Vrs9VV,VVggiLVaV.V,Z VMWV-,V VV,VVw,V: VVVV-V-:,VVwe, Vrsgwsr -22V-mu-SV? MQW- --wwgfsw VGQVVVQQWQQ-9-srrerffsfg 239- , - V- Florence Duvall ffm? V -V-VV1gVVVi WV-Va we-fVfVVVVf iw . - ' Rafts ,VV fwfr- VVSWVMV-ev -wr . ,. 452355 , mfzf .. QV--QSM 'sri!?mi21V - -VVV:--V. VVVV-11.5 gm? 1- V V ww f-2 dwg :,, 'A'1i?:2w -J, . . VVV..., ,,w, ,. M W. V. ,,V, M .WVHVQ ,FV ,, ...V V. VM, V V V, VWVV.. VV. . , ., V k D II V IC I UVU V .I ' . 5921 , - - - V - - V- 13 --V raw- -----V -szV,V,V,V .V,VV, V-vf E57-92 V .::f -. Wiiw :--- - :I mf --rum sm - Q, :VVVV-VVVYX V:: . www mf-e,.,4Vg .. VVVVVVGI- -VV VV, MMVVV 5'-Ibm V'5'1VVrV,Q -V ----Z .VVVV V . , . V, ,, V, V .. V ,V VVVV, ,. . V V, VV V V VV rig VVVV W, IC ar em 1955, age ?3TV.feg52 VV, fwggijg -. VV-jg - VVQVVV-1 gym Airfare? flame? 5-:gs--,iwiwrggsazf -V QZV 5 is .VV .... 5-V 'r f'-VVIF ' sig w e 'mn .IV V mme? VV2s1Vgrf.5VV -- mzfrf 235514 grgsggsgez Wagga Vaug,,,gw.59V1fw :T - Siem Paul EdWCI'd5 VVVV ' . .V - -'S- 'VVV V 5.4 'R .E5??b5?T - 7 --Wi' A 5'i'iS1l:f'r rif raaj' ar' ABQ? Wifi? A V VWIL we -filrlvrxillff Wiifsi'-'fe rf?-: -l' A-'iff ,iii MIL . Sandra Edwards 3--V.V.. V ,Vg5:-,V-V514 - 42- --Y.-V -, - 5 ?':V-Vw, ,'i.,f--V,-f -- m vfmzr -'r-VVV-H V2ri,.r5,,,ai QV V e!- 5- V5 V--rms V. V ' - Chippgr Eisner V- ' 27 74 Bob Emrich Raymond Ertel Don Esham Rocky Esparza Bob Estes Ken Estes Jim Etshokin Pamm Ettinger Carol Eustice Don Evans Sheri Evans Ruth Ewer Richard Ewers Joyce Fahlberg Margaret Fairchild Christine Fall Margaret Farrington Terri Fastie Brian Faull Bonnie Fee Steve Fegon Stuart Feldman Terry Felt Gordon Fentnor Jim Ferguson Marc Ferrer John Fetter Barham Field Steve Fila Richard Findley William Findley Bob Finley Aynne Fisher Mark Fisher Betsy Fleming Deborah Flood Jesse Flores Greg Foraker Teresa Fosha Leslie Foster Fred Fox Carolyn Francisco Dean Frauenfeld Paul Freistedt Debbie French Liz Fridye Robert Fritz Linda Froehling an 6 S r.,i. 6 .ew- Mo..- S Si S S 2 ,. L,e-WL, H 1.1.-',,. f gg- Z K 1 - Wi . - . :Fw . . zg -f - -U ., A .i ,i .- ., . g ' f . -QF1-it p i. QQ? K go, e :. if , S 54-NN ,M is 2 Q- i Q2 E .J sa . 1 4: gg ., . fi : W Underclass students on the morning session took advantage of their 12-minute break to get something to eat, socialize and relax. Freshman :zz--5.7 ., --ss ,. -f,.s .:' xx . J ...E 51 I R52 K ak' 5 i,.c ,if . stt I gk .xg -if. . . - an Q... ii J. wif 2, . .sa ve-2.11 E X. NLM, 1521'.17g- S . -- a-QiH-..'- . f ..,-- ..... . , . . ' . w.. -.fiif--.IT-QQ .V . , Q .1:.::'-if. - ., II' ' A Alf' ' ' - F - K ' F 2 if A J . ' . - K -x.,. ::f: . S i iM.sa.gkJ:L.f- :1..k,g?:k.jL' -E V V ae- . . .gt ' 1 3 ' A V K. .Lei . . . Lk in 1 .5 I Y A' . S, S S S , zz . 5 1f:.,..se',-3. 3-,VI-gi.-K ,. L J J - Q- . , . ,. . , A .. . ' A 5 ' 1 is 4- - -f it is X K 8 S . 3 I .-ii -- f 13.-L K .1 A K .. 5- -. ,. S fy S -f S i 1v17F'5 , , 1-' .1 A .. .- L liffeiiw .-if . :K ff-212. 'i klfi s-f -:'i'.-f . 1 ' . TI' --12 Tiff! 1?-in , 52-11-Q -fi . K-ii' V 175 -. ' - .. 1 -fzsffli-f ' ' ' ' Fill ! ' '.l2fl:-.l- f ii-f ' ' :?iTQ - -- ' 5 ffl ' ., 1 . ' v Q. . - .- 1 -' :'- . ---fi r:.:.Q:'v ,-.1.-1:-sfiisr X- 5-W - 'W 2' fa ' z 5 X Q .S . .3 I . ' F s - '--' .. is ' ' S - , F' . .,f-..r E. 6 - gf, --IV K ws 'Y ...fel-f wx. kg.1a1f..s Q S f H ,,r - S .,,. I -. - ' I Q I i.1f2i-21.25522--S .ie-fig ' 11- ,i..,w'f V --1, 1344 . - ,,-'vzi---Wei . -,, Ss Z,-'fzifg-.g.: i.eaf' x. F g1Ti:5 35 ' 1---.gil--ff-ig-ii? ,sg.'-f21gg -.i'Qy - 12.1-fi. . '-.-:EIf- - g-Ti?fff7i?i f :Liv , lm' - N : -Q15 ,-y,g,fL I . . 2.4-'jug fi 'i--f-- 5.5-2 -7 .. ' -- .--7, I H,-fi-'Q Hg- kfifii-is 'i ,J : .. li ' , . W - ll . .', Qi. '11 f Jyfiill-' , 'ileii . . -iii f ' is if 'S - Qi-:2.r:-1 S Lf 1? 'Tis iff- ,. S31 ' ' in-.MQW 5' ,. .. .5 525:25 '-L -,- - . ' ' 22 W . . .. .. ., ., ,. .,,,. .. , .V , .- .ze , , 4 .-an . .fb--. gf. wf.. .- xy.. .... . 1 - --17,-ze.:-sf waz. -. . . zz- . f . . .. - . . - .. . F 'L ' - - f '- ' 5 g ,--L... 'L'Lsl5 W' 1'12if11.. ,- i f' My 3:.f.Yf 31 .4 .:',, H. . ,.., , K F Q V . . f-Q J T 5 if J J Si K ' ' ' ' W 2 ' F 'fi 1. ' X, .fi L. 'K ia Q ' 1 ' Class Jay Goodharl Marsha Goodman William Gordon John Gorman April Gorfer Rulhanne Gould Kathleen Grady Becky Grunt Becky Grant Ruth Ellen Gran! Charles Gray Dale Gray Rhonda Gray Vernella Green David Greenberg Ellen Greenfeld Donna Greer Diana Greever Wally Gregg Ann Gregory Sieve Gribben Seo!! Grieve Pam Grundy Ana Guerrero Ginger Guess Mimi Guidroz Mike Gustafson Kuihrin Gusiilo Mary Gutierrez John Haas Penny Haas Janet Hadley John Hafer Alan Hale James Hall Paul Hamer Scott Hamilton Sue Hamilton Patti Hammack Darien Handley Danny Handt Greg Hanna Beverly Hannah Donald Hannaman Curl Hansen Mark Hanshaw Barbie Hanson Pennie Harcus Q Q 5 .X,M,,A 255:55 SSW 1 Q-fb, ,M Un. ilk , ,, Qsifwgsgfsz .4 , .-me 21 11,1 wtf . 1 ,. mfg:-Szwr ' W ,, Ssmwiegqs, ,az , :sig fmg:22141- , sf leiffz-22? ga ggi,-w,1fwgm:mwww,-wg: -- K f f 6 R, We 5 s , M X 'Q as Qs. W 1 1: f ff ' : H2if-TE' 2 :ist S S S S as .a S Q V M f 2' Q . fy --M ,L - mi: , 2 3 f N , , SS u Q I S 6 s 5 X 2, 12 22 xg E 'S S s. M 5? Q 2, Q' S 3 . S in reil .h is F, in S is iw S isis .L E aal A, 6 ,S J N Q 3 if S P 2 HA 9' 5 , H . E z Louis Froehling Debby Fullerton Pa! Fulfz John Funderburg Jeanette Furnas Jim Gagnon Steve Gaines June Gale Jeannie Gannon Ben Garcia Bobby Garcia Doris Garrett Steve Garrigan Joe Gaugush Dan Gaul Liz Gaxiola Peggy Gaya Judith Gerall Barry Gerber Sandy Gerhart David Gharis Marc Gilchrist Ann Gilliland Monte Gilmer Polly Gilson Steve Ginthlum Denise Gish Robert Glynn Debbie Godwin Dorothy Golloher JoAnn Gonzales Stan Good S S A X ' waffgfw ww- 1, Z51s2:Qfig4s1a32f' 1 wv1i?gf5fs?55f ..,:S1,ss2 Q- -,. 2-- , 2 S1 52-.gnfgxws , EMM: , kf,,W1,-, , wwf WS msg, S fsefsiflsg iiw img -. geiiQfg, f ::a::' 455 i'i5S1fei?g ,., 1 . -Q.-my - 215 S :f1eLfgg , z: fL -Q :wee 1 me ,f :ei n bw , ,.:1f:w:. m A in '- 2. mf: :.- Mig ,X , 13 ifgigzfwgwgih -- ,A F:-fm -M - 'ima ' X f L-vegig v gwefig gm A , 4-..1m ,IQ fit:--:ss Ifefwv . ::::S:i: - exif? :rflfw az .. W-V 'mej is f ,Q : :Vg 11: 'A:f2! e. Hia' Y 459 5. HL '17-, my - ,wg ,,, . I-.Q-.gm Q-g,f,.1:wwz Li gue- -es wi W 3 K, if we B ess , 72 ' a.,,: I i.,, as is.: .,,k W , .. . H , me, Z, . , 5 . I ... , . .. LIT , I g S . ,Wg W . g , S 6 ff'-l1i:.'1l3ij'i.Lifff15,xlllfifki I , q . gf 3 , 5 'l'i-H-552' f 1? Z ief-V' 1- Y 'J 6 M' Q S N935 X 22 2 SS -f'fL-'E-'1 if i-11 -:Y Ie 1,-f.fff'w ?f5P5552?m?gS1L?55Q? e??i?Z??siQiEi35z ,.,.,k, , ,,,, . ,K , c.s, .sy ,,--, -3.11, -,.. , ,:,f. -, 2 2 Q. M ,, A- ,,.k gw?iW ,., 5 Msvigm .. '11, 5 S L S ,A ,S S , :ff ,fgggigg -' f1e.giigSgi -gsvzqm mam 2 H , 5' , A - , ms www ,, .. S Us A. fs S - .. 23125 is ,. .1 K: , K ' f -211, 3Q?Q.,fjl5Qjf3 L: -. 4: iffy-fy K 3 -: ' ' If I H . Sears 'Iwi f1 1S2wf H - :Q-1 f Mig: S K Es- 523511 Q' fagsm--,.gx W . , '-1.w,. Q g W1 f gang ,:f:fv-gm ,ws S ,iw V-sw yew ,. vm - sg Q2-V: k 5,1 Y ,fin 4 -i -'ujlggg fxf ff 'Q 2 'M A Y, I V 1331: , ' ..t'.g VQjb5'g -Fi. 'gig :SEK 1 jf,-, if Q fy' ., 117335 4' Nz: ':,:: .f1x rg, X-A512 y my ,I 2 K H, lg Q, fm, ':z, ,.Q1, - U, :Aw w , 1555, ,J-I .521 is z z--.:,1ii7S ' we ei. S 5 ff fsw .11 fifezigzgfg S242:f ffzgeiY -'gf '?il1ff-Fill? --,T:,' a6?gsi1a? ' ' K -- i 1 , , , 'T'-1 , S gags -f,'- 'ig 5,3-QTK 111- I' k 115:75 .E ,, zaiiiz-H L fir I' Q1 2215311515 25 Fligf' .- E515 ' ' ' flffif' Llliilf- 1 -' 01 '. LV - -H . .,- : 55f2'vr9T V 5'Q ?'S?S - -Am E , , 0, W N M ,W ,K Q -Wy. , Q iam 5.2 , mi ' 5fifQ:,-as 4 W:w1f,s5-m in 3' , ,wfnzw we V ,, 1 sawn Y 2, K -f ' f ff Q sail- -f '- , ' , -' -if QQ' ,1 W - g a'-fp5bi g4g1sig2: ::':i'1' -'S , V ,1vv'1fmz1sv,gpm,. Jw- in hw A , S if 3 L S, , , ' 1-11 -:S H23 S K , gefgsgfzsigggs ' S f 'f . wnzisszwgqf S was .wazwvnwwf , f::f:Q2-.:- -- f -, '- ,. fmwv 1 :rise Qefwz' skis? ffwsffw-f - ' ' ff -I , I ,. Q --- -4 - A 5? 2 : V 3553, , sg : ww we Pwifgsiis 1etf fg?g wg wi- 'ff ,, 51 ia: .1 ,fign , A if .: JL .uw aww: , Nw :fax if 2 :- 2- ' 5 ,, -Isa, 745- gy' , b -4- -,,- . :im -1 wwf :wgfii wwf -,V awiiexfiw nnrn f . -' af -41215 'i 'T ,. L Q z. ' A ,si 5221521554 '2:.' w , '. zwgfzf if by ' M221 . EWE1-SSH X 1 ag r H49 Qin-f.'w?iQ ,MW - 1, 2 Q mag ? 1--if wgseag Lef fg kl - ifsms 51 f ..- fe, 22421 Qggsfgfgfi: -::: Q5f1 : i ,vs :wgp -- -5: ,,,w : ls, k,,,:5,m.,,k,i5,l ,M . 55, ,,' .-1-Q1 ,4 zilhggmg gaw '- vgg-,m kgaf saw 5-.wlww px: ., , 1,1 f ff L W .. 7' my -iv , ,. e 5,f,H u fMwz,13i5Sf,i Qmsfvgy-' 3 if assU'wgeiQ?2g ,z4eef?4 L 1fe??wgs, Y Q2 A2155 sfgfsgaifmefsi J 'F ,af J 'fix si 1, 4-1LlQf'if2isi.f-inf 'g,f,-1.-gggq fy gg - 2 if f s,sx5gf5 YQ, ' fy' -. A 1 iw--: -' :m.si1fL11Y'l'me-.K-' H .- ' aziiw, -- J ,ff 2: Axis: ffi:w , :f:2jv:.-fy . H , . .f M V Q, , ,A H - V, M, F, . fWu.Q,vLfQ,fAw .. - -,lv ma ,W .aw I - 1:-1 .:w3.::' v - -w..,,Lg3 f. ' .. f, - - szusrvm .- :- f. 4 his - mg. at 55seis'Af'S'21WA :F AE' - : in ,LQ A S 1 ,Mew , ..-:.,:: . ,-W , ..: : -wi ,Q 7 ,, V. .Q fm' . EWR ' : 5 K K' -- - T 3 I N' f '- 'L - - ' L if n g 1 - J gi I , gk , gi I , Lew, my -ff, ,M . .fx - Emmy: twill em:miaLszvgsagiezkeigses.V QgeSSSi1?a5s M ' ,L i?:11 ,mligfzff S W -11 .fLzwffg,,gf W' n,mg,w 'sygwg ' S ,, - 5 yu H, MM, S 7 ,mm W ,hw f .,,..ff:.,,,.-3: , , . ,, 1- '- ,f. my mf 1 K ww, WW f ,. ., If: 1. H .- 5. -nf sw A. -A523 ww wwf MTM ww an ,gi - 1,195 ws:f-,:w:::f':- 1, 1 ., Q ff- 1 4 4 ga, :S 7 ., sqm :AM Hmm . ,--,. w if , V- . mg:-A f wif f- Q: m,.A- , L , , ,iw gl nw :g5.':g5.,-Q-:5 :,.-:I S sz. Q- sex, ' w .li,:fffg, pzfzzx ff 1:7 .gaguk 5 ,3 W gm, 55:25 W ,, gmt? Wg? S , MIS mg g, .-ima. 1 f,-zm kesfxgw, fp: 1- ,,' -H-fr ' 3 2212 ,ff 42-we-.4 ig! 1,5 : 34252 i Y is S ' , . Q - V. . - . 5 5 WH'77'i ,-:ii .:: - X555 uv' K W I I: ' '- , SGH ,. f.,... : .f,I' A ii ' A va: , j xggjff ' ,,fjgE5f,m. ' 'H 5.515 ' 1 ' ' Lfrlszi' 59553 In K 3'1 'Way ' 5 if I ' HS V' ff ' fy Aff 5 5' ' 1 5 z if S2543 ' 2 W1 1 ef H ii? , Af L' if . ww . ,, .. .wg S 5- : .:, .W ,R :- 55 'ez ' . .,.:gg.. .:f 'ri ' K 25 Hp Siv a -'iw tv w siggvw -il 22 9 Q22 fl sie? f 'Qf ' -Wy: 1 H 2 w 6 .Q wk ef' -' .r wa Qual. H -'+s:::::5a- fv,Qs-f:f,- .2- , ,: :P::M: : ::f'Q:::2?H2iF vQlfrfk-vf4H1bf5hfvfLw ,fm U.,A..,-my ,w,,,L si, ,..,L5.f:. A -l,v,,k,, k.,,k5,m,k:, .V fy L., 5715:-,f-wk , iqugzy :Lag 11 zz. 1 :,gT5y5,f1,:,..,. fp mgw .fa a- A .law rzaffywzxzv- ,'a'V1fT in it-12f-Sammi -1' '35b21,'iw'SQi?' WM ,Zz ' ww 5'fY-9?V'A7-Am'-3gKIw'A5' V ,-A 11.35 R ' A fag' X, g 5 miiewlsfgxzfefvglse'lsiviilvise-wif yifgfgg TTK-1fiii??55W2-Glffl A S as 'vmfzv as S S 2, L f:gigif?2iiS:v,2?gi ififf :f,zfQf1gf:z,kf,1iggfg ,fffsww-U S M' gs Qrsigsitas a fxgfggfjgfwiqf , qw A f .mi - 2g1:z,:e,'a gms Wifi 12245245 534 K , :Hi M? ,. , 3 '53 S ,. ' ,www 5- f H -' my f: wax ' as :ww : M f S-1:-.11 ' wzmwvs W -'3 aiggsv 1 bw My K Jimi ,g- -: ' 1945, '- -.3 S Ye iw , f 1,2241 gsg k 5 L , 3: - my A. 5,533 ,A ,.u-m.-A:.--gin. me ,mf , - . QL MW-,.1:: 1,3 mg lg wg-gf-I Q3 ,, 2- P- .- mai' ga ,wlww , .. ww, ffwmgk r ,lk vggw . f... :: , W, ,,g?s,Q,f ,1y,,, :5,: sw- Q ,,, ,: ww e-fww wg fx iEsS,wjmQ75gw f ishfwggf QM 323352 H . 5 -1, ff iw gLgg1sLggk,f?if,- 'f g fysszg wiwq 5 wgalkiilii, . it :,g, 1g5g,f,: gff3:z4a?S-f,-qsszs 'fgmma vDf,f,gg:',1f -'fn fwziig-ilgiigii A-iwsifsii Hsififw f' fA1siff:f4bm,,1,g sf ' ,f f-f.1.e-fm. vm.. M 1553 , 3-wig ., fa ,fggg h,,,A,,f-5f1gf,,w Q: mm, 7f55w,.,l,,iQ,, , 7:5 4:13k57f,l,..,, f Egg 6, ISHN, , EIAIQEUXV JS, ,, V1 A K -sif1f21Qs1 , if efefwizm Nisfwiiziaffglf w ,W-W f svgzfzfwvg- 2, M Li:-QQQFQQIFSL- ' f-Q15 552352339 55 zswjigi 55555 ' ..-::fFf:F' if fffm- ' 125215525 :ww 'W f mgfiwgi-wg?'iffiiiv S-f,s,11:'f? Su jz., . Q ,few-,f,1.' gfzai: :: '- ilqkg, 12 emi, :A 'H Xfggggls 1251 S V12-Ifgiml 1 z12U:'2241w3wZk., -11i' 11z:',,tiS-KV WH wg K eg kwlfzgszilbzi fz1Q,.sz?,f3'S:'w 9:22 Sg33'Sfi V, A min,-fw:g ,L , U,1gAg5Z:,k,,l5-ws. , H MB: -gr fm M.,,M, . M m ,--, ,,,f,g if, --g,,wv M- .,::f..aaf'::'-3. ,V a: :E:f. V ww af f ,A .b V, Q fs -- -, M .sy ,. ,.. .ay lk K ,A -Wm. .:- -vu, S -,. wry 1 .M -f , , . .. ,,f . - 5 W., -,Q Wi, .sw 5256 911' ,. -- A , se N ,, ,'51.,. --vw :B ww We r f-WL, M, V V z, 5 1 - M1 K, 'f ir ' ' - i lb? 5551? ,- 55: g,A9,m A lwkss, , 6 51. ,. Y 1 ,: T' k ' ' , 'C Mfg? 'LSI '- ffl 11393315151 Y , Lfiig v' V Q 'Ji-V: QL-UT'GfLV Vi I 1 if f' -g23:q5exf?- Q 5 , ' f- ff,--2-2 . 5 , wal 5 -I I2wiv-ae.fszpwfe , H 'EW' - ?!:f:s:ss..:Ma--:.- . J. : , , , A 1- ,in-.fp .:- 3 -as ,1 ff ,uf f , - :H y t , .Ev --gy:--:,. , MH fM,,f Q 27 Thomas Harney ' 3 VV V ' '- ' n1mfg:+V k5i'.EEiH 9 3 7?3Vi'Q,V . . , lvlli is 9 Qxfgitfyfig ggpliea fri'e1'Vi, ??i11Vi1:55,.' V X -V V Lynn H 'fe's 'V ' ,V V. V , V- Pete Harrlngton V . . .. V. V FW . V' , .VVV lfiiV.sVV ' WV ' V V J ig, HS B9CkY Haffls 1 V' V . Lrkr -V V :f':z.:q,f . V zwav. V VVL4f?,.e,sS fee.: V'1'1L. if -' : . ., -, .. - , - - V . .V Blum Ha 's ii ' , ll JV ll ' ' ' --'- V- V I VV ITF Y , V V Ellen Harris fm . T i V Ek .5 if ...I I ,L.L , ,. V r .V Danny Hartke ' ' ' ,gffl V f ' if V ' V ' ' Mark Hartman f 2 Vi Nancy Hdsslef X -,'fL V VV 'V - V f ' ' V . Mike Hlllrh - r- , V . V: 25232 , - V fi Q32 ' M I--lf ' Aileen l'laU9h - V V V V - . fi ,. . , iZ' ' ' ., ' .e f , J' VV Steve HUUSBI' V J k' H 2 xffwfff' VV V W4 ,efiezeagf 'Q3?l651VwVVVVWf3LM ' ,.,,.V ,Vt ,, AQFVQSVVSVV VVVQ VlV,.,3VVVV?,, .,. , V V CIC le dven , gi V VVmgVggV A 'V ' I V r'-r MV , John Hqwk V VV -V ---r . V - n . . 5 'l-- S K V, V Elame Hdwkms if ' 2' VV VVVfV ' Q 1V ,HVVV V, V X rrnl V C 'Y H'Yes V V, V Vnrn V , VV 'Q , James Hays V V1 -, , ' HHVV M-4 . VV V Jeff Hazen -ff -2: V if Z1 . V V n,,f Manlyn Heath ' , 'RF XE VV, QR V V ,, X V .:' V E, gag V 8 ,- QQ .VJ .V , K . d . V. VV K V , V . V- V g ,, , , ee VV arm He gcock 3 V, VV f :,. V ' V 1 2 V - Vgg,. ,lies ,V - . VV 'VVVVV V . f VV V V, y L fy ' Dorothy Helm fiief f' f JV VV V3 . .V . ' .VV if VV1.Vli,QgiVffV' if -V ,V V T ' . Elsmarie Heimpel 'V VV VV V VVV - VV V: V . V ,VV .,r- V 2 . . . J ll ll . -VV' l , S' ' Debb-G Hemlz 23:9 V .ff ' 55 -V :V-Jglg VV ' 3 Kent Heller H V V V ' A 3 Christine Hernandez V Thelma Hernandez :fV VV V fV,5m,V , , M 'V ,V .- , V V V V David Herrlford gs ,. V.PfTl il .gf f V' Shirley Herring V 1 --'-V i- if f,V LV mf' e- - ef. .V ..?f ,VVVV ,,,i jg :V E. V X: 'Vgggvfgk I l , Brenda Hicks ww .- - ,.VVVVV1, :Vs VVVVVV falVsrse12.VQfeVfeV jVfH2f6i14ee:i5 V V , , 2 2 'S 3 Debbie Hlfks V77 X , A I. .mf F7 .V. iff? D bb' H- W VV g. V V . A g V QELK VV, I V Q. YV , e le lgggggn 5 M A . , Vt. eg A A ,M ,W A if V , , f Q an o if 5. :Q 'L Ax Bm H'99 '5 S A V'll ' . ' , ,.V,.. V ve..1.W - V 15:55, My 5 Karen Hilliard V ' A VV VV ' li? ' C'ndY Hllloh ,vez 'i .. -SSB V V U 'V we eg: fs' ci V k,-. ff vznig K a H. I. k , , V ., . ,: , '. -V - SQL, F - 'A 311:15 :fr'l5Fl V ' ' 7-IZ' A I A V., . lg an H g .., .M m y ...Liz , V K N,.' t V I . my ren :me nc V' ' W W' V V V' , Annette Hmdman 'V V , V , f . V V' - . ,, ,r . -V . . V . V, VV., VV V 'QV , V VVeV V VV 'Mer' H-M1 4' V V - V V :e.VfiVV, f V, .- r - , . V . . ,VV R. V V V' VJ V VVV V. VH.. Q V. V V., ,V V. A , Doug Hutchmer g. ff! .N V' S V359 we -V ' YXVVV. VL . gy. 5- . if E, ' if ,tk 3, ,V V'V. . ' - ,. X5 V Elizabeth Hoehn V ' , V ,.,-V-Hd ' ... V V . A V V ' W .V Q :V , gv xy V V 55:35:32 V: Q i V V VV X ' . . JoAnn Hoenmnger L WV V V k Ve Alan Hoffman . V V. , eV'gVaV.VV .qgewg . VV V. Jlm Hoffman QV ,V V 5 . V ,V . V tg VV .QV gi f 'g1VjjIV!, V A. 5 V 1.5 Ruth Hoffman --- VE H' ' V:V VVVV V V 1 Vi ' V V V . .V't2iezVw'VVVV VQ,,ifVef1V p H lb rf if VV . , V V .ef V V ' , .V on 9 e l 'LVL V A John Holden Q L - V V VV IL- , Vi ' V' Q Ml: l ' V ' ,V VV Jim Holland Vp, l FXJV 1, V ' f.?,,:,irqgg3 2 f V Gary Hollenbeck Debi Hollingsworth Richard Hollman Pat Holman Linda Holmes David Horn Donna Homer Dianna Hosley Karen Hosterman Charlie Houghton Julie Houghton Nita Housman Barbara Howard Jill Howard Josie Howard Mark Howell Holly Hoxie Vicki Hrometz Barbara Hubacek Judy Hubbard Michael Hubbard Ronald Hubbard Judy Hulden Pam Humeny Paula Hutchinson Frank Hutton Denise Iavagnilio Michael Iavagnilio Paula lckes Raena Ingham Stacy Ingram Maureen lzon Charley Jackson lass of M V V V T 14 .V .V 1 g .. li V ,...V. V ,,VV e '.'V VV ,,VVVV , 'V , V .e,,,. . VV Jw fVV,'?'.VVV Viv .V VJ! VV :zu 3 '2 - 'A ' ' . V ., V -lil .V' ' ' Va .. V . VVV. 1 V V, , if V i i:VV3':Vf.'V1jV.iV'1'VVA , VV V ,:'f .VV V V .,.. ' V1V.'f1V vm , X . V VV. V. V Ve vV V , me , V .V . V, . ,1lv3K..f V. ., VV -V VQ E V V- .,.V, V . .,., ,V V on-L 2351 4' , if Zi: l 'Q we Q ,,,,.. , . ln V' V,,'. . V, -. 5 'Nl I ..,, iyr, K 'X SV VV 1.W' jPV .V V V -L5 1- V' VV V A VVJVDJV VVV' V L .. 5 V,: yy llll VV V VVVVV ' 'VVV 3 ' I V. . VV VVV' V f V egxfe .feifwsifgif 2..f 3 h A 2 E K P15 iii? 'Z - .fiiwswf zl 31Q1g'W 'MVT 7. n35.5'5V'5i?7Ef ?A5?5 2AeWQg2Ae'?3?w1w:?fvW' .wee Lwfwgsg. -.,l-221:- ':5-frm' we ie ea we 1 , J .W . ... .. zfiffif :A ,,,4f22,'s T A557555 5f:a.5:' 333 551 . if 553925555 - 1 wg I HS ,wie L W. ,K A ,Q ..... ,L1 F ,i,7 .:,-' - , . Ev 2 2 JW! - 21?2222as- 2 1 Sw , 3 ' ss fa U we 'Q' are A' Wim? Q2 is we ease, :E me ,Q 2. .M ,2.,-s rkeeiiliazee 2 W : I, Qeeaewsgei ww-fffwewas'-sei agme???f '-- 2- ' we qw . 7' N712 .' .. reefs? 12 QWQ2 2 f ' - A2-' -- e2' s 2 s2 5 few 35 .11 Mail .- . I ' W asf 'ZQ'ie25aWs 2 5 QF gem .. Wm A5 ,eu,,Qfeg.Q Xfifegegf- Q Q 9 W p 2 fees K K Si Q .. S W 3 7355435 J 9' -:-'!2I:. 25355 . IAN 21 'l -fe: 22 ::: zfviffia, :-we -:1 wifi krvwimi aiiii 1 2gf+Q2.2Lf2. 1 21, m sg. :- 2a:::: .amuse Q2 H e2 ,ef 2'-2422-1 .: 2.. ...n s-:'.I .2 e f 1r '?:'EQz ' lei 'I - ,... . .... -2..:1.. -- ey. -2, 'V Efzii-mia Hi ' A ' M ae m-efvaefgag rw L wfwwiffvfwe 2f9fefe2ee2fesef1e'?eawe:2g' X Q 3 ,2 gm E Q ,DZ M . Ei W ,Q aa ,J ,Q .. ww? 53.531 , QAM? 2 i' f X wal- el, 5 4 W 3 N We Q ' Q 'Ri is 'W Se, 13 3 Y sw 2 fy is ? l fi ag cr Q? e , X E Q, .e M ee S 3 , , se, Q ez 2 , X2 W eil S S V is ff f if Q- Q we W H W Y . , W M, S 6 W as ax 299, is M if Q Qafraf N 3? axe, ag N Se .gg ,1 22, as e2 X S Q w 92 Q5 2 gba? , we sg-3, SQ ef .3 Q Re fee 5 S Has 35 mg 3' '..' - , ., we Q52 aefiiwrgsz 352525323 e w ..,, LU,, L, A.,,, . We 2525 M :gg-45,222 f2, s,1e,2m,,. 2 523235.52 1 1f23,s?21s' 5259253 5,452 2 22i2s97fs2'f, '-Zsisi -5' ' s?2fti2f2Y siege, 1. ,:,g,- 22 7.12 2s742vfs22e?7f4fe1g?e+f+1 F9224 212'2f2. 225525561 25521222 ISYW5 2522 2 '2,22 ., .,,,. ,W W , .,,, ,,, e w ,,: 2, 51' 2 ' 2 ' '2,,2'f225- 2411577 'TS i ,,'2:weYf?', , e2W2Afe2e2-my we 12 221212. gegggfeggEggfelfgkfifkgaegee, ?3eswgs2s: i' i .e1:51svisfsu ,wg ff r3,2w.,2s51, gggug - 2 1252525 iaflsi 552 3352157 .F -,. ,lzgwg ?fX?iP5 A95 53242 5eiQ, .. 2' ,2:' s,,w,,1 .k ,,. S, e2.s2g.2i1 -E, sv:f2m:vs meme: 2 21e21-22 awww -21. 2 ,e,mee2. -,fe , 1 law'seweewemssfemeassrl if: Qeeieiegegwghgfegeefefleei mkgfrgm i fe l 2e2f?55e1m5?2s1f Xgsigfm-es :2...1,:.2, . ,QLQAQ2 fecv,fe2g61 . MS, , ..,, ,.,, , f,2eiw we ,.v, so 315252 -- -, - eggs? . ' - 2245955 1:65, 1-.2 f a-:-5 as ,gfais 1553. 15? 051373: . '2:E!..I' ae -252 234-::, , lai r, . 55 '-ul -2I,. :::E:3,,' aws 2 ' g L5 a'?5sf2 sifeggge5 2 2-.. 2A w5'Zfe2f:awsff2sf2ef 'Q 'i?f2S2f3?2ei22::fiSfL W -- W2 Wffewmm fxewvfwaswsvff QE?ie,.eiQw .pr QQQQQW, , '2:f' gua2f:g.:3::- ' 2'ff .' e ii-- . ,Ja ,' .ily we nf . 5 Zi ff A5 ' 232 T, fs :ls mix: 2 r ,Q .U ml s. 2 1-45 Asafwfdfiwl5f A2s!1a:f--Qagsenfx e?2a?Sigge'eeegsigAg?2es2Q,aek155seg .2 m fezgggeg . gmlw 1.1 - 53eiAe2g2 . .re g,s2 315134. 4e2.5?f?2 fseim ' we zaglei ef.-21 A ,112 asm w . 2 2 rs1.: ANL, 24 21?5fgPiaRia1 222f oem.. we ---- f22g2gfms2e f ww. . fn. 2:WSq.1f221 W ifi? , H91-'222':f'?.. , . . ' 4555, '25 :2r.,.:24:,, Q, M, i95223H57QifEi5?s5'?555ix'f'Ebl5f?iiS?5L?L? :Wwe .. -Q Q Q. ee.. .. ,W M. viii? 55355 5 . 22122 H W ' .aw S le Q .Q ga Q me .1 -2 ,,a's:,r,- I -- 122,- Q Q Y fe QA? W 4 Q al we be as 'Z eff X 3 2 S' Q J Q S2 he an 1 3 5 'Q fe- ? me K Y 2'v3 'eHfe,egs-1eeW2m1. iieiiikikeiiaee fszwgsggggfaf .2:- me ,-vf M ...,. ,- E525 .1 ' X2ie2see,, s,.g2 ,,,,ma, .25 W i- igxgji? , . 5 2 .1 i s F 32 2 aw We mfs W e 3 1 Q Sw QTL ,,, we 3 4 a in sei Q 2 X Q 93 a. L 5 gg 3, W e 12 3 3 iR2J55l2Zf1 ' u59 X 2 areas 23 Q x 2 2 . as Qi? 3 2: Q2 K M352 2 , Q as Q Q ea Sf fi Q' R1 if W Q ,Q 5 .'25?z2 LW asaezl. ,M ., ,2. .. Ji' e W an e::..,,u s'--ja K1 -L 322 rxgggfg: 2g,gAfyg-vf ees I . 2 Weis eg mv. , is -f.::.:k--- lan Q1 'Q H- 4525? 37352 A SW Lexi : ' i:W2?S:::: l'--:.::.v 'e. .. , im f+3zsf?1eff25fQ22g? 2 igwgisgegg 452525 -' .2 1-v,f:s2'.2'.: '2:: 333.5-,ha-, EERE? 2 95,552- A ' 5iefH ,:'2.J' .. ' ' J E?5?if,192fS,22lSTi3' fi' H .5'-:iiiz ' 5E?::::E:3:EE?I-s. 2:. 3'222 5025-'571,gxf'!E,-S52 2YiE,i.i223952g2-Mk - 1 W: '--'ef-..2::...2 2a:.:1s..,w-lg Ms.af:aa: f-..:E::2:f.:: 1: 225's22f :L .K -'25,2:25g1V25?v2se.?92 E:P:::v.m. .: Z.2ag--,,- F-12225 sv: A 15H3'f?igx-952355 EpgL5i?22Q4Pjgy:e2Qf ,A-vilifligx ,e?gg:g2,L2g2:ggfgqfg --- :W L-ii' 'ii .L5SL ,Z 93'-VT 59522551 1 222,4i4125:' 'ff-ffelkif . gage .- -,,, ,,,r 522523, eww ,323 M 5 1 '::g,- H ' ,a2 22-,i?321s2f,2 1 2 , 1-f.21 J X521 I '-: 1 -,gif -i . . H A Eine: 4 521 52 ?21ft22'f2?iX2'k -f ' MP2s- E Q mf 2 ' www .esg?2o,, LweHmm aff ree s-M5559 l9l Susan Kelllewell K B C enny Kidwel ill Kiernan andee Kile 425,195 5: , . QM, '2 ' -552 22 24 ,Q A .,-- 252 52? . ,. . N as . en W-Q51 .. .. fe 5,52 F. 5 M .wg ge i Iafffggg 1 2213519 .H',:1E2i: 22- -. im? '23 - was - . ::'2 wggex : ml-',. wma, , , . fe i l. 25? ' 73- f, 3 :QQ ip -f f Exif X31-:T ,ggi A, 1 ,., , em My as ,.gif2.,. 2,.1,- img?- gieggf- 2 :if Q RR Q Wm em,2we ,fem -M2 22Q2,2mr Q 1 Q 'ffm .Rza 1.25 l isiifiiisilf ,z. 2 e2fq,,,, ., . 24, 2, X-vm. ,.-2' .fs1 ' 21 rzrsfw is 1 AF sag' E 2 23 H W 3 Q H 1 Q 3 is 2 Q e .2 A t L fe be B e Q me isfizzzewf' - .. ,N .. , 2 my Q 2 i re X.. r 1 3 5 as 2, 2 ef 8 W e L 2 J f ea 3 3 if A J it 9 ,fs e J 7 1 eg 'E' F 1 1' H3 we::fmff:e:sfme,: 22-fagee. Fi' - W,g25g 2 of 1 W -eg 2 W Q Q iw Q 2 4 e R, , ., .. M . .- - , we ie : . is-as 5 . iifw if. -. we ' . -gg.. Q. me Q 2 L 2 U i , E-mF22ie2 agf2mmm'w72yse2g? .2 ' .. 2 free-f:smzs?1A:e2 we1ge2:ffS 2, ' mmf- we we .. p A A W' w. . 225535, We. 2.33155 me 2 , A E532 S315 V Q Q2 we 53 e er P, eg W, A?-is S1 2:f2ges2.2'522.2555,'422ffs5gsf5224s 152,12 iL?7e5422fi2s5?W -2 ' P5fa,1elf22e:i:i 1?s:,L?2gf -2252222 ' .,::.,: wife 91522 M 22wff:2gf fue' 21a,,:v- . mg sif?33'S s . 'Fi ' 2552 552525, if, -2 xgfswfi, .-2 , 25,22 2 2-. v 5:92 : - QW 5 2.14 . .1 V' 'C5J?22,15,Q '5 : 2 ' 'fs 52521 2 4 2.- 122. 1 - E 'Sw . 2251 Ywgiifik A 'lzzfff -2 ' fi Ffffaifi 2213221211 ,asf Elm -,1 ,1' Q2 :.22j' 11:sePevQ7sf244 ' 3 525g?2,':w2,-2g,,. 5 2 52. 5 :f,f,2. ,, .f li2f2?ei1E?S'i2TLs2 ' .215 5232. 'sfg:2xf22 2 :gm Qi '2-7:2 '2' ,? .S5fi2g5f Lfwff v g fi, ..,. , .V ,, ,2 ,M A.., 52 ,. -f22 ,--,, , ,-,f ., v,..,, . ve2g,fs2e-2 . .,,, .er ?2w21:2e , - 2255 - , nz.. , , if 2 S Q 1 c 3 '27 ' a 1 E y 1 2 Aix 1. 3 Q 2 Q 3 F 1: vi , 3 Q Q 2 s- we S R JK iw Qeggzevegsaw w if sfwrvfvsfmnwfrwwey e Z 7 Q Q 2 gf Es S Z K -2 BMA- e,.?2.eW , .sw ,nl w':,.:v22 iz532Q?Esf'is22:e22.:-xii..ffl 'f::2' Jia. 'M 'ffkif .... 2 ::..2 2 M .K ,. .,., .. ,... '2,4e, rs. - ms, A zum:-V wh, .W A-W wa:.?2 'i,s-4,52 V V A ,.e, XM, M .., A - - ?2Q1fmfw22 5595224 ' '- :s22s2fP2, 2f2 2afe1fWQ??se21Q2s We . . A W. ,M ,.L, 21m2g?f1s22 e,.:25Qggs2 222.5151 ' i'.w2fsg2 WSI 2115? 2 :: 'Pfsrapftfg 31922 -f .22 1-, uwwxz 32-Wei' '- :'y?f5's2rfii :rv Vzigz Z 'M 'uiiifff '.215g?f5jQf? F2332 ,, ..A,.2f , 9i7f?fg 32521 H 'z 2 -gggigy -' 42.2523 - - , -, .sys W2 - - eww kgs-2 e A wail. 2A--M., - MM, 2: .F2 fem- .,,:- is ,. ., ,fw- .fw--2N,. ,1.2,,M2 E. W. ,-.H new , .. M , ,..2,.,s mm- W.. .. .: -mee? 12255 in .. 52521231 gf m e 1s2215i71fv'e?.H Yifa. 52 'S152 5.252211 3'?s2?lf- ,.f22i 22212 : . -:i A2 121225 JDE We 2 s,,. ,L T35 ' 2422s,.Q,,2,,f22,fe212e 25 ls- -s2s,2w2--if .2112-w.22-22s -..s,f222 m.qg:e:-1 fe, f.. 2f,:: .,, A ?'f2f1?Hr' if.2iiw g ?feIi!?4:?:f22 25fe?s22gMXsf24f22a:ei-2' Q4Q25fswfs2,'sf 5: if 1 Li, nefEffaw2e s:eggmyQ2g25,f'M--'92 ' fx fQ5512Q2.s22gf22 2 25 '21 l - S2312 ' , f22?i22:'2.?,' 25y5g1?2s-'r1,,ga,.-,,,fz7 -,fiffeiifv :S f 2- 2, 4 - w.-H222-2-21g 2 efw2,. 2 : .. . 2 ,fw,,,gZ,. iw., ., 2- ,. - N . .. . ,- -,S 5555, 2 :c,:-V 2 J '222'.22,'Pz,??25j,gQ,'fzi , x .2 . T - 12-2-..22'f2 K ,. 2-521222 '21-2 . ., J , Siif'3YS?T?572i?sV1f:f?i??52'fff'Yx,.?J:2Y27x2S' T'W351f3'asLS+iAfW2:aS 'E :iEV42i'Wzar:2-41'2'i NH?Z'SF12'i2fsr1'!'-2i':ias1Aw2s:L?24WI22V ggaieeeeeeeie i gfaeflsifsii SSQQQAQEQFQ2 ?2w1?szsi:ef2gas?1ff s2eggeQ.e2..2s22P2.eM2 -fm22m.2fg23, emw!e2s2 -- mSe:e2.a 2e'2m21swe3ee 2w.Q,,2Qv2g2 9222159 45192255 :,,,g19 . ,,e525f- 5,55-2 A . -' 52fas,g22e2' 2 We g,iaL1i 1f92:2f2. ksfefl 5221235 122252 e2vf2s2 22,1-1 2 22,12 ew w Am-fe --A2: Jes me 22 f .:,,, .. ef:-QQ -N. 1--f2-12622 .-if use 5 V :,.21..:2. me .fs ,::.,-' 5.-gif swf 2- 1: 155225 -. ifEzfi222i ' X122 ' A255523 -- -:E , ' -ii 5135- -' ' A .' -- V-2 A Q ,132 . -.J ,f Qi JW- me .M22 fs24?2fz - - ,. A - , ' M , 2.- 12 AMWQQ J . ., 52 22 fffffblfe 31 2 2 . USK.. .. we -2 1-'v f f' 4 Y-2m1s wa .i24W2 , , - W 2- sm , f'2 is Q2.-21-2 34.52.2152 -W: La -: , ?ilH.S5?F?:'f52fNE': fs- 2- Q, :siw2 f:i5sZ?'e'Q5 - izwiw? f:wzMfW'w2 21, sw sv . me 2:-V f Am ww M M.ef,3,1s2-.22. -- 2e?iR5'?si'5egQ snail M5452 e1i2A2 f2fgprgf2e255e2geg JQ21i.j2f.eA-V, . - V-M Aff ' 'V' 3 5 -,,-H-ni..'2 Qs 732.3-0, 2: fs2fsr2x2Q- F .. -P3'2:saL.w2yl'iI W we 5 em ie-,2XfG22w mfisgk -seliew Le: 1 -1-L31 2225--1322 se2,2fP2e fp2 H. ggggwr mgsgggag ggeisfx A521225 , Kei gs25222g32Q52 1r221fe2. .. - ' .r- . A... lie-w 2 .F A 2 . sseglgwl vfes-V571 ,Q i- : .?i22f'sz4f b r sgigg. .. - iw . . -:Er lieu? 25fQ2?fg!E12 g2:: ?f 2wwf2: f3,. f:g?fge.: 2 ..2,gi2gg2,.e2gyg :E-smvr we ..2g2g1.1,-, ..2,,, 1is:s2f212-f sgg:ew:f..,:, w21s22gf2fgfg 5- regal gg:gg,ee?i L52gg,.fv 4Wgfs2'152,: 2-32253 , , 22 ,I 1 J 2- - . 2:2223 -e i ,,2w-2522221321522 y2,2,.fe..2,2Q,2,2J. . . Roxy Killingsworlh K enny King Judilh Kinglon John Kinkaid Jane Kinney Becky Kinsey Marion Kiper Tom Kircher Scoll Kirk ichard Kiser Beniamin Klei Marcia Klopp Don Knarl J udy Knight Roberl Koch T ina Koenig 2 N22 2 ,2 51? ,M K 3 . ,,,.., es., ., M- 2.f2.s,.s,23 3 , S mm? s i2 - fe. 5- 'i.s22s2f2 f'3Q5'1E1esfw wuz, 1:2 max 'szsr':sv'wr ., S.,,.,,. . re A ,.s, A- ia2:eg:214eiQ:22 1159552 .eM,e2ff f J ' hm. N, X, .. .A,' 'fffkll ,,r .,, .,.-23. .. M735 2f,,1seg.s, 2.35m e,,g,3.2L, , gg 22222 -,, M5252 , 2..2,ffgg2:, 1 2-H22--2? gf ::f2. - mf,.w,1kg 2Q,f.g72: , 152152252122 - .2,.2.e, ,V 2.e,.w,.s, 22 2-2 - .e.52ff2,e,.s , - H21-2: 2 ., ' 2.-2,.2,. e,fS,.s,,2w25,, s2..2,e.22, W2 . -2 12.2, . .5 -2 wig, -4e22 .:.Q5i2 s 3 A, .Xi Sams E Y 'fi as r' 1 H Q was s E 5 .ew V? E ae 3 .7 S ,ls S we Q X z E my ., , 3 . S .. . ,. ,.-- . ..,2 M , . A 2f-, . :ffm2s2se2g2ffgs1f, W22'2w,,'is7f2u222, i2gf2geig22g ' ' 1292122422 222'2gagfe7 132234, 52,552.72 2 w22,1f2?? ,Q 22:L.:,, 453,542 ' M-2322322 22.52522 25,-.efw - new fig, ss2Qezgy2f , gyfgggggsf .. .2 23,25 W Q 2,2211 7252 212g ,Q2,2s22' zaiws 224:22 ,.:2:2fs2 H 2522. ...t w 1 5.25. -, ,,, -2 .. , , YW 1 42225-W sw '::2g5:2:2 ' - '22-29: -2 W' 25312 9231 22gs2 i 52if2EZ2i 12:93 2 Q2 -: 12 ,,.f, ,2g,,,, , :ai 3522 'fiw l 2' 4.22542 52.12.1229 w2,5iilE2L'2. .ss2gg224s22f2,'.s 9219! 2?ffii:2Y:2ir2f7L 5.22 2 -22,5 ,, .2,. 22 s22g22:e2f7 2ff,2f:2f:2'feff ll 2255222 QsS2:is2 y2 2 P2 .- 422.52122 , M2 5.5 22' X151 ' 2 2 2- 'f'2'f 12wfw2 2-gm: -2-4 :22'22f:2u- if 25 .. 7, ,- l so , ,Q 2 5. , 3, , ki, .... ,2 1, ,2 , , 42, f222f-22fvm-2s-fw23gmg2,:w:atv im, ,2 -2 , 2, 2,1 . .22,,W2i.22.22,2fQ2223222.,-,5.s,., , ., , .,.e2.g2.e2rQg .MW ,,., . ,, . ., .,5,m.m ll me -2 my Q ' - n fl. 'iii' ' Ronnie Kokol Suzin Konralh J eff Koons Sleven Komm mg 2, .J V 5 2. z ,F 5' an W 9, z,,,.2 2 e X we M Q S ? 2, Q ,Q f me -if 123- ' f22e2: ii 2 WA . JV ,J ,.e2. .sM2 . siidftif . .-i ., a2QiQ,1:22e?f5 ,gif 2315 is 51.1 ss 2 -- m,.,.e gmei Wleiff 57557122 ey .l egeieeg 55 2 V3' V 'AW ' ' izigeifk , S Ragga X 5 , 3, W 5' 3 is S 1 Q 5 if KS ya E Q a be fi We ef mfg i 3 S R Ei' 935 1. ig 51 A 5 2Lw2em ,, new ai. U,,L ,, , v,,,, L2-4 2 nsfwifigg --2.4 . -a. .,.. X . Q., do e Eb 1 I-1 l ,J i .4 sf 4 , 5 if? 2 2 2 , I , I as Q re if 1 Q , 12 Q 2 ei S we we 1., LQ,.n Us . 22 Conn: Kosky Sdndl Krdlher Angelina Kfdlflpel . ww: A I Am 2:3-'waxy A, few, 12-2-.l - 2.2 ..::: U99 'W K UmP9l sf 2522 254224 j1:3.e:::g 3,32 Sleve Kralzer . levrle Krerer '-- ,,' , Kerry Kreulz Terena Kring .jg ,L 5. ,.,,.., .V 2 r,,.,,.. 2 .U ,, v,v. . K. 2,4 ,Q ,f , X J Q, 23,5 J' 'W e,,,2. 12,22 2: 9 f 2 mswem2.m2,'-2229 v'A-v' 122452 22215215 fffw 2 22m 21,1251 .2 ge, 552322142 251 gags 2 523 254 ,Lf -Q we ,, 2 .822 ge .32 25222-22 W i ' ' . ' 11s ef 2, we. . .- 5422.2 5 . . Lge: 5 , fgii.5?E2?E'5Ei?ie2' 9 'i Q???4f?2if,i?'ia 224512 1s,.e2-- - 2w sQ1etisg2efsf 2525226 ., vfS2sm:2 5955325' eg' : L A ,eiiiiif 'misfgieif . ?i- 5f?,53f'5a W . .r22,,Qr2fi2 WQQ222, 21 Lf2s,22,. ,sw -1-,Q2 ,iw sry.. z .. 1 ,2 ,.- , ,-,., V, -- weiifzv wifi f- 2?lv2ss21f2e-rear.,-m fs emwe v.. . 2 :w2s22fs2,. E. 2 22s,fQ.f2 9 M . , 4P:a3ii22f22- H1529 M1125 'SV T 2if2s55,i5liP 323 ' ' 'ef 'u fJ2f2,'e,122 2-Sri'-21 f7Ei4Q,'5T2'?2fiLlST 2 5' x v'-Exif ififfim Jia 5 'JC' -22,2':f:,awswfw2Q gfew :ea :eff - :.-Ef t' i galwfsf. 5 3'- K -- ng?-,QAM zww , , M- M. . EE-Q2 ,,. .- PM JSMQM waexzerswkswf. H225 ,,.1.am, .,,.., .,, me-Q Q ,M ,,k:, .,,A,,.,: ,Lx A,,,A,,. e ,, . .s2,5f22,fi,.s2 2, f-,:g, i-- f 2: 1,12 2 22 w:,,.sQ.2w2.m2 421215 5, 2 3, ,,f2ff5, ' 2 11 22,-iff -. 2- , gss2.f2f:ess2gi2LQlfl ff - ::- ' 5f2s7i5EL?232js2g,Ugg 2 2222222 2f.21s2ggsgg,..2 veggie. ' :', . g . ' ' ' .1 2:1 .. . 517:75 iii? H - '3E:!'C'52::f a:s4 2 , J. : urs f 5 si1f22f'fs2iff2-f:5,,'121il'. f,.2222'5, 2 , ' 172 , 511 ' ' '?ffi5?5iE-52'fQ2-355153292 2'zl57rs2i!?71?5f2 ,- - S, 2 2' 2, -fl, we . gw2g2w2g2g,2g,,. 55. , 25-g f-ng? 2 .,:g422,1f2s2.22. ,fu 1filP'2s:e25a??:2,'222., 'fl- file - 2,Z.22g!if:u22e 22,2'fi2TS?:?1 ne, is 'M - ' is ?1afLf22'Pffs,4e Aiisiffiafi ffeeiikggf- '2ffUfi, 2 in s222?.aLe egffs S222 222372421,ii,g,2e2zz:2af:223?i,e:sz fa. 221feif1f?sMfkii7S42ii?ge?f?35?fe2zs2?2si We r.., ,.,. , A ,,, W, 1225x252 212 2 iffy 2 ' . , mmf. s:feg5.e2i e,, ...ul esfm . .f.,,.e, f2,gf,g2,, ,2. 22 e25wggh, Qgimf 2g5gQ2.S2J2's225 ' :Ji 2 2:1'T2fvixSQs555fG ia,l52if -2:1 , 2' Q2ii'f'f2fJ 1aE,.. '2-12. 452521525 -2:2 2 ,ff2:z1susf:i22im fag. 2?f:.f222s22g2 , 1153552l?i''WWWi?fiiEQ?l21f2S3T!i2:3:6'I . i??aE?:5i ' i5E?5fLfii2 . . ?iPi,'?,' - l. bS752E.Ti 2, '1i,:. m,,2.,- . - . -- i2gssi3fQ . 2, , If r-vallsg. 25564-2 5, 2,f'2s Hwriii' 2 VTX ,,: .5 . 2 24ws52f22?gf 2. mZ?',:f2 . .. w2,.,,,,f., 22.-He, 2.2w,22f2,r '2 21s?ff5?3Z4f21.5Sg?E2ffl 2 3531122 ' 1 !' ' - 'v w fi, if.2,Ql 1! 5' 12,1 2, ,-,Y f -Cyl ' W 2, 22, .. 2. sgresw: 5 ,ffm ., 2-:A f if :2 - gsgfeisf ' 92..-252 l2'g2 2 :.,,,2fe, 1 2- '- Aziiesff if22-- f- nl - :si24f.2r 222 ' -f 1 5iQE?if51 2fP2 .2ii5i5 f ffl' :55532'5f'z 55157755 . '- 22212222 25512222 We-2 .55 ew '22222 . - 1 2 Jaw . 2:15. r Debi Jackson Ginger Jackson Jim Jackson Mary Ann Jackson Jay Jarrall Jacqueline Jason Laura Jenkins Chuck Jepson Jema Jewell Dave Jirschele Debbie Jirschele Arlhur Joachim Susan Joachim Bruce Johanningmeier Ande Johnson Carl Johnson Carolyn Johnson John Johnson leola Johnson Mary Johnson Roberla Johnson Dianna Jolly Bob Jones Debbie Jones Michael Jones Pam Jones Palrick Jones Todd Jones Colleen Jordan Nanci Jordan Tom Jordan Darrell Jorgenson Karen Jorgensen Donna Joyner Diane Judge Pally Kabella Karen Kaigh Kalhleen Kalman David Kapley Pam Karp Mike Kee Millard Keith Kevin Kelly Mark Kelly James Kellon Debbie Kemp Charles Kennedy Karen Kessler :gf--eege-.. .f:1eV--VF.., .F-e-1sezs- .. Q v.L, ,. L. ., V .,Q.X.?g..,.--VVV.,--V. . M-....-Q . . . Y., . . 2 SV -:g1f' .., gs E5g?ggi8F21 5V1V'i fi - 5 3 X V X. We li- - Q - - P 5 fy ca J 1 - V Q 4 P SN A in .. . .Essex 3 91 --.S-.-- ...ie H Phil Krueger Bob Kuhn Michael Kunzmann Alfie Labor John Lacagnina Bob Lacey Holly Locock Tom Lacoss Nancy Lahmann Michelle Lamb Sleve Lamb Dennis Landry Mike Lane Tim Laos Marc Lappiif Vickie Larrabee Gay Larson John Larson Randy Larson Ken Lasler Maurine Laler Brenda Lawhead Debbie Leal Debora Ledbeller Jennie Lee Roger Lee Sally Lefko Helen Leopardi Peggy Levandowski Jennie Lewis Linda Lewis Mike Lewis Us .. X V A X X , , .. V. S of -L w.Vwv1aV-.r-VV-- f - . -V 5 - 1.13-L--,-V1 M- -V . - . V. . gf- 2 5 cf-Q--1 -.figs---1--m.V..,q,g VVa V--if V- 1 - - - - ,Msg S .- -- -V---V-Vw -1--. of -wgz-fw -z..-V .. ,. M111 .-- V- -V-ig L--.Q .-sfik-V1-V .. ef.-V:-ik,-V V..VV,-f .1 -2-1--V-- V- , gf-1. V--5 , si.. , V. - -f m' A-Vw is-vzrw :V , 11-5,1 .-H-gVH VV:-1 - .w ::m:22--.. Vvgsf-Sw 'QW-f V -- - -fs-1- .V- .,- -. VV .. . . - , if Vw . vw ef. VV- ' Vw--V1-, - V.-we -. , -1...-V :. ---we .--S--V -V-XV--V-., ,.-- -- . 1. .- . --.V- , 4 - 1.-g :'5,..faV ., ..--.- 1-QM-VV ---.ff S ww- . V V- In--.. ., .Q-Vp ...MV .- V ,.V--1 rn.. --....-,. Ve SVVVV V.: V VSV V. - -..- -: -..V -sag-g ..V,,,., ..- -.c . c -Vw .VS W, gm. .---,,.V--if S-I-. -.f-ffV..q- ,-. -:, -- Vs. '25, - ---V .eg ..fg-VV--1 .1--.. ,-- me -Q Ve. ,V-1. f ,A --V-I2fs-1-.Vi- we-.1--Vrf es -w-1V-.wVe-,.-- --. -- -we- -S -V V 1-zz as .. -.V-V-11 .IV-.V --Vs V -4- - . .. ' -.V--V. . ss-.T .3-fsx A-Q. Vg. .1 9 .es-VM V.Hi.s: VV--1 ,. , V- as .-VV-. vie w - ww- - 1- -.V,,- VV - -- .A V .ms ,V1 -- --, A v V. - A - V- , w V- .,.1Q. V V. -V--1. .S .. . fe , ,, M ,. -. .. .. . . . . . . . . ,. . --wg.-,mf-V V--V---VV --sg, ,.w.-.- . -.1-M.,-.. -, .. , ,, V. ,yi . A 5, .WN . -V V-.-,-. V832 fgz1s,1LgjfL- ... fa' .-2--M-iii ffm-fzlsifieiIV:-'12-TL-sf '--V was S -V-?g1Va' - ,.- -mf J.. -, -V.. --ali k,k,,E.S.Ls,W? A 5. ...ww ,Q:..fS.k,m M., ,. - . S., , .L , -K.. ,s -- ., .. . . ..,. .- .--e::s.rgvg5--, i.,,.,km, W.. ....S.,..l,...,.c,.L. L. ke, , , , 1 . V , ,. -- :gg .. - .--.V V-f , - . .. -Q--.-we.--ri ...W-. -V1,-if -pry---.V ,.,--...--V...-.V---We - ,V .V ,. ,. -- V-VV., ., - -V-.V--: -. , -..-.---.V --V.:,. aw, - .-.-21. V ' .. of--g -2 --235223 --.V,-ggfsiff-11, -, A . --.V--V.. --V.-V .. ...V -- ,-ag.-. VV -i ' - --.1-VV - ' Ve:-5.185-2 f--Q.- . . wc-S-:V V.--Eg -,--.V. .yn---.V-Vr.V, .V f V g-.fig -, V ..-1,1 I .Qc-kg-V Vf -,-.- - - Q. V- f-gf.-1-f -- .Ve-is-e-915 ,ssc-fi - ge- S- -ag..--1 V-Q--.1..Vp11f f eu, -- 1- -L-SV. ., V --if -H' ai 'L - -2 - .- 'iii iagw-74 . J Q '--.Z Ek Q - Q ilifz -' ' iii'-. ff-'1 1 . -: ' ge- JV-V. V- 3 '- f 4 ig. - V- .2 VV- V 'V - - 2:-. - , Vs . . 'f f751ffg,1fmgi-- if - - ii M Q ---VV--3 .5 1,1 .V .- --135.-V-.V -V--.V .Vi-----is-V-..V fV1ir.e-.Q V--.V.fvv.--mr--V V-wesfgffv-.1--V q , . .. .V .., , ..., -r,. . N..- .V V --- S S 5 s-V V,.1'm -9-V -- 2'.wz.r..w- :e S .Q V- .f3.1 -3 iw- -ms-YV 5--'15 11' -- 3 , ,,.. ,. ...,.r L,,L .G-V-.,.--.,... S Q . . .-...V-...V .. - V --V 1-Q. - --cs Q-2.---,W 1 P -. - - 1- .V--f --.r1g.--w be - - 2 . - -- S , V Xi. - .. 4.5, :a,g-V.--E. --.V L ---wm-2-V-- -f--H-, -1 9 - -V., ff ----4 ,., .,.. .,. ., . ,. , . . Nl- Q,-, .,,.,, .. . , .,. . .,.., .. .. e Q..-V - . V. - ..-.---.-- .. ,. , 1. x fi wh - - V, '1 5 'i 1. 5:53559 S2 X - W 1 H Sei- - '. . 'tai lb,-J : . -' ' ' FZ N gsfw. -- S A ' - I-'Q-ef-1 - - ' w --'V--Q -if--f Vz,-V.-- 3. --' V' .. 1-3.---xggfw--V.s-1 sie- -.- 12-Ver,-25 i-s-2:Sve-.y i12 .c-- --V 5 V.-ss.fg.a V.:--V5-V .--.-i--ve..::,aa .V --Q-.5-Si -'Q--'1--3 Het VV-1-Vai. -'ii V-T.--T 1 .-1,--i. wsgfw- ve- V -Vfgi-- -:VY - -. V- LNSQX1 5.5-1.-slsgrl, 571 1:- ,uvssffi-,s41, :g.: -:-: :: - .- ' .2 ',--:1, 'V ' i.:V.e5-ff V ,L - 'V , 'f gm.,-K, : , : 5. neg. , 1 V .--QKBZSVQE1--92-f-z.g Q -2 V V -- Vf .V ., --1--VV - gffifgw- f- - V e S - 'H .-- W. --'HV 1 g.c-.-'lx eefi- F ,. V 4' - . 3-V, - V- -Ve----w.V--VV'.1--V.-,...--.W .1-3, Vie -. - V :. -1 . .-f-3-K -- VV: ., 4,-, r..,r . e,s. r..,, . ... K,.,, . . , .V y- wg, --V , - . -Q- .cqfafe V- . 545--.-.-VV-f -..VV-fm --2:-3:5--fs-mi ' A K 4 ' 1 . K Q0 -T--L, L-,V-411:52 Qin - .fs-V.-l..M-Ve-.---V..--.-..--.S -ff- -V ,,. .r--f.. -- .:-. -:.. .-VL.: .-,.. 2 ., s,-.5-beef'-gc-gg .KVM--1 . --2-.ftQi'2,.. ...,..--3,-. 5-1 .W VVV..f--Leu., .A--In 5 A he-.5-f Q--V-.N ., HV- - Lis'--1 .5-my , W f fmt 6 D9 5 S S 2 'bers' S:fe1-333-3 fi--gr--iifzcagw , 1-ji--ii .. .V iz K X - M, sf S .wfssa2-m.-s- Vs -' ' wv1f2V.w-'H - 1'-1--ea.--V W - s 1 iV-V - 1' 2 - 'V-Qeweze L.. --,.- .,.. V S . , W T ...ee ..- -V Vi -. X f so 93 .Q-ef...-V . kbk, .--V . ..,: . --.. f-.. - 3 ..r,.. -V W.. .. V. ,. . ...S . . , V 1-if-253215 QW-1-1 if V --.V--f fb . V11-we G tiiew , . S. ,.., .S .. .. .. , .. V. ,.., .. ..., .. N... . ., .l-.. M, . X 81---fossil an S 2 f.-fV.V--Vv1.- .. -SQQ--V5-Qi , Q 'Vw ' -, S ,-ss,gtgy,aVlE:-.,-- -1 S - 2 .Vs--V.---Q .x-. ff ..--V S Q : V3- .- V-1--V g Vu - -: ,..-ng we-4,1 V -V 2. -4 -.Vr..V ..-1-F - K S -2. -Sei., YV-Skiiiffili 3. .25 , , f :. -.u2'i 7.5 ' '- e -559' .SSVQ-Si-1' - . , ' ,W . .. zz- Vg g,5:,., ,U ., ---1 , M 7:55. A v K 519, -4. M, .V .V-. S ffl V-V--S: -f -1- .- V- E .- .V- -gf ss? 5 - : . V 19- S 2:1 5 isaigseic-1535-lzg.Vf-,.. 1-3.522211-621:-.V- VV--iff VW 47.3, I, -5 VV. ,Q--3 -.r--m-f,,f-fS-- .sm is-15-2 .f .f--megs uw..-V .--.Vg-,.U- ,,-eg..--5 gf-mf, V-2.15-ag V- V1 -V .,.. ke.. gqgygggi.-e es:--we-.VV V---2 ig!-igfggfgfieiis--5 gig-3:2515 --'VL-L7 W -fqilfie-52-QSPEWV.-15211 1-1-VL -- :S W .-biig-W 2: ,V .11 QV.-'i-ss --V-Si V'e-feiwfs .ws-V112-V5 -rw-V1-S1-VM--e V- ,V Va-es-Q .5515-,-Vw f-QT.-V ,. - ' - V--1.--Pu V..r-- .. . ----5 : - -V ...V..X..ee-V. - .... . ..., V ..S--- .V ..,. .. L. .,.. ,...... , .. .,, .... Q , ....,.,-. .... . . 5- , . .,., ,.,.. X.. .... ., ,, .... 1 . .k,,. , .. . ..,.. , ..L. . .. ,., ,.., . . -.. f 2v1w-Ei5wWgs-i1-- Q-qw 8 vifvi ..-, - V F? 'W' VS--ig ' 2 'W V. v V .. 5'-'N P-1 -' , - --.5 ... . ,,--,,.- - -- -- -.-- - -fff V -- ,.-. V ' 1-1 WS 4-gg:-Eezseflge-5-fzaiirwv1--wi,-...H-5. Q S 3-.Q--.V -V.- iwzefwlsiargzf' .--eg..-Vceieiwig--V.-Q-ms.--is-.ce-if S c-,m..-.-V..----V--...ew-,.,V,... ., f V --V WV--V-sasrgifgezgs-Q 3 V - -'S is 5-in 2-SW ,QV -'fe VV 'life-5414-5'x:v ,M -V as V--V z-VV-ytgg--usff 1.1e:wE,L: mgiifesig-VV. 2 zgsergssz'.i,s:515::- V , . A-7 Zife-ELQS-W? f : V , . My lsisykw-,..vZVf KSN-:2Lrf'7iS? ' limi? ffsxf' -.sim -.Q 4' awww- ef-fu -V1-M-QV-Q--V -MV-2.--V, elenww.-Q-V - ,V 551---VM-es-2 its-M-W-si V-253-S'-5 geiigwf - 2-She V.--.-...S -Ve:.V.i,.-- V- 351mg-E-Ve. 5 --2i:S-?efw f--SP.gS'?i-- mgfe- ge-525,54 . if M , new -Q . . M5511 15-51: 'I 'V-? V ' . 'LSE iilsff-ii. '7IZ3r--- ,Vwv-5553? 1' 'Lil ' ' 15558 fkifffii -I: :- 45 SWS! 5161 5153 i 'xi .. 59511 -532 - Rfiw gm -L.. E 3.--gg, K eo--w , 3 QW. 5-W -ff , V eq.-M QQ... V egg -.es ...- 5 ' we -- e .V ' :rf-I ,. ' ri -w if-zafgw :ra :N A 1 E! Vvgsevfl' 'gg-. QTL-HLLAQSVL ' 1.5-L Q- ,peg guy 32 ' :TV :iezws V ,, ,,-:g, -2.3 ur -5 .sw -V 3 rea- w 'QQ '-, -V - H5 L H ,Sw fe 1 - -S - ' '- ----i es-3 Q-Q iaii-fag: ic Se- ww: 23. ,Q-'55 j. f' .-eff 3,5 . 5 -. ...W-1-V., f H.. Jn -:-: 3 .rs VV--f --me 2Vr,V--w-SV- au- -- w, - Q - :VV --w-m21s ,. - VWVM-QV-V .....s.c-Vu NW .ms-,E .. -. - :- fe w-.EV . . lr Ve ,. , .. .Q wc.. WV-msaf, - sea 1 . m.s..f,.,, -E-L.:--w.m .- F-en ... Q S- ,M-.is-..m. .5-, .. -Sw -we -VV L---gfe2-r.- ... Q V W.. --Q-..5-M...-1? - . . ,Ve,fufe- .. V-. 3.5.5, --,..,-.-35 m.,-Q, W W. ms T.. new-. -VN --VV -1-see-s eas,-S -MV fe.. - V-V.. .--5 - W.-Y. A---V-we --.ewes -3. ' . -V-sei' - 3.211 wf5HV1 V,,-V5-eiime rl- V1--L. ,S-M22-w-ies' Wzfk--wwf 515- V' lwiiffeiie '25 -VV-ew ., VV.-V, , - . ere ffm-'3?K'f . ':- 'cw 1-2 :-A, 'L-V -sf Awe-5 ..u-Sm.--wer' . V fc- V--f 1' A VVV 1 '- - is-VQESQQ1 Vai: . -- 'Y' 1s '- . V :. . -if -wg,--,q,.W L , -is... V -g... ees-VV----V1-As-.wrV----V-f.--fV--- -W---fy.: ww ggi F V.-A --.- V:-V-se if --VfV.e-:MQVV ,.wVwg,-V K .-2.1 VV 1.-QV. V5-cv Ve - - :V-': -ire .V Q15-1--ew.-..- 1--fr L -V Q -V-Ly .4VV.,,. sf-1 -- Va-ip s.. ..-V- -..-Vs--- A-'sr . e 3 S y 4, - ' lf iersiilgg 1325814 ::'.i5f'j:L . ' .,, . ' 5 V. .ie--if5' '13 , s,,, L 3 H. 2 V Ni l c ...W .. 9 L. ,,., .. . V Hai ex , . - tw: xiii ' 7 ffl If 33 .gs V . - .- -fgifi' eff? K ff 'fl ii-I ., . VV V. if ' -Va- .i . r. . ' 1 ' 5' ans. V-,.- ' 11-55 Q A X 'Ex .i- . V: 4391 i. . , ,ig megafxif , 1-.Gif ?- V -V---.-5 1 Fre h Scoli Lewis Joey Lien Wendy Lienhari Darcy Lieser Candy Lilley Ron Lindsay Sleve Lipari Deirdre Lise: Debbie Livingsfon David Loeke Rick Lockwood Mike Loflis Gary Lombardo Gary Long Robert Longoni Vicki Looper Francisco Lopez Sleve Lopez Terry Loudermilk DeWalt Love Alan Lowe Bill Luce Albert Luian Linda Luiz Belh Lynch Kalhy Lynge David Lyons Sherri Macfariand Belh Mach Mary Mader Cynlhia Maeser Bill Magness Jerry Maldonado David Mallick Don Mangham Vicki Mann Deby Manlecon Mari Manlecon Sally Mapes Ralph Marble Kalhy Marcanlonio Tony Marconalo Daniel Marino Doug Mark Robin Marmon Michael Marsh Glenn Marshall Janice Marshall m3l1 Freshman elections were held on November 1. Bruce Stone and Cathy Cox took advantage of their opportunity to elect class leaders. Iss ? ? Q e fw gxs fe Q 3 e 2 Q - Q 4 Q 3 W . ..v.,. Q 2 ,, V Q PM 3 Sf is .fi 'i Y T YJ, ,,,H.:a ii, ' W rg me f, We gg 2:5 re .W iii eff t, W K -. , . ex V fi Q X. w5,::.1,f:5:,Jf2 L e P . QHEZSTE effgtfulieeivfg Q n e 5 -If? Q Q if el r,ff2'fIi mif1.,-QP Q 5 t ,eaiwgfiw X lwl i figeeigg Q , , - ,,f,,,,5' Q , ,W,q,m,g -- -. wzmew Q Q 2 Q f' 'M Aw, e fe f f22m,:g wage . N e 2 2 .. . 2 ,, ge? M eg re-We Q 8.4 e K Q . - o fthe ' ' ? K t .3 2 feigpgge . aegis T if iw lee? - f e? 2 8 V 'fifef 52 w Q QW few 2 4, . 1r:5,:?: -.V :vac Sy at ' fray, Q mtg .. at RK M, R 2122, Pl' w-.2:- . Qlmffff ui gee M. P M fe Q 1 Y f ,, .. fzffwzf f 'frm .M :ei lf, 14' ., Q -v. we If :f feffewffsz Effie, f,-g'fQ,ga:f ' - af 2 1- get Q ' : Zgrsrw. . me Is,-'fi' 2 'Q -141' li - ,,'f'i9ffWf ' tiff' .3 JEWV' ' ': KF -3 f, ' M 'Af - 'f flsiiifs, nl. fi , -, Ei ' 55thHf'i'S ie-if-R.: 'f':f,g - , - - ' f - ef 1' W ,sffsv:ffM s:9we db'-:f we 7 i , - - : '2 . T fws,5rfg?w,'1 :2:. Nigel 1se'SJfs9 :f f a ,:gm54 - vfsrfffqg - e, fy - ,ff ts' I-,:5,-ifiwrfr 2 7g,11 e,ef:5v!f7fef -fsfp-.efg,fQ5fe 2: '- ta' .hi J, , , - ,, ftQ,eg:ff,y . .gf eg, , Q K-,ef -V 2-,ggf-, .ey ,W g fff, J 'w:,,f:g- t . tn f Je J f T -g'f:s 'f i :Q,,ff:ae zlfwfsf if . S Wag. T. fs,m 2 fsw ' Y -on - 2,15 15 ,ih- zf,-fffff-zgff 11' ' . e f o ., Q it ,Q 7 15 el -19+ V af- 'fs I ', g x an H T f 5 , : e ., 5, if ' W . pf - ft V , . ,. 14 Q ee P ns' e :Wy at Q 25 T ,, f t ' - f f X R Q ,ef 5 it 1' 15 ii .- -ff T if Q W if 4 -,'.' J M ff iff if flu T ' 'Q , ,..,, ,,,.. ,..,, , . .... f . In iffff ' V - , We , ' ' 5' ' , . 'E' , , M f, B: 1,e,5u,X 'L ' A I - -' S P- H ollo -' 'R R , , T -i'fe'J f ' 'L ,F L fi- ' 1 ' X 'Iii 37 2:5 -' f .f ' K V f'3 :iQE?' ,. -, ,RL- L '-,g iL ' ' 4p?fi5?' 1 ' t h '- j -.1 'A , RQ 5 R eij'eQ1 ii5t .L'gf'g'ii'4?if3fe15?'rkHi ' , A K . Q 'Y-3177? ef 0 9 N ' T p , ' 1 . M- MW- ,B W, M, sr W H 'fl Mft .P , e . -va., H ,V . -. . -at Ne' 4 S si iwefffsl wffifff. L 9 fhnrae er . Fifa, .s 3 '- : Z ' - L -' ,,,, a 'A , ' , .ff -,- ff if ,I 17 ' 1 ' 3'9 'uf V ' - 51 '- we -. U lf f if f J I 'W f 'iy:,i y-, 3 HW Q ' if' -31 Z ii 1 5' ' 5 ' ' ' .. ' ' 9' V' T 'V ' , .. 53 'Nt' - l st 2 L 1 22313. fx I K: fme we ,, pg W .i.iQeg,gi,io jg in gr , sg ,M ,, . V V 'Je iff 321: f 'moz X fe ii tw- mfs 4 ' We-. H? Q' wr v Q N' 1. 1 ff 5 F ' 9? 7 We 5 at Y 1 , .... 1... gf? ra Lyz Marshall Andy Martin Art Martin Arthur Martin Debby Martin Keith Martin Tom Martin Kathy Massey Ralph Matthews Randy Mauldin Debbie Mauler Richard Mauntel Curtis Maxey Kenny Maxey Steve Maxey Paul Maynard Jim McCallum Rob McCann Will McCann Dione McCarty Thomas McClelland David McClintock Cheryl McCloskey Carlla McCulley Beth McClure Arlene McDowell Brad McFarland Tim McGinley Mark McGovern Mike McGovern Susan Mclntyre Rudy McKenzie Mollie McLane Phyllis McLeod Kathy McMullen Randy McNeal Collette McPherson Sharon Meade Don Mendenhall Ann Merritt Marilee Meserre Dean Metcalf Dorothy Metzger Sue Meysenburg Ann Michaels Linda Miley Thomas Millage Bambi Miller 279 Bruce Miller Dennis Miller Frank Miller Libby Miller Linda Miller Marc Miller Mike Miller Patty Miller Susan Miller Theron Miller Elizabeth Mills Greg Mills Donna Minella Louis Mindes Kenneth Minnich Ronnie Minnich Charles Mitchell Gary Moeller Kim Moffett Mary Molina Terry Mongeon Beth Monier Mike Monka Robert Montano Debbie Mooney David Moore Garry Moore Jerry Moore Kay Moore Linda Moore Mary Moore Pat Moore - L12 1 fe?-33-3-3522532-3f.3f-.3?-3.fm-3 2-32 'G we' . sm . at -3 me .Q-TirE?fS?iw - -1211-5231-3332 3, ...M . ,. Ww- 2565-i2.',i:5s-i3'. . 3-lfef-N 'elf-Q1 23.33 .. I-33.6 L?2w,S?f 5555-55 9533.52 if . 3313: QW- ..,g:..3.3g.,5. .Wa . 3 . SX 'S Q if ee - 'elf-fi--5.15 wmv -3'femzNe53'g,f-s3x3q51sff.fHw31s3 wang he verge .33-f 3-3. - -5322 pie .., EE' ' YHETQY 3. . V-,:,. 6353? .- 3 f- 35555 . 3 1- :,. M-ii.ZTgQi.?f5i 232' - '?' ew. 'it h 333 Pile e-3 A312125 552 we pe- ' f--1. E fe 33 Q 63:3 3 33 .3 3. ik 1 , .,... . ? ' -5. - if .3 me Q 3 2. 1 ,ge 3 P l rf , S-3 ??s5'1'T9ii1P2?. f' 3 ' .- .-- -fel? W33-,,f ZW: Q32 M2 3 F i 3 .3 2 is Q .- 2152 W' K 33-233 -Y 5. ' Z ,.3333.3v.eQ 5 3. 5 3 5 -33,3 3 e Y N' 2 3 .5 3- Q 33 ZW tt by fe? ave... 3 'D Q 3 :vw iam. fawh--1.3. 5w5.ewt Q Q3-3: - 1-f,...3333--2-133, 2235 . -fa. . ll 1 .- li- est fi 295325533 M2155 . Zig..-is 33.3. . QR -L ?:,---33 .3 .333 3 - 3 ew-V ....3.3,,.. 3,6M5A,3N53.m .51 3,252-3,515 3... .V it ' Q23 3. .L JW ., . , . he: .MNH - , 331s3g13,,-::fe.3:5 ff,55,'f..-M ,3. .3 .., r,.. ..,-..,,...e-3. . 33 33. 3 ,,A, 33... .. .. 1. -3.3-3--323 3.4.3.-e 4 A 3.-WM ' 7 .3,f3if2f3. . 3-M.. iaiiifw QQS133 WP., ..,, .,. :BQ 3., ww ,,.. -f-- - '- MEN 3.3 2 f ' .. ' ki :.iNfvi,?fix 1-'iz -NL. :-. glrsvfi . : LQ if-E?,,'?':!y I 21- war, :-..f-...4,.4iF.. :,-rr 3, 3 33 if -sw 2,3 .3 3 w?gE3?-13 1 3 1:- w3 -Q Q 'Wag-W 1 .32 , 3 A, N -3 X 3 C S 1- 155 : .WEP -: ..--2-'i -- .eww - 51.3 6,3 333-33:--333. 3 33 Q3-33.3 - --3.. o,ii -- 3-. .1 w ie. 3. 3 .or , . . az53'fi?Si:-5 W 4 ai? v I 3..5:1?F-3. - i i A Q3 .... 33 3 -3-,, 22 3 3353 Q3 K its 3 M Sf w .F im -3 3 '33 3 Y 'Z SQ iw ge w 13.-3,?b-f3- 513,25 33 wgf... 5,3 3 Q 1 3 1-43,3 X 2 .553 ,- -fiigqr eil? gff3e3,. ' 371 - 1' '. 3 - .Wm-., -W., ., S'-135 'i-33 wig? Q W? F3 -5321? Q P Q is gs. 1 3-2-. we 7 A -are 3 e . Q3 a 3- 1' We 3 3.35 533 Q 1 . -' - ' dial g ni' -f' . .3 T- . 2- 3. -rf .1 5? 1 3.33. , 'QEEES .- MmI5wi'5iWi2i-Qf,g5E'5Fl5?'h3i?5'i we-we -. W-M 3-K f- K 2 3- 2 3 3 E 3-L Rl 3a P3 w -Q i If X ff P1- 5 -3 We as' Q af Q a 3 3 .3 5 33.3.32 33 N 3 .3 + 512 33 3235 3 if l J Y? ia 33 --33, we .3533 5. P i' 3322 if '25 43- ? Q 3 .sf ii ts- t Y F -lm .5-,. wwg,gfr3.gm3.w'-wf33inm.igm333.g552f.f gf . -1--.re ?:g-gegfigfs--' -- 3.35556 15, 13531223 it:-ef. I .. 3 - is. 2 . w3m.3o33..3 3,.3.- 1 '-7.. 4 Q- 1251.--we.-iff.: ff- 'isle .1..5,.-3.f.,. -.w- 1-.f f . ffifjlximfz . 3.3-,5 ,.... - A... . R -, -331,3 Q- fi? f f' i?2Llfl.:' f1f..-:Q 2-fit ,yi . K., . , 1 ' ' ' 3- 3 ff ,W N Q5 .a 3-X 3 33 3 W 3 3 'it -13. y ff x 11 1 I -- -fl.-5 3-333 . - 3325.2- 33 2' 'S ,, 3 1 a 33 M? X W e A 2 . . Sf -5 Y N L 33 .. . 3 3 ff X 3 33 -S: -3 Q 3. 3 3 3 2 2 Ns 33 .3.f.33w3.,.3- 3.33 - i ' N25 - -332.3-.3-we-R P 3-,.,,-3 93 - . ef YW -Q--we M33 3-13, . Q .. . -.3 3,3 335 3 . S .. r- 23' 3? I' i eaff-if Wig.. vig: 55.1. 3 Hxe- : 5- -.,, .' v me H - ' S333-5332-g l 323.3 .3-1-33 .3-M 5. 3, .3-Q3 3-33gf33f23 - Q3e3..3..3 ,,.3.... 3......-.33 . ,3e-Q3333 353.-...... -,,s-.3 ,333 ne. ..-.3., ,,,, 3 ,,,, . .. .3 .33 3,8-3. .. M33- ywf-.--.,, Q:gff? ,, '- f.sz'f-- .. . -: 2 23- - . ..Qt .Q 3 Y . 1 'h'fi'f1f-N' .e'12f- a -J.. -- . . ff .35 ., V , 3... ,.23-..f.33-.-.f...3.,,,-..,. tem.. ifPWf1,'51fJ:- we ' will - . ..33,.M.3 . 3.. 3, .,,..-f 3 . ,i -1 ' new . 565432.35 . - ..3,.?:.3K3. M-- 1 fy-gg 1.53 -gym-3 -35.12.55---.f3.sf .. ,. M 33.3. 3-3.3. 33-3...3 -V .. W'- -. . , 3.....wf-M .3.-my V .- .,3f. ..., . .,.. .3 .. .I 5 3 -3 331 3 P 3 92 ? fx ws: 3 Ee ' . 'i? iE 'S . 3'-f 35 4.1417 .E EAS - iii Y :-wart WWE? 535595 3.---.w--.3, f., 31-M fsfes-53 - 1 -2 .Q A 3 1 3 3 E fe it Q 233-3 ii Q! x 3, ak .3 we J, af .3 Ye r 3?- 3 f K 53 hs .3 35.52 . 3. .5., 5 Q., .. , ' 33, 1 .Tn -.Pg - .93-few. .. 3. 3 3-. ..3.,, -3353.. . ,--7- 3. 3 W 3 3X -.3 ,S 3 3 33 Q3 2 gf .3 47 E wiv- Y N135- E H v we e Y -4... 3 Q 3 3? of 3 .31 5. 3 it 3. 3 he 3 -3 .Q .3 3 L 5. .. 3 3 3, 3 3-3 -mf -'M 3 3 33 3 .35 3 ev 3 3 W 3..,, . 3 -1 Qfiae :iii ie -. -3,--12 33-.3. 3 ' SN 3?g.:fvfP ,af ff54Svf?.? + 5'b'a:4 -,' 53623 . - - 1 il. Si..f5l-3 - i' Pwfeiil- .. R! 3 lTif.w?ia . 531-filff ' f: m e 3 ffl' ,-.,--Siffflff' iw afi?QQ 3,3355 .45 .rt X . 3 -33 13-833 Hwi f -- ee . , 'i-2' we - ... '3:33. 91695 wg.. .wee-2 . gg: . Wage -. . 33. r3 fe .33 ies? .312 Y Qi 3 3. Q 'Y sf 3 2 'Q ik f..3iif3g. mf .. fe ite. -3 32 W X2 if-3 'Q 81 'Y W H5-take? 1 W2 33313 P53 W '62 . me ? ..f,,f-- .- 535535555 ifsi i4i5?SaggQeal' is i'f'5?5- 5vfa'3':i'L..'.' .553 1-156:21-, 31. - :MQQQ ? 1 --ii ' 'f-fe . ' -31233 X f me... E5 33 , -3323:-ef Q33 ' 12934.35-Sag X? Q95 'f' 'Z em 5 3- 3 3 3 E .nf 3 3- Y F ,Ig 8 3 -3- -.. Q 3 .3 .3 3 if tie 3 .5 -4 if W 'V EQAEQEPY' fe-5? Q- 3 3 .3 ,233 3 3 33 PA 1 33 2 3 3. 3 + .335 3-133 te E vi We Q., Q-3- Q YM SX 3- 1:5 5 Se 'Q 3 2 3 Q 3 . f Marcia Moran ii 3..r,3,a my .... -3 , 3325. 3.. - 5 fi, 3. 3 .3 AVIIIG Mvrenv Cheri Morgan 3 if -L ' - Pg-. .- , ff- f. ..s-.tg 53313. 7 . .33 . ,, -,,- 5- H . .-a?a?1S?w, ...kY-p -M -5 5,75 fy , 34. - ge... -g..A3.,-,-.3:- Snookle Mofgun ., . .15 ' -QQ--:jf--tigf,gfg. .. H iiifgf J' 15 . -' W Nancy Morris . ,. 5,,5St?2'r.i- 'i .l-ii? ' -fifiai. , .E,:sA-W '.':i: 5 .A , T, .... ,:, s5i:L. .,- -. if. 1 . ,,..-,.v.--- A Pam Morris , -2- - zz - -T' f- .ev------fi' ,Sf .. g 3 X .,.. a...,.3q. Dom Morrow P' --ff-fm' l g f ..--- ' f .:.. .. .f . .3 ., . 3...-. .. .. ,f ,. ,. .. .- N -. Mike Moynlhcn 553 3 -.-. We . .3 . , ., 1.,.,..tfV.? M ,K N. .--. Mike Mullaney M .. V .Q y J. . K Q Sue Mvlvvney S .. - - . ' i 1. . . ff 3, . 3, -5-,. .-...- . - 11-.S V32-'I is. Wi. 4' , '22 3 . Q'-. .- - . - .. .. J e M -f igs ,, 3. ,. -' 591399-1-g. f' . - dwg, --MQ' -vi as., - , gl '- - - ,. xx, -W - 1- -' -- .- Mike Myers M ' . 5.3 L . 5, . S. if- ' 3 i -7-1232 M . ...ff f Wi? ' 'X ' D? ' N 9 'e - fl fl .3 at f i 322' I iw- 2 1 ' . ' .N- Gldeon Needham xg:-3 ,gf Q. . 1 . . i g . .M 5 5 55?-'ig95i5f-SF?fPf:ei.f:iF?fSI?la:4Z5f?3'?fE :I .. .ar-R., ......-' .. .3. .... t., ef -. . .,,, w.. Pamela Neel 3 , L. . VKLLV ,V K. Q rhxrk Glenn N elson f . . 1 -3 . if - .3 -. -- . . .. -lim Nelwn - . - l l 1 . f ' -' Paul Nelson . . I Steve Nicholas .3s1s5ggg,.fgg . ff - .fi 9. I reg... K A ek- . ., 5 55 2.2.3, 5. -V Eg .-3 .,, 3.7. 7 557. . 5 3 ' . if ' - ' Carl Nmk ' 53 ' 2 - '- if 1 - 5 Mlkl Nolf ' 5.3.-' M' , 7 3 P . ff' Y' 5 ' ' . NCHCY Nvrvelle ' - - . , . . ' Larry Oberly - Mary Jane 0 DUY , .. 1:51 C. d O d -fri?-1' .ggi s V. ., 54. ,-of :-.s.f:.- - ihkfi-. . , fE '. .ff gl 1 .gnu - -gg gps. jgg 3-2, 1.5 .' gy:-gif .:::f571P2.5 ez -1551 V'- - . 1 y Y 9 en P-A V - - - 3. .-2 . -33.'rf,3-3 . f.-. .. ..-1 .mg-: .' -. . ..-, - .Q-e.f' . 1 - Debble OSIGY f P . . -. , 3:22 Manbeth Ohmart A . 5 - - W ' - M ark olbin - - ff' 3 ' .qiffii ., v 3. L'-szmsw'-:-Z -'sl-'. 'nit . , ' -- : 4: ' 1 . - ' ' - I' ' . rw 1' .- 1 , ,-- - . Q? f-fast.-95,11 .. ffss.-M1335-.-?.. -' ,e'v.i..13--...-fsseea.: lzgives-3fffff:t:f'V fvfff3m3ffef:+f.ffw:f . 'W ' -3 -'-- . .. . P' v - Scott Olmsteud -- 3 3 ch 5 e Olsen . K -f . 1 ' ' John 9Iv?y Q , I-ee 0 Neill - - 4 Ron Ostermun 'Nl',-9:-b37?'5l,3,f5 ., Tp . N. ' ,5 .g- D 'm5Y3e'lg'i' gC 'V Eflgjlf'-P1 I -a.-ff74:.:.-1 :,. I' L,-wi jg.:-Qiigisiy .11:1jg g E,, ' :',:: , .3 '- Barbara Ott .. 3 i' ' :fn RUIPH OH 3 . Bqrfy Owens fs'.-:age f- fdgliiz fihfqiv -I. ri' vm L? 1 akfife. .3 aw 33 a '- 1: -- .. ,. .4 -gp-:w i R 'ii - ' 3 3 2'-:gow . we Y 2 3-33 -,L-g.. 1 rw H1 -1 ., Etivzfi Tri- .f-'J--:Y - J:z.ff iff eq '--silk -'V' ., P w .5 ' - .213-if -- w e , . ,.-5.1 ff-.Ht sz... .- ,-1---- .7 -gg-,Q-3.- 5 .rw . ., 3 333 ' -- 3 ., , .. 3 2:5 f..-sg: 5213? . :-J' - ,. . .fggfv 2- f , .:- 'iizig -,':..g y.'..- .-353' , ..1:s.: '55 11,3 -- : 131. - .3 3 jf - 5... 3.-5,5 M r.. 'g.. ..... 3g-.3i5-3,:- .. vs fy- ff. .1 - fs. ,P K I , L N Y -was 3. ' -.sr ' 56. ef.. 3 - .. .,-,- -V ' 1' .' 5- Q Kevin Owens Sam Owsowitz Jan Paddock Leo Paluska Alicia Pappas Sharon Parker Fred Pascoe Patti Passmore Val Paliengale Jan Patterson Ken Patty Carol Palze Dave Payne Janis Pearson Kim Pensinger Mark Pepe Angelina Pereyra Diana Pesqueira Lloyd Peiers Paula Peters Sally Peters Valerie Peters Kathy Peterson Patricia Pelruccelli Stevan Petty Kyle Peyton Rick Phanion Bruce Phillips James Phillips Elizabeth Pickett Karen Pickett Kent Pierce Rene Pierce Robert Pierce Penny Pike Lorene Pilkenlon David Pinion Donald Pitts Steve Plefl' Rena Polaski Mike Polivchak Sandra Ponce Debra Ponchelli Robert Poncin Dennis Porter Gerald Potter Rodney Povis Bill Powell Richard Pratt Stephen Pratt Kathy Prchal Cheryl Preisch Margie Premovich Kris Preston George Price Trudy Price l9I ' 1 5 fezwfsgf:,ss,gi,'1ffs,'1fgrlfHx'2,sa'f1:s'fsi 'fwiseg:s2g2s3fw:'?4?fefz:P45?f5fees: fsziw:fmvwxfe,gre1.ws:,5'few - - -iaggeemif sxsgww '5??973??S' 415555 9553 5 iiiigrilis ws? , fp,5,1f- imw :sim p ez. '-ffisw . :fegffg 'Lew F3 .gi L-g,,'f -ff ez- ziimfezsf cimfev Vffsewfeir ffm: in 1:11 ff:?ss,f-fe: .. ' 1 . , . . Q A M ff: 'E - ' - nz, 'V ,weweswwmwe W 1 ali 'vr:'3iswff?7g.sr .1 ,A nz? 'wee 1ef.f?ga5mseAf4seff1i?2m21?w .e,,W,Wz -- We M. M X -6 we Y .tgps s,: f .H gl. e sf 1. me AQ be wvgiw N Q 93233 QW, , wer we We -We im 11 f 8 ,I Q Q1 mg .2 Q fy 2 ZW 5 y Q 1. A sf' 3 Ny ,M K 2 + Q Q . 1 il f 5 X Q E , S tti teisf M stst esi,tt ew' 8 QZZEVZYEAQYSHES my wwwfcssicsef-Meme, ?e,mmwmm'ent-.e4m,151fw1 new .gym xv -vwmeyfsfgzimx mmewmye -ewfwsi M 2 EV5g3f'SyfW V Q.a5L?il57l5fT ??E13E5Ef5?,7 f5fi'V3i?9E13E '-Ziff: ivgegeis .mgerfw fx M -. -we ewwmsf fwasav fzsrtzfszf-'f'xf1.'i fsiieia , Hvlszfw . 4, avi' ' -, y u V- . , maggie Ame-agp ww X 1s22zztam, fs - . sngewjflgg A wifi H gig my :guy fm - . . csugi2.wffff.i6ff'see gsiewv ifssfwfrfyfisiw 'i': 1 , ,uf--Y Gieijiii :WEE '-,Dfw . 232:51-i'f5Af4 f xi ii- , lf iiiff -5, . wifi 12 f we :ai iff f- .. 115214 - -K.,'M. , LEM 7 ' fbi, 7.2 -ml! ' ,,'s-van. -::' -. -i - ggisijifi . :LV ' iffeis i. .vi4,1:e,.fi'f f ..e ., ., M f 1 , f?Q,'E,,3iM:ewW'Q?3gfS wwe Lake, q.e,Qw,msf-weve -- if ez eeigesf wweieye ,mmemamf-wwf ff :ww m,rM . QSM A gs - - - ,elvfsigeszwf Y W fwzesam Aff' ei' W'sms1m V-emi' es 5 I mei? , H , gi g ss, .. if c,,. W, 3. Mgigwg 1 Q? we ' M.. -: -2 ,K A A V was-sill weve! 9522 'i lgifbffi c eh asas in is H512 3 N 94 as wifi Q W Q Q 3 R' Wg - of ef . Q Q - ' 8 K 3 51 M,,: ,w : ,Aeg -Z3 . 1' an 'EE: '-E- Zn .:l?1!,:Ei i :: i :. w gengng T ,Elf as, H awke w i Q fl: ummm www swells, . , A si. Ha: . 5551533 43 7 Je wwzwfe, as m:aw:e3?1 2? wizw 1 9 1 ag?v?5za I i V R A 2 Q 552 FS lg F' il Fei? , 1 1 - Q35 ,.. ,W . Q W fa .5 A as 3 2 53, 9, me Q as J K kg , 5 egg ci E gi M M 1: :ew , .A 99:51 ,. lt, , M -- -,l- mag Yfgg,-we Q7 egeeeqge-qg yielge ,A 2 5Q,igg3gy.g sf,ef - . Q gage 5 'qw we K5 :Z guise? ggi , fem? 1, 'Sm -E A M .: M' :www mu 1 W , f Lew lemme c:m1,fW1311s11ifm :Q 12 Q42m,i5f .31 U., ' iizifvii Q erm Slime . c,.c,. .W , .V ., iw Qc wf-w ,ee mm 1251211 fm it 555232552 meg z, 5?Gz:avsmw szww' fpmn -1514555 ss. WEEE- . S J 6 S we va aes s , xg, ,.. P sie? Q UH ess 2 is EASBQ ax 3 ff 52 ' J 3 ,Q S S ,Q Qs J Jw S 1 5 :,Meke.w Q5 Q X 3 Q 3 3 Q f 3 9 2 9 H 3 1 wi .sf we N 1 S, 2' Q Q v L Y J S sg --92' 'azzezuiwif ,, .,,.,.,t. e, ,,,.,.2 , A-Menswear ez f ,1f,1w1m .muy 522742215 w e Q K ey 1 i A 5 x f Y an al 1 K es L, M 1 +L , 35 Q3 ge , .. K., , fr. It we Q51 '2:IZI::,.'?,. 1. ,.1 5,A5,g1m T 3 X E 9, 2 1 ,zeifiesRilififsezifw, 7 W QM we Yemen '-ffgeisgezifqis -3 Qian xiii. .:.p , -af' 1-5 412+ we ,ewmwzfi u ..-. .. .er ,isa-,faH'4+'f X -.' V el mefzfaxy n Eaimf few, W sa .-es: :em 5'-.2 me Ffrqfg- f,.' . 2 Q 1 it 2 J Q E S ,, c S 52 gsm ia si 1 5 9 'ze 42 36555 W ' S1 A2 lg mm WAR 25 fi .. 3 ff' X 2 ke, SN A 1 gi A 1 fa S em, M K W E E we gm Q engage fe 2 9559515 ef A 31 121 pu ww. ,X if sum few, we 2 9 fri S1 .. Q A L -- rf' +1 fi :La g V f -':,::5'::iiff-:I'-: 'il4?iI5F52T 'SSW Ji? ii :if :Zi I 'K 'en E 2332 0 Yi fa K are Q 2, if Q 2, Q f 1 .za-'f'i ,PI2'f'-Lia?-Yi? ' 52: Q e.,,.5y5e ,L - J '5'V5W5sYfQ,5'Y'0fH55' WS3,2g 15 RSFEEX HQ, V aj 1 ,:,..:bb,,. i -- 125 4 L E? 52 get 5 S W ff eggs 5 an -o 42' ,ia FQMXJ 5 lv' ' 9' B Q2 E ' , r ES my rags 5 ig QE if? is ,1 V ee ffsrwwe f1E??sv,mi knvf2S9Ji-2955-LM , we - ,,, ,,.,,.e,..e,.s,.W-s-v,,fU,.,.,5L,geU ,Lug My 555 wmv,-. L H 3 ,:-:mr fi, 1.3 .lk :ST 'IHS' Hi t A fgfgwigiin'PSA-5Qi9ff3fIfEfQlJff35TS7Li1ffs5iTls? dgfjffgQ?g5QiiQfiff:?Iflliilii awww-g7x'J,f i595L5iffLflfi'r' Aki, :::,gfj 5555 j5g5g,iY13l7l, ' :fff:.f5fTf5 ILP Svlegwikfjsgiigiik5923:'?EIN55ff3iLLfQ5:3l ff1i5 Vt2isgP'g?:5'7 k ZT2?sff5:isfl7 'g52i532f5EIff 157.9 AL flfzififllffli' ' 5f.5i:f5f'?4IIP5f5i i5f1i3lQ'i55f:5' ??fi5?f5'eE's7f :S It :wax rurzcgfms - 5 Qisiifilw f :': 3 53135, iAfeZ19ht'st'l A-Sfv-13243 ,5m,,,,e,. feifrsefgva ,Mw,.ez , Q, ,GW-f ,. N fs.sf,fs1,:f gpmswz -msexafee iE2i5i.QZ5 ,' 57f5i.fAL iusiwzff , 5525 cliff H -- '3f9V:5E' 79i?55lI?5L .1i,. '.,i 5Yl'1fv7J ,aewlgggfg mzlszessgg ffm is wi We Qf:,35g,,45 5:15225 515322 -3234 14-we wr: Mm, :- wgigggg 11 My -emi -'MM :ww 9 , ezf,,-g i, gg IH' H . , Us fax! semi 5 wi: Zfiisfis 2 V LSFYAQS15: ziklpjaglj fai'-:Z Vfzfygjif kjfEQ:5ikf5f.. vfgzilx 5. : ::. f :iff V56?f5f'f E: ' .' 177555 ' Eli: Qfkiflfiili s5'f54X:Lm1:7J f 5521551 rtisatlikvk- VVQQV: 3525 ' 2251 Q .lfwt ':55m:w,.fQ, ,Q jg 533 555' j3:gw,:K V33 121, r:- If ' Ji 'Eg -mrs. aw!! if 1' Vlnilsxlg Sf f A555335 ie' gig, ,f 552455655 f'k5t5,emzgf125241222 l,41'wi .ffin 2-lzilw fiffifmlwf--1-fi 5ggP.,S7 fume 25245133 rgsggeg Sgwigssiseze fb 2.5W5.-zfsggg qfe eg i9zg:51s27gsie, 1H wifes -f..s2,w gffgiwgf: ,ig gwr' rf' ' vgjgijffgfimii ,,fiff3f ZQWASW . . 72,fif:1 5ki3ffS'7fs3?5r :. A Jae.: 'i 153,553.5 -5: A 51 '-5-Egg D 1 J 55 4- -f v' .':.,v, .-- hr 1 ' -S:-fmlfz ff' iwffizi fif 1'f-- EI . . ' 'uriifsifff V' .gi fizgigifi esi gr gy ' 527 m s, 'W if -- F 5 ' -. 'Sings , . jsgggfigiiggiiiliiissr -15511? 52, ifiifiie gfilfial STV .,..Hf ' ' ,E W Q-:gm f , , .. ,g,f5s1?sg4e21mwv i5?i-iif5sFS359IF wsa,M.r, 'e:vs:m:u+,.::s'fs-an X fqmfsnof-:ww : ,Le We-, I-he ,Q-f ww- S,z,,,l,,,w,- Weis, ..,,. 2 .Q M fi . we :Z :,'b1'h1??A l - efmf' 532554 ii! . - Q ,X ,, ,Q M W ew J ' Qi ' 1 Z if sf fm egos 1 an 5 .9 fs if Q x Q? ,uf 3 ,cg 2 V 2 w X 2, ef 3 w W E 1, 2 1 K ggzgfgggggekwmzzpzQvlsvegezsiwez 2,9 1 ,,. Mix' 'f n 332152152 Qfwsiif ' fzQwems,,M -mfsfe.ia. Ellen 'f' ep -- me . , diei J V 3 .5 1,1 11. me 3, Q 1 W2 ii A xiii is 22 9' KS 9 N 5. My V, A, 1, Ngrgz fggsgr s aag ES 'Q geggpf , S Q 15 'Sv f X nwegiwwew efiesegslsf . - 1 . , MQW mc? 2 we 98035 1511 ff .fx V zggriazan e ,4s 1 :',g 1351 ,eff-1521515 .J ' fix' by . A ,c,. ..., gwxs ir J, .. ' we in Mes! W S S Q 4 Am? M 5 wif if 9, N 3 2 3 5 3 S nw 1 5 ., . .... ,. 4 : Y K ZS- , Q K , L 3 1 rv s,f4gfQmzfe1wWgwg Q M w wzfwzieszffgec new adm Ame .,,1 ge4Qzf:e:1s.fwf'.wv A355-:ze M mm: f V - .131 f s .sp , , , ww H ,, fsw2Qf'1s+1 QWe.eLe,1fe,e ., rw .,, L, 2122 Izmir, :em H mm, J.- fwwssz w my fu me ,gc ge were 3527255 :Ewa 1 Mmm ? , .' ?'fz3fs5 wwggs ey 1 - M, 2,,,, ..,1 V . zffJ5Hew' --:-QE: geg,z1ez'i: 1 ,.,: missin' , -ev a V1?35Ti1Lf1LVLwfefL :'5 gi ZAV .. .,, fewffwi vffacfw ff ff 3 S ei W Q' Q 1, Q 3 X2 2 ox eye S a fi? E5 is le 3 se 32 Q Q 2 ,mme U,- M: ,,, KEY if Yer ,,-12,. .. .. imwffeiii, . .lf J li 3 H , V2 we 2 2 1 we 2 5 k .KE ,ig E Fink' 9 46 an + 2,2 gg., gains 4 5 0 e we mfg? f,..zm:fiifa-Pasvv . ., ,,... ..1. MW meal -1' EHS? .,:.1 ' 5 ., ew -WEA fe .fa A. M Q- , 'TT'ff':: '::-:Q 4 W2 S f .jf S5522 ,l y my ' x iii Q ililx me E D Y I- 3 S Y-V ,Q in Q P F fs -if few ' 'W ' fe 12 5 : :-': , g5i2e45:xmg?1f-- P - ygfsggggggggg 'renewefe :aww w . i f-weizsw ezfspssw 'ffffwv .s - L-gms 1355555 -,,i. - gegggg Zeiss 4.5-e f n-..1 figqggga S? A 1, .I wa Jif iiexesi e f-1, . . il u.,-f---w -if ' we ' iii 'E 523535 3353 57951 'lgii : diff ' is Effgwl f w' Q'9ir ?i5f 515' .. 1 f lj Slfwmigi-,::2,2f 3Y2 ,f fwwfges, . 7.31.35 5, gf VL i V V I VVVV I g,ff:k1 1- ' rams-is ,gym-f . , Nye , fm . :sf wg essay 25945 'isxkik v. 5,555 iviizeei 953.5 - Elsa , 5515? eggiae x Suaivmiills we eww: f ,n,,1,,W,e, ..., ,. gimme, , 193525554 zireffyiiiw W W M, .. ,, I , arise s im -W.m,,, ,. 22421152 ,11 me M ex 5 Q 6 Q, L ,ms , .--mf ,W if Q fy 098 Q 23555 wwwfwggflmeiswgzneiefi M161 ?Ef?S?QW2esa4f2 F M f7iz 1322 , of mf 1 63525, , we ' r ggwew as-was Ang sat SzI ' 'fEV ..'i:1,w, 2 W, mg :':--A n o S5 ' ' i e, 'I fax-121'11iY4' 214 Q. A .Q I 1.. -- 8 e Dim fs, awww .V X Vw 5 ,Q N5 Q Q S 0 A S, ,Q ,S S Swf S E912 if S K A 2 Lie 14? ei 2 S Q Q Ffa e 3 91 M, 1 Y si is if K Q we . ... 353932 lwsxfcz,-11 51-Yeziiifzii' in K ,, ,,..,,. ,,.. K ' ' ,. if We ,K - . .-.. , Sw: waffles F' - h e ie- '1 9'i,5?ff9ff'5iz, '539i A ii 2 :15 Wgggtfg H - if lwgvs :Ewe22,wf, 5: 2 fLE25457i5lEfii?5z' ',fl'ff':E+E' -A H U sv ff X2 23, X A 9' Q 5 NW 1 1, Q A X ,A , A2 Q K S 8 1 Q wr 1 Sak is , 3 mezfefsvae-, .. . :wwf-r-' -- .:--em' izeeiif' 'if' :wffgi ie. Y gf, V W, ee 2ww5em??5m:Q.:S,wWmgggggee, ' ' -W -ifeffwrafgs afeisesis -' Rim mania were ,ffsffzssge 5123553 gmiw ig-',21ia ww ,came . Ask, ,A we cameos, W .., 2, W W ww '25 32523: Egiveileilsffv ieiskq ibiiwve egwswgegwggex fmafwie -sums, e. ,. .. 2, me 5934 , ,, -I if - 5 , 1-7: -jiwesf A si H-'.'fl': :,s ', ,W-5, 81 ,, .mg sggigigwgsrgeviwzExim-wswggei, -e,L21,S1fefe -f,:: i iatismegiii 1 ' M2 E42 1, P, v,Av,A., M1 vssvfgfaw V EH - dim? swmi ,Q 1., . wm- ? sueimiisgf -6' HQQMQQQ eqfesfefegff, ,isaefqz Evkafssii ff 'Wi fimfgeiw we-if , -f . L- ,,d,,Q 7.,,L., V -Q 1, 4 K ' 7 '1 ,- esvfunigmw g.g,,S.11s1a, .V wx Q 'Y nz A- f ivjizj., , .QR ,PLM W W new mmwez W fsgszssggmm of fm: xfwagezief' z.. sei Www i sewim .. H , egg ax , was 3 3 F ? 3 5 3 -WML 1 .N 1 , ,ee f ' 555' 5515215345254 ' .'Efkf.Z':'2'- 'busieckzg -ii if--ew, ,fsggesf 5?a.w?i6e3sa, 1s2is Queues-wife, we :. .: :- fe . we Qfwg, agen w .::,,-'g,,-- P4123 f?f?ffi22ifi in fe '- fse,Saf1e?1-Leif: Q- v ffl g gefg S3 i '5fi f . M557 is mfllfgfi g gfk ,L 1 1 f5a'?iE3'iie1iffz?QQ??zm:fffrs114221331 ggfvffgfpizsgigf:megs my 51 Q35 fl Mike Prinlz Nancy Propp Regina Puch Douglas Pulsifer Kim Quail John Queen Bob Ralslon Richard Ranger Ric Ranne Lee Rapp Viclor Rascany Roy Ralh Nancy Rau Debbie Raymer Carole Reames Sieve Reddy Tom Reeb Debbie Reed Gary Reed Jim Reed Jim Rees Mike Reeser Dwayne Regal Pat Reidy Troy Reimer Larry Reiter Joe Reyes Nonie Reynolds Linda Rhodes Peggy Ricard Diane Rice Brian Richards M l f Ar X 4 5, uv MJ I. 3 X W ,ig one . 2' QE R 'J' 0 c : i is ,gf ,ir 1 X 5 ii iw U, ef? -..- ff J - I -, , - ,K ,.- gi. Ik. A M K J, 15. S f. ' :Tift A I ' 2 - , x I - N 'ago ga -1, 4 j ' -- ,. :-JV.. 'we . we ' . -K eN 'Paam.wMfwfi if ,A ini, , Q K U V, Q .. q A .N yr A ,?, ' 7 l ,, Q W? , A ek 6 O LWQ ll' last' vii? N M XX of of ee. M X 'ae if W ek EL If .:- 1 Q .- A A ,,.. 3 -1 A - in E kylililmyjy V :I A .,.,:.,, L 'kg K f M M s K ii i S M... .M il . if 5 ,, ..:,' -' lk : sl 5 '. - .11 ,, S icsrr . .S c , is H ssit igg' :-: ,,.1 C 'L'hL I Q L L . i VVLLLV V f n ': ' H' i,l,,,. ,,,. , , E S iir, - by .LL 5 V, J 4- 3 5 lm, ii ' ' .K--- -WE. K-'? gf . N ji ,gf f-' we -Q Q A V' HM- ' ig-' its 5 1 f F yy MKS f iii ig? gg 5 . 5 ' ,A f L L .., 4 312193 A QE' nf - 1 ' - - Qzkic 131 ZL. -- 5' Q' if 5 - , Am Susan Sanders Charlene Sandoval Mark Sanford Franc San Nicholas Tim Santeyan Debbie Santorella Victor Scanlon Bill Schildmacher Randy Schloatman Kevin Schmidt Regina Schmucker David Schmuker Carl Schneider Deborah Schnelle JoAnn Schock Glenn Schoditsch Jeff Schrader Pam Schrand Denise Schroeder Ann Schrubbe Kraig Schutte Jim Sealy Jean Searle Rick Seckman Thomas Segundo Lynne Seidler Tom Seitz Cathy Sepulveda Jacque Shaffer Dolly Shaw Mardy Shaw Kathy Shelton Nancy Shepard Rena Shepherd Susie Sherman David Sherrer .lane Shinevar Kim Shipp Dee Dee Shofner Jenny Shreve Steven Shumaker Debbie Shurtz Pat Siefarth Heidi Siegel Randy Sillik Ken Silvestri Carl Simmons Richard Simmons Mari Rickard Daniel Rincon Shelley Rinker Kathi Rios Karen Ritchie Wayne Ritchison Douglas Ritter Jerrielynn Roberson Cheryl Roberts Karen Roberts Kim Robinson Thomas Roche Patricia Rodriguez Patti Roehler Leonard Rohlik Bonnie Romero Janice Romero Kenny Romero Susan Romney Buddy Ross Virginia Ross Fred Roush Cinde Rudrud Scott Rumel Mickey Rumic Dan Ryan Carol Sager Gerardo Salaz Brooke Sammons Dominick SanAngelo David Sanchez Marlene Sanchez Freshman J S B on A B C i so -, . ,, , S , s i? 1 ' , : Q ' V fff, - .lj-' '-'qi' Silij -Q Vfgglfk ,' Lv Ex: t . Wis h 'ilk 3 ,sy fig? . R ' V ' --.- ' A . i ,L.k y . . . --.-. V. , , - - A Q ,,4,, ,.... f Y , F S . . , -, -2 - if siifir- . 11151 ' f . -- ' 'S 52- I Q E - vssgifst. L ' ' me fgf. , --'E-f',,. .... -- - f f . . - 5 . j' f -. fi? M ii' ' s 'fi f , ,... ' - ff' H . , 1 .razors i35'.,li Z?fR3 5iiVf952fPf5:A3Q'slag gfsf5wra:r5im,g- W . ,. H - ,V K ',l, L S ,lk, , , ., L: in ,V .'l. V , L W-'W--mil wmv i I Lf Q ii,' R !'iY?EEEfi3frfljf: 1, , S L V f f ft ,ii' S... if - ' fy :ug ' . E 1 .M U ,K 5 A ,Mm A Q ..'k 1 R f fi W - . K' K 4 5' fx, ' e ei 1 k. y K '32 ' , ax' ' .1 -or ' Vfsigieeff' -iff,-'5' . , ' fi X - 2 4 f fr :.L.. 1s'lf ?'., 3 E - , - 2 0 e .. wa: 12' -li Ms: ffm . K 7' I - ff ,, . fy 'ii .E R SX X is R ,, K A ,F Q lil 3 . eff L . il' , si I ,I Q his gk me M . 1,152 9: ,ggfk 1 L4 L, 33, L 3-F - , 5 1' 1 ' -3 fff35?13ivi,iQf'itf3f'Q 'i15j?jj 'K K i K ' F211 -. 1 :. --,'. , V . , . . , . S. . V7 -'- e , ' k , ll? A . f: of ' R :Ti S o 'ff . o sses A R ' ' f-ff fd B Q S .5 - g- f 1' ' A l ' .5 ' 7 S xi S! Ae'i I LL,. I y 5 ,. ,. e A . 1 1 S E A , N ' - S I ' l X A . W , Q f fs Q is 'f'- -353 'gifs . wi' Aw ' X W I N - i izxx - f K I eff 1 K l i E , f if A C I, '- - ' - W L' l . 'S mi? Q ' ' . - 'ii-H Q71 A ' lf -- ' . ' if .nfl Q,-., T ti? 75 .5-J . I ' -'i. if -W C if K . 'mf s W gi ,xii-75. gffj , , : , '- m f : ,gh ' K, f Y X -,.' 2- W 2 ' f f rf wg - gf 3 frfw' ' Wltsgf ff s...-v' : fi- e ,fe-:egg sf , f ::,,.g.a 'fm Q5 , gf:,fgs1yi . 5 lx K -' .ISK JQAQL we i knew-on . i l ki., K 5 FQ ' , fgggyfijggglQQ j.2Lg3'igYjisig-13x':gzgfy-5 gL2?:3Qg?5',g,Q1:1'f3gLgg:,g-I , i H , V ies as-'ez M 1 -- . .-,. :I 'Q i -M J L Q. :Y -- A ' . . ' 1. R' 'fl , V' -iii? 'J 1 fs! M fl K- i K ., Q I . i I ,. 11 5, R - ,- T ' qi, i S ' 'i 4, ' ' .2 f ' A 3 4' A A V R ' l . if ,V,. . : XX f .m v 7 y N55 W.- Y l b n ,y mg xg . 'l M: ,A 35,1 5 -53 fav , sky Fei., . gy . , I N ff fd' ,Si W '- ,. . 8 In T , is 2 , . f X , A 1? 2 fx, . ' L ,Y x -'J 5' W 75 , 1 ' , 'V f f' E f , . K X i 4. if .- .L - f i 'fi is - S 7 s of . - 4 ' f f'5 - A ' 'fx so if f . , 'xr Q ' ,, . ,Q . f . if Y A- . A 'f y R . A -. Wg, gf 1 9 3' -+' ---, e. , -- - - 3 n x me 5 -I B I 2 I :Sys N1.W:'9 if f 'r ,g:5i25.f Class Rick Sparrold Michele Spatola Patrick Spears Sherri Spence Donell Sperduti Tom Spicker Lesli Spiegel Kathy Spitler Julie Spotswood Marilyn Sproule Karen Stamback Jeff Stanfield Billie Stanton Chris Starr Cynde Steele Wayne Steele David Sternteld Alan Stevens Mike Stevens Lorraine Stockdale Bill Stone Bruce Stone Marcie Stone Denise Straub Darrel Strom Joseph Stroud Alyce Stutz John Stutz Tim Sullivan Kenny Sunley Sandy Sutherland Rick Sutton Tuck Swafford Bruce Swanland Thomas Swanson Margie Sweeney Sharon Sweet Ken Swinehart Debbi Sykes Louis Taber Gigi Tambures Gary Tatro Danny Tatum Tom Tatum Greg Tella Valerie Tennyson Steve Teto Brenda Thoma -21121 1 -1 22. 212 fwefsz-fwsw-fw-N1 22222552 ?Wa2QSiQi22'2a21f2 2 2 225i52g.32222522??22?2s1-euwfii-321-21-5 Zf5fit-f5i2?-f?i-Fi-ffiisiis 2 22571521222 gfyfislfverfslwsns--22-P21-111-12 25-HQ? - -2L2,L-,222122212222L22,2221-ss-22-Q1-21-is--5 is-2-322-21--22-12212222222 2 2122112212 2221222121-2:22-few N21-fwf .2222 ,2 212,122 212222,..,1e,.22e,,. , , . 2, 22 22 2 22 22 222 ' 12222212211 isfanfszaei z52v2zf2Ezkivi ' YIXYAPHSE 1'ff5M3'?5H2 251951214 vLszL221ez12 2w22z2, 11- ,. S1521-Q12 Qiffgffifi L-1 - 322,35 saw 5 .2 5 -2. , 55555: 2565225555 -511551551255 ifiifflf mbu 25121 212-122 2212222222222 .2122 21412121 .Wm L H 2 sm, 51 X 5-22g11L222e122-2 221221, 222222122 2212,1 ,. - L 2222212221 12212222 :.,. - .. 2 -252 .2 .. 2.. 22221 f2w22 2 -' sg2gg2g:e ?zg 2a221 2 1215 ,. ,1f - --'22 ,222 siege new 25215-2142121 fs M fi?-512 1-2' 22i-222 we 259-Qsiiliiliwrfafii iiil 2 s22gQsg,eQ3g12fw2 , ff - fs- .2 gseggsgsgg-322322222223 5142122142 112212222222-2 : -- fs-fsi:sffiQ22f12 2,2 2 121212-122,.,-1.eQ. 1 2,2 2 2 Ls-L22,L22L221 22-12- .2,.,,.vLL,,..L,,, .,r 22 ,..,, 222212122222 1 2 f gvgfz5z,1l2 22221 N i-H E 5 3 we - 2, K- 225-223 -2- 5 ,2 9 2221122712 .- - We 2 2 , 2-1 - 12,L29f2i2r, 2 1 L,-22 - 41,2 5 -511' , ' s2 I4f ' :fe-: fL21LW5z, D' 5 2 L -1 22295212252 2 1 cr,, 1 c,.:,,T.,.:,,.:,,,..,,..,r. 212,12 ,..,,. 2,122,112 2 2 ,..,.., r.,, 1 E21 2521222225222 1221225 2-121 222 2 'flfiisif . ' S 2 S 3 2 2 12.1 . , ' '1--1221 2 S, 1--122 11,1 ,. S ms g - L - .. i g rw- 2,1 teffssifs ta 2 f sixfwzssz-E2 2112 P 2 LSP,-iff H' L22-a,-f1 2.-.F -1 ' 12115 s ev-212:12 1111 1 ., L. 2 ,2211 1 -'12-V12 ,. 1--'1 22 2 A U , k.,A. .,,:f.--' -12 1 ,-1 2, 12 2.-22:12 -21-1 1z:2:::z -J' . 221' ' ' 1. 2 121-11-1 ,11212-22222 , , -2 - ,.,. 1, . 22s,.:2:.:2n :22 .,: 1:22 1 1 -2 - A, -2 J- 1 -- 11-we S53 :L 11 -12122 -12--12-2 3- 1, , ,2 2 2 . Us . 25 1-111222. 2.2 12 , , .2 1 1, Lew 2.1: 11 L 1 1-,-p 122212, .22 4 1 2. 2 1.12 - , 1. L 1. 25 221222. .W -L 2 12, , 12 2 - 1 eg- 22-,L . 2 2 giiigivfia 1 25351233 IL. 1 -,1 ' 2 iw L 22 . , 22,,. , .2 .2- 12, 122 . v,.. .21 2- ,.,,,m,2L5g,53M,,,,,,,,2 2 ., ,L 2 , ,L . LL ,123 .M .1 .,.,., ,Z 2 2 2 212, .22 .22 , 12-22121 11 Tad Simons Ed Singer Bonnie Sipiora Steve Skarsten Lynn Slagle Paul Smart Harold Smid Bob Smith Debbie Smith Ellis Smith Michael Smith Mike Smith Randy Smith Robert Smith Robert Smith Steve Smith Steve Smith Sue Smith Tom Smith Wayne Smith Scott Snell Roger Snider Judy Snyder Jeri Soelle Scott Soland Linda Sonkin Ellen Sosin Lorraine Southard Stephen Southern Cecelia Spaeth Wayne Spahr David Sparks LL,LL2 .,.,,.2, .,.,,.., W- 212212-122e12:12:.1,L21,L122.121.22L122112122122 a.,, .,,a. 2 2 2 2,,.2 21L2 Ls,L2,.2,.2,.2 2 ,21122221222,12,.12,122112212,12,1 .221222212112212s21222112212222221.122.2211221222122, L, ..LL2, ,,a.,,.,.,.,a..,.22 12---122112-12212 f2Es2sfsz4wssfss7f4s2T42sif2?f2 i Sa?f3f2i 221211 Q22-51-21 2vs2s212ww22w- w a s 2 2,.zgsezsez1f swf f J swf -'QQ f,.,, 522 zz- ., 1- ,'i'i 11' ' LSF7 V' Z ..,,,:, ,i, if , ,.,.,.,, 22.12 ,Ln LM, s,112,22,, , ,k,,.,,. ..,,t.,,..,t.,,t.,,t..,,..,,.,t 1,2121 ,,t. .21 M X2 2 2 3 M 2?2i4s2'4ezs2r ' 'evffiwa 2? Us 2 Q 22 gikmeiii fii W' 'WQQE5-552 '? 21'22a2zz5j222 T' 1 :sei ' f2-2 - Q 2... . .'fL,f' ..' 1'2- 2 12:2 ,,.. 22121 L- 2:Przi12 1. L'1 E z 5 . 142,122 ' 1 X 1-i312 1 22212 W: 22-Q '1-M -f 1 -Q1 P' 2 12, 1222 .. L2 2 ,12- we - 1, 1,2 '1-- 22ifsi1f'?2i'1., .. .H 11- -12.-zflfrf i. . 2 111211 eseiwfsgfs vlesg , i 152,121 ' fwf11',.s1f- ' 2 21 1-Wi 1521121121111-1'- ' -2L 2 11f'1 2 -:' 22-' --11--12-112 .LLL .. .. ,., . . , L. ., 2..2 , ,222 ,. 2, .L ..,a. .,,. L 2,222 22.2- 2.. LL fiiiiffilg if 5 Zip: fiffQv,'i5zA :: :E, 'V' j9i,3St k .102 ' 251.5 , 70,1 Z-fffj fit? - '2 , f:,2255:2. .2' f1221f Q A 225: ifT?5f'-2L-- 'ififi' W' sw 12221 112 v2:12L:f- 1 -we ', Le ,. 2- .. ..,2., 1 .I we minfzgs aw- 2 1.Pzf5u21'vzi,4m , -Us if nfs? ' ' Il lend ,- K ,,.Fh,1'2,f52,l2' :ggi aw: . 01:31, if' 411122 - ft 2 fi' K - 2257 Q . :ug 5 :1:121s2,:.2- .1276'12fmL1-'f12'12is S' 1' -'fi fz:zf2252iS121ig5f1'im L 5s1'sfL:w7'1-:'1:7:, iifw'ffYfi2 -' 1 f,f1f5ff?ivE.l9EQ5 9 5' f'L f'f:t Wifi: 5 3 1 - sE,53L557,55L M N 32.55235 2 2 f 1-112 -.--- 2, L., -- i 1 :5522-222, 5 fs? ' -Hz. 2'-'L '-2 V745 1 , ,11,12:12:1221 ,2. ,112- 1 p z:12:11,212a11:,1f-f2,, ,2-12 1.24. liv f'if,'ff'fv37i9Qilltf fQf'f,'ff?f'f '31 Av ' ' fliufffl 1195 ' V 5 15 ' if-7:--c. .,,. L 1 Z 1s,lC,.5Y,mxlz,Lx fxwfz li .Sap . new : . 1 , 1' .I ,1 - - . - U ay' A ,::51. : 121,12-,1 11222-21 2 1222. 222. , - . ,, , , --.2121 -355:-assi! i I2 :if ' 'isful' 'Q '3l'ifflQs,:' U i wiwgi ' ' c -: ' , f'5'f 5, ' , fails, L lff'f'E,55 51235221--ic, .,., 1222 2 222 22L 22 . .2 -. 1122.121 ,. 1.2222 -221 .1 1-121 2 ' - 1 7 S 2 -ag2,f.,.22-,22'g,, 1- , 2 1 ', eff: 122.5 2 H 22 '2 2- . 12 1 . 1 212 12 - 2,-1221221222 . 2 L, . 22m -2 .... ,.-22-22 :2 22- '22-2 air il I - u'ff?'1' if j 5 -42-5 , .I g 3 , 1 3 12, sg 1 12 22 1,, 1.2 22 - 2 A -W -- 2222521--2 2 '- K iiiifff i 2 2 515521 .2. 1-52 3 1 1 3 7.3 Q A 4 V, 5 ,:'5 if ' ,- 'LF' Fm? f 'if - ' 'S 1- ' 26 3 56 'I-Wi 'f7f14, ff-2 4 1 ' 2 ' 1 -1 22242312242-1 we 2vf .1z,:1vxs:z:2 2,1 222: ry, we . 1, ,L 'Q 22 2 2 fav? 2? 52 22 2 2 2 ,asp . .. .... 'S'-'V ihss4222Ls2,5?1 1 1.11.51 if 2 l l-if'if'Q i1 V f1s91'1ff 1 i4flE,iiQ,13 .2513-E LEIESII- 1- 15 12,2211-2'2ggf:fMg, .2 1,:,.11'1 11 1, ' ' wif,-'1 s722 .' 2-Z 1 -1 2 ,1,.1 .AI . ,11,., A e 5 2 .2 2 2 se H2 ' 'Mi L2 2 ,,.f, - ., 22 Tis, L 2 L -T 1 T11 F2- 222 X .2 A 2 L 2 2 L 2, 557' 2 eel' 22 ' X 5:1635-32i,ib5Ti?+i 15523521-SZSQSTZH 1572.52-752,57 ' 3551 2 ' I '. u i-. 22 22 f ew QQ 2 1221 2 2 11,1 1-2 7--3129 512-'L: 2 9' . 3 7 'zaifsfxii 'iff K 1-flfs sii swb 1 1- i?.iZsi,.2,T1- 1 5 12. 1- 2 5221112--122:-112-12,122-2 - 2 ,.., ,.., , ,..,, 515: -, Z 22331 2 2 2 2 L 2 2 2 3 fkgg 2. 2 2, LL 2 2 22 0' at LL2,,L22g.g22,224 ,,1 1 221-11,1 1 M -122-1212,11,,.1,.211,121,1s1fwzwe1-21 1- f1?is?i12i?ifE1'1271-'I-if-if21:4e?3eis51?32??s5 , 'i2s4f2,:e2 115 K ' ,.,. .,,.,L,,M,:,w ,1 , 121121 2152 1 ,,.. 2,,. , , .L 2 .V V, , 1 ialif1'f?iL5if1-f1 .E 13? 22 22 , .,., Ng. ,.,.., Q L22 22, 2 5 R2 2 , 22 2221-Q -if L.22wy,2Q112e::L L:Q.2L21g, 21.222 ,.,1:21.2ZL,2,,5m,22221.L giggsgigjggi 43:33:32f222:R2:2z3222fff 22-V i .. ...., .Y ..:i 5 . sziffziiiff ' ,, z, EiE'.EL?af?EZLiiiii55fE.52,''-1gSd5jPE1i?EE i:.i:g13Qg155,13?3g3512Z'fz:.:7:v ':1'1- 111315-125121.59-?::lz111T11'fl1 1 P we E zssigsiisim I-1' --Y ,. s1,:f?Qks1:s-1: 111111. ess..-1,1-11---1:1-:-1:1- S f Jn f11g21gw15:1 1 1 4 H. , 1 sfwlszvlei' '1'1:'faifsi.4f-i we-1--mf:-ff- 111 -me -51 ffm- me 1 gl, 1.11 .-T 211, '1.'-1?-1.1 1 ,1- 1- si- 215 , ,- 5415814 1 fy-jf sz- 535212 Q31 H K 1 -11-..-we -1 .,,-.1-3' 1- 1-A . ,1111 511 1 1' 112531 .- 41121-ff 1111--2.221 ,,.. 'J-1 -111411 .. P W we Q- f- ..5,--1 ,1-1 21, 11, '-1... . ww -rw..-1:-.5 u 1. , -1 - - fe , 5,92 1-ff-1-.3 1311 1.11, - '1 ..... S I - ,L,. N Lin 1:12111 11.1 ,.f1gf , 11z'1 -11 KAL--1-11 , -f-' 1 1- .-- . 115- g,11, f-114 22-53 jfs-two ., 151- -jk, . 111,33 1 U 1 'Q .. . 1 M ,1- 1151 - 1 -,W - -ez-11:1 , Sq-51,5 1 .-.-gg 2,11 .-ig, ggi- eafzgssi .1 ' ,-,-1,515-1: ,-f2,'1.4s221'.- we :' 11.- ,.11.1,- -.- , --1.fS1' asf 'ers k'k- . '1 ff :1,f1.2::g:- ,111s.1.-1-is-. S 3l15 ' 11 ':1::.f1E?5 eaE-,Q 1 Ta. -55:3-J I fl :.- 3.51, 53,51--, ,, 1, 1--.gg4,3g15X - 5-,551 :::1A1f 1t. , 39 , -is-1 543 wx 11- : F -4 . . 1 ms. sf ww B- 11,51--1s ,ur Q 1:1 5.5111 -1-1-gs-11 wx--I 1 -1 'L --' -1 12.-fain. 1 1-:. ::..e,,.:: 1 2 --Y 111.1 .M - - A ...A -1 .1 1 , -,. S S 1 .,., . - ' E, 1 1 1 I k 1 ' T T ' eff' 1. .,.,., ,. 451.-,.1-.31 g.gf1g-g51.g- gggg-11,g-11.- -11,111-., -1, 5-1-1 K--A--ag. 1 f 1' if-frggggif rr-,P'1 ii. :Sis-S11-11--3, . is ---' A A 11 -1 .1 1 fzrggi Mlk 1 xv 1.2 --. , ' f - , .1 . 'vs-. ' - , 39? ' if . .1 5' . 2 15 : ' -.,-,, 15: I 4,1fm1.e1w,11,12,s 15-S, 31-11--13-,e-15-f 11--11 1w11.1,,1 ... . A k:,A: ..,.MS.,P:.,., .Lc. Z., ..L..,b.L,..v,., N :,, 3. ,k,k .. W. - --i--1V 13-1gp35P1,5-31:1-41154511-sites.farQ--13: 1-311,-1 -11.411 Annette Thomas Dennis Thomas Grant Thomas d a Thomas Mark Thomas Sheri Thomas Cryslal Thompson Harman Thompson Linwood Thompson Paflie Thompson Tiefz Frank Tilford Michael Timmins Rosemary Tindall Cyndy Todd e Todd ws e--U-1s s-1 1,-1:1-V1:-, few-sk.-sS,511ez.s:fSs P11st11x1.1sVss1.1sti1 lsf iff'-f1-Y1-P1-77-Y'-9E.S21,l'Tl551Qfl''iff T'ftiWi7:i3'i.:-11.-gs:-Y-11 we TVPF11-:11:v-.1-f.sP,r1.fw.:st,,.Q,1..:.ss1s1' -iv f--f 1,--1,.-1: r,.1,:szs,e.r- 11 -11,-15-Q-.rw -- -11.-,em we-,sf f-.e1,1m- -pe ' 11- 11 ff: -- 1-5, ff-- 11--1 -fs- 1 - ,..i'.':g11.1. ,sas-H5155 .11-1--1:,g315g115f 51,.-1,,-.,,.1,.f..- 1:-1:-1 ' 'iszseiss 5755515-F13gfgg1' 2155225 .wa-21-11'-111' 1 111,-gg 1 1,5ig1gq1.-1,-.1 --A1--15-1 A ,,,4,? ' Jlm T0l'eSdCl1l E7iei'?f5Y?1 SSLQESLI. . 'lieelsiisfsi E 5E5?S2l13.., 1'.j,,..5.-,., .f.5lYf.lT' H ' I wn en I .. E .. G ll.. S d -1--V1-W '--P' 1319? E: .sifvikif izziitisfa .?. 1-1 1 11:1 931:25 ' 1. .. :fave ...,,.:t..1'z .- 1 -5- .:1'-1 Q 1- - 2225 E: IF-131 ' T '-' 11- - '1 ..-1' 111511--:as 22814,-Q1 1 115-1sf1.- 14--1,f1 1 -1 ..fzf'1 if,-11 EfQ5ESTL5 211' ---- 1- -' CII' OWHSEH 1 Y , John Trvvsch 1 . 11-- Dmnu Tfenfk 4 - .1 . 51, . Q15-11' . . - jg- d. . , if 'F' 'l fixegsgsazi 1 . ' ' 1: 1Y- ,r ,F-,' 1 :-1-1, 1-1:1135 Sdn I Trlmble . M 1 Bob Trower e , 1 lfvfiiixa - use xngfjgjszg, , , V , 3 , 1 - -2,1 f s,,, ,. T ff T k 1 11 - -- 1 . - 1- ,L a y uc er - 1 - s N 11.- mfiwiis, --151,5 1,1 we 1 'Mg X 3 3 ' W F ' Fred TUFIISI' 1 . - GGYY Underwood -1111 -1- T5 eine, EH 5551 . -, I'?: 5: --Q.: , . .Q Calhle Updlke 6 . .T 5 Elvlne UPl'1Cm G'Ib U ' W i I eff l'lClS P S 11--3231-15. , 1:,-55:1 A3 -L1 .--eb 1- 14 .- 43.11 .1 H ::.,1-gr: -:- f 1f mms? 511,51 il ZLL 'fi11s1'1 'fu-,, ' 'ziaei Zf'il::'.,'H 12' 'xii wi . ' F ifi. sm, ff, wr - 6.6 235 1151 1--ziseig 11:1 ' Shellu VUII 2122-1 .- 1 11- we 1' 1 Sf,-1'-E 1 11-fe-if 25-. . if:111est1Ls ...mg 7' 42... v '-F' X ,1 , he , . ..,. 1-2 11 , . .. ,5,-5,,3,1--,-f .1, -, ., Alf d V Id ww 1 1- , .1 1 - . ...pn af fe C el Ilwwfve ' ' 1 -1 . .1 - , 1--F15-1355255231211 552111.-11 ' 45-1 ,w-.is . N-rg' '. 1, awe-., 1 - 1-wif: 1 1 -- f ,1 - ,. ..,, r 1 .3 -J-13. 3, ,- IC I Cl en mn A 5 .iv .Lie-.md V,-11.511, -a re-W-P51 ieweeia 1-1A-,.:1efgm-Q:1f1rs'1fM 51- weA-..w11wf,,1y1e--1,.1f1s,,m5,1f1s,.- .. ,J--ff Je Y Van Asd ' .- I Va fe-A 11 - 5 n .r 1 - 1-ww .1 5 d V d - ' 111 , an YU an enE'nde EQ , - ' ' R'Ck Vandeffofd -1 - - -do - - .. L1 Km' VUfV ' Sieve V'-'WY .. ,. ., James Vaughn .. 1 R, . -1 1 - Edmond Velgel .Q . .Q ' E f'-if 'EMT 1 - ' 1 i.'f'5.. 'fy -1, .1 11 - ' 1 T ' 1' ' -1 1 1. .. ' 1 1 , 1 ax .1 ff 1- .Q a s Ea 1 ., ,f 1 1 45 -fg S 'llY Velasquei 1 ' 1 ' ' 1' . ' ' ' X' Lisa Velluh . 1- Steve velfmdn - . ,, ' xl, I o . - ,1 Q Cindie Verleni - ' ' , -- wsiffif' iff: ,.--1 Q-1151561 1 '-?Yvg, ,1- . ,Q 1- - 1--1155-1111, .5 5-Q12 Ofddh VBTIIOTI 1-s.w4s1i?sx1f?3?g1:f -55-3:21-f 5-if .Q 1-1:1215-w - fee -1 1251515151 112135115 1- - -F-1' .,,. - - 1. .1 , ' L ' 1 - - -- Ph'll'P Ve 0 1 ' . 2 MU 9a'el Vefsmlles W if . 1 1 1 w 1 1131 . -. ,, , . - . . 3 ,5,f.1,,- 11 -,ig - .15 ' . . ' sis-H532-g 'T Q-XTQQQQQ 'if-'?iSgS2,5Q 127525173 575' 1 f'fi5,Q'5g?i15 2293 A ' x '- 'wigiffgfifi' l 55:2 fix, i'1E'5'f55 :f '3' 1' iii-?'5l5'l.1f 1564511121511 ' EQQLQ.. ' Pal Villeneuve 1- . ., U 'Mon .. .1 - - 1' ' Alicia yimle 1' . . - .1 eanne e 'lu X15 11 . Debbie Vosburgh W' ' . Melvin Vuke 1. . 3 1 ' ., 1- - '45-511 1 - -l..TRiJi2', 'Eff-' . 5fti9kI1 ':- 7.11 ' - Wffflvf' fi 5...,1 . spin,--157 fS'1 fipg?'QQ5111?s,-551 j'g,5 ' ,:.?E,iy?1g ?'?'1k fsjw iff . 15? 7532:-' 1 iff 3 . .- rj A W F' ,, M11 a ft ij 1,5jff . , -11,2-, Mm-gore, wade 1 -- - R , -11:14--LW' :TN - .- 1 5412 4-7 1 W 2-315T?7.1y'fi1.'ff'.-fill .,,?'-5:-1211'E 5 i .1 . H g. E' 1' 1- 1 5. we - W. -, .w .,,- -1 - 11 ,1. 1 ..-. ff,,- ,,11,- 5- 1, . .. .M .Q g- - 515 . -1 -111..,:- K-,ing-V. . .- 1, 11 ...J g r 1 K'5fi1Q'jj'SL'?El:1-G'25f'?s:5J212 'wifi he ::.,sf 1'- ...-. -..1rg51P2at-- 1-ffwrefzs .wwrff .--1.14..:-1-.parm w.e's111-51w,.. t... . ..,,.-,.,,. -1.,, .. - . W HWk'wk 'ka'XM J K T 7' Xalan Wendy Wade . Make Wagner -A' -. .. .- - K- .. . , . Bob Wahl 1 ,. .' -' a . I .- ' ' 'Y -, 1 Lllylglvahl, ' . , U W e . 1 1- 1 - 1 - 1 1,- . 1 N' KUWY Walden . .- z -1 . . -1' - -- ' -- 1- L. ,- KUHYY Wallnskl 1. 1 if 1 - - ' Jackie Walker 1 . .1 5 . ., M. . ., ,, . .. .. -1. . . . -..1f - , ,r-.1 W1.--,,--.-1-,.1,k.m -.1 L ., .. -..-,M - mg ,EQ-1. ,?3.,:gf 1-.1 - y 1k 4 1 V . ki,-V.. 1 , K - - --we- 5 we -W W 1. . W.,-1.1,.,... .W .. .. .. N.. . , . . . ' ' N' 'H 1 ' - 'Z' 1 Ruth Walker H 11 1 . 1 '11 Ann Walther . -- A I W d - .. 1 1 - U99 U UI' -. .. Duane Ward E ' .. . ' Terry Ward . - 1- .. ,gr , 1,..,.1e1 -. - - .. . qu ,. We -Y... E1 -1 .,, .M..1r.fL,1 1--gms ., ..,fff?.,.s.1w.e...,- Q.,-e.11. 1.1 TCITII wCI'deCkel' --f .. 11 - ww ' -s' efsv ,. 1 -. 51'--...MW - Y- -1 AL 11- ,L ' - 121. 11 1 Roberl Warden H 1 ,- T James Ware -- 1 1 ff' .. . 1 - 1 f ' ' .- - 5' -Q1 . '- fe - 1 sw-we on arren , - .- 211115 , i :.' --C 1-:Mica-1 -:EI .Z.,:w:1 ngii-:N-L 'filly faibfg-1 ,H 112755-1-E, f..f .TQQQE1 4- Llefveii? ' '1jl,5i21J!YgE W 1f'1 13? ,Eyre - 1 . -. .. -1 Rochelle WUSl1 19'0f' I - Rltlldrd wGlCl'll'I1Ch i V'Ck' Wvfmvfe ' 1.,- ,- A . Ch ' W h 1 - ' TIS 6 6 Q .. .1 rs P- Q, 1 - EV 121 -- 1y1.:,fg- -151-111 -1- -- we my ' 1 51s wfyfs 1' N' ww- 1:12fx:s'21s,.2 h as-51,36 Je Y We 'e'9 1- - Don Welnlapfel 5,1 .M 1 -gf . -- . -.1-.11 1 '1 , 4 QE?- '222V22'M'ff5:g2Hff2s+e5:SH-wif? Wins? Kathy Weisel Greg Weitzel Tom Welsh Patrick Wells Rita Wentz Doris West Sally Wheat . re: - H-W Prgvse-'ie'-iggx f im' M--9--rms 1-we QV was:-ef-2-2 we '-.ff . ,. .2 M2 A - 22'Qg?.2gg t bzeawsgggwiaiffg SQ -:A- '22v'2-2...'-2 Q5-if, -- 325115 M22 2gQ1Qy,5Qg VV.ggg35V2e1V' '- ':2aiV-'2 '.,- V VW f 14s2V22,gVg QV Y 251 ' 9:4 1 V ifqif Maw, , 7 2 V V. 2 . . 2. II 2 2255 5 :amaze 2 -- we --ANA-Q - gil-2: f,,11ff:22 ,.. ,MTEQV .ni -22,2VVV V ' 12,fV-V1 .:ffV V-19 A-1S,1eV1 HQ-ggi .f -- 2 . .: ' 2, 1 - we 1, m-.,112 ,gm VV2-VV31: Vi mee I Q, -, .- 5-2522 , 1 wifi-- Ziiff 2535 V- 2 .. , 2 -, es2iE2V22e2gAT VV ' V12- 22V2s,, A2 -' - ,I ,III .II , .... .. 2,,.,,22 22 .22 223-A-2,rA,., 2 ,112-V1.,, . M222 2 22. ,2s2..2V2 Af. 51A , V V, A A VA V2 VV1V.1Q.111 w V.f2,..,. , V .11--V..V,1 242 2- VA -We-W -- V -V 'gg V - ge .2,.eF4g52Q5,g425AQ?IQ:swe w 1gSf,1 ??fA2 -V 2 , Lf- 2 :gg-5,g.. ,V , Q-efg22.M .mrgs1..VVV 13-1f2V.1ww?gfsgse2,1S--,-Vx'-11V fA12Pi21VV,,V-Vf Vzir, 11 V---2 1- 1 --2 -. 2-JE2, J V V ' -- 'A -V 1 2V2. s,-s,L-h,h eV,-V2V12,VV.15, -- ,12, ,.:v A A-,- .,, A V., . 1 ,. L,,,.. ..,. , V A A . 2 . 21 . . ,, ML. W -- vx.311g523sgiQf s,Vg22,A2g3fagg2-IVgAsagj 1fgaiViZ.HsVe,VVW f x3vifg?,E?ssa,1 1s21Qifet?fe5 -S ' -Qfvflevfeifw ' ff-Qffiiivff ' '-'1--'V1sV2,'fez -fQi.52'E:,?1P?Zi-SW' tLE55E25M2sfa - 2?k.Q91H22122Sf' ?2-2525516 WQSZSSVA-VV11 iii---SVAHI fm-iii' f'Vf'f- 2ff?'VffV-U ' fwiiftlfif? ?AfSA2zsf'Ew ,. .. .. II -22-gzVggez.2V.1 .. 2 V, . 1:5 215-1., .. 194535535 'VI 'X' F siegssg mg-1 -gQs?s.VV ,125-VI.2, MII. .gg-IIII, IIN' III.. VV253VS.22,I Iig5.I,2,,I,g :22,:22I I 2135-151 - :22 -fzgseif ,' ,maxi ,Vfzafw V 22651522 AEESISHSW ZL-15211 ' 161 gn, '22, -1-we-' , g f -s m II I I , WV A ,. L 1 .353 V-:-1:V':fE22..V-Vf-21 22:'2. '-fm, - ---. 2552 5 .2 I-.'- -- Viserseaia, 25542 12211735 gfmiwif I--2'.1s2V f2VV1g3-3.5 lem. 1zAgs,.V' 1VVV.-25+-' gng:VgQi.1,'5? ,.5,2111-V, 1saf'.V V wgssiig ' ' ., ,I - .. . ..E:g5i :- -v:.::- I,.4-g I--312 1: jam J E 1: -IVL vg22,,fgs.:.,455I l55!ll1L V,iVAi6V5-V VQEVIW5-5-Vk.,s7 - wrqjgglggjgg- 9-323 Q5 1 -H-eV. I,.5V fig: . ,,. 'f25-5'L'1YE, V '- '11-V2.sfV2''A 5!Q.ifV,.5L -E,li37'A-- A-WF -if ' WV' W .. 1, .- V 4' :f1?if : :i- '-22, iii:-ig-iiA1z,s 55241 15541: S2 24P?2As'g1a.:'aV23-F552 31 2215 Q A125 sfegsfz- -:na t ' ' 'if-V--V Jiiiixi 2 ffV 1' pf.-2. .. I -A V '. ,. Q V. 3 L' V - . , 2- V L V , hygyy A,A 5g':.MVj.gg2V,LV2I37Vgg5qg15f-jsi 9555-1.-31135-Vik 35Ijf'm-,5 eezgrigalgglgjifgjffgkif?-if iigig-g'f?5,5fT5jVe1'.Qf i'-5?Al1f,5??H'1f Q3-Ijjgg'g5iV.i4?fftf'A'Vi-525' :jp Qf5ESSE.5jjA-ig- '51-:.fQggjiQ'E1--,E.S1' tis-'fffL?2ZL5Ei5s5eA557 '9'iLif'?5,l9iilkE'1 qS?L5if5LZsTif'fAf57-W 337751 'P 5323 ii gi W , .227 I .V ff-f .2 'sg,955gs21s?1' 2.- I , 72127 ff? iii-ffV'2Ai' ?21fiiVQ,-' 'V 25751, , . 15162 312,- gn I 2.- in -V11V I 11 -. Z, 2':si1g2fQ - le I 32 S533 V ,. VV , ----A1222-11 ew -. A . - -- . e- 13119: 2 ' A V V A ' -V ,- 3 5115341 -ig-AI,:h1.j V - 1, '-K we I : I if V 1 2 :S Q Na, V 551-fV Q '2:-,. e- 142,3:-:ff-221-.fiii':V2Fai--Qiii-222223:-VV:iifVi: 2 I ,552 , '- V- - - ' , . . . 322 , .. ,VNV ,VL,2qV-22112112252 -12.22 V-aV.2.. .1s..2,2.2 .. .. me .12 .. V251 2.22, .MA ,E - -V ,221 , 1 is 2 gsgy f 2gm2Vi?2g .12szg2g1g-52--QsVgs, 1':2z ies . au iigxgw ,g1sz'1 .-.. 9122, Esfifviisz. H2142 figs-22?V ,11 Q5-Miiff'-fwz2s7:1,-21,. .:egg2r:f,:. Q, ,2 2, , . if , .. ge 222, .. ei ,,.. 12 2 , If , 21.22 si 2 ,, 2.22. R , . ., 2 , 2, .. . . . -,. . 2.22 ,, 22 .2,.21 !E,..EE.::...-V. A .2 SIYHE VWVS-, ISIIVQEVW I2,1V3,VVg.,V-2,.ezV 522, ,. ,MI l2.,VI1Vm2I3arg-2,131-,V2.V. I. V IV-2,11-gzn V,,,IIVJ91Vxz::-Vw -V V fw 141912 23.22.16-f's-eA1-fag. ' 52 V-sf-1A221 -viii-fs WV--1V1eV1 A Hufaii : ?L:2Vm2f'V'fX1-2,15-'Aw 'H as - fra-V' .,.. -- 12- mE,nw w-12,V ,VQs2,,2:V3 ,22V11s22-MI., VVLL . I ,jmgm 2,m,,V,eV..2,.2,IVw. 1. ,su , .. I. II m.Is.I . IW.,.2q 1 emi, 1 A . K Q ' TW . ' .- .. i. . f 12V,:.'-V1 K 12222-13. is-1--V V Vi-A-. 1. wi ik A 1: 2, ,VV I9l Frank Woitasiak Maybelle Wood Sally Wood Peggy Wright Pete Wright Dale Wuertz Elizabeth Wylley Doris Yauger Susan Yeager Jennie Yordani Kay York Mark Young Sue Young Roland Youngling Raymond Zaiaczkowski Brenda Zepp Steve Zientarski Denise Zimmer Kathi Zimmer Jim Zimmerman Tange Zink Anna Zoback V 2 A-1222 Hz 1522 22125 22,1 52 2 ei 'Y'-QQ-12 22 .:22,2iw2ie.22-1.5.3, 22 E:2,2:2sH2e2f,gaVg-esW12s12s225V2mggg ggggggefgzmigfsigsgzgginfssfamswfsse 5ifQV2flw25gg75gg35:g7sse1s5VzQii45fgagQQ? ggggggggx2Qi5g5g52g233gg52iZe1Q5fggg I 22 Vw . .muon wow-V3,P2KMf5zE9'f1fi.2 am: - -E52 1' V1--Yr 1-wmV1sfV '- V S7Vf2Aeif2z.. V: is-was-ffAW1SVi1SV.re 1 u'--VN?4fVH2HXA-A-Wif-us35H3VfS111S ' gqgggsws-' .2gV12is get-SJEISE iw-121-eif 521sVfigsQVw Li6f??f5?5 ilisiffsw s Ski?--M112 .-::s:-:gg.V::f:-:- '-2.fs2-!2:V- V Vs QLWHS -21fs2if!e,1Vf'.,2 Vf'1ff21vV KS2122 nge!-221 Iw V .Q 1-a:.-1:- H:-jyik Egg AE Swizxiix , VVgV2'7g.Q ,122 ' .Si 5 fwfstgsg I- I .Q .ir WWA is- : . a If 22 VQW22 2,2222 A2V12V, , I 5: i ':: :-' 2':--- SK A is 11: '. ,. xc., :-222:-1. Pheggsi my M- .' -V iffy! fbssxxizm 2V II IIA'-II:2 : s- 52-21. 252 , ,aA. 141,z:2I ?' S 25.225 -Vg-2. . I ew 223351 22- S22-wi V. 112--V. g2,2qgI V V11Vmggq IMS, me22-as-EV:--'.:--5.5: 22.--22, ,I , 2. 222- - , :,V- -V VIL -: .:'V '-: 1m,1sV V311 we, ,sae fi- wig .2 V 114215-VVV 1.12152- - ',., 22-Ve ,,--,.-- 'm22e?52e s2 -- 2,EV3ig?7gAV5- If-343551521221 55595 ' m,2mVI12V312251 V w -gs y3g5ggg:qg211x1e,.eV ? 1 gzssissffs seg . 1 V5Af1g2V.s1,..'Vs2v122122- w-SVVIIVTS Sf' 'V . '11:V.:.': :-' X . 22.V -' :- i2'I ' i t . - A-V-if r .... , 2: gig sed.-V-VVVA ,, y V - mgzp- V,,22e-o-,Vw-V.-'. V-m -A --V - V .einem-V1VV1-V.-,.. V Vs -V2-VA--V-AV 2, ,. 2 . A . ' 12-Vu:12-vm-.2n.1.-vw-fVh'VP'f' 15, , V-Vw- V V1,, ,Q ,W-1,, 22g.V,.1A 22 . A as as V 222 +wf22.s-if 2-2++.g1, V2, . ,V V ,, V , , A V 2,1 V 'ti 'W . . V. -- VV 2 fini! 21V- ms'QVWV11-V..2,,12,,1253-552-qAffsf71AVV,-.AV12, ,. 6 ,, V 2-2 H2 +2'12-na v'2i- -nd'9vm-e2- .51 5 - V - :V :AVVQ we .V 2 -.2-V ,, ga' 52if.ii,.5:: um: yay-A V-:v . ' . V- VV.Vz:'e summits I -mens ugly ,VWV ggsg gggjjgq-K 'f1if'zdRi3l-y . Q g I 2 ,I wg '-:: . :E. 21555: 21554 2515 A- ,ii '-4:-.'55,',,,',,Qff Q , -F-eg: -:,-i' Cf ii :ii WV--5 5,1551 7:3725 iii: 8 ..H H -2: 5 iiiflw 1263- ,Iggy . ,: ' we , 7-.I lg-zrzsvii I':sfQg5E:: ' ... ..? Lg iggglggg ?25?5335V -5? ., Lwzezmfi E: ?E-' ' - :- saga? .4--, QI- 2- . .1 V.s,Vi?I5f' fj?gA'V ,iff 35-V55 :Q -',. Zi'7 Fi-SSELEEYZ ifQQtg59iQgg5fjf5f Bgiflfiifiii I .. V . .... - V V-VVA - -V1-V. 222V1222V2,1 V25 12VVVA 2V2,1V2,V11 A ,. ., 211: gs: xi I 5,,,,,g ,:-Vg12?ssw21w gi-21515 -Y' s 'K ---iz wif' - -,v ..g fwfsexeisf -1325-A J.-.S-'V, . K '12---A22f ' 4,'1,V ' - '.i5if5i7T51if2:'?i -P? - 2321. .9?7i.55i.e,,1.s fefiz55Qgf'fA?iEi -32.553155 :'f1V'liL Siiifi 515' VV -fvxri grif . .evV11ss2.s'VV'Vi:VViEiEA5'V1,1V'1iV f-V:-VV' A . - ' . :fi Had- mn. .. -:::s'.. :s::':: :: WX Yk msfmilsiv'A-We-fff-?Z1i5?L55iIfiEi5iiifff?A? V 11ZAfiZAS2TSifA'3WU97il?5iIiiTQi'1s3'-W-WLS EV'52EEFS5ifW!'A5'f3S6917R1'1'Q?7i'Wf'3'54f1 if1'i 9'W5i5i3?Q'W L 'f?bi93f. .. er. 2 V WV -V -2VA1sV-12V ...W V ,.2 V VV 2 VV V f-AAMA A V2 My .. F - A 2-ew Y 2 VmV2,222.,VAA,V . V V 222.122i1s2VAegw. V- 2,2 WVE22. V - .122V2,VA.V-2, .. 2Ve22,22.,A,.VM .---:.'-2.2m: 'f- ' ' 'iii?2Q5A:J:i3l-- Vezgesisaifef ' 2s3?geIsafTi2,1 42515524 iiiiiligiiiigiii 2-'A 93255599- --f- - . -22 .22 22--. --mm 2sVw,12,1Q, VVVVQSQQV. ,2,,. ,gI2gy.,. M, 2,X.,.2f ':a-:'aa:'V ' f 51.22 -51121559 hge ' 5922221 22, 12 21 mf ::2E:'. '. . - -..--.-::2.--- '5F.22'f-...- assess '1e '-ai -:: EMS?-522 45'-we I -I1 .'V.. II :: :fH2 52V.w2 -5--. '---' -2 fig? gs, --V 262.5 Vff swan ZV.. 2 ' W ff-:. 21.V- ' -1 , ., --2,-- 2:2 Wg- 1 . 2. 2- -6-fin 2 21 fe21s2V12f - .:: - . .. V , Z .. .1 V1. 2 S 2512?-12Vize-Q 1-2 W-Sieve 22?5f3,2:s-M wav-Sa II 2253.1 52212221 .A,,,V . .2 --A-VV A2e2,222w-V 22 WV Q, Eggs-1-'.-'-1.'-',.sEf2fZ. 'ii ' 12 .. Eaggesilirsf V1 5-1113 'Q 4' Q Abi - 6 ', ,. , . Rags W- 122: .. gnV2Ig12jg1-'ff 1 xv, -1 5:22 , - .. I ' Ai Q 2.11 1 . F1 2- :f5gg?YAg5TfQTV'i ' 5' ?- -W ' M . ?iS?M ' -fwzg- in g - Marc Whitacre George Whitaker Ginger White Jim White Paula White Donald Whiting Raelynn Whitman Bill Whitmer Chuck Whitt Alicia Wiggins Matt Willer Debby Williams Dennis Williams Tom Williams Curtis Willis .lim Willoughby Debbie Wilson .Ierry Wilson John Wilson Robert Wilson Karen Winans Kevin Windrem Bobbi Mlinstead Stephanie Witkowski Kris Wohlfort Kfviievtwess'-fefisiisiswsmaw--QV rv.mee4-11s?fs2'f:?s?1Ai2Alii--MV -V VW-- ,. MfwAQ122V22V12w1V2V-e 2 22V-2V1-2-22VVVA- -VVA V1-,.2VI V -V -2 2- 2 D,,.,e ,, 5 eiV2iPzV1?21gs ,S ..,,. 2 ,,..,, ' V-?2V-f4Afw2V gs,-.122 -121,-V .gg?5g2g3S1' :-2. 12 gage 4751 1 22562, ixllslsiils ' is 1 V:fV. VV:Pzufx 222-2s,VeV -, ., .. -gm 2,112 .V21-,II sV51fVI 2 -::I3 ffl-29 T1-2 V: - .xi 2,,V,8IVs,V ,V ., 2-3 L, VQQV 12 V - - - ,- . MVS 21122V1221s2. VV-w,,,.,,11 V2 -VVQSV1 .,.,, 2,.2,, V,-V211, Zisisfgif slqf-7Igj:2 sfigwg sb1isgg,III fVV-351. fs, -P52322-5 12V.12VvII,. - VVS,-V3-V..V -22 ,V22-Vw 'V--V--V112V-2,,.S,.22V we V1sSV:f2?f: ,mm 2. .,., 1 V AAVVA VVV. . .2..2,2,.2V i.,, 22,223 eV 22VAfV..,12,2 .2V12V,.2, ,,..I,fI,,.,s,,,IIII..I,H5m 1, , ,I,,I. 14s2Vi4'.12,V A2 .-f,:s,f,,122,g--1-mfs Q 152,212-VV V -ww - az1AVV2V V22 ,, 2,IV,:QV.1-T'isVa1f1-1,1 ,1A,.2A-1V-I, -.2u.'g,:i'-1 :'. ' V sQ1.:f',2 -rg-ffiffh 1. V2 lcigwas-zgv-V mr: V K 1sexeaf-m2awg221,2222212fV2sz22iiw22sw -QV-2 2222 ,222-., . 2 , 2'1ex2V22se22A1fVV .25 iw. .. 22- .. 'L21ge'wHw- '-Y-f?sV.ig2Ll?2 V ,222 Ig, .,,. . 22322212 - mz.a21'sg: V -W. ,.2,V. 'AM2 'SVV--VV -Shaw, gs, .2 H215 VA2222 2,.,,222 ., I ,. IW, .,.., ,. I,I I .. ..,. ..V..- V,-:., .. 1.,V.1I,12,1, 2-..-s.--: V1g,2.e2V2,51 1.,A2,.2,.gIV12s-15 2, is,. ..,.... ., .V Vg-evfegfazw 1122 gV122V1s222- Vg- VV 12V1 VA vig. 5 1 sw 2 -2 2 22 s 22 S 9? ie - 2 , Q22 1? 229 sa, Q sk 5232 5 X 2 2 ,I A 2 R, sg 5iZi55gShSf'265 ' 5 2 eiismi esazewszx .. Ig 22 2' 2 ' wig 5 'is 4 If 23 2 Q 4251 i 2 'il ' 25 ,SS 2. ,. ' V1sS2142,12,1si12sT6VA-M - -. - 1515-42-5 s122122w1s,1V- V.12,11--1 .12,12,V:VV -V V- f2V1w.1--.1- .2 1A ,,.2f,12,1: sm my ig, 5 VV -2.1 1zV.wz1e,.5: : 2eV125I2fI1 . 2,2- --Vsm . , .- 'r-sw M55 VVV1mV.22.2222s,?'229E2 - 5A-.1112V11 5, ,1eV12-VW 2. VA . 2822 1 . i:-zz:feVe12-VV-11--55312 ls 'Y S iw P vs , ,D Q 22 2, X S 527 25 2 is U52 as 1 3 S s 'Q 12:2 2,1 22 Q I I2 e I, II 232 23 2 YEL! I? . if! ap, I A S .. , . 4 .... . V V 2 V,. V 2. 22- -V V 5 if Vue-:sr mi I22- 22-,,gIVI,,-,I V-:I22f22,,-2. 2. QQI-2? I.9z,Vzy5 Ii 8 Q i A 29-V: K 5 M S 2 Vm.1eV.1 ifszswz 2 232 2 '22 S Q 3 2 2 22 1 5 2 ,, 2 2 22 ,, fe 22 1 9 HEI S 229 N Y f II I 2 M 3 2 K 2 2 w ' Sk s ,V is 52 .2 22 22 s.,,2 sm .s, ..i2.22,2.2 2V,.21,122,V 28-25 V- -agus 3752115 Lk - Vim ,Ag - K' --f V -2 2, 2 1 1 an w 22 2 -W-22212211 1 2 1 . 2122V12222ef'22222f1fwV2w22 Q12V,g2I5y222212f2,w5Vw2Am3 s12g2222 .... 122112122sVAV2A LV-222121312 Vee22V222w H s112m22 23,55 1mv22V1 .. 2: -1 21122121212 V.12VA2b --122 22 . - .1 . 18212912-V W 0 22 V A ,1sV1A-VV,- ..2MEIs I -rf'u22fs2., V ifgsiigffzsw-22V AV2V sVf221112n2g ffigagffgeieiiefiifeiitgigfg e,V,,,VZ,YVV V-VVs22mw.2M,, 22222-- .,2,, sLfm22222,1.g,. .. -VVEQSSVS222 ' 'fV::ss5'3 A222 -2,wV gVw112-iV-- - 22.-22222 ,V i b2:.22 ' 'I Z'-i VgV.1V,1-,I12, V 311-Liv V mesa Eiillieffs 'i 2:1-21.-V ,I V253 .1 f ii ::H ..::'2 A' 1- ..,.. 2,.2,2,I.,2 V 1 V 1 1 ' 1 1 1 ' 1 1 1 1 1 1 1 1 1 I 1 1 1 1 1 1 1 1 1 1 1 1 -1 1 1 1 1 i 1 ' 1 .x-A Q .J ' .'. ' , or , 0. . .- ef 1' l ' ld 'Hsu 0 g ' v A . ' ' - . V 2: 1 i - . -' - ' ' . '1 . -1 -1 -1 . V ' ' .' . lpA.vls .' Q ', E . , :sg I: .'. 1 a, ' . ' ' ' , v , . . - , . I J. , z,.?'...Z'.:'agi2n Q a l.'.- 53 ,' '..'?' ' ' , ' S- - ' l 'Q or l.,',.. .T-hr .u 1.' ..' o .' rg ' . :. 4 ' 51 1 n , K' . Q ' ., Q . ' in , 4 'MI .3 .. , Q , .- ft -' ' . 2oGc 0 , ' ...' , ' 0 ' A--v 3711- -.4' ' 5. -M' . 2 . 5 Q V , . - ' . '. ,'Q i L - Q . h - 1 - ,, sgj! 3. . , 4 1 - 'H . -. ', ' ,. ..f r.': 4+ -'FA' '. ' . . I ' ' -U' -,L . 4',!f.! , V vit. 74- - W 2 It K my 0 M 'ffv f ' 'f If L.. 1, 0.'-gd . w. - ' 'Q' 5' 4 -...Sa ' 4.1.1,-W K . ' 'E ,Air +551 11h f - -. 2 1- -Q g-, W 1 MT ' ,W 1-'O' , 1 ' ry '. , . 4 '99 -ff 4 A4 bg, r , -1 3 Ml, ,W 1 4 M ' -1 g aw.. , -.f, , ,Q ,,f,.1.ZI , fx ' 1 ., 'M' ' ' 1- H ' ' A' 'A' ' f l ' 'Q wi . 9 .,.if -wwe - 1 9-' U . ' ' V ,I ' f ' M Q, 1 ui. 0 - 1 1' 1 - , M- 4, . p,, f. . vs .g .f ...-.. -IQ Z wt V ' h K , -n arf., O ll! L. nw l tg. : go may 1 . Atv-4' I '90 nhl .mas p , ,,, K 433 f ' . . -.U ' ,V ,oi 71 1 1 l Acknowledgements j The 1968 Olympian staff gratefully acknowledges the many people 'who have ' contributed to the yearbook. We extend our special thank you to , . . A l Mr. Conrad Quenelle, Principal P Mr. Eugene Guirl, Assistant Principal f- Mr. William Kemmeries, Assistant Principal Mr. J. McGee Evans, Dean of Boys 1 1 Mr. Albert Slawson, Dean of Boys Mrs, Emily Cox, Dean of Girls 2 Palo Verde Bookstore 5 , Office and Maintenance Personnel Student Body and Faculty Parents of the Olympian Staff A Ray Manley Commercial Photography Mr. Ray Manley, Proprietor M r Mr. Lynn Sanders r Hennington Studios A Mr. Gene Scott, Representative Newsfoto Publishing Company Mr. Mel Wakefield, Representative l 'M ' ,sis ' '.: ' 6 ' , .A .r ' , ,. .. . ,.wq.a'a-!f.fAJ..-awww 7 ' il 'H Q' so K ,Hy B 1 4 lil-Fl' 0' Ahh wt -' 3 gtx' 'E . 4 - y-V v ' K Q . 3 , l ' i l , ' I 2 0 ,qw X 1 . Q . 1 1 v ig, 5- 1 , 'W an .lr 0- I f O n- , .Y n ' wir ral-JL. A.,. in gn . Q . , A 'A , N, ggi 4 in I ,9:.i,s1.,.5,1:' S8 l I J.. 1, 3' 3' 'l'fv,x'J.g.u , , fi an ' . . A V f' ' ' A . ' pu ,R ' M . , it ,,. -. ,..,. pi-A 15 -,Ur ----'cr' f f ff -M 55+ ,f , l, -W '-irllgo jilafgf - ' - S , or-x. v . , .ii w-tgftfwy , , Wy' to ,Q ir .M . u -an-'ii Vo in-rd f at , ,, ,v is , w-Aeuwqwaw frrwfs New V, t m. A , Www f,.x, l x M . ,.,,..s.f, 4,11 m 4 , . A K F ft V A ' , 4 it-MW l ACORN, KIM: Gymnastics I: Wres- tling 2,3,4: Weightlifting 2,3 llntral. ADAMS, ANNE: Quaclrille Team I: Drama Club l,2: Art Club 2: Stu- dent Council 2: Social Club Chair- man 2. ADAMS, HANK: Homeroom Federa- tion 3. ADAMSON, RALPH ALCANTAR, ALEX: Concert Choir 2: Spectra 4. ALCORN, STEVEN: Wrestling 2,3,4 llntral: Weightlifting 3,4 llntral: Judo Club 2: ICBM 4: AFS 2,3,4: Chess Club 3,4: Red Cross 2: Spectra 4. ALFORD, JEFF: Tennis I: Track I llntral: Basketball 1,4 llntral: Baseball 2: Football 4 llntral: ICBM 4: National Honor Society 4. ALLAIRE, ANNE MARIE: Girls League 4, Folk Club 4. ALLEN, ART: Homeroom Federation l,2,3,4: Basketball l,2,3,4: Base- ball I,2,3,4: Lettermen's Club 2,3,4: Advisory Board 2,3: Vol- leyball 4 llntral. ALLEN, SUE: Titan Lite-Writers 2,3,4 lPres. 41: Yearbook Staff 3,4: Ad- visory Board 4: Red Cross 4. ALLEN, WANDA: Donut DolI I: GAA I: Jotter I: French Club I: Judo Club 2: Art Club 4. ALLEY, LEE: Basketball I llntral: Golf 2,3. ALTUNA, RICHARD: Red Cross I: Homeroom Federation 2,3,4: Bas- ketball I. ANDERSON, CHERYLL: Red Cross I: Thespian Society 2,3,4: DECA 4: Archery Team 4. ANDERSON, EMBU RN ANDERSON, GREG: Basketball 2 Ilntral. ANDERSON, LESLIE: Homeroom Fed- eration 3: Human Relations Club Sec.-Treas. 3: Songleader 4: Ad- visory Board 4. ANDERSON, NIELS: Chess Club I: Proiectionists Club 'I: Basketball 3 llntral. ANGEVINE, LINDA ARCHIE, PATSY: Mixed Choir 2,3: Red Cross 2: Golf 2,3,4: Tennis 4: Softball 4. ARDREY, CATHI: GAA l,2,3: Pep Club I. 1 ARDUINE, FRANK: Trade 8. Industrial Club 2,3: FFA 2: Broken Bow Club 2,3: OKIA 2: l.c.E. 3. ARGRAVES, ED: Football 'I,2,3: Bas- ketball l,2,3: Track l,2,3,4: Cross Country 4. ARNESON, MARK: Football l,2,3,4: Wrestling l,2,3,4: Track I: ICBM 3,4 IPres. 4I: Spirit King 4. ARNETT, PAM: Ski Club 4. Senior Activities ARNETT, PAT: DECA 3,4: Ski Club 4. ARVESON, JANET: AFS I: Folk Club I: Treblettes 2: Girls' Ensemble 2,3,4: Concert Choir 2,3,4: All State Chorus 2,3,4: Jubileers 3,4: All City Honor Chorus 3,4: Year- book Staff 3,4: National Honor Society 4. ASHCRAFT, THOMAS: Football l,2: Wrestling l: Track I: Speech 3: Speakeasys 4: TV Production 3,4. ASTON, ROLLAH: Football I: Bas- ketball l,2 lMgr. 2I: All State Chorus 'l,2,3,4: All City Honor Chorus 2,3,4: Concert Choir 2,3, 4: Jubileers 3,4: Stage Band 3,4: Orchestra 4: National Honor So- ciety 4. ATCHISON, ANNETTE: Red Cross 3. AULT, ALAN: Homeroom Federation l,2,3,4: Track I: Judo Club 2,3,4: Volleyball l,2,3,4 llntral: Bas- ketball l,2,3,4 Ilntral. AURLEY, SHARON: Red Cross I: Folk Club 2: Ski Club 3: Pep Club 3: Class President l. AYERS, DAVID: National Honor So- ciety 4: Folk Club 3,4: Band l,2: Orchestra 2. AYLSWORTH, SUE BABAUTA, KEN: Latin Club l,2: Bas- ketball I: Baseball I: Basketball 2,3 llntral. BABINSKI, KAREN: Basketball 2,3,4 llntral: Softball 2,3,4 Ilntral: Volleyball 3,4: Hockey 3,4 lln- tral: Badminton 4: National Hon- or Society 4. BACKES, JEANNE: Red Cross I: Pep Club l. BAILIN, SHERYL BAIRD, MARLA BAKER, RICHARD BALCOM, MAURY: ICBM 3,4. BALL, WILLIAM: Red Cross I: Bas- ketball 'l,4 Ilntral: Freethrow 'I Ilntral: Volleyball l Ilntral: Track I: Cross Country 2: Gymnastics 2: Swimming 3,4: ICBM 4: Let- termen's Club 4: Ski Club 4. BANGERT, JERRY: Basketball l,2: Pep Club I: National Honor So- ciety 4. BARNETT, MAX: Wrestling 'l,2,3: Track I: Red Cross I: TV Produc- tion 4. BARNETT, ROBERT BARWICK, ERNIE: Football 4: Bas- ketball 4: Homeroom Federation 4. BASS, BYRON BAZURTO, BOB: Track l,3,4: Bas- ketball l,2,3,4 llntral: Football 2: Volleyball 4 llntral. BEDDOW, THOMAS: Basketball Mgr. I: Basketball 2,3 Ilntral: Volley- ball 2,4 llntral: Wrestling 3 Iln- tral: Senior Leadership 4. BEDUNNAH, KAREN: French Club I. BENDER, MARGIE BENGE, JOHN BENNETT, BRAD BENTLEY, EVA BERRY, WILLIAM: Volleyball 2,3,4: Softball 4. BERTLING DORENE: Pep Club 'l,2: Cheerleader I: Homeroom Fed- eration 3: Red Cross 2: Baseball 2: Volleyball 2,3. BEVER, DARYL: Wrestling l,2,3,4: Cross Country 2 llntral: Letter- men's Club 3,4: Key to the World l,2: Guidance Advisory Board 3: Russian Club 4: National Honor Society 4. BILLINGS, LINDA: Advisory Board 2,3,4: Post Staff 3,4: Pep Club I: Anytown 3: Senior Forum Com- mittee 4: Human Relations Club 4: Speech 4. BIONDI, KAREN BIRNEY, BILL: Drama Club I: Radio- TV Club 2: Thespian Society 2,3,4. BISHOP, STEPHEN: Baseball l: Bas- ketball I: Football 3: Golf 3: Baseball 4 llntral: Basketball 2,3, 4 llntral: Volleyball 4 Ilntral: Tennis 4 Ilntral: Red Cross 4. BLACK, TOM BLACKWELL, MARGO: Pep Club 2: Homeroom Federation 2: Girls' League 2: Gymnastics Club 3,4: Gymnastics Team 3,4: National Honor Society 4. BIECHA, BONNIE BLUMER, LOIS BOBBIN, CARL: Student Council 2. BOCKMAN, MARY: AFS 1,2,3,4: Folk Club 2,3,4: Chess Club 4: Capricians 4: National Honor So- ciety 4. BONEWELL, CATHY: Concert Choir 2,3,4: Yearbook Staff 3,4: MENC Chorus 3. BONHAM, KAREN BORGE, PATTY ANN: Pep Club I: Red Cross 2,3,4: Ski Club 3: Drama 2,3: Thespian Society 2,3 BOUTON, JOYCE BOYD, KAREN: Scope 'l,2: Drama Club l:TrebIettes I: Mixed Choir 3: Gymnastics Club 4. BOWDEN, JOHN: Basketball l: Track 2,3. BOWER, SCOTT: Basketball I Ilntral: Volleyball I: Volleyball 2 Ilntral: Basketball 2. BOWMAN, DALE: Modern Dance l,2: Pep Club I. BOYER, RANDY BRADSHAW, CLAUDIA: Girls' League 4. BRAMBLETT, SCOTT BREWER, BILL: Concert Choir l,2,3, 4: Homeroom Federation l,2,3,4: Yearbook Staff 2,3,4: Titan Lite- Writers 2,3,4 lPres. 31. BRITTON, DEBI BRITTON, SUSAN: Spanish Club 3. BROCK, ROBERT BOCKMAN, RONALD BRODIGAN, LYNDA BROOKS, GERALD: Basketball l,2,3, 4: Volleyball 4 llntral: Math Club 3: Lettermen's Club 4. BROOKS, LAURA BROWN, DONNA: Drama Club l,2: Homeroom Federation 3: Key To the World 3: National Honor So- ciety 4. BROWN, PAULA BROWNLEE, JEANNE: Volleyball I: AFS 2: Advisory Board 3: Guid- ance Advisory Board 3: Girls' League Council 3,4: Forensics 4: National Honor Society 4. BRYAN, JUDY: Tennis Club 2: Ski Club 3: Tennis Team 3,4: Na- tional Honor Society 4. BRYERS, PATTY: Advisory Board l,2, 4: Folk Club l,2: Homeroom Fed- eration I: Debate Squad 2: AFS 2: Junior Achievement 2: Trebel- ettes 2: Mixed Choir 3: Guidance Advisory Board 3: Songleader 3,4: Spectra 3: Stage Crew 3: National Honor Society Vice-Pres. 4: Senior Forum 4. BUCHHOLZ, BOB BUCKLES, JAMES: Homeroom Feder- ation l,2: Student Council l,2,3: Key Club 2,3,4 lVice-Pres. 33: Newspaper Staff 3: Quill 8: Scroll Honor Society 3. BUCKLES, ROBERT: Ski Club l,2: Track l,2: Basketball 1: Football I. BUETHE, RICHARD: Red Cross 4. BURKIN, NANCI BURNS, JAMES: Football I: Wres- tling l,2: Track I: AFS 3. BURNS, STEVE: Class President 'I,2, 3: Student Body President 4: Spir- it King l,2: SPOT 2,4 lVice-Pres. 41: Baseball 1,2 llntral: Basket- ball l,2,4 llntral: Boys' State 3. BUTLER, DONNA: Badminton I: Na- tional Honor Society 4. BUTTERFIELD, LINDA BUTTON, BARBARA: FHA 3: Tennis 3,4: Hockey 3: Red Cross 3: Homeroom Federation 4. BUZZARD, WAYNE: ICBM 3: Basket- ball 3,4 Ilntral: Volleyball 3,4 Ilntral: Judo Club 3. CACIOPPO, CAROL LEE: Homeroom Federation 2,3: Concert Choir 2,3, 4: Treblettes 2, Mixed Choir 3,4: ISec. 3l: Gymnastics Club 2,3: National Honor Society 4: Song- Ieader 4: Yearbook 4. CALLAHAN, ANA CAMERON, SCOTT CAMPBELL, FRANCISCA: Gi r I s' League 4: Homeroom Federation 4. CAMPBELL, LINDA: Concert Choir I, 2,3,4, Jubileers 2,3: Girls' En- semble 2,3,4. CAMPBELL, PANNY CAMPBELL, SHERRY: Yearbook 4. CAMPOS, AIDA CANADY, BILL CANGIOLOSI, RUTH: Pep Club 2: Girls' League 3: Red Cross 4. CANNON, PAMELA: Ski Club 2: Pep Club 3: Red Cross 4. CANRIGHT, CLARK: Football I,2,3,4: Weightlifting I: Track I: Wres- tling I,2,3,4: Basketball 4 Iln- tral: Advisory Board 4: Homecom- ing Attendant 4. CANRIGHT, MARK: Football I,2,3,4: Track I: Wrestling I,2,3,4: Gym- nastics I: Weightlifting I Ilntral: Tug-of-War 2 llntral: Basketball 4 Ilntral: Lettermen's Club 3,4: Student Council 4: Class President 4: Homecoming Attendant 4: Ad- visory Board 3. CAPLES, KELSEY: National Honor Society 4. CARNAHAN, LINDA: Spanish Club I: Pep Club 2,4: Thespian Soci- ety 2,3: FTA 2: AFS 3: Russian Club 4: National Honor Society I. CARPENA, ANDY: Wrestling I: Red Cross I,2,3,4: Volleyball 3,4 Ilntral: Baseball 3,4 llntral: Foot- ball 4 llntral: Wrestling 4 llntral. CARPENTER, LAWRENCE CARR, BARBARA: Senior Girls' Choir I: Mixed Choir I: Class Vice- President I: FTA I: Pep Club 2: Homeroom Federation 2: Year- book 3,4: Model UN 3: Scad 3: Songleader 3,4: Spirit Queen 3: Homecoming Attendant 4: Senior Forum 4: Class Secretary 4. CARRILLO, JERRY: Baseball I,2: Red Cross I: Football 4 llntral: Volleyball 4 Ilntral. CARILLO, SILVIA CARTER, DAVID: Post 2,3,4 IEditor 41: Young Citizen 2,3,4: Advisory Board 3,4: Speech 3,4: Model UN 3,4: Scad- 3: Senior Forum 4. CARTER, JERRY: Basketball I llntral: Arizona Club 4: Map Department 4: A.V.A. 3,4. CASEBIER, RODNEY CASEY, NICK CASSIDY, MICHAEL CATE, COLLEEN: FHA I: Pep Club 2: Girls? League I,2: DECA 3,4. CELENZA, GLENN: Wrestling 2 Iln- tral: Volleyball 3 llntral: Bas- ketball 3 llntral: Gun Club 4. CERENDER, GARY CEREPANYA, MICHAEL: Football I,2: Track I: Basketball I,4 llntral: Football 4 Ilntral. CHAISON, ERIC: Stagecrew 3: Model UN 3,4: Homeroom Federation 4. CHA RUSOPKY, MARK CHARVAT, CINDY: Pep Club I: Gymnastics Club 4. CHAVEZ, AMANDA: Red Cross I: Ski Club 3. CHAISSON, SARAH CINQUEMANI, PETE CLARNS, JAMES CIPARES, KAY CIRZAN, LES: Stagecratt 3,4: Thes- pian Society 4. CLANCY, JIM: Wrestling I. CLANCY, RONA CLARNO, JAMES: Football I,2: Track I: ICBM 3,4. CLAUSSEN, DARRELL: Basketball I, 2,3 Ilntral: Softball I llntral: Tennis 3 Ilntral: Football 4 lln- tral: Drama 2,3,4: Thespian So- ciety 4. CLAYTON, LENNY CLEAVELAND, JANET CLEVELAND, MARILYN: DECA 3,4. CLIFF, KAY COATES, DIANE: Pep Club I,4: Girls' League I ,3,4: Stagecraft 3,4: FHA 3. COCHRAN, ANNEETA: Homeroom Federation I,3: Girls' League I,2, 3,4: Treblettes 3: Gymnastics 3. COLE, BOB: Football I,2,3: Track I. COLE, NANCI: Pep Club I,2. COLEMAN, RICHARD: Track I: Cross Country 2,3: ICBM 4. COLPITTS, BEN: Football I: Basket- ball I: Football 2 llntral: Bas- ketball 2 llntral. COLVILLE, ANNE: Advisory Board 2, 3,4: Pep Club 2. COPE, ANNE: French Club I: Stage- craft 4. COPPLE, STEPHEN: Wrestling I Iln- tral: Track I Ilntral: Volleyball 2 Ilntral: Red Cross 2: Band 2,3. CORDERY, FRANKLIN: Football I: Spanish Club I: Gun Club Pres. 2: Baseball 3. CORNELIUS, JOHN: Band I,2,3,4: Stage Band I,2,3: Wrestling I Ilntral. COSNER, DOOLI E COX, ROSEMA RY COUCHENOUR, TERRY: Chess Club I: Baseball 2. COULBOURN, GARY: French Club I: Football 2. CRAMER, BRUCE CRANE, HUGH: Basketball 2 llntral: Softball 2: Gun Club 3. CRANE, LINDA: Latin Club I: Con- cert Choir 2,3,4 ISec. 4l: Jubi- leers 4: Titan Service League 3. CRIM, JAMESON: Track I: Wres- tling 2,3,4 lMgr. 3,4l: Table Ten- nis 3,4 Ilntral: Wrestling 4 Iln- tral: AFS 4: ICBM 4: Lettermen's Club 4. CU RTO, TOM CUTCHALL, MIKE: Tennis I,2,3,4, Basketball I Ilntral: Baseball I llntral: Football 4 llntral: Letter- men's Club 4: ICBM 4. CUTSHAW, DAVE: Volleyball I,2,3 llntral: Basketball I,2,3,4 Iln- tral: Softball I,2 llntral: Baseball 3,4: Lettermen's Club 4. D'ALFONSO, SUSAN: FTA I,2,3 ISec- Treas. Il: AFS 2,3,4: Red Cross I,2,3,4: Ski Club 2: Judo Club 2,3,4. DANIEL, DIAN:. GAA I,2: French Club I,2: Student Council I, Scorpionettes 2: M ec h a n ical Drawers Club' 3: Pep Club 4: Ski Club 4. DANIEL, STEVEN: Basketball I,2: Football 2,3: Lettermen's Club 3. DAVI, NANCY: Pep Club I,2,3: Girls' League I,2,3: AFS 2,3: GRA I,2: California Scholarship Feder- ation 3. DAVID, MIKE: Gun Club I: Wres- tling I Ilntral: Baseball 2 llntral: Basketball 3 Ilntral: Homeroom Federation 4. DAVIDSON, DENISE DAVIS, ELENA: Chess Club 2: Pep Club 2: Psycology Club 3: Judo Club 4: DECA 4: National Honor Society 4: Junior Achievement 4. DAVIS, SCOTT: Football I,2,3,4 llntral: Track I: Football 3,4. DAVIS, SUZI: Homeroom Federation I,2,3: Girls' League I: Concert Choir 2: Mixed Choir 3: Ski Club 3: Advisory Board 4: DECA 4: Songleader 4. DAVIS, TERI: Red Cross 2: FTA 2: Spectra 4. DAVIS, TOM: Volleyball Captain I, 2,3,4 Ilntral: Weightlifting Cap- tain I,2,3,4 llntral: Basketball Captain I,2,3,4 Ilntral: Gymnas- tics I: Judo Club 2,3: Chess Club 2: Red Cross 2, Homeroom Fed- eration 4. DEARTH, LINDA: Titan Service League 2: Thespian Society 2,3,4. DEBRECENY, DENISE DECKARD, JIM: Band I,2,3,4. DELOF, TERI DENOMY, GARY: Basketball I Iln- tral: Track I,2,3,4: Football 2, 3: Lettermen's Club 3,4. DENNIS, ROBERT: Chess Club I,3,4: Basketball I,2,3 Ilntral: Volley- ball 2 Ilntral. DENOGEAN, RAY: Track I: Gym- nastics I,2,3: Volleyball I Iln- tral: Art Club 4. DENOLF, WENDY DEPPE, ROBERT: ICBM 3,4. DESHAZER, STEVE: Tennis I: Band I,2: Stage Crew 2: Chess Club 4: TV Production 4: Tennis Team 2. DICKENS, SHIRLEY DIETZ, SHARYN , Skeeter Fox and Bob Stanbrook acted out a play in their senior English class. Many students were required to write and perform plays using simple props. DIETZMAN, THOMAS: Gun Club I, 2,3,4, Volleyball I llntral, Foot- ball 4 llntral, Football Manager 2,3,4, National Honor Society 4. DOEPKE, JOYCE DOMBROSKI, DUANE: Basketball 2, Volleyball 3 Ilntral, Baseball 3. DONOHOE, CAROL DORAME, YOLANDA: Red Cross 3, Homeroom Federation 3, Girls' League 4, Junior Achievement 3, 4. DOVERSPI KE, JAYE DOWELL, CAROL DRAKE, JOYCE: California Scholas- tic Federation I,2,3, Homecoming Queen I, Choralettes I, Foreign Language Club I,2,3 lSec. II, GAA I,2, Pep Club l,3, Girls' League Cabinet 2, Maidens Ser- vice Club 2, Drill Team 2, Home- room Federation 4. DREW, STEPHEN: Wrestling I, Bas- ketball 2 Ilntral, Judo Club 4, Gun Club 4, ski Club 4. DREWES, GAYLE DRIGGS, KEN DROEGEMEIER, DAVE DUDDLESTON, THOMAS: Basketball l,4 Ilntral, Swimming I,2,3,4, National Honor Society 4, Spec- tra 4. DUDEN, WHIT DULL, JANET: FHA 2, FTA 2, Pep Club 2, Girls' League 2. DUTTLE, RAY DWIGGINS, ROY: Basketball 2 lln- tral, Wrestling 3,4, Football 3,4, ICBM 3. ECKHART, KEITH: Wrestling l,4, Gymnastics I, Wrestling 2,3 Iln- tral, Volleyball 2 llntral, Chess Club 3,4. EDDY, DIANE: Treblettes 2, Gymnas- tics 3. EDWARDS, DONNA: Girls' League I. EDWARDS JOHN EDWARDS STEVE EDWARDS, EVA: Drama Club I, Pep Club I, Human Relations Club 4. EDWARDS, WANDA: Girls' League l,2,3,4 Pep Club 2,3, Home- room Federation 3. ELDER, CHARLES: Volleyball I lln- tral, Softball 2 llntral. ELLIOTT, SYDNEY: Titan Service League 2, Forensics 2, Thespian Society tion 4. 3,4, Homeroom Federa- ELMS, BARBARA: Treblettes I,2,3. EMERLING, FRED: Tennis I, Cross Country 3,4, Track 3,4, Football 4 llntral, Basketball 4 llntral, Lettermen's Club 3,4, National Honor Society 4. EPPSTEIN, STEVE ESPINOLA, LARRY: Track I,2,3,4, Cross Country 2,3, Football 4, ICBM 3,4, Basketball 2,3 llntral, Baseball I, Lettermen's Club 4, Homeroom Federation I,2, Ski Club l,2,3,4. ESTRADA, DIANE ETTTNGER, CYNDY EVANS, sos EVANS, KATHY FABEL, RICHARD: Table Tennis I llntral, Basketball I Ilntral, Vol- leyball 2 Ilntral, Anytown 3, Red Cross 2, Chess Club 3,4, Advisory Board 4, Pep Club 4, Human Relations Club 4, Speech Team 4, Stage Crew 3,4. FAUSSETT, KATHLEEN: Student Coun- cil I, Art Club I,2, Tennis Club I,2, Basketball I,2, Band I,2, FHA 2, Judo Club 4. FAY, KATHLEEN FELT, SHARON FENIMORE, THEA: Red Cross 4. FIELD, BARRY: Football l,2,3, Base- ball I,2, Class Vice-President 2, Debate 4. FIERRD, STEVE FINDLEY, BARBARA: Hockey 3. EINEEROCK, TERRY: Band I,2,3,4, Orchestra l,4, Science Club 3, Football 4 Ilntral, Softball 'I llntral. FINKELSTEIN, WILLIAM: Wrestling I. FINLEY, BILL: Track I. FISHER, MICHAEL: Tennis 1, Debate 3. FLAMING, MARTY: Banal l,2,3,4, Orchestra I,2,3,4, Hockey 2. FLOOD, PATRICIA FLORES, JOE: Basketball I, Football 2,4, Football 3 llntral, Basketball 3 llntral, History Club I,2, Judo Club 3, FTA I,2, Lettermen's Club 4. FOGLE, TERRY: Pep Club I,2, Red Cross 2, Homeroom Federation 3. FONES, MARLENET AFS 3,4, Stage- craft 4. FOX, DANIEL: ICBM 3,4 lCaptain 4I. FOX, MIRIAM: Red Cross l,3, Home- room Federation 3,4, Advisory Board 2. FOXSTEIN, ETHEL: Red Cross I, Thes- pian Society 2,3,4, Forensics 3,4. ERAHM, TERRl FRAME, DEBBIE: An Club 3,4. FRANK, WARREN: Volleyball 3 lln- tral, Post Staff 3, Spectra 3,4. FRANZ, RICK FRASER, SALLY FREEHILL, KENNETH: Mixed Choir I, Band I, FTA 3,4 lVice-Pres. 4l, Stage Crew 4, Speakeasys 4, Advisory Board 4. FREEMAN, GARY: Football I, Stu- dent Council I,2, ICBM 4. FREEMAN, THOMAS: Basketball I, Football I ,4 Ilntral, Wrestling I, Lettermen's Club I. FREUND, CHRIS: AFS 3, Gymnas- tics 3,4, Modern Dance 2,3. FRY, LYNN FUCHS, WANDA: Homeroom Feder- ation I, Student Council 2,3, Swimming I, French Club Vice- Pres. 3, Cheerleader 3,4, Let- termen's Sweetheart 2. GABRIEL, BOB: Red Cross 2, DECA 4, Homeroom Federation 4. GAGNON, MARILYN: Titan Service League 2. GAINEY, SHAWN: Wrestling I, Free- throw I Ilntral, Wrestling 2,3 llntral, Basketball I llntral. GALAZ, SUSAN GALL, MIKE: Football I, Volleyball 3. GANNON, STEPHANIE: Class Secre- tary I, Red Cross l,4, Homeroom Federation I,2,3, Advisory Board 2,3, Modern Dance 2,3. GARCIA, DIANE GARCIA, IRENE GARCIA, LAWRENCE: Advisory Board I, Homeroom Federation I,3,4, Stage Crew I,2, Track I, 2, Weightlifting I,3,4 llntral, Judo Club 2,4, Coraleers 3, Jub- ileers 2,4, Concert Choir 2,4, All-State Chorus 4. GARDNER, DAVID: Homeroom Fed- eration I, Junior Achievement 4, Red Cross 2,3, Band I,2,3,4, Stage Band 2,3,4, Volleyball 3, 4 Ilntral, Wrestling I llntral. GARLAND, VICKI GARRETT, JOYCE GARRISON, MARILYN GATCHEL, CHRISTINE: Drama Club, Psychology Club 3, Thespian So- ciety 4, Speakeasys 4. GAWTHORPE, DAVE GEORDANE, JOHN: Track I,2,3, Wrestling I,2,3, Football 2,3. GERSTEL, JAY GIBBS, KAREN GIBBS, SHIRLEY GILBERT, GAIL GILMAN, COLLEEN: Orchestra I,2,3, Juclo Club 2, Folk Club 2. GILMAN, RICHARD: Homeroom Fed- eration l, Basketball I llntral, Football 2, Student Body Vice- President 4, Football 4 Ilntral, Boys' State 3, Baseball 2,4, Post Staff 3,4 lAss. Ed. 4I, Senior For- um Board 4, Advisory Board 3,4, National Honor Society 4. GIVENS, ROGER: Wrestling l,2, Track I, Drama I,2,3,4, Advisory Board 2,3, Baseball Mgr. 2,3, Thespian Society 2,3,4, Junior Achievement 2,3,4 IPres. 4l, Na- tional Honor Society 4. GLASGOW, CAROLYN GLINSKI, RICH: Latin Club I,2, Weightlifting 2, Wrestling 2 lln- tral, ICBM 3. GLYNN, SHIRLEY: Thespian Society 3,4, Titan Service League 3. GOLDBERG, ARTHUR: Homeroom Federation I, Stage Crew 3,4. GOLDEN, GERALD GOLDSTEIN, FRANNE: Homeroom Federation I , FTA I, Treblettes 2,3. GOODMAN, RICK GOOSHERST, PAT GORE, SHERRY: FTA 2, GAA 2,3, Cheerleading Club 3, FHA 4. GORTER, RUSS: Football I, Volley- ball 3 Ilntral, Advisory Board l,2,3,4. GOULET, RONNIE GRADILLAS, MARY: Homeroom Fed- eration I, Girls' League I,2, Pep Club 2,4 lSec. 4I, Red Cross l,3, 4 ICouncil 41, Dance 3, Capri- cians 4, Advisory Board 4. GRADY, GAIL GRANT, MICHAEL GREEN, PATRICIA: Pep Club I, FHA I. GREENER, NANCY: Girls' League l, Folk Club 2, Gymnastics Club 3. GREENBURG, ADRIENNE: Forensics 2, Thespian Society 2, Capricians 3.4. GREGOIRE, Pl-lilLlP. Basketball i,3,4 llntral, Wrestling I,2,3 llntral, Volleyball 3,4 Ilntral, Softball I Ilntral. GRIFFITHS, MARSHA: Cheerleader l, 2,3,4, Pep Club l,2,3,4 IPres. 4I, Gymnastic Team I,2 IMgr. II Kayettes 3, Mixed Chorus I,2, Choir 3, Medical Career Club 2. GRIMES, JEFF Glzol-l, JANET GUARD, sANDlE. DECA 4. euDAs, STEVE: Weightlifting 3. GUTIERREZ, BRENDA: Pep Club I, Badminton 3, Girls' League 3,4. HAAKER, DANA HAGGERTY, ROBIN: Pep Club I. HALE, ELLEN: FHA I, Homeroom Federation 2,4, Pep Club 2, Any- town 3, Post Staff 3,4 lAss. Ed. 4I, National Honor Society 4, Model UN 4, Advisory Board 4. HALE, Liz HALL, BARBARA HALL, LYNN: Red Cross 3. HAMER, LEONARD: National Honor Society 4, Tennis I,2, Model UN 4, Basketball 4 llntral, Track 4 llntral, Softball'4 llntral. HAMMER, SARA HAMMIL, RODNEY: Band l,2,3,4 lDrum Maior 3,4i, Dance Band I,2,3, Track I,2 Ilntral, Basket- ball I Ilntral, Volleyball 2 lln- tral, Homeroom Federation 4, Or- chestra I,2,3. HAMMOND, GARY: Cross Country I,2,3, Track I, Football 4 Iln- tral, Chess Club 3, Homeroom Federation I. HANDT, DAVID: Wrestling I, Vol- leyball I,2,3 llntral, Tug-of-War 2 Ilntral, Basketball 3,4 llntral, Softball 3 Ilntral, Gymnastics I, Gun Club 3. HANSEN, CAROL: COE 4. HANSEN, MARILYN: Homeroom Fed- eration 1,35 Girls' Gymnastic Club 3,45 Girls' Gymnastic Team 3,4. HANSON, GAIL: AFS 1,2,3,45 Girls' League 1,2,35 Human Relations Club 3,45 National Honor Society 4. HANSON, JOHN: Advisory Board 1,2,3,45 Wrestling 2,35 Softball 2 lIntra15 Basketball 4 lIntra1. HARBISON, SHIRLEY HARDCASTLE, ROBERTA: Girls' Ten- nis Team 3,45 Volleyball 3,4. HARDMAN, VAUGHN HARE, KATHLEEN HARMON, LARRY: Baseball 35 Foot- ball 3. HARRINGTON, JIM: Wrestling 2,3 llntra15 Weightlifting 2 lIntra15 Gymnastics I,2,3. HARRISON, TOM: Ski Club 35 Math Club 4. HARTMAN, NANCY: Band 1,2,3,4. HASTINGS, KELLY: Advisory Board 1,25 Pep Club 1,25 Girls' League 1,25 AFS 2,35 Art Club 4. HAWK, JAMES: Junior Achievement 2,3,4 lPres. 415 Red Cross 3,45 Drama 3,45 Speech 35 Forensic League 4. HAWKE, GEORGE HAYTHORNE, REED: Football 15 Red Cross 2. HAYWOOD, VERNON: French Club 15 Chess Club 25 Volleyball 25 ICBM 3,4. HAZEN, STEVE HEACOCK, DAVID: Football 1 lln- tra15 Volleyball 15 Basketball 15 Track 1,35 Football 25 German Club 35 Judo Club 45 Folk Club 4. HEATH, STEVE, Track 1. HEIDMAN, DON HEIMPEL, ELIZABETH: Advisory Board 15 AFS 25 Red Cross 25 National Honor Society 45 Capricions 3,4. HENRY, JANIS: Art Club 35 Red Cross 3. HERIN, MARY HERNANDEZ, EDWARD: Football 1, 2,35 Baseball 1,25 Wrestling 2 lIntra15 Football 4 lIntra15 Base- ball 4 IIntra15 Weightlifting 3. HERRIFORD, ROBERT: Football 1,2, 35 Basketball 3,4 IIntra15 Wres- tling 1 lIntra15 Track 35 Science Club 3. HIBBS, HOWIE: Homeroom Federa- tion 15 Yearbook Staff 2,3,45 Photo Club 2,3,45 Red Cross 4. HIBBS, JEFF: Drama 15 Concert Choir 25 Titan Lite-Writers 4. HILL, DAVE: Golf 35 Basketball 1,4 llntra15 Track 1,25 Tug-of-War 2 lIntra15 Homeroom Federation 2, 45 Advisory Board 4. HILLIARD, JOHN: Red Cross 4. HINES, JACQUELINE: A d vis 0 r y Board 1,2,35 Homeroom Federa- tion 25 Treblettes 25 Mixed Choir 35 Modern Dance 25 Drama 45 Gymnastics 35 Debate 3,45 For- ensic League 3,45 Speakeasys 4. HINKLE, JIM: Science Club 15 Math Club 15 Folk Club 45 Scope 45 Advisory Board 45 Thespian So- ciety 3,45 Gymnastics 1,2. HINTE RMAN, BARBARA HIRSCHMAN, RANDY: Cross Coun- try 15 Baseball 1,2,3,45 Basket- ball 1,2. HIRSCHMAN, RONNY: Baseball 25 Volleyball 2 lIntra15 Basketball 1,4 lIntra15 Softball 1 lIntra1. HOAR, BETSY: Pep Club 1,25 Home- room Federation 35 Songleader 4. HOARN, JOHN HOGAN, SUSAN: Latin Club Sec. 15 Concert Choir 2,3,45 Jubileers 45 Treblettes 25 All-City Chorus 45 Girls' Ensemble 45 Yearbook Staff 45 National Honor Society 45 All- State Chorus 4. HOLBERT, JANICE HOLCK, EMMET HOLMES, CHERYL HOLSINGER, JANE: Treblettes 25 Mixed Choir 35 FTA 4. HOPKINSON, SANDRA: AFS 25 FHA 3,45 Pep Club 45 National Honor Society 4. HOPMAN, DEBBIE: FHA 1,2,35 Girls' League 1,25 Advisory Board 3,45 Ski Club 45 Songleader 4. HOSLEY, DEBORAH HOSSMAN, JEFF: Photo Club 2. HOUNSHELL, SANDEE HUBBERT, ANN: Orchestra 15 Twirler 2. HUDSON, BILL HUDSON, MARTA: Gymnastics 1,2, 35 Judo Club 2,3. HUERSTEL, JENNY: Latin Club 15 French Club 25 Art Club 15 Ski Club 1,2,3,45 Red Cross 15 Judo Club 2,45 Class Secretary 25 Girls' League 35 Spectra I Staff 3. HUERTA, CHARLES: Basketball 3,4 Ilntra1. HUGGINS, DANNY: Homeroom Fed- eration 1,2,35 Red Cross 1,25 Track 1 llntra15 Wrestling 2,3 llntra15 Basketball 3 llntra15 Base- ball 3,45 Lettermen's Club 4. HUGHES, SAN DY HULL, RONALD: Cross Country 1,25 Track 15 Basketball 1,2 llntra15 Weightlifting 1. HURLEY, SHARON HUSSEY, ANTHONY HUTCHISON, GREGORY: Band 1,2. HYDE, TOM HYND, JOHN IBARRA, BOB: Softball 3 lIntra15 Football 4 lIntra1. ILER, JUANITA JABLONSKI, MIKE JACOBSON, DEAN: Track I lIntra15 Basketball 2 lIntra15 Volleyball 2 llntra15 Titan Lite-Writers 3,4. JANSEN, JOSEPH JASTER, MARY: Girls' League 1,2. JEDLICKA, BONNIE JOHNSON, DANIEL: Cross Country 1,2,35 Track 1,2,3,4. JOHNSON, DEBI: Tennis 3,4. JOHNSON, GREG: Football 15 Swim- ming 1. JOHNSON, LEE-ANN JOHNSON, MARY: Student Council 15 Red Cross 15 Service Club 15 National Honor Society 4. JOHNSON, MARY MIKE JOHNSON, PATRICIA JOHNSON, SUSAN: Red Cross 15 Volleyball 15 GAA 25 FHA 25 Girls' Glee 1. JOHNSON, VECA JOHNSTON, KAY JOHNSTON, MARY: Homeroom Fed- eration 1,45 Class Cabinet Offi- cer 25 Marching Band 1,2,3,45 Concert Band 1,25 National Hon- or Society 2,35 Yearbook Staff 35 French Club 1,2,3 lSec. 1, Vice-Pres. 315 Pep Club Treasurer 2. JONES, DANIEL: Band 1,2,3,45 Bas- ketball 1 Ilntro15 Radio Club 45 Reading Seminar Representative 4. JONES, FRANCES: Homeroom Fed- eration 4. JONES, JERRY JORDAN, CYNDY: Hockey Team 3. JORGENSEN, ED: Football 1,25 Track 1,35 Softball 2 lIntra15 Weight- lifting 2,3 lIntra15 Weightlifting Club 35 Basketball 4 lIntra1. JUAREZ, GENIE: Treblettes 45 Cap- ricians 4. KALPIN, ALLEN KAPLAN, MIKE KASEN, GERI KATZ, RANDY: Homeroom Federation 15 Drama Club 1. KAUFMAN, KAREN: DECA 45 Juclo Club 4. KAUFMAN, LARRY KEARNS, NANCY: Girls' League Council 1,2,35 Human Relations Club 3,45 Yearbook Staff 3,45 Red Cross 45 National Honor So- ciety 4. KEE, DEBORAH: Modern Dance 2,35 Homeroom Federation 45 Song- leader 4. KELCH, CHRISTINA: Girls' League 1,2,3,45 Orchestra 1,25 Speech 3,45 Drama 4. KELLY, KATHLEEN: Pep Club 1,2, Girls' League 3,45 Homeroom Federation 35 Tennis 35 COE 4. KEMP, KERRY: Basketball 2 IIntra15 Volleyball 3 lIntro15 Softball 3 llntra15 Judo Club 35 Art Club 4. KEMPH, DEBI: Tennis 1,3,45 Ski Club 2,4. KENADY PAMELA: National Honor Society 4. KENADY, PATRICIA: Key to the World 25 Gymnastics Club 3,45 Gymnastics Team 3,45 National Honor Society 4. KENSKI, GLORIA: Political Club 25 Forensics 45 FTA 45 National Hon- or Society 4. KERCHUM, PAUL KERN, DENNIS: Red Cross 25 Home- room Federation 4. KIEKEBUSCH, KEITH KING, JEFF: Marching Band 2,3,45 Concert Band 2,3,45 Cadet Band 15 Tennis 1,2,3,45 Basketball 1, 2,3,4. KING, LINDA: Girls' Track Team 1, 25 Basketball 1,2 IIntra15 Volley- ball 1 lIntra15 GAA 1,25 Golf Team 35 Soccer 3 Ilntra15 Spanish Club 25 Biology Club 15 FHA 3, 45 Student Council 35 National Honor Society 4. KINGSTON, KARYN: Girls' League 1,2,3,4 lSec.-Ttres. 3, Pres. 415 Capricions 25 Homeroom Federa- tion 35 National Honor Society 45 Songleader 4. KINGTON, LEASON: Titan Lite- Writers 3,4 lVice-Pres. 415 Gun Club 25 Volleyball 1 IIntra15 Photo-Publications 4. KISER, PATRICIA: Capricions 45 COE 4. KLASSEN, CAI: AFS 15 Girls' League 2,3,45 Post Staff 3,45 Scope 1,2, 3,4 IPres. 415 Thespian Society 3,4. KLASTOW, SHARON: Red Cross 2, 3,45 Girls' League 3,45 Art Club 4: COE 4. KNIGHT, DEBBIE: Homeroom Fed- eration 1,2,3,45 Red Cross 1,2,3, 45 Spanish Club 25 Concert Choir 2,3,45 Mixed Choir 35 Songleader 45 Girls' Badminton Club 3. KNOX, GREG: Football 15 Baseball 1,2,45 Softball 1 llntra15 Basket- ball I41 Ilntra15 Wrestling 1,2,3,4. KOEPPEL, TERRY: Titan Service League 4. KOSKY, MIKE: Homeroom Federa- tion 3. KRAMER, JOHN: Football 15 Track 15 Baseball 15 Basketball 3,4 lln- tra15 Red Cross 35 Homeroom Fed- eration 4. KRAMER, LYNNE: Homeroom Feder- ation 35 DECA 3. KRATZER, KATHLEEN KRIETEMEYER, KATHI: Pep Club 1,45 FHA 3,45 Homeroom Federation 45 National Honor Society 4. KRUEGER, ELAINE KUGLER, BARRY: Basketball 2,3,4 lIntra15 Volleyball 4 lIntra15 Base- ball 4 llntra15 ICBM 45 Home- room Federation 4. KUHN, DAVID: Mixed Choir 35 Con- cert Choir 45 Homeroom Federa- tion 4. LACKEY, BILL LAMB, GAIL: Pep Club 15 Twirler 2,3,45 Homeroom Federation 45 National Honor Society 4. LAMB, MICHAEL: Latin Club 15 Ger- man Club 3. LAMBERT, ELAINE: Hockey 25 Titan Lite-Writers 45 Red Cross 4. LAMM, SUSAN: Pep Club 25 Home- room Federation 35 Stage Crew 35 Songleader 3,45 National Honor Society 4. LANINGHAM, JOE: Wrestling 3. LARGENT, KEVIN: Basketball I,2, 35 Track 1,25 Class Vice-President 35 Basketball 2,4 Ilntral. LARKIN, ROBERT: ICBM 4. LARSON, GAYLE LATER, LINDA LAWRENCE, GLORIA: Gymnastics 3. LAZARES, BETTY: FHA 1,2,3 ITreas. 2, Vice-Pres. 315 Girls' League 1, 2 ICouncil 1I5 Advisory Board 2, 3,45 Homeroom Federation 25 Class Councilman 3,45 Songleader 45 Ski Club Treas. 45 Forensics 4. LEE, ANDY LEASE, WILLIAM LEEDOM, MARGARET: Band 1,2,3,4 ISec. 4I. LENHART, DIANE: Homeroom Fed- eration 1,35 Pep Club 25 FTA 25 Red Cross 35 Spectra 3,4. LINDLEY, BARBARA LINDLEY, CAROL LITTLETON, JIM LLOYD, LINDA: Treblettes 25 Girls' League 3,45 Photography Club 4. LODGE, HARRY: Football 1,2,3,45 Baseball 1,2,3,45 Basketball 2,4 IlntraI5 Spirit King 35 Homeroom Federation 45 Boys' State 35 Let- termen's Club 2,3,4 IPres. 4I5 Homecoming Attendant 45 Bas- ketball 15 Tug-of-War 2. LOFTIS, PATTY: Advisory Board 1,2, 35 Red Cross 15 Modern Dance 2,35 Homeroom Federation 25 Titan Lite-Writers 45 Songleader 45 Photo Club 4. LOGAN, STUART: Football 1. LOGAN, THOMAS: Cross Country, 1,2,3 IlntraI5 Track 1 IIntraI5 Basketball 2 IlntraI5 Baseball 2 IlntraI5 Wrestling 3 IIntraI5 Gun Club 15 Swimming 3. LONG, MIKE LOTZ, PATRICIA LOVIN, JEFF: Baseball 1,2,3,45 Foot- ball 1,2,3,45 Basketball i5 Advis- ory Board 1,2,35 Homeroom Fed- eration 15 Lettermen's Club 2,3, 4 ISec. 415 Class Vice-President 35 Boy's State 35 ICBM 3,45 Na- tional Honor Society Pres. 45 Bas- ketball 2,3,4 IlntraI5 Key to the World 1,45 Guidance Advisory Board 3. LOWE, ALLEN: Advisory Board 1,2, 3,45 Basketball 3,4 IlntraI5 Base- ball 4 IlntraI5 Wrestling 1,2,3,4. LOWE, DON: Softball 1,2,3 IlntraI5 Volleyball 1,2,3 IIntraI5 Football 1,4 IIntraI5 Swimming 2 IlntraI5 Tennis 3 IlntraI5 Basketball 3,4 Ilntral. LOWTHER, MICHAEL: Folk Club 2,35 Stage Crew 25 DECA 3,4 IPres. 41. LUDTKE, CRAIG: Football I,2,3,45 Track 15 National Honor Society 4. LUNDSTROM, KURT: Homeroom Fed: eration 15 Advisory Board 45 Senior Forum 45 Gymnastics 2,3, 45 Basketball 4 IlntraI5 Wrestling 15 Softball 1 IlntraI5 Math Club 15 Russian Club Vice-Pres. 4. LUTGENDORF, ROBERT: Judo Club 45 Ski Club 4. LYNAS, DIXIE: Red Cross 2. MABRY, BILL: Baseball l,2,3,4. MACFARLAND, KEN MACH, JOAN: Treblettes 25 Tennis Team 45 National Honor Society 4. MACPHERSON, TERRY: Homeroom Federation 1,25 Pep Club 25 FHA 35 Advisory Board 4. MADER, MARK: Wrestling 15 Gun Club 1. MAGUE, PATRICIA: Tennis 4. MALDONADO, BOB: Baseball 1. MANNS, KATHY MANVILLE, KATHRYN: Latin Club 15 Girls' League 1,25 Pep Club 25 Scope 2. MARTIN, BETTY: Concert Choir 2,3,45 Girls' Ensemble 3,45 National Honor Society 4. MARTIN, KATHY: Titan Lite-Writers 2,3,4 ISec. 415 Post Photo-Editor 45 Red Cross 25 Capricians 45 Homeroom Federation 3. MARTIN, PATTY: GAA 15 Gymnastics Club 1,25 Gymnastics Team 1,25 Titan Lite-Writers 3. MARTIN, SUSAN MARTIN, WILLIAM: Fencing Club 2, 35 Teen Club 2,35 Varsity Club 2,35 Track 1,25 Swimming 2,35 Football 4 IIntraI5 Ski Club 2,35 Football 1. MARTINJAK, FRANK: Math Club 2, 3,4 IVice-Pres. 4I5 French Club 25 Football 35 Track 25 Science Club 3,45 Chess Club 45 National Honor Society 45 Photography Staff 3. IvIAIesI-I, DENNIS: Baseball i,2,3,45 Basketball 3,4 IlntraI5 Football 4 IlntraI5 Red Cross 1. MASON, DEAN: Track 1,25 Cross Country 1,25 Red Cross 25 Free- throw 3 Ilntral. MASON, KATHY: Girls' League 15 Cheerleader 2,45 Pep Club 2. MATHEWS, DAVE: Soccer 1. MAULDIN, RON: Wrestling 2 IlntraI5 Volleyball 4 IIntraI5 Basketball 4 Ilntral. MAZUR, RICHARD: Gymnastics 1,25 Volleyball 1,35 IlntroI5 Baseball 3 Ilntral. McCANSE, DAVID: Football 1,25 Softball I IIntraI5 Track 2 IlntraI5 Basketball 2 IlntraI5 Track 35 Homeroom Federation 45 Russian Club 4. MCCARVER, LYN MCCLEMENTS, MARTHA: Homeroom Federation 1,2,3,45 A d v i s o r y Board 45 Speech Team 3,45 Speak- Saniar Sanslaaaars had an Opportunity fa Perform without the iuniars at the the last halftime routine done by the seniors. The songleaders created their own Salpalnta game an February 13- ll was the last Home game af the season and routines and used a variety of ideas such as the Valentine's Day routine. easy 45 Red Cross 1,35 Swimming 35 Folk Club 2. MCCOOL, MICHAEL MCCOURT, LAURIE MCCULLOUGH, JAMES: Cross Coun- try 1,2,3 llntra15 Volleyball 1,2,3 llntra15 Basketball 1,2,3 llntra15 Chess Club 45 National Honor So- ciety 45 Honor Guard 3. MCDONALD, CHRISTINE: GRA 15 Pep Club 25 Volleyball 4. MCDOUGALD, BOB MCGINLEY, PATRICK MCKINNEY, SCOTT: Cadet Band l, 25 Track 15 Band 3,45 Cross Country 15 Volleyball 3 lIntra15 Softball 3 lIntra15 Weightlifting Club 35 Russian Club 4. MCCLELLAN, LESLIE McMlLLAN, MARTY McMULLEN, BARBARA: Red Cross 15 Ski Club 3. MCMULLEN, MARY: Girls' League 1, 2,3,45 Red Cross 1,2,3,4. McNEAL, DAVID: Baseball 1,2,3,45 Football 4 iIntra15 Lettermen's Club 4. McNElL, NORA MCTARNAHAN, BILL: Gymnastics 15 Thespian Society 3,45 Drama 45 Homeroom Federation 45 Russian Club President 4. MEADE, CHUCK: Swimming 1,25 ICBM 3,45 DECA 45 Track 3. MEANS, ERIC: Class President 25 FFA 1,25 Ski Club 35 National Rifle Club 35 Student Council 25 Football 1. MEARS, PAUL: Tennis 15 Drama 2, 3,45 Thespian Society 2,3,45 Take Her, She's Mine 35 John Brown's Body 35 The American Dame 45 Homeroom Federation 3. MEDLIN, CANDY MEIBOHM, JOYCE: Cheerleader 45 Gymnastics Club 4. MEINEL, ELAINE: orchestra 1,2,3,4. MERCHANT, JANET: FHA 35 Capri- cians 4. MIHALIK, DENISE: Basketball ly Ski Club 1,2,3,45 Pep Club 1,25 GAA 25 Red Cross 1,2,35 Spanish Club 1,25 Speech Club 25 Newspaper Staff 1,25 Girls' League 35 FTA 35 Future Nurses Club 35 Human Relations Club 45 ICBM 4. MIKELSON, SHARON: Red Cross 1. MILBRANDT, PATSY: Red Cross 2,45 Baseball 1,2. MILLER, BARBARA: Girls' League 4. MILLER, BARRY: Volleyball 1,2 iln- tra15 Wrestling 2 lIntra15 Gymnas- tics 15 Gun Club 2. MILLER, DAVID: Titan Lite-Writers 3,45 Photo-Publications 3,4. MILLER, HOPE: Treblettes 2,45 Red Cross 3,45 lTreas. 415 Forensics 4. MILLS, LINDA: Post Staff 45 Red Cross 4. MINA, CINDY: Capricians 3,4. MISENHIMER, MARY: Archery Team 45 National Honor Society 4. MITCHELL, ANNE: Tennis 1. MITCHELL, QUINTON: Art Club 2,35 Track 2. MIXSON, MARY: Pep Club 1,25 Red Cross 3,45 Gymnastics Club 1,25 Kayettes 1,2. MIZE, ELAINE: Concert Choir 2,45 Mixed Choir 3,4. MOHR, LINDA: Pep Club 1,2,35 Homeroom Federation 1,25 FTA 25 Future Nurses of America 35 National Honor Society 3,45 Year- book Staff Assistant Editor 35 Post Staff 4. MOLINA, JOE: Football 1,2,35 Track 1,2,35 l.C.E. 4. MONTIEL, MIKE: Football 15 Bas- ketball 2 llntra1. MONTOYA, RICH: Basketball 1 llri- tra15 Baseball 1 llntra15 Football 1,2 llntra15 Gymnastics lp Base- ball 25 Wrestling 1,2 llntra15 Weightlifting 2 lIntra15 Wrestling 3. MORAN, BRUCE MORRIS, PAM: Yearbook Staff 1,2, 3,45 Homeroom Federation 1,2,35 Advisory Board 3,45 Student Council 3,45 FHA 1,2,3 lSec. 215 Homecoming Attendant 45 Na- tional Honor Society 45 Red Cross 45 Girl's State 35 Girls' League 1,2,3,4 lVice-Pres. 3,415 Student Body Corresponding Secretary 4. MORROW, LYNN: Junior Achieve- ment 2,3,45 Scope Advisory Board 1,2,35 Wrestling 15 Gymnastics 15 Red Cross 35 Art Club 45 Homeroom Federation 45 ICBM 4. MOW, DALE: Track 1,2,3,45 Cross Country 1,2,35 Football 15 Red Cross 3. MUEHLBAUER, GARY MUELLER, WILLIAM: Guidance Ad- visory Board 35 Chess Club 3,45 National Honor Society 45 Honor Guard 3. MULHOLLAND, LINDA: Treblettes 2, 35 Junior Achievement 3,45 Red Cross 35 DECA 3,4 lTreas. 41. MULLER, SHERRY: Red Cross 25 Girls' League 35 DECA 4. MULVANEY, FRANK: Weightlifting 1 llntra15 Basketball 2,3 lIntra15 Volleyball 3,4 llntra1. MUNICH, JAN: Golf Team 1,2,35 Chess Club 45 Folk Club 45 Let- termen's Club 2,3. MURPHEY, GARY MURPHY, SEAN MURRAY, KATHY: Volleyball 1,25 Tennis Team 35 Gymnastics Team 45 Spanish Club 2. MURTAUGH, MIKE: Chess Club 3. MUSSER, KAY: Advisory Board 1,35 Student Council 2,45 Cheerleader 2,3,45 Yearbook Staff 3,45 Girls' State 35 Guidance Advisory Board 35 Honor Guard 35 Class Coun- cilman 45 Homecoming Attendant 45 Spirit Queen 45 National Hon- or Society 4. NELSEN, DONALD: Track 1,25 Base- ball 1,2. NELSON, BRUCE: Basketball Mgr. 1, 2,3,45 Volleyball 1,4 lIntra15 Red Cross 25 Track 1. NELSON, CATHY NELSON, RODNEY: Wrestling 1,2,35 Softball 1,2,3,4 llntra15 Football 25 Basketball 3 llntra15 Volleyball 'I llntra15 Band 1,2,35 ICBM 4. NETTLES, ISOLDE: Gynamstics Club 35 Gymnastics Team 3. NEWELL, PHYLLIS NEWELL, RANDY NIBLETT, ADRIENNE: Student Council 15 Pep Club 15 Yearbook Staff ly Gymnastics 1,2,35 Cheerleader 3. NICKOL, NEIL: DECA 3. NIEL, SCOTT: Volleyball 1,2,3,4 lln- tra15 Football 1,3,4 llntra15 Bas- ketball 2,3,4 llntra15 Track 1,2, 3,45 Math Club lg Chess Club 1,25 Scope 35 Gun Club 45 Na- tional Honor Society 45 Basketball lp Football 2. NOBLE, SUSAN NORDQUIST, EDWARD: Football 1, 2,45 Track 1,2,35 Wrestling lg Homeroom Federation 1,2,35 Ad- visory Board 3,45 Cadet Band lp Lettermen's Club 45 Wrestling 4 llntra15 Tug-of-War 2 llntra1. NORRIS, MELISSA NORTON, BONNIE: Pep Club 25 Con- cert Choir 25 Songleader 3,45 FHA 3. NORTON, ROGER: Football 1,25 Wrestling 1,35 Baseball lp Photo Club 3,4. NOVAK, LARRY NUCKOLS, JOE: Track 1,2,3,45 Foot- ball 35 French Club 1,2,35 Band 1,2,3,45 Gun Club 25 AFS 2. NUSSBAUM, MINNA: Homeroom Federation 1. O'BANNON, JEANNIE O'CULL, LINDA O'DELL, VICKI: Girls' League 1,3 lCounciI 315 FHA 35 Pep Club 25 Red Cross 25 Girls' State 35 Na- tional Honor Society 45 Year- book Staff 4. OGDEN, HAROLD OPPENHEIM, DON: National Honor Society 45 Post Staff 3,45 Stu- dent Council 25 Advisory Board 25 Basketball 1 lIntra15 Volleyball 1 llntra1. ORTH, SHIRLEY OSBORN, GEORGIA: GAA 1,2,35 Archery 35 Basketball 15 Volley- ball l,25 FHA 3. OWENS, ART: Thepian Society 2,3,4. PADILLA, LUIS-DANIEL: Orchestra 1, 25 Drama 3,4. PAGE, SANDY: Band 15 DECA 3. PALLO, DEBI PARK, CLAUDIA: Pep Club 1,25 Girls' League 1,25 Quadrill Team Sec.-Treas. 4. PARKIN, KATHY: Spanish Club 1,25 Girls' League 1,2,35 FHA 2,35 Basketball 2 lIntra15 Hockey 2 lIntra15 Tennis 3. PASCOE, LAURA: National Honor So- ciety 15 Track 15 Pep Club 1. PATTERSON, BONNIE PATZE, JOHN: Gymnastics 1,2,35 Wrestling 2 llntra15 Softball 2 llntra15 Basketball 1,2 llntra15 Cross Country 2 llntra15 Wrestling 3. PAULIK, JOE: Baseball 2 lIntra15 Basketball 3 llntra1. PAYNE, BEVERLY PERRY, DEBORAH PERTKE, BETTY: Stage Crew 35 DECA 4. PETERSEN, KATHY: Red Cross 1,2,35 COE 45 Modern Dance 1,2,35 Cap- ricians 4. PHILLIPS, JOHN PHILLIPS, TED: Football 1,2,3,45 Baseball 1,2,3,45 Basketball 1,2, 3 llntra15 Track 3,4 lIntra15 TV Club 35 Lettermen's Club 4. PIERCE, RICHARD PIERSON, ROBERT: Baseball 1,25 Basketball lIntra1 1,2,3,45 Volley- ball 1,3,4 lIntra15 Track 3 lln- tra1. PISCITELLI, LAURA: Volleyball 15 French Club 1,25 Art Club 1,2,4. PLIMPTON, LINDA: Gymnastics 1,2, 35 Pep Club 1,45 Girls' League 1, 2,3,45 Orchestra 1,2. POLASKI, JOHN: Baseball l,2,45 Basketball 1,2,3 ilntra15 Volley- ball 1,3 llntra15 Football 3 lln- tra1. PORTER, DON: Baseball 15 Folk Club 45 National Honor Society 4. PORTER, DOUG: Basketball 1 llntra15 National Honor Society 4. POTTER, CHARLES: spanish Club 15 Titan Lite-Writers 45 Baseball 45 Track 1,25 Basketball 3 lIntra15 Softball 1 ilntra1. POWER, CAROL: Pep Club 1. PRATHER, KAREN: Advisory Board 1. PRCHAL, STEVE: Gun Club 1. PREMOVICH, MISTY: Band 2,3,45 National Honor Society 4. PRICE, CONNIE: Yearbook Staff 1,2, 3,45 Girls' League 15 AFS 25 Anytown 25 Human Relations Club 3,4 lVice-Pres. 3, Pres. 415 FTA 45 Stage Crew 45 National Honor Society 45 Guidance Ad- visory Board 3. PRICE, ELLIOTT: Volleyball 1 lln- tra15 National Honor Society 3. PRICE, MIKE: National Honor Society 4. PRIDGEN, TOM: Basketball 1,25 Track 15 Football 4 ilntra1. PRISER, CHIPS PUFF, YVETTE PURCELL, MARGARET: Track 15 Treblettes 2,3,4. QUALLS, CHARLES: Wrestling 2 lln- tra1. QUAYLE, THOMAS: Homeroom Fed- eration 1,4 lPres. Pro-Temp. 41. RODRIGUEZ, RAFAEL, Swimming I, QUINN, ANITA, Girls' League I,2, 3,4 lCouncil 3,41. RADEMACHER, FRITZ: Track I, Golf 2,3,4, Tennis 3,4 llntral, Free- throw 3,4 Ilntra1, Basketball 3, 4 lIntra1, ICBM 4, Table Tennis 4 llntra1, Lettermen's Club 4, Guidance Advisory Board 3, Na- tional Honor Society 4. RAMIREZ, EDITH, AFS I,2,3,4, Pep Club I,2,4, Advisory Board 4, Titan Service League 4. RAMOS, VIRGINIA, Red Cross 3,4, Track I, Badminton 3. RANNE, DON, Football I,2,3,4, Wrestling I, Track I, Weightlift- ing 2 Ilntra1, Wrestling 3,4 lin- tra1, Math Club 3, Lettermen's Club 4. RAYMER, PAMELA, Concert Choir 2, 4, Mixed Chorus 3. REDMOND, MARNELLE REED, RICHARD, Basketball I,2 Iln- tral, Softball I llntra1. REICHEL, JOSEPH, National Honor Society 4. REIS, KEVIN REMINGTON, DEBBIE, GAA I, Girls' League I,2, Gymnastics 3,4, Homeroom Federation 3, Ski Club 4. REYNA, ELIZABETH, Red Cross I,2, 3,4 ISec. 41 Homeroom Federa- tion I,2,4, Pep Club 4, Orches- tra I,2,3,4, Treblettes 3,4. REYNARD, HENRY, Football 4 IIntra1. REYNOLDS, CAROLEE REYNOLDS, KENNETH, Baseball I, 2,3 Ilntra1, Basketball I,2,3,4 lIntra1. RHOADS, DONNA, Band I,2,3,4 ISec. 3, Pres. 41. RHODUS, DOUG, Basketball I,2,3, 4, Baseball I, Track I, Letter- men's Club 3,4. RICHARDSON, CARL RICHARDSON, JOSHUA, Homeroom Federation I,2,3, Band I,2,3,4 ITreas. 31, Math Club I,2 ISec. 21, Tennis I,2, Freethrow 2 Iln- tra1, Tennis 3 IIntra1, Volleyball I,2,3 IIntra1, Basketball I,2,3 Ilntral, Cross Country 3 Ilntra1, Football 4 IIntra1, Concert Choir 4. RIDDELL, BRAD RIDDLE, RICKY: FOOtbCIll 'I,2,3, Bas- ketball I, Golf I,2,3,4, Basket- ball 4 llntral, Lettermen's Club 3,4, AFS 4, Advisory Board 3,4. RIEDELL, JOAN, Girls' League 4. RINKLE, JANICE, French Club I, Spanish Club 3, Student Council 3, Homeroom Federation 3. RIOS, MIKE, Wrestling I, Baseball I. RIPLEY, TOM, Concert Choir 4, Boys' Ensemble 4, All-State Chorus 4. RISK, JAMES, Wrestling I, Baseball I,2, Softball I, Red Cross 2, Soc- cer 3. RITTER, JACKLYN, FHA I,2 lViCe- Pres. 21 Ski Club 4, Songleader 3,4. ROBERTS, DIANE ROBINSON, TODD RODRIGUEZ, RENE, Wrestling I lln- tra1, Volleyball 2 lIntra1, Basket- ball 2 Ilntra1, Softball 2 Ilntra1, Homeroom Federation 4, ICBM 4. 2,3,4, Scout I,2,3, Literature Club I,2,3, Science Club I,2,3, Phil- osophy Club 3, Newspaper Staff 2,3, AFS 4, Student Council 4. ROSE, GENE, Folk Club 2,3,4, Rus- sian Club 4, Spectra 3. ROTELLO, JOSEPH ROTHMAN, FRAN, DECA 4. ROTHWELL, BRUCE RUELAS, RICHARD RYAN, PATTY, Pep Club I,2, Ski Club I,4, Student Council I, Homeroom Federation I, Drama Club I, Track 2, National Honor Society 4. RYAN, TIM, Football I, Basketball I,2,3,4, Track I, Volleyball 4 Ilntral. SAKIN, JAMES, Homeroom Federa- tion I,4, Red Cross I,2, AFS 2, 3,4 ITreas. 3, Pres. 41, DECA 3, Junior Achievement 3, Drama 2, 3,4, Thespian Society 3,4, De- bate 4, Forensics 4, Speakeasys 4, The Man Who Came to Din- ner 2, Our Hearts Were Young and Gay 3, For Adults Only 3, Our Town 3, The American Dame 4. SALTZMAN, SALLIE: Spanish Club I, Thespian Society 2,3,4 IPres. 41, Model UN 3,4, Speech 2, Red Cross 3,4, National Honor So- ciety 4. SANCHEZ, FRED sANcI-IEz, TOM, Football I,2,3, Key Club I,2,3, Golf I,2, Student Council 3, Spanish Club 3, Boys' Federation 3. SANCHEZ, GAIL SANDERS, KATHRYNN, Stage Crew 3. SASSE, MITZI, Thespian Society 2, Debate 3,4. SAYAN, GAIL scHAEER, MIKE' scHEERENs, JOSEPH, Red cross 4. SCHERER, DEAN, Stage Crew 3,4. SCHMIDT, KAREN, FHA I,4, Pep Club I,2, Glee Club 2, Gymnas- fic, 3, FTA 3. SCHMUCKER, JANE, Tennis I, Gym- nastics 2, Folk Club 4, Mixed Choir 4. SCHOCK, ROBERT, Football I,2,3, 4, Wrestling I, Track I, Red Cross 2, Drama 2,3,4, Thespian Society 2,3,4 ITreas. 3,41 Advis- ory Board 3, Class Vice-President 4, ICBM 3,4, Lettermen's Club 4, Homecoming King 4. SCHOENBERGER, JERRY, Wrestling I,2,3, Football 2,3, Baseball 2, Baseball 2 llntra1. SCHOLER, CRAIG SCHURIG, RICKY SCHWARTZMAN, CHARLES, Tennis I, 2,3,4, Soccer 4, Football 4 lln- tra1, Basketball 4 llntra1, AFS 4, ICBM 3,4 lSec.-Treas. 41, Let- termen's Club 4. SCHWIMMER, KIM, Stagecraft 2, Student Council 2. SCOTT, CHRIS, Band 2. SCOTT, DAN SCOTT, ELAINE scott, GREG SCOTT, SANDRA SEBEST, MARCIA, Speakeasys 4, For- ensics 4, Debate 4. SEGRAVES, ANN SEIDENABEL, JOHN SERIGHT, HELEN, Red Cross I,2,3, 4 lPres. 41, DECA 3,4. SHAFFER, SU, Pep Club I, Advisory Board 3. SHAFFERY, JON, Wrestling I,2,4, Football I,2, Gun Club I, Thes- pian Society 2,4. SHANLEY, JOHN, Cross Country I, Wrestling 2, Basketball 4 lIntra1, Golf 'l,2,3,4. SHARP, CAROL, Pep Leadership 2, 4, Gymnastics Club 3,4. SHARP, PAT sHAvER, REVELENE SHAW, DAVID SHELTON, KATHY, Treblettes 2, Mix- ed Choir 3. SHELTON, RENA SHIELDS, KAREN, Homeroom Feder- ation I, Red Cross I,4, Girls' League I, Advisory Board I,2,3, 4, Student Council 4, Cheerlead- er 2,3,4, Class Sec.-Treas. 2,3, Student Body Recording Secretary 4, Homecoming Queen 4, SPOT 4. SHIPLEY, CHARLES, Basketball I lln- tra1. SHORT, MARILYN, Pep Club I, Girls' Association 2, Ski Club 3,4. SHOTT, NANCY, Red Cross Pres. 2, Speech 2,3, Thespian Society 2, 3, Volleyball Team 2, Homeroom Federation 4. SHOUN, STEVE, Gymnastics I. SHUGERT, LINDA SIDON, CLAUDIA, Publicity Club 2, ski Club 2, Pep Club 2, FTA 2, Junior Achievement 3,4, Speak- easys 4. SIERRAS, EDWARD, Wrestling I , Softball 4 llntra1, Volleyball 3, Football 4 IIntra1, Basketball 4 lIntra1, Wrestling 2,4 IIntra1, Weightlifting 3. SILVAIN, ESTHER, Homeroom Feder- ation 4, Girls' League 4. SILVERNALE, DIANE, Red Cross I,2. SIMMONS, DANIEL SIMONSON, CHARLES, Football I,2, Basketball I,2,4 llntral, Track I, Wrestling I, Baseball 4 Ilntra1, Wrestling 3 IIntra1, Volleyball 4 Ilntral, Lettermen's Club 2,3. SISK, MICHAEL, Track I, Gymnastics 3,4. SKARSTEN, SUE, Ski Club 4. SKEVINGTON, JIM, Basketball 4 Ilntral, Freethrow I,2,3,4 Ilntral, Volleyball 4 llntra1, Football 4 llntra1, Soccer 3,4, Track 3 lln- tra1, ICBM 3,4, Lettermen's Club 4, AFS 4, Junior Achievement 4. SKILES, PAT, Concert Choir I,2,3,4, Jubileers 2,3,4, All-State Choir I,2,3,4, All-City Honor Choir 2, 3,4, Mixed Choir 3,4, Wrestling I Ilntra1, Soccer I IIntra1, Chess Club I, Folk Club I, Red Cross 2,3,-1. SMELKER, HOGAN, Tennis I,2,3,4, Chess Club I,3,4, Science Club I, Math Club 2, Gun Club 2, Pep Club 3, FHA 3, FTA 4, Folk Club 4, DECA 3, Orchestra 4, Basket- ball 4 llntra1, Advisory Board 4. SMITH, JANICE, Pep Club I,2,3, Girls' League 4, Latin Club 2, Red Cross I,2, German Club 3, 4, Spanish Club 4, Basketball Team I, Volleyball Team I, Queen Attendant 3. SMITH, JEFF, Red Cross I, Judo Club 3, Ski Club 4, Stage Crew 4, Pep Club 4, Advisory Board 4, Radio and TV Club 3. SMITH, PEPPER SMITH, RICHARD, Baseball 3,4, Football 4, Lettermen's Club 4, Basketball 4 lIntra1. SMITH, STEVE, Football I,2, Basket- ball I,2, Baseball I Ilntral, Track I,2,3,4, Volleyball 4 llntral, Homeroom Federation 3. SMITH, THOMAS, Band I,2,3,4, Stage Band 2,3, Orchestra 3. SMITH, SHERRY SOLLERS, SUSAN, DECA 3. SOLOSKI, MICHAEL, Debate Club I. SOSA, NINFA, Judo Club 2, Drill Team Maiorette I, Pep Club 2. SPARGUR, BARBARA, Choir I, Biolo- gy Club 2, Spanish Club 2, Ju- nior Class Play 3. SPARKMAN, NANCI, Pep Club I,2, Girls' League I,2, Red Cross 2, Ski Club 3, DECA 3,4, Spectra 3,4. SPENCER, GINNY, Anastiasia I, The Women 2, It is Love 2, For Adults Only 3, Our Town 3, Cry Havoc 4, Drama I,2, 3,4, Thespian Society Vice- President 4, Forensics 3, Red Cross 4, AFS 4, Speakeasys 4, TV Production Club 4. STAGG, FRANK, Football I,2,3,4, Track I,2, National Honor Society 4. STAMPER, BASIL, Football I, Track I, Baseball 2,3 Ilntra1, Basket- ball 3 Ilntra1, Volleyball 2,4 lln- tra1, Red Cross 4, Chess Club 2. STANBROOK, BOB, Football I, Base- ball I,2,3, Softball 3 IIntra1, Weightlifting 3 llntra1, Basket- ball I IIntra1, Student Council I. STARK, SANDRA, FHA 3,4, National Honor Society 4. STARTZEL, MORRIS: Wrestling I,2,3: Basketball 4 lIntra1: Wrestling I, 2,3,4 llntra1: Homeroom Federa- tion 2,3,4. STEFFE, GAIL: Red Cross I: Pep Club I: Titan Lite-Writers 3,4: Photo-Publications 4. STEVENS, ELAINE STEWART, DEBI STOLBA, DEBBIE: Pep Club I,2, sm- dent Council Advisory Board 2: Advisory Board 3,4: Key to the World 3: Yearbook 2,3,4 lEditor 41: Songleader 3,4 lHead 41: Na- tional Honor Society 4. STOUFFER, CATHY: Treblettes I: Con- cert Choir 2,3,4. STRODBECK, WILLIAM: Gymnastics I,2,3,4: Softball 2 lIntra1: Mike Boy 4. STUMP, JERRY: Football I,2,3,4: Track I: Weightlifting 3 IIntra1: Lettermen's Club Vice-President 4. SUAREZ, BOB: Football I,2,4: Track I,2,3: Basketball 2,3,4 lIntra1: Tug-of-War 2 llntra1: Lettermen's Club 4. SULLIVAN, CECILE SULIIVAN, CHRISTINE SUMMERS, DIANE SURLIN, CHARLES: Drama Club I: Art Club I: Chess Club 4. SWANLAND, KRIS: Latin Club I,2,3 lTreas. 31: FTA 2,3: Volleyball I, 2 lIntra1: Basketball I lIntra1: National Honor Society 3: Pep Club 4. SWART, LEON: Cross Country 3: Track Mgr. 3,4: Basketball Mgr. 4. SWIDERSKI, FRED: Wrestling I: Wrestling 3 Ilntra1: Basketball I, 2 lIntra1: Football 2,3,4: Football 4 llntral: Baseball 3 lIntra1: Red Cross I,3,4: Gun Club I: Titan Lite-Writers 2,3,4: Photo-Publica- tion 2,3,4: Folk Club 4: Letter- men's Club 4. TABER, STEPHEN TALAVE, STEVE TARBILL, CHRISTIE: Cheerleader I,2: Girls' Glee Club I: Mixed Chorus I: Girls' Ensemble l,3,4: Class Treasurer 2: Junior Mixmaster Treas. 2: Thespian Society 3,4 lSec. 41: Concert Choir 3,4: Rus- sian Club 3,4 lTreas. 41 Jubileers Sec. 4: Dance 4: National Honor Society 4. TATUM, MARLA: Chess Club I: FHA I: Red Cross 2: Ski Club 3: Gymnastics 3: Homeroom Federa- tion 4. TAYLOR, JAMES: Softball I lIntra1. TAYLOR, JANIE: Spanish Club I: GAA I: Songleader I: Newspaper Staff I: Student Council I: AFS 3,4: National Honor Society 4. TEEPLE, PAM: DECA 3,4: National Honor Society 4. TEGIMEYER, PATTI: Red Cross I,2, 3: Pep Club 2: Judo Club 2: Folk Club 2: Homeroom Federation 4: COE 4. TELLA BROCK: Football I,2: Basket- ball I,2,3,4 llntral: Swimming I, 2,3,4: Advisory Board 2,3: Home- room Federation 2,3,4: Chess Club 4: Lettermen's Club 3,4: ICBM 4. TETO, DIANE THOMAS, KAREN: Concert Choir 2, 3,4: Jubileers 3,4: Girls' Ensem- ble 3,4: All-City Honor Chorus 3,4: All-State Chorus 4. THOMAS, LYNNE: Judo Club 3,4 iPres. 41: National Honor Society 4. TIDWELL, JINX TINDALL, KATHY: Latin Club l: Girls' League I: Orchestra I,2, 3: Pep Club 2,4: Homeroom Fed- eration 4: Songleader 4. TINDALL, LOIS: FHA I: Girls' League I,2,3,4. TIPTON, DEBRA: Pep Club 2,4: Titan Service League 4: Titan Lite- Writers 4: Homeroom Federation 4. TO RESDAHL, J EFF TOWNSEND, ROGER: Class Vice-Pres- ident I: Basketball I,2: Football I,2,3,4: Track I,2,3,4: Advisory Board 2: Lettermen's Club 3,4: Homeroom Federation 4. TRAUSCH, KEVIN: Baseball I,2,3: Basketball l,2 iIntra1. TREADWELL, LESLIE: Art Club 2,3: Pep Club 3. TRINCA, PETER: Newspaper Staff I, 2,3,4: SCAB 2: Debate 2: Folk Club 2: National Honor Society 4: Homeroom Federation 4: Ski Club 4, AFS 4. TRISLER, BARBARA: French Club I,2: Girls' Choir I,2: Red Cross 2: Badminton 3,4. TUCKER, BRUCE: Track I: Basketball 2 lIntra1: Gun Club 4: Basketball I. TUCKER, TOM TUDOR, JUDY TURNER, DANIEL: Chess Club I,4: Concert Choir 2,3,4: Tennis 2,3, 4: National Honor Society 4: ICBM 4: Lettermen's Club 4. ULLERY, SCOTT: Basketball I: Swim- ming I,2,3: Basketball 3,4 lln- tra1. UPHAM, BETSY: Red Cross 2: Pep Club 2: FTA 2: Advisory Board 2,3,4: Girls' League 4: National Honor Society 4. VAIDEZ, HENRY: Basketball 2,4 lln- tra1: Softball 3,4 iIntra1: Volley- ball 3 lIntra1: Football 4 Ilntral: DECA 4. VALENZUELA, ROBERT: Baseball I, 3,4: Lettermen's Club 4: Model Legislature 4. VANASDLAN, SHIRLEY VANCE, TED: Wrestling I: Gymnas- tics I. VANDERFORD, HARVEY: Gymnastics I: Basketball 2,4 iIntra1: Basket- ball 2: Lettermen's Club 3,4: Track 3,4: Cross Country 3,4: Football 4 lIntra1. VARVIR, MARK: Volleyball 1,3 lln- tra1: Softball I Ilntra1: Track I, 3 lIntra1: Red Cross 3: Basketball 3 iIntra1: AFS 4: Football 4 lln- tra1. VEALS, ANDREA: Girls' League I,2, 3,4: Thespian Society 2,3,4: Speech and Debate 3,4: Red Cross 4: Speakeasys 4: AFS 4. VETTERLEIN, BABS: FTA 2,3,4: Thes- pian Society 3,4: Red Cross 4: National Honor Society 4. VICTOR, WILLIAM: Track 'l,3,4: Cross Country I,4: Basketball 3 llntrai: Homeroom Federation I . VILLASENOR, ALICIA VINING, JOANNE VOGLER, VICKIE: Red Cross I: Pep Club 2: Girls' League 3,4. VOLNER, RICK: Gun Club 2. VUCASOVICH, ROBERT: Football I, 2,3,4: Basketball I,2: Track I: Student Council I,2: Lettermen's Club 3: Weightlifting 3 lIntra1: Wrestling 3 IIntra1: Basketball 4 lIntra1. WAHL, MICKEY WAHL, SHIRLEY: Newspaper Staff 2, 3,4: National Honor Society 4. WAJTASIAK, MELINDA: Forensics I, 2: Regina Maria Club I: French Club 2: Science Club 3: National Honor Society 4. WALKER, RICHARD WALTON, CAROL WARD, FRANK WARD, MARTIN: Band 2,3,4: Chess Club 2,3: Latin Club 2. WARREN, DARRYL WATT, LINDA WEBB, KAY WEBER, AMY: Class Councilman I,2: Girls' League Sec. I: Red Cross I,3: Homeroom Federation 2: Cheerleader 2,3,4: Spectra 3: Yearbook Staff 4. WEGER, JERRY: Track I: Newspaper Staff 4. WEINBERG, LILLIAN: Red Cross I,4: Cheerleader I,2: Volleyball I: Basketball I,2: Badminton 4: Spectra 3,4 lCo-Ed. 41: Homeroom Federation 4: Ski Club 4. WEST, DAVID: Track 2. WEST, RAY: Homeroom Federation I: Basketball 2 Ilntral. WESTERFIELD, ROBERT: Football I: Baseball 2,3. WHEATON, JANET: Orchestra I,2: Homeroom Federation 4: Capri- cians 4: National Honor Society 4. WHITAKER, DALE: Pep Club 2: Treb- lettes 2: Ski Club 4. WHITE, RANDY: Gun Club I: Vol- leyball 3,4 llntrai: Basketball 3, 4 llntral: ICBM 4. WHITING, ANABELLE: Orchestra I: Pep Club 2: Judo Club 2,3: Red Cross 4: AFS 4. WIDENER, SHARRY WIGGINS, MARY: Homeroom Feder- ation 2: Treblettes 2: Pep Club 2: SCAB 2: Mixed Choir 3,4: MENC Choir 3: Yearbook Staff 3,4 lAssist. Ed. 41. WILEY, CAROL WILEY, SANDY: Band I,2,3,4: Treb- lettes I: Concert Choir 2,3,4. Rodeo Queen Patty Loftis and King Fred Emerling reigned over the Rodeo dance which was held on Wednesday, Feb. 28. Eight attendants were also honored. I WILDE, KRISTIE: Advisory Board 1, 2,3,45 Key to the World 1,2,35 Homeroom Federation 25 Girls' State 35 National Honor Society 45 Songleader 35 Cheerleader 4. WILHELMI, MARY: Red Cross 2,3,45 Forensics 2. WILKE, MARGARET: AFS 15 Spanish Club ly Treblettes 25 Ski Club 35 Gymnastics 35 Model UN 45 Spec- tra 45 Girls' League 4. WILKES, BEV WILKINS, JAYNE: Homeroom Feder- ation 1,25 Pep Club 1,2. WILKINSON, AUDREY: Pep Club lg Titan Lite-Writers 2,35 DECA 3,4 lHistorian 41. WILLIAMS, SANDRA WILNER, MICHAEL: Football 1,25 Baseball 1,2,3,45 Wrestling 1. WILSON, CORLEY WILSON, KAREN: Pep Club 1. WILSON, NANCY WILSON, THOMAS WING, JULIET: Art Club 4. WINGARD, RENATE: FHA lg GAA lg Future Nurses 25 Secretarial Club 2. WITTER, ELLEN: Gymnastics 3,45 Homeroom Federation 4. WOHLERS, RANDOLPH: Stage Crew 1,2,35 TV-Radio 35 Titan Lite- Writers 4. WOITER, BRYANT: Football l,2,35 Pep Club 2,35 Swimming 1,2,3. WONG, DANNY: Cross-Country 15 Track l,3,4. WOOTEN, HOWARD WRIGHT, MIKE: Basketball 1,2,3 lIntral5 Baseball 1,2 llntral. WRIGHT, MILDRED: FTA l,27 Treb- lettes 25 Mixed Choir 3. WRIGHT, STEVEN: Wrestling Mgr. 15 Swimming Mgr. 1,2,3,45 Foot- ball Mgr. 3,45 Lettermen's Club 3,45 Football 4 lIntraI5 Wrestling 4 llntraJ5 Red Cross 45 Pep Club 4. WRYE, CLAIRE: Spanish Club 15 Red Cross 1. YAUGER, LOIS: Basketball 1,4 lln- tral5 Softball 3 llntral. YE RKES, TANNA YORK, BRENDA: Girls' League 15 Homeroom Federation 35 Red Cross 3. YOUNG, LORETTA YOUNG, WALTER: Volleyball 2 lln- tral5 Art Club 4. YOUNG, YVONNE: Titan Lite-Writers 3. ZEIDEL, LARRY: Band 2,35 Stage Band 35 DECA 4. ZEIDMAN, SHAR ZEIGLER, MARLENE: Treblettes 2,35 Red Cross 3. ZEPP, RALPH ZIENTARSKI, LAWRENCE ZIMMERMAN, KATHY: Girls' League 3,45 National Honor Society 4. ZOBACK, CHERYL Senior football players, cheerleaders and songleaders celebrated the senior vic- games which were held during Spirit Week. The Class of 1963 won 'he -manic, tory in the chariot race. The race was only one of the events in the Titanic as well as the week's overall class competition and the Spirit trophy. A Agte, Milton: 18,141. Alcumbrac, Nancy: 18. Alvarez, J. R.: 20. Antrim, William: 34. Archambault, Philip: 26. Arriaga, Edward: 20. E Facult Elrod, Locket: 32. Essig, James: 16,233. Eustice, Willard: 22. Evans, J. McGee: 15. F Gardner, Ruth: 18. Arvizu, Rosela: 37. Atwater, Gerald: 18. Austin, Leo: 24. Aviles, Herlinda: 26. B Bailey, Dianne: 18. Baker, Bexta: 29. Alley Baldwin, Nick: 22. Baral, Evelyn: 18. Baron, Edward: 28,170. Barr, Reginald: 20. Bee, Burdette: 32,102. Bell, William: 32. Bishop, Towne: 20. Bishopp, James: 32. Bittinger, Jane: 16,17. Bool, Larry: 20,61. Boyd, Beulah: 18. Brady, Thomas: 34. Bratt, Lita: 3O,146. Breinig, Patricia: 18. Brown, Richard: 22,40,199. Bruner, Lois: 22. Bunker, C. A.: 26. Burgess, William: 30,31. Bush, Gaylord: 32. C Caldwell, Earl: 16. Campbell, L. F.: 28. Carlton, Muriel: 16. Caswell, Patsy: 29,193. Chapman, Joy: 26,141. Chedsey, Leonard: 32,105,137. Christ, Dianne: 18. Cole, Roy: 40. Cook, Jamie: 126,233. Cook, Rollin: 2O,156,189. Cooper, Richard: 28. Corder, Wayne: 28,173,178. Cox, Emily: 15,132. D Daunheimer, Jim: 32. Davenport, Barbara: 34. Davenport, Ula Mae: 34,133. Davis, Charles: 24. Davis, Dorothy: 29,121. Dawes, Jeanne: 22. Deardorff, Duane: 16. Dick, Jim: 20. Diehl, Wayne: 22. Droegemeier, Arthur: 22. Drum, Priscilla: 18,132. Duran, John: 24,156. Dye, Marilyn: 18,106. A Acevedo, Ginny: 270. Acevedo, Henry: 157,270. Ackerley, Ande: 116,234. Ackerly, Phil: 270. Acorn, Candy: 270. Acorn, Kim: 181,200. Adams, Jim: 7B,191,234. Adams, Linda: 254. Adams, Steve: 254. Adams, Teddy: 200. Adamson, Ralph: 200. Addison, Jean: 234. Fleshman, Geneva: 29,194. Ford, Robert: 28,187. Fraesdorf, Marie: 18. G Geisert, Glen: 24. Glover, John: 34. Goodwin, Walter: 20. Guirl, Eugene: 14,l6,17. H Hall, Robert: 22. Haluck, Gerald: 22. Hamer, Leonard: 18. Hamrick, Joseph: 25. Harcourt, Verna: 20. Harcus, Glen: 28. Harden, Sally: 29. Hatcher, Paul: 24,25. Hawn, Claire: 22,135. Hilton, Esther: 29,194. Hodge, Howard: 23. Holliday, Walter: 25. Hollis, George: 34. Holley, Don: 28,156. Hopkins, Louis: 26,165. Howe, Van: 20,154. Howell, Joyce: 23. Hubbard, Lee: 28. Hudson, Marion: 34. Hunt, Mary Jane: 18. lsmay, Bill: 20,180. lveson, William: 30,31. J Johnson, Dexter: 18,24. Johnson, Ralph: 25. Jones, Robert: 28. Jordan, Pauline: 29,122. Justus, Lane: 30,112. K Kanouse, Lynn: 32,154,170. Karrle, Mel: 28. Kellis, William: 25. Kelly, Maxine: 18. Kemmeries, William: 14. Kowalcek, Frank: 30. Kush, Bill: 23,253. Addy, Mike: i57,i77,1s7,27o. Addy, Noel: 234. Adkins, John: 234. Ahart, Cathy: 270. Aitken, Eileen: 254. Aitken, Jon: 190,191,234. Alcantar, Cathy: 234. Alcorn, Steve: 200. Aldrich, Donald: 270. Alexander, Cliff: 254. Alexander, Cliff: 156,176. Alexander, Lawrence: 234. Alford, Jeff: 45,51,200. Alford, Joe: 234. Index L Lens, Bob: 2a,19o. Lieurance, Marianne: 18. Linkhart, June: 18. Livieratos, J. N.: 20,44. Lowell, James: 24,25,128. Lundy, Jesse: 38. M Maben, Ronald: 33. Maxwell, Ed: 23. McBride, William: 34,144. McConeghy, Robert: 25. McKnight, Ray: 23. McNabb, Richard. 26,27,140. Meyer, Boyd: 19,164,165. Mignery, Jack: 25. Milner, Don: 19. Minarik, Smith: 21,208. Mitchell, William: 38. Modica, Diane: 29,199. Mondeau, Eugene: 25. Morriss, Madgelene: 34. Mueller, Sandi: 21. Murphy, Wiley: 16,17. N Nelson, Robin: 34. Norris, Celeste: 31 . Nowels, lda Mae: 21. Nystrom, Suzanne: 19. O Ocon, S. A.: 26. O'Dell, John: 21,61. Owen, Marie: 26. P Palm, Dick: 21,154. Patterson, Mona Lou: 29. Pearson, Ken: 24,25. Peterson, Rose Marie: 31. Pinkston, Ruth: 16. Platt, Mary: 37. Powdrill, Dolores: 38. Putz, Dorothy: 19. Q Queen, Everett: 22,23. Quenelle, Conrad: 13. S Sadler, Merrie: 25. Santee, Donna: 21. Schiesel, Cynthia: 19,130. Schnaiter, Lois: 26. Seiler, Jerome: 23. Shapiro, Norman: 26. Shoemaker, Susan: 34. Shrewsbury, Myrtle: 37. Sievers, Paul: 21. Silverburg, Asher: 19. Sitterly, Roberta: 19. Slawson, Albert: 15. Smith, Mildred: 21. Smith, Sterling: 25,269. Soelter, Ann: 19. Sommerfield, Richard: 25,144. Southard, Richard: 33. Spahr, Z. W.: 33. Sprinkle, Joyce: 29. Standifer, Charley: 37. Stevenson, James: 31,110,111. Stiles, C. V.: 36. Stone, Dorothy: 26. Strang, Kaay: 29,12O. Stuessy, Dorothea: 26. Swart, Leon: 16. T Tabone, Anthony: 19. Thorp, Charles: 23. Tidwell, Clyde: 21. Tozier, Andrew: 19. Trachta, Mary Glenn: 23,132. Traister, Charles: 16. Tweedy, John: 21 . V Van Horne, Kathleen: 19. W Walden, Calvin: 34. Walker, Wanda: 34. Warren, Elinor: 19,253. Weeks, Violet: 23,145. Weimer, L. R.: 28,156,177. Weiss, Fred: 21. Wester, Juanita: 16. Wharton, Jerry: 23. Whipp, L. A.: 19. Whitaker, Barbara: 37,135. White, Mary Lou: 269. Wilson, Virginia: 34. Wing, Jim: 25,167. R Raskob, John: 23,135. Ratcliff, Arthur: 25,145. Richardson, William: 31,109,147. Ross, Clarence: 21 . Roy, Phil: 19. Student Index Allair Allen, e, Ann Marie: 200. Allen, Bruce: 254. Allen, Jim: 234. Allen, Pam: 104,234. Allen Sue: 104 105 137 200. Allen: Wanda: ioo. I I Allen, William: 270. Leon: 200. Art: 68,90,127,161,169,200. Allison, Robert: 254. Allvin, Vickie: 270. Almgren, Steve: 254. Altuna, Richard: 32,200. Alvarez, Diane: 234. Y Young, Kathryn: 29. Z Zammit, Alferd: 34. Amato, Fran: 234. Ames, Lawrence: 254. Ammon, Joel: 254. Amparan, Gar: 270. Ancharski, Michael: 133,184,232 234. Ancharski, Robert: 157,187,270. Anderson, Brenda: 254. Anderson, Charles: 270. Anderson, Charlotte: 234. Anderson, Cheryll: 200. Anderson, Christine: 2701 Anderson Anderson , Craig: 270. 1 Debbie: 234. Anderson Anderson, Emburn: 200. Anderson, Gary: 108,111,234. Anderson, Greg: 270. Baird, Marla: 201 . Ba ker, Baker, Barbara: 234. BOb: 201. Anderson Anderson, , Janie: 254. Anderson Anderson Anderson Janet: 253,254. Janice: 254. K.: 270. , Laura: 254. Anderson Leslie: 121,199,200. Anderson Linda: 270. Anderson Lisa: 254. Anderson Mike: 254. Anderson Niels: 200. Rebecca: 270. Barker, Andrew, Ed: 254. Andrews, David: 254. Andrle, Barbara: 112,234. Andrle, Warren: 270. Angevine, Linda: 200. Angulo, Kathi: 270. Angus, John: 270. Antonetti, April: 109,147,234. Antonetti, Bonnie: 270. Baker, Chris: 234. Baker, Cythia: 270. Baker, John: 270. Baker, Richard: 201. Bakrow, Bruce: 234. Bakrow, Caren: 270. Balcom, Mort: 201. Ball, John: 187,254. Ball, William: 127,187,201. Ballash, Kurt: 254. Ballis, Anne: 254. Bangert, Jerry: 45,52,201. Bankson, Bonnie: 270. Bankson, Lee: 270. Barba, Danny: 254. Barber, Linda: 270. Bartield, David: 254. Bargos, Debbi: 270. Bargos, Michelle: 254. Bennett, Danny: 270. Bennett, David: 191,234. Bennett, Faye: 254. Bennett, Gerald: 234. Bennett, Paulette: 270. Bennett, Ralph: 254. Bennett, Susan: 254. Benson, Karen: 108,270. Bently, Eva: 201 . Araiza, Araiza Eva: 270. Frank: 137 234. Ba rndollar, David: 254. Archie: Patsy: 194,200. Arduin Ard rey , Cflllilz 200. CYl lfl1lG: . Ardrey, e, Frank: 200. Batiste, Arendell, Rick: 185,270. Argraves, Ed: 179,200. Armbruester, Ronald: 270. Armour, Dana: 200. Armour, Diane: 234. Armour, Don: 270. Armstrong, Nancy: 111,234. Arndt, Darryl: 110,254. Arneson, Jim: 152,176,234. Arneson, Mark: 83,127,128,152 153,1B1,200. Arneson, Tom: 270. Arnett, Greg: 104,234. Arnett, Linda: 254. Arnett, Pam: 200. Arnett, Patricia: 200. Arnoldi, Mike: 254. Arriaga, Joe: 181,254. Arthur, Jackie: 234. Arveson, Janet: 45,103,113,114, 200. Asbell, David: 254. Ashburn, Cindy: 270. Ashcroft, David: 108,147,254. Ashcroft, Tom: 201. Asher, Chris: 253,254. Astiazaran, Aida: 234. Aston, Rollah: 45,51,111,112, 114,147,201. Aston, Sam: 1l0,254. Atchison, Annette: 201. Athans, Carol: 115,234. Athans, Marcia: 254. Atchison, Bruce: 32,270. Barlow Bill: 153,174,234. , Steuart: 254. Barlow, Steve: 234. Barner, Barnes, Barnes, Margaret: 270. Pam: 270. Susan: 113. Barnett, Bob: 201. Barnett, Bruce: 270. Barnett, Lynne: 270. Barnett Baron, , Max: 201. Dave: 270. Ba rr, Buddy: 254. Bentley, Evelyn: 254. Benton, Craig: 254. Bentz, Joe: 144. Benziger, Adelrich: 270. Benziger, Phil: 234. Berger, Eddie: 254. Berger, Janet: 109,233,234. Bergman, Eugene: 185,254. Berk, Errol: 56,58,133,147,161, 176,232,234 Berkson, Gale: 254. Berkson, Larry: 270. Bernacdi, Danny: 254. Bernal, Sue: 29,254. Bernard, Kathy: 234. Bernhardt, Steve: 144,234. Berry, Cindy: 254. Berry, Debbie: 115,254. Berry, John: 1OB,234. Berry, Pete: 254. Berry, William: 201 . Bertling, Dorene: 202. Barrett, Larry: 179,234. Barrett, Scott: 270. Barringer, John: 234. Barry, Katherine: 234. Barry, Mark: 270. Barsness, Dawn: 270. Barsness, Randall: 254. Bartel, Debra: 270. Bartlett, Gail: 270. Bartlett, Tom: 234. Borwick, Ernie: 201. Bertschy, David: 254. Besecker, Valeri: 254. Besecker, Vicki: 235. Bess, Bill: 254. Best, Mark: 152,235. Bethune, Tom: 109,l84,255. Betterton, William: 254. Bever, Daryl: 45,50,181,202. Bobin, Richard: 271. Bockman, John: 271. Bockman, Margaret: 255. Bockman, Mary: 45,202. Bogardus, Karen: 115. Bogott, Kent: 255. Bokowski, Jerry: 109,184,185,235 Bollinger, Marlayna: 255. Bolv, Bob: l52,ls5,l74,235. Bolt, Charles: 255. Bond, Kevin: 271. Bondhus, John: 255. Bonewell, Cathy: 103,113,202. Bonewell, Dave: 192,271. Bonham, Karen: 63,98,202. Bonham, Laura: 271. Bonshoff, Diana: 255. Bonshott, Lois: 271. Borbon, Arnie: 235. Borbon, Mary: 255. Borbon, Tony: 179,235. Borge, Patti: 202. Borgert, Richard: 271. Bortnick, Lauren: 235. Bossard, Cregg: 271. Bothwell, Lon: 255. Bouchard, Dennis: 18B,235. Bouley, Steve: 271. Bourbon, Linda: 271. Bouse, Linda: 235. Bossard, Cregg: 271. Boutin, Chuck: 271. Bouton, Joyce: 202. Bowden, John: 202. Bowden, Paul: 271. Bowen, Richard: 271. Bower, Scott: 202. Bower, Tom: 255. Bowers, Candy: 235. Bever, Sharla: 254. Beverly, Bezy, Ca Gayle: 270. rol: 235. Bidegain, Christie: 270. Biesterteld, Darrel: 156,235. Biggs, Bi ll: 157,171,270. Biggs, Brian: 270. Bowers, John: 271. Bowling, Becky: 193,235. Bowman, Cathy: 255. Bowman, Dale: 202. Bowman, Guy: 235. Bowman, Bryan: 156,235. Bowman, Yvonne: 235. Basie, Michele: 115,254. Bass, Bryon: 201. Bass, Chuck: 270. Batiste, Marc: 254. Robin: l25,254. Biggs, Peggy: 235. Billings, Joe: 179,235. Billings, Linda: 60,106,107,131, 202. Billings, Michael: 192,270. Bowyer, Cindy: 202. Bowyer, Frank: 271. Boyd, Karen: 202. Boyd, Mike: 255. Boyle, Pm: 271. Ault, Alan: 201. Austin, Tom: 270. Avram, Melanie: 270. Ayers, David: 201. Ayers, Jack: 254. Aylsworth, Sue: 201. Azua, Cecelia: 270. Azua, Sandy: 234. B Baader, Becky: 254. Babauta, Ken: 201. Babinski, Joe: 68,84,126,160,161, 162,163,234 Babinski, Karen: 45,194,195,201. Babinski, Raymond: 270. Baggin, Nancy: 270. Baggin, Steve: 234. Baglione, Richard: 254. Bailey, Gretchen: 234. Bailey, Jeff: 153,234. Bailey, Guy: 254. Bailey, Kevin: 254. Bailey, Michelle: 115,234. Bailey, Sharon: 234. Bailey, Vance: 270. Bailey, Walt: 153,187,234 Baird, Keith: 254. Bauer, Judi: 270. Bauer, Marie: 270. Baum, Chris: 254. Baumeister, Doris: 115,254 Baumer, John: 234. Bavaro, Bill: 169,234. Bavaro, Joe: 270. Baye, Judy: 254. Bazurto, Raul: 177,270. Bazurto, Richard: 234. Bazurto, Robert: 201. Bea, Charles: 270. Beard, Judy: 234. Bearden, Paula: 270. Beardsworth, Debbie: 270. Beathe, Keith: 254. Beattie, Barb: 234. Beattle, Betsy: 270. Beck, Gregory: 234. Beckel, Hollie: 270. Becker, Gary: 234. Becker, Janet: 254. Beddow, Thomas: 201. BeDunnah, Karen: 114,201 BeDunnah, Thomas: 270. Begay, Rose Ann: 270. Beir, Sherry: 270. Beitel, Jerry: 270. Belford, Peggy: 254. Bell, Arnie: 234. Bell, Bonnie: 270. Bell, Kit: 254. Bell, Roxie: 254. Bellintonte, Richard: 234. Bender, Margie: 201. Benefiel, Tom: 177,270. Benge, Cathy: 234. Benge, John: 174,201. Benhase, Lynne: 114,254. Benhase, Rick: 270. Benites, Lorraine: 234. Bennett, Brad: 109,201. Bingham, Jean: 130,235. Bingham , Mike: 127,169,235. Bingham, Sandy: 254. Bingham Binnie, L , Susan: 270. ynn: 254. Biondi, Karen: 202, Birch, Melanie: 271. Birch, Michele: 235. Bird, Sandy: 271. Birnbaum, Harry: 254. Bishop, John: 254. Bishop, Stephen: 202. Blacharski, Sherry: 271. Black, Charmayne: 271. Black, Ronald: 235. Black, Tom: 202. Blackman, Althea: 254. Blackwell, Bill: 181 ,1 87,252,253, 255. Blackwell, Dave: 235. Blackwell, Margo: 111,193,202. Blake, James: 255. Blanco, Dan: 271. Blattel, Peggy: 109,235. Blaylock, Janet: 111,255. Bleakmore, David: 271. Blecha, Bonnie: 45,202. Blecha, Pattie: 253,255. Blecha, Pete: 103,187,235. Blessi, Melanie: 255. Blessing, Bill: 235. Blevins, Randy: 255. Bloomingdale, Melinda: 255. Bloomingdale, Richard: 271. Blower, Susie: 271. Blumenstetter, Anne: 254. Blumer, Lois: 202. Bluth, Marlene: 271. Boam, Gary: 109,255. Boom, Greg: 253,255. Boas, Marcy: 255. Boatwright, Pat: 271. Bozarth, Lyn: 235. Bradley, Barb: 122,123,232,235. Bradley, Bryce: 108,147,235. Bradley, Carol: 271. Bradley, Donna: 271. Bradley, June: 235. Bradley, Bradsha Mike: 156,255. w, Gayle: 253,255. Brady, Chris: 255. Brady, Diane: 255. Brady, Gail: 271. Brady, Janet: 235. Brady, Steve: 189,235. Brahms, David: 56,181,252,253, 255. Brahms, Freddy: 56,171,187,268, 271. Bramhall, James: 271. Bramblett, Scott: 45,62,202. Brandenburg, Gail: 271. Brandon, Betty: 255. Brayton, Ken: 235. Brena, Pete: 271. Brenemon, Gayle: 235. Brewer, Bill: 105,113,202. Brian, Adrienne: 255. Brian, Mary: 271. Brickman, Les: 255. Bridgeman, Jerry: 157,271 . Bridgeman, Sharon: 255. Briel, Sue: 271 . Bright, Bill: 255. Briney, Carol: 271. Brink, Dale: 271. Brink, Dave: 235. Britton, Margaret: 271. Brisley, Rick: 113,235. Britt, Debbie: 255. Britton, Boston: 112,156,255. Britton, Deborah: 202. Britton, Susan: 202. Britz, Pamela: 255. Brizee, Bill: 271. Brock, Barry: 202. Brock, Lynn: 271. Broderick, Charles: 271. Brodigan, Dennis: 271. Brodigan, Lynda: 202. Brodsky, Arnold: 255. Bronson, Ginger: 235. Bronson, Valerie: 271. Brooks, Barry: 271. Brooks, David: 235. Brooks, Gerald: 9l,160,161,162, 163,203. Brooks, Lynda: 255. Brooks, Moncia: 115,195,255 Brown, Charles: 255. Brown, Darrell: 255. Brown, Dean: 109,271. Brown, Donna: 45,203. Brown, Brown Elaine: 235. Frances: 255. Browni Jim: 176,255. Brown, Joann: 255. Brown, Joy: 271 . Brown, Kathy: 271. Brown, Ken: 255. Brown, Linda: 255. Brown, Michael: 156,176,235. Brown, Paula: 203. Brown, Richard: 235. Brown , Tim: 156,176,255. Browning, Bobby: 177,271. Browning, Robert: 187,271 . Brownlee, Jeanne: 45,132,203. Brownlee, John: 253,255. Broyles, Ann: 271. Bruce, Bob: 235. Bruce, Jim: 235. Bruce, Kathie: 271, Brueck, David: 1 1 1 ,255. Brugman, Jon: 235,253. Bruins, Cory: 255. Bruins, Joe: 235. Brummett, Rodney: 185, 255. Brunson, Karen: 255. Bryan, Judy: 45,194,203. Bryan, Wendy: 271. Bryant, Cathy: 253. Bryant, Eugene: 271. Bryers, Patty: 44,45,49,12O,131, 199,203. Buchanan, Linda: 271. Buchholz, Bob: 203. Buchholz, James: 271. Buchholz, Leslie: 193,235. Buchta, Roger: 235. Buck, Jim: 58,78,141,157,177,187, 269. Buckles, James: 203. Buckles, Robert: 203. Bucy, Linda: 193,271. Budd, Brenda: 255. Buehler, Joel: 235. Buethe, Mary Lou: 271. Buethe, Richard: 203. Bumgartner, Rick: 271. Burchard, Scott: 235. Burke, Debbi: 103,108,233,235. Burke, Diane: 115,253. Burkhalter, Jill: 271. Burkhart, Jeannette: 110,113,255. Burkhart, Julie: 271. Burkhart, Lisa: 235. Burkin, Nanci: 203. Burnett, Ruth: 235. Burns, Arlon: 235. Burns, James: 203. Burns, Mike: 192,271. Burns, Steve: 45,55,56,72,77,16O, 199,203. Burns, Tim: 192,269,271. Burrill, Barbara: 235. Burrill, Leanne: 271. Burruel, Carmen: 255. Busboom, Melis: 271. Bush, Deborah: 271. Bushey, Sandy: 271. Butcher, Dale: 255. Butler, Donna: 45,203. Butler, Patsy: 235. Butterfield, Debbie: 255. Butterfield, Linda: 203. Button, Barbara: 59,93,194,204. Button, Cyndi: 132,271. Buzard, Candyce: 235. Buzzard, Sandy: 235. Buzzard, Wayne: 204. Bye, Susan: 271. C Caber, Rick: 235. Cacioppo, Carol Lee: 45,68,104, 112,121,204. Caffarella, Linda: 113,114,235. Caho, Kenneth: 235. Caho, Wanneta: 271. Caid, Joe: 271. coin, Bob: 191,235. Caldwell, Ray: 271. Callahan, Ana: 235. Callaway, Andrea: 236. Callaway, Debra: 236. Callicoat, John: 236. Cambenst, George: 255. Camen, Andrew: 271. Cameron, Scott: 204. Cameron, Wendy: 255. Cammarn, Roberta: 255. Campagne, Jana: 236. Campbell, Carolyn: 271. Campbell, Cathy: 255. Campbell, Cindy: 271. Campbell, Debbie: 236. Campbell, Karen: 271. Campbell, Linda: 112,204. Campbell, Mike: 271. Campbell, Nan: 132,194,233,234. Campbell, Panny: 132,204. Campbell, Rod: 108,111,147,255. Campbell, Sherry: 104,204. Campos, Aida: 204. Campos, Charlie: 255. Canady, Larry: 255. Canady, William: 204. Cancio, Gilbert: 156,181,236. Cancio, Maria: 271. Canfield, Tami: 271. Cangiolosi, Ruth: 204. Cannon, Curtis: 164,255. Cannon, Pam: 204. Canterbury, Jim: 255. Canright, Clark: 38,66,72,127,153 155,1B1,199,204. Canright, Mark: 14,56,73,80,82, 127,153,181,198,204. Caples, Kelsey: 45,52,204. Caples, Sara: 236. Capple, Sally: 236. Carano, Patrick: 236. Cardenas, Steve: 176,255. Carithers, Liz: 272. Carithers, Pattie: 236. Carlton, Bruce: 272. Carlton, Jeffrey: 236. Carnahan, Linda: 204. Carpenter, David: 109,255. Carper, Bernie: 272. Carper, Margi: 272. Carr, Barbara: 72,103,120,131, 198,204. Carr, Jim: 114. Carr, Kathy: 255. Carr, Randy: 255. David Carter, Cheryl Zoback, Pearl McCIements and emcees. They were responsible for introducing- the Bob Schock were selected to be the senior show skits with humorous comments on the presentations. Dailey, Carrell, Carrillo Carrillo Jamie: 255. , Cathy: 273. ,Celilia: 255. Carrillo, Chris: 255. Carrillo, Silvia: 204. Carrillo Carrillo Carrol, Carson, , Jerry: 169. , Steven: 255. Rose: 272. Jill: 114,255. Carsten, Val: 272. Carter, David: 61,106,107,l31,199, 204,299. Carter, Jeff: 176,255. Carter, Maureen: 236. Carter, Scott: 116,253,255. Cary, Merle: 255. Cary, Sherry: 272. Casadei, Patricia: 255. Casebier, Rodney: 204. Casella, Joe: 272. Casey, Barbara: 272. Casey, Bill: 156,17O,256. Casey, Cindy: 236. Casey, Lynne: 109,256. Casey, Nick: 204. Casey, Steve: 156,17O,l 81,256. Cassidy, Michael: 204. Castellanos, Margaret: 256,272. Castellanos, Martha: 256. Castillo Castro, , Sylvia: 272. Alex: 236. Cate, Bill: 272. Cate, Colleen: 138,204. Cate, Paul: 188,272. Clark, Chris: 272. Clark, Debbie: 256. Clark, Deborah: 256. Clark, Emily: 236. Clark, Linda: 272. Clark, Lisa: 256. Clark, Mike: 256. Clark, Philip: 272. Clark, Tom: 25,236. Clark, Tom: 236. Clorno, James: 205. Claussen, Darrell: 205. Clayto Cleme n, Lenny: 205. nt, Georgette: 272. Cleveland, Janet: 205. Cleveland, Karen: 272. Cleveland, Marilynn: 205. Cleven, Cathy: 108,109,1l1,114, 233,236. Click, Tom: 256. Clitt, Kay: 45,205. Clifford, Mike: 272. Cliffor Clitfor Clinga d, Neita: 272. d, Stephen: 272. n, Catherine: 236. Clippinger, Sharry: 256. Clippinger, Shelly: 256. Clor, Virginia: 236. Closs, Rogena: 236. Cloud, Doug: 272. Cloud, Steve: 236. Clautier, Nevin: 236. Clukey, Dan: 192,272. Clukey, Tina: 256. Corcoran, Cochelle: 236. Corcoran, Colinda: 272. Corcoran, Cortney: 272. Cordell, Gwen: 272. Corder, Betty: 108,256. Cordery, Russell: 256. Cordery, Wayne: 205. Corey, Bruce: 256. Corlies, Mike: 256. Cornelius, John: 108,205. Corron, Nita: 272. Corron, Teresa: 236. Cosner, Doolie: 206. Coss, Lawrence: 181 ,272. Cossel, Michael: 157,272. Cossel, Stephen: 145. Costello, Trudianne: 256. Coston, John: 236. Coston, Marti: 272. Costin, Peter: 236. Cattle, Cathy: 272. Couchenour, Linda: 272. Couchenour, Terry: 206. Couell, Mary: 272. Coulbourn, Gary: 206. Coulter, Marshall: 113. Courtright, JoAnn: 236. Couturier, Dan: 170,257. Couturier, David: l65,272. Covault, Mark: 1B9,236. Covel, Mary: 272. Cox, Cathy: 56,268,272. Cox, Chuck: 272. Cox, Dale: 257. Dame, John: 'l09,273. Daniel, Danny: 257. Daniel, Dian: 206. Daniel, Steven: 206. Daniel, Daniels Susanne: 273. , Terry: 273. Daniels, Juanita: 237. Daniels, Linda: 257. Daniels, Martha: 257. Daniels , Tom: 273. Dari, Nancy: 206. Daugherty, Ed: 257. Davanzati, Gina: 257. Davi, Nancy: 206. David, Kim: 273. David, Michael: 59,206. Davidson, Denise: 206. Davidson, Gary: 257. Davidson, Jamie: 13O,237. Davis, Anita: 273. Davis, Connie: 237. Davis, Doug: 179,273. Davis, Elena: 45,51. Davis, Geraldine: 237. Davis, Gordon: 257. Davis, Guy: 181,237. Davis, Janet: 273. Davis, Judy: 237. Davis, Margi: 273. Davis, Rick: 156,176,237. Davis, Rob: 273. Davis, Scott: 153,206. Davis, Suzi: 91,98,123,199,206 Sherry: 273. Cazee, Denis: 272. Celaya, Josephine: 256. Celenza, Donna: l33,236. Celenza, Glenn: 204. Cely, Cathie: 272. Cerender, Gary: 204. Cerepanya, Michael: 204. Cerepanya, Pat: 157,272. Chaidez, Gordon: 104,272. Chaison, Eric: 6l,205. Chaison, Sandy: 256. Chamberlain, Alex: 256. Chamberlain, George: 236. Chambers, John: 188,272. Chandler, Cathy: 113,139,236. Coalter, Marshall: 181,256. Cobb, Howie: 236. Coburn, Jimmie: 256. Cochran, Anneeta: 205. Coghan, Frank: 187,272. Coghan, Margaret: 272. Cogossi, Gail: 256. Coins, Mary: 272. Colborn, Beth: 272. Cale, Bob: 205. Cole, Danny: 256. Cole, Dave: lO9,1l1,1l4,147,233, 236. Cole, Nanci: 205. Cole, Scott: 272. Cox, Lonnie: 272. Cox, Nancy: 1l2,236. Cox, Rosemary: 206. Croce, Jim: 257. Craig, Melody: 272. Craig, Paulette: 236. Craig, Terry: 236. Crain, Lynette: l95,272. Crain, Paulette: 272. Cramer, Bruce: 112,l33,206. Cramer, Stephen: 1l4,257. Crane, Hugh: 206. crane, Lindo: 112,113,114,2oa. Crane, Mike: 273. Craven, Mary: 257. Chapin, Wanda: 272. Chapman, Lorraine: 236. Chapman, Renee: 272. Charleston, Terry: 236. Charva Charva Chavez Chavez t, Cindy: 205. t, Lorrie: 236. , Amanda: 205. Karen: 272. chqvezf Mike: 115,256. Cheney, Barbara: 272. Cheney, Jane: 236. Chesin, Gail: 236. Chiasson, Sarah: 133,141,204. Childress, Rick: l06,174,l78,179, 236. Childress, Sally: 272. Childs, Jim: 256. Chinnis, Kathy: 272. Chitty, Ricky: 179,272. Chlopowicz, Janice: 104,236. Chlopowicz, Roy: 256. Christ, Connie: 256. Christensen, Kathi: 236. Christensen, Steve: 256. Christianson, Jan: 110,272. Christner, Nancy: 236. Chronister, Larry: 256. Chuba, JoAnn: 256. Chuba, John: 256. Church, Cindy: 272. Church, Jack: 236. Ciborowski, Sue: 272. Cichinsky, Michael: 236. Cinquemani, Pete: 205. Cipares, Jan: 272. Cipares, Kay: 205. Cirzan, Les: 205. Cirzan, Ralph: 272. Cisco, Debbie: 272. Clancy, Jim: 205. Clancy, Rona: 118,119,205. Clapp, Babbe: 236. Clark, Bill: 272. Clark, Bob: 17O,'l76,17B,179,236. Cole, Steve: 236. Coleman, Richard: 205. Colgin, Sybil: 236. Collier, Brian: 272. Collier, Jay: 256. Collier, Noreen: 272. Collins, Bob: 272. Collins, Charles: 142,256. Collins, Charles: 176,179,236. Collins, Dennis: 272. Collins, Herbert: 256. Collins, Maylinda: 272. Collins, Pat: 129,256. Collyer, Randy: 272. Colon, lrma: 272. Colpitts, Ben: 205. Colvill e, Anne: 35,98,199,205. Clavin, Earl: 272. Condit, Marilyn: 114,256. Confer, Patrice: 256. Conkli Conn, Conn, Contre n, Patsy: 138,236 Jeff: 256. Russell: 256. ras, Arlene: 236. Converse, Becci: 256. Conwell, Dana: 272. Conwell, Kim: 157,272. Cook, Coo k, Allan: 236. Chris: 236. Cook, Cindy: 114,256. Cook, Janet: 25 6. Cook, John: 272. Cook, Cook, Lawrence: 272. Rhonda: 272. Cooke, John: 272. Cooke, Joy: 115,236. Coombs, Barry: 256. Coape r, Brian: 256. Cope, Anne: 205. Cope, Bill: 272. Copher, Paul: 256. Copple, Steve: 205. Corbin, Ted: 272. Corbin, Tom: 256. Craven, William: 273. Creigh, Emmy: 56,252,257. Creighton, Teresa: 257. Creighton, Tam: 257. Crider, Ronnie: 177,lB7,273. Crim, Cythia: 273. Crim, Jameson: l81,206. Crist, Cindy: 236. Crobbe, Dan: 68,160,161,236. Crosby, Drew: 257. Crosley, Debbie: 236. Crosley, Sharon: 257. Cross, Clayton: 192,273. Cross, Robert: 257. Croteau, Chuck: 237. Croteau, Dave: l26,176,237. Croteau, Sue: 273. Crowe, Jerry: 237. Crowe, Robert: 273. Crumley, Steve: 257. Cruz, Kenny: 177,273. Cude, Dana: l92,273. Cummings, Deborah: lO9,273. Cunningham, Linda: 257. Curtis, Loren: 237. Curtis, Sherrell: l43,257. Curto, Dave: i56,237. Curto, Tom: 206. Cutchall, Greg: 185,257. cufcholl, Mike: 127,2o6. Cutler, Mike: l84,273. Cutshaw, Dave: 127,206. Cyprian, Florence: 273. D Dailey, Sherry: 273. Dakutis, Terri: 237. Daley, JoAnn: 273. D'Alfonso, Susan: 206. Daly, Lynn: 273. Daly, Michael: 257. Dame, Chrissie: 237. Davis, Teri: 206. Davis, Tom: 206. Dawes, Toni: 273. Dawson, Carol: 237. Dawson, William: 273. Day, Kathy: 257. Day, Nancy: 273. Day, Nancy: 273. Day, Ramon: 273. Dearth, Linda: 206. DeBoe, Nancy: 273. DeBreony, Jim: 206. Deckard, Jim: 108,206. DeCook, Kenneth: 257. Deeming, Randy: 108,273. Dees, John: 1l2,257. DeGagne, Jean: 273. DeGagne, Paul: 257. DeGreer, Ronald: 237. DeHaven, Tim: 257. De Jonghe, Nina: 273. de la Houssaye, Suzanne: 237. Delamore, Charlene: 237. DeLaVergne, Bill: 273. DeLaVergne, Ronald: 177,273. deLesdernier, Mark: 273. DeMarca, Jackie: 21,273. DeMars, Chris: 273. DeMars, Peter: 257. Demma, Tom: 257. Dempsey, Kathy: 237. Dempsey, Pat: 257. Denker, John: 1lO,273. Dennis, Bob: 207. DeNogean, Mary: 237. DeNogean, Ray: 146,206. Denolf, Wendy: 207. Denomy, David: 171,187,273. Denomy, Gary: 174,207. Denomy, Lawrence: 257. Denton, Fred: 257. DePorter, Fred: l76,179,257. Deppe, Rick: 237. Deepe, Robert: 69,88,207. DeShazer , Steve: 207. Desiardin Diane: 273. Desjardin, Elva: 257. Desiardin Lupe: 237. Desserres Jeanne: 273. 1 Devine, Suella: 273. Devries, Mary: 237. Dewberry, Karen: 237. Deweese, Daniel: 257. DeWitt, Dirk: 257. Dews, Dorcie: 237. DeYaung, Bob: l05,237. Dick, Dana: 192,273. Dick, Kirby: 257. Dick, Tim: 273. Dicken, Velinda: 273. Dickens, Maggie: 257. Dickens, Sherryl: 237. Dickens, Shirley: 'l39,206. Dickenson, Jayne: 'll5,257. Dickerson, Marilyn: 237. Dickerson, Trudy: 273. Dickey, Jerry: 273. Dickinson, Barbara: l35,237. Diers, Diana: 273. Dietz, Sharon: 207. Dietzman, Stan: l57,l77,l 87,273. Dietzman, Tom: l42,l45,l69,207 Diggs, Barbara: 273. Dills, Theresa: 257. Dian, Bill: 257. Dion, Louis: 237. Dirtadian, Armen: 'l89,257. Dix, Deborah: 237. Dixon, Alan: 273. Dodds, Dean: 273. Dodds, Keith: 237. Dodson, Skeet: 257. Doepke, Joyce: 207. Domtroski, Denise: 237. Donahue, Shelly: 273. Donatelli, Janet: 257. Donatelli, John: 273. Donley, Danette: 237. Donley, Denise: 257. Donley, Jackie: 273. Donner, Steve: l85,273. Donohoe, Carol: 207. Dorame, Yolanda: 207. Dotson, Fred: 'l77,'l79,273. Douglas, Diane: 273. Doverspike, Jaye: 206. Dow, Linda: 257. Dowell, Carol: 206. Dowell, Judy: 257. Dowling, Patty: 273. Dowling, Tim: 257. Drake, Boby: ll0,273. Drake, Jack: 257. Drake, Joyce: 48,206. Drake, Lloyd: lO8,237. Drake, Rod: l29,l53,'l76. Drenske, Barbara: 237. Drenske, Debra: 273. Drew, Roger: 237. Drew, Stephen: 207. Drewes, Becki: 273. Drewes, Frank: 257. Drewes, Gayle: 207. Driggs, Debbie: 237. Driggs, Ken: 207. Driscoll, Marilyn: 237. Droegemeier, Arthur: 'l57,165,l77, 273. Droegemeier, Dave: 37,'l53,207. Droegemeier, Marie: 237. Duarte, Linda: 257. Duddleson, Bob: 257. Ducldleston, Thomas: 45,61 ,'l78, 207. Duden, Whit: 207. Dudley, Diane: 257. Dufek, Pete: 237. Duff, Mary: 273. Dugdale, Dave: l08,l47,237. Dugdale, Pam: 273. Duke, Patty: l33,257. Dull, Janet Jo: 207. Duncan, Albert: 273. Duncan, Debbie: 'l94,257. Dunlap, Mike: 273. Dunn, Mike: 273. Dunn, Susan: 273. Duperre, Dan: 273. Dupuy, Barbara: 233,237. Dupuy, Debi: 237. Dupuy, Elizabeth: 257. Durham, Delores: 'lO9,'l l0,257. Dultle, Larry: 237. Duttle, Ray: 207. Duttle, Ron: 192,273. Duvall, Florence: 273. DuVall, Vicki: 273. Dwiggins, Roy: 'l52,l53,l8l,l8O, 207. Dyer, Debbie: 257. E Earl, Christina: 257. Earnest, Gary: l76,257. Eberling, Richard: 273. Eck, Roberta: 257. Eddy, Diane: 208. Eddy, sieve. 169237. Edwards, Donna: 208. Edwards, Doreen: 257. Edwards, Jill: 237. Edwards, John: 208. Edwards, Paul: 273. Edwards, Sandra: 273. Edwards, Steve: 208. Edwards, Wanda: 208. Eger, Chuck: lO8,147,'l85,257. Eggleston, Patti: 237. Eichenberger, Berna: 257. Eichenberger, Bernard: il3,237. Eichner, Doug: i7l,273. Eichner, Pam: 237. Eisenhart, Sue: l94,233,237. Eisner, Chipper: l87,273. Eisner, Tom: 237. Elder, Diana: 257. Elder, Eddie: 208. Elletson, Kathy: 237. Elliott, David: lO9,l7O,257. Elliott, Sydney: 'll6,208. Ellis, Gary: 237. Ellis, Irene: 237. Ellis, James: 257. Ellquist, Stephanie: 237. Elmer, Glen: 237. Elmer, Pam: 257. Elms, Barbara: 208. Ely, Lu Wynn: 257. Emerling, Fred: 45,89,l27,l47,'l79 208. Emerling, Mike: 56,l8l,237. Emrich, Bob: 274. Encinas, Charles: 237. Engelke, Peggy: l25,257. Englert, Kathy: 257. Engstrom, Arthur: 237. Eppstein, Robert: l56,257. Eppstein, Steve: 208. Epstein, Larry: 56,l87,232,237. Ervin, Carol: l94,237. Ertel, Raymond: 274. Esham, Don: 274. Eshelman, Jim: 237. Esparza, Rocky: lll,l 87,274. Espinola, Larry: l27,l53,l74,208. Estep, Joe: 'l7O,257. Estes, Bob: 274. Estes, Dave: 238. Estes, Jeff: l81,238. Trees and green grass added to the beautiful patio which many students en- hours working to keep up the grounds. ln the center of the patio was a marquis ioyed during breaks and after school. Custodians and gardeners spent many dedicated by the class of 1967, which posted information about coming events Estes, Ken: 108,274. Estrada, Diana: 208. Estrada, Sharon: 257. Etshokin, Jim: 274. Ettinger, Cindy: 61,208. Ettinger, Pamm: 269,274. Eubank, Bruce: 257. Eustice, Carol: 274. Eustice, Cynthia: 112,238. Evans, Beth: 238. Evans, Bob: 208. Evans, Don: 274. Evans, Kathy: 208. Evans, Sheri: 274. Ewer, Ruth: 274. Ewer, Vincent: 257. Ewers, Richard: 274. F Fabel, Richard: 60,199,209. Fabel, Robert: 6O,141,238. Fahlberg, Joyce: 274. Fahlberg, Steve: 238. Fahr, Randy: 238. Fain, Ellen: 195,238. Fairand, Carl: 257. Fairchild, Margaret: 274. Faires, Bette: 108. Faker, Rod: 257. Falkenhagen, Tom: 257. Falkner, Dan: 258. Fall, Christine: 274. Fall, Mike: 187,258. Fallwell, Glenn: 258. Farley, Bill: 156,176,258. Farmer, Beverly: 238. Farnsworth, Chris: 258. Farr, Sallie: 114,233,238. Farrington, Margaret: 274. Fastie, Terri: 274, Fatkin, Virginia: 258. Faull, Brian: 274. Faun, James: 258. Faussett, Cheryl: 109,111,238. Faussett, Kathy: 209. Faust, David: 238. Faust, Nina: 238. Fay, Jim: 238. Fay, Kathleen: 11,209. Fee, Bill: 238. Fee, Bonnie: 269,274. Fegan, Debbie: 109,238. Fegan, Steve: 274. Fehnel, Rynee: 258. Fehr, Don: 170,258. Feldman, Arlene: 11O,258. Feldman, Bernie: 189,238. Feldman, Harold: 110,174,238. Feldman, Stuart: 274. Felt, Sharon: 209. Felt, Shirley: 258. Felt, Terry: 274. Fenimore, Thea: 209. Fentnor, Gordon: 192,274. Fentnor, Mark: 186,187,191,238. Feret, Jack: 170. Ferguson, Dan: 164,170,258. Ferguson, Jim: 165,274. Ferguson, Scott: 238. Fernald, Lori: 258. Ferra, Charles: 258. Ferrer, Marc: 177,179,274. Ferrin, Jerry: 258. Fetter, John: 274. Fickett, Don: 258. Field, Barbara: 274. Field, Barry: 209. Field, Jerry: 238. Field, Linda: 258. Fierro, Steve: 209. Fife, Bob: 258. Fife, Paul: 258. Fila, Steve: 157,171,187,274. Findley, Barbara: 209. Findley, Jon: 56,57,109,164,170, 252,258. Findley, Richard: 274. Findley, William: 274. Finefrock, Debbie: 258. Finefrock, Greg: 238. Finefrock, Terry: 108,111,209. Finkelstein, Bill: 209. Finley, Bill: 209,274. Finley, Bob: 274. Firth, Richard: 112,113,114,238. Fischer, Louise: 238. G Gabriel, Bob: 21 O. Glynn, Shirley: 116,210. Gochenour, Edwin: 108,258. Godbehere, Karin: 238. Fish, Donald: 108,111,238. Fishback, Fisher, Ay Diane: 258. nne: 274. Fisher, Mark: 177,274. Fisher, Michael: 209. Fitzgerald, Patricia: 258. Fitzgerald, Robert: 156. Fitzgerald Sue: 238. Fitzgerald, Tom: 17O,187,258. Fitzgerald, Tom: 258. Fitzpatrick, Linda: 258. Flaming, Marty: 108,110,209. Flanzbaum, Margie: 36,258. Fleming, Betsy: 274. Fleming, Jan: 16,238. Flint, Steve: 156,258. Flood, Deborah: 274. Flood, Patricia: 209. Flores, Jesse: 274. Flores, Joseph: 153,209. Flores, Patty: 258. Gabriel, Kris: 115. Gagnon, Jim: 275. Gagnon, Marilyn: 210. Gailiusus, Barbara: 239. Gaines, Steve: 275. Gainey, Jock: 239. Gainey, Robin: 238. Gainey, Shawn: 210. Gaidorus, Carl: 156,176,181,258. Galaz, Susan: 210. Gale, June: 275. Gall, Lois: 239. Gall, Mike: 210. Gall, Rick: 258. Gallagher, Janice: 237. Gallopes, Jim: 239. Galvin, Linda: 258. Gamez, Frances: 258. Gannon, Denise: 253,258. Gannon, Jeannie: 275. Gannon, Stephanie: 79,139,210. Garard, Mike: 258. Garcia, Ben: 275. Godden, Glen: 258. Godshall, Chris: 258. Godwin, Debbie: 275. Goldberg, Arthur: 137,211. Golden, Ginger: 258. Goldstein, Franne: 211. Golloher, Dorothy: 275. Gomez, Anna: 258. Gonzales, Bob: 238. Gonzales, Celia: 239. Gonzales, Chris: 258. Gonzales, JoAnn: 275. Goo, Gary: 258. Good, Sheron: 259. Good, Stan: 275. Goodhart, Jay: 275. Goodman, Debbie: 125,259. Goodman, Joe: 239. Goodman, Marsha: 275. Goodman, Rick: 211. Goodman, Will: 146,239. Goodrich, Bob: 239. Goosherst, Mike: 156,259. Flynt, Charles: 238. Fogle, Terry: 209. Folks, Steven: 239. Folks, Foltz, Tom: 108,147,258. Mark: 179,258. Foraker, Greg: 274. Ford, Karen: 258. Forrey, Maurice: 239. Forrey, Mike: 258. Garcia, Bobby: 191 ,275. Garcia, Connie: 258. Garcia, Diane: 210. Garcia, Irene: 210. Garcia, Joe: 258. Garcia, Larry: 113,114,210. Garcia, Rosita: 239. Goosherst, Pat: 211. Gordon, Karen: 121,239. Gordon, Michele: 239. Gordon, William: 177,275. Gore, Brian: 259. Gore, Sherry: 211. Goree, Joe: 259. Forsgren, Mike: 258. Fortman, Kathy: 258. Fosha, Teresa: 274. Foss, Janice: 18,121,122,123,124, 125,239. Fossett, Richard: 258. Foster, Leslie: 274. Fountain, Larry: 258. Fox, Daniel: 24,128,209. Fox, Fred: 157,177,274. Fox, Skeeter: 209. Foxstein, Ethel: 116,209. Frahm, Terrie: 120,209. Frias, Edward: 239. Frame, Deborah: 209. Francis, Deborah: 258. Francisco, Carolyn: 111,174. Franklin, Jeffrey: 258. Franz, Rick: 112,113,114,125,191 209. Fraser, Sally: 209. Frazier, Darrel: 258. Frouedfeld, Dean: 274. Frederick, Shelly: 108,258. Free, Fred: 170,258. Freehill, Kenneth: 135,209. Freehill, Kevin: 258. Freehill, Mark: 144,239. Freeman, Debbie: 115,239. Freeman, Gary: 76,209. Freeman, Steve: 239. Freeman, Tom: 210. Freiser, Ben: 233,239. Freistedt, Paul: 192,274. French, Debbie: 274. French, George: 239. Freund, Chris: 210. Frias, Edward: 239. Frias, Rebecca: 239. Fridell, Ann: 239. Fridye, Ann: 239. Fridye, Liz: 274. Fridye, Verna: 258. Fripp, Sylvia: 258. Fritschy, Wayne: 239. Fritz, Orlin: 239. Fritz, Robert: 177,184,274. Froehling, Linda: 274. Froehling, Louis: 275. Frost, Penny: 239. Fry, Cher: 25,115,210. Fuchs, Betsey: 233. Fuchs, Wanda: 122,210. Fuller, Ca rl: 115,258. Fuller, Jerome: 239. Fullerton, Fullerton, Cindi: 114,258. Debby: 275. Fultz, Pat: 275. Funderburg, John: 275. Furnas, Jeanette: 275. Furnas, Paulette: 239. Gardner, David: 109,210. Gardner, Jack: 156,169,239. Garland, Vicki: 131,210. Garner, Linda: 104,110,239. Garrett, Doris: 275. Garrett, Joyce: 210. Garrett, Kay: 239. Garrigan, Steve: 179,187,275. Garrity, Judy: 239. Gaston, Debbie: 258. Gatchel, Chris: 118,21O,218. Gaugush, Joe: 275. Gaugush, Tom: 258. Gaul, Dan: 275. Gaul, Pat: 239. Gavlak, Bart: 258. Gaxiola, Liz: 275. Gaya, Ben: 258. Gaya, Peggy: 275. Gearhart, Chuck: 239. Geiger, Debby: 258. Geisert, Cathy: 109,111,258. Gelineau, Thom: 258. Gerall, Judith: 275. Gerall, Mina: 130,239. Gerbais, Chris: 258. Gerber, Barry: 157,165,177,275. Gerber, Rich: 239. Gerhart, Sandy: 269,275. Gerstel, Jay: 210. Gerstenfeld, Renee: 258. Gharis, David: 275. Giambruno, Cyndie: 258. Giambruno, Teri: 12O,239. Gibbs, Karen: 210. Gibbs, Shirley: 210. Gible, Debbie: 135,239. Giddings, Mike: 258. Gilbert, Gary: 108,239. Gilbert, Mark: 115,239. Gilchrist, Marc: 275. Gilliland, Ann: 275. Gilman, Linda: 238. Gilman, Richard: 45,55,56,59,6O, 63,106,107,131,210. Gilmer, Monte: 275. Gilson, Sue: 239. Gilson, Polly: 275. Ginthum, Steve: 157,275. Giorgio, Pat: 239. Gish, Denise: 275. Gish, Dian: 119,238. Givens, Gary: 185,258. Givens, Roger: 45,210. Glasgow, Carolyn: 210. Glass, Patti: 258. Glaze, Mari: 258. Glessner, Cindy: 258. Glinski, Alyce: 258. Glinski, Dave: 239. Glynn, Robert: 187,275. Gorman, Gary: 259. Gorman, John: 275. Gorter, April: 275. Gorter, Russell: 199,211. Goss, Peggy: 259. Gottlieb, Jack: 239. Gould, John: 239. Gould, Ruthanne: 275. Goulet, Larry: 259. Goulet, Ronnie: 211. Grabowski, Linda: 195,239. Gradillas, Leonard: 113,114,184 233,239. Gradillas, Mary: 126,199,211. Grady, Gail: 211. Grady, Kathleen: 275. Graham, Craig: 239. Graham, John: 239. Graham, Sharon: 85,252,259. Grant , Becky: 275. Grant, Danny: 239. Grant, Deborah: 239. Grant, Michael: 211. Grant, Ruth: 275. Graves, Paulette: 239. Gray, Charles: 275. Gray, Dale: 192,275. Gray, Jimmie: 259. Gray, Kathy: 239. Gray, Rhonda: 275. Gray, Sue: 239. Green, Kerry: 237. Green, Linda: 114,239. Green, Patricia: 211. Green, Vernetta: 275. Greenburg, Adrienne: 119,211. Greenburg, Bruce: 112,135,239. Greenburg, David: 275. Greene, Judy: 259. Greene, Wendy: 113,259. Greenfeld, Ellen: 275. Greer, Donna: 275. Greer, Kathy: 127,259. Greever, Dave: 259. Greever, Diana: 275. Gregg, Wally: 275. Gregoire, Phil: 211. Gregoire, Tim: 259. Gregory, Ann: 275. Gribben, Steve: 275. Griebling, Gayle: 116,239. Grieve, Scott: 275. Griever, David: 110. Griffith, Gaye: 259. Griffith, Gayle: 240. Griffiths, Marsha: 122,126,199,211 Grimes, Jeff: 211. Groh, Janet: 211. Gruber, Steve Jo: 259. Grundy, Pam: 275. Grundy, Pat: 240. Grushka, Mark: 259. Guard, Sandie: 138,211. Gudas, Steve: 211. Guerrero, Ana: 275. Guess, Ginger: 275. Guess, Shelby: 133,259. Guidroz, Mimi: 275. Gunning, Kathy: i08,115,259. Gunning, Mike: 240. Gunning, Steve: 4O,68,160,161,162, 174,240. Gunzel, Steve: 153,i55,161,174, 240. Gustafson, Mike: 165,275. Gustafson, Tom: 127,176,240. Gustilo, Kathy: 275. Guthrie, Richard: 259. Gutierrez, Bob: 164,259. Gutierrez, Brenda: 211. Gutierrez, Mary: 275. Gwattney, Bonnie: 259. H Haas, John: 177,275. Haas, Penny: 269,275. Hadley, Janet: 275. Hafer, John: 275. Haffey, Ann: 211. Haggerty, Robin: 211. Hale, Alan: 275. Hale, Debbie: 240. Hole, Ellen: 44,45,61,90,106,107, 199,211. Hale, Liz: 112,211. Hale, Mary: 259. Hall, Barbara: 211. Hall, Cathy: 253,259. Hall, James: 275. Hall, John: 240. Hall, Louis: 240. l-lull, Lynn: 211. Hall, Michael: 259. Hall, Steve: 156,176,240. Halphen, Diane: 240. Hambor, Lois: 114,240. Hame, Jack: 181. Hamer, Holly: 111,240. Hamer, Lenny: 45,61,212. Hamer, Paul: 275. Hamilton, Scott: 275. Hamilton, Sue: 275. Hammack, Patti: 275. Hammer, Sara: 212. Hammil, Rodney: 108,111,212. Hammond, Gary: 212. Handley, Darien: 11O,111,275. Handt, Danny: 171,275. Handt, Dave: 212. Hannah, Beverly: 275. Hannaman, Don: 275. Hansen, Carl: 275. Hansen, Carol: 139,194,212. Hansen, Diane: 240. Hansen, Gloria: 240. Hansen, Kathee: 240. Hansen, Marilyn: 193,212. Hanshaw, Mark: 165,275. Hanshaw, Robert: 259. Hanson, Barbie: 275. Hanson, Bonnie: 259. Hanson, Gail: 45,212. Hanson, John: 35,199,212. Hanson, Mary: 73. Harbison, Shirley: 139,212. Harcus, Pennie: 269,275. Hardcastle, Roberta: 194,195,212. Harding, Richard: 240. Hardt, Don: 187. Hardy, Rebecca: 240. Hare, Kathee: 212. Harkness, Karen: 259. Harney, Harney, Harpel, Harper, Harrell, Harrell, Harrell, Richard: 259. Thomas: 276. Beth: 259. Shirley: 210. Dan: 75,153,181,240. Gary: 156,176. Lyle: Harrelson, Lynn: 276. Harrelson, Tom: 240. Harrington, Jim: 212. Harrington, Lynn: 240. Harrington, Pete: 276. Harris, Becky: 276. Harris, Brian: 276. Harris, Ellen: 276. Harris, Scott: 188,259. Harris, Sue: 240. Harrison, Thomas: 212. Harry, Neil: 240. Harshman, Richard: 259. Hart, Dexter: 240. Hart, Joe: 181,259. Harter, Mike: 240. Harter, Vicki: 240. Hartke, Danny: 276. Hartke, Sherrie: 240. Hartman, Mark: 276. Hartman, Nanci: 108,212. Hartman, Tanya: 259. Hartnett, Joe: 108,181,259. Haslag, Judi: 259. Haslag, Kevin: 240. Hassler, Andy: 169,240. Hassler, Nancy: 276. Hastings, Kelly: 212. Hatch, Mike: 276. Hatch, Nicki: 240. Hatch, Pat: 259. Hauer, Barbara: 240. Haugh, Aileen: 276. Haugh, Thomas: 240. Hauser, Bob: 240. Hauser, Steve: 276. Haven, Jackie: 276. Haven, Kathy: 259. Haverlack, Nancy: 115,259. Hawk, Jim: 133,212. Hawk, John: 192,276. Hawke, George: 212. Hawke, Nancy: 103,120,233,240. Hawkins, Elaine: 276. Hawkins, Robert: 259. Hawkins, Tom: 174,179,24O. Hayes, Cathy: 276. Haymore, Dennis: 259. Hays, James: 276. Hays, Michael: 259. Haythorne, Reed: 212. Haywood, Doug: 240. Haywood, Vernon: 212. Hazelbaker, Steve: 113. Hazen, Jeff: 276. Hazen, Steve: 45,212. Heald, Barbara: 114,259. Heard, Jennie: 240. Heater, Ann: 259. Heath, Marilyn: 276. Heath, Steve: 212. Hecht, Frank: 259. Heckenlively, Judy: 240. Hedgcock, Karin: 276. Hedstrom, Karen: 240. Heideman, Don: 212. Heilman, Chris: 259. Heim, Dorothy: 276. Heiman, John: 259. Heimpel, Eleanor: 259. Heimpel, Elsmarie: 276. Heimpel, Liz: 45,119,212. Heinz, Eric: l52,l64,l76,24o. Heintz, Debbie: 276. Heller, Bruce: 156,240. Heller, Kent: 187,276. Henderson, Donald: 259. Henley, Ann: 240. Hendrikson, Mark: 240. Henlex, Bill: 259. Henly, Bill: 259. Henninger, Marilyn: 115,259. Henry, Dave: 176,179,253,259. Henry, Janice: 38,212. Herbert, Donna: 240. Heredia, Lila: 240. Heredia, Yolanda: 240. Herin, Mary Ann: 213. Herman, Nancy: 259. Hernandez, Christine: 276. Hernandez, Edward: 213. Hernandez, Thelma: 276. Herriford, Bob: 213. Herriford, David: 276. Herriford, Tom: 259. Herring, Betty: 259. Herring, Shirley: 276. Hersch, Debi: 240. Hertel, Michael: 259. Hess, Tom: 259. Hessick, Sherrie: 259. Heston, Kim: 259. Hetrick, Carol: 11O,259. Hewitt, Jerry: 259. Hibbert, John: 259. Hibbs, Howie: 105,213. l-llbbs, Jeff: 213. Hickey, Gene: 259. Hicks, Brenda: 276. Hicks, Debbie: 276. Hicks, Mary: 259. Hicks, Walt: 240. Higgason, Debbie: 276. Higgins, Bill: 108,276. Higgins, Mike: 259. Hilberg, Janet: 259. Hill, Christy: 259. Hill, Dave: 80,199,213. Hill, George: 240. Houghton, Lin: 133,241. Houghton, Linda: 241. Hounshell, Sandee: 213. Housman, Nita: 276. Howard, Barbara: 276. Howard, Jill: 276. Howard, Josie: 276. Howard, Sue: 193,241. Howe, Peggy: 260. Howell, Mark: 276. Hoxie, Deborah: 122,241 . Hoxie, Holly: 276. Hrometz, Michael: 260. Hrometz, Pamela: 241. Hrometz, Vicki: 276. Hrum, Monica: 259. Hubacek, Barbara: 276. Hubbard, Ben: 260. Hubbard, Judy: 276. Hubbard, Michael: 276. Hubbard, Ronald: 276. Hubbell, Pat: 17O,26O. Hill, Scott: 240. Hilliard, John: 213. Hilliard, Karen: 276. Hillock, Cathy Jo: 233,24O. Hillock, Jeffy: 31. Hillock, Randy: 259. Hilton, Cindy: 276. Hilton, Robin: 194,259 Himelick, Karen: 276. Hindman, Annette: 276. Hines, Jacqueline: 213,307. Hinkle, Jim: 213. Hinterkopf, Karen: 259. Hinterman, Sue: 213. Hintz, Robert: 276. Hirschman, Randy: 168,169,213. Hirschman, Ronny: 213. Hitchiner, Denny: 156,240. Hitchiner, Doug: 157,177,276. Hite, Debby: 259. Hoar, Betsy: 17,12l,2'I3. Hoarn, John: 109,213. Hodges, Allen: 240. Hodges, Mark: 240. Hodges, Vernon: 240. l-loenn, Bob: 240. Hoehn, Elizabeth: 109,276. Hubbert, Ann: 125,213. Hudgel, Rhonda: 260. Hudgel, Warren: 241. Hudson, Bill: 214. Hudson, Marta: 214. Huerstel, Jenny: 214. Huerta, Charles: 214. Huerta, Laura: 260. Huffman, Debbie: 260. Huggins, Danny: 37,63,79 169 214 Hughes, Hulden, Sandra: 214. Judy: 276. Hull, Bob: 241. Hull, Charlie: 176,260. Hull, Hank: 260. Hull, Ronald: 214. Hume, Jack: 260. Humeny, Pam: 276. Hunter, Hunter, Hunter, Hurley, Hurley, Hurney, Barbara: 260. Tom: 260. Nancy: 241. John: 164,26O. Sharon: 214. Bill: 260. Hussey, Anthony: 214. Hutchison, Edward: 260. Hoenninger, JoAnn: 276. Hoff, Dodie: 195,259. Hoffman Alan: 276. Hoffman DeeDee: 240. Hoffman, Jim: 276. Hoffman, John: 276. Hoffman, Paul: 240. Hoffman, Ruth: 276. Hoffman, Steve: 240. Hoffmeister, Donna: 259. Hogan, Susan: 45,104,112, Hoggatt, Billie: 259. Holbert, Don: 276. Holbert, Janice: 138,213. Holck, Emmet: 213. Holck, Vinson: 259. Holden, John: 276. Holdman, Mary: 259. Holick, Beth: 240. Holland, Jim: 276. Holley, Lois Paulette: 240. Hollingsworth, Debi: 276. Hollis, Judie: 105,241. Hollman, Bill: 129,241. Hollman, Richard: 276. Holly, Karen: 259. Holly, Patty: 24,241. Holman, Pat: 276. Holmes, Cheryl: 213. Holmes, Linda: 276. Holsinger, Jane: 213. Holt, Frances: 115,260. Holter, Richard: 260. Holth, Karen: 260. Holzworth, August: 260. 114,213. Hutchison, Greg: 214. Hutchinson, Paula: 276. Hutton, Carol: 260. Hutton, Frank: 276. Hyde, Tom: 214. Hyman, Wendy: 241. Hynd, John: 214. lavagnilio, Denise: 276. lavagnilio, Michael: 276. lbach, Billie: 241. lbach, Jim: 260. Ickes, Paula: 276. Iler, Juanita: 214. Imatong, Philip: 241. Immerman, Jodie: 113,241. Immerman, Warren: 260. Ingham, Howard: 105. Ingham, Raena: 276. Ingham, Rex: 191,260. Ingram, Stacy: 276. lnsley, Debbie: 260. Ipsen, Nancy: 241. Israel, Andrew: 260. Ivy, Don: 187. lzon, Maureen: 276. lzon, Zac: 241. J Jablonski, Mike: 214. Hopkinson, Sandy: 45,213. Hopman, Debbie: 121,213. Horn, Bruce: 260. Horn, David: 276. Horner, Donna: 276. Hosley, Deborah: 213. Hosley, Dianna: 276. Hospelhorn, Teri: 260. Hossman, Jeff: 213. Houghton, Charlie: 177,276. Houghton, Julie: 276. Jacobson, Dean: 105,214 Jackson, Charley: 276. Jackson, Jackson, Debi: 277. Frank: 241. Jackson, Ginger: 277. Jackson, Glenda: 260. Jackson, Jean: 260. Jackson, Jim: 277. Jackson, Joe: 241. Jackson, Mary Ann: 277. Jackson, Penny: 260. Jacobs, Ken: 103,187,241. Jacobson, Dean: 214. Jacobson, Karen: 241.. Jacobson, Melanie: 113,26O. Jamesen, Sandy: 260. Jancek, Roberta: 260. Jankey, Gary: 260. Jansen, Joseph: 214. Jansen, Terrie: 260. Jarratt, Jay: 260,277. Jarrett, Larry: 241. Jarrett, Marcie: 260. Jason, Jacqueline: 277. Jedlicka, Bonnie: 214. Jenkins, Laura: 277. Jennings, Steve: 156,170,260. Jensen, Bill: 191,192,241. Jepson, Chuck: 277. Jewell, Jema: 277. Jirschele, Dave: 277. Jirschele, Debbie: 277. Joachim, Arthur: 277. Joachim, Susan: 277. Johanningmeier, Bruce: 157,277. K Kabella, Patty: 277. Kacin, Karen: 260. Kacin, Nancy: 241. Kahler, Glenn: 241. Kaigh, Karen: 277. Kalman, Chris: 241. Kalman, Kathleen: 277. Kalt, Joe: 186,187,241. Kalt, Kristy: 260. Kaplan, Harvey: 241. Kaplan, Mike: 45,215. Karp, Janis: 241. Karp, Pam: 277. Kapley, David: 277. Karr, JoAnne: 260. Kasen, Geri: 215. Kasen, Robby: 260. Kassing, Glen: 109,241. Katz, Neil: 260. Katz, Randy: 215. Kaufman, Karen: 215. Kintner, Joe: 260. Kiper, Marion: 145,277. Kircher, Gail: 109,241. Kircher, Gwen: 260. Kircher, Tom: 187,277. Kirk, Linda: 241. Kirk, Scott: 277. Kiser, Patricia: 118,119,139,215. Kiser, Patty: 121. Kiser, Fichard: 277. Kisinger, Linda: 241. Kisro, Tom: 242. Klassen, Cai: 61,106,107,131,132, 215. Klastow, Sharon: 139,215. Kleiman, Andy: 180,181,253,260. Kleiman, Klein, B Sallie: 117,260. eniamin: 277. Klein, Dale: 260. Klein, Denise: 242. Klein, Denzil: 242. Klein, Gaye: 242. Kleinhesselink, Carol: 108,260 Klisch, Bonnie: 242. Lamb, Michelle: 278. Lamb, Roger: 113,114,242. Lamb, Steve: 278. Lambert, Edward: 261. Lambert, Elaine: 216. Lamm, Susan: 44,45,120,216. Lancaster, Donna: 261. Lancaster, John: 242. Land, Mike: 106,242. Landry, Dennis: 278. Lane, Cathy: 261. Lane, Mike: 278. Lange, James: 242. Laningham, Joe: 216. Laos, Mark: 242. Laos, Tim: 278. Lappit, Marc: 278. Largent, Kevin: 216. Larger, Bonnie: 261. Larkin, Bob: 216. Larrabee, Vickie: 278. Larson, Gay: 278. Larson, Gayle: 216. Larson, Joel: 176,179,261. Johnson, Ande: 269,277. Johnson, Johnson, Camilla: 260. Johnson, Carl: 277. Johnson, Carolyn: 277. Johnson, Dan: 214. Johnson, Dave: 241. Johnson, Debbie: 214. Johnson, Debbie: 112,114,241. Johnson, Doug: 260. Johnson, Gail: 241. Johnson, Gary: 260. Johnson, Gene: 260. Johnson, Greg: 214. Johnson, Jack: 179. Johnson, John: 177,277. Johnson, Joy: 241. Johnson, Judith: 260. Johnson, Kay: 108. Johnson, Lea-Ann: 214. Johnson, Leola: 277. Johnson, Mary: 214,277. Johnson, Mary: 277. Johnson, Mary Mike: 45,214. Johnson, Pam: 241. Johnson, Pat: 214. Johnson, Roberta: 277. Johnson, Suzan: 215. Johnson, Veoa: 215. Johnson, Walter: 260. Bill: 25,156,176,i81,26O. Kaufman, Larry: 215. Kayner, Andy: 241. Kearns, Kearns, Tom: 260. Keaton, Dee Dee: 260. Keatoy, Danny: 241. Nancy: 45,104,215. Kee, Debby: 120,215. Kee, Mike: 85,171,269,277. Keith, Millard: 277. Keith, Sandra: 271. Kelch, Christina: 132,199,215. Kelch, Karen: 36,132,233,251. Kelleher, Jerry: 241. Kelly, Kelly, Bill: 260. Dennis: 260. Kelly, Kathy: 139,215. Kelly, Kevin: 157,165,277. Kelly, Mark: 157,177,277. Kelly, Steven: 181,241. Kelton, James: 277. Kemp, Debbie: 98,277. Kemp, Kerry: 215. Johnston, Colleen: 115,135,241. Johnston, Kay: 215. Johnston, Sandy: 241. Jolly, Diana: 277. Jones, Barbara: 260. Jones, Barry: 241. Jones, Bob: 277. Jones, Bob: 260. Jones, Bruce: 112,174,179,241. Jones, Debbie: 277. Jones, Doug: 260. Jones, Francie: 215. Jones, Jerry: 127,184,215. Jones, Michael: 184,233,241. Jones, Michael: 277. Jones, Mike: 260. Jones, Pam: 277. Jones, Patrick: 277. Jones, Paula: 241. Jones, Ronald: 260. Jones, Sandy: 110. Jones, Todd: 277. Kemph, Bob: 185,26O. Kemph, Debi: 75,19-4,215. Kenady, Barb: 260. Kenady, Pamela: 44,45,193,215. Kenady, Pat: 46,52,193,215. Kendzora, Debbie: 260. Kennedy, Charles: 277. Kenski, Gloria: 46,49,215. Kepner, Terry: 260. Kerchum, Paul: 215. Kern, Dennis: 215. Kern, John: 260. Kerth, Pat: 241. Kessler, Karen: 277. Kettenbach, Kerry: 13O,241. Kettlewell, Patti: 241. Kettlewell, Susan: 269,277. Kidwell, Kenny: 277. Kidwell, Marifrancis: 241. Klopp, Marcia: 277. Knart, Don: 278. Knife, Mark: 261. Knight, Chuck: 115,233. Knight, Deborah: 112,121,216. Knight, Judy: 277. Knop, Kelly: 153,242. Knorr, Carolyn: 115,242. Knox, Greg: 90,181,216. Knox, Larry: 242. Knox, Steve: 156,170,181,261. Knutson, Tim: 242. Koch, Jody: 261. Koch, Robert: 277. Koenig, Tina: 277. Koeppel, Terry: 216. Kokot, Fonnie: 277. Koningsor, Roy: 261. Konrath, Suzin: 277. Koons, Jeff: 277. Koons, Terry: 261. Kopman, Leslie: 261. Kopman, Linda: 133,242. Korn, Anne Marie: 261. Korn, John: 261. Kornman, Steven: 277. Kosky, Connie: 277. Kososkie, John: 91,242. Kostrodki, Sandy: 109,124,125. Larson, John: 177,179,278. Larson, Kathy: 261. Larson Lash, :S Randy: 278. ave: 242. Lassiter, James: 25,242. Laster, Ken: 278. Later, Linda: 217. Later, Maurine: 278. Laughlin, Susan: 112,132,233,242. LaViola, Irene: 242. Lawhead, Brenda: 278. Lawhead, Eddie: 106,242. Lawrence, Gloria: 217. Layne, Lynn: 261. Lazeres, Betty: 56,120,198,217. Leach, Arlynne: 242. Leal, Debbie: 278. LeDuc, LeDuc, Claude: 243. Louise: 261 . Lee, Andy: 217. Lee, Danny: 261. Lee, Jennie: 278. Lee, Philip: 185361. Lee, Roger: 21,278. Leedom, Margaret: 108,109,217. Lefko, Lefko, Greg: 261. Sally: 278. Leggett, Larry: 156,181,261., Leinen, Michael: 261. Kramer, John: 216. Kramer, Kathie: 261. Kramer, Lynne: 216. Kramer, Sandi: 277. Kramer, Stan: 242. kmgsfon, Bob: 164,253,26o. Jones, Wendy: 260. Jordan, Colleen: 277. Jordan, Cyndy: 215. Jordan, Nancy: 277. Jordan, Tom: 277. Jorgensen, Ed: 215. Jorgensen, Karen: 277. 278. Jorgensen, Mike: 181 ,260. Jorgensen, Pete: 181 ,241. Jorgenson, Darrell: 177,277. Joesph, Geri: 113,241. Joster, Mary: 214. Joyner, Donna: 277. Juarez, Barbara: 260. Juarez, Genie: 215. Juarez, Jo: 260. Judge, Diane: 277. Kiekebusch, Keith: 215. Kiernan, Ann: 241. Kiernan, Bill: 277. Kight, Harry: 241. Kile, Candee: 277. Killebrew, Robert: 260. Killingsworth, Roxy: 277. Kimmey, Bill: 260. Kindred, Jenny: 260. King, King, Candace: 241. Jeff: 161 ,21 6. King, Jennifer: 260. King, Kenny: 277. King, Linda: 46,216. King, Richard: 145,241. King, Roger: 156,241. King, Sharon: 194,241. King, Susan: 115,241. King Tommie: 241. Kingston, Karyn: 46,12O,13 2,216. Kingston, Lee: 216. Kington, Judith: 277. Kington, Lee: 105,137,216. Kinkaid, John: 277. Kinler, Sandy: 260. Kinne, Dwayne: 108,260. Kinney, Jane: 277. Kinseth, Mallory: 114. Kinsey, Becky: 277. Krampel, Angelina: 277. Krampel, Angelita: 277. Kratzer, Steve: 277. Krerer, Laurie: 277. Kreutz, Kerry: 277. Krietemeyer, Kathi: 46,215. Kring, Terena: 277. Krueger, Elaine: 106,216. Krueger, Phil: 277,278. Krueger, Valerie: 242. Kruse, Jachie: 261. Krutzsch, Eric: 181,261. Kugler, Barry: 216. Kuhn, Bob: 157,177,187,278. Kuhn, David: 216. Kuhn, Mike: 108,147,185,261,278. Kunzmann, Michael: 278. Kutoroff, Steve: 145,242. Kwart, Don: 157,171,187,27B. L Labor, Alfie: 157,177,270. Labor Kath - 261 , y. . Lacagnina, John: 157,171 ,187,269, LaCasib, Jerry: 181. Lacey, Bob: 171,278. Lackey, Bill: 216. Lacock, Holly: 278. Lacoss, Tom: 278. Laemmel, Steve: 242. LaFrance, Fred: 261. Laguna, Frank: 242. Lahmann, Nancy: 278. Lamb, Gail: 46,91,109,125,216. Leiner, Meryl: 261. Leising, Patty: 261. Leist, David: 243. Lekawa, Raymond: 243. Lenches, Nancy: 103,243. Lenhart, Debbie: 112,261. Lenhart, Diane: 217. Leopardi, Helen: 278. Leopardi, Mark: 261. Leschinsky, Richard: 243. Lethaby, Lenny: 261. Lett, Brenda: 261. Levandowski, Peggy: 278. Levandowski, Richard: 109,261 . Lewelling, Pat: 29,261. Lewis, Allan: 261. Lewis, Bonnie: 243. Lewis, Henry: 243. Lewis, Janice: 261. Lewis, Jennie: 278. Lewis, Linda: 278. Lewis, Mike: 278. Lewis, Randy: 112,113,114,115, 184,243. Lewis, Red: 184,185,243. Lewis, Rita: 243. Lewis, Scott: 157,278. Lewis, Steve: 178,179,243. Lewis, William: 261. Leytem, Debra: 261. Liccione, Charlie: 261. Lien, Joey: 278. Lien, Kristi: 261. Lienhart, Wendy: 278. Lieser, Darcy: 278. Lieser, Tim: 243. Ligner, Dianne: 59,122,123,193, 233,243. Ligner, Mindi: 59,122,132,233,243 Lilley, Candy: 278. Lilley, Jeff: 243. Lind, LeAnn: 243. Lind, Warren: 181,243. Lindamood, Bill: 185,261. Lindley, Barbara: 217. MacPherson, Terry: 139,218 Mader, Joe: 262. Mader, Mary: 278. Madison, Jerry: 244. Lindly, Carol: 251. Lindsay, Ron: 278. Linkhart, Carl: 243. Linsenbigler, Debbie: 243. Lipari, Steve: 278. Lipari, Wendy: 243. Lisec, Deirdre: 278. Littleton, Jim: 217. Livingston, Debbie: 278. Lloyd, Linda: 217. Lo, Judy: 261. Locascio, Jerry: 11O,176,261. Lock, Linda: 261. Locke, David: 278. Lockwood, Bob: 243. Lockwood, Rick: 278. Loczi, Missy: 261. Lodge, Harry: 35,37,6O,73,127,152, 154,155,168,169,217. Loeke, David: 278. Loftis, Mike: 278. Loftis, Patty: 79,s9,1o5,121,217, 251 Logan, Johnny: 243. Logan, Stuart: 217. Logan, Thomas: 217. Lombardo, Donna: 243. Lombardo, Gary: 157,171,187,278. Madison, Susan: 262. Maesar, Cynthia: 278. Maghrabi, Nagvi: 110,244. Magness, Bill: 278. Magrabi, Joyce: 262. Mague, Jett: 137,262. Mague, Pat: 218. Mahalik, Clitf: 181. Maher, Barbara: 262. Malas, Laureen: 29,195,244. Maldonado, Jerry: 157,177,187, 287. Maldonado Mar : 262 1 Y - Maldonado, Robert: 218. Maleske, Daniel: 262. Malik, Lisa: 108,113,115,147,262. Mallen, Joanna: 262. Mallick, David: 278. Mallins, Gail: 195,244. Mandel, Marvin: 262. Mangels, Chris: 244. Mangels, Cindy: 262. Mangham, Don: 278. Mann, Vicki: 278. Manns, Kathy: 218. Manns, Pete: 156,164,262. Mantecon, Deby: 278. Manville, Kathryn: 218. Mapes, Sally: 278. Marble, Paul: 181,262. Marble, Ralph: 157,177,187,278. Marcantonio, Kathy: 278. Marcantonio, Marie: 244. Marcek, Kathi: 112,244. Marcille, Janet: 262. Marconato, Karen: 244. Marconato, Tony: 278. Marino, Daniel: 278. Margotta, Teri: 262. Mark, Diane: 115,262. Mark, Doug: 278. Markle, Dennis: 244. Markie, susan: 113,114,139,141 262. Markovich, John: 262. Marks, Karen: 130,262. Marmon, Robin: 278. Marmon, Sharon: 61,244. Marple, Cindy: 262. Marsalla, Joe: 262. Marsh, Dennis: 169,218. Marsh, Michael: 171,278. 1 Marshall, Glenn: 278. Marshall, Janice: 269,278 Marshall, Lyz: 279. Marshall, Melton: 244. Marshall, Ramona: 262. Marshall, Windy: 130,244 Martell, Brenda: 262. Martin, Andy: 279. Martin, Art: 279. Martin, Arthur: 279. Martin, Berry: 46,113,218 Martin, Debby: 269,279. Mmm, Kathy: 90,119,137 219 Martin, Keith: 279. Martin, Lynnmarie: 262. Martin, Marsha: 262. Martin, Patty: 193,219. Martin, Sherry: 244. Martin, Stephanie: 244. Martin, Susan: 114,219. Martin, Tom: 279. Martin, Virgil: 244. Long, Dan: 17O,261. Long, Gary: 278. Long, Mike: 133,217. Long, Tim: 261. Longoni, Robert: 278. Looper, Vicki: 278. Lopez, Alex: 181,243. Lopez, Carl: 156,164,17O,262. Lopez, Francisco: 278. Lopez, Genevieve: 262. Lopez, Steve: 141,157,269,278. Lopez, Tony: 157,177,187. Lorrey, Morris: 169. Loty, Patricia: 113,217. Lotz, Karen: 262. Loudermilk, Terry: 270. Love, DeWalt: 110,278. Love, Marie: 217. Love, Rosanne: 111,243. Lovin, Jett: 44,46,48,6O,127,153, 154,169,211 Low, Sharon: 262. Lowe, Alan: 278. Lowe, Allen: 79,181,217. Lowe, Lowe, Anna: 262. Don: 217. Lowry, Margo: 243. Lowther, Michael: 138,217. Luce, Bill: l87,278. Luckow, John: 262. Ludtke, Craig: 46,152,217. Ludwiczak, Daniel: 262. Ludwig, Cathy: 262. Luian, Albert: 278, Luian, Magdalena: 262. Lundberg, Diane.: 262. Lundstrom, Kurt: 46,52,124,125, 13l,14O,191,192,199,217 Luscaleet, Margot: 243. Lutgendorf, Linda: 262. Lutgendort, Robert: 217. Lutz, Fred: 243. Lutz, Linda: 278. Lynas, Dixie: 217. Lynch, Beth: 278. Lynge, Kathy: 278. Lynn, Janis: 243. Lynn, Pam: 262. Lyons, David: 278. M Mabry, Bill: 217. Macaulay, Roger: 244. MacFadden, Linda: 244. MacFarland, Ken: 218. MacFarland, Sherri: 278. Mach, Beth: 278. Mach, Joan: 53,194,218. Machen, Mark: 262. Machen, Mike: 138,244. Titan Trouble Shooting team, Larry Novak, Mike Sisk or of a car. They represented PV in the Stale Ply- and Rick Mazur corrected a difficulty in the carburet- mouth Trouble Shooting Contest in Scottsdale. Martinez, Gloria: 244. Martinez, Margarita: 113,114,244. Martiniak, Frank: 46,145,219. Marvin, Maryku James: 185,262. lsky, Virginia: 262. Martz, Chester: 262. Mason, Dean: 218. Mason, Gail: 262. Mason, Kathy: 124,218. Mason, Mary: 262. Mason, Mike: 244. Mason, Mike: 262. Mason, Pam: 262. Massey, Kathy: 279. Massingill, Andrew: 244. Master, Bruce: 262. Mathews, Dave: 218. Mathis, Virginia: 244. Matternack, Bobby: 113,156. Matthews Debbie: 112,244. Matthews, Jerry: 218. Matthews, John: 262. Matthews, Ralph: 165,171,279. Matthews, Randy: 187,244. Matthews, Ray: 185,244,262. Mauldin, Randy: 279. Mauldin, Ricky: 244. Mauldin, Ron: 218. Mauler, Debbie: 279. Mauntel, Richard: 279. Maxey, Curtis: 279. Maxey, Deborah: 244. Maxey, Kenny: 58,279. Maxey, Steve: 187,279. Miller, Diane: 263. Miller, Eva: 263. Miller, Fran: 263. Miller, Frank: 243. Miller, Frank: 280. Miller, Hope: 115,133,219. Miller, Jeri: 243. Miller, Jerry: 263. Miller, Libby: 280. Miller, Linda: 280. Miller, Marc: 280. Miller, Margaret Ann: 263. Miller, Mike: 112,280. Miller, Pam: 253. Miller, Patty: 280. Miller, Paul: 243. Miller, Roberta: 115,263. Miller, Robin: 263. Miller, Sherman: 187. Miller, Susan: 280. Miller, Theron: 280. Mills, Elizabeth: 280. Mills, Greg: 157,177,28O. Mills, Karen: 263. Mills Linda: 106219. Miii:f sfeve. 243: Milner, Dave: 243. Milner, Tracey: 243. Morrow, Pat: 243. Mottley, Debra: 263. Mottley, Lance: 156. Moulis, Ken: 243. Mow, Barbara: 263. Mow, Dale: 174,175,178,220. Moynihan, Mike: 280. Mucklow, Larry: 263. Muehlbauer, Gary: 220. Mueller, William: 46,51,220. Mulholland, Linda: 220. McKinney, Scott: 108,219. McLane, Mollie: 279. McLellan, Diane: 244. McLellan, Leslie: 219. McLeod, Phyllis: 279. McMillan, Marty: 193,219. McMillin, Mike: 262. McMullen, Barbara: 219. McMullen, Kathy: 279. McMullen, Lauri: 262. McMullen, Lynda: 262. McMullen, Mary Frances: 219. Mulholland, Mary: 263. Mullaney, Mike: 171,280. Muller, Sherry: 220. Mullinax, Pam: 263. Mulrow, Maureen: 243. Mulvaney, Sue: 280. Mulvena, Mike: 137,188,263. Munday, Heather: 244. Munich, Jan: 220. Munie, Phil: 263. Munyon, Sue: 263. Murawski, Tom: 244. Murphey, Gary: 220. Murphy, Michele: 244. Murphy, Sean: 220. Murphy, Tim: 169,244. Murray, Gary: 280. Maykulsky, Virginia: 109. Maynard, Paul: 279. Mazur, Rick: 218,305. Meade, Chuck: 219. Meade, Sharon: 279. Means, Eric: 219. Mears, Paul: 31,219. Medlin, Candy: 219. Meibohm, Joyce: 122,193,219. Meinel, Ed: 108,110,262. Meinel, Elaine: 111,219. Mina, Cynthia: 119,219. Mindes, Irving: 243. Mindes, Louis: 280. Minella, Donna: 280. Minich, Jan: 189. Minnich, Kenneth: 280. Minnich, Ronnie: 280. Minton, Dean: 263. Miranda, Edward: 263. Misenhimer, Mary: 46,220. Mishkind, Sherry: 243. Misick, Raymond: 109,263. Murray, Kathleen: 193,22O. Murtaugh, Matt: 263. Murtaugh, Michael: 220. Muse, Mark: 263. Musgrave, Jim: 181,244. Musser, Kay: 45,5O,56,60,62,72,83, 103,122,198,220. Mustakes, Barbara: 244. McNeal, David: 127,169,219. McNeal, Randy: 157,171,187,279 McNeeIy, Pat: 262. McNeil, Nora: 219. McPherson, Collette: 279. McQueen, Lance: 18,244. McQuilkin, Cathy: 262. McTarnahan, Bill: 46,62,116,219. McTarnahan, John: 262. McVean, Karen: 244. N Nagore, Debra: 280. Naliwski, Vickie: 244. Narcho, Dean: 263. Nations, Lynn: 263. Nava, Pat: 244. Neathery, Debby: 115,263. Needham, Gideon: 280. Needham, Gurnie: 244. Neel, Bill: 244. Neel, Pamela: 280. Neighbors, Mike: 263. Myers, Joe: 280. Myers, Mike: 157,177,269,28O. Mitche Mitche Mitche Mitche Mitche ii, Barbara: i2i,243. ll, Charles: 280. ll, JoAnn: 243. ll, Quinton: 220. ll, Robert: 263. Meinhausen, Steve: 191 ,244. Melter, Helen: 243. Meltzer, Helen: 243. Meltzer, Patricia: 262. Menchaca, Jinyles: 262. Mendenhall, Judy: 262. Mendenhull, Don: 279. Merchant, Janet: 118,119,219. Merilee, Dale: 262. Merrill, Marilyn: 262. Merrill, Patti: 84,123,243. Merrill, Robert: 243,262. Merritt, Ann: 279. Mers, Debbi: 243. Mersereau, Michael: 262. Mersereau, Michele: 262. Mesereau, Michal: 262. Meserre, Marilee: 279. Messing, Vicki: 243. Metcalf, Chip: 243. Metcalf, Dean: 279. Metcalf, Roy: 114,243. Metz, Gary: 262. Metzger, Dorothy: 279. Metzger, Susan: 243. Meysenburg, Sue: 279. Michaels, Ann: 279. Mick, Joseph: 243. Miguel, Mary: 262. Mihalik, Cliff: 263. Mihalik, Denise: 219. Mikel, Jenny: 194,243. Mikelson, Sharon: 219. Milbrant, Patsy: 219. Milbrandt, Sally: 195,243. Milburn, Sandra: 262. Miley, Edward: 243. Miley, Linda: 279. Millage, Thomas: 279. Mixon, Mary: 133,22O. Mize, Elaine: 113,115,220. Moeller, Gary: 280. Moffett, Kim: 280. Mohr, Linda: 46,48,106,107,220. Molina, Joe: 220. Molina, Mary: 280. Molling, Pamela: 263. Monasmith, Thomas: 114,263. Mongeon, Terry: 280. Monier, Beth: 280. Monka, Lynn: 243. Monka, Mike: 280. Montano, Robert: 280. Montano, Tom: 243. Montgomery, Mary: 243. Mooney, Debbie: 280. Moore, Buddy: 243. Moore, David: 280. Moore, Debbie: 243. Moore Garry: 243,280. Moore, Jerry: 280. Moore, Judy: 243. Moore, Kay: 280. Moore 1 Linda: 280. Moore, Liz: 243. Moore, Mary: 280. Moore, Pat: 280. Moore, Phyllis: 109,243. Moran, Marcia: 280. Morehouse, Steve: 280. Moreno, Avilia: 280. Morey, Sandi: 243. Morgan, Cheri: 280. Morgan, Keith: 244. Morgan, Snookie: 280. Mc McCallum, Jim: 111,279. McCann, Rob: 157,167,279. McCann, Will: 279. McCarty, Diane: 279. McCarty, Renee: 262. McCarver, Lyn: 111,218. McCaslin, Vicki: 244. McCave, David: 218. McClelland, Thomas: 277. McClements, Martha: 218,299. McClintock, David: 279. McClintock, Samuel: 262. McCloskey, Bob: 262. McCloskey, Cheryl: 279. McClue, Beth: 269. McCollom, Pat: 262. McCool, Michael: 218. McCourt, Laurie: 193. McCourt, Rick: 191,262. McCoy, Linda: 110,262. McCulley, Carlla: 279. McCullough, Gene: 109,262. McCullough, Jim: 46,53,218. McCurry, Linda: 244. McDermott, Jim: 262. McDonald, Chris: 218. McDonald, Douglas: 244. McDonald, Laura: 262. McDougalol, Bob: 187,219. McDowell, Arlene: 191,279. McDowell, Joe: 191,244. McEwen, Caren: 244. McFarland, Brad: 11 1 ,279. McFarland, Candy: 262. McFarland, Kathy: 244. McFarland, Mary: 262. McGhee, Denise: 262. McGhee, Marven: 244. Nelson, Don: 220. Nelson, Bruce: 220. Nelson Cathy: 220. Nelson Connie: 280. Nelson, Doug: 263. Nelson, Gary: 108,263. Nelson, Glenn: 280. Nelson, Jim: 280. Nelson Leanne: 263. 1 Nelson, Max: 114,263. Nelson Paul: 280. Nelson Rodney: 220. Newell, Phyllis: 220. Newell, Randy: 32,191,192,220 Newton, Paul: 164. Niblett, Adrienne: 221. Nicholas, Steve: 280. Nichols, Carl: 224. Nichols, Lance: 224. Nicholson, Jan: 263. Miller, Bambi: 279. Miller, Barbara: 219. Miller, Bobbi: 117. Miller, Bruce: 280. Miller, Buddy: 219. Miller, Cris: 263. Miller, Cindy: 105. Miller, David: 105,219. Miller, Debi: 243. Miller, Dennis: 280. Morre, Gerrie: 243. Morris, Bob: 263. Morris, Meta: 135,263. Morris, Nancy: 195,280. McGinley, Tim: 279. McGlotilin, Linda: 244. McGovern Mark: 187,279. McGovern McGovern McGregor, Mike: 185,279. Tom: 184,233,244. Ruth: 262. Nicholson, Mike: 224. Nickol, Niel: 115,221. Niel, Connie: 195,224. Niel, Scott: 46,174,221. Nielsen, Carol: 121,244. Nilo, Debi: 223,245. Nink, Carl: 280. Noble, John: 245. Noble, Susan: 221. Nolf, Miki: 280. Nordquist, Ed: 62,153,199,221. Norford, Ellen: 245. Noriega, James: 245. Norine, John: 169. Norris, Melissa: 221. Northey, Becky: 263. Northey, Mike: 245. Norton, Bonnie: 120,221. Norton, Roger: 221. Norton, Tim: 280. Norvelle, John: 245. Norvelle, Linda: 245. Norvelle, Nancy: 280. Novac, Larry: 221,305. Nowocin, Debbie: 245. Nuckols, Joe: 109,174,221. Nussbaum, Anna: 110,233,245. Nussbaum, Minna: 221. Morris, Pam: 55,56,60,73,104,132, 220. Morris, Pam: 46,280. Morris, Rosemary: 244. Morrow, Donna: 280. Morrow, Joseph: 263. Morrow Mo rrow , Lynn: 220. , Maria: 263. Morrow, Michael: 243. McGullough, Gene: 262. Mclntosh, Malcom: 145,244. Mclntyre, Susan: 279. McKee, Mike: 262. McKee, Sandy: 262. McKenzie, Rudy: 279. McKim, Nancy: 244. O O'Bannon, Jeanne: 221. Ober, Ron: 263. Oberheim, Merylyn: 245. Oberly, Larry: 280. O'Cull, Lindo: 221. O'Day, Mary Jane: 103,110,269, 280. O'Dell, Vicki: 46,60,103,221. Odom, Julie: 263. Ogden, Cindy: 280. Ogden, l-larolol: 221. Ogley, Debbie: 280. Ohmart, Maribeth: 280. Olbin, Mark: 165,171,280 Olesky, Pat: 245. Olivares, Gilbert: 263. Oliver, Kitty: 263. Oller, Debbie: 263. Olmstead, Claudia: 263. Olmstead, Scott: 280. Payne, Dave: 157,165,281. Payne, Geof: 263. Payton, Kyle: 188. Pearson, Bruce: 263. Pearson, Janis: 281. Pearson, Wendy: 245. Peck, Jim: 263. Pedley, Ed: 263. Pelc, Edward: 245. Pellegrino, Tony: 263. Porter, Cathy: 264. Porter, Dennis, 281. Porter, Doug: 46,49,222. Porter , Fred: 245. Porter, Kathy: 245. Porter, Keith: 188,245. Porter Porter Porter , Kim: 264. , Roberta: 195,245. , Tom: 264. Portertield, Nancy: 264. Pelusi, Kathleen: 126,245. Pennock, Jan: 245. Pensinger, Kim: 281. Pepe, Lynn: 122,245. Pepe, Mark: 281. Olsen, Olsen, Olson, Olson, Olvey, Betty: 245. Christine: 280. Candle: 245. Darlene: 245. John: 157,177,187,280. O'Malley, Bambi: 245. O'Neil, Lee: 280. O'Neil, Mike: 245. Oppenheim, Don: 46,106,107,131, 221. Orcutt, Carol: 253,263. Orcutt, Jerry: 245. O'Reiiy, Lynn: 263. Orendutf, Wayne: 245. Orinski, Bill: 153,174,245. Orlow, Rolla: 263. Orrison, Kathy: 245. Orth, Shirley: 221. Osborn, Becky: 263. Osborn, Chuck: 263. Osborn, Georgia: 221. Osterman, Karen: 115,263. Osterman, Ron: 280. Oswalt, Gary: 263. Ott, Barbara: 280. Ott, Ralph: 165,177,280. Ott, Vivian: 245. Otte, Cindy: l26,195,245. Owen, Chris: 263. Owen, Dave: 245. Owen, Jeanni: 263. Owens, Art: 221 ,307. Phillip, John: 222. Owens, Barry: 280. Owens, Gary: 245. Owens, Kevin: 31,2BO. Owens, Pat: 263. Owens, Steve: 108,263. Owsowitz, Sam: 280. P Paddock, Jan: 280. Pereyra, Angelina: 281. Perfetto, Art: 245. Perkins, Bill: 245. Perkins, Gary: 169,245. Pernicone, Vicki: 263. Perry, Deborah: 222. Perry, Jim: 245. Perry, Warren: 263. Pertile, Betty: 222. Pesqueira, Diana: 281. Pesqueira, Ray: 245. Peters, Andy: 108,110,263. Peters, Eddie: 108,245. Peters, Joanie: 263. Peters, Lauren: 245. Peters, Lloyd: 281. Peters, Mary: 263. Peters, Paula: 281. Peters, Sally: 281. Peters, Valerie: 281. Petersen, Kathy: 119,139,222 Peterson, Judy: 245. ' Peterson, Kathy: 281. Petitti, Charles: 263. Petitti, Kathy: 245. Petruccelli, Patricia: 281. Petty, Steven: 281. Peylock, Janet: 245. Peyton, Kyle: 281. Phanton, Bob: 109,157,211-5. Phanton, Rick: 177,187,281. Porters, Kathy: 245. Post, Carol: 108,253,264. Potter, Charles: 222. Potter, Gerald: 281. Povis, Rodney: 185,281. Powell, Bill: 281. Prach, Percy: 264. Prah, Sherman: 245. Prater, Terri: 264. Prather, Karen: 222. Pra ht, Pratt, David: 264. Florence: 264. Pratt, James: 181,264. Pratt, Richard: 281. Pratt, Sherman: 245. Pratt, Stephen: 281 . Prchal, Joe: 264. Prchal, Kathy: 281. Prchal , Steve: 222. Preisch, Cheryl: 281. Premovich, Margie: 281. Premovich, Misty: 46,109,222. Presley, Carol: 264. Preston, Kathy: 264. Preston, Kris: 269,281. Price, Price, Connie: 46,50,103,222. Deborah: 245. Price, Elliott: 222. Price, George: 281. Price, Mike: 46,222. Price, Roxy: 104,264. Price, Trudy: 281 . Pridgen, Tom: 222. Printz, Mike: 109,281. Propp, Nancy: 281. Prowell, Lillian: 246. Pruitt, Debra: 264. Puch, Regina: 281. Puckett, Karen: 246. Puckett, Tom: 103,246,264. Putt, Yvette: 193,222. Pugh, Perry: 264. Pugh, Regina: 110,281. Pugliese, Carmella: 264. Pulsiter, Douglas: 187,281. Purcell, Margaret: 115,222. Q Quail, Kim: 281. Qualls, Charles: 223. Quayle, Thomas: 59,223. Quebedeaux, Ann: 117,246. Queen, Dora: 246. Queen, John: 281. Quihuis, Cecilia: 264. Quihuis, Christopher: 246. Quimby, Bill: 105,137,246. Quinn, Anita: 139,199,233. Quiros, Henry: 264. R Rademacher, Fritz: 46,48,128,189, 223. Rattensparger, Karen: 114,195,246. Rafferty, Ann: 246. Raffler, Marcia: 264. Phillips, Phillips, Phillips, Phillips, Pickett, Pickett, Pierce, Pierce, Pierce, Pierce, Pierce, Bruce: 281. Gary: 191,264. James: 281. Ted: 127,153,168,169,222. Elizabeth: 281. Karen: 281. Dawn: 245. Deanna: 264. Jeffrey: 264. Kent: 281. Patricia: 264. Padilla, Daniel: 221. Padilla, Rene: 263. Page, Sandy: 221. Pageau, Kent: 263. Pallo, Debi: 221. Palmer, Steve: 263. Paluska, Leo: 108,177,280. Pappas, Alicia: 269,28O. Pardridge, Kady: 263. Park, Claudia: 143,221. Park, Jensine: 263. Parker, Geoff: 245. Parker, Jay: 109,245. Parker, Sharon: 280. Parkin, Parkin Barbara: 115,263. Kathy: 221. Parks, Bill: 263. Pascoe, Fred: 157,28O. Pascoe, Laura: 139,221. Passmore, Patti: 280. Pattengale, Val: 281. Patterson, Bonnie: 222. Patterson, Dennis: 245. Pierce, Rene: 281. Pierce, Richard: 222. Pierce, Robert: 281. Pierce, Steve: 112,245. Pierson, Bob: 222. Pike, Dennis: 181,264. Pike, Penny: 281. Pilkenton, Lorene: 281. Pinion, David: 11O,281. Pinter, David: 264. Pinter, Susan: 245. Piper, Sandra: 112,245. Pirollo, Bill: 245. Piscitelli, Donna: 245. Piscitelli, Laura: 222. Pitts, Donald: 281. Plank, Terri: 264. Plett, Kathie: 245. Plett, Steve: 281. Plimpton, Linda: 222. Plowman, Chip: 245. Poftinbarger, David: 264. Pogue, Linda: 264, Patterson, Jan: 281. Patterson, Scott: 109,137. Patty, Ken: 192,277. Patze, Bill: 191,245. Patze, Carol: 281. Paul, Tom: 17O,263. Polaki, Christine: 264. Polaski, John: 168,169,222. Polaski, Rena: 281. Polivchak, Mary Ann: 245. Polivchak, Mike: 56,l65,l77,268, 281. Pauley, Pam: 263. Paulik, Christine: 263. Paulik, Dan: 263. Paulik, Joseph: 221. Paulus, Gayle: 263. Paulus, John: 245. Payne, Bev: 222. Pollock, Pat: 245. Ponce, Sandra: 281. Ponchetti, Debra: 281. Poncin, Robert: 281. Pope, Gary: 264. Popovich, Betty: 245. Poppen, Richard: 145,245. Art Owens and Jacque Hines rehearsed for the drama production, The Ameri- can Dame. The play was performed by morning drama students from Dec. 5-7. 7 Raines, Lyndia: 264. Raicany, Flory: 246. Ralston, Bob: 13O,281. Ramirez, Edith: 223. Riddle, Rick: 8O,127,189,'l99,223. Ridgway, Bryant: 247. Ridgway, Keith: 126,164,169. Ridgway, Linda: 264. Russell, Don: 265. Russell, Gary: 185,265. Rust, Dennis: 184,185,247. Rutter, Cookie: 265. Ramirez, Nora: 264, Ramos, Bill: 156,264. Ramos, Virginia: 133,223. Ramsey, Lavonne: 264. Rand, Diana: 264. Ranger, Richard: 165,177,281. Ranne, Don: 153,223. Ranne, Ric: 165,171,281. Rapp, Glenn: 246. Rapp, Lee: 281. Ried ell, Joan: 223. Riggle, Maurine: 247. Riland, Kathy: 247. Rincon Rine , Daniel: 177,179,282. y, Carl: 152,174,175,233,247. Rinker, Shelley, 282. Rink Rink le, Janice: 223. le, Nancy: 264. Rios, Kathi: 282. Rios, Mike: 223. Ryan, Dan: 282. Ryan, Debi: 247. Ryan, Joe: 247. Ryan, Patty: 46,53,224. Ryan, Tim: 161,224. S Sadler, Adrian: 265. Schuler, Randy: 265. Schull, Derek: 112,247. Schull, Steve: 265. Schur, Barry: 164,174,253,265. Schurig, Ricky: 225. Schutt, Jacalyn: 265. Schutte, Kraig: 282. Schutte, Pamela: 265. Schuttz, Mike: 181. Schwanenberger, David: 247. Schwartz, Steve: 265. Schwartzmann, Chuck: 54,127,128 183,184,225 Schwimmer, Kim: 225. Robinson Rarick, Coco: 246. Rascany, Victor: 281. Rath, Roy: i77,2ai. Rawson, Rex: 264. Ray, Jeff: 264. Ray, Nancy: 143,281. Raymer, Carole: 113,281. Raymer, Debbie: 281. Raymer, Pam: 223. Reames, Carole: 281. Redding, Mike: 180,181,246 Reddy, Steve: 281. Redford, Allan: 264. Redman, Richard: 246. Redmond, Dave: 264. Redmond, Marnelle: 223. Reeb, Tom: 281. Reed, Debbie: 281. Reed, Gary: 281. Reed, Jim: i77,2si. Reed, Josie: 264. Reed, Kathleen: 246. Reed, Marcia: 39. Reed, Martin: 170. Reed, Reed, Mickey: 264. Rick: 223. Rees, David: 264. Rees, Jim: 281. Reese, Nan: 112,114,264. Reeser, Mike: 58,157,281. Reever, Michele: 246. Reeves, Jerry: 264. Reeves, Mike: 264. Reeves, Randall: 246. Regal, Dwayne: 281. Regan, Jim: 264. Regan, Tim: 246. Reich, Frank: 246. Reichel, Joe: 46,226. Reid, Martin: 17O,264. Reidy, POT: 281 . Reimer, Troy: 157,165,281. Rein, Jeff: 17O,264. Reis, Joan: 264. Reis, Kevin: 153,223. Reiter, Larry: 281. Remington, Debbie: 193,223. Reyes, Hector: 246. Reyes, Joe: 281. Reyes, Sylvia: 246. Reyna, Elizabeth: 11O,115,133,223. Reyna, James: 246. Reynard, Calvin: 106,107,246. Reyna rd, Henry: 223. Reyno, David: 264. Ripley, Tom: 68,'l13. Risenhoover, Patti: 264. Rishur, Donald: 264. Risk, Jim: 224. Ritchie, Karen: 282. Ritchison Ritchison , Dale: 247. , Wayne: 282. Ritter, Douglas: 177,282. Ritter, Jackie: 120,224. Rivers, Nancy: 247. Roach, Jacki: 247. Roberson, Darrell: 264. Roberson, Jerrie Lynn: 282. Roberson, Mary: 247. Roberts, Cheryl: 282. Roberts, Dave: 264. Roberts, Debi: 264. Roberts, Dianne: 46,224. Roberts, Karen: 282. Roberts, Scott: 108. Roberts, Steve: 113,247. Robinson, Christine: 247. Robinson, Dian: 247. Robinson Robinson , Kevin: 247,264 Kim: i7i,2a2. Robinson, Linda: 264. Robinson Robinson Robinson Robison, Robison, Robison, , Michael: 264. , Robby: 264. , Ted: i7e,i7a,i79,2e4. , Todd: 224. David: 264. Robin: 247. sfeve: 191,264. Robold, Shirley: 113,114,247. Robold, Susan: 115,264. Roche, Thomas: 282. Rodriquez, Patricia: 282. Rodriquez, Rafael: 54,56,141,224. Rodriquez, Rene: 224. Roediger, Gordon: 264. Roehler, Patti: 282. Roehler, Robert: 264. Roetteis, Red: 264. Rogers, Judie: 247. Rogge, Leslie: 247. Rognlien, Bob: 231. Rognlien, John: 109,247. Rohlik, Leonard: 282. Romero, Romero, Bonnie: 282. Giana: 264. Romero, Janice: 282. Romero, Kenny: 157,171,282. Romero, Nanci: 264. Romero, Romney, Sandi: 247. Janet: 112,247. Sager, Carol: 282. Sakin, Jim: 116,141,224. Salaz, Gerardo: 282. Salcido, Mark: 247. Salcido, Sandi: 265. Saltzman, Sallie: 46,61,116,224. Saltzman, Suzanne: 247. Sammons, Brooke: 11O,177,269, 282. Sammons, Randy: 61,11O,141,233, Scott, Chris: 225. Scott, Donovan: 176,265. Scott, Elaine: 225. Scott, Karen: 247. Seale, Kathy: 108,265. Sealy, Billy: 247. Sealy, Jim: 171,269,282 Sealy, John: 247. Searle, Jean: 282. Sebest, Marcia: 225. 247. San Angelo, Dominick: 282. Sanborn, Deanna: 110,265. Sanborn, Linda: 247. Sanchez, Art: 247. Sanchez Belinda: 265. 1 Sanchez, Bertha: 247. Sanchez, David: 282. Sanchez, Fred: 224. Sanchez Hiiinio: 247. Sanchez, Marlene: 282. Sanchez, Tom: 224. Sandberg, Carl: 265. Sanders, Gail: 224. Sanders, Kathie: 224. Sanders, Lynne: 265. Sanders, Susan: 282. Sanderson, Margaret: 247. Sandoval, Charlene: 282. Sanford, Mark: 282. Sanford, Ricky: 265. San Nicholas, Franc: 282. Santeyan, Tim: 108,157,177,282. Sami, Chris: 104,132,247. Santorella, Debbie: 282. Sargent, Mike: 247. Sasse, Mitzi: 224. Sauer, Joan: 247. Sayan, Grace: 224. Sayer, Joan: 247. Scalise, Judie: 138,247. Scanlon, Victor: 282. Schaefer, Robin: 247. Schaffer, Susi: 265. Scheerens, Joseph: 224. Schenker, Beth: 109,111,247. Scherer, Dean: 224. Scherer, Dyan: 115,247. Schiermeyer, David: 265. Schildmacher, Bill: 282. Schildmacher, Sue: 247. Schloatman, Dan: 265. Schloatman, Randy: 185,282. Schmid, Donald: 11O,247. Schmidt, Jeanie: 265. Schmidt, Karen: 224. Sebree, Craig: 113,189,247. Seckman, Rick: 282. Sees, Mike: 265. Segundo, Charmaine: 247. Segundo, Thomas: 187,282. Seidenabel, John: 225. Seidler, Lynne: 282. Seitz, Tom: 179. Sellars, Sue: 115,247. Semlow, Marcia: 115,233,247. Sepulveda, Cathy: 282. Sepulveda, Rose: 132,265. Seright, Edward: 113,133,137,265 Seright, Helen: 133,225. Sevy, Naree: 265. Shaffer, Billy: 265. Shaffer, Jacque: 282. Shaffer, John: 247. Shaffery, Jon: 181,225. Shaffer, Susan: 225. Shanley, John: 189,225. Shannon, Mark: 247. Shapiro, Aiuh: i27,i37,i53,i74, 247. Shapiro, Joel: 248. Shapiro, Mitchell: 265. Shapiro, Philip: i76,i79,2e5. Sharp, carol: 122,193,225 Sharp, Patricia: 225. Shaver, Reuelene: 225. Shaw, David: 225. Shaw, Diane: 265. Shaw, Dolly: 282. Shaw, Mardy: 282. Shaw, Mike: 265. Shaw, Robert: 248. Shaydak, Terry: 248. Sheffield, Debbie: 265. Shelton Gail: 248. Shelton, Kathy: 225. Shelton Kathy: 282. Shelton Rena: 225. Shelton Rll'1CI: Shepard, Ahh: ii5,265. Shepard, Nancy: 282. Reynolds, Carolee: 223. Sheppard: Bruce: 265- Romney, Susan: 282. Reyno Reyno lds, Ken: 223. lds, Nonie: 268,281. Rhoads, Donna: 109,223. Rhodes, Linda: 281. Rhodus, Doug: 68,161,223'. Rhyner, Mark: 246. Rhyner, Mike: 264. Ricard, Peggy: 281. Rice, Diane: 281. Rook, Ka Rorbach, Rose, Ge thy: 264. Diane: 247. ne: 224. Ross, Buddy: 282. Ross, Jef f: 265. Ross, Virginia: 282. Rotello, Joe: 224. Roth, Cindy: 135,247. Rothman, Fran: 223. Schmidt, Schmidt, Schmitt, Schmitt, Kevin: 282. Stanley: 156,247. Dyanna: 247. Mary: 265. Schmucker, Jane: 224. Schmucker, Regina: 282. Schmuker, David: 282. Schneider, Carol: 137,282. Schneider, Gayle: 247. Rice, Mike: 156,176,264. Rich, Lillian: 61,106,233,246. Rich, Michael: 146,233,246. Richards, Brian: 281. Richards, Cheryl: 115,246. Richards, Ruthee: 246. Richards, Sue: 264. Richardson Richardson Richardson Richardson, , Deb: 246. , Gail: 223. , Josh: ioa,ii2,223. Marc: 17O,264. Richey, Darla: 247. Richwine, Steve: 264. Rickard, Mari: 282. Riddle, Celia: 125,264. Rothman, Todd: 265. Rothwell, Bruce: 223. Roush, Fred: 282. Roush, Nelson: 247. Rowe, Rhundo: 247. Rubendall, Gretchen: 247. Rudrud, Cinde: 282. Ruelas, Richard: 224. Ruelas, Rosie: 265. Ruff, Richard: 181,247. Ruiz, Rene: 156,17O,265. Rumel, Scott: 165,177,282. Rumic, Mickey: 282. Rumore, Phyllis: 265. Runsey, Robert: 265. Schnelle, Deborah: 282. Schnelle, Jack: 247. Schock, JoAnn: 269,282. Schock, Robert: 71,116,128,152, i9a,i99,225,299. Schoditsch, Glenn: 282. Schoenberger, Jerry: 225. Scholer, Craig: 225. Schrader, Eric: 265,181. Schrader, Jeff: 177,282. Schrand, Pam: 282. Schroeder, Denise: 282. Schroeder, Patricia: 247. Schroer, Margaret: 247. Schrubbe, Ann: 282. Schrubbe, Paula: 114,265. Sheppard, Stephen: 110,245. Sheperd, Rena: 282. Sherman, Stan: 188,248. Sherman, Susie: 282. Sherrer, Chip: 248. Sherrer, David: 282. Shields, Karen: 55,56,7O,71,12'2, 225. Shinevar, Jane: 282. Shinevar, Julie: 248. Shipley, Charles: 225. Shipp, Kim: 282. Shofner, DeeDee: 282. Shofner, Jacki: 265. Sholin, Norm: 137,248. Shopf, Geri: 248. Shopf, Sha: 265. Short, Marilyn: 225. Shott, Nancy: 225. Shreve, Jenny: 282. Schultz, Mike: 265. Shumaker, Bev: 68. Shumaker, Steven: 282. Shumsky, Nikki: 265, Shurtz, Sidon, Debbie: 282. Claudia: 226. Siefarth, Brad: 248. Siefarth, Mike: 188, Siefarth, Pat: 188,282. Siefert, Siegel, Cassie: 248. Heidi: 282. Sierras, Eddie: 226. Sierras, Margaret: 265. Sillik, Randy: 157,177,187,282. Silvain, Esther: 226. Silvain, Lydia: 265. Silverman, Gale: 248. Silvernale, Diane: 226. Silvestri, Ken: 282. Simmon, Dan: 226. Simmons, Carl: 282. Simmons, Chuck: 137,164,265. Simmons, Richard: l87,282. Simmons, Todd: 169,233,248 Simms, Larry: 181,265. Simons, Cindy: 265. Simons , George: 265. Simons, John: 265. Simons, Tad: 269,283. Snell, Scott: 283. Snellstrom, Ron: 265. Snider, Roger: 189,283. Snider, Scott: 248. Snow, Ruth: 265. Snyder, Ginger: 248. Snyder, Jody: 283. Soelle, Jeri: 283. Soelle, John: 248. Soland, Scott: 192,283. Sollers, Sue: 226. Soloski, Carol: 248. Soloski, Michael: 226. Somonick, Linda: 248. Sonkin, Linda: 283. Sosa, Ninfa: 226. Sosin, Ellen: 283. Sotomayor, Jess: 137,265. Southard, Debbie: 265. Southard, Lorraine: 283. Southard, Rick: 248. Southern, Stephen: 283. Spaeth, Cecelia: 283. Spahr, Wayne: 283. Spanhook, Jon: 248. Stone, Bill: 283. Stone, Bruce: 111,283. Stone, Dave: 248. Stone, Stone, Marcie: 283. Vicki: 109,111,113,226. Stoops, Tom: 127,153,155,174,248. Stouffer, Cathy: 112,113,227. Strahan, Loretta' 226. Straub, Debbie: 248. Straub, Denise: 283. Stroud, Kathy: 266. Straus, Ellen: 248. Strodtbeck, William: 125,19O,191, Theuret, Jack: 164,170,266. Thoma, Thoma, Thomas Thomas Brenda: 283. Jim: 176,179,249. , Ann: 266. , Annette: 284. Thomas, Dennis: 157,165,177,284 Thomas, Edith: 266. Thomas, Grant: 284. Thomas, Karen: 112,114,228. Thomas, Linda: 284. Thomas, Lynne: 47,129,228. Thomas, Mark: l76,'l79,226,284. Thomas, Sharon: 195,249. Simonson, Charles: 226. Sim son Peter 144188 265 P . : . . . Singer, David: 61,181,188,233,248. Singer, Ed: 283. Sipiora, Bonnie: 283. Sisk, Mike: 32,191,305. Sisler, Richard: 265. Skarsten, Doug: 248. Skarsten, Steve: 192,283. Skarsten, Sue: 226. Skeen, Yvette: 265. Skevington, Lynn: 248. Skevington, James: 127,183,184, 226. Skidmore, Pat: 248. Skidmore, Sandi: 265. Skiles, Colleen: 115,248. Skiles, Pat: 226. Sladek, Sharon: 145,265. Slagle, Lynn: 103,283. Slavin, Colleen: 248. Slavin, Craig: 248. Slonaker, Vickye: 265. Small, Richard: 248. Smart, Patty: 265. Smart, Paul: 283. Spargur, Barbara: 226. Spargur, Michael: 265. Sparkman, Dale: 265. Sparkman, Nanci: 138,226. Sparks, David: 283. Sparrold, Rick: 283. Spatola, Michele: 283. Spear, Libbi: 265. Spearman, Vikkie: 265. Spears, Spears, Spence, Spencer, Spencer, Spencer, Mike: 265. Patrick: 283. Sherri: 283. Ginny: 116,136,226. Sally: 226. Scott: 226. Sperduti, Armand: 176,248. Sperduti, Spicker, Spiegel, Tom: 283. Lesli: 283. Spiller, Ralph: 115,226. Spillers, Rusty: 156,17O,226. Spitler, Kathy: 283. Splane, Spogen, Spotswo Spotswo Spray, J John: 'l7O,226. Dan: i87,226. od, Diana: 54,226. od, Julie: 283. anet: 135,226. Donell: 37,85,268,283. Smelker, Hogan: 127,183,184,226. smid, Harold: 283. Smith, Smith, Bob: 283. Calista: 265. Smith, Candy: 121,248. Smith, Char: 138,248. Smith, Cindi: 265, Smith, Debbie: 283. Smith, DeEtta: 248. Smith, Ellis: 283. Smith, Gary: 265. Smith, Janet: 248. Smith, Janice: 265. Smith, Janice: 226. Smith, Jeff: l99,226. Smith, Joe: 170. Smith, Larry: 265. Smith, Lynn: 120,248. Smith, Lynn: 265. Smith, Marri: 248. Smith, Michael: 248. Smith, Michael: 283. Smith, Mike: 'l57,177,187,283. Smith, Nancy: 135,248. Smith, Pepper: 153,169,226. Smith, Randy: 283. Smith, Renee: 114,248. Smith, Robert: 32. Smith, Robert: 265,283. Smith, Russell: 248. Smith, Sherry: 46,226. Smith, Stephen: 169,248. Smith, Steve: 283. Smith, Steve: 174,226. Smith, Sue: 283. Smith, Teri: 265. Smith, Tom: 109,111,226. Smith, Tom: 248. Smith, Tom: 283. Smith, Wayne: 283. Smyth, Jeannette: 125,265 Sneath, Dennis: 112,113,114,139, 248. Spross, Marvin: 248. Sproule, Frank: 226. Sproule, Marilynn: 283. Stacey, Pat: 248. Stagg, Frank: 46,153,227. Stamback, Karen: 283. Stomper, Basil: 227. Stanbrook, Bob: 93,227. Stanfield, Jeff: 283. Stanton, Billie: 283. Stark, Sandee: 46,228. Starr, Chris: 283. Startzel, Morris: 228. Staugoard, Elson: 248. Steadman, Cynthia: 248. Steele, Cynde: 283. Steele, John: 226. Steele, Linda: 248. Steele, Wayne: 283. Steffe, Gail: 105. Stellies, Phillip: 174,24a. Stenbakken, Barry: 248. Stenbakken, Dale: 137,248. Stephens, Karen: 248. Sternberg, Craig: 226. Sternfeld, David: 157,283. Sternfeld, Phyllis: 248. Stevens, Alan: 283. Stevens, Cece: 226. Stevens, Joe: 248. Stevens, Mike: 283. Stewart, Carol: 227. Stewart, Debi: 227. Stewart, Linda: 226. srewrm, Por. 115,226. Stilb, Kevin: 226. Stillson, Jerry: 248. Stock, Dave: 226. Stockdale, Lorraine: 283. Stockham, Twyla: 125,226. Stokes, Sandy: 226. Stolba, Debbie: 46,102,120,227 227. Strom, Darrel: 283. Strong, Peter: 41,56,69,128,182, 186,187,248. Stroud, Joseph: 283. Stroud, Kathy: 226. Stuffing, Evelyn: 54. Stump, Jerry: 37,8O,91,127,152, 228. Sturgeon, Rick: 226. Stutz, Alyce: 283. Stutz, John: 177,283. Suarez, Bob: 153,227. Suhay, John: 226. Suhay, Robert: 226. Sullenger, Barbara: 226. Sullenger, Steve: 248. Sullivan, Tim: 283. Summers, Diane: 47,227. Summers, Joel: 226. Sunley, Kenny: 185,283. Surlin, Charles: 227. Suter, Dale: 113,226. Sutherland, Sandy: 283. Sutton, Martha: 112,226,253. Sutton, Rick: 283. Swatford, Jim: 248. Swafford, Tuck: 283. Swanson, Thomas: 283, Swanland, Bruce: 283. Swanland, Kris: 227. Swann, John: 248. Swazey, Alan: 249. Swazey, Sue: 226. Sweeney, Margie: 283. Sweeney, Mike: 249. Sweet, Sharon: 283. Swiderski, Fred: 105,127,152,227. Swigonski, Susan: 226. Swinehart, Ken: 283. Sydow, Barb: 249. Sykes, Debbi: 283. T Taber, Louis: 283. Taber, Stephen: 227. Talaoc, Steve: 114. Talaoc, Vivian: 249. Talley, Ceclie: 226. Tally, Debbie: 226. Tambures, Gigi: 283. Tense-y, lvlyke: 176,179,226,253. Tappan, Larry: 226. Tarbill, Christie: 47,113,114,116, 14O,227. Tarbill, Cindy: 13O,226. Tate, Mindee: 249. Tatro, Gary: 283. Tatum, Danny: 177,283. Tatum, Marla: 227. Tatum, Tom: 157. Taylor, Aubrey: 249. Taylor, Clay: 153,176,249. Taylor, Janie: 141. Taylor, Jim: 227. Taylor, Liz: 115,226. Taylor, Walter: 23,226. Teeple, Pam: 47,228. Tegtmeyer, Patti: 139,228. Tella, Brock: 127,128,187,228. Tella, Greg: 283. Tennen, Les: 266. Tennyson, Valerie: 283. Teran, Robert: 266. Teto, Diane: 228. Teto, Steve: 283. Tharp, Janell: 109,266. Tharp, Tom: 266. Thetford, Craig: 114,249. Thomas, Sheri: 284. Thomason , Don: 266. Thompson, Cinali: 249. Thompson, Crystal: 284. Thompson, Doug: 249. Thompson, Harman: 187,284. Thompson, Jim: 153,249. Thompson, Linwood: 284. Thompson, Thompson, Thompson, Pattie: 284. Roger: 249. Susan: 253,266. Thornton, Walter: 249. Thrasher, Kathy: 115,249. Throp, Don: 249. Thrush, Brad: 144,249. Tiderman, Karen: 266. Tierz, Al: 284. Tighe, Ellen: 61,115,249. Tilford, Frank: 284. Timmins, Michael: 284. Timmins, Richard: 266. Tindall, Kathy: 121,228. Tindall, Rosemary: 284. Tipton, Debra: 228. Titley, Ron: 266. Todd, Cyndy: 284. Todd, Mike: 284. Toland, Mike: 156,266. Tolley, Ruth: 253,266. Tomoszewski, Lynn: 266. Tonkinson, David: 249. Toombs, Harvey: 266. Toresdahl, Jeff: 228. Toresdahl, Jim: 284. Torreion, DeDe: 249. Torreion, John: 112,114,249. Tost, Bruce: 108,147,266. Tovrea, Harold: 266. Towle, Holly: 249. Townsend Bill: 284. Townsend, Cheryl: 249. Townsend, Gary: 284. Townsend, Renee: 249. Townsend, Townsend Roger: 153,228. Sue: 249. Tracy, Cliff: 249. Trausch, John: 157,187,284. Trausch, Kevin: 228. Treadwell, Leslie: 228. Tregonis, Nanci: 193,266. Trenck, Diana: 284. Trimble, Sandi: 284. Trinca, Peter: 47,107,131,228. Trisler, Barbara: 195,228. Trisler, Bob: 249. Trower, Bob: 157,177,187,284. Trumbo, Karen: 266. Trumbull, Kathi: 266. Tsaguris, Chrysann: 106,233,250. Tucker, Bruce: 228. Tucker, Paula: 266. Tucker, Rene: 250. Tucker, Taffy: 284. Tucker, Tom: 228. Tudor, Judy: 112,114,228. Tully, Pat: 258. Turner, Brenda: 266. Turner Dan: 27,53,112,127,184, 2281. Turner, Fred: 284. Turner, Gene: 266. Turner, Jolene: 112,114,25O. Turner, Judy: 266. Turner, Richard: 250. U Ullery, Scott: 228. Ummel, Linda: 266. Underwood, Dave: 250. Underwood, Diann: 266. WfiQhT: Peggy: 285. Vuke, Melvin: 177,184. l Underwood, Gary: 284. Updike, Cathie: 284. Upham, Betsy: 35,47,63,199,228. Upham, Elaine: 284. Upham, Jan: 266. Upson, Cindi: 266. Urias, Chuck: 250. Urias, Gilbert: 284. V Wagner, Jennifer: 250. Wagner, Mike: 284. Wagner, Pam: 135,25O. Wahl, Bob: 284. Wahl, Linda: 267. Wahl, Mickey: 229. Wahl, Patty: 284. Wahl, Shirley: 47,107,229. Waite, Harold: 284. Waite, Rex: 267. Waitt, Marilyn: 115,267. Waitasiak, Frank: 285. West, Jay: 229. Wester, Cindy: 195,267. Westfall, Scott: 187,25O. Weston, Tom: 250. Wheat, Sally: 285. Wheaton, Janet: 47,119,229. Wheeler, Patrice: 122,250. Whiney, Barbara: 250. Whipp, Janice: 250. Whitacre, Marc: 285. Whitaker, Dale: 229. Whitaker, George: 157,165,285. Wiseley, Nancy: 115,267. Witkowski, Stephanie: 285. Witter, Ellen: 230. Wohlers, Dana: 17O,267. Wohlers, Randolph: 230. Wohltort, Kris: 285. Wolfenbarger, Mike: 267. Wong, Danny: 230. Wood , Wood, Wood, Christine: 251. Mary Belle: 285. Sally: 285. Woodrom, Robert: 267. Vactor, Jill: 108,125,250. Vail, Richard: 250. Vail, Sheila: 284. Valdez, Alfred: 284. Valdez, Henry: 228. Valentino, Val: 250. Valentino, Vicki: 284. Waitasiak, Melinda: 47,229. Walden, Cathy: 250. Walden, Gale: 194,25O. Walden, Kathy: 284. Walden, Kris: 195,25O. Waldron, Susie: 267. Wales, Joyce: 267. Walinski, Kathy: 284. Whitby, Barbara: 267. White, Ginger: 285. White, Jim: 285. White, Linda: 250. White, Paula: 285. White, Randy: 230. White, Robert: 267. Woods, Danny: 181,251. Woods, Donny: 251. Woodward, Tony: 251 . Wootan, Jeff: 125,188,233. Worner, Eileen: 267. Wortman, Candace: 267. Wray, Cathy: 267. Valenzuela, Bob: 169. Valenzuela, Linda: 250. Van Asdlan, Jerry: 284. Van Van Van Asdlan, Jim: 284. Asdlan, John: 266. Asdlan, Shirley: 228. Walker, Jackie: 284. Walker, Richard: 47,109,229. Walker, Ruth: 269,2B4. Walker Tona: 250. Wallace, Linda: 193267. Walls, Dan: 267. Whitehead, Debbie: 267. Whitehead, Gary: 267. Whiting, Annabelle: 230. Whiting, Brian: 113,267. Whiting, Donald: 269,285. Whitlock, Stephen: 250. Whitman, Raelynn: 285. Vance, Mike: 266. Vance, Ted: 226,228. Vandenberg, Susan: 266. Vandeneinde, Gary: 250. Vanden Einde, Sandra: 284. VanDeren, Cindy: 250. Vanderford, Harvry: 174,179,229. Vanderford, Rick: 157,187,287. Van Marten, Beverly: 266. Van Winkle, Brooke: 266. Van Winkle, DiAnne: 266. Varley, Bernard: 266. Varvir, Kim: 33,109,157,17l,l87 284. Varvir, Mark: 229. Vasey, Steve: 171,284. Vaughn, Debie: 266. Vaughn, James: 284. Vaught, Larry: 266. Veals, Andrea: 116,136,229. Veigel, Edmond: 284. Velasquez, Sally: 284. Velluti, Lisa: 284. Vercillo, Richard: 284. Verleni, Cindie: 284. Vernon, Gordon: 171,187,284. Vernon, Phillip: 284. Versailles, Chester: 250. Versailles, Margaret: 284. Vetterlein, Bobs: 47,116,135,229. Vetterlien, Debbie: 266. Veynon, Gordon: 284. vlcfor, Bill: i74,229. Villasenor, Alicia: 299. Villegas, Isabelle: 250. Villegas, Rick: 250. Villeneuve, Pat: 284. Vining, JoAnne: 47,78,116,229. Vining, Julie: 118,125,266. Vinson, Hal: 284. Vistor, Bill: 113. Vitale, Alicia: 110,269,284. Vitil, Susie: 266. Vitiz, Jeannette: 284. Vitil, Susie: 266. Vitiz, Jeanette: 284. Voda, Avis: 109,266. Vogler, Vickie: 139,229. Volner, Rick: 229. Vondrak, Rick: 250. Vosburgh, Debbie: 284. Vosburgh, John: 250. Voss, Gretchen: 267. Voss, Susan: 250. Vucasovich, Bob: 127,153,155,229. Vucasovich, John: 153,174,176,256. Vukovich, Tammy: 122,250. Vukovich, Vicki: 253,267. W Wachter, Raymond: 267. Walsh, ram. 153,161,25O. Walsh, Tim: 68,161,169,233,250. Walther, Ann: 284. Walton, Barbara: 267. Walton, Carol: 229. Walton, Laura: 267. Ward, Angela: 284. Whitmer, Bill: 285. Whitney, Barbara: 250. Whitt, Carol: 267. Whitt, Chuck: 285. Whitt, Debby: 251. Wicker, Randy: 230. Widener, Sharry: 230. Ward, Ward, Chuck: 250. Dave: 191,25O. Ward, Dianne: 284. Ward, Frank: 229. Ward, Martha Ann: 267. Ward, Ward, Martin: 108,229. Terry: 284. Wardecker, Toni: 284. Warden, Bill: 109,147,267. Warden, Robert: 284. Ware, James: 177,284. Warner, Verna: 108,112,114,250. Warner, Vicki: 284. Warren, Don: 284. Warriner, Jim: 267. Wiese, Carleen: 250. Wiggins, Alicia: 285. Wiggins, Mary: 102,115,230. Wikfors, Deborah: 267. Wilde, Kirstie: 50,60,98,106,122, 230. Wilde, Tod: 267. Wile, Bob: 250. Wiley, Carol: 115,230. Wiley, Sandy: 109,230. Wilging, Randy: 250. Wilhelmi, Mary: 230. Wilhelmi, Thomas: 267. Wilkes, Bev: 109,230. Wary, Clyde: 267. Washington, Rochelle: 284. Washman, Mark: 267. Watchman, Kara: 250. Watchman, Richard: 284. Waterbury, Dwane: 250. Waterman, Jan: 250. Watmore, Vicki: 284. Watt, Linda: 229. Weaver, Tom: 250. Weaver, Vicky: 267. Webb, lcay: 229. Webb, Mike: 250. Webb, Steve: 250. Weber, Amy: 103,122,229. Weber, Stephen: 145,250. Weber, Tom: 153,25O. Webster, Ken: 250. Weeks, Rock: 250. Weeks, whii: l7o,267. Wegen, Bernie: 115. Wehe, Chris: 185,284. Wehe, Marville: 250. Weinberg, Alan: 267. Weinberg, Jerry: 177,284. Weinberg, Lillian: 130,195,229. Weinkauf, John: 250. Weinzappel, Don: 192,284. Weisel, Kathy: 285. Weiss, Scott: 267. Weitzel, Darrel: 176,179,250. Weitzel, Greg: 177,285. Welch, Gary: 1B1,267. Welsh, Tom: 285. Weller, Steve: 267. Wilkie, Margaret: 61,23O. Wilkins, Debbie: 267. Wilkins, Jayne: 230. Wilkinson, Audrey: 47,138,230. Willer, Matt: 285. Debbie: 250. Williams Williams Debby: 285. Williams Dennis: 285. Williams Janice: 267. Williams Lynda: 250. Williams, Maggie: 36,267. Williams Sandy: 230. Williams, Tom: 285. Willis, Curtis: 285. Willis, Walter: 250. Willoughby, Jim: 285. Wilner, Michael: 169,23O. Wilsdon, Lorna: 250. Wright, Bob: 156,267. Wright, Brenda: 253,267. Wright, Dave: 267. Wright Mike: 230. wrighff Millie: 231. Wright Pat: 194,195,251. Wright, Pete: 192,285. Wright, Steven: 133,153,187,231 Wrye, Jean: 231. Wuertz, Dale: 285. Wuertz, George: 251. Wylley, Elizabeth: 285. Wylley, Marie: 267. Yaskan Y ich, Diane: 135,251. Yates, Peter: 267. Yauger, Doris: 285. Yauger, Lois: 231. Yeager, Susan: 285. Yelliott, Barbara: 267. Yerkes, Yerkes, Yoachu Yordan Yordan York, B Nancy: 103,251. Tanna: 121,231. m, Chuck: 267. i, Jeannie: 285. i, Rick: 251. renda: 231. York, Don: 181,251. York, K Young, Young, Young, Cty: 285. Belinda: 267. Dave: 153,154,174,251. Janice: 267. Young, Jeany: 267. Young, Loretta: 231. Young, Maric: 187,285. Young, Mike: 157. Young, Sam: 164,187,267. Young, Steve: 267. Young, Sue: 285. Young, Walter: 139,231. Young, Youngli Yuonne: 231. ng, Roland: 157,'l65,177, Wilson Bill: 267. Wilson Charlene: 251. Wilson Corley: 230. Wilson Debbie: 285. Wilson Herbert: 251. Wilson Jerry: 285. Wilson John: 285. Wilson Wilson Karen: 230. Linda: 195,251. Wilson, Nancy: 267. Wilson, Nancy: 193,230. Wilson, Rick: 267. Wilson, Robert: 267. Wilson, Robert: 285. Wilson Sheila: 267. Wilson, Steve: 251. Wilson, Tom: 230. Wilton Margo: 267. Wade, Cathy: 250. Wade, Douglas: 267. Wade, Margaret: 284. Wade, Wendy: 284. Wellman, Jan: 267. Wells, Mark: 250. Wells, Patrick: 133,171,285. Wells, Sue: 135,25O. Wentz, Rita: 285. Werft, Terry: 267. Werner, Jim: 68,161,162,250. West, Barbara: 267. West, David: 229. West, Doris: 285. West, J ames: 267. Winans, Cathy: 115,267. Winans, Karen: 285. Winchester, Gary: 267. Windren, Kevin: 285. Wing, Juliet: 230. Wingard, Renate: 230. Winger, Ronnie: 181,267. Winstead, Bobbi: 285. Wirges, Minette: 251. Wise, Frank: 251. Wise, Shelly: 267. 285. Yount, Jeffrey: 267. Z Zacharias, Jim: 267. Zaiaczkowski, Raymond: 177,285. Zebrowski, Linda: 251. Zeger, David: 267. Zeidel, Larry: 231. Zeidmon, Shar: 231. Zeigler, Marlene: 231. Zepp, Brenda: 285. Zepp, Bret: 231. Zientarski, Larry: 231. Zientarski, Steve: 165,285. Zimmer, Denise: 285. Zimmer, Harold: 251. Zimmer, Kathi: 285. Zimmerman, Jim: 171,187,285. Zimmerman, Kathy: 47,49,63,231 Zink, Tange: 285. Zoback, Anna: 132,269,285. Zoback, Cheryl: 141,194,231,299 Zobel, Glenn: 181,251. Zobel, Ken: 17O,267. Zoeb, Kathy: 267. Zucarelli, Don: 267. Autographs NEWSFOTO PUBLISHING COMPANY