Northern Illinois University - Norther Yearbook (DeKalb, IL)
- Class of 1970
Page 1 of 464
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 464 of the 1970 volume:
“
X 1 95 Lg 3 ., 4 flwfmlf ,. 1 V 'H H 'V ' fi'i'J '3'1 '.5I-sf,- .llifi w i? EF X' 'f:'iii 5gwr:E.' WW l?ff?,'T:':'f:'31. f12 -E'ff'Tz?If'3'5'1'-'TWLQ 1 51-ff' 'fall-2 .25-1-'.EW'f 1'-z flflx. JH:-r Z-'f1':52T-Jr, 'IM' - Q. ' f ' 3:fif21WI'if!Taif:Ws'fff 'JHv:.iJf :.aYffi1LELf! LW-?Y1:iI:E':'?f14:521F5E.33:9vIl?vi24-f'37,k',i6'-1f'f-.5-:52?L2Ki '114,flHfz31-VW:Mixi'1'4fAi'f'l'f'4ffV. ff 'Tri'if-f'?'3'i'rf?1?55 l'-'K 15919-'3i '7ii vf'i.C .f.ESIQF..-3555-..?f 'fxifx '5i l:-fi'4i'f21-1 fl li 9522-L 3.541 21,53-ilfi cihqfrii' 4-?3k7'..fi35f-f5.,,X.1ff: A 1f-,EL-lG'F- 'H A 4,1 E: 1 ,Tw-:w11.LGt. 1-ai, fx-:As'vw--N'1r?f-,v-ft? .-vv--yfm., 14' 1-m,,.m,Eiws4. ,f2-g-1Ew,:fgf- wyffli,f?::,'g4w,f-'.vg-ze, ,.-f:wi'gqgu-4y,:f,w-:.f., J w -1. if if ww-11,1,w1'-: gPm.:':is--42 -rex ?'a:li 5, 1 'L P711 F3-isg5,!j12af1?,9gg1ee1ss::'f,Ef2tgQsg.apf .-5316555.Qmvwlggfff,faffgizgyM 5 3,1vwQ'9fk'j 1.35112-ff1.u 71f fi'k'3f iw 413i'2'gigx3w4 JE A gf '- nb. .1 Zi'1,1,,1g-'f1af az ,Q w5'Z,iefQi'5fH5sf2g3' '.L,'1pf,f f:5fq'Z:-1.115 a3,25T 11F.':1!'1 1?-15 1, . 275:51 114.5 :'f'-3-1' fl-1 J -ifivh sf f'- Q 292-'T ff F E X T59 5F2255i5'Z--123521933152 :N aeq?f12i5f:fL-iifzesiLy-1'1i34'-1'f'21Qf5g4-4151.' E517 !w'i'lf3 'I-ffwigggzi, .HE? 15fs5-'if.,- 52' .1?q'ff51fff,1,,Qj if :1 bf 'H:i:f3'Q2 fgi 1:':!f'f1Z -w5',.Sm-2-,Ee111i5W2E9'5e?i?f5sgg6 ' vi 'IL 52 ?-'29 'flrfff If 1ff!ff'n?Z1f'F' if'fQ3f,1::l1 1:P?l11f'f'12ff'-if ?'1fi If:?ni2 if 'i'f,i11 'Ql1lf:ff1:'fi1:?J 'WPQF' elf? IP? upiiffif ?f1Tf.'1?'w:f i'1ii'11ff5?QL!?4wf- J- ' M 1,gvg:?f:p,'..l. ge .f'1a i.f5J f2,:12.l'.,'-1,51 5'f yitIyel,Z .gif.53-5g:f.qZ',5 --ying' -,L 31ig'f'1':.:5E ,-.wifi'1Z'.2i2'z.'ea1g,Txajfgfi if? I-:I-52. '25-,,. . G , 4 , f f f vLviAie1'1'f11'v'i?f:li Jw:,Pezff:a f9sze5r?f12'-six?1ff'ptQf 'f? :tfb1'--'-.:'-Pwrlpm-fm fziiff-Je.-awvvlfa-4'1fm'f?Q: 1S '!fLhI-:Cv'fP:i,?E:vew944i3wLgw1r-Q-.3riiv:-Hem ,zy-fvzvmev1:94 ifzfigqemfigl-fn-'Aiwa'ug2sfnf.3Lgwzv'1wwgsf1L14'f:2r:1msawrr'-M--i'-ww 'm1Frv2ai'H2gf.,i'W.f1f!:5rrf,' QI- L Ei iv. .1512 ri 625923, if Wi'-,1,h!Q1ff1f-25-l.4 ff'f:E+2Z-rg:-1 'iqwlf aiaiiivgziig 1 ff'Z1f5,EJf gk,51'wa:f4f ,rg fcf 51655533 :2s: g,fi .ifQM-'?Z1v1f:f2' 1,1':Y1'Lf,, 'fl-ff?q','3ff1 Hafpfwe -sfx!.ff'fQ+?g'.-: ? F ffvilfi Tex? 'laws ' 5 -' :ffl2f 1 'a,mi'a151-Ag-ii.:-14Ijfvhi ,-'Mm vfQ:'r211ga,fnfilsffwi2fQ?:f.H3 wqxlzwia: LH1,h,f:'-a5m'f'1: ' fre4WiifflaSw-z'm?:f'f4ti'vi-gwtfiufiNflN.1-hw' .:Q-- fabQgw:,jiwfL5rv.5?.'g -agfzgmirX raffgpu 1,-mfggwrgagsggmi-my:mf'fs2fw1.z,jq.5-35:41:15.'fafq11gjg':4'mvyL,,.5:a.su .fn 'g.,5,mi'.f:If-YE:13-vzgf.'Si1fLf.',, ,P-:.,i''Q- .I'1:Xf,',f,g-' H .ami : ftff fgei.. wr.-i'1f1:'M. FTF TP :ef-3' ,W '1-fnf?A'1.-251' 453- miie-:aq--'+-gg ' af-:q'f'w,p.--.gwnr 1523 ww.: 1331 2g3f'5YJfzFg1e?lT,f-ELEM! '--'3I1'Hf1'1fPj'?,Lf'if,?','i5':M?- i'7'n ', w 'Q iw 'iw 5. 'i?fi9'1H.'I Sflaf 1'f'ff:1b fL'w1 1f -2,,f1..s'1Fifxtfwfravi '3Q,fz!1ii5:l-'saw 3.iF r 1-'f'if:251l'f Y Q2 P if ggg:.QfQ,5fJ:'Q'i5wl2-4 pg faasy.fQ?fEgw.J3fgi wg, ,'?a'sni.gg4Sa 1 . gi 1 ,Q Lf gif , 1.i 'f53 '.xm? wis' 1Zf.Mf11. 2'Sax 'ff .'. :fi4-v'-'W Trix? -' V-' w ir'.'f2- Fifi' w..3'.f wlfv-aw H- ' E - ' V' f::f,'H-1.fQi:12f1.5'iwf :Lk +firw m miQ-1I,mxn.::1,.Q1'wrwfjm m15.sLf:ififfei ,gwiqjwHmils-an-4p2f:','s-'.2,qQ2g1 mwi, 1:w'.,rw- ,,v.-:mei z21.wfa1v2y -Y' ,Mf..21.-y?',r1s:--?i-'z'miu1' prxzwfffgf wig, '91 f :fgg 11 5 1w-,,amL7,,-MEgywg- fm 'i,f1p211' ,,f.1fafw gym, P if vf.pff .,:Jfffffwf ge '.f:,sf-sff,,gAgQ-qu Nagy- W..wgmgpw,xffw-fqmgii. -1-P933-'QF'J,1ZIv,WS'.i'1fgk' Away: D5vw!ww:'wz-wxMgr-'2!,wJ'wwffff - 31533.21 'Q .- ef' W--N5 .-.Ri 'zimfv -Aw. M, sg1fgiagf5f:z2ps31f912-214 ei-fftzwsiqe5.511241mezfifasfriifwk 3627-vw?3'215'.-p2,,ms5w:.a22liz-,u3f?l2221ffe,':'f!,Q-231:.win1I-1swifiwuggifilgaifwngfwlwzfwms-if . Qii-ffefPaisavldxgt-ZxbaafqzQhmg'mf W ! mx' M152 31. wi S211-if1:v-A'-wsziswmlwnfesf-f3'.VW4:?1 fg.wrwfw+xz ey is fra-iilggfwmv1-f14s:v 2-EW.:fag-,flzsii-farmzxrfefwH:f.+f+e'ff?5-wev1ff,:r-wiiffwfhA55-+12 wmv fw . Kgff-asia'-1 idp .sit Y H-2 k1J'w'3p haf11'1N.',4Ge3,l!i'NPd14 'fs' 1?ffSr9iw.:'3fff, x,Pz3 1 ?'i Sd wife' fl M !4Peff'm.'L'gwW1 49U '?A-Q' 'QWED' :FFLMM1.alw: i:i'1?'f-' '-f,v1:'f n'3'14 ...-'M 2w51I'fB' if -'ff-r if,,i,.1.'-ww , --QP: M f wise H -'Ffh '?- -1' my , ' 1 , ,f fm-, mvsftfyQQ.--1Fi- 1 ,,n1+:..fy4!.gA1.w'-Pi . M..1.': ,'.1me YW .ff-1 M -'11 :JRE'Ain.MMQ-e,L,,','u5'-J H M .xfesih fe-:Www ww' J Hkl23'-T-!zM1QgPb 'rw'-11'1wi.'f-62-794: f:',:'i,w?f'FE,mgf- wid-' .S Hui! X' ff 23-'W' 1. 1 A-u 'gf ,FL - A- m 'fr . 1.4- '- M . q 1: ,ff -adm? wr. Jw ., 4' ,mg -51-Kg' ,Ji .--:AM-+1--.',f-a.i.M 'fff,yF,v.4. .H-.'l,5?.,:4n., skwkpffrlw-ffgf4 4' 1 '1:!15xg'1'k,fv-+5 Miz!-,,f'73'! H ,Mr -1 'Q-' ,K f,'-+145 ENT Y-,. M -9- .14 F ' 31' i , f. Y . XE '. .4 HSL f .ai r: -' 'me ,wa5fdgg,M?ii2 3E1f1z 'f9i:a'fff-q'wq5'f,E9,A1A 9 .4 -We 11243-Awe QW, Shing. ,Q3,1agk.w:.4.,6w-4 1, x g: RQ, 4, 2 3'w1w1emgf3f 4w,g.gi,,5.'fa,a, :,g1:,g,- m fg. 17,1113 , 1--Mikgflv f , ,Q 1iqs1f'.4+ Q, , 1 x pg, , ,FA 4, L gma z ufww. 12- Y'1f'1i fi',:M 1Vii1'f: .SVgW3,. 'zyiigw'-wiixfg-slam .:M+.f1vl5'4f' 2s?1fx1miiw.f 1f' F5333 V ,- Cece, V124 sM,1.f,a ww ' S93-wa, X 1 N M261 'a Q 15 - 9 --'fm Am , vi' tial iw ,Amqs ,Jwzi my .yigm- 4-s-Ngwgfg ' r uzf f4g4,-,Q .wg W. f ,A-,. gig? 1- a.qLwQgg' QNim f 51,414,512 EL' s' , A v ',f J . , -wgqfg 4' xv.- wwgf 1544- M w .Mg ', w ??'f: N,p: X ?'9?.'I 1 9-'fgef if w--:WFP w z'1af3af '16,- 11:1 M' '5 1 4k Jn- xx Ax P -- . 1. U r -M '?4 . ? 4 Q.-' , EMM . , H 5 ,ff r' 1 - :, M -5g5slL'3M 'iii iffffwsf -I-. f e: W IA Wi a:ff' - 11???ffif5fiLf 3513 off' Wi 'M D339 i n 24,35 - H a. 5 .ff ,'fJM fw5w - 9' Q 'T' ,,1::'J 'Lf' h, .gi lm ? M 22 fZ,,1ff: vw.- I .. j21g:E55.wQggi vf' f E-E512 'fi' 551153 A gwfi,. 51245e , w5',:-3 1S9E1gig, . 55,9 ,,ggE,gggnE,11f?'.QQ,igJQS afgkw 'gg2gffg+g ?sE3x,g in , 1 g gy , a.,,1'g ' l5 i9x gg, , ,f Nr .111 W -111 .1 - f,.4f, 4 'g5 -if N .I We js L, Jia K . -q u. L12 1 ' ff 'fu ',.,, 1 R q, -, I AQ 'HH ay .4 ,-134, 1,s 'v w12f' w 1. 1, 4'1,mm+ S, it 'iff ,ff+51w??i!-,ff 13311 xml: Jew- 1'-513' G. -Y , '. ,gf ! ,,,i1, N ,m v Q55 wi n U,-4. X-1, W , .. , ww f- ,ggi , , um, M. 35 ,Mlm 7 .L f t ,N 4 , ,,., , gm, sm., xg K 3, may ,m,f,gg-may 4 -1fn.,.,23Lk,wwffqz ,W5,,f,.f, L,y,.,i.f1. 1 . f.4.1- ails +321 ' 9 1 1. 4. - t w i- ig, , ,fu A A 1 my f,-Q 1 N'- 'gf fiw xg ,gif . -u f -me -em T Y- ... N- , -'w p ,V - f ,-1 weimfv 'V M rf'-, in lim-Mfn'1i Hw5'rFP!1 swerve' :Wg-,14f W Af Qgifwm,-:K lei,-g 2 xiii'-13 1 , ff '1 w w ' Wi fe-my . ri we ff? -,L - - ,i 1 .1 l - 'I X 1 PwfifdnfQ'f21f5'5i6xf5?-P'?+513lTMNm'.ai'r. 521i . . ig-M. ffgiviffiv 'QF4,x5 ?f-wifi-5129-X 1i4f2G?fm l:3v.Agri-S'Z1E:i 1331121-fi 45 '9f5ii1 'g,f'f?.,v531f3i5,.?i5 ? 35.551211f5Q?Q53QiQ5ii'4 34, 221: MA,-K4ElL'?5!5N'5Q 2?Si3?ff2EE33if?'Q?11rfFH25153555-511545: ii5ff.rELf?Qf,-.-wif? QQ::G32514'-4534gff,15f?g5Qff3'F4l,13411!ffaz7Ni'LQf55YIi,HMf!iv2,',l' Hill ' Q , fit L HMKQE EQ E75 25iS,?1f2,,T'fll2Qiff1i 4'iI1?Qi?e1kW5Sfl:Mf?W,?5.,.ij5?fi?yFff:fVff i?il'TY'1' 'i 6435fkffi'f2'2i5'l-:'If? ,i5fJ:'Q1'i --.' 'Ywfiff Qf?'w?f if145ij?'Qf1 1?'1'5Vifi - , ' 4 3 0 ' 4, g 1,f:fw.g43 L f ggsgifsg'iii-.,f4,':,5:2'1L5,35 1,gx:,-mzri ,,Af5'x.fu',1:w:1:g. LM., fmmgg .41-r ,- ,,1,vyf:'-,g:, irjmA-,1:?g5y:34aagq:,iigQaw,Iv.g.wQ ,5'Jf,'fLNf.1a2w1w1.1w?f1eJ.Esf.fis-1,1 M, gif' lsrm,-1 :P ff' W1 Z ffw, -V A ' 'dbgxgfm -sim, QQ 'ffwaw gv'fvgm,y3g 'lf' 3 Q3y':-Qggu W ',av?m-lm' 'Q-plLifm:T-Q' -1':,g.m '1zm'f'iQ -if-s,'f W-3215221n-saS,3efqf A, ..vf.g1wa 1.vm--fQ1'1gf.g1':w:,W-:Emfg:-Mww,wmsff wg:ewF11efaf2ff4,1f'g'3f:wfg1f , QM, 1 Y, gf, wwg,-5. QL: Efgr1,,Q1wL' dy' 1.557256 , 'e 5f,iQV25g,,ugrm,5 'msg-' ,15,:Q-'34, iw f1r'U'gil5gy'715f,4nAg5. 1lIFqfQ?La vigqfzigwgfgpf egjiz:r'uglJg11:,4gf ggyiwgv-f,fnwgf fszmm-mmff!f:'3E-iw!em-12wg,3 Allis: fa' f'1.'f-,-11f+.ftJ,a3f+1-'rif -'l-ww,fm4'hv ' WSL ,. I 1. , g -1 .',, -:,,. my, R I -3 . . 4 -4 , 1- V W-.nm . - -1 4- 1, L-mn qu -1, f, F- .An ,v wggg' q,Q?,. ,:4,x.efI5.,-M 1 f , 1, ., ,- Q 1 ,f .L 4, ,z,,,f,,x,f,.,:A,,, wx-, ,,m,1,1suI,,ff,g...L,- . m.,,.Q, F ' 3 ,41 KVI. 15 J'?ipi5,5p3?-,lfa'5f.: . 'Jsfbhf a4Liw -fi P459 w:.1'w552gH' ,+'1Sfiif:aSJgiE'wffy.,gf1f gif? i'4e,fa:j11im-,,jftiiirf-Q'X'w,5,vfxEE1gF5QS: iWffi31,5iE1if? ,1 'P Q,-.mf Ks',, w.2 , mr, mg a . 1 1 2 - -1 ff 14 ' 'H 'w iv ,wr X V ' 1P'i'52'f QL TF'i'-Ml' 4:75-..'Wf,.,Aii?'l'12 '3f3d2i4a54 W' -,f?f1z1'PfiJ57v3T1?1ff5:1.i'12i: , 1if1E:1'11.-if-'Qu-mv-''lfnffwfii-'fiwffwfwizE1:':'?Pia 'TJ' E 'fvigi f' 3 1' T lfwl L 'AJA- r-J-1 s ,., A. ,Q-vp , ,, .55 .4 , L aqgfwg- gg--4. , ,mfg ,A.4fEf,Au., ..,1, 5-gi ,-dw, d,,,,,1-.t MQ. M.,-Q P A , V, ,,nJ,.,,,.iy, , A .Y . 1, Y, . .- 1,11 , 1,. , ' 1 ' ,M v- fu Y Lg- :':'r..q' sw:-'f.,:ff :g :fwa,r ,Z ww? ,12'V-F 1-Lf'f, , '.qwy': 1T41- fi-'-E-' C155 I Ek 1 1-,JESS 1 1,5131 1 .:gq1:Q y,:5v:.,1-'gg-gb,g:g. .x,f,g1,,Q'?1 13 4, ' 3,1 2, 1- , 4 - ,',. vw -X ' ' , , V - 1 gi ii43'Yg5?5?' kSZ:Y 5PiQ'f1Q kj? .Q Hi! ' ' 'EE ?f?1i'V 5' in 7 142 -3 'GE' w. gp VE- 52, , E1 .fx HM. Jl,.mEfk'fgiZ1kif4 ,3E?,4F:f 53.i5,,??k4,5S,W33-zglggggQfsegiggggjwgggafffw-55,ii55mfi4Lxfgga5,LgqgggggfE1.,iw5ii?i,3m,5g1w11,5f,Qiy5 awgggfgly., fig?-1 ,pw I 1 A ,314 M w ML , ,,:,g,wL,KA ,1 , ,gb V' j f. Q A . I ., J -,.- M 1 'V '55 b ig ,.ggNkg,,i 2?riW4f5E53H5n,3fitiiiprsgg QQqgf1sJzffFf!Q25ii' -2,1,i'.fQf1'54hLt ':j,e:3i'1f,, V' ig , nk-I :H ,ZY'f1ff wi 1 72 1 ' ?3'Q?' ' WWE' 'e i'5S3f5'i52ig'iWai5f ' ifQf2 5ifS'iJ2f. ffllfg' w 11,1112-i'l ,' ,fifw Wazifffgw e , -,im 51' 5.-g . fun ww. ,qua uv Q' 3-3:1 1. 'I LWiiiQ.s:sr : mfg-Q :'i.w,. mg-v - fw,.Y.,:v'11,yS'4Z's'if'PQ1J'a'fEa-fxivizw-LQHS,h,A':1iTi-Q 1 g:i.v.uf fHs -341532-iw,.mifqai ' -1231 -'i1'1:f.ff Af' 1-591' M. Hit - 52 A 11. 5-WQQNQ-if 1 '- va J 4, ,QQ vkwfii-n-g dm, - 5 -'. .QlL!Q,.,sQ,1. mfg, Y 553 5-'aiu.W-!.4gg?u:AnM,45,g.t,,gL5,5--x,,q,.,i ,,1,,.qgg,., -as w ,P New-f.:g gf -'.-Y 4 my 1 wf',L,f2,-f MJ, gan- .zmzfn-,ffm 45,5 ff -- 1 ' 1'f Q':' 1 ' 1 ak .Aiwa WV-A ah-FPfi+1.2,'Pii3?:?i?i afifww' l,5.:f'1i:?r1's'z?,2f wi? 1 :EW 'A-i1fQV?,Efl,f :. ,WWF- ,:,NJ-4ff ,.f i:z,1 fy-f EW! .. .X -'i f .WP H 3 -, 4? iw ff' ' YJ , X, A , . .- .., ,, 5 1541 , -fly, . :aim ., , -1w,m.fg..,,' ,a',ff.,.1,, -,XL gf, 1, - fy XRGLY. xy, H- Y, Ag- ga J, gg,,+,,.,v,--.,g g,,-lm. ,121 'wwf V1.1 in Q. f ,1,f,,,y-5 ,,1,.fw Lf. A , v K- L j.-W , w 52 .5Y Wifi l?i4Lf25!,?fF3'QiA'?'l:f3f?Q3Q,i 3.q,g,gg--N.y5,3g,Q'.q1g-,.g9QA-pi-f1.5 QilQffi41Qw?gE.:', miie ' 2 f' , 1 f 1, J ' .5 Q. + 'N 'Q' Wg ' 1. g '5f, 1-'ij f'f ' '3 LQ' ! '-1 -.'5Q - gg M gf 1.41,-'giy...f Kwai: 1,-,N 2.u.,-ky? 'fsigf-Ili-1'41fi,+!-aiwfmiul psf-:E MQ!-v 51,4 Lp- I1,1'ig..'gw.n-'k3f.,,.,mA.',fi'J--.ig.93.15 j,iLga,e 411 3? 13? .aw .L in N , W Agia ,P YM ' 35-T, Wgr- . 4 P533 al.,, fn il1!,.51 -za ?1-'Yswff-f ,gfS?TWA-iyQ-i'n1Hf'f :- F155'.1'l1-irw ym?1i:.fv'1S'f'f'1v.' W1fwrf.4fbU,w2,a3: EE 14-fur' ,w,:,11f,., sw aaiiig xfszfiyl gg pffzvrp Q we f 'M i ffu,,,-g?- 2??rQAs1,g im, ri , i 55ff i2m g f F 2 4 45 iff!! 5 fz f2T 'f?2 ?liiMfgw'f.1 f gigs fH 5,f e ' 544.1 -SK NE-,5'3ifS.?Qis gifffglfff 5'f':giie?S9liglfmiaz5215?-g sg1fpgftaggfgilggmgatrgiggvgfgrwgrffl5..2??E pfff,gi.X-1 ,g , nf '.-41.1- w if, I ' . ,w s- ,M ' W '.'f.f,,g11 w w ff -: ' , saw I yy f ' 14 2' if H ' f f1f.m wf:3 fm ' A-125122-Jigf .pfgkgiihffgme T, fm!wi1:g.::,flW2fH+:2--1 '1i,.g'wm9 L 1,vf-ww ,l1qMs :w!'.,2'lM aww' ' f - -, - -.,v , h-13'!Lf','wj5 1 W' Hi- 3' H. . H Y --v- W L f: ., 35,55 , W M, ,. , Q, , ,.i-AM ,,,,,:.1,,f. 14151-fX.1gH6yM,E5f'mT1r AM 4t,f.':ja,xLg5A3qQi2'f:z',Xqw:, ra--A1091 kz.H.u-if ,, ',5,.'QL-v,-111.15-,m,1.,3gf5,,,,v,q.1,-39.-g,,,,.-, , .W M fi T Q g,+55?g-ffm' dj - f f . Q 22? , v5:,,-y1f1y'- 13 w'1fl'. Q! A ,wfiif we ze Q, 4312iff-vHf!'v1n-Jsmiikfggmmy Q!-84'pil?f14'G'i2Wi?13f?f,f,iqffq-2.1,4Q? iG v'f7l3i'f,'4f1 ? 1 + 4 , .W-4, :w..1:5r'x:2Q'?'Q:'L xxx-iii!-:fffikfzwx g x w ww 4 1:4-V1f + mf wx, 9 'XM' ww w W w,,,f.1f..mL -f1f .M faf111u'f f 4-,ffw Q4' f ,1,--fl mf Wwwaf-,Q f1'S5-w- 45111 afxwsf-N f 3:4 f,yrE,1fisfQ.5- W. 15-.ELfrm:pp4,,1.y4W-43,34eiawgwf 1- L .:-1 y ::fw15fUf:w4. 'fvkmz ,P 'flflgiw' 3X71'5S3,j' Law s X - ,ix 11 11fJfd'3, f 3 wily!! A '-,ak my Q. 1, ','mgfQa11e- ' -J! fs14,v'VVQ:f'2i?,7:4 - jj: , 1?Qfw' :' h '.f 'W g f' ligg 'C 35 S- 4 f., my 3351-' 'Pfg Y : f1fg.',gf, 1' -.,, . 'T 7 L, 1. ,Q..yJ!g M L iv? xmsF1d fgzifffl .1 W 'wi,:f?'.?y5'qf ' V ia 1- .-.. vw 4- 1 i ,gp M ' ,Tqu 1 w., H .A '41 '.wmQwF1g, A'- f:A.2'- .235 M .- . we vyw: Q Emuww H kv a f-W -+'1lw1ba.Tf435'5:aMW','L2V nf- :hw-M -41 -fiwwqwf-, H,-fl 51- ' ww!-f'1.+ -QMW1 - 14- ' w.3'1 , -' H' E- ' ' A- Q. -fum -will .1511 .- :f.3YP,'f2' ww K . 2 4 Je, 4 - M . ffwrtfwzw'-f?f1?e w'Hz1,P5'--W 'wh ,f'-4r:5fN?. 5:?5J.f4hiA A .' f 'wi 16' iz EQ: aeiiqlii 'gf2:v9?ws -wig 4 '5f5f'i1fkl.i'H.. 1 15 ' 1' 321 av -Er 5 , if f m -' N, ff f, fa? ,Qf5m,AEV.gg33 ,33,:ii3J-srgfan ix 2, viesm EV ?gigJ5wf a,f, -35? riff- -fivd? wi: 1+-'M U. fiiq' -1,-H,-s asf: 2 ff 1' f ff-,,:LQ,gx'5g4-f32'2.- LJ wif HWS'-11:1f2' 1N -'Ns 'S fivvaf-E'f4 .fS ,ggiff if 'H JM'N?3.'.i 1:2-fv 1 wif- ' ,-Q9 1, ig.:-. 'wif 4991 .mfg-.Z' wfkaiw Qfwmwr.1gw4f H . 'fiA4.:'?-A- cv Q '- miff s 59- V.-'ffxewil155-'bM'fa1'f1 'V 12' Wtf97,,.J111-W5-? Y ',i5i!f ' 1.11:fn-mf,Nw-fJiwws-f-'iZ,'41 we 11 w'fZ'v'5w vrwfivfmiy msn -as fx 1. ' fc' L, rw AS -'ff't :Jf. 3:--1+ 2. f A 4'f'I .5 ?f?.'f'fxah1'Lf,i4f'1 Q, nf MH . m'm1v.eTj-.'t,r,,g.:1 , - ,mga -a 1-A 4 ,e ff.:v,r, A 'f'.9Jf.n4 EFL A-L Z'm', 1 --'2 ww J , ,ff f ':5 V'7?f1.Gi' mme?-.sl QEQ ..r,+,j-D'.:F,-'1' Ulf?-lg A I-:.:751'A.yg-1zklzzsf' 1- K 9,11-f1w.f 4 .f'Q.-i 5.1iEz.-2-1.114ff' f' ,la-,Wg-LE fhffifw- ,Living 1'-vfjigfv, fw53U','e . fv'.3.afP- 2-:ef-,.:n,waH,-1:y+?Q , ,w 'g1l': 1':k Lib, . E -1 1 Mn. Hg, Q' 1.1 g., :fm . . . , . 11 1..', . a, ,A Q, .gm - vw ,.,.p,. , . . .Q-,E-, ,X ?.:3,.v,w1 ,,.,,,5i-wifff, :z,x,.g,,,1,,A,y,,g,g,,L , V, , ,g If ,5 ,., M 4, ,Ami 5 , 'f.2f,Q:jgi z if 2 1 ,gg 5gi,yg:Q':,5,9 143 5: y??3i'k4!Qg,4 42Qf,fjf52,E'f5'1 ggAgg,11qi1E5jggf,3i31:5:523595 .agp4gp,g15,fiqg,3l3ggb,5? 35533 , .11 gf 'A' .- 'fe' if' 'M 1-zfisll' '12, 15125 f':',-'J 'L3 'hi 'Vi'29'f. f .55-355551 5' ' 'thi f'L2.',i, !:Y' 'V 772-T fl . 'W V 2lC1fqn1.f1f Tff.Lf':r 1f W I 3'2F '- 1 gf ' ?55?'fi-E2 ff'ff-WF!! :,?::arQf:fgfws , if 5521112555112fwfff-:Wikiage1.3 - E55 iz Weiiififlii' bw? 'fgfwfmagqfw !-':q1f-:ww 'ff53w31fp1-49-in ik '7E.'filY-'Nl if viwmf 4 g-'5fq !'H5a,,1 ' .6-'-w5e':wf.. .liffisxp by-wmg's,M fh- Mg '43 by-32.91 1.1.12f,3if5Mf'ql'if2,,ff,5,L?m:fq-feeifhw MAG.jS'i--I-5S'g5 ,91w.-:mf-diffr,'Mg:g-fgwlz-qfvgi1-:aff wgvgmfg -,.w?1g-4553 5,5 li f ' 2- -' mf:-5' 11' Swv L 21 fix, 1'. m., 2' m,ffw'f ix i2 'f '.:'NEl2, ' 'R-'14-1 ff .4 , mf' J '32, 'xg ',11Q?sw'4'as.j' lm' fra--, :gr .1111 , f ,A 'pg X, -H41 .5 ' 'fi ' ujf5-fr2'2'ff1ff.a,':af: Yrw'-15235 in fray' 2?g!?1r:g.1 w ww- L -. 3' V5551.fi2:f-V'ws1Mia.-1E,53?uf:f'2r?'2z4iin W - ' sflwvfwif -955 15: S :i '1Y ',.'-217,75 11, iff f. 'ru-5,v:wJ'f 2 .+- ?f 'L:21v5xA :1 f-'1:v4!,:-YL '52,': Fi:,.i1 -LEQV6' .-9 f.f'--gi-4f22'I1,alas-'fin-f-Hi2:':4F1':ff1 1h-.:E' hizlffkff s Q ' 4.,,, .nf-3.,,,,,5'v, 1 ,. Q, -Q,.,,..g...m..,,- Manx- Q. 4 ,ff , M41 ,J , w.f,.- Q, -31..f,., JM. -,.,'g31.V-.J4JA:,v2,-1.. ,Q ,..,J-ff ff .- ,,--,vwv'..,..-mf,-1,-Vg:,f:1,f..V,.f4 V,-,ix,,,.g1, . 1-v,,,.,h w,m,,qF,,r.,.f..44+ - .F 51 '--.czwivf-' f 11' ut, V-4, H ff'-:sy ws--141,-':+:w fi ,.w,.f..'- A-.111fs'1f':.'1.-'ds' LPFZJQ -'Jw .Aw--1: - 1'15.112-innwizigrf-'-va.,Mf,':Y' 11 HbJwf'- afp'?1,1119- 0-'if-.Simi-:1 1-'kzwix fwfr '24'-'1-'A-'N' '-'24 W5-'13 kf'W-fi '57'u n- -' ., . I' 1- 4-vf'-2-J-g3,i: QV' .-3-'ia',3i'v ,ggllrfl-Syiirirwg-37'-5 -'ifflyffe' ' ' 1? f f.4-4,fffi 1y4'm:5-'4,i'i!'t! if yQff453v ig fi-A-'GE-'fai'-f,'G.'b'Mu-':'r' -1!f:'w1f. 4H1f,'f 4 'Ffa , wvqf-'Je V1-f'2w1i,,-2 ffm 'W'- .,:ff', '3!G5r!'i'TI14?iwJ.i' :E! :2f?4-. . '- , F . Lp. ,iggms?MFY.figfksffifi-92wQq' 5g1 ff, '.gYf,1nf3ggs,f:q1:gk .1 Pig-5 gg..p5'353rf:A f wfr? Aivlgflglfazgqg wQ ff!.2 IH - TQ-' Tll2 '-WWA -7'fiQ-Nfl' AF 53.-'T,133? Zi7L0!5212 ff!-9 -l,'s ,-,v'f?'i5: F74 LW' 'izlw526-f.f15:11.54-4'-Fifi ,j'3. HM 5-Eiifiii-5i51 'f.ii' ?.'i? JT,33 '?i'K'-,s'Aif2f53ff?''4',iWg 'l--57'5 f ' fi 5,'23556'-'f s'!?5-E13 h 'Z A. 1 gg - 'Q W 1 '11 il '1 ,-' ,Az ' ,fgpg 5-'X'-1-,f .,, - .-A ,Lv 1-, 5 Q, 131' ,255 3, -f ,fr-.! 2','.i ' , ' , 1 fi-'g'2fy.gJ' .C Lg: .3 L54 7 -fE.', . ff-231:5-'!1:ffr,'giiL. 4 lf-rj.. V gn'-' ' ,T-1 ,J 2.4: . ,hi ' 151 ,,5?'413':ggf'A gg:2ip,..'qE'ff1Tgcff. 1 gg,?5:i?q3.11gii' fu-ki! ,i,f:,a,,4f3qa?,5,'3q4V2f 'fg 21555 QM?-qg1i? 1?15,igY332g5 qi? ' . if gi'-,rr,'.y.f15+w-'A' gp., EQ ir? 3f'F'Mf ivff'waQtiQ,L wig: Kyra 'L 'ri' 'ug' +':1.ZfLy!?- TlE:1.11'P.5,.'f??- 2-iw g 'mi ,g5a4?4'g??ii-fit' Pif'f'v4i V-'xasgfidfw'-Ww yi 73 9? P357 35 561-1?L - 'f.W'1Wgli'lfi1si i ef'9'?'9',w Awifi -..'e-fftwig--2-1aff fry'-xaffsfiyf 'Mu 12:6-f ,Iykel'ff ?1'-1?'2W:!,'354ml':T3f5Fff4-f3fsf55iLrH3i p?xf'ff f'?Yi:.w:fgif-W- f f'4'fHf2i1gf?2 cfg:.E 4ihg5fzfli 'FEW Z' 'Wf.L?f-23 2 4w?Qf'l'f'23 3-M 12, N- ,. '1?:31!, -f 4' ' af- 53 xv M- 5222 IEW 155i?if.?2tf55I2fav'P7 W x : f w,Qfiga21v f' x11,5x,1'fia'33f'i-ak . wir- 'W14iii5k ff viii :fiffi y ji 125623559,:,11,g.1'-5F5w?g'fQs?:A3 13911 21315-,LW .3-,IP 'S ffizf '-g,-.ngbli ffeff 'xii '-',v!5'23ig ia5g5 'gggagifimpi'-.2f,l-air YV-.i1'?5 1 54833 Spa , H M16 xfigflilwg-4-- ' fx ' 1' f i ' 'W u '. PS- ,- QQ ' 4 Af viii' , M W. 93,11 why.. A: ,w-we-S--' fw,.!fL .,,1:fw-'iiggw ,R-nf -- ,wf :P JL70,-sa ffwfuff -. wil,-:WV ,W . , L-Iv :izfif -iw r3f+w'.En- 1 f ' . V V fy r. 5 .wiiyflii . wnhr .G- , MH . ff' ..- An ' Y H vi- 1, V ' -, lf' 5 Q 44.1. 3, . -'nf-4.f4f'1?w.f'.A 'aww-,rcs ww ff11-wif awww -. ',,fK.+...1r 4:2- -QA, 'P iw 1555-:J Sfgkr,571:4'-ma-wi?-.awla S .. M 1 ff:-, ,Sw s, f -y-,u u,123L' 2 5111 ., l ug, , -mga, 4-X4 V :tins I-MF,-un'-51' ,44w'?',. -ii' 1:51!fZ'r?1Li'iiagigfmg.,-'Alf '?'3'5vi -1'il'?Wf-'a1'-Y-'-:f'-'kv-94ff2i' f'-4241-.936 --'U 5 'wffwiw 4l4si!'3'-ff'-I 'v .ff 7- , '-52 r -,-r. Fi' :f.wKwJ4w.1 -1-A-P's55 V Vfyg-, H I 1 ' yi -,I .FS 'W ' 1 V 345 -. Jw ' L' ?' f f '.mZ-As xi ,-,,g1ff-aria: lf 921,11 f1f1v?1?wQ'nfm-5mmf 4- im flwwy 'U fdyqsvy f,1ELf ifvf'f4f' 6 37 455 'fwkigfax fu F'-' 1. Jw:- 2? f 1 ff ' M' f 1.4: in -in 'I A mf V ' W 5' ' f3:?IW+f.vfi' 2- Q-Wi-av2i.w5j..,'y:'!3:11i5ig.w'pf'u2'lQ'ff4m.g1:yv '1lr11?1 -Q-3Q'ffgay1,-.sf'f- '1 - PBHL-Syria 'g,,'-My J NFD A . -1 , -P - fra 114 - fa V 'ff 1' f ,1 '1 31 4 SWE ? -if - 2. 17 L-N fi Ma J - M7 ,L fha' .3... , f wl z' 65',fE51L3i-'3 - -V . . , . 1 - . . ,Q V ,. ,--af-FTW ff-.R ,fn b f b. - , 4.1,....L , , 1, , ng, ,4 , - , M ,M-?a,,....9, .,,. , ,Wg ,.f.,,,, ,ws . 4, my -,,i,,g,2g,H,1s4 e 4'-e,,,5,., 4 12k,':'-1.1k1!i5,1f,'Hzzkv1.:eAgQ?f','-Wil,'Ff.ef1'.5f ,.i,mhw,m,Hf , - in-.LWQM ww Q , -:qs-J-mi fu , .., X, amz 'ffimvf . 1, -N -Qin , wtf V W wlvHP !1lf'1: :qf', ,L-xv .-vw? 'w.A,-- -w-mei-.y' fA f.Q-f'f1Fmw12A,,a5' sniff fs: 3-31'-354 w M- ggmifvrw w- - -'.:1:fRd11w. M -.wifes 55' z2 -,L w a, ,am X 2 Mwsfdv fx y51f'w+ 119 .494 wiv faf2swwfi-mfifff We L lawiwfhwiam, fam? .uw ' 'ilfffiw 14 mwah:-,emi'lfw -Q 5 -pfbgzfwgff mga'-.4adz1f.:f 'gf 1 We Q,gi411f-15,37-1 -. .'f w1.rggggQ. Z'f5?i ' Er +vf:fx,,,-f-'kz,,w - gig, A e,?Sf1:,,fgy, ,al n,,gw,g+fd ,k-JM 1' 1 gfmfgw v .HEg'wfw',1i5ff'f M,fM 'v,,w,2,5f'aas .is af-www' vs f' f -f,i1.f:?f 'f L ' L ilwf' W 1 IS' I i f-B'-N:lv A ff: i. w ??iiHew915'E.i 3,..q:as6' i'nrfQ:,i?aw,-gfkrfbi' 'W' PGM A -1155 QW Eff?-5 515155-.f fl in f'eg5g, MW2 f gf 'za-W 2 wif ws-,iw ig ,sf We LH: A ,245?1'v4lf . ff,fvawwf.:?naw,Sgr aigfp fx. M f P1-'fr r 1.122 g,w- -www' 'Wgffag VL, .., 2' s l. --'a H'?Aff'2ff,-mx gk., F- . , . ,iw ' sy fn., , ai ,,-V ws,-f:fgE7', ffJi,'g,,f M -mir., 'srygi,,.qgw,g,,,-.gf,,.5.345 wh ,,-qw f , gif' 1, xi '7'h?5'!j- mff,'??:w.,w,11: 1163?-iiiv? ,-iraifmgeffvw' 4,-H,,1 ': 14 Q- ,-,- W fa p si. ffbwaf. - w a-ff' , -5. gm :f .QE.:mxpr:n3f':f ,fs,?ff.,MT:fzgzfnez-'YET' ,.a:psg3i:v:u.r'.f 4 xiii'-a1'Tf.a'ef:'iifi.f'mivH1fwfn. f5s1fegFfm.2z.:wifi-V , if? 3-H + i 41 -4 4? -ga . wi? -.'v2iiHMr. m 4.1f:e?im+1!:-,!, . wl 2'e51:5gE+4iinas5.fff:e..i6Qi5:?,f .f1fFfw'f1f1-fifq F1-24.bj.ig.5E513ii1, ?'af15i':?Lqvfiieysufigifmgxx.A:ziSQSLA-ff mn?-421 ,,?ew?':-152155,-wif?'djifmf:.-1wi3ff fE ' iii? ,F 552,s ifF5f? fag? fghiggf415Q?5g5q34,QggjLgifg irgieig igiiifjjffiefg -i,5s,w5,fNV312g:, 5g5,4-ghggf53,y.i5-Wggggggga, , gg,-fggffg9-gfzvggag 53:,f55 -f',f5,55:1QQ,.,gg,?gM,,. fgqggg,-3155,f 5 Q ,wg- A 9 , .1 xg gfifgw ,, 1: 1 ml. 5 grin 172 1,zf,1y3135m:.:, bmw-Qt ,al'fwM5,lfLI1Pig,'.: 1ga11w,,1,E:,eQg?J1g g,'x2aV,.v,: ,siffngw wg -mu f-gp, 21,555 4' 5fZ4,g,21L Qijszf sgfg-Qg,j A M51 'I + M! H ,gi '41 Q M 121 'fhll faQ,5'f5gs:1'sfg.,, 'w5 , gk wbfuswt'.:!:wfggQe15!g'fF'Q,?'7Y'm2--' 'tLi?'w.31f5Eg,gKei,-Qwfelm-f1',f:?1i5sz'f4:vw:Nfi'wx- A'-.i5 ,f'iZf:w-gre'Vi-ivzga, vw A 'W weqzffwl'-?f'u FSm-s,frf'pq'v'1r,f'i1l Eff P 1 ,hi wvrv Rf f-PK , .V .gg, ,, ' EU , E,aq.,.:L: Q-4w4:b'4IWr,L.5A,,.pw-551-ig, i'r4eLy?IH' L, 'V-g!??rw!gfE..1wMg4',,.LI25X'f4yy s:L'5.qfg,:gfX,,, 4,2:',,,jm,'l3NEa '1,X,,i3Qfp414s5fw- 12T5',ig-ay-W vu',wv 41' Af-:rain V My , - 1 'H ffllvx 'L' , ' I 'X P , 1 1 f . wiwiqfi- 'EWW,ef-'jfQI?'31V1e, 11: PPWw'!w-if wM?wFf.f.s,M1-ftw:fg5',w:f11f,'wi'w :ww1aw,-Sf--f--',.fWnw- rw W3-fmf,fuu,11w' Q al a -'M - w - ,w f 1 n A Jr ' Ma ,T 156 -533' ngilzgy, 'wicnf Un l'n1'Sa' uh TQ'.5Er.,.c1te.gFfL31'vM2129 15 f ,6'f4f wr S? 'r f ' r V31 'mf 1, :Ns--E? ' N.i:?'f', '-ff f-W 1 ' - rfb' If A 1 ' A , ,' ,,. , 74Ff,,z'if-,grrjdqj gw,Hm1x9,,qX ?5n',: g'1fW nr-,K-tang ,iff-mai'-Q58 gg -1gvwffzw. 4,1 .,,-.',1Li,, .1 V H ' , X? ,. '- ',. V-5-1 .g f Y wb , 5 .' ,w ' - ' '7g52g3p'Q Zhxs-,FQ5,..:y'hwk,4:iQif1:.15Q1,ggQRqauiixma?5l'f'.LwM-lp: pfsgifi-11h-'P,.:'fw,wg:1f-Awg'-.sm-f,:4+e fm ,-5 rw Q'-e N11 1z::w1.xf,v- mai, -V',- Q ,f, 44 v-L 1 g yu, , S -.1 va fu, w-M3111-yiffrKL53353fgygfwA1Yf 5wg,51.g,fziigrfepm?fi4-5'gs,5.11Q'a1IL'2ai!3gr:.f2,.w'geL:'g'1g5g59'35, ,hiv Q xii fp H ' Q . ,1,-1 ':zg,2,f '? ,3f K ,, A 3 Y ygik HMS, evfhwgvfi-211!,1.w-'--M 2' Ip'iiqu.9 ,-,ffmaz 2-wf'1? fm-ffiii,Wm-fWSH- W-'ff:'+J :'W'f.1F4-:f:,'w-. ' 1 5: A 1,1 ,gg 1 ggi, ggf.,,f.f..,. f ,f.w,. ,f ,tg 'W-,vTf....,. gm., mi. '.,4Lw,.,1w V f X, U , X , , V Mfw.,e1f'-,..'1L-me :e.r:mpx,.avww-vfiif www MJ. Q , nf. A fy ' ' ' 'K 1. '- 1'1:Iii22592,1v.5ffM'Q'511,vf4?wPM'iihfxwm-iw-f1Z::fW ':1:-'?- Q35-2111111 f-'auf W2 1 QWWP' HWI-'1 , f sp. ai I A fx - Y - X11ii,,Ef9'k1lfif1'Ff Q,jr,QQ!,QQfjfEffzeS1?!fI:2QiiaffL4:f'LV .flF'WV'5-1 L71fUkjQ1-,,f5fVL'? ,:1+'1?5-M,-1? ' ' 5 f3 'Q,i11,K K :11fiiJ'f?3'?ff,56i4f2JIVISTI-w9F'3?f-i,'iii U?'e'h-P:-N:mfifzf-S'f 2,1 fi f3f'1 2 'iffff 1 ' ' ,- mm sm ' 1 + - f- L1!3!g,wz'Q,fk.w5w,.1'-' 2.4, qffvwmiqsi -qfj 4 1-A 1 r ,X 1 as ,fy ' -' . L .g , . ,, ' 'g,fNQ.Qfgi',,ggAs1a':, E xfL,2..,,,f,, .3'f.q-14,1 gr,,m2':,qa ' K 5 5' 1' 7-1:1 w . .' ' 2' -, my,'g-wg-ylf,,f ga-gpv.f+ .'1w,.wm-Ji' -,v1i,!.,,!,-11, Q, www ., .. -,..ff,,S1 x 4: f4 1 .s:5?1iE'fX-.,,.1u,4 , -A V12 'fffw :U 1 H 1 gag ' H' 3, , ftaf,1j,,qg4sg41i11'1ffiga?gl,L'm,5if?5,1!2'Lp-iq,145511,tiffwg g '?5l,llL'i .,Mifwx,-,-fuffffpf-2 1:4s,..kf:-'Vitf.,:1f'w1 W ,rwwfgal-2,511--1.wy'A'fm'e,1w1:'wvsw ' ,qw + mai, .fy .qA4gpA1,1g,54wggvk1g,f-Magi.53414512 1 1: 115:mwg :g-1,ra. g'e2fgfEQ1 'w1mv., l -ig: :s'F1f..,E,i l3fff ii QU . A S ,f :Qk ,lr?:W.fwfvw1 1'f - - ,Cz Y . ,V U.:-lsr: g5'.ii,g-IliaX,.I:'gi-H315I ..E:La'.-:- .. I jk rimgf- -3-ima' , W M ,z . ,.. ., H., Y 1 VJI'?Y'1R':kTr'f Q1 ,.e,yW'i 'f 35241 ,m f' f VV ' Q '1 1 r' ', f' '1,, ' A ll W equalSpfwfgi,i,E??2,'Im'-l43L,vfQ'ffgi2'1uL'2.Q5,J,a5'51'Q'filwriif'-. f1 :b2,'1f2f'QL, '5 F' 2 2110, .L '.1':V'-H'v,Hy:1 V' K T A 4 A 'E' , miffsigswggega,.5252-1:gg:b,, a511.w.,:',2e'5'-a,L5:Q3,,,,,Q::1J1 ,f.lL':-w :fu f 1 z141,,1f,g244'u'f. f'ie.p1,,1 M,-ffW--'24-:Qf Lwivs , ,v Aim-4 - , Mia' 5, - - V y.,:, V v , K, N 'a.95',:u,'Ff1 qw' .:,.?Ewn!!-wiamS .1--'ie'fA,.1u '1-wr. is , Un 4' LW-'E 'w:2Js.3fQw-1,5M?'4 ' ,,,,1f,g22 wfxws- ,-w T-15, , .:.f . ,, V ' - N4 Z ' J1119,Qi'1L?L1i,fwE:.g,g?-'M we::.gw! .V lac-1:5-1wx,:w1?'- -rvgv :1 1-mn 4 -1 Aw, W: gy L-.A ,Wgwq , 'aims .Q , . f Q, V - .. N' .Q 'Gr '21H'1'f'1f??H.. i:3a.111.'if if!-. w'z:f'sfQ11n:.?: ff? vsfzvl,,aw'.vff,-K-:.ms 1, M A 135Qvff'wYt1'-'f' ' 'f,.41:,3m I. ' ' 1, Q1 mf 1 4 ff' 'Y FmwQ if 2 1 2-ffi? l fl- ' if I 1 ' 1 T 1 4 X 52'-PEW'A ewQfw1,l:s1:iL-5',lf fM1 'sf-s'W41 '? '7-f '1 f V 1 SA 'Y' f I fi .i 1 f. 1 f-EU' i ffl' Q 'Q I ff 'if ' I . wt .. .V J dir-'QW:,i-Nigel..-451-L,-,Qf fG'f-2-i,f-,gmgwr-A X- V ,P e.n1,. 'mg' 11.4 - yf',E f 1-25 4, ,uf 1 v- 1. ,. X- -:Mx ,v,,,lX,g-, '1 -mf ' my 4 ,--4,1 t -- i Nr. - wf, f V -, 'q YL l, . ,K 'L ,fy A - V, fweiiakii-fff'W15 M 4'i:i21m-N? 'ZW?V'.'-'f?.wvfw3W?T 3.-f'i'f? w'w-:?1f'. 1'4?', f,'1ifi51:if,,'?'If'l 1-'P-25'---,P f ',33'fl5 f'we-ww - s'.:4:w2,.' s5..w 'ma gfw ax . q 11 . l. rf 15'9.fim3:11,nmxrf ,' A-ye , ' f11f'f,'13!W'e,,- ,va f-'J:',uE ff fc-i'5 f:f,'z5,'.xb' 9' II-55 my w.: , guy 1 , few mp L- mm: MH: aff: 51,--ff Y 'J:4 fir w iwgggg,5562E1Si'JggifEg24fii?4j?y'HmT935fa,wi3::5m.s15?QFwf'.g.i5s.ei2wi::wf.a,r'v:'-fxFf-fgilz??iini:5sN'555!PNfr1'-QEQMQYQA, ,ffsF'fe,5ggf?ge,I!s3:if:i-Mikif2Es1egQ5ffN,fAA,g,Qi 'Q 'Ni pf -ly ig ,lzlglwfffrvg',f'gLgQ,Qww :QW-az.y4,2g2 V - fw 1- NW:- u'1 nf f' vJ '54f' v. iff ,f'.'g,.f ji, W-is 'Hy Q EW: W sm pi 'figQ1H,'l:,.'l!,1'5i5,f:I1iQggf 1 1:g,r 3, fl? fa f VI, -V. lyk 157+ 9-ui. , : n 2-5' :f 'Q:' J ':1'?f,1- ,4 , 5?r!iii3,52fT'5fL',' QQMQESE2-11QW5EA+Zim?ew14 g2a .,r1 gl: 1 i,3fg,,gp4 g.'w4?gigQfui'grf2 Q21Q ?1E wifi:xg v? ffz-Lguw s,w1+fw2 ?' 'm m31.fleffe ' ,wr2 a1 g'Q i,fwk1545+ Jsfffsw My i: W?g 2 '5 ? f:: gw - iff'M-?i f1wf rf if gfw fwf':2ffi fxf: Qi' 'JU i '13fii3A'3'M'3Di'?V5Eii :11LUH' 5'5'-W4i:q'CffS1',ZH-Y 5f5'f1,:'fAyf2 ?'n'fQ'7:h7',l'9,'.' 1f,1 'iwvAffx iff er qw-915 Y 'f-,'1f'i,flf' W'.,Ui1f1pii' ri' +'4'E43'lN llfkiflZr!mSYf . Wim wif l3fQf.i. 51-lf92: zJ iu.7E'? :Yrfrzitlf Y V gwi'f'fff Wffiif 4 . wsQm2: 2vaQa4q2f+ U K il 4 4 ' ' ' , 1 is 4 ' ? T xx , ,331 1 l , I dxlir f 14.5 Ti mm :L-'a .vu vi 2 L M12 An, , il 'P . ,. . l f? i- H ,,,+,Ar4?4f V 01 5 ,hi ' 'ii i mg E gig ' ' K Q 55.11 ,f fr 15, ' affix 'wwf 4fQ,ag,qm , . if 5' 1: Q. -aging, fu ge5'399f1iQi a - f2f'1f1'2fiii,:?Ff w ig' 5 .ff ' w V xml, as 1 ff 39 ,. i fx' is - an ' '- fiiziiigff 355,56 A ' 51' VW 'f f fab V if 4 'f 'X am' 1 -sm : .L 5. .fl z .N G gh- .Q .-E3 M '. Lg? W 1' , 2 HSE ga YF r R 5,- 1: 3 ' ., ,, ,,k ,ga ,Ks ,uc , X5 f,,,:i., 1 Q , ypihr Qfgevfgtu in u ,S 3 rw' 1' 1 -' . 4 E' M fm , ,.-K Q ' ' , 2 K, A -s u',w13f5,:g:fM , Mfr QM., ,HZ V 1.1 X gr, ffqh . 5?ii5,i?1i !Q iF 951 fm,-QM ' 1' i Mig. 1 gi? 1-f if 1g.125 Mgf '1 .2 qt 1 1 .Q rr - 1' , w vtv 1111. ' -' fx 1 , 7 'TL 'V S ' big Jw x WW v Q 'L I I 'PM ! 52' r B 5 iii V5.5 , .,3 F 5 'W 'EE F ,. -2351 in- if PW ,P 1-1, 1' high l E L Jin gn rf .Q uv we v V' i n in v 51515 1 ig W5 ' N2 P. ., wi 721' 'P 1 J-,in g-V-51 Zami-'5,, , a ,',jl ,fa- l ? f71' 'f .1 x ,' K ,gffgfw-if xv? w 2g!'5Qli1 wwf 511 A ,Q W q, M , E ,, 12 Mess T4 Sem ,, 1 1 VM 5 in I ,q g 'uiWf . FL L1 6' if ' Q 7 M5254 ig l 7 X I H251 ,gi aw I ww I L 1 1g C' ax gl vm. 'Fm 3 wiv. I , , I jx? ' it JL . r, A E ,L 2 ' .11 :gi Q'i,'f'MIfAvF-:fi fi WNW13'5'1i1i1'vh'If?'fIfi V 'fgvQ5i.5 Q 'sQri111:ff:i1Q , KlEX'Q?i'sLf 9' ff'5yvi:fQiQf1i 'Y 4 ?,:f1' ' gym! ' 'R T,lUQ'Eii 'Yr 5 W Wt' IJ Efw qwmk H 1. fu M 1 16, g W '. , .- V 1 : SM y Y. ,, .M S r' ,- -! -- ',uffw,:rw F -'5'Ue.S.',a'2'efLa4 5.,',,,4:gfpr1,5L.-giw Ytaps5,m,5.1,f3f5,.L.--.mi 'vi fw. X HJ M 1 5 25133:51fil1i f 3fG'W?4'54' IE! was ,hr gif 5 -z , L x , --X x '- 4 fb M - '- , A . fu 'UH .Mm L. , f:-1' . vf,,v-4,-ff:-:,3' -'L' -X , .K l . fi' if 5Al??5l55fif.fi.Af1f .. if -1 if Q- F ' w-,L --f' '. ' - L nv.: 13 ,wiki ., ., , 4, 2 ek., . ' . .f ., . 3 , , . ,, Q ai wx-54 s W Q 7' AJ? 4 5 3 ni ,PQ '4 1 . nk? 1 5 gi siggwi, if Ri ? Til3g 4 ' g?415 f'W 5 A . 35 1 sy rg , ff Qi' Him . i if 1 W W . 1? ,A Q H 25+ 4' . f?g5P34f vii ,5 e'a.' 'gg fl 3' ffgfa .wifi LJ g K,51'J'411,9vfI lx! 1 'U if is ' Q ral Tiff ia ggi Lwi QQ swx 9581 llijlqir '23 ,lfif,f'i'T Jigga' X 'si H .y., 1 ll 1 ,354 wp, sa, ,,v',L11 15 qi vs M i, I ww +4 P wx, MMU .xi lu if fagu iq E Igjg7'YfFgiE?.W ,T5,'1FAEg '15, 'Fit gk-MQ f Q , 5 Q , Jil 5:4 3 5 B s, 3 5 3.15-W K 'M f' -f' r M . r 4 ,w'1,,f yy, , P , A fe ,ff QM. 1, V'l'? f,L'Wq .,1:,v 1.pVL15' , , ,4 1 lf :'ffWMk Lf, urzf .m :'13,1w 11 A A :E--iy grgff 1: 1,5-H ,.f if -.rl P , - ' . Pe' , '4,' Af6 u f b is 532 vi' fe. , r '? fl i gf f '4f1M2i1?:7?Egsgl25 '. - X 553 ' 5, ga Q3agu41E'1'ff V 45, 5-wfifag 4 1345516-e' 55u.!EE U we X , ig gs Nfl. ,4 ?Aa1.:f,i, P '. f ' !V if ? .eF: 2r ' f' '-Sf' Z' .EW ' 'f' - - 4' R ,Ms 'f'Ai.il H f .5f5'. fi .' , Y Mi? 1 L gi 1: 5' MW .fw-I v 'W f f 'f lm H Q fi ?i ,. ' j' -'.5'1':LFf at ,A 'H mi' S :J5.f5 ' j' -! If '5 ,,, 3- gg fly rag, ' M w L' - 3, -,fx .45 1 'fi 1 ' 4 fffffin f ,, , .,4' 51 .gy ,, Q - i i Lx,-'41 1- F15-' 3 1 V. ' 2 Q . 'wa' - 'f fr-W . - S 4'u' ?'1 W ' 2:5 x ' - - 4 - . JF Q- . N 'W m le f in , afiiaillggi iii if 232 2. 35599 A J1xp ,ms,. Q . .S Wi g' 1S .Qf '.fiiiA P g v 4,1 f 1 W ' f v ig lr get 5 W .5245 ,I direction '70 1970 Norther, Volume 71 Northern Illinois University Dekalb, Illinois 7 CONTENTS Introduction Special Essay Adrninstration Academics Year-In-Review Campus Life Sports Seniors I I 5 Dircction 70. Therc's no turning back. Apollo ll . . . The age of Aquarius. Napalm . . . An Astroturf Held. And thcrc's no turning back Z3 f f ,Q- 6 1 Q -in .-U-Q' - ' Q' 'Aa I ' . .1 ' 1 ' -2.539 AP- 5 -v f qweaz . A ,mm mm ' ma mf? ak.. 1 M fry. ,,,..-.ff---- ' A -,-,g,,,.,...A,,,.-. 4,-,Mr ,,,,,,-at w 1 L90- VQ5 1' An. ref 51 Xu .ff 'Q' , gs 5 O S ,ff N 5 S bi - mn , 4 ,V bm, S Tear out the arboretum for Montgomery. Give Gilbert to the girls. Gradeless grading and sexless sexes. Progress. Change. ln a new direction. Direction . . . new direction given shape form mass by new intellect thinking old thoughts and labeling them in new directions. Q. hge- W5 'W ',3n, an fx- Q19 W If - Y -K A 'flffl , .JN W, ' Q wq . -A 43. I A . ,V f- - . f Www M 4 4 4. ubsimb Q as 'E' 'Bw-, Y 4 , 4. ne- f A .sgw -pen g' ,, nf uv' wi of 'fu Mp - U '- F3 fr 53 , im, ,.' 1 it eigkgf 5 jdfix s Fifi . Q .v'ie'Qg i Vf Ml E it V 4 A 3 VY , . flair R 1 , I' A .. f . - gl-, v,f.u, rig ' . as-5 'Q . .mqfaqf 1 . Z . , b H -A sg- ig' ' W : f 'sw Y F ,Q - -I 'Q'-gtfkajw in-, 'f - 5 . th' 3' J gp,sf? if . ' 0 L ,A M ,Q ., 1.5 . . ' , 1 'Q . . A +9 , ' ' M U WA . as ---+ Q1 4 . ua 4 an TTA J ,Q M ji 'M 'fy A ' 3'-.. IF ' - . ' ,.wwf4 - ' 1 2 A? V ' e ' ' ' ' 33' Q in V fa, .fm 'L f f , ' ,M . W .v-00 'N ' '-WM, ' .mal-4 1 , A, ,S 1 25' , i M ,. jr' . Q ' wash' A fa AQ Q' lg ,M , Zi . -fr I N V, , S' v what Q L , L 1 I x, . s K X - 9' .n ' 1 ,. 1 'L '1 f3i 'r?? , , - ,, ' iw., Q. 4 -MQ 9, N fmt? N ,, wus uf M.- N., ,ff 13 05' sw 5 gr. L,.,fr 1 E'-'Ra-9 ' f .110 Friday. Thank God it,s Friday! Suitcasers on Greyhound buses and parties at Suburban. The ones who stay 1 'L. S- 'iff-V look for fun ai x rf gig 'wir if .454 42 4, .,,'- ,.. -4 . Kr ' 'fix fi' X , 'Y 5, ,, at 'Jr' -N. .. wm- Q K, Q, 5... X. in a new direction. More of everything - money people the dirty Kish. And there's no turning back Janitors Want more pay. Strike! Let the kids go hungry. Scab. Picket, ln a new direction. M SMX mm sm STEM Keep going . . . going. . . push, drug, rush. Going. Going. Up, ahead, away! In ai new direction. There's a force. It makes motion forward, backwar but moving. Expansion . . . goals. Innovation d, sideways, in place in a new direction. Beauty - eye of beholder. Bricks . . . concrete . . . mud and rain. Old -- seen in a new direction 'WS 3 1, af , W . 1 4 V . ,M AV' 'AM jx! T 11 414, e Fifi sg. 1 Q 1 ' 1 1357 z 11 i X -. 1 4 ,- J ,, M ..f ' fm Wg W m 52 W 24' ' I fp. f, Pot grass LSD. Colors whirl . . . magic world . . . minds bend. Escape - live in a new direction. Rings, chains. Bells and hair. Trends, changes . . . once started thcrc's no turning back affa- , S 'j3','I' ' 'BH' -' Y f , 5. E, -.1 1 - ,, , 4, . 91- - 'f 'AA - 1 Vw .p52,EYMf,5,i,f:,mwf!--Q,f'55,,,,-,myfgg , 2 we x Q W-H-sw 0 I aff: . Qs, r 'C ' 5 F: ws -+1 14,535 ...i ngs :L S- 'Q W 's. ,1 v?w,,.wu ' w we M , .JL ...M .xH-mtg ,sn xvx, k .. . MM 3 ,. ' 1 1 Q 5 Z E Z f waefifgw E ' .. fv-.M.1,', M.n...-H. M...-m.,.J....m-N ...p-....wM 5 2 i , Q .- , ,,. aa 3 , ,, .4 . az -:,33g,51.,,,' 4 x v .5 . Q- 4 Kring 1 1 L- 2 W ,, ,Az ww. 1 'F fu Tummy' is , Q' W 'W 'GWXMJ V Lwislim U ll10lW M. x . wmmmv X-f.,ff,.-, - .. -.... 1 . 41. ,V ' g Q H 'Y 515.21 rl-E41 BLNM 5 ' -I Where are you going? Around . . . around Faster. Aiming in a new direction. Born . . . grow . . . get out fast. Make a place in the world before there is no world. Therels no turning back. Freshman to senior in four short years, maybe. Child to adult in an unreal world and there's no turning back Vr ' mmvnu..,,.-- A K if Va, .- 5 G0 big-time in a five team conference Better teams . . . new coaches . . . more Wins. Play dirty and lose winning. Nice guys always come last. Higher scores and higher scores and there's no turning back Direction 70 - starts with a word . . . ends an idea or a thought or a small step for man a giant step for mankind. Creation - new worlds out of the abyss of old. And thcre's no turning back on a new direction. 2. ' A, 'E rf' Q '06, :fd 1 .4 L-ff.. Tis' . .il Y D uh, S. ' Stix -- ' Tfuff ' '- ' 'Wim .. 'z 'vu' A A' V' 9 - 'bf ,bv jiwf. f V mffl, UV P Q., AA!! v V ' ' A -W1 bwum 1 . ', ,A V Num AA -YA , , A V- .D ,S 9, gA - .A ll , . ' -, ' - - , J., 1 , .J A ' .-A -11. - - f- 3? '-f -if . 9' 4..- 2 ' A' IQ '5i2'? ,Q,'4 ' N- ' aL',, , . in N -.,A:f 4 .. ,LA 'A A Q' -'-...SQ , ' '- ' - ',.', ' .'i,'?: -1 ' 5 '.xA1 , ,- ' ' 'inf-rs, A - v ' ' 'H .-.UA b . -I ' 'Q A -,. .. -,V-. Q , jr. , , n ': Q . U W .Sys . . . ,D .wi Y . V AW'A -'?'- wi'-f . - -'rf' L-if 'P b - ' IJ- ' w. u . swf . A. , . . . rv. fi, I I sig., v ' ar I-,gl .vy ,' 'Q .ir 1 wr.-n ,i A.. 75 Q- 1 4 in ?f'f:gg?. A A N I, TNEQQ gr, fi? A ., 'W WW. -.juz l My A ,id Y ',.' '-A ani.. mfs r ' , - A, A A .- Ai., A gift, A f 1 VA. ,...A. 3 ,T K 54, - 4 ,Agn A ,A ' f .., JG. 4 he A v . Ji x .,1 . ,cf '.s .. 'T' WA 'r 1-N I jg 'AA ,Av 'W ..,u..- JP' . A ,- ' 4 U Ar -'iv r . 1 1' Q. 0, . 0 A-73 X 4 1 4 w,,. r' ' ,V - A X A. --N, . 'ff 4. 4: A . fa-3' Af . -A ' fb' 'firm' A A . 3, Z. W Nhgqgwrwf' V1 ', A1 A qu jq,,I EW W 'U' Y M ,5,A,5M.yfn. M Am , 536 .Nw v Y f 'vue ' 4' - 5 nik, '.- - M1314--1 ' W we f-1 v A 1--Q. ' A gi 7 A l .T q,,: fh ,g4,1:,a . V Q NI' 4, 1 I' ' A, ,.. 'Q yggrgf 4,17 3 -f -QQ ' A .' g ' -2' ' , ffq-f. ia. Ti Q HA 5 f -'wg W4 1 A .- ,. A Aj.. A ' 1 A. ff 1 -L1 iff IL . - , A,,..'A . A , -' .vw 4 -2- A,-A , V up-W , +C ' has' ' Ln- vw ' ... 1. ' 41 a , . F Z L .2 E4 ,Q 5 i sf S ' iT, .za Vg' - a A , 4 ., f A- A' ww MJ- 'A f A ,-A 2, ' FR 1 , f-cf 4, 1 . . 1. ,al-N .,A A ,V w 'S 'Y 'M , Q 'w..f'n J 4 w f . A... -. 14. Nw, 1' A V vw, TA I Y. A X, N - . - -. 'A ' 1 w- N. M A-iv., '- L '--f- fx Q' ,i . A A A AAN. A . ,, is -.., HA., N xg. A . , W 4f,,,4- .Mk +2274 W. 1 v- ., , ., AA - 1 -1, K, , . , -L fa .A ' 5 f' f - 51 ' 4 'ima' - ' I - A ' if ,J f A A gy' x AA - -A A A- -W -, ,,, A. , A A A. A. ,,-, M -- A Q A A A .A , A, ,. V. A . .A AA .A v -- . is A e N .-wif'-A ' A 1 A f 5 ir 7. A :vii if . 'ELL-A., 1 - 1, . 4 '12 'f 4 - -5-77 ' ..... A 5 15194 ' . ' -as tu . 3 - , AA...-vm . ' - 1, f 3, - A3152 .A 4, ,5 1 4' , ' r 'Aww H ' - X 1 'Q,'F.Av V 1 A . ' A .- - H v A A Q ' 1' - Q if-'f 4. ' ' - A A. A X A -v-A K ' 1 ' V LV 1' ws.: H.:'fa?,,' jx.. - M' ' Zin'-F., ,Qf XA M '!'-' 1+ - ., A ' A V .Af ' ' 'U '73 .A 'VW - F I A. -1- N' .- .N 'V ' f A. ' w 'J' . '-5. t A 43' i 'Qf1-,Q M: md ' nv - ' ' - A fliwv- --.A ff ' - 1' -A mln 1, ' ' '- wi- ' ,- ' 1.5:-A ' 'I , ' ' x A -.Q . '-f -' ,f - . . . QQ .- A . A. A ., f, if - A ivy: cz - V .- I 3 ,A F ,JA 1' ff A Lf ' f':- f ' A: A , ' ' Jr ' ,LA J, Q A. K I. . w I a: ,hk 'Y' f A -.. 1, I, I ,N - ,rlM5,Q,E4gAA,-A-., A. -A ,Q .Y 9 A ,X an Q , '-f A A W. , A A A ' I A A, AN M- A JA- . N-1-1--.. W.-J fQ 'W 1 mfg Ag' Mi' of ,, Ar' - -Tv? A-ff' W 'A .,i.,.M.i'L Q' 5 A' Ag A ' V A ' - . ' ' A V ,wejf 4 4 ' ' -' v . -. v J - ' f A .. .H l ' . Q-cf A,-rv. : : '2 ' M' . ' ' W' x J ' ' -,fx vw A- - - A I-A-f,'v 44' I -- ' K' 4, A - -' at - A , 4- ' f vw- . , ,pf ,Af - ' .- -+ A A AA A.. x., . 41' 1 'H f fm 'b if-IA,f 'H11f '1 QA '.++'5 f ?f-An.: fi ' ' W . ' W :A ' . 3 ... ' AA-' 'QA 1' AA' 'f ' .A ,Ai .-5--'f-if A 'A' I .LA ' 'X -..-QM? N- -1 I -- S rue, U M' ' x ' 'L A :'...' - A of X 14 U. ' - . ' , . v , If - f' -' W7 1 'A' Wd- ' bQ:.'frA?Lef'f If V ,EM F A 9' w Mmffffflilflw. ' ' ' A .vm K 1.55737- A. 7 5 1 9 Q7ff i 'Tr1? UNF I3 1 5 ?W'5V THE 1, ' -. 1 5,---' LCDWDEN HALL Z- 1 5 'x 1 'U' Q -' - h ij A H I i'i fr:.a r 1' ' 5 If I X --4-n-1 SPECIAL ESSAY I ' x ,QKKXA A . '-Q 'S WI -N x , A , 1- V , 'j4g1 ',,,,lI.. T - --1,4 .. N- 1--- , ' ., .. ,-4' V, . 32 Va: .I ,up - ,. -, ,, . . ' ' all-' Ui? .' . , sa - . ,Y 4. , . .ff-1. , V, 3... A - ' YA ,: UT sfiwl' ,' . 1. ' Q 1, ,N Y, ' fm '5,, , Univ, T193 - - . .,,. .V 1 'f n' ' ' 1' .. K'ML1nif ff' 1 Q :Lf If If X, : 5 ,P 3 , I MJ I f ,ff -M f , ap , I 1 ,,::'L. f V ix Q h IW' I' V' 'jffv x ki ,Vw 1- Q xg ?x. .M of X y',5N,g'k. X-iifga MWFNMMQJENW X -x iw i. ', fp ii' - '4 1 l 5fXmhf5!' I AQ- :z Nl 1 fy K Yf ENV ' I in 1 My U . 0 I ,- givin .. r -. 2, In . - QQW' 6 X Y v .,f 6 ' 1 V H 1 ' ff Nur? rigid :R ,I I I: , f ,,',,1+'-1, 'Qt ' ' ' - ,,wg,-ffM , I xf S 'L if V X8 X -f' -4 .' A ' X A 7V f f xf' X' 'iff j X 42241 3 , X Xt I ' I My! M 'X , 1' .' -Www ' ,f 1 . A f N Q'ffy'f, ,' 1 Q iiltgfrg-.I x If X , f . 2: 4 ' ,f A fy f , if, ,WL ' 'kk x I , ,Ah xx -I. . I V 11 NX V. f f I W Z f Z S N IM K Mn W N X X Q Q X THE RADICALS ARE SUFFERING FROM A CASE OF THE BLAHS, THE LIBERALS ARE FRUSTRATED AND THERE SEEMS TO BE NO MOVEMENT IN ANY DIRECTION EXCEPT TOWARDS ONESELFY' aw' Tai milf What is the student at Northern Illi- nois University? He has been labeled apathetic, but he made a showing for the moratorium, and he became involved with the janitorial strike. He has been called involved, but while students at thc University of Chicago, UCLA, and other universities across the country become involved in unending demonstrations, he focuses on DeKalb, or his home town. He calls for student spirit, but stays away from the last football game because it is too cold. He is accused of being totally ignorant of issues and problems, but he storms the Carl Sandburg Lecture Hall to hear Doc- tor Spock speak on the right to dissent on those issues. What is the student, Northern Illinois University, 1970? Where is his education taking him? How does the university see him? How does he see the University? DEFINITION: STUDENT - A per- son actively involved in obtaining an education, especially from a school or university, or trade school. DEFINITION: NORTHERN ILLI- NOIS UNIVERSITY - An institution for the obtaining of an education. It has an enrollment of 23,000 graduate and undergraduate students. DEFINITION: STUDENT AT NORTHERN ILLINOIS UNIVERSITY W A part of a Whole . . . an elementary education major . . . lf23,000 of the complex . . . an apathetic being . . . a business major . . . a freshman . . . an involved being . . . a person striving for identity . . . a senior . . . a life seeking direction .... What is a student at Northern Illinois University? He is, statistically, a product of Chicago, its suburbs, and a middle class family. He is the first generation in his family to go to college. HAlthough his parents didn't go to college, they are well educated by the standards of their time, and realize the importance of a college educationj' ac- cording to Dr. Peter Abrams, director of research at Northern. He is looking for hope in the college degree that he seeks - hope that he can be better than what he is now, or hope that he can keep up with the others in his generation, or hope that he will not fall behind the others in his class. He is not a specialist. He is seeking a liberal education. He is Willing to ac- cept anything the world has to offer him. according to Mike McDermott. ombuds- man. He is willing to Work, if only to get ahead of his parent's living standard. According to McDermott. the student at Northern Illinois University is not basically apathetic - he is simply not dedicated to one field, one calling. This lack of dedication keeps him from re- volting. This school is designed to meet the demands of a certain segment of the population. It does not offer a medical school. it does not offer a law school . . . it is not a real science center, it is not a humanities center. So, in etleet, this in- stitution still offers a curriculum that is, in both the best and Worst sense of the concept, a liberal education. 40 V ,wp 'tThis is again because of the growth out of a teacher's college. The student who comes here is not a specialist, and not particularly motivated to become a professional. He is, in effect, not orien- tated to a particular career when he gets here. And the university, at that point, does not force him into any vocation. So, a lot of what we call apathy is indecision on the part of the student. Because the student is not particularly oriented on his arrival, he does not have a preconceived notion of what his educa- tion should be offering him, McDermott believes. And so, he does not rebel. A t,, t - A 'ir I ,io- A student becomes more easily radi- calized if he has a real impression of what he is going to get from his education. If he really had a definite idea of Where he was going, and when he got to the uni- versity he found that he was not getting what he hoped, then he would rebelf' Mc- Dermott commented. x ,M - X - -A ,i1'-igiwhggiy 'LS . wks Aish , - K X XX X ., wx. - 5 f.,mf,, - Q K. ,B ix g Y ,ggqffia 5 -Is: s -'-k H' ,SKK :W Q is Q X X X A x . X -.Q . x k 2 H? X ilk Wbkf Nb X X X N 2:2 , . S + is . X- K Because the student at NIU doesn't have this preconceived notion of where hc is going, he is more open to acceptance of what is offered him. He is Willing to take what is given, because it seems to further his nebulous goal of getting ahead. So, according to McDermott. the stu- dent at NIU - because he is grateful for any education - is nonreactionary. He accepts. maybe with some murmured complaint, and feels that what he gaining is of use. He has to feel this, of he would be dissatisfied. Dr. Abrams sees another reason for the so-called apathy among NIU stu- dents. According to Abrams, there are two types of students who rebel - those who are the academic radicals, and the student who is not smart. and comes to college as an escape. 1 K ' 3 . Q XX K Q . ,EQ -- is K- -ts. L. K 'Mfg' if 1:25-Ei .' ' . ,ZflQ?Z:'?:Z 5 1 Nfi .SEN ' oiee 'i 2 T5 N NN s .W t it W SX is Q' 'Q 'xi- , rr s , :,. :-,. , ,E N i s as r . zkflaf '35 sag r12:::s:f:.,' W ,it - :st - Nu i.-Q s The academic radical is often very rich - his father is a professional - and he is often very intelligent. He does not have to worry about being expelled from school because he has the funds and the intelligence to get into another university. At the other end is the student who doesn't know any better than to rebel - he really doesn't care what will happen if he i-s expelled, because his education is basically unimportant to him. 47 qw:-f The student at Northern, according to Abrams, is in the middle. He has all to lose, Abrams explained. He cares about his education, and he values it, so, al- though he is intelligent enough to see where reform is needed, he either looks for accepted channels of rebellion, or else pushes the issue to the point where he is personally endangered, and then backs off. So he ends up looking apathetic, but it is because he is being practical about his college education. -D-+ K SQQQNX sm 4-,'Ml'Ks!3s.'YNk es. The moratorium briefly kindled ex- citement in some of the students. About 250 students banded together to go to Washington for the November 15 observ- ance of the moratorium. And the October - and first - moratorium was observed with a multitude of speeches, panel dis- cussions, and a walk-in on the Delfalb draft board. But the spirit was short- lived, and between the observances, the black arm bands disappeared, and no effort was made to keep up the mood. NWA, ff , ff .sg tis 'YH fi M 'Z 4 if 'fa M 'iw Wx, ,:1V'7 Qffiw 1 w-wks.-M A...:., X355 The school could be a little warmer. I think itls striving to get that way - the people, the professors, even the adminis- tration. I think we need something like a winning football team to pull us to- gether with school spirit. In four or five years we should be ready to go out and take on everybody, a junior boy re- marked. But most of the comments rellected the same thought - It's close to home . . . it's near Chicago . . . you can get away from the campus if you want, and get into the city . . . it's a good education . . . and inexpensive . . . I could not afford a pri- vate school, and Northern's as good as any state school I guess .... 'Q-. 4' Perhaps the student is, as McDermott suggests. indeeisive, and grasping for anything to make his plight better. Or maybe. as Abrams believes. they are too concerned with their own welfare, and too worried about losing the tenuous grasp that they have on a new future - a new hope - too cautious to take the chance on becoming involved. L W, ,wmv ,,.,, f f R 57' 'HFNHODL 1 55 'iff ,M ,mv-m,, V ...L WMIWNOUI' ' YUM wx ,W M 'umm munwlb' mxmmxuzkw W 'NYM NNW wx! Y x www wx NX Www Www, 'mmxxxx wx' K ' - Y vffk i ' NWN? - X . K Xxx K N Qxxxi-mx. K h X ' xx x wx X x Xfglibx X fl Y ' Q 54' vi. ' ,Qi w ,I , I 4 ,A ,f 1 v 11 1 NMI WNMNI W Nw R XX Y Y , , X. W 'L MJxjXNXX N xxx X ff7'Z Q?Q2Q12:E,f'ffQf,ff - g x . 1 4222 if '54 '11 454 54142, ff 7 X X W.. ffffmfigf Q. QW, ,,, f . X X yf egg, x X 21, 2 ff S-SQ Jig 'EE' ' QV 1, 'if if 21: 1 2 224 p, X, , fn, ,1,fi4f, f 'V 'i 2'1f L52 1 -'f:7k?,4 Z ' ff f 'fp fffffn f'4:4 f 'X ,f 'ff f nfjfffg? , 4, . Q. 2 ,,f?,,:?ai A AM., , , vzfgeuf 4 Q74 - 65? 13 ,5ff2:f,,Vjf X .f 424 ez: .,, 4, , fffaay ' f ff 7421, 144 f f fzvz, ff Qf: 1 ZWZQ4 ez , 1, 251 112524 , ff '2:fZff 4 ' fzpf' .4 1, Qi X' , ' E . ' ? E 2 i --Vb 'I if fi: ,Aff 1 f ., .,,Qf,,Q, X gn., if x ..f':J vf' f 2 f ,3 4. :Q ff 1 , , 4' f 1 fzi ' f Z , Z 4a . 31 rss Q YVVY X Z The studcnt at NIU -0- what is hc? Hu is l,f23,000 of thc complex . . . un apathetic, hzlrricd, involved, grasping l 23,000 . . . and hc is looking toward his future with searching cycs to find somcthing bcttcr than what hc has today. Hc is searching, and NIU is thc object of his pcrusul. Docs it fulfill his nccds? Does he live up to its possibilities? .. A 15751, 31,12-I, I r 1 Y-1 L . .5 A if Y X n - ' A ,4wk f,wi' 'K 4 F .' R f 4 fm , ,4p+-Jxinfx f:f. Lf I 5 f' . ' 'Nf ,- '1'1- 4-1' ll. 1 S V , D -:i ' fi?-,E-'.f?7' x: X-,XJ ff: ,il 'A E Y .7 f 'JW ' ' . xv , I - 'YL 115-- ' 9 ' ., .4 . ' af TQ, Q 5 , . . 0 TQ: -' ' ' wif To iff! A1 1' 1 uf ,' j B ' :Nl 1. -b-23. Un, 5 U 43 ' my - ' H- -- 1 H.-L., . , my '. , A :A- ,Hq'- .A-.r :Aa f 16 Q 4 4-'ak 4'- Je Q - - ' 1 4 LJ I. If Y, I 1 Y, N' A. .xx li I I . x X 190 gg! 11,2-l:3.g, 3 X .AIV :xi f x. - - ,fwhihl 1' ,- I fini . 'xq 1: In , K llilq N 1 If .A . M I . x. If 4 3.5, VI, ' A ,. K+, ffgi .,'l gg, ' P A X: L' ',,l,2r,F ,fi 1 If . LQ? . .WA V..'l,:,' , ' muh V Vq,L,,,,.- f 1: ' .k px fv,5'fg!f,5 1 A' rx -,..'i ig: J: 4Q ...sw a ' .Xl bf ri A ,,W U , .Q NN . 1 wx X--X. -,wwfl f 4 A . Xt,- Fx .. w. ' , M - ,R+ 1 'N , 9 N T15 Af, Hall .451 .cl ' - QQ! SMX?-'N F651 i s b U A x'1 4 - .,v-w e f f Fifla vi L 5 I !,f-M :.- 4 -ex? If , .J ,, X8 , ' Irffe X 'C' AJ n 71 I f' HTA- V,' f' -2-' Q - - :N A -vi- , 91 'v. 'i ' ' 'ff r, G,r?:X19' 57 President Rhoten A. S President Smith feels that in order for a university to grow and develop suc- cessfully, the administration must plan according to the Heharaeterl' of the insti- tution. Smith, now in his third year of service at the university, has done much to develop Northern's ueharaeterf, When I lirst came here,', he said, I had an ambition that if I ever became president of anything, I would certainly try to establish some type of program for racial justicef, The result of this ambition is Northernls CHANCE Program, Com- plete Help and Assistance Necessary for College Education, initiated in the spring of 1969. 'iOf course, the black students became interested in it, Smith said, uso, out of discussions with them and Working with them we set up the whole program. It is something that is of great interest to 37 me. For such a plan to be successful certain changes in attitude in the community must come about, according to Smith. With as many people as you have in- volved, Smith said, Hthere can be no doubt that there is prejudice in America. So, I feel that the solution to the desper- ate problem of race relations lies in a change in attitudes, primarily in the Whites, a change which cannot be legis- lated or decreed by anyone? Presizlenf Smillz grlmrzees wlzlle faking lime 0111 from l1i.v lmry sclzetlule of acririries to aet as referee for tlze Lire and Learn football game lielzl at Grant Towers North Residence Hall. 58 , a 3, V, ,, f 'G 4 1 ff,, I 'nuuw...,.,.,.,,,, 7 I lZrs0Wl.y ' Smith aids NlU's growthg physical and academic. Northern is in Phase ll of the Master Plan for the state set up by the Illinois Board of Higher Education. It is antici- pated that our enrollment at the freshman and sophomore level will not grow after next year, Smith said. This will be our quota and will remain the same. Our future growth will come at the junior-senior level. ttThe masters degree level is the fastest growing academic level at Northern. However. the largest future growth will prob- ably be on the doctoral level, said Smith, 'tparticularly in Liberal Arts and Sciences. When asked about housing problems. present and future. Smith said with a laugh, That's a good questiong a question that most institutions never gave much thought to in years pastf, Northern is coordinating its housing plans with the Greek sys- tem and the community at large. Steps have already been taken in this directionfi Smith said. This has been the first year we really have been confronted with a housing problem. Smith is deeply dedicated to student involvement in matters of student concern. We haven't seen a radical student govern- ment in the past two years, Smith said. The last three admini- strators have tried to be far more sensitive to student interests and encourage interest on the part of studentsf, Smith feels that real progress has been seen in student government and a deeper involvement of students in those matters which concern their lives will continue to grow and spread. l'l'e.s'izlelit Rl10tc'r1 A. Smith fll.YC'llSSC'.S' policy with the Ullll'C'l'.X'llj' C0lllIL'll. iXr0l'Illl'l'lI'.Y f'lllIll'l' is f7lI1IIlI!'ll in relation lo Ilia' 1'1'q1lirc'niwz1.i' of Ilia Wins- ICI' Plan for liigliw' ezlucution in 1111ii't'r'.vfIic'.i' llII'UHtL'lI0llI Xfzllt' of Illiliois. 60 , ,, ff Q ,- Ay PW A W in Ta E X il -i la aff? llgpww - M 7' .--unl ' sive Administrators frame NlU's future We are definitely experiencing grow- ing pains here at Northernf' said John B. Gardner, assistant to President Smith. 'fWe are building our future plans around the ever-growing problems that arise. The most pressing problem is enroll- mentj, said Gardner. At present the ad- ministration is considering halting the freshman and sophomore admission at the level reached in the 1970-71 school year, resulting in a larger percentage of upperclassmen. To accommodate these students the administration is working toward the establishment of more and im- proved Ph.D programs. f'Nearly every de- partment is working to establish a Ph.D. program or improve the program already in use, said Gardner, citing examples in fields of mathematics and sociology and many others. 'LA rapidly growing number of students are entering the field of art, and the high school graduates entering the 'hard sci- ences,' such as physics and chemistry, is steadily declining, said Gardner. He feels that the reason for such changes may be based on the changes in todayas society. In the sciences, requirements are contin- ually becoming more diflicult. Whatever the reasonf, said Gardner, today's uni- versity must be prepared to adapt itself to these changes. Enrollment swells and faculty must grow as well. f'However,,' said Gardner, it is extremely difficult to predict just where students will settle. Departments cannot be accurately assured of the num- ber of students they will have and thus the number of faculty members needed? To accommodate students flocking to the university, a greater amount of hous- ing is needed, both on campus and off. New dormitories, said Gardner, can be built, but we cannot be assured of suf- ficient off campus housing facilities. It takes time for the people in the surround- ing area to react to the needs of a campus growing at the rate Northern is? Above: John B. Gardner Assistant I0 the President. HCHANCE is an opportunity, said McKinley HDcacon Davis, head of CHANCE and administrative assistant to the vice-president of Student Personnel Services. Formerly the director of Rock- ford's Booker T. Washington Commu- nity Center, he was appointed in l968 to recruit for the program and for counsel- ing of those students already enrolled and on campus. A translation of CHANCE is Complete Help and Assistance Necessary for a Col- lege Education. We are seeking to raise the aspirations and the expectations of students from the ghetto who have been victims of problems of education and en- vironmentj' said Davis. He continued to say that because of the increased demand for students to attend college and the overcrowded conditions in most colleges and universities, higher 'iw requirements are being made. By raising requirements, we have created a larger gap between those benefiting from a top quality high school education and those termed below par. ln effect, what we are doing is screening out those students in most need of educational opportunity. Davis continued, MThe CHANCE Pro- gram takes a more humanistic and personalized approach in determining stu- dents with college potentialf' McKinley QDeac0nJ Davis Administrative Assistant 1 X ,ala ,f f CHA CE Program opens opportunity. As Head Counselor for Special Pro- pects, Jerald Durley is working with re- cruitment and on-campus counseling for CHANCE. Enrolling at NIU in 1967 after returning as a Peace Corpsman in the Biafra Area of Nigeria, Durley brought an interest in racial injustice to NIU. While completing work for his mas- ter's degree in the field of community health, Durley became part of a student group that worked closely with President Smith to focus on the problem. Durley hopes to avoid a static counsel- or-student relationship in his job. To help the disadvantaged student adjust, his of- fice is set up on an academic-social at- mosphere. He urges the student to come to him with any problems, whether aca- demic or social or just to talk. A special week of freshman orienta- tion is held in June for all incoming stu- dents in the program. We tell all of them the hard, cruel facts rather than paint a rose-colored picture, said Durley. We don't stress the concept of finishing school in four yearsg very few do, he said. 'fThe important thing is that the student has obtained a degreef, Once students do obtain a degree, Durley hopes that they will go back to their community and help alleviate the social ills of these underpriv- ileged areas. Durley hopes the students will grow toward self-realization through talks be- tween persons with similar backgrounds. He cited the case of the first black stu- dent to seek help. Being confused by registration procedures, the student came to Durley's ofiice. '4At least, if you could not help me, I found someone to listen? Jerry Durley intcfrjects thc' personal touch 'into coimseling. Ht' L'l1C0llI'lIAL'l'.l' studerzts to come with any prolrlenzs they may encounter. The coimselors will!! I0 instill black pride by pro- moting black orgruzizaliozzs, 64 2 M., is 1, Top: Ernest E. Harxmzz, vice pr'e.vider1I, Student Pcmorzzzel Services. Middle: Fnlrzcis R. Gvigle, aYvc'IrIivc' vice prUsia'w1I. Above: Rich- ard J. Smillz, vice prv.vizlc'11I, li1l.x'if16S.S AUllfl'S. Left: Paul BIIIYIIUSS, acting lzvuzl, College of Liberal Arfs and Sciences. 65 Dir. of Regionzzi Services William F1'00111. Right: Azl11zi11istr11ti1'0 Sludent Dean Keith McD01z11Ic1'. my Above' Donald E. HeiI11zz111 works claw with .s'I11dc'11ts as adviser Io Sflllllellf ucrtivilies. Right: Harrzlzl E. Hum 11.S'sist.s' Illc' IIICII of A!0I'liICl'll Illilmis IJ11i1'l'l'.S'fI-V S0I'l'iIIIL' u.s'Der111 of Men. 66 lima K 's.-, R T ,.. qseaggx 3 ,f Q 3 5 i 1- f! ' f 7 2 ui 1 3 , ' 532 4,-a wx! QU jx X . K X 'RN if 5 Lf if .P fr, . A r- ff ' 'ff' fj'if'l is r 'ailx ,fin ax 4 ,I 3' 'v 'vc W 5 a , 4, 41 H .V L Qi Goal of Deans: student service . HI am a dreamer, said Dean of Wom- en Ruth Haddock. nl would like to see and meet with everyone. This office was the original Ombudsman, continued the Dean. The original role of the Dean of Women's ofiice was that of trouble shoot- er, mediator, and liason for the women students. She feels that as long as Northern is a coeducational school. a feminine influence is needed. The office is open at all times and Welcomes any and every woman student to visit. Dean Haddock expressed a concern for the bad image that sometimes goes along with the Dean's office. 'LOne is never proud to have been called in to see a Dean, she said. Hlnstead, there is a 'What did you do' attitude which stands in the Way of more students using this of- fice more freely. Students are afraid of us and they really shouldn't be,', she con- tinued. If students were more aware that the dean is the guardian of records and the promoter of strengths, more students would use this ofiicefi Dean Haddock 68 continued hopefully. The students of today are more ambi- tious and idealisticjl she said. 'fOn the whole they seem to be more academic, more mature and more sophisticated than the students of the past. the Dean said. HWe have had a good foundationf' she added. uThe university of today stands on the shoulders of the past. It is our good foundation that makes this university what it is today, she said. Dean Haddock feels student sophistica- tion is reflected by the number of students leaving for home on the weekends. g'Stu- dents underestimate the campus if they think there is nothing to do. While the city does have more to offer, the student can hnd much to do right here. The more aca- demic stay on campus, using their extra time to study or ponder in the libraries or the laboratories. ln addition to her counseling duties, Dean Haddock is sponsor of the Asso- ciated Women Students CAWSJ, and Plei- ades, an honorary for the senior girls. t Q l I l I Top left: Dean Ruth Haddock. Top right: Dean Wexflluzzl. Above: Assistzlzif Dean Mfllj' Millel'. H .ir ,V .,. Q ik - .1 WN Y., '-v- .X as 'Wu-fP'f7S.a i N' sf W 2 'Q A , ., . at R Qfhi ,lk Xi u Q I :R itll vw-5, x. in ...W , - .'B.n'q,,...: J., X ., fl: Q kv'-:wi Mfr- H ,, 1 - . t Q.-. Am . ., K if ya x we Nw'-gm Top: Dean Boy Collier. Above: Asif. Deniz Robert Karabifzus. Right: AXSYI.DUIHI.lf11I7U.S'Pfl'l'SOH. f'The purpose of the Dean of Men is to provide a source of information to the students. not to be a disciplinary courtj' explained Dean Boy Collier. He expressed a great concern for Northern's student body, and the hope of definite changes in the relationship between his office and students. 'fThe judiciary aspect should be moved out of the Dean's ofiicej' accord- ing to Collier, Hand placed in the appro- priate handsf, he added. Collier stressed the helping, function of his ofiice as opposed to the popular counseling concept. 'fWe especially Want to help freshman, he said. 'fFreshmen often find themselves in need of help by the end of their first year, he said. f'The Dean's office is available to aid these stu- dents in overcoming their problems whether they are administrative, academic or financial in nature, he said. Dean Collierls hopes for the future in- clude an overall revamping of the stu- dentfs understanding and use of the ser- vice provided by this ofiice. He feels as more and more students come to use the Dean's ofiice, an overall student image of the Dean's function will be more clear- ly understood and appreciated. f'We Want to overcome the ogre image that has come to be associated with this office and hope those who are in need of help will feel more secure in asking for it, the dean said. Dean Collier. in addition to his ofiice duties, is lnterfraternity Council sponsor. One little known service of the Dean's ofiice is in regard to veterans at NIU. f'All G.I. benefits are handled through this office as well as aid to dependents of de- ceased veteransf' Dean Collier said. ffAssistance with transfers, withdrawals, and reinstatements is also providedf' 69 raw' a f Security Office fosters friendly relations toward NIU students The major change in the Security Police department ex- pressed by James Elliot, acting head of the department, is, the emphasis on a personal relationship between students, faculty and the police. There has always been a wall between the police and the community. There -is now a trend toward a feeling of friendship that has been most beneficial, remarked Mr. Elliot. 'There isn't the same hostility which was present a few years ago? He added, We are now seeking a higher caliber of men with a proper attitude when working with studentsf' f'The Security Office, through experience, has found that the old standard is not always the right way, stated Mr. Elliot when questioned about panty raids. Two years ago police left their cars to disperse crowds of raiding male students. Now the secur- ity force only follows making sure things donit get out of handf' he said. He felt this policy was a result of the University growth and of its going ubig time. The Security Office has different departments including a newly created motor vehicle division headed by Lt. Paul Leif- heit, a patrol division is headed by Lt. Jerry N. Busby and Sgt. Kenneth Kaiser heads the investigation division. f'Students also make up part of this oiiicef, continued Elliot, We feel that having the students in our office further exemplifies the em- phasis on a friendly relationship. Right: James Elliot, Director of Northern Illinois University Security and Safety. Above: An NIU policemartcwzdidly converses witlzastudent. 70 l , twwzas ,aid an-:G ' an Q . ' T? 2 I ,J ' A 'ii ,M 'Z' H-. fi 5 V f I' 'Y o 3 . 451 3 W W V R if.: Q' ' V . Eiyxm Below left R0be1tBuclzanan supenzses all Ilze acmzms of dormlloly food seruce Below EllgClZl8 Walkel lzeadv the zntcgml 0H?ce of student admissions, x,.,...-45115 H f F T'r j,.- ,Q ,.,, W-f bw , l V, ' ' 7' W P H Left Rccd Arzdrac lzcad of Unuezszty auxzlzary Services talks of his povmon Above P0141 Af1Ff!lIlXllIlC'CfS'fl1C' Ummelszry Research Bureau, N. xg V Y. ,ie X ? k in 1 H0 2 f gg L M ,J ,K its . wi? A 4 . pw Q 51? W iii? Q Student Health Center seeks improvements on many levels Our aim is to improve health, physically and emotionally in a growing community, said Dr. Harold C. Wright, acting head of the university Health Center. Wright feels the primary responsibility of the director of the Health Services is to work with other administrators and make them aware of what problems may develop in the future. This is a constant problemf' said Wright, It involves the Stu- dent Personnel Services, the Business Affairs and Budget depart- ments as well as the Health Center. Through the use of com- puter services on a statistical basis, the Health Center is able to project what problems may arise, and what aid from other ad- ministrators may be required to cope with these problems. Wright feels they are able to calculate the future fairly accurately, for a live year period. In regard to the Mental Health Unit recently established by clinical psychologist Hugh Weiner, Wright feels that an ever increasing number of students are taking advantage of this ser- vice. University people seem to have enough insight to realize that they need help with emotional problemsj' according to Wright. Particularly young people, students, who realize that this help can be utilized to effectuate their goals in life. At present the Mental Health Unit consists of a team of a psychologist and a psychiatrist. mln the future we hope to ex- pand this team to include a psychiatric social workerj' Wright added. Other facilities available to students include the Coun- seling department, which has several clinical psychologists on its staff, and the Health Clinic in the College of Education. Right: Har01zl C, Wright, uclizzy direcmr of the Healrlz Services, works on future 110111111 problems. Below: Stu4lr'n1.x' await concisr' clizzgnosis. 74 Top: Clyde C. Wfzllon, director of Iiblurivs, coordirmms library flzlzcfions. Below: Kfzflzcfrirw Walker, c1.s'.x'i.s'm1zt lUl'C'CIOI' of libraries, works to inzprarv library .x'z'l'vices for SflldClIf.S'. ln orthern students choose Top Teachers Quality breeds quality. With dedi- cated and interested teachers the out- standing capabilities of students can be brought to light. For it is only those teachers who have that special some- thing, who are able to instill in the stu- dents an interest in the subject matter he is teaching. A panel comprised of NIU student and teacher representatives chose three educators they felt best exemplify excellence in teaching. In recognition for their line teaching, Drs. Arnold Fox, and Edward Herbert of the English depart- ment and Dr. Edward Harris of the Busi- ness Education department each received a grant of one thousand dollars and a cita- tion. The grants and citations are awarded by the Standard Oil Foundation. For the first time since the programls initiation four years ago, two of the awards went to representatives in the same area, the Eng- lish department. The distinguished three have a com- bined service record of thirty-two years of service at the university. Dr. Arnold Fox has been a part of Northern's faculty since 1955. Before coming to Northern he taught at Chicago City College, Bowling Green State Uni- versity, University of Iowa and Rutgers University. Presently, Dr. Fox is serving as the Director of Undergraduate Studies in the English departmant. He is also a member of the Modern Language Asso- ciation and the American Association of Below: Dr. Arnold Fox, director of English undergraduate studies, discusses the curriculum. .- Z HN. Nw' 76 University Professors. Dr. Fox has taught courses in Victorian poetry and the works of Wordsworth and Coleridge. Dr. Edward Herbert, a past recipient of a Fulbright Grant for study in Europe and a post-doctoral fellowship at the Uni- versity of California, presently teaches courses in Shakespeare and modern drama. He has authored several articles on the teaching of poetry and on Eugene O'Nei11. Dr. Herbert came to Northern in 1957 after teaching at the School for the Royal Princesses in the Netherlands, and Duquesne University in Pennsylvania. Dr. Harris joined the Business faculty in 1963 after eight years of teaching and administrative work in the Davenport, Iowa school system. Dr. Harris has been a frequent speaker at national, regional and state conferences on business educa- tion and has himself received six awards from the Distributive Education Clubs of America throughout the past nine years. He has authored a high school retailing text and has plans to publish a work on the subject of marketing research. Dr. Harris has taught courses in the Held of oilice and distributive education and has served as supervisor for student teachers in Business. These three men are dedicated. They are interested. Their service to their stu- dents and their school has been recog- nized, and the tradition of quality will be carried on by them. Right: Dr. Edward Harris, Business Education and below, Dr. Edward Herbert, English, pause. e 1-. I Mt , I .lr Ski? , '55 is--if Excellence in teaching was described by a United States president as a log with Mark Hopkins on one end and a student on the other. The ideas of President Gar- field are applicable to our own ideas at Northern. Students and teachers here all have their own opinions as to what makes the tLexcellent teacher. Jim Chestnut, Student Association president, sees an excellent teacher as one who takes an active interest in sub- ject material and his students. He feels the teacher should take an active interest in affairs outside of the classroom. He should be willing to take time to sit down with students whenever they want. Dr. Richard Bowers, vice president and provost said an excellent teacher Hhas to exhibit dedication to scholarship. The teacher must be stimulating and cannot divorce himself from his studentsf, Northern's Graduate School Dean, Wayne Mcllrath said 'tthe best way to judge a teacher is to have his 'product' view him with hindsight, Dr. Robert Topp, College of Education dean, noted an excellent teacher 'tdoes not expect students to teach themselvesf, Laura Willer. co-chairman of a publi- cation evaluating teachers at NIU said uAn excellent teacher is one who is well organized, a good lecturer, and relevantf' Left and below: Dr. Edward Harris, Dr. Ed- ward Herbert and Dr. Arnold Fox. pa Program expansion goes International f'We deal mainly with Summer Foreign Study Programs, said Dr. Orville Baker in describing the function of the Foreign Study Office. HUniversities are selected for the program on the basis of cost, qual- ity, and their ability to meet the needs of students at NIU, he explained. The office presently is associated with Loyola University in Rome, University of Illinois in France, New York University in Madrid, and Wayne University in Ger- many. In addition to its work with the summer study program, the Office of For- eign Studies coordinates the Alien Faculty Committee, and the Junior Year Abroad. The entire office comes under the con- trol of the Office of International Pro- grams and is responsible to that office. t'To qualify for the Junior Year Abroad Program, a student must have a working knowledge of a foreign language and a 3.0 overall grade point averagef' Dr. Baker said. UA student Wishing to be in- volved in the program applies directly to me, and then is given forms for depart- ment approvalf' he added. ffWe'd like the participating students to talk with others about their experiences abroad, he said. Right: Dr. Wit, Head of Inlernatiozml Programs O1?'ice. Below: Dr. Baker, Foreign Sindy Obfice. 9551- 15 ,t. gi ...K Q :Vu 3, 5 .. ....f1'. 4 as NVE! fb. ,kiosk .- xvlxgw iH,::Xv' g wg Y fx' A in iik tx ,.. 'fa ..1'e f it . eees fwfr-c1952 s 1 su ' j o . I . .f,s'NQ- Walkin---. ' if' 'Y ' Q nl S 4 :wi .Av .x. K .1 51. Northern is slowly becoming involved in progress outside of the university com- munity, and through this office we do what we can to build a better NIU, said Dr. Daniel Wit in describing the newly formed Ofiice of International Programs. He felt expansion should not be limited to a particular department or to an iso- lated group of individual students. In the past our programs have been limited to a summer study program. We are presently working toward the goal of developing an academic year program in terms of inter- national education, Dr. Wit continued. f'This will give the student an opportunity for a more in-depth study approach and greater application of the things they have learned? Significant educational opportunity will be offered to a greater number of stu- dents at all levelsf, he said. We will be looking for schools that complement and supplement the things we offer at NIUQ' he added. Again he stressed the fact that this type of program will yield a well rounded student. Dr. Wit's function as head of the Office of International Programs is not only one of supervision, but of control as well. The office coordinates the activities of the For- eign Studies Ofiice and the Southeast Asian Studies Center. In his own words, Dr. Wit is responsible for the develop- ment of our international activities. What I would like to see,'l he said, is selected Northern students in all parts of the world. Before coming to Northern in 1961, Dr. Wit served on the faculties of several Big Ten Universities including the Uni- versity of Michigan, Ohio State Univer- sity, and Indiana University. He has held government positions in Washington and has lived in both Europe and Asia. He also initiated the Southeast Asian Studies Program, now in its second year of operation at NIU. He received his bachelor's degree from Union College and his master's and doc- torate from Princeton. Dr. Wit also has worked on a United States technical assistance program in Thailand. He served as a Fulbright pro- fessor at the Hague. While at Northern he has served for eight years as department chairman in the Political Science Department. Below: Dr. Orville Baker, Coordinator of NIU's Foreign Studies, pauses informally to comment. One student who's talking about his experiences is Enrique Barrios, sophomore exchange student from Mexico. The thing I was most impressed with was the dorms,', said Enrique. 'fNone of the universities at home have them. If a student is living away from home he lives with a Mexican familyf' he added. f'There are a lot more girls here than you'd find in a Mexican univer- sity, too. At home the boys study, the girls keep house. Enrique was born in a small suburb of Mexico City and is one of nine children. Hels an avid sports fan. Throughout gram- mar and high school he was a member of the baseball and soc- cer teams. HMy big thrill was winning the league championship at La Instituto Nacional de la .luventud Mexicana. We lost only one game in the tournament, but wouldn't you know, it was the one that I pitchedf' he said. While college life has posed some problems for Enrique, life in America is not so strange. In January of 1967 he entered McMahon School in Norwalk, Connecticut. 'fMy father decided that my brother or I would attend high school in the United States. Being raised in California, he was anxious for us to learn the ways of Americans. He thought the experience of an American education and being financially independent would be worthwhile. My brother wanted to stay in Mexico so I was elected to go. It was very hard at first. I was not used to Working and going to school at the same time. My first home Was the YMCA. After that I was fortunate enough to find a family with a room that they wanted to rent to mef' he added. He completed high school in Connecticut and was accepted at the University of the Americas and the University of Connec- ticut. I was lonesome for my family. After being one of nine, it's hard to get used .to being alonef' he added. I chose business management as a major and psychology as a minor. I'm taking the same courses at Northern as I would at home. The one difference is greater specialization here? The weather has posed some problems for this exchange student. mln Mexico, where I lived, it never snowed. This cold Weather is really something to get used to,', he said. TB.. : 1. .. 'v. - 4- -'.L.I..- ..-,P ' ' - 'f'f'fw:1figa f -95,91 , . , 4, A. , , fa-.. if 5,3 I aku f N' -1' F' we l :Z 4 'M -F1 ff U .. H .Eli -3 1 'ff' .ax I QL Qsififfl? 'sz-i 4- AQ--' ' . , ,.f ' . - -, wif,- . ,f . 'si' l' 1. ,- - 5 f' . ,- P ISI' 4,2 lg 1 59 .ff , -L2 2 -' ' 'IA ,inf JK? 'AMX f - ' ' 5 If-- I' ,,f' 1 . A ' il H I i MILF ' i SMX ....-L , z , 4 xx ,ly '- ' lg l-Q Q ' Y-1 .' rx Ry , I , its 'p ,-,:-iff-' J. ' ' K ' Jug. ' Nfl y c , Q' X :mf-' I' Af 1'Y ff , : v ' :ul gal x- 5 .X-4-N. .,., ,,, 1 ... i L , .f .. , - . it , - 1 tg-.1 1, iz. ,U--, I va ,Q niq- 53117. fn 5' ,at.'f, '2'?ff'.Ta,I 4.1 - LAP, ' 3z1v,?Ut-3g,g!f!IV1..i'. , - wing- -. .4 A!:v,1u: :t,.n:.g,l:, .l.., ,, ,. ' '- 12.56-:, , Q !n-.,3z? . .. .favs .:f.-...Q 5. ' ' xffi -X 14 Q, . J t nw LOWDEN EEE' 4-'1 fi .glij Q1 .. . -ya r'-A .LV ' . .w- I l ' V -Q-vf, I A U ,xgl ,vi . ills, H- --V ff' I gf ' W I. i HALL 'x l-:f'r:sf , I NW ax N. 'Q -Ns.. 'Jr ' 54. -N vt A te' l ,N . ' 11 Vw ' ' V nl I -Jgg. vf ,s' .,,, , g COLLEGES liberal arts and sciences ..... .... fine and applied arts .... .,.... 1 02 82 education .................. ...... 1 08 business ...........i... ...... l 20 graduate school ..... ...... l28 132 summer school .......,.... ...... continuing education ..... ...... l 3 6 research ...................... ...... l 40 I . I, 3 '-'d'14L .. sr- . .., W1 , ..---H , , Y, 1' so K ,K I H. .v ' . .gli 4 fs- H V '- lh'..'..., 1 - 4 ,, - 14 . , vw uf' , , v A .- , vv ' . . f: fy... 1, ,r I 'ix Q' I ' V... Q i at 5 ,455 'X J. rise 6,51- . -y'F vi' 1 W' ,f 5 l,.,f I. i I. 1 V .f ff , ,gf , '91 ' S. ff 2117. A X' , ' Q r f' - . 'yi V' bv 1, i' N, 1 XI' 1 .5 '.-- ' gl, -,,. ' I ' 1- '-.- :igqfgliv ' . . L -N .- fi I , ,I v. X ' L!! yr, Z., gi -rlr V ,V -fum P .I 1' V,-'flm Y I xillx- l ' , 4 ' . . I ','-' YQ!!-if '1,.T6,-',.j. .LZ ' I fr . 1 L X' 'g , H -,5 n X ' J Q '. I ' ' m N1 MVK '- 1 f: 'f 4-I -' ,A f , ' ., J-. CX X wi 'X wg ww my X 1 x X f 1 Xw W2f'1 'l xr A gl xl xuf X ff 1 ,I If -, ' H '- : I? Qx X Q 'V+ ,4f1wa+' ,XI ' jf. Q yay-Q Qv yfxj H R , ', , I 1. gm, 'ill-17 b . 'V 1 1 A , .1 M F!! SVI ' P' fr' Y ' 4 f ,Ing Xe ! 1 I N 'J 2' V I N86 X .,f.' LIBERAL ART CIE CE Department gear curriculum to future . Paul B1lI'IllL'b'A' Dean, Lzberal Arts and Sciences The College of Liberal Arts and Sciences seeks to fulfill two equally important objectives. Through its general education program, it en- deavors to provide the student with an understanding of the complexi- ties of the modern world, the his- torical and cultural heritage of modern man and the laws of nature governing the universe. The college seeks to develop in its students an active intellectual curiosity and a de- sire for knowledge. ln addition to the general liberal arts program, the college offers its students an opportunity for profes- sional training in one of its sixteen academic departments. The training offered prepares the student for work in his chosen field or further study in a graduate or a profes- sional school. The college began an academic advising center. ..4l xx ::- .M Nw 4 9 N x kx N-' S? -R 'S N, sq, 'X X ,Q ni 3 Msg.v'f'K Hmm wb M, Q.. The new Montgomery biology labs allow for student research outside of the class. Montgomer opens Biology at NIU is experiencing a period of rapid growth and development. This is indicated by the increased number of fac- ulty members and the improved facilities of its new quarters. The impact of ad- vanced methodology with traditional bio- logical problems will increase understand- ing of life for students. To help Northern students better un- derstand this life, Montgomery Hall pro- vides biology students with a modern well equipped building for teaching and research in the biological sciences, ac- cording to Dr. James A. McCleary, head of the department. The Montgomery Hall facilities include greenhouses, controlled environment rooms, electron microscopes, animal quarters, and instruments for phy- sical and chemical characterization and analysis of biological materials. John McCleary Head, Biology Dept. li E Chemistry adds Ph.D Reflecting the overall growth of the Chemistry department is the development of the upper level undergraduate and graduate programs. The past several years have been devoted to the development of the doctoral program. These efforts re- sulted in the graduation of the first Ph.D. in August of 1969. The efforts are contin- uing in additional strengthening of the fac- ulty, additional equipment for specialized instruction and research. Research projects in the department cover subjects from the isolation of spe- cial drugs from common weeds to studies of the structure of proteins. The Ameri- can Chemical Society awarded the depart- ment a 510,000 grant to conduct research in the use of petroleum to produce drugs or plastics, directed by Dr. W. R. Mason. Francis M. Miller Head, Clmnzisrry Depl. Experimentation allows students I0 learn chem- ical principles tlirouglz cxperierzcc. Above: Economics high level courses provide .students the rfltance I0 express their views. Right: Antlzorzy Scaperlzuzdu, Acting Head, Economics Dept. Econ emphasis on graduate levels Economics at Northern is an expanding department. In keeping with the master plan of the university it will put emphasis on the graduate level of study by increas- ing the integrity of the courses and the intellectual capabilities of the instructors they plan to hire. The objectives of the undergraduate program offered by the department are to participate in the preparation of students for their roles as responsible citizens and to provide tools of analysis for economic speculation. Due to the fact that the department is currently understaifed, it is expected that the staff will grow more rapidly than the total university faculty. In the absence of greater financial support it is likely that more courses will be taught in larger sections. Omicron Delta Epsilon is the depart- mcnt's honorary fraternity. The Econ Club acts as the direct aid to the honorary. Grad studerrts' decide the outcome of the recent stork market clzarzges on Wall Street. 86 M 'ew , ee 'Y , M a we Seek teaching goal Onc of the major goals of the English department is to adequately prepare Eng- lish majors for. teaching in junior or senior high school or for graduate Work. Nine hundred undergraduates and 300 gradu- ates Were enrolled in 1969-70. Sigma Tau Delta, the national English honorary fraternity, moved its headquar- ters and semi-annual literary magazine, t'The Rectangle, to NIU's campus. Election of a Northern professor as na- tional secrctary of STD and editor of t'Thc Rectangle, prompted the movc, and STD's national convention was held at NIU on April 17-18, 1970. STD also publishes the campus literary magazine, 'tToWers, which includes outstanding student work. Two English professors received the 1969 Excellence in Teaching Awards. Clzzlrlcs W. Hagclmrm Hvrzd, English Dept. lllllflfllllllll interpretations of Erzglislz lilvralurr' are lll'Ilfff1l7lC 10 Ezzglixlz .vl1lzlCl1I.s'. 87 Spanish majors observe Mexican life Twelve NIU students participated in the first foreign language program associated with the Universidad de Queretaro in Mex- ico, 137 miles northwest of Mexico City. Most of the participants were Spanish ma- jors, living independently within the com- munity. They observed various aspects of Mexican life, while taking upper level courses at the university. Changes in the Foreign Language de- partment were made with thc emphasis on achieving a graduate program. Intro- ductory courses in French, German, ltal- ian, Russian and Spanish have been streamlined to hit the fundamentals more directly, Dr. Dorothy Allen, acting de- partment head, explained. This allows more concentration in conversation and other skills at higher levels. Portuguese, Modern Hebrew, Modern Greek and An- cient Greek are among the new courses being taught this year. Portuguese lan- guage courses are being directed by Dr. Albert R. Lopes. Dorothy H. Allen Head, Foreign Language Dept. Hr. Lab assistants set up tapes for foreign language students. The lab allows a student to hear himself on tape. 88 In Remote Imagery Interpreting class, students examine zzerial photos with a stereoscope. Geography unique, according to Black '4Unique'7 is the best description Dr. Lloyd Black can give for Northern's de- veloping Geography department. 'The Geography department is growing as fast or faster in terms of undergradu- ates and graduate students than any other department in the University, Black said. Northernts Geography department is unique in the state of Illinois in that it is the only one that offers an undergradu- ate's degree in the iield of Meteorology. It also has the most modern map and weath- er equipment available. New equipment is constantly being purchased to upgrade the level of academic achievement reach- ed by the students. Gamma Theta Upsilon, a national geo- graphic educational fraternity, is the most active organization in the department, ac- cording to Dr. Black. The group is one of 100 nationwide chapters, sponsoring speakers and Held trips to coincide with its bi-monthly meetings. Field trips are one of the most impor- tant aspects of the departmentis curric- ulum, according to Dr. Black. Occasion- ally, ten or twelve students go to another state on an observation trip as a part of their class assignments. One of the field trips this summer was to Ephriam, Utah. Lloyd D. Black Head, Geography Dept. Geology expands to include studies in marine geology Preparing students for the many career opportunities which are opening up in the field of geology is the main purpose of the Geology department. Marine and plane- tary geology and geophysics have all tak- en on new importance in today's world. According to Dr. Malcolm P. Weiss, head of the department, the facilities are ex- cellent for rock dating and Work in geo- physics. g'We need to accomplish our plan for a doctoral program, Dr. Weiss said. This necessitates enlargement and im- provement of lab facilities and funds to remodel Davis. '4The next most important thing we have to do is improve our curric- ulum requirements and standards on grad- uate and undergraduate levelsf' The Geology department does not limit itself to the NIU campus. One project in- volves geologic mappings and history of the Ozark Mountains. Salt deposit areas in the Antarctic are being studied, and the rock dating lah is studying the crustal history of the Lake Superior area. Below: Malcolm P. Weiss lzeazls Geology Dept. Right: The X-my .S'f7L'CflA0j,7l'l117ll ruzrl identifying lzfmd specimen rocks, top, are part of llle ex- cellent rock dating facilities in geopliysics. 90 X294 Q MW, .J 17 ,. ,Willy mwwaw sw History students learn to see history in action with such visual aids as maps and movies. History sponsors annual conference Northernis History department spon- sored the fourth annual Illinois Confer- ence on Afro-American History this year. The conference, entitled 'tNew Directions in Black Historyf, was directed at some of the problems in the research and teach- ing of Afro-American history. A new student teaching program, im- plemented for the first time this fall, uti- lizes a close working relationship between the history student teacher and his super- visor, or clinical professor. For undergraduates, honors courses are available in all general education history courses. Upperclassmen focus on seminar classes with a senior thesis Worth three semester hours credit. Interdisciplinary study areas in which the History department participates, in- clude international relations, Latin Ameri- can studies, and Southeast Asian studies. This type of course of study permits the student to be more flexible in bachelor of arts degree programs here at Northern. Robert W. Schneider Acting Head, History Dept. 91 Journalism masters program initiated, dept. in tenth year The year has brought many honors for the Journalism department. Starting the fall semester with a convocation celebrat- ing their tenth anniversary, the depart- ment awaits accreditation by the Ameri- can Council for Education in Journalism. This would mean that the standards of Northernls Journalism department would be recognized as being among the best in the country. Also being added this year is an M.A. program providing a continued education for a student enrollment that is tripling in size. To cater to the needs of the student, the curriculum is constantly being re- viewed and expanded. Dr. Donald Grubb, head of the depart- ment, has been named president of the American Society of Journalism School Administrators. He officially takes over this post in August, 1970. Several professional organizations are available to both Journalism majors and those who work on campus publications. Right: Donald Grubb livads tlze Journtzlism Dept. Below: Advertising .vttulcrzts learn proper layout teclzniqucs for their urls. Writing and editing advertising copy is also important. ,Xa Libr for at we X 1 xx s - X. K Q X ' X A M, X N 'E x XM 0 X . y H, p X Library Science gets 015,000 grant for two fellowships The average Northern student knows little about the Library Science depart- ment, a world of books, cross references and library cards. Library Science has no undergraduate major program. Under- grads may take courses in Library Science as a minor or elective. The United States Oilice of Education awarded a 315,000 grant to the depart- ment this year. Two graduate students in the department were awarded fellowships for library and information science re- search through this grant. The graduate program has grown in relation to the University. The graduate students meet together periodically and are now working on a program in which student representation on the governing policy of the department will be made possible. A sixth year certificate of ad- vanced study is now being considered. LaVcrn A. Walther Head, Library Science Dept. 93 Assistant Head Math Dept adjusts according to changing needs The Math department is planning vi- able pograms in mathematics, consistent with the developing role of the University. The department has already submitted its Ph.D. program, which should be approved shortly. The existing Master's programs are being revised. Ml believe that the graduate courses are realistically meeting the needs of the current Math majorsf, said Dr. Rodney Angotti. t'Also, in the revision, several sequences have been made available to students in areas dis- tinct from mathematics. These courses are designed as an introduction to math technique and study of phenomenon per- tinent to the disciplinej, said Dr. Angotti. t'The propagation of the subject matter is the goal of the department. The pro- grams in the department are consistent with the needs of students, but the de- partment also provides a professional base for the facultyf' said Dr. Angotti. A rapport must be developed with jun- ior colleges in the state. This will enable a continued education at NIU without loss of credits . . . These students can then linish their education in four yearsf' The department aims at this goal. Below: Tlze Math department includes courses in computer math to meet demands of the future. Far Right: These symbols hold meaning for the Math major that others don't realize. to measure small electrical currents. Right: 94 si r i tba. - . - , Primar emphasis on the student One of Northern's smaller departments, the Philosophy department can place pri- mary emphasis on the student. The re- cruitment of faculty has always been on the basis of upgrading the quality of reaching. With the initiation of the Ph. D. program in the fall of 1970, faculty members will need strong research and publishing backgrounds. Our approach as a department is somewhat different from others in that our needs are not along the lines of new equipment or a building of our own. Our needs are in the constant improvement of teaching excellence, said Dr. Sherman Stanage, chairman of the department. During the past year, the department has completely reorganized its curricu- lum, making it one of the most diversified departments in the country. Philosophy c01zr.s'es Sfillllllllll' Ilie mind of the serious Sfllllfllf. Variety of courses offer nzmzy IIKIIIIS to explore. Left: Slmrnzfuz Smnrzgv, Clmir- num, Philosophy Dept. Physics provides the background for other sciences N ewtonas laws, thermodynamics, kinetic theory and magnetism are a part of what every physics major hears during the course of the school year. The Physics department pursues certain undergraduate objectives. First of all they try to provide an understanding of the division of undergraduate physics. A background is also furnished for such re- lated areas as chemistry, mathematics, biology and the earth sciences. Physics serves as a prerequisite for such professions as engineering and medi- cine. Present research programs of the de- partment are in the areas of solid state physics, nuclear physics and theoretical physics. Members of the department and visiting scientists speak at seminars con- ducted by the department. A student division of the American ln- stitute of Physics is an active part of the department and regularly sponsors speak- ers on campus throughout the year. Top and Below: Physics .YYIIZIEHIS learn princi- ples by using such tools as the galvarzometcr I0 nzcasure small EIC'CII'iCllI cllrrclzts. Right: Clzzzrlcs Wood lzcuds Ilzc Physics Dcpl. .MW 40 - l William R. Monat Head, Political Science Dept. Political Science gains new head A new department head and revision of courses characterized some of the changes made in the Political Science de- partment. Dr. William R. Monat was ap- pointed department head When Dr. Daniel Wit resigned to become Director of Inter- national Programs. Dr. Monat, who re- ceived his Ph.D. from the University of Minnesota in 1956, was active in the Pennsylvania State Legislature and was a professor at Pennsylvania State University before coming to NIU. Use of discussion groups in large lec- ture classes was begun in the fall semes- ter along with the development of an honors program for some courses. Dr. Monat plans extensive revision in the de- partment, especially in introductory courses. HThe establishment of a center for governmental studies is also antici- patedf' Dr. Monat said. Many Polilical Sz'it'f1c'e C'0llI'SL'S nrt' held in Rvuvis Wes! IPBCIIIISC of the Clrzss A'lZc's. 97 Psych department soon into full swing graduate program The biggest changes in the Psychology department are in the development of an enlarged graduate programfi according to Dr. Sanford J. Dean, head of the Psychol- ogy department. HWe are now offering a major in six areas on the Ph.D. level. Ac- cordingly, our faculty size should increase considerably in the next three or four years as these programs get into full swing, Dr. Dean added. The department awaits the construction of the new Psychology building, sched- uled for completion in the fall of ,7l. This will eliminate the present problem of having the department split into live or six annexes spread over the campus, in- cluding two apartments on Carroll Ave- nue used for research. For students this will mean more consolidated activities. A big problem in the department's cur- riculum has been making introductory Psych a quality course, since it must be taught to 2,600 students each semester. Therefore, experimentation has been go- ing on in the Living and Learning Center. Eight small discussion groups meet with a faculty member and several grad stu- dents. The extent of the program will de- pend on its results, since it is a fairly ex- pensive method of education. However, this has been tried at several universities, and the results have been promising. Right: Sanford I. Dean, Head, Psychology Dept. Ron Mervis, doctoral candidate in psy- chology, works with Dl1kc ' in ull UXpCI'll7lUI1l. H ,, ....,. ',...-f fb 5 l 'x','n '- 1. . f s K,-.,-,Mh I. t M, ' ru '.,..,,w-1, :Vi-L fl. . ,,z , !i.1....i .navel -1 4-f ' ' s tu 'f s,, f ig' 'Q' A iv. ff ' I .X pf, 4' 7 I-. '. gf, fs, J.:-' iw' ' ,Q if f, '. Q',f, ',, '4.i.!d!F ., ',,.p?2'H fr Q if 2 I f ' 3 K Iggy V , :M,,,,L 4 gy. if . - 'up - 2 .1 I 'pr 25. 'sf Q.. 'Hi 'Q . ' r .Q -J.-sim .4 Drill.r and more rlrillx gel ROTC .x'111zlc'r1I.s' in xlizipr' for flllllft' r1.v.s'i4w1r21z'r1fx. 'l Q! - or ag 399 emi . W2 gm. mn hr-vi Fi' irw .Q wr., 34-1-. Rriynzoml F. Hlll1IilIAQfUll llvzld, Mililury Sc'iw:ce Dvpr. Military Science develops officers Eighty-eight students enrolled in the new Military Science department for the fall semester of l969. Our objective is to develop selected college-educated men for positions of re- sponsibility as officers in the active Army and its reserve components, Lt. Col. Raymond F. Huntington, director of the department, said. The department is designed for students interested in leadership and learning the complexities of being a military adviser. Program improvement is sought mainly through television, guest speaker pro- grams and further integration of course material with other departments, Hunt- ington explained. During the Seventies, we will see a better qualified and more well-rounded individual available to pro- vide military leadership from the Reserve Officers' Training Corps programj, he added. A six-week summer camp training session this summer was held at Ft. Ben- ning Ga. An orientation visit to a military installation is planned for some students next year as part of the program. 99 y ig ,, Anrliropology labs provide students with a chance to reconslrucl Ilia past. Soc dept focuses on other societies The focus of the Sociology and Anthro- pology department lies in the comparative analysis of societies. This is reflected in courses at all levels. Training in theory, methods and logic is emphasized in soci- ological research. The Sociology department is consider- ing a mass reading course where each stu- dent can do his own research. Research could be initiated at the sophomore level instead of being limited to senior methods courses as it is now. The Anthropology department differs in its approach to undergraduate research in that it believes in actual field work prior to receiving a degree. Northern has one of the few Anthropology departments in the country that can boast of labora- tory facilities capable of handling a full range of anthropological research, espe- cially in serology and genetics. Pariwicz' and fJl'L'L'fSl0ll are put info each recon- .S'!l'llCIf0lI smcly. Bottom: S. Frederick Sey- nionr, Hand, Sociology and Antllropology Dept. 100 wx U ,,,., , ,EQ W jg? dv 4 iw ff. f + lt f X' Zi we 2 is ff' if a 2 5133211 imfi' ' 1' 4 1 1 2.3 M 915 S W lg? 8 4 faq, Af, 9? r V ,j ,ini J. Q , if f 'C' H . f ' Mfg r ff 'if' fl-fl - mpg 145151 1 ix S i1 F 1 4. . Q S 9 5 COLLEGE OF Fl E A D PPLIED ART Departments altered to gain new status William Wlzybrew Demi, Fine and Applied Arts The creative and performing arts are gaining attention at a rate never before equaled. The need for ad- vanced knowledge and skills in the increasingly complex technological areas of industry and business is self evident. Through its departments of Art, Home Economics, Industry and Technology and Music, instruc- tional programs and other services are provided. They are directed toward the nurture and propagation of the knowledge, understanding and skills in these areas. The big addition to the College is the new art building built on the old football field. A new music building is also planned. The efforts of the College are directed toward the preparation of skilled practitioners, inspired teach- ers and an informed and discriminat- ing public as well. K' Em ff T ,rn ' x ER' LQ- 1' V T :T 1 -ffi ff f Q. , 4 Y I Small cl11.x'sc'.v in cnmmzfrcinl nr! and design add personal Contact tlirougli informal reaclzirirf. Art building ready The Art department looks to the up- coming years for many changes and addi- tions. Of course, the biggest change is the completion of our new A11 Buildingf' said Dr. Jack Arends, Art department head. f'This will open new facilities to us, enabling us to continue not only as an Art department, but also become a School of Art at some future date. The new building will make all programs more effective with new equipment and in- creased facilities such as a proper art exhibition gallery and art history class- rooms with desks for taking notes. The department hopes to offer a doc- toral dcgree by the Fall of '70, Other plans include the purchase of more art- work to enrich the campus and the for- mation of a study center in Athens. lack A remix Head, Art Drfpl. 1 104 4'5 v'sI 'Q QW' .4v ' s- , A ew' V ' I '11,,guiQQl,1. .' l 'll-. 4, , 'App Home Ee classes used in an effective learning experiment 'tExperimenting with the effectiveness of working with large classes was used this year in the Home Economics depart- mentf' said Dr. Catherine A. Rockwood, department head. Home Ee. 180, Personal Development and the Family, was the only general edu- cation course used in the experiment for effective learning. A large lecture class and small discussion groups were used to achieve the necessary interaction. HWith emphasis upon family life educa- tion. consumer education, the growth of day care centers and nursery schools, our enrollment has been affected at both levels, Dr. Rockwood said. Four hun- dred undergraduate majors are presently enrolled in the department. Students in Home Ee. Education may be recom- mended to Pi Lambda Theta. The food Illlll' child L1L'l'l'l0f7lIIl'lll labs pr0Vic1'c mi opporfmiily for Home Ee majors 10 apply lvrmic pri1zcipIe.s'. Below Right: Cfzllzerine A. I?r1r'lnrurnl, Hemi, llonir' fLlC'0l1IIlIlfC'S Depl. P7 . ,e ,, i icl 2 ri 2222 ni .Xi fr 'li r Q nf is 1 -. Ns 'E fx away--'1x1?'x ' K ff ss Av xgkwxmsfx , Q gig M M ..iZ?'.,iS5?3':'f' 'T k ' ,V ,f A W-nh, 1 41. ,. ,E 4. '.gm,! ' .L ' A 4 x . . 5 R4'r'1'11I1ir1Ar' 11116111011 sllrrlelzts, above. 1,1115 Cllll.S'Utf the .llzmv tlt'f7llI'IIII0l1I to dozrlvle. More individuality in Music methods t'The talent of the students we are attracting today is superior to past yearsf' said Dr. James Ballinger, head of the Music department. 'tThe present empha- sis on recruitment has resulted in the doubling of the enrollment in the past five years. The whole environment is en- livened considerably as a result of a freer approach which permits greater individ- uality in the faculty. Secondly, we have a new theory program which calls for more creativity on the part of the student. By using tapes, the student can learn to sight-read at his own speed. The department is developing a pro- gram in eleetronie music. A synthesizer, which is a computer of sorts, for music, has been purchased. Additional courses in this line are hoped to be added. Also new this year is the formation of a jazz group. Although not for credit. the group will perform in the Blackhawk Room. James Btllllllglll' Head, Music Dept. 107 COLLEGE OE EDUC T10 Educational training always on rise George Weigel Acting Dean, Educalion Although Northern has long since outgrown its old Teachers, College days, it still looks with pride upon the strength of its teacher educa- tion program. From pre-school to preliminaries for the doctorate, re- quirements are reflecting the greater complexities of our society. The level of educational training must constantly rise to keep pace with our ever changing society. During the summer Dr. George Weigel, professor of education was named acting dean of the College of Education by a special committee. According to Dr. Weigel, his goal as acting dean will be 'tthe develop- ment of the entire College of Educa- tion into a sound administrative unit to turn over to the new dean. The department received three re- search grants for a larger project. 'TKT' fs MW News 'x is K rs . 1 QP wi - ,KK K K K . Y . A-.W f iii- 'f A ,' y Q :KK K K H rv KK K :: 93: ' . -.L k .pix K , - K? N ' K 5' , EKWQ ,4 ' :, -' , , . 5f if i?5w3f I I Lin ., .. f LK Q 1. 'S .Q hx in H 1 R ,W. K, . .1 .QW K! E I ii? , sf' . k ', ' J fi 4 I . , . ' fi .fs K 'x d, F 5 i ,. KK S' ' Qi' K ' K ' K if ' Q vmg K Q. lgmw ., K QQ' K. sa ' , A f A . Q. ..,w ,f.f , ,.xL g , Q. Q , Q sm 1 f 5' .fr f Ni sv , -p 1? Q' K 5.4 ff :X E- 9 1, a KK su. K K K 1 'JC' ff Sh -M xg? 1 , L ' K ' E 'K 1. . ' ' af l Ng' :AA - ' x K, I if K DE, I ' Y L K K av w ' W , S .Q , N' . . . 5 s1w:. . Q.s'f'fff x--fi' ' K Q, xg K ,V K 2 s,g.f if KK,,.,,,,, 4 X. . '?. if .JM-Q ii KKKK A -Q. KW KK K ,K 1 f .KK KKK KK KK K Q. K' W.., KKK KK, K KKKKK K WKKJQK K K KF ' V ' 1 M' ' l'1uv,- f' 5 A 1 ,Y 'Six . Q, O K K 'N ' -ga., S 0:5 J. R. li X. :N - X Q B Q. S f. if ' k 1 .-.K'lf f' ,. tt K K K jX2g?f.. K .4 ,, K P. Q . 5 J' 1 .QW . Q A Q 2 KK Q Q , 1 5' A 1 s, 3. 3 .4 .. f l W -K., ' Q K K ff 'f ,. vi, . f' K. 'A K K X S917 fn L,,- ' kk X s A X 1 Q -. .. R K X R ' , K x . . X A I K F K . .K ig .,. 1 K xK ...S S Mg. K -.. X kg: . Kg . K. YK K ' 11 my if 3 5: L1 - if Q K Kj .a 'K , fn Q R. K!! K x I ' ' K fC 5 X- KKf':,x, G'lf,. ' X. K . K K K . 4 K , 1 KK K-rs gme .QKK . W N-K sf A 1 W .M 'X' ., -L-1 , ' K ' ' , s If f ffgff U w ig X: 1' V' X52 K ' k 5 f K' M., -X il. Q f gl 1, , . FR I .. ' fi f 1 , 5 5 yu? K K ,H KJ I, KK L , . . x.sX,KK 1 K K . K XX KKK Niki fn ii if , ' Q v -gwf' Qvvw f -- K A . iff:-Q - -zfiir as Q.. -K KK K K.i:K :5,x,6 K K K K' f YK, , if Ti' f f ' f - - Q- GE. K. , -A KKSAKA , D , K ... ,Q MK .71 . Ki-,K K -Qg3K55.U:K,KKKKK K -KMA Vrana' .- ' JL. f K f Q.. , 'K If Q . , Nsx xwzfwvjvrakq , - Q.: , E+ NW 'i 4 kK'i L-722. kg 'Mx' ,of -, , 2 ' ' x . . iv Q , ' .K K 'ix ' S- K Q :Tlx K Y Wi K ' ZTKQ fi Q ?-f '-g- ' fy J K, ,, If KK ..?5 1 Q I rig - 4 W , .H .gg K ' .KKK J gr '- '- . f uw, MM, ff . , -- Q . f A 1 1 . K. K V ,KK J j' ' ' ' . Q fr l W.. . . , ff-4' Q'-4 . A ' HV N. f gig.-'f ' s f-W .u 1 1 v Vx -. 3 -, KKK ,K.. K WK XA: K, K, , , , K .gy KK , MJ I ,M .- f Q KK, Z 1 A, , ' gf v , K K KKK gun J' f' , ,,..a-if 1' Q ,, 1 w.. K H. X . ff f ' 4' if is A 2, ww . W... 11. - ' wg Q' f f-Q: +1 - ..-.. --- Q- , 'I P' 4.f M 7,,' f f-, K .15 '.. Q 4 , -f4.l3,':f?z-'?Kg...,.,- 3, 'fK-,QQ K, - , ' . 4 KK 5, MM W -1 ff S1-wmfzf M -L 1-'16 4 Admin Sz Services for graduates only The Educational Administration and Services department is one of the few de- partments in the University that functions on the graduate level only. According to the University Master Plan, NIU will con- centrate mainly on advanced programs on the graduate level in the future. There- fore, it is believed by the department that its growth will continue and accelerate. The doctoral program of this depart- ment is the largest on campus. A success- ful program requires a close working re- lationship between the student and the instructor. To facilitate these relation- ships, an increased number of faculty and seminar rooms will be necessary to pro- mote better working relationships. To keep pace with current trends, new courses and programs are being devel- oped in the department. Il1SII'IlC1f0II in the unc' of aurlio-vislzul aids is laugh! I0 grazlllale studwzls for fullzrr' class- room usc. Top Right: L00 J. Louglzlizz, Head, Adn1i11i.s'f1'uIi0f1 and Scr'vit'r's Dept. 'is F El Ed enlarging The Elementary Education department is constantly enlarging, with the biggest expansion expected on the M.A. level. Last year almost 800 students received a B.A. With such a large number of stu- dents to educate, a large and qualified faculty is a necessity. Among the 50 full- time faculty members, 45 hold doctorate degrees. As a result, Northern graduates more future elementary teachers than any other Illinois school. An experimental program has been ini- tiated on the sophomore and junior block level this year. To bridge the culture gap in teaching the deprived, a special Inner City block will soon be formed. Lflvllrclrlrzrv EllIlL'llIff7lI SIIIIICIIIX gain Valllablt 4'.Y17L'l'fL'llL'l'. W0l'lxflIAL' with lub-,rclzool c'l1iIrll'w1. Left: Lin-vrl L. Lrvnmlrrl, llvurl, Eft'1lIt'l1flll'j' Ed. si 5 5 ff if 4 if V?- ,I . ,i . 2 N . ,,...Nw--W-ff- 'A'M.-4-o in is 5: 5 ai - 1,,.:v' 3, 9 px Curriculum helps clinical experience An over-all curriculum change, espe- cially in clinical Held experience, is being put into effect within the School of Nursing at Northern, according to Dr. Annette S. Lefkowitz, department head. This change is striving for further integration of various areas such as psy- chiatric and public health. These con- cepts will thread throughout the total School of Nursing curriculum. Within the ten years since the de- partment was established, there are now more teachers than there were students in the beginning. In 1958 the department had two instructors for 19 students. In 1969 it has grown to 22 instructors and 405 Nursing majors in the department. This fall's move into Montgomery Hall brought the department under one roof for better coordination. Lower left: Annette S. Lefkowitg heads the School of Nursing. Above: Nursing students get briefed before going on the job. Lower right: A student nurse learns lzow to get her patients' medicine properly nzeasnrecl. .N 1,5 V fm Taft eapitalizes on outdoor experience Expansion describes the activities at Northern's Lorado Taft branch where new dorms were built, younger children learned about the outdoor environment and new courses were offered to gradu- ate students. An 80-bed dorm was completed in Spring of 1970 and a project was under- way to make a demonstration lot of a prairie in its various stages, Dr. Donald Hammerman, Outdoor Teacher Educa- tion head, said. Northern's program is one of few in the nation that offers a graduate program. An internship program and a foreign study tour of European outdoor educa- tion centers are offered for the summer. Five and six-year-olds from the Uni- versity Lab School werc the youngest ever to enjoy outdoor experiences at Taft. Top: Even Calcliing minnowx cruz show the Icrzclzifzg aspects of the zmtzrral outdoors. Right: Donald R. Hammermcuz Head, Outdoor Educariorz Dept. 'rf A ,W-1-.,.a....a sv Q U Q X, i A Q.. -Q ...sr . f M. .r X ...A-.mf ie..---fra mg S MEM. N . 731,55 ..k. . .ep ,krr A - V kkk, Wk .. at A k I ' i .. '..e-v4i:.,1'f .. 1- , W- - Q k KW, ...Q 4 i J ' odern lVlen's PE building anticipated The Men's Physical Education depart- ment is preparing for the future with plans that will make it one of the most versatile and well-equipped Physical Edu- cation departments in the country. A new building has been requested which will contain a number of gymnasi- ums. This will result in an indoor intra- mural program that will virtually elimin- ate having to play any sport outside. Wells will be built for scuba diving and aquatic sports. Lighted baseball fields will be furnished for night games. Other innovations include a canteen for dispos- able activity suits and utilization of the roofs of buildings since space is a major problem. The new building is scheduled for completion in 1972, Left: Dr. Robert J. Brigham heads the Men's Physical Education department. Below: MPE courses are designed to develop and improve the studenfs physical strength. aww WPE Works toward Ph.D., triples size One of the first four departments to offer a master's program at Northern in 1954, the Physical Education Depart- ment for Women, is currently working on a doctoral program, Dr. Margaret Dun- can, head of the department, said. The number of majors has tripled within the past ten years from 125 in 1958 to 350 now. The department is growing to such an extent that it is having difiiculty in accommodating its classes in Anderson Hall, completed in 1964. An octagonal balance apparatus, which is used to measure a person's fixed bal- ance and his active balance, was made by two NIU faculty members from the de- partment in the spring of '69. Majors in physical education may select a comprehensive program of 50 hours or choose another minor. Near right: Dr. Margaret Duncan is lzeatl of the Womenir Physical Education department. Below and far right: Swimming and modern dance are only two of tlze activity courses ogered in WPE. Others include golf, ballet. liebe xg at YN'?w,f::'tg, , W 4 ., 7,1 .if , , . ig, 1 r -fr s t Y W f at rr B J 4 1 , as tr. , 2 ' ,M , L, , Q. a t g f 3 Vi' ' V ' ' it,va3.:e o, ' MK ui Z 1 wvfb if 1 1 l ,, - TQ '51 4 5 i t ,N M at We 6, fgtttiv wt . wg- i l Special Ed grows, creates new office Intense growth within the Special Education department ranks it as the fifth largest departmental student body in the nation by the National Council for Ex- ceptional Children. Within the past four years the depart- ment has increased nearly 300 per cent with approximately 1,000 majors now. This expansion has resulted in the creation of a new post for directing doc- toral studies and developing a research center, Dr. E. Milo Pritchett, head of Special Education, said. Special education offerings for the summer of I969 were among the largest of any university in the nation. Forty graduate and undergraduate courses were offered, which represents a 74 per cent increase over the number of courses offered in 1968. Four nationally known lecturers also spoke during the summer. A center for educating the multipli- handicapped opened in DeKalb Hospital. Above: Dr. E. Milo Pritchett heads the Special Education department. Left: Students work with mentally and physically handicapped chil- dren. As N1U's special education facilities in- crease, more clzildren are eligible. ll7 News 118 Student teaching assignments grow There has been a rapid increase in the number of student teachers on sec- ondary and elementary education levels in the past tive years,', Dr. Max S. Hueb- ner, head of Student Teaching, said. More than 1,000 elementary education majors Will student teach next year, Dr. Huebner said. This is an increase from 400 majors in 1965-66. In 1965-66 there were 14 elementary centers, and next year there will be 35 centers. Northern trains more than 1,000 sec- onday teachers yearly. The student teach- ing oliice assigns them to approximately 100 large high schools. Gaining experience in the classroom provides prospective teachers with valu- able insights in dealing with students and their problems. Student teachers are graded either satisfactory or unsatisfac- toy by their cooperating teachers. Right: Max S. Huebner heads the Student Teaching department. Students, such as this Psych grad student, are given the opportunity to practice their teaching teclutiques in the actual classroom before they start their jobs. ltr 'vw Lab Schools solve education problems Laboratory schools were established to provide practice teaching opportuni- ties for future teachers. However, these were ideal situations. The new trend be- came prestudent teaching involving ob- servation, but the expense of this drove lab schools in a third direction. They became oriented toward research and ex- perimentation in solving problems in the public school classrooms. NIU,s University School is firmly committed to research in direct identi- fication with the public school, accord- ing to Dr. George Gogo, director of Uni- versity Schools. We are reorganizing and retooling the school to meet any kind of challenge. Our staff will serve in a consultative capacity to public schools. Teacher exchange will also be utilized. Our findings will be carefully docu- mented, for the school's use,', he said. Left: Dr. G. Allan Gogo is director of Univer- sity Schools. Below: The new resource center compliments other study arrangements at the Lab school. Junior High students listen atten- tively to their Biology instructor. sz K is W M., 8538555 W ee. COLLEGE OF BU INESS eeredited after four ear preparation Robert L. Thistlewaite Dean, College of Business After four years of formal prep- aration, the College of Business has received accreditation by the A- merican Association of Collegiate Schools of Business. Only 140 col- leges and universities have received this accreditation. A college self-study and recom- mendations from visiting consult- ants were included in the prepara- tions. The AACSB visited NIU in March, and the announcement of the accreditation was made in May. Dr. Robert L. Thistlewaite, Dean of the College, feels the accredita- tion will be beneficial in four areas. NIU business graduates can move more freely into graduate schools. local organizations will be able to affiliate with national groups, re- search funds will become more ac- cessible and faculty recruitment will be more successful. X 4 4 W' 'llfg w W, ,Q M, f 33' I Akin VV w , 1 , A 61' 'LM2' 't , A f3j,:f?1f 15,5 4517232 Q Z' , 4 ff 1, f ',,fV A ,Kr Wg x , f , 9 2.1 Q, Q 'h 'K 4 ,,, f -A, we . W 'f .. ,fv W, afffff in V' lg? W ,ZQWW ffvi?Aa4zggfv'fw1 'Q MW3'mw2'iz2f ?3ggfyg?w I, qgfvm , af, Q 7 A fn. 5,3 ag Aff? ' 12 ' -' ITM, if , ,Q f f 095+ 4 3 1 W R g f .1 ,i 1' AI' v ' -nf yfgwf ,Q Q, ' 'N if ' M 4 A f 4 122 X , f wha M 1096 2 4- f ' ' 4 f f Q y f Wi' ' If MW , Q fw' f HQ' f fviwiw' 5 , hi ff' f ',Lf,,'?kf'1ff? f 'I 2 4 ' ' ,nw 1 5' I 5 If ' Hvwflmww P mwswq Hs' sa is gxwuvw Business Ed skills soon to be taught in electronic labs The Business Education depatment, headed by Dr. Lyle Maxwell, is incorpor- ating new ways of teaching business skills. According to Dr. Maxwell, 'There is no question that teaching will be done electronically for routine subjects? Short- hand labs will be set up similar to the language labs. Typing is another subject that lends itself to this format. The Dial Access process for information retrieval will also be utilized in the near future. This will mean that a student will be able to dial a number from his own room that will connect him with a library of lecture notes. He will then be able to listen to a recording of what he missed or review for a test. Two years ago the department decided that Liberal Arts students should know about business. The result was the course Business and Society. This is so success- ful that it will be expanded into the Living and Learning Center this year. Top: Dr. Lyle Maxwell heads llie Business Education zlqnfzrtnzclzzt. Center: Speed and accu- racy are sircxrsed in stenograplzy courses. 123 ti Ziggy xi f- V. , my Q, f A 1 ,fy-,'lf44.4? 4 K, ' ZYQM' ,.,, . ...wit - 52 ,, ,,,, ,,. , ff Wife ' Vg, A ,A . 'mm A 3 aw 5 it ' 6' ,H ,V 2. 'Zi we 4 . ,Q . af GV' vfl E .ff nf .. Je '44 tff a ft ZWMW' ,. A i W '-it W in WE' M. Finance build on faculty trength The strength of the Finance depart- ment is in its faculty. Of the 20 per- sons attached to the department, 17 have a Ph.D. degree. f'We have been very suc- cessful in recruiting experienced and qualified faculty members, especially over the past five years? said Dr. George W. Bishop. Finance head. Six per cent' of NIU's College of Business is composed of finance majors. On a nationwide basis. the average is live per cent. Of the 376 majors. most are preparing for commercial banking or stock brokerage. The Finance department has expanded its curriculum in the past year to in- clude courses in the financial history of the United States for undergraduates and investment management for students on the graduate level. Above: George W. Bishop heads Ilie Finance department. Right: Finariee .rludenis work in- rleperzderzlly on Ilieir own problems in fl special work'.i'tuzly room equipped with Calcillafors. Q ,ff f V' 9 f f ay afgaeaap f stlr . A tartt i,,A . Management grad level emphasized A complete revision in the under- graduate curriculum is being undergone by the Management department. In addi- tion to becoming more up-to-date, it is also working toward accreditation by the American Association of Collegiate Schools of Business. A greater emphasis will be placed on graduate education on the undergraduate level. There will be more use of mathematics in problem solving and more research done in the organizational and personnel problems of business. Dr. Lawrence Hackamack, department head, said NWe have experimented with many ways of teaching our subject. We have tried mass lectures, small lecture groups, and business or computer games. The purpose of these games is to get the student to understand decision making. The department is also proud of its Business Club, which has consistently won national honors for their activities. Lower left: Management majors Richard Ma- loney, William Malloy, and Arnold Norum are strzdents who know the value of hard study. Above: Dr. Lawrence Hackamack Head, Management Dept. N . K X A ss -is i Q E f es tr E + if 1 s we wg E Q Q 2 i i 3 i .- gs: 5-3 3? 3 if S if S. si. st S. i. S. 5. f t as fa H ititfstidtdeft. 5 5 3? 5 vi 'S .3 V tg eg .5 4.3 5 ' if Y 3' tffsgsaaif AL in x .x gs A fi ' Vx sg T' t gg Z Q gs if tt 5 if r 5 s s S Z., Q X . as 5.2 is iii 5 ss Q 1' s. , ,, fg- M- Nu.. - sat s K audi ww 3 'it s i 1.....as..w imsfi 2 Q 93 sf S.. 53 3 5 E E ? 88 .9 .1 it S X l 31 ta. 3 J E fa it 3 3 s asia lllll 3333? 3333 5 544 ISIIS 55585 itll? 38888 S9999 i 3 3 5 S S l 3 S , , E s tt tssagtsssssa 1 1 1 1 1 333333 tattsst starts assess Q . W -5,5 2 X A i w-M. 2 51 X N ,we i fl? T A ,E A 1 f 4.11. WL' J ,. aw, f -cfs -K ' A' -nd Keynote: Summer Internship lnterns from two departments sent throughout Midwest A ll- mfn. . 4' Q 'SW' up MAJ ' , I' VV ff I p I 1 ..-M A jf . if x.. , 4?-Fei-'-. .i .Ll-1 ' ' TV K. f' ' L':l'4 fl: , j..- any 5 - ,Ye-'v-is. ,fs ...aw - , 'MW .,... .-.. ,wlgg ....--...1.--4 .-., ...MF , in ,A .. .- - M Rl' -4.,,,. V, ,'.-.tw ,qwy .,. . -:Q3,7.- .,.... - ,., .....- A -.W A-43 'Q , -- . Q Q -A J I . H, og, ,L ..,. .-.. V.. .' - - ...Q .,. L.-,,, 5- ' H-1 ' 1: Ln: 51: - -1: , . .1--up ',,,.,,, .L.vn0-f'f , 3- '- ' ' .rffj PF ,-'- , X .:.:',,5,?L1:-:,gTI: I.:'.f-iz,-ein' un. V' gn vm . . N-N-Jak' , 'I' . gg gras i' l 1 I vp. 12.-v ' 1:11 -'-'fig -Qg IL 2-if-3-g '1 ' - L1::'I 35' '?7 ':,-f-- . 4 , , V. .. ,N ' W i,..,.f-f'..,,,.....'- -, -Lt-5 - ,1,f::5.-,,,.s:.: ..-wi----n wggj 'Q -- f',,.-- f- ' Northern students are spread over a wide area of the Midwest during the sum- mer of every year when student interns in accountancy or journalism are sent to business and industry for actual on-the- job training in these fields. This summer one of the largest groups of NIU summer accounting interns found their classrooms located at offices in live cities. The NIU College of Business pro- gram, now entering its 13th year. has placed 18 prospective accountants in of- fices in Aurora, Chicago, DeKalb, Men- dota and Rockford. Dennis Patz, acting coordinator of the intern program, stated that the in- N,,...--M zg- ' ...... -....,,, .. .. ,., .,, - -- ice., ' ' ' hmm .nv ..-e1 wv '-4 ..- '-,:'1'.'.C,. Q- ... we-f f-1 ternship gives the student the chance to broaden his vocational experiences and to see if this is really the profession that he is best suited for. The student accounting majors are se- lected for the program through a rigorous sceening process, and they receive fom three to six semester hours of university credit plus a salary from the participating firms. The interns also must be accepted by the firms on the basis of a normal job interview. The journalism internship runs under the assumption that experience always compliments classwork, according to Dr. Wilbur Peterson. professor of journalism. ' IMUNP . - . , . - .,--r - ,- ...V-Pw f:-cf ' -.4-. -- .- - -A ,v fl ,.,,,f 1 4 qu. 1 N.. N. 4. . W ..,.. ,,,--. :j.L1f.i. A f .. -'j,,,4f,Aqw-HW' '.1f.L,.,.l j - WAN 5 ...- E Q- .1 'T' F-+f,1?ii ' ' 7Q.L.2F'1i'-5 4 Q y 1 -' 'au ...J M' .Q-f ,,..l....,f . ' pglAlNU f WW' fi ij' fi? Q ,H 'cwudfy ge ej- fr' . . a---L2nl The program, provides journalism students with meaningful professional experience as they approach the final phase of their university training, he said. Students participate in the program by enrolling in Journ. 352. Course work in the program follows the media work and includes submission of a work report. Advertising agencies, newspapers, public relations departments and radio and tele- vision stations have all hired interns. The intcrns in both departments are required to be between their junior and senior years of college Work and to have a B average in all university work to be eligible for the program. l27 Q ,. v.. GRADUATE CHOOL Master plan includes 23 Ph D s Wayne J. Mcllrallz Dean, Graduale School Strengthening graduate programs in all deparunentsis part of Premdent Snnths master plan for NIU. The plan is con- cerned with developing new academic programs, especially on the doctoral level. Eight doctoral degrees are currendy offered, and the establishment of 23 new programs within the next ten years is pro- posed. Doctor of philosophy programs in geology, phydcs and educanonal psy- chology have been submitted to the Board of Regents for review, and an Ed.D. pro- grani proposalin indusuial educauon is also being considered. A Ph.D. proposal in phnosophy has been approved by the Liberal Arts and Sciences curriculum committee. A key future program is a doctorate in computer science, which will be complete before the undergraduate continued 'Q QNX QQ Q x NN f .,- bf ,, ' www If lil y,-F L 1-S in .4 J: --A - av- Q Q..- Q sf?- .1 sfkxaufu, ' ,,. My ,a -5 . .. .THX -:F W it '5 3-Ax. -.. if 0 J Grads seek fellowshlps for more study proved areas. Dr. Joseph A. Martellaro is the new associate dean of the Graduate School. Below: Two graduate .students in the College of Fine and Applied Arts make use of the azlvancea' facilities in Ilze various departments. W Q35 Rs iii ... sig? if E , Q ., 1 X N A. -L5 Right: Mozzrlzly IlIl'ClillAS, S are held for graduafe YIIIZICIIIS in bllSfl1C'.Y.Y. Center: GI'GC1IlfIfl' level ed- ucalion Courses arc' often infornml disclzssiozzs. gf' . W mg . K SUMMER SESSIO Summer Session offers insight Damon D. Reach Direclor, Summer Session All colleges offering courses lead- ing to undergraduate and graduate degrees participate in the summer session at NIU, an integral part of the general educational program of the university. While the summer session has many distinctive fea- tures - conferences, Workshops, and institutes - of particular inter- est to summer students, the general policies and regulations concerning admission, grades, housing, credits, schedules, and requirements apply in the same Way that they do in the regular academic year. The ultimate goal of the sum- mer session is to provide a vital, dy- namic, and intellectual environment that will provide every responsive student with a stimulating, rounded educational experience, said Da- mon D. Reach, summer session director. continued ,, ,, ageyaa me ZW' My fm. fm we W 7 4' A ,,4, ,, ,ZW 1, W, 5, MA f Q fivi?1Q? 1 1 2' in Iifem Q, ' '51, .M www' af .M-441, ' ef' H i ,f-'ef 5 v 1 ff? aff 1 I ,ff W ,.,.......,. Nur W N , , , H .kr -.Q 4 Mfg' at f ' ,- Af I ,--, f Yfdwi N fi , 'ef W, ,f MW .ww v r F , .1 fmfiif' , 1- 9 .4 Hx' -....,.........., if .uf ,W L Course offerings diversified for convenient summer stud A diversity of course offerings is available in the summer terms to furnish opportunities for persons Who find summer a convenient time to study. Teachers and administrators use thc summer session to improve their professional status. Recent high school graduates get a head start on their college careers, and others take advantage of special institutes and workshops. Adequate diversions, including visiting lecturers, music groups and feature films are also available throughout the summer. The 1969 Summer School elzrollnzent at NIU exceeded 8,800, surprzssing a 23 per cent increase in 1968. Below and right: Sluderzhv fm! the .summer envirolzmezzt especially eoliclzzcive to Sflltly. 'WMW'49ii4rv '+ ww' ' 'V Ng 1 aww? ' if L Elf' ' ' ' MM-ff..-..,.,..,..a, - - -V, f , ., J J M' H fe-Mg-fs-few. ' M , ,,,,,., I L W r, .1 . 4 ,.,. ., W r me W' 'xv ef, , M H an fri.: 4,1 f , f ws I A 4 M .f A V , f Q' ff Y W ...,.,.,. .- 'L 'W ff Wf. 'WKWYQ Y - -fs .f y. z ,A ' ' i , N mf, JW I 1 J N ' ,f 0 N -Fear .ff ..: . 2? 4 , fm - . . M if f . g , .. ,, ,. . , ,, ,- . , ,L-lf-fm W ,V ,L WH 2 ',-Y, ww If I y I , , .. . AN. .. WWW . W, M Q ' H r,f's.-uf-f V I V K V W , 4... V ,MR In V I .Lf MN W awful! W'fi ' f' ' iwf M ,, 1 f 4' , 7--I-, 5 AN U Wit... F W 1' 'N-, .-- 5NA AN. xx N fwm 13 Q Q? S5 Q -:gifs X Q N -X S --vuadnk 3, owvw NNN-as w awww N-Ni ww-431 no-'vw' of-wvu-ann-wink W 124 A t , M .1 '4 . wg, fig' ? p , U' Y ' , A ' . I f wy ff, . 4 J ,l 'r Nl f 1 ,.,, A if V A -15 WJ 1 556576 Z K Y sg R we 1 V1 .ff ,ff ,f 7 , I ,q gk',1r1',f7 A flaw!! V ,YA WTEZSI aff , ww 1. in, f, mr f I 4 g A , ,,. , 5 V its V 4 Q' if , ,Lai 'Y 4 ' ' ' ' ' , 5 ' Y ' 1 1. f W 1, ...f 3 f , if ' f W 1 . , -y YQ ' K .'.J 'H . 1+ Isfh CONTINUI G EDUC T10 CCE serves adults throughout state Virlus W. Suhr Dean, Continuing Educalion A large institution of higher learning like NIU must make its fa- cilies available to a wide variety of people interested in learning. This B the funcnon of the CoHege of Continuing Education. Each year the coHege oHers a nuniber of con- ferences, ivorkshops and special credit and non-credit courses both on canipus and throughout Ihinois Administrators, teachers and busi- nesmnen n1ayenroHinthese courses Dr. Vdmus VV. Suhr has been nanied acung dean of the coHege He succeeds Dr. Virgil Alexander who resigned to become director of the Quad Cities Graduate Study Center. Suhr has served as assistant to the dean of the College of Con- tnnnng Educadon Qnce 1967. Adult Education is one of the di- visions of the college, headed by continued w i H ik LW .Q ,- - 3 Pf k . ' N .xkX k N.-fx' 'H 1 ,Sf 3 , - ,.,, , L EZ fg, K Q WXSL ' - L as K. www -. , ...nut K., 5 AS 21 ii 3 Ly, H? NNN ...umm wp..-... Q51-Nb. 4 Courses in adult education, police training and junior colleges D. Arthur Burrichter. A new sequence of courses has been designed to provide thorough professional preparations for those in adult education. These courses discuss the history, philosophy and var- ious programs in adult education as well as the needs, abilities, and interests of thc adult learner. A study of the learning abilities of disadvantaged adults is a re- search project under the direction of the adult education division. Forty policemen from campus, city and county agencies completed a month- long basic training course oifered by the college. The course covered patrol pro- cedures, firearm training, criminal inves- tigation and other areas required for permanent police assignments in Illinois. Right: Dr. Arthur Burriclitcfr heads Ilze Adult Education division. Center: Dr. Joseph Clerten- berg is flze direclor of Ilze collcgeis University Extension division. i' Q - . s f. . . l 38 V,-s-E . . - -E H . . ---sas-W A N'-tiff.: si ' ' siimf , s ,,:.:. .lrzqg I 8, 'E - - sf .lif .'...L Q - ' s '- . . . 1 5 Q.. . kt 'i are included in Continuing Ed Q1 4 A5 - A., nga N, n dnX nn,n n Q d dn nY 1 df d ni if f 7 57 , Q n f F .KQAAA X g d n fd ' 5 R3 Q d n N? ng. L,k. .M N G' .. n d d ,Q ndmni K -5 if C0IIIflIIlfl1AL7 Ezlucation ofwzs' C'lllS.S'L'S for intel'- estcfl people 011 u'c'c-k-Iziglzlx. Above left and right: Man from Ilzc' C!IfC'lltQOlIlAL'IlIf1kEIIC0Ill'SU in 7-l'tIl'f1flIAif PIAflll'f,77It'.S' of Adult El1IlCl1lf07I X 'W-his-d A ,0 ,, , I ,- --W - 4, 1 'KWH 4 a M ' . 4, M me 41 aww' HG ff H41 ak 47 , 4 'W an 4 Mi RESEARCH Department explore unknown ., ij:.,,5v5gqf . f A I , , . ,fr f ,mwfwwwwafwemvww f I . -f f'fW+'xmQ Peter D. Abrams QLD, director of Uni- versity Researclz, and Milton Carlson, assisrruit. In keeping with its role as an ever- growing academic complex, NIU is constantly involved with research in all departments. Unfortunately, most students are unaware of this aspect of the university, and much time and effort goes unnoticed. The purpose of this section is to give recognition to some of the develop- ments at NIU this past year. A clearing house for research in industrial journalism is being set up by Dr. Albert Walker. This will in- clude the collection and analysis of data for organizational communi- cations to aid in finding trends and problem solving techniques in in- dustrial journalism. Numerous projects are being conducted in the electronics section of the Industry and Technology de- partment. One such project is high- 'gym continued ,, .. ff ,fl M ,I M ,ff .L M' W4 n V. Aff' 53 ,M WMF' 'Q . 49' ' fav ' f M f' My-. , , J' ' 39 'W ' 4' ' if 'HU . I 5? 3 ,4 3, Q ' 4 Tea ,W ri ',f'W film' if WY V ft ff, ,K 7' xl, 5fwfmfg, ggy I ig22Mg,.,wW,ZH .- , if W , .4 mmf' W . X-kg1e' 4 X- 'xs?s.Q. kgQ,igNf1s Rz'sz'urc!z in all Ilze scierzces, A'IlCfl as chemistry , biology and il1llll.YIl'j' and ft'ClIl10l0gy, is cxpcci- ally imporlunf. Much of Ilzc I'C'.S'C'f1l'ClI in oflzw lll'I1!ll'fII1C'l1fS is bf1.s'c'zl 011 Ilzvir fillflfllgi 44 'sf . 1 R i nv' ps , ,,,,. . X , Ns td ci 'Y' cf is- l l e s slsse ,5 i p esses ' l A e , ' :KX V y n V- W k , , . f sf.- 1 -s -A gf si sflesee.-ses Q Thr' Living and LClll'l1i1lg Cwiter is part of a l'CSl'!ll'Cl1 study into the effect of an informal atmosplzerc 011 lcurzzizzg. More biology srudies can be nzadc since Monrgomcry Hall opened. Research projects add to knowledge frequency oscillator design, which pro- duces ZO0 million cycles of electricity per second, a necessity in high-speed computers. The practical applications are being studied by David Lind. Dr. Lyle McGinnis of the Geology de- partment went to the McMurdo Sound in Antarctica to study its lakes and valleys. The purpose of the study was to dis- cover why this lake does not freeze in below-zero weather and to explain the strange presence of salt in the water. 4,dl' , 1 if. ' , ., ,.x . ' r v - f L0 W D E N H A LL 6. . -V-A' A ' ' I ,vi ji? B J 1 -' A ' N' 'I ai 3 fvv 5, W '1 ' . . g p ' v' - --5? 65.7 Q f' pw, iw 1 1 , af if 'ff '. E - ' ' A L 3 37 -lQ.e 1 M ,-ll T:Q',Z,.a,gi.'f4 ff .- KP 'ff H- .gif 'I V 4 'I NF 1 4 ,f-U ' Ui Yi x Uv ' '1 if ' A Aheil' F51 I- +2 -' :I LABU 43 ' A - 1 1 ' Cf. V' .,Jbi 2 X in-.:..1-.,.,..,. I YK fl 1 P-LST-Q sprmg ...................,,.,,,,,,,.,,,,,,,,,,.,,, SLIITIIHSI' fall ..,,,.. .,,.,,, W1I'1tCI' ....... .,,,.,, , x N .X x ' , I . X' XS' X X . - g ' 'X I 7 ' 1' 1 . 1 ' Q xl... I ! 1 .4 ' ' X I ,J Q, '. h kj F , Av J. . .,-I,-V , 'Q -sux ,-- . H- ' 4- - YEAR-IN-REVIEW 146 170 192 ,L , 'U IMI: ,jg I f? . N., ,f I! 1 'yQ.:' v 191: 2! yjf231S'L, 5 i fx rp---'A -' l xxx! V! iw -' ' I - 1' f, x?,,,I' 4X,:iQ. sf . ' : Fir? f X' I xff'. '1j K, N l ' b : if .'.l ,r 'r.' '.,': . -.W x',-I -. M34-2 71 f 'Q Q, ' X ff W 'I fag' X ' H 5'-I ' J' , Xb. N A NF A f r -1 ,I .I Ms ,Q avr ., I 1 lx yywjx OQXM D 'fy L I -'fff ff V-:iw 1 uw! . V . v...1 , We at 1 lf- I uggal l Y, I -gf fl, Y f X8 ' f f +.fe ' fir ' Lf' 'I x G V' X 2' V V' ' Il I f f X 1 A f Mudluscious puddles hail season in Just - spring when the world is mudlus- cious, and the world is puddle won- derful springtime's gentle whisper came to the campus called NIU. Along with the arrival of spring, noted speakers also came to NIU. William Garrison, director of Ur- ban Studies at the University ot Illinois Circle Campus, spoke to in- terested students and faculty about present and future problems of our cities. He stressed the important role of science in the improvement of our nation's cities. His philo- sophical outlook stemmed from his scholastic background at both the University of Washington and Northwestern University. He said that the future of a productive ur- ban life depends on how Well We apply our scientific knowledge to our country's natural resources. Pulitizer Prize winning poetW.D Snodgrass initiated a series of au- thors, poets, and playwrights to be presented in cooperation with the English Club and S.A. J ' 147 :::.,:Eii nf VW' J 2 Q ,Q K f 'Q' ,Q w a 1 yy .. 'H , ,s bu I S W ff f K 5 -EWQIYMK Dining out by Ilze luscious lagoon are Marlies Lueck and Jinz Kozick. Munch- ing in clear spring air provides a fantastic escape from dormitory food lines. ,,.M. ....l..,.......,,,. . . W. Baja Marimba Band spring activity finale One of Norway's outstanding compos- ers and choral directors, Knut Nystedt, was featured at NIU during Scandinavian Music Week. He presented two lectures and a choral concert of modern Scandi- navian music on March 19. Opening the concert was Nystedt's com- position The Moment. Featured so- prano soloist was Alice Berning. On Saturday night, March 22, windows and Windshields were broken and seven persons were injured. About 200 black students congregated in what was de- scribed as a retaliation of the beating of a black student by tive white students in the presence of the University Security Police. President Smith issued a statement within 24 hours of the incident and said that campus violence is intolerable, He pledged protection to ALL students of Northern, regardless of race. The clown brass sound and electric flule are parts of ilie enlertaining Baja Marinzba Band. e' ttiixixt A .awp ll 0 -1 we-.rx f Called the biggest event of its Abd Il A 1 . A 'zz ze rt festival turns NIU into an art Inspired campus. Sue Forsner, left, and Linda Hummel, right, welcome evenls. 150 Blonde coeds wearing silver lame mini-skirts, white boots, and I Am a Festival Girll' buttons promoted Northern's Fine Arts Festival, Arts USAQ, April 26-May 3. The festival opened with the National Print and Drawing Show judged by art critic Dr. Alfred Frankenstein of the San Francisco Chronicle. The West Coast Art Exhibition showed works by coast artists. Weather balloons filled with marshmallows and flowers were sent up daily into the Northern skies in front of the University Center. Donald Strill, chairman, called this an 'flnter-planetary Love Gesture. A hand-crafted nickelodeon with illustrated songs and a Middle English reading brought back the arts of yester-year. Body casting highlighted the weekls events. Pop and avant-garde art explode at NlU's first Fine Art Festival 'sThe Celluloid Bag: A United States of America Film Festi- valf, included every subject and length of underground and experimental films. A school bus converted into a mod movic theatre, 'The Great Mother Shipj' was also on campus showing some of the iinest underground and animated short iilms, en- couraging individual interpretations of the subjects presented. Beaux Arts Ball of the Bizarrew and a masquerade ball concluded the Festival week. In addition to the background of the art Works created during the week, a light show and arty refreshments stressed the environmental aspects of the ball. Ybvo acnvines of lhe Pine fhvr Fbsnial are daHy launcher of Ciesnne I balloons and body painling. Both are being viewed from the Sludc nt Center sem. ef .ew fi. . . sr Qfgk-fi il .gs .ft ,Mg C ,L Q 1, Ifil P e w.. was .K ,LQ Y ee is in 5 al, fi aa .QQ J bg K Q S I - f jg., 'wha llllllltlllfllllil 01611131111 l'0lIIll1CfFCl by EIlAQ'l'IIC' Ormamlx pzmzdcs prmvcalive Center :fi X C0lICl'I'f. I . T' .k at Q The month of April begins with noted speaker and plays Northern hosted a two-day conference of journalists sponsored by Sigma Delta Chi, Northern's professional journalism society, April 10-11 for 75 journalists from four states. Among the noted speak- ers at the conference was Herb Klein, Nixon's director of communications. The month of April featured a first for Northern Illinois University as it hosted the National Debate Tournament. This competition dates back to the end of World War Il. More than 1,000 colleges and universities entered the preliminary rounds of the tournament. Forty-four de- bate teams met for the national tourna- ment at Northern Illinois University. The t'Baja Marimba Bandf, billed as the 'tliveliest brass section in the country, appeared in two concerts on April 20. The group is a protege of Herb Alpert's Ti- juana Brass. Alpert formed the group be- cause he wanted a marimba rather than a brass sound for the song 'tComing in the Back Door. The colorfully clad musi- cians mixed humor with good music. For the first time in UMOC history, a girl, Kathy Streit, a junior from Aurora, won the title of Ugliest Man on Campus. The women of McAuley Hall came through in an all-out effort to promote their candidate in what turned out to be an amazingly close contest. The contest is sponsored annually by Alpha Phi Omega, National Service Fra- ternity, for the purpose of raising funds for service projects and charities. Senator Charles Percy visited NIU dur- ing his five-day whirlwind tour of nine Illinois colleges and universities. The purpose of his tour was to bridge the gap that he felt exists between the administra- tion in Washington and those who are atlected by their decisions - the youth. Il. S, SFIIIIIUI' Clzarlvs Pw'r'y, left, talks with NIU.rl1ulv111s in one of his fur!-filzrlirig c'an1pu.r IIIIIIIY. Tlu' lel'.l7lll7llCIlll from Illinois 11n.i'w4'r.v rr'lr'i'r1nt l1lll'.YllUIl.V in lzis vloqlwrzt style. 153 v is I Q n. pd M..- WA .,NX . W my '31 xi Q QE 1 , iam V ,Rf W Q' 5 ' W A K - 1 l E 4 S, A, ,,,, 'un ,A f 1 ' ,192 A 5' X Jw 5 51' X 1 xf L 'QA v- .ff S. 'qu f f - X iw r s 'X if W M Q 'Hz T, HM A ,wlkf v 'PH ' 'xr , . 1 si H '- A ' ska' 1 M 'A ..- A, . W . llj, , an I - C 'L' . Q - 1 'P . I a 4 I Q V . ' U mf. a .,1. sr .H ' of - Tinting and strength lead Flzinkies to llze tug clzalnpionship. Trees give better View of tugs. Budding campus greets May Fete 1969 Shooting cascades of fireworks oliicially opened the May Fete ,69 celebration of Come What Mayf' A full week of ac- tivities was planned for the campus. The nrst event, a dance featuring the sounds of the The Rotary Connection, was held in conjunction with a most beau- tiful legs contest. Cheered on by an ap- preciative audience, Daniel Sinese, spon- sored by Delta Gamma, was the winner. Monday, Delta Upsilon paddled its way to victory in the menis division of canoe races. Sigma Nu took second place. In the female division Sigma Sigma Sigma won first place and North Neptune took second. May Fete activities were given a new twist with the introduction of a car jam. The somewhat battered remains of a 1957 Oldsmobile were stretched to capacity as group after group attempted to squeeze in that one more person. Theta Epsilon had the dubious distinction of stulfing 27 men into a single car. Pledges of Delta Tau Omega are responsible for putting the final touches on their scenery. Vffwk A Wh Q' I N0 W 5'-H' -ILT In 1 gn - Q . F- if 'P Q W? g tV'1',,3 , ,r 15 1' .f vf4,'N,,'M, !,Vvig?T',Qhg. 411.44 , v f' ' -1 g'7 : -V . p, -' 14 ' - 'Q 'x W5 ,, 4 f - , R 147' . i. W 5 ' ' ' ,R XA Q I ,. qw, 3 Z ay 4 w K agp, M' 4 1 4? 5 , it 4 gi, W U , 4 ' M ff ,+V V' f ' sprigs- W ' fn , ,1- W ' gf4f:f?M'fW:??'?'1V zffhylewii ' f V I ,, 7 , . v WW , ' H ,v--L W , . v' -f ' I '!E 12225:-115 ' fd- A ' , ' ,. v v- af 1 - ., . ,,. -1 , '. V . ,I A f 'fz , W . , 14' ' .V 4 2, 'f ' ,Q-id . ,gy , 1 in , ,, ..,,,,. , V ., V ,, H, , W fm, ey aa., KV E, Sissei Hanssen and Jim Pagliai reign as ioyalt of traditional spring festival The reigning royalty and energetic paddling lziglzliglzt May Fefe Delta Upsilon is victorious in the men's division canoe races. 5 f . in f f all wf 4 'W an -2 . aw WMM W- if V, if af f W M 5,5 a ff ,s.mw 5x 1 Q if 9 ,rqpixxx Nmix 157 :PQ- NW ,w f---mils UWA wi. We was mfW73 '!'QJ M Q W' AMWQ1-gsgl' W f, was W M W av ,W My W mn :M ' vt- WM mmm Qllwwhw 24 nmsii'-iff .yu use ' ...Z --K '- 'll w.M Q gn. ,ff U -.nf P uw? yn. -Q, .rd ag. ,,:.r-we I ..-mfr .r, M -N--..,,..'-'r-f'. I.' '-' W A 'lp-m-..,n,w .. LW- -..., A calculated dive, into the long swim, and the final dripping emergence from llze lagoon depths all illustrate a famed segment of May Fefe week men's pajama races. Cold Dekalb did not play tricks, even Acts must continue. Because of the rain the Island Acts were moved to the field- house. Delta Zeta and Sigma Phi Epsilon won the best over-all trophy, best costume trophy, and best choreography trophy for their skit, 'tMay Saves the Dayfl The best scenery trophy went to Kappa Delta and Sigma Pi for their act, Viva La May-I-Co. Uncooperative weather forced a postponement of the tricycle and tandem races until Sunday. Williston Hall held on to their three-year title for the tricycle races. Alpha Chi Omega won the trophy for the most beautiful tricycle. Jim Bennet and Cathy Snyde were the winning tandem team. Heavyweight May Fete tugs proved that pure strength was not enough to win. Coordination and teamwork proved more powerful. The Flunkies Independent Organization CFIOJ , inde- pendent champs, tugged Sigma Alpha Epsilon, fraternity champs, for the all-school title. FIO won the tugs. The pajama races caught a few moments of dry weather on Friday afternoon. In the independent division, Tau Delta Epsi- lon took first place for men. The women's title went to North Neptune. Delta Zeta and Delta Upsilon took Greek honors. On Saturday night NIU students grooved to the sounds of The Fifth Dimensionf, The five-member group launched their own campaign for happiness with pop hits such as f'Aquarius,,' Stoned Soul Picnicj, 'fCalifornia Soulf' May Fete week at NIU wouldn't have been complete with- out royalty. Queen Sissel Hanssen of Sigma Kappa was spon- sored by Delta Tau Omega. King Jim Pagliai of Theta Chi was sponsored by Alpha Sigma Alpha sorority. The May Fete court consisted of juniors Jon Campbell, Sig- ma Alpha Epsilon, and Candy Carroll, Sigma Kappa. Sopho- more representatives were Don Kopec, Phi Sigma Epsilon, and Elaine McAulilTe. Frank Wasilewski, Phi Sigma Epsilon, and Kris Krueger were the freshmen representatives. l'Come What Maya' came and left NIU students with abun- dant memories. All will remember cheering favorites onto vic- tory and enjoying the ever-changing events. May Fete left NIU's budding spring campus in a fantastically full bloom. The SAE's hit the dust in anguish after being defeated by the F10's in Polly Geballer paints her panda bear friend for her Island Act appearance a tedious lug. The Fl0's are N1U's all-school champs of May Fete week. Sigma Sigma Sigma and Phi Sigma Epsilon pooled talents for May Fete Mud frolieking ends tudent cleanliness As spring semester came to an end, the NIU Studio Theatre and University The- atre Series held closing performances. The first presentation in the series was the explosive drama 4'The Crucible, by Arthur Miller. Director Robert Dahl- strom considered it one of the best Amer- ican plays of the last 25 years. The play centered around farmer John Proctor, played by Ray Montgomery. His wife, Elizabeth, was played by Judith Couglin and Gail Dedera portrayed Abigail Wil- liams, the ringleader of the girls. The rigid Puritan morals had driven the girls to ac- cuse others of witchcraft to displace the blame for their religious waywardness. Concluding the NIU Studio Theatre Series were two contemporary one-act plays. Both were studies in loneliness. 'fMadness of Lady Bright, by Lanford Wilson, was directed by Frank Fetters. The lead role of Leslie Bright was por- trayed by Nilo Manfredini. The play used a three-way mirror technique to allow a character to see all sides of his character. The second one-act, Portrait of a Ma- donna,' was directed by Mary Gamble. The spinster Luretia Collins, who await- ed being taken to an asylum, was por- trayed by Donna Weinmeier. The play assumed Miss Collins had been in the same apartment for the past 35 years and had not ventured out in the last 15 years. A change of weather prompted innova- tive projects. Sore feet and a sense of ac- complishment were the aftermath of the Walk for Hunger, May 11. In coopera- tion with the Wesley Foundation, about 150 NIU students began the 30-mile walk at Glenbard High School. Each marcher had a sponsor who promised to pay a set amount for each mile walked. One march- er, Nancy McLaughlin, earned S6 a mile from William F. Buckley. Check points set up every two miles recorded distances. Funds from the march went to four or- ganizations: Hope and Aid to Dependent Children in DuPage County, Mississippi Delta Project, Self Help project in Biafra, and the Literary House of India. Top: Sigma Delta Tau works with American Cancer Society for research fund. Right: Uni- versity production of The Crucible. 160 ,l rr . a Q -zo YM' tr , 3 ' if A 2 We M 2 , fa W 2 K af , ,,,, , H 3 , 2 A ,Sid 'ff' ,K ,.., ,, f aw f , aw V' ima 5 - 1 6 1 v S' w'4ff re ,F g. ,J filrwzef, M73 ' ffeffjyaf 47 -If 2 Z i N 9 .53 gg fajge Q 7 V 2 ' E 5 I Q ' 1 ' L 2 Q ' I- 4 X We 2 1 ,W hw z' We 'Q 2 +52 Mia? W ' 3 , iw We Q a ge is I rr 5 f, 5' ' 1 ff f',f'f , f j:,.f,fl,, . U ? mf , 1 2 , s 5 ' ,,ff5 fi K , ' , . I s Q ' f , si Ear, 2 me 42 . , fa 2 f W5 ,,,.., fy- -- ,aa i ,- va ,Ar We ,Minka .1 f 3 f My , , f,.:,, f.- if We .,.. W r ii f f from .M jgagggwa-Wada .,,,. ., A ,Q I fiwgi y Wu ...gm . A ,Vg :kA: 5,5 Jigga-swf ....,,.,,-nf .W 'fff' f at 7453532 On zz f7l'IlCl'fll! spring :lay about 40 Sfl'1'C'lISOIl I'!'.Yf!lL'llf.Y take r1n'wzr1tagc of the nzmlluscious season by pzlddlc u'uz1im,' and flipping in the lagoon. , W W. W 'nn 'M Wa w MQW 7, WM' H ,1 , am, 'L , ,V ww. Q - ,L .fn ' h'f k'4'0 1.,MfmWfrM 161 lvvwu , A f,w,,, WW 1 MM' V A sf f , Us f I 7 www WW ' gk 1 , i W ,, J 4 4 4?gw ff ff W Z 2 2 3 , ww 2 ,,.'m,5g, f 7? tw if 2 f ,, f' 5 K f ff as 3 Z 1 , if fa : ,if ' ,' , ' 3 4 I ,V - f f , , ,, X , f ,Q , Wi g ff 1, 4 i f X ff Q, ,Q , 25 f ff' J ff Q , ,4 f 4 ,g 22 , M, , , 4 gg, W I 4 Q ,f if M4 if r 5 s Z , . 2 w M Q mr. I 16? Keynote: The Graduate 'fl really Want to make my imprint on this old World NIU graduates, exhorted by distin- guished speakers to be proud of their part in the evolution of educational opportu- nity, generally had one united thought . . . Itas over! Now we must look in a new direction and start over. On Saturday, June 7, NIU held its 70th annual commencement, 3,400 students were conferred undergraduate and grad- uate degrees in the NIU stadium. Dr. Howard R. Bowen, president of the Uni- versity of Iowa, addressed the capacity crowd. He asserted that America was going through a period of trouble and doubt, but there was no need for such deep pessimism. Bowen, addressing the graduates, concluded, I find hope in the idealism and the honesty of the present Q7 '.-10 -D--g. ?'f-as-...-Qu . R5- bl- H- nu under 30 generation. I believe that through them we may find the way to achieve- ments of the spirit in their time equal to the achievements of the material in mine. The largest summer commencement ceremony in NIU's history was held Aug. 7 as 1,000 undergraduate and graduate degrees were awarded. Dr. Samuel Bra- den, president of Illinois State University, delivered the commencement address in the University Center Ballroom. Braden urged graduates to decide between the 'fpower of fear or the power of love. He then challenged the NIU graduates with yours is the authority that goes with the power of knowledge. You will determine whether that knowledge gives you the power of fear or the power of love. NIU Executive Vice-President, Dr. F. R. Gei- gle, presented the degrees. The Reverend Mr. Richard Fraser gave the invocation. With degrees in their hands and mem- ories in their minds, the graduates depart- ed from NIU. Approximately 90 per cent of the education majors began their ca- reers in the state of Illinois. Ninety per cent of all the business majors found job placement in local business and industrial concerns. Ten NIU graduates contributed their talents to VISTA or the Peace Corps. Graduates of NIU truly did begin in a new direction. Graduating seniors will go in all direc- tions. Where they go will be up to them. Their goals and plans vary as much as their interests allow: I think I'1n going to miss the kids, the friends. We'll all go in different directions now and I guess thatlll make some sad. I guess that I'm scared. But as they say, 'all good things must come to an end,' so what are you gonna do?', I plan on teaching near my home town because live always wanted to teach at my old grade school theref' MI think lim in a unique situation. I've been in the heart of the generation gap and I plan to do something about it. A high school is the place for me to begin. I don't know exactly what I can do, but I feel like I can teach kids something about living that I was never taught in high schoolf' I came to college so I could make the fbig buck' after I got out of here. I donit really care so much about the money now. I just want to be happy. 'Tm Hnally getting married. Jim and I have been waiting for two and a half years now and I say hurray for gradua- tion and for marriagelw VII graduate as a Poli Sci major and plan to eventually go into politics. I hope I can correct everything I've been despis- ing for the past four years. 'fl really don't see why I have to sit through the graduation ceremony. After four years of waiting for that diploma we don't even get it at the ceremony. f'Well, I suppose if I don't get the job offer Vve been waiting for I can always come back to graduate school. 'fAfter four years of sleeping late and cutting classes, the nine-to-five world will seem a little strange. I guess I'll just have to get into that sleeping habit Iive been wanting to get into for the last four years here at schoolf' 'flf I donit get the job I want, I guess therels always teaching to fall back on in a real pinch. ffFor four years Ilve been preparing myself for the cold, cruel world. Now I'm leaving the harbor of the university and really finding out what itls like. I donit suppose the people will be different - just the situation Illl be inf' MI really want to make an imprint on this old world. A lot of kids graduate and get the job they've always wanted. Maybe lim too idealistic but I really feel I have the whole world at my feet now.'7 I64 'QW . 1-'Fr ggfgf , Mag, wing? L, '?4ik,M, ff' Q65 'Hi 4- sa T is Q 3 gg .ig if .X it S x . Ln.. M- V 3 5 53 5 , is K P' 4 w X Eff i X 2 Ysgg h 5 -5 s 'k 'V - K' E ' Aw .Q5??'-'Q ' A ' if A 5355 . .qi -5 .51 - WW ff S 3 7' E iii' a-wwnnmww W........-.--N-S A ,s x xx R54 Y N ,1- .M - N 5 'L x v .M ,, i T Q i 'QV' f x ,OOO enjoy shorter sea on classes While most NIU students were relaxing in the sun or Working to pay for their school year, some 8,000 others, went to summer school. Why would some students choose to en- roll in the more -than 1,100 graduate and undergraduate courses offered? Acceleration or achievement of the degree in less than four years, to lighten the students' load, to take a prerequisite course, or for enrich- ment and advanced study. Supple- menting the course offerings were institutes and Workshops covering shorter periods of time. More than 60 per cent of NIU's summer population were graduate students, compared to about 15 per cent during the recent academic year. Summer session was more than strictly academic. It featured pro- vocative speakers and artists. Winston Moore, warden of the Cook County Jail, told of today's prison system in a summer ap- pearance. Moore related some of the problems prisoners face in con- finement. continued qfQHM'W V4 r 4, ,Vk, 5 4,5 , H V7 JW' A I W Q, , W M., , V 'mi ' ,M , 4 Q ,f Q Q YG , Au ,V ff W 1, if aw ,mwgsarjv da fm. , was, F Students involved in summer Upward Bound learn under the guidance of Henry Sanders. Sanders was one of seven English instructors working with the program. Keynote: Upward Bound In pward Bound you can concentrate on your studies ls I 1, Mfr' , - '-:.a . 5' ffna A I, f 7 QQ- l lay.- ,, if a I, gift-Sufi, I . 1 j I . ' 1 . - , V V ' V V .QPI , A .YH94 i ' ' ' ' , . . - 4 . , , in W l 1 . x ' f at .xv .4 il K A 'f A I I ' A i 1 . . - . .EI 'A f' .41 Project Upward Bound on NIU,s cam- pus stressed total education for 110 stu- dents chosen from the bottom half of this areals city high schools. Upward Bound recruits these students at the end of their sophomore or junior year and tries to give them a preview into the college freshman courses and the kind of education they want to gain for themselves. During their two year commitment, the students spend eight weeks during the summer in a curriculum of English, math, social sciences, theatre, reading clinics, drama, language, art, music, physical edu- cation, and journalism. They also spend time twice a month from September through May for special academic and social programs. In the last three years, the project has begun to show results. The first two years proved to be more than 90 per cent effective. Mr. Leroy Young, di- rector of the project, said, HA project like this can exist on a campus but it is usually pushed off to the side and ignored. The first year that we were on campus our job was just to stay aliveff Emphasis is on the individual. The student is able to study under the supervision of a tutor. Gne student commented, We come from a background of social problems. In Up- ward Bound you can concentrate on your own personal studies. Leroy Young is concerned about the future of Upward Bound and the direc- tion of the program. The future of N1U's project looks extremely good when taken along with the CHANCE programf' he said. A great concern of Young was that the program tried to reach about 30,000 students annually, but there were 570,000 who do not get into the program. The program has succeeded in student motivation because it provides individual attention and introduces the student to new cultural and creative interests. In some cases the effectiveness of the pro- gram will not be seen until a generation later with the children of these students. 169 Tl ' 0 play was set in a Nazi concentration camp I I I I and consisted of an all-male cast except for the camp commandant's wife. Com- menting on the contents of his work As- trachan explained that, Halmost all of the script is based on factfl He commented upon them during a ques- Adding more to the summer activities tion-answer period. The point was made were Senator Edward Muskie's visit and that jails are necessary because one-half Lucien Stryk's reading presentation. of one per cent of all prisoners cannot be Edmund S. Muskie, U.S. senator from rehabilitated. He pledged to eliminate the Maine, spoke before an audience of about Barn Boss system in Chicago jails. 1,500 students and faculty members. Well known to audiences of five conti- Muskie commented on the important nents and a mother of five children, Cana- issue of student power. He said. L'We have dian contralto Maureen Forrester per- learned that freedom doesn't work unless fomed at NIU this summer. Often Mrs. we work at it . . . That, perhaps, is a least Forester is called Canadais t'Musical Am- part of the reason for the surging determi- bassadressw to the world. nation of so many of our young people. Lt. Governor Paul Simon, spoke to a A far-ranging question and answer session capacity crowd in the University Center. followed his formal address, His emphasis was centered on three main Lucien Stryk, of NIU's English depart- thcmes: increased employment, better ment, presented a reading of his own housing, and increased educational op- works with accompanying comments. portunities for all Illinois residents. NIU received '4bigtime standing when Simon said the news media can help the National Collegiate Athletic Associa- with the problem of communication. The tion admitted NIU to University Division press can help by humanizing its approach status this summer. and not just quoting poverty statistics. NIU's acceptance in the University Di- The highlight of this summer's eight- vision was the first in the state of Illinois week summer Drama Institute at NIU was since the NCAA established the two divi- the play 'tHorror Scope. It was written sions for the college and university, some by Samuel Astrachan, visiting lecturer in 33 years ago. the English department, and directed by Leo Durocher would label it 'gbush Dr. Willard Welsh of the theatre division and Houston's Judge Hofeinz would call of the Speech department. it naked without a dome. But the Board The original version of the play was of Regents, NIU President Smith and written three years ago by Astrachan. The Athletic Director Brigham were con- I vinced itls exactly what the university Atrocities of cz Nazi cotzcetzttwtion camp are needed 1 AStf0tU1'ff0f NIURS new- mul' ctzactezz' itz Sattttwl Astt'aelmtz's Horror Scope. tipufpgge fggtbgll field, 5' t Q Sen. Edmund Muskie, Maine, sees student power as determined ejort to make freedom work. 170 H6 was WII114' as . A ' fvpwwg A-if Eff K , X Q O O Iv? UTUM J ammed campus symbol of September Moving in the direction of 1970, students decided to enter NIU and leaves decided to fall. A festive autumn atmosphere at NIU lent it- self to seasonal happenings. Tradi- tionally, fall began with HCorn Boil and the coming of f'La Cache? To rid Del Monte company of their sweet corn, Newman sponsored a '4Corn Boill' at the lagoon. Besides much linger-licking and lip-smack- ing, the '4Corn Boill' provided a corn country welcome to new and old Northern Illinois University students. The warm shifting atmosphere of a coffeehouse and the professional quality of a folk concert uniquely combined to describe La Cache. Sponsored by the University Cen- ter, La Caehel, is NIU,s entry in the Illinois-Indiana Coffeehouse Cir- cuit. This enables the week-long sound and light spectacular to fea- ture some of the best professional and campus talent. While the mu- sic vibrated and popcorn was passed, students experienced the ultimate in informal campus entertainment. 'wg N-Q55 X Speaker Russell committment: living and dying for something Bill Russell. retired member of the Boston Celtics profes- sional basketball team, talked about existing social problems and their connection with today's youth at the first lecture in the Uni- versity Center Board series of speakers. nSportsman of the Year, Gold Medal winner for basketball in the 1956 Olympics, and Most Valuable Player of the NBA, were among the honors bestowed upon Russell. He made sports history when he became the first black full-time manager in a major league of any kind of athletic competition. Russell felt riots were an important issue. Commenting on a commitment in life Russell stated. You're born, you live, and you die, and added that it was tragic to have nothing to live for and equally tragic to have nothing to die for. McKinley f'Dea- con Davis. administrative assistant with the CHANCE program, echoed Russell's plea for help from youth of this generation in facing racial problems in a reaction to Russell's speech. To further the sports program, NIU joined a five-team inter- collegiate athletic conference in September. The five members are NIU, SIU, ISU, Ball State and Indiana State. Governing the conference will be a Council of Presidents, a full-time commissioner, and a staff. NIU's President Rhoten A. Smith was named acting chairman of the council. Competition on a league basis will commence next fall with a cross-country meet. A double round league schedule will be played in basketball in 1970-71 with wrestling. gymnastics, swimming. track. tennis. golf, and baseball following. Abou! 2.500 l'lll'.S' of corn ii'r'1'1' UIIYCII at the Ncwnzrm Corn Boil. The C0171 was cooked by Ilia .vrvrinz of tl A'Ic'tlllI wigizic owner! by Clzuck Rayniomz' of DeKalb. KX E XX. . . . .,,,i, L , . Sz. .. 'bf K. -S QA if.. . K. xxx H . 3 Q.. v P' is tv - .,.,L . . ,. Q, Y . - .4 aww - 11-gf f .. . gpg, -. MQ' ' Q S. W b s X X X wg if gig y XY reg! X X 52 X X X ,X g X ,SA X if 2 X XX X it X S Y' .9 X x ' Ns. if X X 1 Q E X . gx x R W X N. ' W XX X X BX X Y X k X XX X Rx X ,X X X ga Q K . T. ' ' X :X X ., NX X F Q swwfi' A f .,,,... M ,W X.. . .. gm M hw W K ,g h 3 i -- m XX iiEk1k - - - . . . -' .1 ,Xg..fSRX.: .iffy - fi R55 K .SL -1' .-Y iff .. W K E . ft -.X . s UN SG M4 Y., Y? f Y q'r'- '52 ' 5 f' Q ' 5 A f- J 2 ' N., .., xxx .,... is TSW N1 1. F x . it f N Q K M- f W ..... ,,..f I X If N ,N I - -..., ' Q A. wg: vs ... his .. fw Xa. Z.: 'Q' 5 ::.. .AN .X fx 4, Fisx x x x -we S W E S 9 X XF' ' X X ..k.. 3-.. ,jf . X vwgif . ex. . X Eestatie applause approves dance companys performance The University Center Board sponsored an Activities Fair to help NIU students become a part of campus life. To illustrate where the action could be found, many different social, special interest, departmental, and honorary organiza- tions were featured. The participating organizations presented displays and answered questions concerning their individual group attraction to the students on campus. About 20 lively organizations packed the U.C. Ballroom. Being ufairishf' Cokes were drunk and lollipops were licked. WNIU and WLBK were there to broadcast live. Surrealism, with a psychedelic-type iioor, empty picture frames and empty mirror frames set the stage for the Studio Series opening production 'fNo Exit by Jean-Paul Satre. In the modern French classic, three strangers who have just died are locked up together for eternity. The NIU Artist Series added a bonus to its five-event recital series which opened in October with the exciting Alvin Ailey American Dance Theatre concert. l l ,,, , The Ailey dance company consisted of fifteen exciting pro- gressive dancers. They electriiied NIU students with their emo- tion-laden dance forms which expressed various dramatic moods. Alvin Ailey's choreography depicted the cultural heritage of the American blacks. Previous to their NIU performance, the company completed its iifth European tour, a performance in the White House, and a week engagement on Broadway. The program was based on a variety of materials represent- ing many iniiuences from American culture. One outstanding aspect of the companyis appearance was Revelationsf' The suite explored the motivations of black American religious music. The Ailey dance company displayed professionalism as well as excellent entertainment. The final curtain was met with ec- static audience applause which demonstrated their approval. Alvin Ailey dancers chat informally as they prepare for their performance. Globetrotters perform for CHA CE benefit The opening play in NIU's Community Theatre Series was the well-known play Much Ado About Nothingl' by William Shakespeare. The most masterful play- wright of all times combined the romance of t'Romeo and Juliet and the sex bat- tle of Taming of the Shrew to make a sparkling play. Dr. Willard Welsh briefly summarized Shakespeare's plot line. It is about sol- diers returning from duty to learn to make love. not warf' The modern message re- tained the playls Renaissance setting. The raked or slanted stage was used in the play which greatly increased the effective- ness of the dance and sword scenes. Beatrice, Alice Eyscnbflclr, and Claudio, Larry Knutson, overcome their childish dislikes. The rhythm of bouncing basketballs matched the familiar beat of the tune ffSweet Georgia Brownw as the famous Harlem Globetrotters played a benefit game at Northern Illinois University field- house. McKinley f'Deaconw Davis and Emory Luck, NIU faculty members, were instru- mental in bringing the Trotters here since both were Trotters themselves. Their for- mer teammates made the appearance to benefit scholarship funds at NIU. Leading the Globetrotters to victory against the New Jersey Reds was the 'fClown Prince of Basketballj, Meadow- lark Lemon. DeKalb area fans, like more than 60 million fans in 87 countries, watched in awe as the Globetrotters went through their antics. The Ginny Tiu Re- vue performed also. S kg ff'-'lnwmw 'wi' W Mflilq, ,, 'V 'Gum Tha' slmzlow of Mila' Lw1'i.s' 111 his 0l'lL'!1lI um! fflltllflllif .Yl71Ofxl' arc pnpfllur ul LlIC11IL'fIl'. Tha' Hrzrlum Gl0lvv1r011z'l'.s' un' ll group of a'lurw', C'lUH'lIiH,L', fl!!!-lUVfIIAL' plrl-vw'.x'. ni 36 0, ,,,, W w x. N s , Q A 'S P, ,,,,,.1 L g, pm, Songs of 60's saw explosive decade Tradition and the end of a decade were the focus of NIU,s annual Homecoming celebration. The celebration, which in- cluded a full week of activities, is one of the oldest traditions of the campus. 'fSing Out the Sixties made students tune up their vocal cords for a salute to the events and songs of the last decade. Besides the usual blends of campus tra- ditions, such as the torchlight parade, bonfire, pep rally and the salute to the alumni, top entertainment was on hand to help Northern sing out. Making NIU's Homecoming weekend a super music explosion were the Stevie Lisa Slzarring and Dave Nelson both crown Patty Schultz Homecoming Queen of Northern Illinois at preganze ceremonies. Wonder Review and The Vogues, who performed in two concerts Saturday night. The wonderful world of little Stevie Won- der clouded up the stage with some smokey soul. The concert included his first single which led to a hit album en- titled A Tribute to Uncle Rayj' honor- ing Stevie's hero, Ray Charles. Like Charles, Stevie has been blind and sing- ing since childhood. Steviels performance with drums, piano, harmonica, and organ was more than en- tertaining. The Vogues capitalized on their chart hits, such as Five O'Clock World and Magic Townf' Their unique quartet singing style, combined with their comedy antics, made an enjoyable music hour. It was like viewing a TV show, they even took time out for commercials! Adding color and personality to Home- coming week were Homecoming Oucen Patti Schultz and King Randy Lewis. Both were crowned after a pep rally at the fieldhouse. Joining the reigning roy- alty were the colorful finalists who served as their court. Homecoming court mem- bers were Sharon Bates, Sue Sundquist, Cindi Gosch, Mary Kay Peck, Bob Lava- lunas. Phil Costa. Jerry Gutshall. and Mike Mahaney. Homecoming was proclaimed a big success. NThe participation was really good. We sold every button, said Lor- raine Zanarini, cochairman of the Home- coming Committee. There was a lot more spirit than l've ever seen before. commented the other cochairman, Jack Terry. Shouts and cheers of We did it! and 'tWe won! showed that many people were equally happy about Homecoming '69. These were the winners in floats, house decorations and tugs who took home trophies and plaques. Sigma Sigma Sigma sorority captured the Most Beautiful and the Best Adher- ence to Theme trophies for house decs. Left: The Flllllhfl' float The Beat Gmar Oh won Ihr' most heuuliful trophy. Below: Sigma Delta Tau and Phi Kappa Sigma comprflc. Float plans originate during tedious brainstorming sessions The entire house pooled their brains and brawn during Homecoming week and designed a Magic Dragon that said, Hus- kies Light My Fire or Puff Gets Tough and Does His Stuff. The songs 'iluight My Fire and f'Puff the Magic Dragon were played effectively in the background. Alpha Xi Delta and Phi Delta Psi took Most Original honors inthe Greek division. Petal paper, muslin, two-by-fours, and much perspiration combined to make Douglas Hall's Music Explosion the Most Beautiful and the Best Adaptation trophy winners in the independent divi- sion house decoration. Although start- ing their project three weeks before Homecoming. they finished only five min- utes before the judges' arrival. This was the third year in a row they Were ac- claimed winners. Gilbert Hall. this year a women's residence. won the Most Orig- inal trophy. In the parade competition. Phi Epsi- lon Pi and Delta Gamma took home the Governor's Trophy for the best double entry. The key to their success was group cooperation. Hustling themselves over to Hunt's Feed Store during the month pre- ceding Homecoming made everything more exciting. Their float theme Wipe Out the Cardinals was more effective with the Sixties' music Wipe Out. Alpha Phi Omega won the Alumni Trophy for the best single entry. The Queens Trophy for the most beautiful float went to Gilbert Hall for their entry. -. ,W 1,1 HN. -, :rem-W' rigagzy 11 2 gxxifi Q 257 'wx 1' .W NV ' 1' W1- 'W A W f' an me-gk ? E .' Sl' ff' 24' Z x mm' H '7 'E 0'1 f f 'l 'A , ,uh wf' XL . ffl I Ii! N H Ax' ,, , my J 1 f f 3 ,,. rm? main G. N 4, ar. ' Y: ,1 - V wa. GLF' .H M' Ji .. ,J W zfwf-w r 3 QNW ' , A4-H M. EM' ,E , 2 -1555 1 , WW W , ,,,,, ,, W wp ' Q Mhdv Winning is the possible dream The Queenls Trophy for the best double entry Went to Delta Tau Omega fraternity and Alpha Phi sorority. Tau Lambda Chi fraternity and Alpha Delta Pi sorority captured the Presi- dent's Trophy with Theta Epsilon fraternity as the best single entry. As honors continued. Phi Kappa Sigma fraternity and Sigma Delta Tau sorority won the Mayor's Trophy for origi- nality of presentation. The Veteran's Club won the same hon- ors for their single entry. Zeta Beta fraternity and Kappa Delta sorority brought laughs to many along the parade route and rightfully so. They were awarded the King's Trophy for the most humorous Float. The Flunkies Independent Organization. who entered singly, skillfully achieved their humor and won the same honors that they have won in the past. continued King Randy rzzljusts Quewi Pr1t1i's crown to prepare for the Homcfcomfng c1'erzI.s'. Tlic plastic fans are captured by the Grant South dorm dcfcoralion. H fit! at ,1 'p-vt if'f ttll 4 1 ,ngvqww A -Nh FS 55. v S Q N. Q Ml. Q fm, if fl. U. Q ' x 1 ft 'J 1 V. A O M. ,,f W vw 1 , , wk, , , ,. 'fr -if iff A Y A . ,,,1-WV., 1- ' 7.2 igqrxx .' 'Brig-.A 'ri - 'fi fw' 2 . ,S fi '. M'Y,'4 ' J. V .,'xg9V' 1, A . , 1 ' in 'Q 4' 4 r.v . '. ' . -. 'sir J -' -'f 4 w, pruy, ,P '. .-J-. .. L, 'A' ,, . P2.1':.Sf' .f1.9e iw : 'm.x:- W' , W' ,rf .- ' I jf .Af ' 'WMI' VFW,-,'.gf .,m ',3 .Mi jlffkk' U , 4 ,- H L 1- 4, V , 4: t' vQ fAc', ' up ' ' 52 115549. 'Nbr ',,wu.A, - .W A A :Agn . Q. . , ni, f - . .1 '52 ,qylf N1.'V .14 ul '-'f -. 'Sv Q Avvl, 1. xl U, 1,,.i2Yfs K , A79 - itz ,li ' ffl, V ' 323. 13, A .,,.1A. , .. Q, ,vw ,L .n ,x 7 ' 0 2 an Q, f 'W iv? 1 Az, ., f 4, Q fa M ifwgm '1 M, qw '46 A , Eg My i,, at ' ,, ,, an f , 7 ,, H f W Q ww ,, ,fl , , If Mtg if :V LMI, , W K ,f 'M ,M W, ., 'gf ,MR an W-Q 4 Q . .,i. .f juli' ,.... 'wr 5' -u 5 Q2 . 3. S O , ,Tv-gv.. .4 is5is'f'3f5fSEl H- ff,Zj1fi'3E-Sf 'f'?1eigi'f1f :- rpg A :3fv,sVf,,:f5.s, E fp-,ml .M 17 QM.WMg4 : .Aywvegnvm 5 rig, .23 aghu' E ,Al Bright orthern lights illuminate shadowy campus sidewalks The members of the Music Depart- ment's Opera Workshop, under the direc- tion of Elwood Smith, expertly contrib- uted a program for the Studio Theatre. This year's one-act operas were Pergo- lesi's La Serva Padrona and Menotti's HThe Old Maid and the Thief? Both were in English. La Serva Padronau CMaid to Mis- tressj originally was produced as an in- termission entertainment between the acts of a now forgotten full-length opera. First performed in Italy in 1773, the durable opera was one of the earliest works in the standard operatic repertoire. Similar to 'flea Serva Padrona in that the music was often quite light and lively, t'The Old Maid and the Thiefw was orig- inally conceived as an opera for radio broadcast. Flunkie Independent Organization crowned Marjorie Schrier Miss Northern for 1969. Miss Schrier is a senior and president of Sigma Sigma Sigma. Miss Northern is chosen on the basis of the number of votes received and the top four vote-getters were judged on poise and community service by a panel. The Flunkie dance is an annual fea- ture of the organization to foster good will and enhance the FIO name, to do good deeds and rid the stifled world of evil. continued Marjorie Schrier slzrieks with glee as the Flunkies announce she is Miss Northern. 188 Q f X. I Browns Mllhe Brig reproduces Marine life with vivid realism A literally fenced-in audience char- acterized the Community Theatre Series production of '4The Brig by Kenneth Brown. Recreating a Marine brigis bru- tality, extreme authority and inhuman discipline, the play was truly an experi- ence for the actors as well as the audience. To adjust themselves to a military mood, the cast marched in the Homecom- ing parade as a precision drill team Fet- ter's Irregularsf' Instead of uniforms they wore versions of hippie garb. and instead of Marine haircuts, they sported contem- porary eollege student beards and long hair. Adding further to the cast's spirit, the director staged a shave-in at which his long hairs took turns with clippers and razors until each of the I8 cast mem- bers looked like authentic 'fshavetailsf' The play, which took place without intermission, covered just one day in a brig similar to a Marine prison camp in which the author had served 30 days while stationed in Japan. Techniques, which were utilized in transforming soft soldiers into nonthinking figures or choice fighting material were demonstrated. Tech- nical supervision was done by two NIU students, Frank Fetters and Mitchell Ba- teast, both cast members and amazingly enough - both former Marines. Does the military change men? Part of The Brig's cus! teslify yes. Changing to Usliave- mils is ll stark awakening. A subtle realiza- tion are dusk's slifulows on rlescwidirzg stairs. 191 Cold orthern Winds mp noses E J'w2n-,,,,,,,...-PN., W .,,QX-...s,,,,.al v it fr:-' The flickering amber tongues of the warming fire took the chill out of the nippy winter night and from red noses. But the memory of the day's snowy north winds was hard to forget. As usual, when everyone got up in the morning for 8:00 classes, it was dark, and when they got back from 4:00 classes, it was dark. Winter was study time for most NIU students. It was usually too cold, too windy or too wet. If not studying or keeping warm, some NIU students frolicked in Northern Illinois' winter wonderland. The winter season saw Dr. Benja- min Spock visit the glazed NIU campus. Dr. Benjamin Spock, baby doc- tor turned political pacifist, spoke about Dissent in General - How Far You Can Go? He appeared in early December at the University Center Carl Sandburg Lecture Hall. hw! 2 Q If . aw? qwgtxv F513 1 2 Q, ,Q --HIM 1 1-ii' 3 'E Aff 51 Wi V - 4 A 5. if 4 t JJ 2:.'H'W Ifn x sa f. :-1415! A A x x v' ' 5' f , wie? .N-. we s Q 'Q' S5354 .gsvwi mi ti .,Y,Av Kris. -'ff -: ,. : S-1:-:av f 2:23 is 'A' .NV fs: ,Qs Ea 'la 'Z f'i an if , Q 'A rf . 'tw 34 s 335 fd, 3 . .FQ- . W ,L 'x s. . KW! fy , 'Q-Vgfg-, 'Wagwf fs ' ' 'ggi ' 3. f9. ..,-ff . ? ff 'i1r-22 1 ,f .W ' 'V . V W v ' Jwfpw 5 V :Vx fs. I, Q Q96 ,' 'A Q f- -. . . . w1.f:Ifg.f IN' ' W .4 , ' ff' Xa fa ., 'Q . .xv P Q- -,gg A H f Q . 19 , Aim, .. 14-I z...Eg t ' Q Sgt :-21113 ,,' Q . Y Q gun' 2 ,Aff 'ff J ' ,fy :Nl W' v,,T'!'1'V' .Ay 9: 'I 1 Maw yi' 023' 1.9 -l ,Z ng +++v,3f,f',2. ?' . Q. 45,3 Ei, 2 1 .- ...,.f1wm W1 1' 11:4 1 ,S -.Ugg .Jiri .lyf ,Z-gyim-.na X Q ', V . , Q. nw .,.sg'fgi ' 2gv!,g.sf1f1.f,.f.....yqg A 51 g if I ,A .yn ,za sy-:Y I ...L 'af ' ' 0 , 1 14--, CPA 2' ,, X 1- ' J , ' I -M IQ.. az. 5.31-fg fz, 745. 4 K ' gy QQ'-15 'WSTQ ' 3435223 .1 2 f Q J y '. Ui 'Y ' .5e'fIA'W- ' M1 ' a ' a f W - ., , 'sg . . .' - i R' , f 57 f 912 f , iff 1 ,251-s , - I.-e'4?73'Q,l 227 'ff' if . 4 ff 3-S7 4 127751 J? Y .fatlxnl : 1 4 Q P ? I I 'CG' 4? 5, X. J' , 5 . I. Q I 91. P' Q., . ,Wg 4,1 Rffggfxv 2 f 'ks' Q 'st I V ik Q 5. 5 Q W Q t . 'rf f ' Q L K My Q QP -. L , :-gf L N rf . . E Pt jg ,N V ra!- . 42 f . Q 'fix 654 3' Q Dx , 2' . ' . ., V rl MW 9' ' -N ' M xx ids A ,Q V, 'v,'fz V , K - A -gs.. VI -W4 , M gif, f - jg .', x'ymw,j,. ,W-Q9 2 M 'M ' .r 3 EW. 'iii 'rr ,a . , 'l:nQ,,,4' , 4 'QS 'siJ:'fi, ' A G.:.,., A, u 4,4 YY x . 5 I .- N W1 '1,. 1' ' , . 'f g,-Q -K 6 f x4.X'.w 7? ' 'Mi I fzga if 'fe , A S sfagffu . ' rg 3 'lg 1. f ,, 35 1 ,, g A gl. .gf 3 t ' Y, ' T . ff Q 1 f 1. 2 X N . .M . Q55 3 ', 2 3'i 4Q?f! . ,,, Nw 1 5 , 7 V Q' V. ,.., . ,W..',,..--. -15 1 V ' W, M, ,aw-- 'f 'f ,mf 'www ,ff A M ,www s,-1 1 Q .4 Y 3 'W 93x5 . I .m.f?.!i1ip55f 'b A W... E x 71 V , .4' AW' ? ZQ'9?'f' 'Q 'WE 5 ff: e. f 9 ' 7 ' .Xl v u ' X P 'KN :rye R x 6' 1' gf , Hz' ,Q if 4, v' .13 s,,.p1Vf yigfvq' 'hp 696-tg' ah iq m?f'H: wg 'Q few Q wx' .3 ev 5 .1 , . L u .A, Mxwf X ,fag . Y Jug, QQWV 3f'? 'f'2i3: viii! -f '.' Q Q45 puffs X.. Q rlwyig' 1. f -4-gy, Nw , sf- 55 ig: 7, .g QJYWOQ .lf X'-' V - . ' V f-.'. ,wb x ,..,. . , I , ,VA 3' , - .L MQ' Q - '11, -v. z ww. 5 ,bv ,..s,i, f , li , ga R -sx'QWg 3 Q , 4, , .- , K if s. X w,,,.,a. 5 ie, Wfflf, 4 I 3 naiixll! X 54Ff- S' K .3 13, 'i'- Q . :bras -tffeea. I N Q.. ef? w J 15 'Z 'Wm Wm s.f,.ff.,f M ' f wg .app- 4' ff 3 '15 ax 'EA' v T' at ., .1x'G,ky ,rg ' git' faig if?Lv-31 ' Q- ui 4 . ' ,d it A ff 4' :M . 'X' 5. ' ? . S ., fiwi Q If uw. Q QL' AQ: ff Q ix24i'?:5'. 'Q 5' f. 2? i 2 Lwipffcfi' i ' 'g Fai1LLA.,a.i is 4 . F?'? f', 'Q FN 32111 25 .. W , 1 pf 4.0. if . R gf' 49257153 15 rn.- ,.. ' 2Wi3'l' me uw unulankdliwllf ii ,fi N Vw. 'rn 'H NE: 1 ig? ,L 'A Pre-Christmas celebrations decorate gala month of December As winter sunk its teeth into Northern, the students were busy preparing for the Christmas holidays. The University Center Ballroom be- came the great hall of an English castle for the sixth annual Madrigal Dinners. The dinners were a series of five tradi- tional Old English holiday dinners, which featured the I6-voice NIU Madrigal Singers. Approximately 2,400 were en- tertained by the Christmas season cele- bration sponsored by the University Cen- ter in cooperation with the Music depart- ment, choral division. Adding to the 16th century atmos- phere were castle banners, heraldic em- blems, spruce boughs and the brightly decorated Madrigal Table. Trumpeters and madrigal singers toasted the arrival of the Wassail bowl, the boar's head and the Haming plum pudding. Neil Simon's popular situation com- edy 'SBarefoot in the Park took honors as the last fall Studio Series show. The play found hilarity in the tribula- tions of a newlywed couple, an unusual apartment, a mother, and an eccentric neighbor. Directed by Robert Piech, the production featured Melvin Hannibal as lawyer, Paul Bratter and Cathie Giermak as Corie, his bride ol' six days. Eileen Smith portrayed Corie's mother, Mrs. Banks, and Larry Knutson was the Brat- ter's neighbor, Victor Velasco. Harold Pinterls three-act drama The Birthday Partyjl brought contemporary comedy to NIU. The play concerned private terrors and the personal farce of everyday life. Two menacing intruders, played by Richard Potenze and Daniel Bialas, staged a bizarre celebration for Stanley, played by John Miaso. The birthday cele- bration took place in a drab seaside rooming house in an English town. The celebration eventually led to the destruc- tion of Stanley's individuality. Dr. Donald E. Polzin, director of the production, noted that because of the many incongruities in the plot and the characters' lines, the incongruity was car- ried out in the multi-raked set design. t'Hail Scrawdykef' David Halliwell's fantasy protest against modern society, was presented by NIU's Studio Theatre in early December. Directed by Susan Koenig, the play focused on an angry young man named Scrawdyke, played by Bart Fleming, who was booted out of art school. Unhappy with society, he rallied supporters to form a new political party. They then staged a fantastic protest to conclude the performance. Members of the Nortlmrzz Illirzois Univcrsily Chorus participate in the sixth Madrigal dimier. Mfaaugg. 5.1 i 1 ig. fy - -B r . . . - - 4 4 . H aw.. gl up ,, V A , .. .Ah ., A J ,yy i . f Z7 1 V V, 451 F, .4 'I -wg 'EW .X , 3 f ,Q 11' a a I ' Q M 1 f' c. 7 an ix, 'N -V ? , v I c f' nwkffkt I .Qlm , fm, .,,,.W , 5 5 L - Q' wif 1.5: ' ' if wmwww ik ff Carnival glitters Amid an unseasonable warm spell Win- ter Carnival began at NIU on Sunday. February 22. The snow-filled streets had vanished, but the spirit of the students lin- gered on for the entire week. The glitter of the exciting opening ceremony forecasted what was in store. The dawning of the age of '4Aquari-Ice was to be a week of tradition and inno- vation with most of the classic events. Midway and royalty were set against the newer ideas of mudtugs and a concert in the tieldhouse, which allowed twice as many students to attend. Medallions in- stead of trophies were given to individ- ual event winners. On Monday. roller skating races were held on Castle Drive. The driving speed of Alpha Omicron Pi and Theta Chi brought them first place honors. AOPi hnished the course in 2.53 while Theta Chi skated the course in 2.40. On Tuesday the saucer sleds slipped and skidded on the grass and snow paths. The Phi Epsilon Pi's five-mem- ber team crossed the hnish line first. Below: ATlIl'fll Chi .www sculpturr' A qimri-Ice. Left: Sigma Kappa and Sigma Pi pliotoyrzzpli heads of people on artificial bodies. I97 1' -:Q mm? Q WW y ' 3 an... 4, qu Af V, WMM '41 ' U25 Q .MVA ,MH ' D 1. ' .mu fm 1 f, , , Q. f g, , M A 5, ff wr Q Q 3 . ' , 1 ,. ' 1, fw' 7 V M ki m: H -I .V Ka, 'Q ,X x ' ' X Q ,f fd E 'fa 5 , ,fff?'f.f wi, Hrygffmgf gf yum' M 1 V ,vm - gm M' ' wf'f2?lf 'g 2 ' V A ' , Hg' ,, as ,Q i ,rvfi A ,ffm ,dv 'I Y, .,!2,,.7,f.asf 7 Y : ,au ,ufMmi4,' av , f.!d.4,,,,Lg4.1 x lg , 4 'U' fy up f 4 2 Hifi' A ,sl f-5,5 ! fm .mm 5 a 5 ii X 551 Keynote : Looking back Decade-In-Review What has 4.700 parking places and 11.000 registered cars and 13 miles of sidewalks and 9 miles ol' streets? Northern Illinois University in 19701 But it wasn't always that way. Today the over crowded classrooms hold 22.519 students, but in 1960, a mere 10 years ago, only 7,042 students filled rooms behind ivy-covered walls. In the booming year of 1960 Northern had 21 buildings. Now there are two and a half times as many, a total of 54. The only building across Annie Glidden Road in 1960 was the married students' apart- ment complex. which was only one year old. Previous to 1960 married students lived in barracks located on the present site of the women's physical education building. In the early 1960's women had hours. Remember that far back girls? In 1965 freshmen. sophomores and juniors had hours of 10: 30 during the week and 12:30 on the weekend. Senior women had hours of 11:00 and 1:00. In 1966 all women had hours of 1 1 200 and 1 200. These hours held until March 1968 when all those trivialities fell to the wayside, It is even harder to imagine that at one time wom- cnfs hours were at sunset every day of the week. To enlighten the minds of the student body, there were 1,248 full-time educa- tors in 1960. In 1970 there are 7,042 educators. the same number as was the student body in 1960. Northern has a V '?:f.?- f ' .r-63160, 4 i -f ., . ..a. I-I I-ll . qx tgt N1i,lt-', , lvl 3 '1 1 Q ft? . ' i 1M i1f' r -1 .1 L I ll I' A 1' 'I 'Athi 11,1401 it A , ,gi total of five separate colleges today. In 1957 by a legislative enactment the school received the status of Northern Il- linois University. In 1969 Northern sports finally received University status. North- ern had finally made its way into the f'big-time? In the fall of 1964 Northern had its first coed residence hall. Lincoln Hall opened in 1962 as an all-male residence hall, but changed that orientation in 1964. The year 1962 also saw the opening of the University Center as a student-financed building and the larger Union was opened in 1968. Swen Parson Library first opened its doors in 1952, but the stacks werenft added until 1963. The north and south wings were added in 1965. The new ad- ministration building, named for Frank O. Lowden, opened in 1965. And the last football game played at Glidden Field Cwhere the new art building is locatedj saw its last action during the 1965 foot- ball season. Today at Northern the male to female ratio is surprisingly low. There are 1.08 females to each 1.00 male. There are presently 5,777 freshmen, 2,293 men and 3,484 women. There are 3,868 sopho- mores, 1,796 men and 3,484 women. In the junior class there are 4,316 students: 2,382 men and 1,934 women. And for the seniors: 3,552 - 1,960 men and 1,592 women. In 1959, with an enrollment of 6,112 and 381 full-time staff members, the Di- vision of Instruction was organized into three colleges: Liberal Arts and Sci- ences, Fine and Applied Arts, and Edu- cation, in addition to the Graduate School already in existence. In 1961 the College of Business was established and the eve- ning adult education program received Evening College status. Programs leading to the degrees of Doctor of Philosophy, in history and English, and Doctor of Education, in edu- cation and business education, were es- tablished in 1961 following approval by Northern's governing board. A two-year program leading to the Master of Busi- ness Administration degree was approved in 1965 and a year later, additional Doc- tor of Philosophy programs were ap- proved in chemistry and psychology. The College of Continuing Education was es- tablished in 1966. On July 1, 1967, Northern gained a new status and a new mission with the establishment of the regency system of university governing. And so a decade of growth slips away and Northern takes on HDirection 70.8 The elusive decade proved to be as all others, memories floating in the back of one's mind. To each Northern student the years bring back the questioning of who am I and where am I going? The decade leaves everyone with a desire to 'fdo your own thing? Years of memories floating in the back of my mind Above: The formation of the new Xfllflflllll for 1110 NIU campus. Right Center: Construction of the grain cIUmI0r or more Center top: Conlinzml growrlz is m1plzfl.s'izz'zl hy ffm new dorms. Cnmnzozzly, Wat.s'01zEa.s't. Rlght: NIU CfIH1.Dll.YlI.S'fl1t Il.YfIl 1960. 202 j. iii W X A I Ulllllf' IIIQIIQII 1 4.1 ll - mpg- K.. www! Lam, ' .Xb ,WJ w.'f'Y -,,7,fv-,-nw., - ' V, ' v V. 'Q-1-xr... , '- .1 --7-.,.,,ig,Ml --....,,,Am -,f ' ' ' , I Mrghmv ,wwf ' ' Q . x , -X ..,...........g, 'H' Qmfihx xl-1-1 Q -v,g.fj wg, , ' R55 A , ,fb -M , my f 1-M . .H 3.5.1 mf, , my rf-' N '95, ,uf-jguv ,. , 1 5 j5.'p 4...-1. V45'vfMjz,v'f .,4 I - QW ,He U N - 11- 4 , if 59.301 , V W .P M KL. - .Y 419 1 5 rl, ww - A ASQ mm, , 4. . ,Q ' d1- 0,4 fy vu L, , wr, Q J'-15' NB ,L ,W Below: III 1960 1111' r11.s'11 l11'I11'z'w1 c'1c1,v.s'U.v from t't'IIIl'H1 C'tl1lIf7Il,S' In 1110 11111011 wrzx tl l1IIll'1l 111111- ner crowzl. Right: Two NIU Coeds display flu' Iww 50-.s'mr flag, aflcr Hawaii glII'110l1 sIz1Ic110011'. Q F' '- www S -.. Above: Cutline from 1v0l'C1I717Fl' 30, 1962 Star, Gone arf' 1110 II0XIII1AQ1C C0bb1c'.vl0m's Irozl 011 bv nzanv NIYTC' vI11z1011Is' 011 F110 wav ro 1110 Tm: Room ll Corzcrefc brid 4 11 as' 11111 .S'1I'l1l'1Ul1 for .s111114'11l.s'. R1ghI: T110 1011 100111 011 l1Il' U11Il'I' .siflc of I114' C'011zQg'1' A1'w1111' 111'i11,1,'1'. 204 5 X?'3WlQlnanQ..1-Q 4 ivfwhurawwwfa- ,. orther revisits the elu ive decade - 1960' 1 . T' 1 if 8 wg . wwf' 5' 5 51? Q r Q Eg, ,- may-1 ,f 1 . MW X ,f, fl' J f'.8f2 !Q Y. 11.1, ' fi! , wi '!1 f4 +'Yf ff 5 ff .s1 .Ma 'Q x I! Q V W K., 1 r 1 Q' Q1 1',... A., 11 H! R , Sk L xl 4554, . A, .1 '?J,tiS'i.f-1-g tg ,I -RV? . Q . -Q. M' 41N..-f . Q1 it-my wk, x- -- 1 ' 3 mi gy 1. Top: T110 111111111011 of the stacks 10 1110 Parsorz library in 1110 fall of 1963. A .s'11'1'1't 11111 I1-v 1110 11171'flI'y W1Il'l'l' 1110 p1'1'.s'1'111 N01'111 WI-IILLZ .s'1111111.v. Above: T110 1lIl11ll11IAL,' 111111 .S'1lllIt1.S' 17C'IWC'l'Il 1111' 110111111 Cc'111U1' 611141 WI'I'IZ was 1110 c'11f1'I1'1'111 111 1961. 110f01'U '61 1111' 17Ilf1111'1IAL' .x'1'1'1'1'c1 as 1110 c'111111111,x' l111I11IAL' llI'Ctl wwwwmw-wfm vwmshwikk A 'A - Q .M qii K Axvkxb 1 m,,,,,,,, M'-f Qmwpuswwwmw 11.1 A . nltmklk -1 55 ' . -1-Q 1 M.. ' ' '5 .., , 1 14-1 1f 'f'ggsri11 1 bit: 1 mf' -fl-f -' 'N KTMDH Q6i?,M,,.v..A , k A 'ww R 11 ' Lawn-nw, 1 , K gym ,Q 's-Q.. , ik 1 1 f 1,155-.- ,. .'.!.., ,A , . 4 , 0 , I yr ff. ' 'f-', x. . Q f. V .A :SW K 153 -' 511 1 1 P X 5 'ln i. I b- ..,..., , .r 1: if E1 ,rr mn ,H ra 1' A lxkm, f ,V -it 'D v 22 5 n r , e .N , Jx ',, ' if T:-I '-.1-V ,f . . A d :- fag AI 1 M. 1 1 I ,wk ww! LA U A1 Aged' rn: I'-' ?'- - 5 hifi 163 . X -' -A.- . 4 A I ...TP U Y v . P s Y i i HALL 'x f'ffT35 ,..f'7' ,, . lk.. CAMPUS LIFE residence halls .. independents .... greeks ............,. off campus ....,... married students , ,gr nm? '14,-. K 1 S- i. ..,, vs, FCS kgxnxh ,IX w ,X ls N 1 , - 1 - - . .,, -., . . , lag.. ,Fvg E. dilfh-1' I' rl rife . '-ii-'..'.. Z f Ln- T Q va p-, 's ' . . fu -.-l.Q,,.:1,,.:,- T ax v ,?4r 3 . fl- V . 4' . Q-I-, 5,-4 ' v Q . fwfs' 'C .1 '-an YL 4 Q :LJ if .II il i . i Vg., kiwi. ' 31 :QHffff. 7i K ,,f ',.A 1 .b . , If A X I! ff .-.' KW X1 f Q - YK-'gill' Nfl -'4A 1: ,- ! ' ' Tm A N :lf J5--ffffx + - ,,g. w Q f g ' ' , w i Obfx. 'TI Nik: 1 an vii.-7 . -gf fif . RHI! 1 QQ, ' 7 ii. I, if Q' f ,. ,flj,.e3 ..v -I -.1 .e , , 1, ,- ,. , I f, , f ag If F X , P.. fr, xc' , N, X56 ' A ll . V f 44 ' U 9, I f Q .1 gi-I -' 12- . I 5f'Q'f.w'f-X6 1 ' - -5. P- .r Sv- ,, X q 1' . -44 X , 207 RE IDE C H LLS Dormlifei alteredb change A full mail box, u long, yet patient wait are hollz Iypicul paris of dormitory life. After 17 years of being known as animal farm, Gilbert Hall Was convened kno a vmnnens dornithk year. Bigger roonis and convenient locatunl were the advantages nnost ohen rnenuoned by the reddenm. One resident said, HYou get to do just about anything you can to dee- orate the rooms. Another said, uThe dnnng area has a cozwr ab mosphere Without the mechanical environment of a cafeteriaf, Disad- vantages of living in a converted male dorm were the lack of built-in hairdryers, an ironing room, and recreational areas. The main reason for the women's housing shortage this year was that Williston Hall, the oldest female dormitory, was converted to an office building. continued 1 W 3 taelmwiiiu-aut, , W ,.m,'1 , at Q Qwff fe 'l' , , ', 'f ' . , :TA H E M . W. - 4 , ,, .,. ,., w, fr ' .f ' ff' , W M TV if 2 . ,-,, - ,MW- f g, 7 ffafmwwww , ' ,. ' M.,aymzW1? eWM h , ,, , V f V I f 1 ' an I ,Y , was I V M, , x w K a 2 EE Hwiazuwa L Q Z k 1519412 vw su' Qi .. 'R Q ef- 11.1-f-. . M'-nmonwW ' gf ,,,.--w MM ,,,,,.l me 9: my PE' ,,-'Grd' Wllg , Mm 'R 0 be I , .1 ,Nf- Mgg I W M 'ZW A , man Below: Eating is a Vary important pusttirne for many stnzlents. This group will soon trcnzsfornz their full plates of spaghetti to empty dishes bound for the clislzroom. H, .v X Top Right: Greeting an inquiry with a congenial smile is just one of the duties of loblty desk rcceptionists. Above: After the ritual of signing in u'utc's, the sign on thc' wing door becomes ohsolvlv for ll few lzours during dorm visitation. F 5 af Y if if I i S Q H 1 ' L ,1-N t' k ww ...w -.N ' .14-:wi -X, K fr 5- ., - ms' Q1 Xeffrlg g Jifc . . -NTYQQ 1' is . - x X N K XS 'N,,... xx X 9 Q N X 'Xi X N Q5 E X Q xxx N W, X S. , we 5 an , limi ' Q 2 X X . 1-3 k wwf' Www '55, .ii fm h ,MZ 2 X X ? 6 Q Q 5-Sl - Qu m -5.' 'Z ' ff . R -W ,gg A X 'Q g -avg ch. X ix Ki 52 t, N ru, is k X . Eiga W , E is N li . MXN XA K .1 wfwwqvvnvfs W, J, WMMWWW A f, fp Nw Vip. . , L 5 4 3, Q K . Ro? X - X N. Ni K ' E x xi--mwxxsam-wkwwiwvwl' 1 11 w Q wwf vwffwf 5 MW 3 M .... , ..WQ.,..,.k,,f.,i-6-.vm QQ i Q QQ? 4 ,rf Zim 4 , V Top: Student food .s'w'x'icfc worlwrs pcvfnrnz an ifzdispwzsfzblc utility in Ilia 1'v.Yizlc'r1c'v hull David Bcmzi, z'00L's lzvlp, t'lll17IfL'.S' zz Snmll bowl into II Iurgw' rlzixirzg howl. Above: SIINICIIIA' relax in the irzforrmzl umzosplzvrv vf cz dorm room by playing a lzulzd of cards during x'i.s'im1i01z. mf wx ' 2 ,.4,, .,,.,.,. A 9 Keynote: RA Resident assistant has responsibility self satisfaction Being 1 lcixdunt xeslit mt IS 1 job for Qomwm who rully hkcQ pwplu As 1 ruldum lSSlStlI1t you not only gut to know m my new people md how they thmk but you IISO get to know youmclf buttu You fmd xoulself ru lCUl1l' to new ldv 19 md to new sltultlom th 1t you mwht not ordinarily find youlsulf Con irontcd Wlth It 12 L1 vuy bro ldLI1lHU gx peumcg m which you ICCCIVL IS much 15 you put ln A11 RA Q llfc I9 not his own He must bg rwdy to serve Ins Hoof hls dorm md myone else who muds him 'lt mv time The RA muq have cl 7 5 lady xvgr 'wc 1 positive pelsonlllty md 1W1ll IUUHCSS to wolk for and wlth thp dorm A Qprln-Y t1 umng Sesslon IS held after which RAs UL chosen A nwldmt 1s51st.mts job cons15t5 of much QLIILIIHCC coumclmg We h wa, to kezp tha, b 1ll rollmv 111 thu dorms He rs '1 lmml ll Cltclmll for m my ploblums Althou-'h ln RA -vets hls loom md nd hu hls hfc lb not L. y Mm hours up spent bemg 'ln RA You do not fully hwy my time to C111 your own Studyuw h IS to bu put oi? md youx gpmdus suifu Some RAs LIISCOVLI thlt oncp they h wg bucomu an RA they rc 1lly lI'K, not Cut out for thu job Const mt mturuptlons HOISL 1ldCk of sleep and the ldbl of llWdyS hwma to bc there uc just sump of the duly problems Wlth WhlCh In h me to contend Frm tlmg ns l 'x1... l1m1tn,d An RA 1115 one tru nl-'ht 1 wgck and one Tru. nwht on the wmlwnd Other nwhts h lvu to bc, spent IH tha dorm He IS xcqulrpd to chuck every hour to sec. th It everyone IS heh wmv m thu lounfms At mvht turns IIL taken to lock up thu dorm 1 his mcludes CIIGCLIHU to su th'1t the men h IVL luft the women s sxda th lt doors m thp bunldmg are loclwd md thu 1 door Uuud IS on duty Vac mon time for m RA IS rcducud He h is to rpmun until thu lxst student has left thy Hoon md hm to be them when thu hrst student urwus Plpur Work and weekly nuptlnvs irc other YIINL consummfv ICUVIIILS We hwe to dull with all thy problems of L dlugs drmkmv m rooms suxull problems md thc, moods of m my umqun, people It IS dlshcaltcnlnv Wolk xt f mes An LXPLFILHCL of the very best oppor tumty to prep up .1 collcgn, student ior my Occup mon is how mfmy RAs fult lbout then jobs Another view expressed WIS that bmw ln RA IS il lawn 111 hum 111 1ty It ruqulms totwl dCd1C1IlOI1 concern md IIHLILSK IH the HOOK li 1 wholp md m exch rpsldmt is an mdlvldu 1l 'lhu 1309111011 dem mds tlme unclgy md Splllt but It offprs mwirds IH countlus some times spummfvly lnslgnlficant wlys It 19 fmncrilly lQI'LLd th'1t RAs wlll not tr ldc, thur jobs Wllh myonc Mutmf' md .iw VVOllxll1U wlth dlihrgnt twpas of people IS m experience they do not wmt to lou The dLll1lI1LlS ITL vrelt 'md 90lNK,Whll tumv but s 1flSiylI'lg overall As one RA u It Bum' U1 RA IS 1 hvm-Y lpumnv cxpuuncp composed of m my tnuw d 15s wxth no vlslblg rLW1rdQ ILl5f pusonll s 1t1Ql 1ct1on md lulhllmmt 5' ' I ' U x r -I 1 .1 1 F ' '.:'w 3 ' g L , L.. . 4 .K r H 1 xr I 5 5 . L L . . . L , E' ' vi . 1 x f I . . X L X - rg ' K ' - ' x , W . X H ,A , -1, W. I . i t D X , . 5 .'3l 1 1' 1 . 1 f w . L. 1 L L . . . . 1 X , - a - 4 ' ' ' , 1. . X' X - '1 , . , L D X -'E w.' ' . ' ,,. .. 3 ' LA L . ,, , . . .i 1 x X 3 3 'v ' . 1 . , 1 1 1 ix v ' -' , L L . L , - E as C d . Q 'A 1 ,- . . .. ,. X , ...- gg L - j 1 r 5' -.I x 1 I . .5 1 1 ' 7 v LC. K . C 1 L L ' -f ' ' 1 , 1 C ,. . , . C, K . A A SL' ' . i 'H' x r 1. 1 7 ' 1'- 1 4 . g . I Q ' , . ' 44 , , , 1 . . L I f f -. . V 4- lf, ,Q A , . ' ' x- J' H' - , 1-N, ' - 1 a - - - 1 '- 1 x-1 I I i r ' E 1 , i VS' -'u L D 1 L c . 1 .A I , . L Q , , - 2 ' I ' 2 li -. 'un sl .. o X Z. 'N' L H, ' ,, ,,. ' X ,B - a 5 , - Y' 1 V xx ' x3'1 3' 1 x X.X x 1 r 11 X - - L L 1 ' 1 1 x X 1 ' x ' X 3 1 v 1 x r x 1' S L C - L A L gc, L K . C ' - I x X - v x l-' 1. .ui - - x . b, .1 . . . 1 E -. ,'- Z ' A x x- U X' . ' . ' ' -1.- ' . L - c a ' p - sf 1 L- 1 a ' . . , , X ,.', x -X ' , , '.' , ,- C , .L . 1 5 L . f 1 - r. un . N H I .4 EM ' 1 . L . sn: L L . L . 'T . L I x 1 H N '1 Q' 'U X 1 -r . '1 ' 1 ' W 3 '- 45 i rr L - - t kc . 1 .4 . A A .' , ' ' ,X . 1 qi L r 1 ' I 1 r Q D X 1 L D L . C. r 'v 1 x rf 1 1. L A . L. K . y 1 v . 1 x -, in L L .1 3 i 1 w X V Z-. xf Z N I wx' xx. 1 r ' X .. .J C X- ' x- 1 ' I ' x- ' w 5 b .. 1 1: ' 1 x ' A 1 i L L - lifi - - - ' ' ' - A 1 L.. C , 5 1 , 5 1 ' 1 ' x , .ui L . . . . ,, . . .C t . L' w 1'w 1 x x- - A . X 2-xr 'x 1 ' 2 1 1 V- 'w A' -v f' 5' 4 w 4 . H,'- 1 ' 1 bo. . als. . y K , , L , 1 . .. -, , , ' '. ' . . ' , ,.., , . L . L . .. .. K, -. 1 X 1 y ' 3 1 . L' J . ' , . ' . - L L K. L ' :L . C. ' 1- 5 1 y - ' 1 ' X- ' 4 ' 1 N b L. . L . . L c . , y 1- - 1- 1 'f w- 1 1 ' -.-x ' . . 1 1 1 . A - . . K C L K. L L , 'Y . , Z X 1 1 , 1 Z V , 1 it H I? ' 1- ' - '-1 . . ' - x. 4 ' .1 -1 ' ' xv. . - ., , 1. . , . 1 .., . x Q xr f 5Lf 1 w 1 . XAXH, ' 1 fxi V I ' l 1 15, I L L x L L A A 5 L .- . I- U ' 1 X ' rl 3 1 . 3 1 xx w I 1 x L . - L A 5 l Lb L A C 1 4 X U X X 1 . U . L- . n L . C, L N 2 Independents thrive Honoraries provided various services to the campus this year. Cwens, Echoes, Pleiades, and Cavaliers required a 3.0 grade average and active involvement in campus groups for membership. These organizations ushered, gave tours, wrote information pamphlets and performed other activities. Veteran's Club was established to cre- ate a place Where returning servicemen could enjoy social activities. Their pro- jects included giving a Christmas party for the underprivileged in the fall and painting family service centers in the spring. Flunkies Independent Organization has been a tradition at NIU since 1952. The Flunkies have won independent and all school championships in numerous intra- mural sports. The Beavers, also an intra- mural sport organization, is a small group interested in and proficient at athletics. Left: Really FIIZZIUITZCIII is CUl1CL'lllI'llfL'll on u Fllllllillif face after lzcnring 1110 lzzlcsl. Below: Aftvr nzuclz llnrzl work, lllc' Vets f'c'c'c'ivml flu' Mnymiv Trophy. Opposite top: Vcfs Clulfs service projects include fl Clzristrnas party for zuldcfrprfvilegcd chil- zlrvn. Left: A l71Fl77bCl' of 1110 Flzznlcivx 1llLlL'Pl'lILlC'lIf OI'tL'IllllZllll0Il Ends nzcfclizzgs I1 lilllc 1IlllI1lII'0lI.S'. Above: Wlnnvr of nmny lIlll'flHIIll'tll .s'pr1l'f.x' c0l11pc'Iiti011.s', Fl0'.s' plan .s'Irf1lz'gy. 'fe 1 M ,Q 241 Below: All wa! Vai, Doug ff0l'H'l'I', ff0IlIIt1l'I'.S' in Ilzv Lugrmzz nflvr ll lmrd Illg. Right: Cmzlri- lmtvfl lu' ilu' Vt'l'.S' Club, A11101'ic'111z flag fiicx. 'Q zgy, V , 7 , V ,,V, ww Www Q1 Q5 , , fvfy H 218 Above: Fllll1lifU PI'C'Sfl1t'IIf, Rolwri fJH'l'lI.Y, p1'v.x'izlz',s' UVCI' Ilzc' weekly H1l'C'lflI.L' wllilz' 501110 cigal s1110l4i11g Fvllllllifllf cfxpwss Il1c'i1' 011i11i1111.s' 11110111 1110 las! F10 h41.s'lmll1r1ll LUNIIIU. ,YP ,mf 3 X X WY' ax QNX .. if- - gk. . ,Q S Nd ,S F gf as X Q SQ as J nl- X GREEK Greek life i total involvement Hi! Wlmfs your major? Penetrating qrlestiolzs arise during rush parties. Rush begins. Houses are visited, coffee is drunk, smiles exchanged and anguish experienced. Finally the decision is made. Pledging and a whole new way of life begins. After months of tense anticipa- tion, initiation takes place and at last the pledge becomes an active. Soon the active learns that Greek life is not confined to one house, to Greek Row or to the Pow Wow Room. The Greek is involved everywhere on campus and in the DeKalb area. There are the fun times as the active mingles uptown or participates in a mixer sponsored by a Greek or cam- pus group. There are also the serious moments when the active helps with a service project or is involved in campus organizations. Vt x .-M, .,.. 5 -, 5, . gg W t. X. : Q X -3 Q, isis ffl? N ails we Q Q iii: M.. , MMS, is ISI-rx: I' 38181 L -31 fit, , ky is-A gf-W -2. N Q. iv K iii ,sf ' M2521 Ax fx X A . y i ' -xfgg Q . s, isi w v 3 Q ,Wi i A JJ X2 , K .,.. , K: 1555 X I Sf K ,Sf A . , K W 'A -' k - 'f'-51f5k: lyk 'f--::':FEFi:-::5- -SSG: 'K - k . A Ex ' 0 Q, 3 S' O X - -A X Alpha Delta Pi Alpha Delta Pi sorority, which was founded at Wesleyan Female College, Macon, Georgia, the oldest women's col- lege in the world. was the first secret sisterhood for college women. On May 15, 1851, 19 women organized this group under the name Adelphean Society. In 1904 a policy for expansion was adopted. ln 1913 the name was changed. At the 1951 Centennial Convention, held at the sorority's birthplace, it was voted to adopt work with handicapped and crippled children as the national service project. NlU's chapter of Alpha Delta Pi, which went national in 1964, is one of 126 chapters. lt supports the national philanthropic project by entertaining crip- pled children. The chapter received two special awards at the national convention last summer. Their faithfulness in writing un- solicited chapter letters to the national officers each week was recognized by the President's Award. They received the Music Award for their sorority songs. Members of the sorority are active in SA, UCB and honoraries. Others are involved in campus media. Ar an l'X'Cllllll,L'l' Alpha Dvlm Pi lUl'H1l7f'l'.Y nike 10 Ihr' floor In display Ilzeir flruzcing abilities. Alpha Kappa Lambda Alpha Kappa Lambda fraternity, which was founded at the University of California. Berkeley, on April 22, 1914, was the hrst national fraternity founded on the Pacific coast. It was an outgrowth of the Los Amigos Club. which was organized in 1907. The fraternity has a housing and fi- nance program which provides new chap- ters With modern homes and gives all chapters the opportunity for new housing. More than one-half of the houses are less than live years old. NlU's AKLs went national on Novem- ra 'Q- ber 14, 1964 and are one of 42 national chapters. They started as the Phi Delta Sigma local fraternity in '62. Each year the AKLs sponsor the Mardi Gras dance. They also sponsor the soror- ity volleyball tournament and the frater- nity pledge volleyhall tournament. They are active in all intramural competition. The AKLs are active in many campus activities. One of their members is Greek editor of the Greek newspaper. Others work for Computer Services. the Nortlzcfrn Smr and Ricks. Brothers are in Sigma Delta Chi and the AMA. Alplm Kappa LIlllI,7ffll,.V sc! up llll alirrzclire dis play 111 Ihr' rlctiviliex fair I0 lure f70fl'lIffIllI71Cf1gCS. Ar a S11ppr'cs'svzl Desires party Alpha Kappa Alplzas and guests dress to reveal l1ia'flc'l1 desires. Alpha Kappa Alpha sorority, founded at Howard University, Washington D.C. in 1908 was the first fraternity among Negro women. The sorority is engaged in a varied program of civic, social and educational services. Many scholarships are awarded annually to high school girls to provide continued education. Undergraduate scholarships and fellowships are also available. Another national activity is the Ameri- can Council on Human Rights, sponsored cooperatively with five other Greek-letter organizations. Their Cleveland Job Corp Program was featured in October's Ebony magazine. NIU's Alpha Kappa Alpha chapter, which went national in May, 1960, finan- cially supports its national's projects. The girls also tutor in Chicago's Lawndale dis- trict. In November they sponsored a Can- Can Dance where everyone attending brought canned goods for the needy. Last spring the chapter was cited as the best regional undergraduate chapter at a convention in St. Louis. Their members are active in AACO. K QW ff we 4 X ,avian Nail Plllllfli lll 'VICTUUI L i Uiztptil' 'ff-. .A Alpha Xi Delta Alpha Xi Delta sorority was formally established at Knox College, Galesburg, Illinois, on April 17, 1893. In 1902, in cooperation with Sigma Nu fraternity, the chapter members developed a constitution which declared their naturalization. Alpha Xi Delta, which established a business oflice in 1918, was one of the first sororities to realize the need to cen- tralize the administration of sorority business. As a part of their philanthropic program, 21 hospitals for tuberculosis patients have been given memorial libraries. NIU,s chapter of Alpha Xi Delta, which Went national in 1959, is one of 140 chapters. Last spring at their province convention, the sorority received the Achievement Award. One sister is a cheerleader, one is on the Northern Star staff and another works on the Norther. One sister served on the Homecoming Committee and another Alpha Xi Delta served as co-chairman of the Winter Carnival Committee. Tired of the routine craps at Northern, Alpha Xi De1fa's turn 10 rmlletrv. 226 Alpha Phi Omega Alpha Phi Omega, national service fraternity was founded at Lafayette Col- lege on December 16, 1925. Three years later in 1928, APO's seventh chapter was formed at Northern Illinois State Teach- er's College. Today, APO has over 500 chapters. Once required to be members of the Boy Scouts, APO's still follow their oath and laws. National headquarters are in Kansas City, Missouri. The Eta chapter at NIU has over 1,000 alumni. During World War II, three out of every four men at NIU were members of Alpha Phi Omega. A service fraternity. APO's were in- volved in many service projects this year. The fraternity Went to Clinton, Iowa, to fill sandbags along the iiooding Missis- sippi River, helped operate registration. and sponsored a talent show with Alpha Delta Pi at the Dixon State Mental Hospital. The Ugliest Man on Campus Contest is sponsored annually by Alpha Phi Omega. Money raised by the contest is donated to charity. APO's are active on campus with brothers involved in the UCB, SA, and one brother is president of YR. Fl'l'fIll,t,' riglzl ut lI0lIIC' ut Dixon Stale Mental Hospital, thc' APO'.r put on ll real show Of talent. Alpha Omicron Pi Alpha Omicron Pi sorority was found- ed at Barnard College in 1897. In 1930 its international movement began at the University of British Columbia. The Frontier Nursing Service in the mountains of eastern Kentucky is the national philanthropic project of the AOPi's. The sorority supports a trained social worker. NIU's AOPi chapter, which went na- tional in 1954. supported the local phil- anthropic work of care for underprivi- leged children by having a party for 20 children in DeKalb. This year the chapter won the 1969 Achievement Cup, which is given to 10 chapters at the bi-yearly national con- vention. The award is based on grade point, campus involvement and the at- titude of the chapter. The AOPi's are active in campus or- ganizations. One sister is on UCB, one is on the Northern Star and another works for WNIU. Many sisters were on the Win- ter Carnival and May Fete Committees. Two sisters are members of Pleiades and others are members of honoraries. 228 Open-housing laws force Greeks to accept AOPi's. .Scuetlv plotting tht talw-over' of General Motors, DSPH stealthily cart' the electro-motive division. Delta Sigma Pi Delta Sigma Pi, a professional frater- nity in the field of commerce and busi- ness administration, was founded at New York University on Nov. 7, 1907. To be eligible for membership in the fraternity, the student must be regularly enrolled in professional business courses. The Delta Sigma Pi Educational Foun- dation was established in 1953 to ex- pand many of the services that the fra- ternity provides in the field of business education. It also develops additional projects in business research, NIU's chapter of Delta Sigma Pi be- came a national in April of 1968. This year the chapter tied for first place in the Chapter Efiicieney Award program. Last spring the fraternity served as guards for the art show. This year they sponsored Project Cake, which provided a birthday cake ordering service for NIU parents. Their fall pledge class served as Santa Claus this Christmas in downtown DeKalb. Their members are presidents of six of NlU's eight business organizations. Two brothers are SA senators and one works for the Northern Star. 229 50 6543 3 Q63 p 3 I 15 20 21 A U I1 I3 1 2 ! 4 5 6 7 B 9 I0 Alpha Della Pi: 1. J. Schindler 2. R. Honeg 3. S. Tanker 4. M. Hanxen 5. C. Hugiad 6. F. Wilkins 7. B. 0'Br1'en 8. D. Creek 9. K. 0'Dunnell 10. J. Miller 11. E. Sknglund 12. I.. Muir 13. I.. Novusel 14. L. Alamprexe 15. M. Harrixon 16. L. Cebulski 17. H. Hrberl 18. S. Bower 19. P. Meyer 20. M. Mc'Naughlon 21. J. Sieman 22. D. Slvck 23. K. Ruslaburg 24. J. Rankin 25. M. Bennerke 26. J. Wmlarzyk 27. P. Miller 28. D. Peter 29. C. Ruwe 30. P. Aves 31. M. Baldwin 32. L. Mariine: 33. P.S1even.vvn 34. L. Randnur 35. B. Olsen 36. J. Buller 37. S. Wewl 38. E. Ellenherger 39. K. Grub- erl 40. B. Kuvanir 41. C. Porrer 42. J. Callahan 43. C. Wolf? 44. P. Phillipx 45. J. McKenzie 46. M. Waeh 47. B. Svheri 48. S. Legris 49. E. M1'Dug1e 50. I. Carvahlrn 51. C. Clulhier 52. C. Neal. N01 pl1'llIl'Fd.' D. Kovanir, P. Thinger, C. Parish, M. J. Running, P. Hausnian, G. Hummel, D. Reid, K. SQXIGIV, L. Marxan, E MrAu1l'ffe, L. Marlin, J. Daw, N. Rolh, V. Phillipx, A. Baleman, E. Herman, B. Bennelt, P. Kopera, M. Kemp. L. Kleinhans, B. Cale, P. Gregurj, and J. Krirk. X 8 1 . QBYJDBV K AJ an M ,M ,M .11 I 392 ao an U Q4 55 U 10 X H sa M vs 16 17 'B ' KGS 6 7 2G H so 2 27 U ! I 1 2 3 42 f KD J 12' I3 Il Q7 K X LJ f Alpha Kappa Lambrla: I. G. Cliff 2. R. Splapl 3. C. Coxon 4. J. Perexek 5. B. Linwald 6. T K7l6!'11I 7. ,L Stafkrrd 8. M. Sanderx 9. R. Lapelina 10. S. Hainea 11. Tf Barrerla 12. G. Kryinxki 13. 'If Laird 14. M. Hurgan 15. C. Larh 16. N. Mavvam 17. J. Sala 18. C. Holinka 19. F. Marlin 20. F Wegrzen 21. F Vasek 22. F. Pulz 23. R. Ciarnello 24. D. Fie1d5 25. S. Kilgaril 26. R. Kampere 27. E. Mul- crone 28. R. Mmlifk 29. S. Miller 30. R. Molrka 31. J. Koxlek 32. D. Wulf 33. B. .Maxon 34. P. Fryendal 35. J. Haley 36. F Sipuria 37. J. Melz 38. D. Krueger 39. J. Jrrlinmn 40. C. Corniola 41. J. Weimhqg' 42. T Warner 43. B. Nemenich 44.J.Sc11rn11l1 45. I.. Bemler 46. J. Ademefk 47. G. Er1c'k.mn 48. R. Mi'Ar1d1e.v.x 49. J. Couglilin 50. B. Capulo 51. R. Klemm 52. B. Swank 53. D. Gibula 54. G. Sapa. 1 4 u 7 1 9 7 X B 10 nv 11 13 14 15 me ' as 19 ao 21 M I 3 6 7 ' 4 1 - ' e 3 4 5 1 fN Alpha KappaAlpha.- 1. A. Black 2. D. Jackson 3. G. Lewis 4. G. Lawrenre 5. S. Hardy 6. Z. Cam- Alpha PhiAlpha.' 1. R. Thompson 2. 0. Donald 3. M. Stringer 4. C. Jackson 5. R. Edwards 6. J. bell 7. L Grundy 8. A. Smirh 9. M. Minor 10. K Perry 11. S. Slevenx 12. I.. Anderson. Nvlpieruredx Blackburn 7. T Arringmn 8. R. Duf 9. M. Miller 10. G. Edwards Il. D. Wilmn 12. J. Oliver 13. T E Gray, A. Carman, P. Moore and M. Carler. Digg.: 14. R. Aikens 15. J. Cumpiom 16. H. Carnell 17. Mayheld 18. If Newmn 19. W Draper 230 20. J. Williams 21. B. Cusler. Norprciureds R. Janes, C. Woodridge, L. Turner, C. Ivey. . 3 4 , . s ' 1 ' A - 3? sq ' 2 3 61 P ix' HlL9 'l1 2 34 5 6 1 lm im 1 4 3 I5 21 I 45 45051 ,X-it l 4 ' A . n --f ... .- . 1- a - M ' ' 6 1 ' Q 'L - I 1 29 4 6 , ' ll Ahzha Phi Omega: 1. J. Danielson 2. P. Callog 3. I 0'Lear1' 4. J. Wliision 5. R. Parkin 6. H. Bull- Alpha Xi Delta: 1. K. Deerins 2. L. Blair 3. B. Brennan 4. I.. Mirkow 5. S. Spalding 6. A. Heinz 7. incl: 7. B. Astar 8. B. Powers 9. 71 Ryder 10. G. Skofzek 11. B. Rauser 12. J. Chan 13. K. Leesman P. Faneher 8. S. Grimm 9. P. 0'Neil 10. B. Barnard 11. P. Wells 12. 1.. Goldberg 13. J. Cunningham 14. J. Herzing 15. D. Krausse 16. R. Babivh 17. B. Vanaiiu 18. J. Wallin 19. G. Tonefl 20. B. Cozad 14. J. Marzowski 15. B. Wohl 16. C. Ulyasz 17. M. Lamherl 18. S. Bush 19. Ti Strand 20. C. Res- 21. J. Nolan 22. G. Shirling 23. J. Nellis 24. J. While 25. B. DiPaolo 26. J. Pazdur 27. E. Garofalo Czek 21. J. Reberg 22. D. Koprzewslci 23. M. Mall' 24. D. From 25. C. Cerkleski 26. K. Mueller 27. 28. F Miller 29. J. MeClay 30. J. Salelia 31. B. Bahirh 32. C. Sowka 33. P. Hunsberger 34. E. Sian- J Kamin 28. P. Bruck 29. C. Ciecko 30. J. Clawson 31. D. Wegner 32. C. Mivliula 33. D. Baaris 34. islawski 35. 71 Keilman 36. 71 Johnson 37. C. Blank 38. W. Sikorski 39. R. Johnson 40. M. Kabarel' I. Levenlhal 35. C. Davis 36. S. Williams 37. K. Wiser 38. V. Willis 39. K. Claverl' 40. K. Simons 41. J. Nurre 42. B. Nielson 43. D. Newell 44. G. Smilh 45. J. Thompson 46. B. Ballani 47. J. Nowic- 41. P. Russo. Noipiciured: K. Ryan. K. Selmariin, M. Sandwell, A. Casler, R. 0'Neil, A. Defhambre, ki 48. 71 Clark 49. D. Fiday 50. I Maloney 51. S. Kalher. N!Jlf7ll'l1If?ll.' D. Conrad, D. Owen, J. Kral- K. Birch, V. Saas, N. Swilzer, P. Zinzer, K. Maloner. K. Anderson, S. Brrani, L. Larson, 1. Diiello, ky, E Dutak, D. Johnson, D. Finfh, W. Jackson, K. Anderson, T Newlon. R. Steger. 29 28 33 34 17 35 w - 34 zo 21 6 Q ? ' I 15 19 22 73 24 25 26 ml 4. . 37 J J, ,O '5 4 5 q V0 ' as ' I O2 B. A gl 9 l3 7 8 9 10 I1 n 0' 'J 4, 45 13 ll 15 I 'Il I 2 3 4 5 0 Delia Sigma Pi: 1. C. Hofbauer 2. J. Moll 3. B. Pale 4. S. Ruda 5. J. Kelley 6. L. DeMen1 7. P. Alpha Omicron Pi: 1. K. Larson 2. J. Jacobsen 3. S. Pirk 4. M. Blalia 5. S. Argenii 6. K. O'Ha1- Thompson 8. J. Neyine 9. M. Nelson 10. A. Domin 11. G. Segura 12. R. Kilbride 13. E. Nesheim 14. loran 7. C. Kurtz 8. J. Grimes 9. S. Sehiewe 10. J. Anderson 11. P. Frug 12. B. Glajsek 13. L. Dab- B. Lislman 15. M. Courage 16. M. Killen 17. D. Gergiis 18. R. Errnilio 19. P Gore 20. J. Lesrikow key 14. N. Green 15. K. Rirhler 16. L. Asaro 17. S. Sheldon 18. P. Rewers 19. S. Edison 20. D. Ford 21. R. Wallace 22. J. Connor 23. R. Barrels 24. J. Lsaarson 25. Dr. Rirharcl Howland 26. Dr. George 21. B. Lawless 22. R. Leazzo 23. C. Moirev 24. B. Freeberg 25. V. Firzanko 26. S. Venzke 27. L. Bishop 27. G. 0'Connor 28. J. Kozak 29. R. Lewis 30. J. Lenlz 31. B. Bergland 32. D. MrDonald Palleva 28. S. Ekstrorn 29. C. Maksay 30. J. Mizller 31. B. Pauiz 32. S. Fraley 33. D. Yiehler 34. L. 33. J. Martini 34. D. Goff 35. M. Halloran. Noipiciured: J. Roevklein. J. Kiss, K. Gruns, R. Hag- Rissman 35. N. Kloss 36. B. Hulka 37. S. Huerlz 38. S. Doering 39. S. Mc'A voy 40. L. Hamilton 41. berg, M. Killen, G. Maguire, M. Miller, L. Nelson, R. Pruclia, J. Srhuliz. J. Sondell, B. Townsend, R. Porneranis 42. S. Molway 43. K. Nelson 44. L. Filzgerald 45. D. Shevin. Nolpiclured: M. Grum- M. Treaagv, R. Whitlaker. mel, J. Raihje, B. Mannarelli, C. Darby, L. Hardi, EJaedlke, M. Paulson, M. Leslaghe, J. Ellis, T Evers, P. Wilhelm, L. Ugel, L. Boizlv, L. Lerquin, 0.M1on. V. Prue. Pi Kappa Alpha Northern's Delta Tau Omega local fraternity went national this year becom- ing Pi Kappa Alpha. In November 1967, 45 members of Alpha Pi Omega service fraternity voted to become Delta Tau Omega social fra- ternity. They were recognized by the Stu- dent Association and the Inter-Fraternity Council in February, 1968. Pi Kappa Alpha was founded by con- federate soldiers in 1868 at the Univer- sity of Virginia in Richmond. Pi Kappa Alpha sponsors two Rose Sales each semester at the University Cen- ter. The Pikes also run the annual Pow- der Puff tugs for sororities. Each semester the Pikes sponsor an orphanage project. In the morning the borthers clean up the orphanage and then take the children on a picnic. Pi Kappa Alpha's are active in athlet- ics with brothers on the baseball, track, rugby, soccer and hockey teams. Pikes serve the campus with eight members on the May Fete Committee. The chairman of Homecoming and the IFC Standards Committees are Pikes. Idolizing Tiny Tim the Pikes spread roses and kisses at the University Center. yr Delta Upsilon Delta Upsilon, the oldest national fra- ternity at NIU, was founded at Williams College in 1834. As a nonsecret frater- nity, DU was formed as part of an or- lganized protest against the secret so- cieties that were being formed. In 1847, DU became a national fra- ternity whcn a confederation of nonse- cret societies was formed. The group adopted the Greek letters of Delta Upsilon. DU came to the Northern Illinois campus in 1966 and was formed as Alpha Chi Epsilon local fraternity in 1963. This past year, NIU's Delta Upsilon chapter got two awards from the na- tional fraternity for the best pledge edu- cation and excellence for a chapter on a campus with over 20,000 students. Service projects by DUs this past year included parking cars for the University at all football games and ushering for UCB musical events. Active on campus, brothers of Delta Upsilon worked on the Northern Star and the radio station. Two DUs are SA sena- tors and others are in honorary depart- mental fraternities. Athletically, DUs arc on the basketball, football, baseball and swimming teams. The local fraternity also won the All-Sports Award. Trying to play Scrooge on their annual Duck Day drives DU pledges 10 the point of being dajffy 'iq RFIQ, vs A A..m ff 0349 WRHIIING l Alpha Sigma Alpha Education has been a dominant factor in the development of Alpha Sigma Alpha sorority since it was founded in 1901 at Longwood College, Farmville, Virginia. Alpha Sigma Alpha altered its pro- gram in 1913 to serve those preparing to enter the teaching profession. In 1915 it established its identification with the field by forming the Association of Edu- cational Sororities with Tri Sigma. The Alpha Sigma Alpha National Phil- anthropic Project funds are used to fur- nish various services for education and aid for the mentally retarded. The Beta Rho chapter was founded at NIU in 1948. As a service project, they have supported an adopted child in Ko- rea. They also carol in different hospitals at Christmas and do volunteer work at Dixon. The Alpha Sigs, who were chosen as Sorority of the Year, are in many activi- ties on campus. Two sisters are SA sena- tors, two are on the SA Election Commis- sion and three are members of the SA Speakers Committee. Gther sisters are in the orchestra, chorus, Orchesis and the Pom Pon squad. Nine girls are on the Dean's list and one is a Pleiade. Using a lzcuzdkerclzief to wipe away a tear, one Alpha Sig sisfer grooves Io a sclzmaltzy p0Ika. Little Jackie Paper dir1'n'r think il was ISIICII ll zlcal' wlzwz ZBTA' offeree! Puff tl free 1101110 in the Kish. Zeta Beta Tau On December 14, 1969, Tau Gamma, local fraternity, was chartered as the Gamma Omega chapter of Zeta Beta Tau. Founded at NIU in 1966, Tau Gam- ma was composed of men wanting some- thing different in a fraternity of bnother- hood. ZBT was founded on December 29, 1898 at the New York City Jewish Theo- logical Seminary. The fraternity was formed as a Zionist movement, but be- came a social fraternity when chapters were formed on several campuses. In 1954, ZBT changed its constitu- tion at a national convention and voted to be nonsectarian. Phi Sigma Delta fra- ternity merged with Zeta Beta Tau in May of 1969 expanding the number of ZBT chapters from 62 to 110. Members of ZBT at NIU are in the honorary management fraternity, on the varsity baseball team and one brother is a cheerleader. Scholastically, the ZBTs are consistently high. The active brothers of ZBT placed second for highest grades in the 1969 academic year. Alumni Clubs of Zeta Beta Tau are situated in 50 geographical locations throughout the United States. The Zeta Beta Tau national headquarters are lo- cated in New York City. 235 Alpha Phi Alpha Phi sorority, which was founded at Syracuse University in 1872, was a pioneer among sororities in many ways. They were the first to build a chapter house, the first to adopt a plan for su- pervision of their chapters by visiting of- ficers, the first to publish a history of their first fifty years and the first to have an en- dowment fund of 350,000 They formed alumni chapters in Boston and Chicago in 1889. Alpha Phi was also instrumental in forming the National Panhellenic Con- ference. The Heart and Torch Award, the highest tribute bestowed by the American Heart Association, was received by Alpha Phi for its Cardiac Aid Projects. NIUls Alpha Phi's became activated in March, 1969 to form the Epsilon Delta chapter. It is one of 94 chapters. They had previously been members of Delta Sigma local sorority, which was formed by five girls in September, 1966. The Alpha Phis support the American Heart Association through volunteer services and aid, Two of the Alpha Phis are Pom Pon girls and another sister is a majorette. Three sisters are on UCB and others are in departmental honoraries. The theft of Douglas' float plum' is prepared, but the Alpha Phis are warned by ll sister that should they choose to accept the niissiori and fail, no knowledge of their activity will he claimed. Theta Delta Xi In October of 1968, 12 men founded Theta Delta Xi fraternity in Grant South. One of the youngest fraternities at NIU, Theta Delta Xi functioned as a social or- ganization for a year. Inter-Fraternity Council recognized Theta Delta Xi as a local fraternity on May 7, 1969. Theta Delta Xi is characterized by di- versification. The fraternity plans to live up to its ideals of quality rather than quantity, and hopes to maintain a closely- knit brotherhood. In Theta Delta Xils first year as a ree- ognized fraternity, the brothers have moved into a house at 350 Augusta Drive. Theta Delts sponsored a Powder Puff Basketball Tournament for sororities in March and hosted their families on Par- ents' Day. In the spring, the fraternity held its second Blue Garter Formal. Members of Theta Delta Xi have been active on campus by participating on the football, soccer and golf teams. One brother Was elected most valuable player on the golf team. Other Theta Delts were in the Ski Club, Weight Lifting Club, Sports Car Club, Oiiiciating Club and Veterans' Club. Theta Delta Xi hopes to affiliate with a national fraternity next semester. The blood, sweat, and tears of pledging became sighs of, Yon made me so very happy, once activated. Theta Deir pledges just experienced the aclives' version of a kinetic playground. Theta Epsilon Theta Epsilon, NIU's newest local fraternity, was organ- ized on December 14, 1967, though it wasn't recognized by the Inter-Fraternity Council until the spring of 1969. The three founding fathers, Brent Ginther, Greg Horwitz, and Fred Williams wanted to establish a fraternity that would stress the individual. This would allow each member to think and act independently while enjoying fraternal benefits. The fraternity sponsored the Danny Thomas-St. Jude Lu- kemia Drive at NIU. The Theta Eps sent letters to every organi- zation on campus asking for donations. They set up a table in the Center for three days so students could make contributions. Theta Epsilson collected over S170 for the drive. In the fall Theta Epsilon sponsored a Pumpkin Sale in front of the University Center for two days. In this, the second year of the sale, Theta Epsilon collected 570. In the future the fraternity plans to grow their own pumpkins. The treasurer of Young Republicans, an SA senatorial candidate, and three members of Phi Eta Sigma, freshman hon- orary fraternity, are members of Theta Epsilon. Successful peddlers of pumpkins, Theta Epsilons hope to become farmers. Alpha Chi Omega Alpha Chr Omega sororrty at NIU was formed from a merger of Chi Delta Chr and Gamma Alpha Mu local sororrtres rn the sprmg semester of 1969 Founded at DePauw Umversrty m 1885 Alpha Ch1 Omega has mamtamed an unusual interest rn the fine arts. Its seven founders were all muslc students and untrl 1915 the constrtutron requrred that a certam percentage of the sororrty members study muslc The sororrty was the first colleglate sororlty to requrre the attamment of a scholastrc average for 1n1t1at1on and also the first to appomt alumm advrsers for IIS colleglate chapters Smce 1947 the major phllanthroplc Alpha Chl Omega s prove zeal cut ups project has been A1d for Handrcapped Chlldren The fund admrnrstered through the Natronal Socrety for Crrppled Ch1l dren and Adults IS used for schoolmg doctors dentrsts nurses teachers and theraprsts des1r1ng addltronal trammg m the Held of cerebral palsy At NIU Alpha Chrs made Thanksgrv mg favors for a nursmg home as a part of therr phrlanthroprc program n F-. B in 231. -Q i vy? . . Ll. .f fi I 5. 2 3 39 M 47 4, 15 2 3 4 5 7 l 1 1 5 Della Upsiloni 1. R. DePhilipy 2. J. F11nr'ik 3. J. l.aml.v1r0n1 4. R. Murray 5. D. Greiss 6. G. Snwa 7. C. Ulbrechl 8. J. Micelli 9. D. Hirks 10. B. Oilen 11. G. Remlms 12. M. Murphy 13. R. Kimball 14. J. Burger 15. G. Sladerk 16. W Wvvqli 17. R. Smnirh 18. G. Katulas 19. G. Hayes 20. C. Cald- well 21. M. Cummings 22. J. Carlson 23. 'R Dunlop 24. J. Gulshell 25. G. Knudson 26. R. Maloney 27. M. Sullivan 28. 71 Paulauski 29. P. Bmrfks 30. M. Harrison 31. B. Housmn 32. G. Orlman 33. M. Carlson 34. C. Koules 35. 1.. Trainnr 36. M. Ullivk 37. D. Zanarzlo 38. D. Brink 39. M. Malloy 40. S. Roehe 41. D. Henniger 42. J. Cheslm 43. K. Galle 44. K. Tranmwski 45. J. Kauls 46. J. Wil- liams 47. F Cellazlirm 48. T Grssler 49. B. Erlanzler 50. B. Sandora 51. F Frey 52. B. Krug 53. M. Heinz 54. P. Brown 55. K. Laurenre 56. 1. Oslergarzl 57. D. Murphy 58. M. Tmlnern 59. D. Carraher 60. J. Baeceri 61. 71 M4'Kiernan 62. R. Marvanlrmiu 63. D. Huber 64. J. Gezlelnzan 65. M. Olsen 66. B. Van Gelder. Nulpic'!urezl.' J. Zeilinski, C. Parker. B. Mallnvr. A. Bengsmn, R. Moss. A. Norurn, J. Cherveny, B. Nelson. C. Pepe, P. Janik, S. Goehl, J. Harringlnn. 23 26 1 29 30 4 35 38 9 40 an 2' Della Tau Omega 1 B Llllflfl 2 U Glllvgll 3 B Barrel 4 L Marszalnk 5 T Fltzpalrifk 6 B De Frang 7 M Wernsiem 8 0 07112 9 J .lernzal 10 H Saclkin 11 R Fuerisrh 12 J Zzzzo 13 B Paszzak 21 N Malmlm 22 B Grlesiak 23 D Sumskl 24 D Walsh 25 R Wold 26 J Yakel 27 G Ring 28 B Jarer 29 P Cipolla 30 D Zaura 31 P Pe1ra111s 32 R Spina 33 B Essarx 34 R Glusek 35 B Arnold 36 G Flynn 37 D Pugh 38 D Olzlfeilrl 39 J Wood 40 B B051 41 J M11 ler 42 J Rammml Nolpizlured J Gluvzek J Kauak L Burzla R Reich D Chapman D Charneis 7 28 3' 32 38 41 42 3 2 13 14 H I6 17 7 8 70 1 2 2 4 5 . A 3 9 - 3 V 4 f I0 1 1 W 'Z Kopp? 14.1. rename 15.-L.Sleffen v16.4G.1ffmhar11' 17.R.Whi1e '1sfA.0fmy0 19.G.Fuis1 20:81 can-hm 14. M. Josephsan 15. L. Levine 16. J. Kamhf 17.7fI.UpeZ 18. J. Lipman 19. K. Berg 20 Alpha Sigma Alpha: 1. R. Shapiro 2. J. Falen 3. R. Wiczer 4. A. Conwav 5. D. Ames 6. M. Ruben 7. N. Beeharas 8. C. Hayes 9. M. Feusahrens 10. C. Slrung 11. S. Gershnn 12. D. Clossen 13. P. Clark 14. C. Burner! 15. M. Gegaran 16. C. Ruppralh 17. C. Ulilir 18. K. Riley 19. J. Hanley 20. M. D0Mgl'l6fl4l' 21. K. Slamm 22. Il Gawne 23. B. Harms 24. C. Trampas 25. N. Hahmann 26. L. Lakin 27. J. Wi!! 28. S. Colson 29. P. Burghi 30. D. Mrkavr 31. C. Gran! 32. L. Zavmlny 33. J. Pelerson 34. C. Schroeder 35. S. Gerber 36. C. Gran! 37. J. Nnurlag 38. D. Pazlgill 39. S. McDonough 40. J. Kadison 41. L. Daum 42. J. Holzharh 43. 1.. Grupe 44. D. Delaney 45. C. Herman 46. J. Cunning- ham 47. M. Weinberg 48. P. Willey 49. P. Balfes 50. G. HlI7lI1'f 51. C. Russell 52. S. Olipra 53. B. Beer 54. G. George 55. L. Vasluski 56. K. Riley 57. K. Saillis 58. 1.. Righi 59. J. Marks 60. L. Car- siens 61. B. Sr-hweiizer 62. A. Mirkel 63. G.Areml1. Nu1pi4'1ure:l.' P. Barrlieski. E. Bernal, S. Gagliano. S. Iverson, M. Johnson, J. Leuly. C. l.ui'k11w. J. Ness, M. P1111 lwpek. M. Tavurmina. P. Weiekle. 0 15 12 '6 19 26 27 9 13 14 15 11 15 ., a 4 5 W1 Zela Bela Tau: 1. M. Harrison 2. J. Finler 3. D. Grirsonis 4. M. Teirhman 5. A. Eskinazi 6. R Freund 7. B. Kuhn 8. D. Mizlzllemn 9. J. Levin 10. J. Slarlanzl 11. R. Viz mr 12. N. Kazumis 13. M R. Weisman 21. S. Marriss 22. M. Levy 23. J. Jusephson 24. M. Bean 25. S. Slein 26. H. Fine 27. D Blilz. Nuipiciuredx R. Sheazle. B. Ammon. B. Thurlow. S. Krause, J. Siarkland, R. Eller. J. Raiber J. Leland. G. Ganlan, D. Rmlkin. C. Pnlr1nsk.1'. G. Adler. 6 Wim r 2' Yi' 'Qf.'-QQ? ' 12 34 so H fi . N 27 Alpha Phi: I. N. Barney 2. J. Horner 3. K. Mn'Glel1nm1 4. Y. I-llrrish 5. D. Bv.x'lf'r 6. L. Rohan' 7. J. Siegal 8. C. Snlrmmn 9. L. Burk 10. M. Chlaperka 11. N. Plwlm 12. M. Purl.wh1' 13. D. Gvuzzn 14. J. Ruherls 15. S. Marino 16. S. Reed 17. S. Granzin 18. IJ. Rnllmlan 19. C. Menkf' 20. M. 0'Mall4'v 21. I.. Phillix 22. J. Slarzyk 23. K. Tronxen 24. B. Howl 25. C. Nulmn 26. S. Krueger 27. V. Amlvr- .mn 28. G. Jfmx 29. Ix'..S'klm1m4'.xki 30. K. 1,axi0wi1: 31. J. Daw 32. K. Mell 33. J. Svallan 34. D. Brnx- Imm 35. C. Wallzfrx 36. C. Rusniak 37. K. Knapp 38. K. Gaulmfl' 39. L. Bewlzlulzl 40. P. Zi1mm'r- man 41. J. Vaughn 42. M. Ellul 43. J. Lgfler 44. I.. Mzlxzzll 45. S. 0'Mallc11' 46. N. Walarx 47. K. Farnsworlh 48. C. REIIIH' 49. S. Fexyenzlzfn 50. K. C'uu'1wr 51. IJ. .Sll'Zl'IPl'lf1 52. L. Illavalv 53. 1.. Dulkiewirz 54. C. Amlvrxrm 55. M. Tangorru 56. T Gurmm' 57. W. fiullm' 58. R. Wellv 59. C. Sc'11mi1I 60. B. Wirlufrl 61. I.. S1 lvullz. N0lpi4'lw'ml.' M. Aurvliu. I. Iirrnn. S. Cruxx. B. Ifrl. I.. Farkax. K. Fleming. K. liarrnmn, C. King. J. Slach, P. Slum: J. Bnfrmun. S. Kirmullx, M. Lexlie. Them Della Xi: l. S. Hein: 2. J. Kaliml 3. B. I'al'lwr 4. 1.. I-Ylulkllcfr' 5. J. H'anl 6. 72 ilwlkfn 7. 71 Crm'- wrr A. .l. Alelrmller 9. G. Rnxxi 10. M. Mvlrm 11. B. 'Yupvlilli 12. B. 11fmml1'H1r1l1 13. li. Rumi 14. 77 M4- .'Vm'rz' 15. D.Rlwfl11 16. L. Danlvlx 17. F. Yamln 18. B. Rzmlvx' 19. 77 Mllux 20. 'lI.0nw1hrfk 21. P. H11- lwx 22. 71 Gnhlz' 23. M. Ju.v11pl1 24. I.. .Mrm':1'k 25. .l. l4 rH'mlvi1' 26. M. Hm'l'1lvmm1 27. IJ. I.1gl1lm'r 28. 71 lhlruh 29. J. I-'nrlunalrz 30. G. Ruhixurr Nui I'i4I1ll'ml: IJ. l'n11w's, J. PE'1l'l'.X. P. I l'ag1'lh', M. M1u'kmw1. G. Oclnu. M. Wmlzila, G. Lavvv, D. Julrwlwul. IJ. M1 1.au1lH1. 13. Ragalla. IJ. Plumb. Q. lung, I'. 72lxxm. ll. Uuwrx. S. Tlmmpmn. x 8 9 I0 , r 7 Q 15 si , 771010 I'fp.xilm1.' 1. M. Sell: 2. G. Ilwherl 3. D. Hurxllman 4. 71 Gllhvrl 5. 1.. Harvul 6. G. BHll17'lj,'Ul'1l1l'I' 7. T Gregnri 8. 13. 1x'urm'4lfl 9. C. Gilv.mr1 10. J. Spfwlalf 11. R. .lnhllmn 12. .l. Juvrnhx 13. J. Tlmlz' 14. R. Mark.x 15. .l. Frmlluml 16. R. Knwalxkl 17. M. 7'hz'rr'1aul1 18. S. 7'm'm'l' 19. 71 0'Cmme1l 20. S. Amlvrxun S. Pnwlex 22. B. fiinlhk'r 23. R. 7'1'r1'lvu. NUll7H'1Hl'l'1l.' .l. Gnllv1'm'kl. R. Sufrfwnk. R. Alainm, 71 Nllrll. B Cahn. Alphafhr Omega 1 PSZHHGFYKI 2 J WPI1fll 31 Barlelx 41 DeGmn1 5 G V611 6 C S'1e1xLa1 7 Darner 8 M DeSalxn 9 M Marlmn 10 T Srlmzlum 11 B Bullman I2 M Pouu 13 J Sllfla Samuel I5 S Webvler 16 S Fehr I7 M Thnn 18 B Slleerll 19 J Jaxaxk 70 IJ Smluma 2 Yfhmal 22 S Knpnrkl 23 J Prater 24 C Huullnn 25 B Mamhen 26 C' Rnxxl 77 J Cnnmll 8 Demku 36 J Dahl 37 M Mime 38 R llaxsman 19 C lxuhnkc 40 L Melzgn 41 I Sellers 42 Hmmpxon 43 J Yhepparcl 44 J Jmre 45 1 Mnnhkn 46 K Neumann 47 J Tlwman 48 B kaxpu 49 N Serafm 50 K Habemw 51 B Hmlxlrnm 52 A Rnhmh 53 S Manly 54 I Pahnnm 5 I Vugl Nnlpulured E Galrmlck J G01 M Jmllfl' J Pllmnxlu H Rvherhml S Vml . .. . .. . . ... 5 .. -. 1.5. .' : . . '. ' .. . . . . . ' . . -. . ' 2.13. Baileyx 29. J. Ryzlzen 30. I.. Wegner 31. M. I.m'ax: 32. C. Olmxleafl 33. D. King 34. P. Rwlflinymn 35. T ' . . . . ' . . ' . . . '. ' ' . . ' .... ' . . N. 241 Delta Gamma Late in the spring semester of 1966 a small group of girls began organizing a new sorority. The local sorority, Chi Sigma Phi, continued to grow from its original seven founders. In June of 1969 their dreams were actualized as they afiiliated with Delta Gamma sorority. Delta Gamma, which was founded in 1873 at Lewis School and later absorbed by the University of Mississippi, Oxford, was one of the first Southern sororities. Its magazine, the Anchora, is the second oldest sorority publication. In 1951, Delta Gamma chose Sight Conservation and Aid to the Blind, Inter- national Education, and an extensive Grants and Loans program as its philan- thropic projects. Recording reference books for the blind and selling Christmas cards printed in braille are ways in which NIU's Delta Gammas support their national. The Delta Gammas have always been active on campus. Two sisters are Pom Pon girls, one is the Greek editor of the Northcr, one is in the women's chorus, and another is an SA senator on the Win- ter Carnival Committee. Six Delta Gam- mas are on the Deanls list and some are in the Education honorary. You bc! your life Groucho Marx was in rlzc frierrdship circle at llze DG house during rush. l I 5 E E E E 2 l l I l ? 2 i 1 x i Theta Chi On April 10, 1956, Theta Chi frater- nity was formed at Norwich University in Vermont. Theta Chi came to NIU in 1961 when Chi Sigma Nu fraternity, formed in 1957, affiliated with the na- tional and became the Epsilon Pi chapter. In 1942, Theta Chi merged with Beta Kappa fraternity, and the 6,000 members of Beta Kappa became Theta Chi's. Sixty- three per cent of the fraternity's mem- bers served in Allied forces in World War I. Theta Chi has over 150 active chap- ters and is one of the ten largest na- tional fraternities. Seven chapters are located in Illinois. Theta Chi national headquarters are in Trenton, N. J. Theta Chi's serve the community by helping WLS radio in Chicago sponsor the Give Joey a Christmas drive in first semester. The fraternity also sponsors a bowling party for handicapped children in special education. Theta Chils are actively involved in the Inter-Fraternity Council judicial and rush committees. One Theta Chi is publicity chairman for the IFC. Other Theta Chi's participate in the UCB entertainment committee and varsity football, soccer, baseball, and basketball. There is a house at NIU, they call Ihe Theta Chi, and it's been the ruin of many a poor girl, and God, I think I'm high, sing the melodic voices of Ihe brothers at a typical FAP. N0 CUOIT was sparezl for llivir .S'Wf'L'IfIl'l1l'IS b Ihr' hr0Il1c'r.v of Kappa Alpha Psi. 'x 4 Kappa Alpha Psi Kappa Alpha Rho fraternity, founded in 1962 at NIU, became the Epsilon Omicron chapter of Kappa Alpha Psi in 1967. The national fraternity was found- ed at Indiana University on January 5, 191 1. The national fraternity has sponsored the Guide Right Service program since 1922. Each local chapter of Kappa Alpha Psi works with the youth in the commu- nity to help them find their potentials through education. Kappa Alpha Psi has 190 chapters and 55,000 members. Other chapters in Illi- nois are located at the University of Illinois, Southern Illinois, Northwestern, and a metropolitan chapter is located in the city of Chicago. Every year Kappa Alpha Psi offers an Outstanding Student Trophy to a pupil at Drake Vocational High School. The award is based on scholarship, activities, and service to the school and community. Highlighting the year for the Kappas is the Sweetheart Ball in February. This year's royalty court had 25 girls, the largest number in the chapter's history. Kappa Alpha Psi's are active in the athletic activities of the campus with members participating on the football, basketball, track, and baseball teams. igma lpha Epsilon Sigma Alpha Epsilon fraternity, found- ed at the University of Alabama in 1856, was originally strictly a Southern frater- nity. lt formed its first Northern chapter in 1883. Now headquartered in Evanston at the Levere Memorial Temple, the fra- ternity has 192 chapters. The Temple was erected to honor all members of the fraternity who have been in branches of the service. During WWI and II, alumni chapters and secret chapters were formed at prison camps throughout Europe. Delta Phi Beta fraternity, founded in 1961 at NIU, became the Illinois Gam- ma chapter of Sigma Alpha Epsilon in 1966. Last Spring, as a service project, the SAE's helped clean up an underdevel- oped area in Blackhawk Island. Two SAEs were SA officers, three are on the staff of the Norther, four are in Cavaliers and three are in the freshman scholastic honorary. Brothers are on the football, tennis, track and gymnastic teams and one is president of the athletic honorary. Another brother is president of the Economics Club. Others have co- chairmaned Homecoming, Winter Carni- val and May Fete. With the dark waters of the mighty Kisliwatl- ken' tlzreutening them, the SAE's tug gang style. ..WWj?3,vQa: f tara?-ta wa-rfegw ' ti f vw .G itfwxfiff' H-fis,ff.f... .f .asrtfmwft ft -A f .ii ,,.- .......i ..,, Q 245 Gne of the newest national fraterni- ties at NIU is Sigma Nu. formerly Beta Phi Gamma fraternity. The local began in l966 and affiliated with Sigma Nu in the spring of l969. Sigma Nu became a chap- ter at NIU in April of l970. Sigma Nu was founded at the Virginia Military Institute on January l, 1869. While other national fraternities were es- tablishing chapters on the East coast. Sigma Nu developed a policy of expan- sion to the West and Midwest. Sigma Nu has 145 chapters and six colonies throughout the United States. Six chapters are located in Illinois. Sigma Nu Rowing gwilly flown Ihr' nznrk-v A'II'L'fIIlI II'llIC'l'S Ihr' mm: of Sfylllll Nu fl'llll'l'lIflAV lIIL'I'l'flj' row. 246 Sigma u national headquarters are situated in Lex- ington. Virginia. Sigma Nu sponsored its fourth annual Operation Lifeline this year, the largest non-university event. Sigma Nu collected over 516,000 Worth of blood for the Lu- kemia Research Foundation - the larg- est single drive in their history. Sigma Nu's are on the University Cen- ter Board and in the Student Association. Other brothers are on the Homecoming Committee and the Inter-Fraternity Coun- cil judicial board. University officials spoke at several dinners at the Sigma Nu house for brothers and alumni. -igtifffe New wil . .Q . xsa- V ,,,h ,,, W-4 1' I Delta Zeta The founders of Delta Zeta sorority at Miami University, in Oxford, Ohio, were among the first women admitted to full collegiate status under a new administration in 1902. In 1956, Delta Zeta, by uniting with Delta Sigma Epsilon sorority, formed the largest national sorority in the country. The Gamma Rho chapter was founded at NIU in 1950. Through the Foreign Friendship Program. Delta Zeta has provided gifts of food, clothing, money and other necessities to a children's hospital in Holland. They also supported a school in mountain regions of Kentucky and provided aid for the terminally blind patients at the U.S. Public Health Service Hos- pital. The DZ's carolled at the DeKalb Nursing Home at NlU's Christmas. They also supported a Navajo child. This year four sisters are Pom Pon girls and three are cheer- leaders. The Panhellenic president and rush chairman are also Delta Zetas, as was the co-chairman of NIU's 1969 Homecom- ing Committee. Other sisters are in the educational and physi- cal edueation honoraries and on the Northern Star. Smiling faces going places . . . like Ricks. DU's served pizzas and colves for a day proving Wllfll yun'rv our of Sclilirz, j'0Il'l'l' out of beer. Delta Sigma Theta The basic thread of Delta Sigma Theta sorority, which was founded at Howard University in 1913, is their five-point public service program through which they create and develop action programs in response to local needs. Each summer the national sponsors a cross-country bus tour of educational, business and cultural institutions for eco- nomically disadvantaged teens. NIU's chapter of Delta Sigma Theta, which celebrated its first anniversary in November, has been active in all of its national's service programs and has also initiated its own projects. Money for needy families was raised in a Christmas Drive and the girls visited Great Lakes Naval Base. Many of the girls tutor other NIU students and some do volunteer work in St. Charles. Nothing like an orange between chins to show how Delta Sig Theta .Sisterhood can be pressed. The Deltas are active in campus or- ganizations. They have members serving on the Black Student Affairs Committee and participating in the African-Afro American Cultural Organization, of which one sister is secretary. They also have donated a gift to- the Black Union. W LCONE MSR DA Sigma Pi In 1959 Alpha Psi Epsilon local fra- ternity Was founded at NIU. In that same year the fraternity affiliated with Sigma Pi national fraternity. Sigma Pi was founded at Vincenes Col- lege in Indiana on February 26, 1897. The national fraternity was originally called Tau Phi Delta. In 1964, Sigma Pi merged with Delta Kappa fraternity, and the members of Delta Kappa were initiated into Sigma Pi. National headquarters are at Vineenes, Indiana. Sigma Pi is the only national fraternity having their headquarters on a junior college campus. The Beta Sigma chapter of Sigma Pi is one of 102 chapters located throughout the country. Other Illinois chapters are located at the University of Illinois, East- ern Illinois, Southern Illinois, and Loyola University in Chicago. A Big Brother program was initiated this year by Sigma Pi as the brothers pro- vided guidance and tutoring for children with academic problems. The president of the Student Associa- tion is a member of Sigma Pi. Other Sig Pi's take an active part in campus life on WNIU radio, the Northern Star, the football team. and the Wrestling squad. Aflvr nmlfing their hair, polishing their shoes, and lzizlirig wl1r1Iei'z'r could 4961 u parent mad, hrollwrs of Signzu Pi welcomed their mothers arm' fullmrx to 1,16 fraterzzity's annual banquet. 4 4 9 eh . 5 : 1 3, QA 'B 33456 aw.. I Q Q, is 2 4 2 v v 1 : 3 35' o 14 15 16 19 o 24 25 zo 77 73 . . ll 12 13 ' 2 1 5 6 5 9 0 1 4 4 6 7 2 4 1 H 2 5 1 A 3 12 1 9 10 I I J A A 1 Tliela Chi: I. H. Carstensen 2. W. Starnper 3. R. Lanlerrnan 4. J. Bon-lzers 5, S, Rive 6, D. Rossi 7. ,I, Della Garnrna: 1. S. Gelasi 2. B. Moses 3. C. Nelson 4. J. Doneen 5. K. Feehner 6. M. Mc'Enroe 7. R. Culhane 8. M. Hoover 9. D. Gangler 10. M. 0'Brien ll. C. Nelson 12. D. Rezahef-k 13, M, Manin 14. J, Fink 8. C. Gierrnak 9. K. Sloeklin 10. K. Davis 11. B. Allabasrro 12. J. 0'Connor 13. S. Larnparler 14. Baker 15. R. Ring 16. T Hanley 17. B. 0'Neil 18. K. Adams 19. D. Sajnaf 20. M. Wliiliarnson 21. P. Gnu- L. Sellino 15. T Capelle 16. P. Ferguson 17. J. Lange 18. J. Johnson 19. M. Larkin 20. M. Twamll' 21. L. bus 22. B. Basara 23. D. Glennon 24. D. Seggerman 25. L. Yoslzino 26. 71 Rirnalzua 27. L. Gerguson 28. Haars 22. S. Johnson 23. J. Vidinien 24. N. Kosar 25. J. Mz'Donald 26. M. Lovi 27. A. Gillespie 28. M. J. Juengling 29. R. Kopp 30. D. Donka 31. D. Dyer 32. R. Swensen 33. M. Cameron 34, B. Miller 35. R. Ehrlivh 29. S. Kellerslrass 30. C. Kinnihurglz 31. J. Giles 32. K. Goseinski 33. D. Corvoran 34. G. Janivki O'Brien 36. If Dipof 37. P. Safco 38. R. Cammarralm 39. C, Miller 40.1, BI1m1q14i51 41, C, Kghler 42, C, 35. I.. Likes 36. L. Benson 37. C. Doran 38. J. Schleirller 39. A. Mrliszewski 40. L. Burke!! 41. C. Leander Gill 43. G. Nysirorn 44. B. Kusman 45. S. Bauino 46. R. Kifowit. 42. J. Spingola. No1pivlured.' M. Anulur, S. Asmussen, M. Bivil-elvi. S. Bork. R. Brrzek, C. Chandler. B. Coveny, I.. DiPompeo, M. Eger. I.. Elias. D. Garbe, J. Graves, J. Lafalu. R. M!'C0fll1,l'. L. Marzinelli, L. Speekrnann, M.Sto1'klin, A. Zera, M. Barry. K. Barry, P. Elias. L. Fanelier, P. Flower. B. Golbin, C. Lin- clahl. J. Pelerson, B. Powell, L. Stulges. C. Willmln. 1 52 53 50 1 io 9 6 7 5 9 11 1 1 4 48 5 W I5 16 45 46 4 3 17 is 2 I9 1 zo X x 33 1 1 I , 1 1 42 43 2 23 24 2 5 2 . 27 38 , 4 4 20 32 18 17 19 1 1 2 4 5 3 8 7 9 ' 11 12 . 4 3 6 10 Kappa Alpha Psi: 1. W. Brown 2. R. Robelixon 3. J. Monlgomergr 4. J. Kellr 5. M. Reezl 6. K. O'Donnell 7. E. Hunler 3.J.JL1l'lK.YUI1 9. E. Brulnlielzl 10. D. .Naves 11. M. Bell 12. I.. Beasley 13. G: Wile-1' 14. P. Dorlzl 15. S. Evans 16. J. Anclerson 17. D. Glll'l'e'1I 18. A.1.Monliglan 19. G. Brown 20. J. Wilson. 250 SigmaA1plm Epsilon: 1. R. Jacobsen 2. M. Gempeler 3. P. Lask 4. A. Salam 5. 'IT Singler 6. J. Brennen 7. D. Sehlieling 8. D. Berker 9. B. Diaz 10. J. Samargis 11. S. S6011 12. D. Slieell' 13. D. Olson 14. T Hoerker 15. P. Bernard 16. D. Duensing 17. J. Terry 18. R. Jablonski 19. R. Parton 20. K. Warner 21. G. Paz-elli, 22. 71 Albers 23. R. Wunder 24. M. Saralian 25. J. Sllcqll 26. 71 Burski 27. 'lf Rizzo 28. J. Chin 29. S.Jenne11en 30. T Prepellica 31. B. Burger 32. B.Aun1an 33. R. Wilson 34. C. Ziiny 35. B. Simpson 36. M. Wuolsey 37. P. Bowen 38. P. Trotter 39. D. Englebaugll 40. M. Mozzlren 41. 72 Sullivan 42. B. Brinkman 43. J. Welsh 44. J. Befkwilh 45. R. Werkerln' 46. D. Young 47. B. Nickerson 48. B. Ballenger 49. P. Weber 50. E. Maison 51. P. Garriiy 52. R. Wolff' 53. 71 Mc'Menan1in 54. G. Gulbranclson. Nolpie- lured: 1. J. Koski 2. M. Weidner 3.1-T Vanstrnm 4. J. Campbell 5. R. Potenza 6. W. Fiedler 7. B. Perry 8. C. Anderson 9. M. Oslreieher 10. G. Keller 11. S. Buzanis 12. G. Buzanis 13. L. Slzorl 14. H. Geller- rnan 15. E. Donnelly' l6.J.S1ri1zel 17. I.. Smilh 18. C. Callahan 19. J. Eriekson 20. G. Johnson 21. M. Tomuszewski 22. R. Furs! 23. H. Cohn 24. J. Wells 25. D. Chapin 26. B. Relger 27. D. Wenz 28. D. O'MalleV 29. J. Hersrna 30. J. Nernelh 31. S. Drew 32. J.'Allison 33. J. Yerlinak 34. S. Carlson 35. K Thqmas 36. B. Happaeli 37. C. Bruhn. W pf Delia Zara: 1. D. Huglmx 2. P, Hcwnan 3, C. Suinxkz 4. Z. Zvlku 5. .NI Ham' 6, h',Sw1m:1l 7. D. Rear- 5igmgNu,- 1, J, ljppyn 2, M, ,Nluglrg 3, C, ,Kopelwn 4, J, Kilp.q1ri4A' 5. J. Murphy 6. W, Brimm 7. 71 :lun S. S. Bfmem 9. C. Ilunwn 10. D. Talmney 11. X. I-'ixlmllu 12. J, 1111111 13. Y. 'llazur 14. P. .'t1a.v1m'm Wulff 8, 11 Kmlguvh 9. I.. Buren 111. B.S1mm1z'r Il. R. Wmm'141n1'1 12. W, Bramlmff' 13. C. Ryder: 14. J. 15. D.S4'11lenk 16. D. Iulmkl 17. I.. Spellmire 18. G. Pivfklwxn: 19. I.. lunnannl JU. I.. Dunalmz' 21. I.. 1-04-,151-10 15, A, Bfyrpyy 16, H, Mm-g I7, S, Fr-gllril-kwpy I8, R, Bm-pm-mm' 19, D, Hlank 20. P. Seilx 21. J. T11m71a,v 22. P. .Vumic',x 23, C. Kenglz 24. P. Har! 25. J. Spillman 26. C.Slwnmmf1 27. 12.510291 28. S. Hgmlgrwn 22, G, Wm-np 23, D, ,N',1m1gf1 24, R,S11upin 25, B, l4'g1,mn 26, R, I,m1g 27. R. Maier 28. D. Tlmrlnrz 29. G. Marl4'n.x 30, C. T1wma,x 31. S. Hizkx 32. P, Bnrwk: 33. E. I.aw11'r 34. A. I'ur'1'a1'u 35, R, Cohgn 29, ,M, Rpul 30, J, 711mnpvrm 31. D.Sa4l114'ki 32. M. Lewan 33. C. Rumwr 34. R. Gulmann NUI Ave.: 36. C. Coleman 37. G. Rurka 38. K.Slem1e' 39.1. 17111111111 411- A- -571111111 41- -1- W1'll'11f 42- B- HUUV1' pivlurezl: R. .'lf11'G01', B. Wffhh. A. 0rkf'r1aml4'r', G. Hurrax, D. Ifrirluzzrr. 71 11'n11l1'r. R. Sllefman, D. Plellra. han 43. P. I.ngg.xIurl 44. I.. Nvlmrr. .N'ulpif'lzn'z111.' B. .'l4ur'p11vr, K. I'1-llmalv. C. I'1'l'r'r, .l. U'1Jm1avar1. K, Glas- D, Mill,-f, yer, D. Halwzrxfw, M, Hagan, K. Ix'1'e'1f'vV, J. Ki11a1'k,1', N, Brvlrlr, J, 1701101111111 11. K. Dunn, S. I-k'l'r'n11f', J. Lzmke, C. .Marrlzma P. Pnwzfrx. , , FQ ' 52 o . 3 g H ' 3 5 6 a 'O 11 13 N '1 9 5 16 11 10 1 1 3 4 5 I I 1 K Dl.f,,,SiK,,,,, yymal- ll lu 1f,,th.,-,,-.,,,.1 gl L- g,',,lf-,,-Wm 3, N, llnwanl 4, I . Iimun' 5. S. .luucx 6. K. Rml- Sigma Pi: 1. J. Ialuxkn 2. B. Bllxlmwll 3. J. Dewgel 4. J. Erirkxun 5. J. Muynm 6. 7f 7'i,x1m 7. B. Worth gwu 7. D.A11w1 8. H. 131111111111 9, R. Marx 111. R. Marx 11. .l. 71nuupm11 12. K, C1ll l4'r', .'Vnrp1l!11rw1.' Ci. 8. D. Brmullzrva 9. D. Milrlwll 10. R.Sar1i 11. 71 Lvnulv 12. S. Ilvcm 13. D. Dalx' 14.,C. Hoge 15. Crmlzllv. A. 'Vm'kn1x. I Mahan 16. B. Rum 17. B. Ilurrll' IX. M. Wing 19. D. Falmma 20. R. Grimm' 21. D. Clznlley 22. Cv. M11- lelle 23. B.S1m:i1 24. D. Willmmvnn 25, 71 Nulle 26. D. Plmlun 27. P. M4'Alm' 28. 11. Iuzarl 29. R. De- Jaeglwr' 30. P. Worth 31, 71 Ix'm'11 32. G. Gilnw 33. B. W1!lI77!'l'1'!' 34, D P1'11'I',xnl1 35. M. Plvil 36. J. Ma:- zukelb' 37. R. Cllamlwm 38. 71 Hurnlylzl 39. J. Burnv 40, D. 1IH',xl4'H1 41. .l. Ilnrwalll 42. D. .1fI1'A1c11' 43. ' J. . 'M'1l' 45. H.Jnn11m 46. G. Hnllaml 47. G. Zalmix 43. C.S1mnm 49, B.4Ka,x:r1m1f B. Rjzlman 44. I M1 I In 50. J. Hunter 51. C. Milligan 52. 71 ,Vue 53. W. Mnrkes. .N'n1pi4'lzu'r'4l.' H. Iimmlr, IJ. Ilvpmlrv, 7. IJHUHIH. ' 'f ' ' J. M -1 A. P. .'Vf'1xmr, R. Swllwzk, J. Sian'- B. Felflv, 77 II1'm1e'r,v1ml1. P. lilglmmzr, 71 Ivrzu, .l. Ma!1uf,mr1. 4 H1 url, A. Travis, 7', Wlml. B. Winlmn, J. Ynnlnw, 25 Sigma Phi Epsilon Sigma Phi Epsilon fraternity was founded in 1901 at the University of Richmond in Virginia after a ministerial student found that none of the existing fraternities accepted divinity students. Sigma Phi Epsilon has 167 chapters, including those of Theta Upsilon Omega fraternity which merged with Sig Ep in 1938. The national headquarters are lo- cated in Richmond, Virginia. The fraternity was formed in 1966 at NIU and was called Kappa Chi. In May of 1969, Kappa Chi was colonized by Sigma Phi Epsilon, and was designated the Illinois Epsilon chapter. For the third consecutive year, the brothers of Sigma Phi Epsilon joined with the sisters of the Alpha Xi Delta sorority in sponsoring a Christmas Party for un- derprivileged children in DeKalb. The 56 brothers of Sigma Phi Epsilon were awarded the highest overall grade- point average trophy and the most im- proved grade-point trophy last fall. Sig Eps were active in campus activi- ties such as the Northern Star, the Univer- sity Center Board, and Phi Eta Sigma, freshman honorary fraternity. Other Sig Eps were on the football team and were officials for intramural sports. Wl10,.Y the cwazy wdlillir? After leaviizg flie Mfiy Fefe purcli Elmer Fudd, Bugs Bunny and the rar! Of Sig Ep clan discuss all carrot prospects. 11'4MI - 'f1- 'mvmwfl .W W ' .. V- M asf Kappa Delta Kappa Delta sorority, founded in 1897 at Longwood College in Virginia, pro- motes scholarships, and cultural and edu- cational projects for the development of collegiate chapters. Since 1921 Kappa Delta has support- ed the Hospital Fund as its national phil- anthropic project. A committee directs the project, mainly supporting the Crip- pled Children's Hospital in Richmond, Virginia. N1U's Kappa Delta chapter, which went national in November, 1952, sup- ports the Crippled Children's Hospital through contributions. They also sell Kappa Delta Christmas seals, unique in the Greek-letter world. Locally, the Kappa Deltas have su- pervised swimming classes for the han- dicapped in Graham Hall. In the fall, the sorority had a party for the handicapped children. At this summer's national convention, the chapter received the Pledge Training Award for the best pledge program in the national. A Kappa Delta was on the Home- coming Committee and other sisters are in scholastic honoraries. A KD is cocap- tain of the Pom Pon Squad. KDS H!! little lzcarrs with tricks and treats at zz Halloween party for lzrzndicappca' children. Tau Delta Epsilon After Tau Kappa Epsilon fraternity was disbanded in the fall of 1967, the fraternity's pledges formed a new group named Tau Delta Epsilon. Existing as an independent organization for two years. IFC recognized TDE as a frater- nity in May. 1969. TDE grew from one pledge class to 50 members and is now participating in campus events. This year. TDE teamed up with sororities for Homecoming. Win- ter Carnival and May Fete. and par- ticipated in athletic events. The fraternity sponsored a field trip to a ball game for underprivileged chil- SQ E iz- dren and sold shakers during Homecom- ing to raise money for charity. The char- iot for NIU's Huskies was built by TDE and was one of the highlights of Home- coming. TDE'S were active on campus with brothers participating in student govern- ment. IFC, the athletic board, tennis, track. football, basketball, baseball and wrestling teams. One Tau Delta Epsilon was elected Student Association senator. one was captain of the tennis team. and another TDE placed first in the Coast Guard Wrestling Tournament. TDlj'x .self-appoirzlvrl Superman show 1l1ey'1'c marc' f70H'l'I'f1lf Iflllll Il Sig Pi, 111111 able' I0 leap wer Il'4'l1cl1c'S in a single 190111111 in .Vprilzg rugs. e e 'x .1 1-:UST univaisuv - t HOME TBALL lMNAY lTY OF x., . as... 254 Sigma Delta Tau Sigma Delta Tau sorority was founded at Cornell University in 1917. Founders were aided in its organization and formu- lation of its ideals and ambitions by the Nathan Caleb House ritualist Multae Patriae. The national philanthropic work. di- rected by the Sigma Delta Tau Founda- tion, included scholarship grants and contributions to Brandeis University. Scholarships in the field of human rela- tions and funds for research in blood dis- eases are also awarded. NIU's chapter of Sigma Delta Tau went national in the spring of 1967 and M, ,, became one of 58 national chapters. All profits earned by the chapter from any local projects are given to the na- tional philanthropic program. During Christmas SDT's Wrapped presents for the DeKalb Salvation Army. Each spring they sponsor a HSend a Mouse to College Programff to benefit cancer research programs. The girls of SDT are active in campus activities. including Homecoming and Winter Carnival Committees and UCB. Other SDT's are active members of the Speech Correction honorary and the Spe- cial Edueation Council. A .rqllfzd-f'll.i'!1L'z' .s'11l'r'wzzl'w'.r In Ihr' fa.s'Ic'.rt ,QITIIS in Ilia' west at an SDT Wild WHS! Coffee Hour. MM , 2, ,,.,,. . U M ,.,, M., 255 5 mf tr ft f y, .... ,, . W. X ,2 fk.b , V at Tau Lambda Chi Tau Lambda Chi local fraternity has found I8 to be the fraternity's magic number. Eighteen men formed the frater- nity in Gilbert Hall in 1966. Later it be- came the eighteenth fraternity at NIU when the Inter-Fraternity Council ree- ognized Tau Lambda Chi on May l8. 256 fix,- ' 4'-mf l967. Scholarship was important to Tau Lambda Chi this year as the fraternity won the trophy for Most Improved Gradepoint for active members. Tau Lambda Chi sponsored a year- long service project in which they enter- tained lourth and fifth graders from bro- ken homes in DeKalb and Sycamore. The Taxmen had a Christmas party for the children. and took them to a foot- ball game between NIU and Western Michigan University. The brothers also played basketball with the children on Saturday mornings. Tau Lambda Chis are involved in campus life by participating on the Wres- tling and track teams, the Norfhcrn Star, and WNIU radio. Two other Taxmen are members of the UCB. T7-.3 Delta Sigma Phi Delta Sigma Phi national fraternity was founded at the College of the City of New York on Decemher 10. 1899. The fraternity stresses personal growth through affiliation. Awards are given annually to individuals for scholarship and service. The national fraternity has 98 chap- ters throughout the United States with na- tional headquarters located in Denver. Colorado. Delta Sigma Phi became a col- ony at NIU on Decemher 5. 1969. and will hecome a chapter hy the fall semes- ter of 1970. ifaitk I lily, W R 'x xx - 1 f Delta Sigma Phi at NIU was origi- nally Phi Delta Psi local fraternity. The 21 founding fathers of Phi Delta Psi created the fraternity in 1966 with the eventual goal of being a chapter of Beta Sigma Psi national Lutheran fraternity. For this year's service project. the Del- ta Sigs sponsored a soap drive for sol- diers in Vietnam. Delta Sigs are active in campus life with hrothers on the Student Association and WNIU radio. The president of the Inter-Fraternity Council is a member of Delta Sigma Phi fraternity. 25 '41 Sigma Kappa Sigma Kappa sorority, which was founded at Colby College, Waterville, Maine on Nov. 9, 1874, was the first New England sorority. In 1959 Sigma Kappa merged with Pi Kappa Sigma, an educational sorority which was founded at Michigan State University in 1894. The sorority's oldest philanthropic project is the Maine Sea Coast Mission- ary Society, which was adopted in 1918 to commemorate the sorority's founding at Colby College. The sorority's oldest philanthropy, established in 1954, is gerontology. It was one of the first sororities to partici- pate in this field. Recognition of the so- rority was made recently at a White House Conference on Aging. Northernis chapter of Sigma Kappa, which became a national in 1954, makes gifts and has parties for senior citizens in a nursing home in DeKalb. The Sig Kaps are represented in many activities. Two sisters are cheerleaders and three are on the Pom Pon squad. One sister is an SA senator and another was on the Winter Carnival Committee. Two are on the swim team and another is on the gymnastics team. Many sisters are members of academic honoraries. AI an IHIIISIIIII Hobo Ruslz Parry, Sig Kaps rrumfw' from their urzml glad 1'ag.v to sad rags. f Nm lx Q xg s Plzi Ep plr'zl,Qc'S are pz'1'c'l1c'zl 011 1111 lllzwillilzgf fOllIllllIll at l.U. IIIIFIUIILQ their lllllllltlf lflllk-Ullf. 7 - -- Phi Epsilon Pi Phi Epsilon Pi national fraternity was founded at the City College of New York on November 23, 1904. The Beta Lamb- da chapter at NIU was founded in 1963 as Delta Kappa Iota local fraternity and became a national chapter in 1965. In 1961, the Phi Eps merged nationally with Kappa Nu fraternity and raised membership to 54 chapters. National headquarters are located in Philadelphia, Pennsylvania. Phi Eps sponsored their fourth annual Cancer Walk this year for the American vu X ww Cancer Society. The fraternity receives national publicity for their march from DeKalb to Chicago. Last year, Phi Epsi- lon Pi raised over 515,000 The Phi Eps named Alpha Sigma Alpha and Delta Upsilon as the Frater- nity and Sorority of the Year at the Phi Eps Third Annual Fall Festival Dance. Phi Epsilon Pi is active in campus life with brothers on the gymnastics and rugby teams. Other Phi Eps are on UCB and the Student Association. Scholastically, Phi Epsilon Pi won first placc in pledge and active grades for fraternities in the spring of 1969. 5 WW 6546 . 7 I 1111 Sigma Phi Epsilon I J Werclerl 7 C Hzhian 3 R Miller 4 S Slllmll 5 K lil II1 6 G l . . , -. . . . . .,., ' .. . lf ax . . .ewis 7. A. f2.Xl4'I'Hl!II1 8. J. Ward 9. R. H1rl'1'II Ill. If Vana II. D. Crew I2. S. Salwllm' I3. B. Quanlnrlx I4. W. 0.1'Ieu'.1ki I5. B. Sanluree I6. S. Vulenza I7. I.. Chin I8. R. Orna I9. R. llmxl 20. J. I'arIal11I 2I. R. Mc'I:1'r 22. J. l.l4c'InI1m1' 23. B. Lee 24. B. Barne.1 25. J. Hillwein 26. F Slzwlm 27. C. Ixllllltl 28. B. Spillal 29. P. I.a11I4'l' 30. C. Arfnenixe 3I. I-'. Burrell 32. B. Slarkevl 33. C. Mu1Afff' 34. J. Maiwll 35. I Ilalm 36. J. Cal'pel1lel'. ,'Yulpil'l1lrf'zI.' R. Belfllnl, B. .'VumanlrI1, D. Ruullrllck. A. Snlmnull. R. Hcglier, B. Ix'Iippe'l'l. B. l.inlIqul.1l, G. Chappel, O. Pulzwan, II. Ru.s:l1l, S. Pa.xqzl-ru, If Ml'Ix'l'lIlp, M. Bf'l'l'r. Kappa Della I. M. Vulpe 2. J. Punan 3. P. Franxen 4. IJ. Cum I1 5. D. I.e1'1l-rel' 6. M. BmrIel'il'k 7. J. Nelmn 8. P. Nel- .xrm 9. B.Sur1lhm'.vk1' I0. M. While II. K. Frl'mIeII I2. N. Dullle I3. D. Bull I4. D. Olxun I5. S. Waclldnljf I6. J. Wallin I7. B. Blll'I'lE'll 18. P. Greene I9. J. Vnmlra 20. G. Lelllnall 2I. M. Ilullnlan 22. J. Lesler 23. .'V. Calafm 24. B. Frenrh 25. M. Rnlrerlmrl 26. J. lim lawn 27. C. Freellmn 28. K. Jumcv 29. D. De- Vim 30. I.. Ovlerman 31. S. Calanli 32. P. Talhnl 33. M. .1IKIVUI71lll'l1 34. P. Briggx 35. R. Ann 36. D. Quinn 37. M. Sz I1a.qf.vn1a 38. L. Helfnrll 39. II. JnI1n.mn 40. S. Sflvaap 4l. B. Neumann 42. K. Bearzl. Nur pirlurezl: C. Drain, C. Fuhrner, C. FeIIrm'.x, P. Gt'lIllIl', l.. Glalzllzqler, I.. l.ewamI, C. l.en'i.1, P. Ml'Kee, M. Mellelku. E. 0'Ilum. G. Priull, S. Rrllilr. ll. Rluga, K. TI1f'i.v.1, M. Flynn, C. Haymaker, M. Jambx, P. Mk J.Bl ' ' ' ar ln, umm, K. Danwn, C. Lee, P. M1SIu'lr1, CDR-1 rlelek. D. Bulemlurf, P. .M4'CllIlul'k. I , 6 7 4 I 55 7 l I , 9- 43 Q f A . , so 1 l 4 7 48 4 8 I 25 ' 32 3 6 6a 38 1 +1 ,O 4 . ,,V Q 41 .I 12 I 28 ' ao 2 23 39 4 1 'B P 2' I l 2 25 za . 1 o 2 9 ao 31 18 1 17 19 5 zo 9 I '0 11 12 8 X7 l 2 3 4 5 6 1 1 l l l Tau Delw Emilvn sigma Tau Della I. P. Clulu 2. I1 Ilarver 3. J. Mzlrm' 4. K. ,Mllxrl11Ll 5. I.. Mnlxan 6. IJ. Dlviln 7. M. Cnnkux 8. T Wil- I. I.. Ileflnlull 2. C. Amler' 3. 72 Slllllmun 4. fi. Rlllvlnxlrlli 5. R. IJl'4'll'I1z'l' 6. I.. Nuglrl'.xIf-1' 7. B. Deul.1r'l1 lllnl 9. G. Mlllrnlnre III. C. Lam' Il. I7. l4'1'l'xlll1lIllllg1'l' I2. Il. l'ul1I'7m'I I3. S. I-'rlllllx I4. I1 Fflllpll' I5. R. X. M. Ml'RerlmIlI.x 9. E. Blilxlein 10. G. SIIW.'l'IIldIl II. .I. l.m'in I2. R. I,1'vv I3. R. Sullllmlf' I4. .I. Kal1lnl' I'lu::u I6. .l. Palmnlm I7. D. Pekm'4'l1 IX. B. Plnnl I9. W. Txlullnl JU. M. Dulfu 2I. S. Sullill 22. G. Illllll I5. G. Anrllfli I6. S. Srlnn I7. C. Ei.wmIul'I IX. C. AIIUI' I9. B. Bl'1n1'n 20..l.Al'IlI1'r 2I. 71 Bowl' 22. D. 23. R. ,M1'IxurImrul1 24. I7. Gnl'nml1 25. B. Swmlu 26. JI. Bulllm 27. R. Rrflwrlx 28. B. I-'llrm' 29.1. Mm- Suvimkn' 23. C. .Vvwlllull 24. J. 0'Cnnner 25. N.Slnn1l1 26. P. Anllel' 27. C. Wkllll 28. C. Cullen 29. Ii. rllmll 30. I1 Rliw. 'V11lpil'l1ll'mI.' D. I.ulnAr, W. I-'l'm1I1l', Ix. illlllnllm. A. limlrlfmn. I . .X'plll'l'lx. .l. Briuu'Ir. Bauer' 31l.S.S1'I11u1 3I. M. Miller 32. IJ. Melllul' 33. M. lilvzfrr: 34. S. . tIl'vnruI1 35. C fjyllmff- 35. S. Kp... I1 Bwmlx. B. .Illnm, A. 'llnlqlexg M. Bnllrnlln, .l. Ixlmvl .wl 37. E. 0pp0r1In'ilm'l' 38. S. Telrlllwl' 39. l. Svlral: 40. S. fi1:Illvl1Ivl'1'g 4I. S. Bars 42. B. Knvirll 43. I.. F1u'gu1': 44. J. Iul'll1lr'l' 45. R. Melvin 46. C. Ikllllvin 47. S. 'Vmrlllzlli 48. I.. Baal' 49. J. Blwlllllan 50. B. M1'MlIIun 5I. I.. Iuxrm' 52. J. Sallliwlx 53. .I. Ifulllllmn 54. B. l.l'nl1 55. D Ylt'l'llIl'l4I 56. C. 'Vz'u'llmn. Nui mlm I IC I I' I- 6 0 1 ' 'e1.' . ln lun, 1 'iIz'l'lmln. S. Graff, A.II1rnlg. R. Ruwnllml. Ii.Sl4il4v1nin. is 3' 9 Q ., 'll i 1 nr 0 L A 5 . ' Gi I ' Tau Lambda Chi 1. Mrx. S. Trerlzler 2. Mr. S. Trevhler 3. R. Rim' 4. A. Rarelf 5. S. Lenne 6. P. Haag 7. L. BHlIl7'lg!lI'1 8. S. Bll1'171t'1.Y1PI' 9. C. W11V11Ff 10. B. Seal' 11. K. Mamllz' 12. B. Carnphel 13. D. Angelirn 14. C. Slewarl 15. E. Quill 16. G. Ahlherg 17. H. Cinne 18. R. Hvawlr 19. .l. Perri' 20. J. M4'Naugl1lnn 21. .l. Brubaker 22. L. Fluvk 23. R. Brrrzlerirk 24. J. Pellelliere 25. IJ. Dunm' 26. J. Iarnhazzi 27. B. Cmvlievr 28. A. Ber- lani 29. W. Dirlxlrlw 30. D. Brubaker 31. B. N1'1.vnn 32. M. 1710111 33. I7. laxlfru' 34. J. Kalm 35. S. Wuil: 36. D. Smilli 37. J. Sarwx 38. J. Yeager 39. B. C'ar1.mn 411. 71 Brm'lwr 41. W Willek 42. B. Delp 43. R. Selan 44. 7f linux 45. B. Basko. lVnlpir1urer1.' B.A11ram.x. B. llailiw. R. Beljgfer. J. Bnrknn'in':, IJ. Culhurl- mn, J. Franzexe, M. Pevonka, D. Pizrinli. 71 Prire. M. Reifl. S. Ruhlwrx. K. Roxeherg. S. Srielu, J. Srlrswlv- ke, D. Snknlmr, S. Yuxlnnu. B. Su'anxf1n. B. Mark. 1-1 Ixlflmlw. S. Tarnufl. MPM Della Sigma Phi 1. T Malmne-r 2. K. Milmll 3. S. Kilrfgff' 4. B. Jenningx 5. R. 1111111111111 6. B. Murliin 7. P. An4lrew.x H. J. Anzlerxzm 9. S. Kuzuk 10. S. We14'11al1.x 11. R. Slafinlwrg 12. 17. Pnllwnrlll 13. A. Tlleile 14. 71Srrng,Uin 15. D. Pelenmhn 16. B. SI. Hilaire 17. S. Dexser IX. K. lrvluml 19. .l. liligling 20. D. Hnlik 21. M. Hemi 22. E Czajkmmki 23. G. Wmul 24. H. Wf'.vlem1nr1 25..l.Sk1ur 26. 11 llmelf 27. G. Knlxlanix 28. B. Nic'- ken 29. J. Mele: 30. G. 7J'lll'.X1l'1' 31. Ii. Fruxer 32. P. 1,mlvmlnl'l 31.1. Ilingramln 34. 'lf 1.ure 35. K. Krr- :an 36. R. Harh 37. J. Meiken 38. J. Curlmn 39. R. Wrlm' 40.1. 1'um-iw. Nnlpirlzwml: M. Sznn11z':, S. M-rlnll. 'If Buhler. if -N ' fl IUQQM . 2 .. 7 U in If rr ' X ?. 'K ' Q '1 H M Si ma Ka a Z PP 1. D. Gdffilj' 2. K. Kane 3. N. Norlhrrqfi 4. J. Wexlermeier 5. 15. Krepx 6. S. Jarvie 7. 71 Wulf X. H. Rei- mann 9. L. Brenllinger 10. N. F1al1erly 11. M. Friezlluml 12. C. Kuulux 13. C. Willzerx 14. L. S1ld1'I'1l'lH 15. D. SH11111 16. S. Luzllow 17. C. Mark 18. C. Higgem 19. C. Parml 20. B. Wruner 21. S. Neukirrh 22. I.. Volk 23. M. 714r:er 24. P. Perkinx 25. L. Ju11n.xm1 26. I.. Mnrlenxelr 27. C Grr:ik 28. C. Malone 29. P. Slevenx 30. S. Uehara 31. B. Srhneizler 32. C. Haul' 33. M. Bennix 34. M. Wilmn 35. S. Zimmerman 36. J. Hempel 37. R. Meyer. Nolpiclurezl: C. Carrnll, J. liuglmx, D. Nnrum, N. Fruivler, J. Bennell, D. P0!'17, D. Buckley, B. Williamxon, l.. Blakely, J. Livarari. IJ. While, L. Ferrix, J. Ogden, P. Rirhanlv. S. Swanxon. B Perri P. Blahur. P. Wolfman. P. McGillivarr. 1.. Rearflnn. K. Sauer. J. Gelzqff N. Dean, D. Phillipx, A-. Tlmrnwn. J. Rice, D. Diario, L. Pallun. M. Palermo, K. Nie1.wn. S. Mrmre, B. Burlianan. C. Bexl. Phi Epsilon Pa 1. G. Blix.: 2. 71 Greenberg 3. E. Lerwff 4. B. New-lin 5. J. Feall1crxlm1e 6. J. Deliganix 7. G. Ezlwanix 8. S. Daar 9. R. Miller 10. B. Gnlzlfeclzler 11. D. Maru: 12. W. Perrl' 13. M. Colin 14. G. Slanmx 15. B. Golzlxlein 16. K. Erllarl 17. L. Simbel 18. A. Mixik 19. P. 0'Briar1 20. B. Hanxer 21. S. Smne 22. R. Ezlel heir 23. P. Ra.w1ux.ven. Nnlpirlured: B Ellix, I. Bruker, S. Berz, R. Hie:e. B. Farher, M. Harlzell, M. Keller, J. Buhl, E Feld, R. Fraxer, J. Lev-r, C. Marrzix. F. Milmlr. L. Rrixenhaunl, B. Breelanzl, R. Qunxx, D. Sc-lzlomnan. M. Jaxper, Ii Benner, P. Mazan, M. Mikkila, B. Newlin, R. Shaman, 71 Taxklr, K. Texla, 71 Gagliana, M. Samer, S. Friedman, H. Gelrner, A. Saumlerx, B. Biuxxal, B. Anderson, J. Drelirh. lf. Erharl, J. Salwar, H. 01.xun, S. Rahn, P. SC'1Ill11Z. 261 -...--U., f t 62 ...L lllfllllllllll! .I ' W. . T., - ,.,., ll!! lllllllllllll fimlllllll. 8 Sigma Lambda Sigma Sigma Lambda Sigma, a service soror- ity, was founded at NIU by I4 girls in May of 1963. In 1967 they became a national serv- ice sorority when a group formed by one of their members who had trans- ferred to Roosevelt University alliliated with them, Since then. chapters have been organized at Western Illinois Uni- versity and the University of Illinois. Alumni groups have also been formed. Each chapter must do some service project which benefits the entire country. NlU's chapter does work for UNICEF AHB and supports the Danny Thomas Leuke- mia Drive. As part of their service work, they also help in many other charity fund-raising drives. The sorority's main service project is an orphan in Taiwan, whom they adopted four years ago. They raise money for his support at an annual Christmas bazaar. The sorority also assists with arts and crafts projects at the DeKalb YMCA and helps a retarded child. Members of the sorority usher at many of NIU's concerts. Thr' .i'i.i'lw',i' of Signm Llllllllllll SIIKLIIIIII cxliihii ,Vl'l'i'l'lll past projr'c1.v at Ihr' Activilivs' Fair. Phi KappaTheta Phi Kappa Theta national fraternity was formed in 1958 as a consolidation of Theta Kappa Phi and Phi Kappa na- tional fraternities. The Illinois Psi chap- ter at NIU was formed in 1954 as part of Theta Kappa Phi. Both founded as fraternities for Ro- man Catholic men, Theta Kappa Phi was founded in 1889 at Brown University in Rhode Island. Phi Kappa was founded at Lehigh University in 1919. I Phi Kappa Theta national fraternity has 56 chapters with headquarters in Worcester, Massachusetts. The Greek-to-Bc Dance is an annual event sponsored by the pledges of Phi Kappa Theta. Fraternity and sorority pledges are invited to the ballroom to get acquainted. The active body of Phi Kappa Theta sponsors an annual basketball tourna- ment for any interested teams. The prof- its of this tournament are donated to the Newman Center. Phi Kaps are active on campus with brothers on the football, hockey, wres- tling, baseball, and basketball teams. Other Phi Kaps are staff members on the Northern Star and are active in the or- ganization of Newman Center. Polish Power inspired Polish passion ax prints, plaids and stripes claslz at a Phi Kap mixer. Phi Kappa Sigma Phi Kappa Sigma, NIU's oldest secret national fraternity, was established at the University of Pennsylvania in 1850. The Beta Lambda chapter at NIU was created in 1962 as Sigma Tau Sigma lo- cal fraternity, and became a chapter in 1968. The only fraternity to have a college named after it, Phi Kappa Sigma Male College was founded in Monticello, Ar- kansas, in 1861. The college was de- stroyed by Confederate troops during the Civil War. Phi Kappa Sigma has 52 chapters Io- cated throughout the United States and Canada. The fraternity's national head- quarters are in Philadelphia. Skulls at NIU served the commu- nity, national fraternity, and campus. They assisted the national in initiating a chapter at Michiganis Adrian College, and sponsored a clothes drive for needy families in the area. Phi Kappa Sigmas are active on cam- pus with brothers on the wrestling and gymnastics teams, the Nortlzcr yearbook, and Madrigal singers. Two Skulls are NIU cheerleaders, five are on the Univer- sity Center Board, and four are in the University Chorus. Hot pizzas, cold Coker and black liglzis were par! of this Phi Kappa Sigma lllixcl' al I9 Up. it ' I W, 'wmuamsfffivaw .. A V . . A T, X, 2 :JS J Slf. ' 1? L. Q 2, rw? gd V 3' I 3. af' I 'Z 'J-fr' in ' ,fl A if .. . -av -7 4 -ov, ar wx 4 .ix LNQ Sigma Sigma Sigma Sigma Sigma Sigma sorority, which was founded on April 20, 1898, was the second of four national sororities to be :founded at Longwood College in Farm- ville. Virginia. From 1911 to 1947 the sorority was limited to teacher colleges. lt was a co- ounder in 1915 of the Association of ducational Sororities. One of the main philanthropic proj- ects is the Robin Page Memorial Fund, which was established in 1951 in honor of a victim of bulbar poliomyelitis. NlU's chapter of Tri Sigma, which be- came a national in 1945, was the first national at NIU. The chapter works with TB X-rays at the Health Center, helps with the flu shots, and the Sigma Nu Blood Drive at the University Center. This year the sorority received the Chapter Examination Award. They were also honored by the national on their twenty-hfth anniversary. Tri Sigs are on UCB and the Election Commission. Others were on Homecom- ing, Winter Carnival, Greek Week and May Fete Committees. Sisters work at WNIU and the Northern Star. Many are in academic honoraries. Tri Sig's and SAEKY rake a break during their pliilanllzropic project on Blackhawk Island. ,..a 2 Phi Sigma Epsilon The first national social fraternity to take a chapter at NIU. the Sigma chap- ter of Phi Sigma Epsilon, has been here since l947. The fraternity was formed earlier that year as Alpha Delta Chi. For seven years the Phi Sigs were the only so- cial fraternity on the NIU campus. Phi Sigma Epsilon was founded in February, l9l0. at Kansas State Teach- ers College. Until 1952 the national fra- ternity operated only at teachers colleges. The fraternity has 43 chapters located throughout the United States with most Q15 nl nw aw as of the chapters in the Midwest. Phi Sig national headquarters are located in ln- dianapolis. This year, the Phi Sigs participated in May Fete, Winter Carnival, Homecom- ing, and sports events. The fraternity won the IntramuralBasketballChampionships. The brothers of Phi Sigma Epsilon con- tribute to campus life at NIU. They are on football, track, and basketball teams. A sports Writer for the Northern Star is also a Phi Sig. Other Phi Sigs are on the Nortlier year- book. and the SA Senate. Phi Sigs are chairmen of the Elections Commission and May Fete Committee. After many ivrfvks' of Irziinirig, Ilia Plii Sigs c'c'leb1'ar0 afrer lwcaniirig Inirzinilwzil Champs. i New is ml , :fps - :asset as s W ' :M - M Q . .1 if H .1 -. 'ifsif-' s f ,St assi--QRSQWR WPPWV W 5+ swf: KR f sans -s mass? - Q M PW Q in YS' S .f' S Y SQ .Q as Q fi + as meant is is Q' S. if 3' 1 it -sl I EM 266 '1 JM? 4 Sm i.. if f Ki' , ,M 3... giyllflli. Sl-ll! . tl do H lQiUl A ' '. S 'V-.PSY li S il J-4 5 fi? 4 -so ,W 1 4,,. 3, Q 4 fi 5 can A V aw -,h fi. In ix .4, ' 5 rv LA Q Qs f fm J ii : hr ' . . . ga if 1. A K . va - + f gags, QL ,Q fd N fx 1 -H Ll , 1 :K 1 ' I u I vm 1 X. .v xv:-'33 , . '-is 3: ' Q 1, . X ' if Z A ,M , fix 'X it , X N W ff Q bt fm, 'K 'A 'E ff '3 A 'ri k 2' V' V . iv ir Q3 f 'ffs EL ff ii .g-- A QA 0 ig gli? 'NX' xpof in N K F., gh X 1 la' X.'k Q - N ' 1 ' W f Q2 ' K xv! J ff 5 F m s 3 K Y N . . fr is 9: fl - A X sa .x X X15 K 1-.5 ff x-I E Q. Q s r E QXk .. ' 4 56 51 n 1 wi P Q 4. S E X tis- , 9 , I ,N W is QQ we Wwx. Y sl ,fu ,wr 'W' Phi Sigma Kappa Phi Sigma Kappa national fraternity was formed in March, 1873, at the Mas- sachusetts Agricultural College, now the University of Massachusetts. Phi Sigma Kappa's national headquar- ters were originally in Chicago, but head- quarters were moved to Drexel Hill, Pennsylvania, in 1956. The national fra- ternity has 86 chapters. Sigma Delta Phi local fraternity was formed at NIU in April of l965. The lo- cal beeame the Pi Pentagon chapter of Phi Sigma Kappa in l967. Every year, Phi Sigma Kappa spon- sors a Toy Drive for the children at Dixon State Mental Hospital. The fraternity distributes large boxes in the dormitories where students donate any toys they can spare or buy. Phi Sigma Kappas participate in many campus activities including the tennis and baseball teams, the Marching Huskies, the Concert Band, WNIU radio, and the Northern Star. The Vice President and the Activities Chairman of the lnter-Fra- ternity Council are Phi Sigma Kappas as is chairman of the Winter Carnival Com- mittee. Two Phi Sigma Kappas are mem- bers of the University Center Board. How ya gonriu keep 'em down 011 lllc' farm after tl Country Mixer with ilu' Alpha Pl1i's? 4--- ,N X 'X I? ii? I' fyri'-5 'ig f Q . Q 92:31 1 nl' , ,,f,,w-P S., is N155 K2 I 3 Abovc lcfl: A .vixlvr nf Alplm Sfyllltl lms ll .vponky l'Ht'Ul1lIIl'l' with ilu' Cl1v.s'l1i1'4' vu! of Alicc' in Wmzflwlmzzl. Above rlghl: Um' lv111111y M'l'l't'.Y 7 I J P ll f?lllI'UII at Ifll' Sig li Iluylwy lJt!lIl't'. Above: lurlyf lezrlyf 269 V129 in M J Q 5 ,J J 111111111 111111111 1161112 1 1 ' 0 J' 1' . Sigma Lambda Sigma Phi Kappa Thela 1. S. Wf'i11sl1'111 2, I'. B1111111 3. R, 1111151511111 4. .11 51111111111 5. lx. 11111111111 6. f , 1f11'111111'11 7. 11. 1711111111 X. A. 1. W. 111111111111 2. If. l'1111111'11 5 T 1111111 4, 11. I'1'A111' 5. ll. Q1111111' 6 .1 U'.lIr1111'1 7. ,11. 'lIr11'1r1 X. .11. Mawll 9. J. 151111111 111. I', l11'1111xA1' 11. 1'. 151111111 12. .11. .W111111111 1.5, A, 1'1'11111' 14, IK. Y1111n,u 15. .1. .1I1'11: S1u1l11 9. R 11111111 111. 1'. 1'1'l1'111111 11. li, l111mA1 12. P. 111111111 1.3. X I 11.U1'1 14, .1 I'111'11n'11r1 15. I. Rw- 1lS.1J.B111'1'111 17. S, I'1'111' 18, I 11111111111 10 .Y 1.11:1'1111111'1 211. .1, A111-11 21. ll. I 11111111 22. 1, Ix1'1':1111 21, :UIA11 16, T 111111111111 17, lx' I'r11'11'111'1'1f11 IX, ,l. .l111'.q1'1 19.11 .S'1111p111'1111' 211. 11' .S'111111'11 21. R. 611111111111 451111111111 24.11. l'1'1'e111' 25. -1. 11111111111 26. V ,S'11111'u'111 27.1 111111111 2X.1x, 1111111 29.11. I111'1m'11 311. B. 22, 11.8111111111 2.1, S. S1111111 25, ll 1'1l:,u1'1'11111 26, X. Ik11'u111 27 K1 R1111111111 2.1 fi. ,S'u11jA11u 1141 29,11 X'11'1'u1111111'1' 31.S..S'1v11z1111'1-rr X2 .l, H1-11111111111 33.1. 111111111 34. A. 1111111111111 ,I5 15.111111111111111 36. G. -5111111111115 ,111 I1 lf1111x11 ,?l,.1 11111111 KJ, I. 611121111111 33- 1. C'1111111'1 14 0 -1111111111111 Ki, 1' l'11w1ff111111f. .1111111x1111 37. .1. 711111111 38. f'. .1lr111'1 39 II 4111111111111, 21 2 A 17 19 16 2 ' 1 2 4 8 1 3 11 1 5 I4 7 10 5 ', - 1 , 2 5 '2 '5 a A ll I . Ill 9 . . oi, . V 'Leng'- 1 f 4 ' Q f A6 4 'ff , .Q e ,Q if .-'fw.11 l,1 1 ' 4 Q 4 1 - 1 Phi Kappa Sigma Sigma Sigma Sigma I. T Hazard 2. J, M1'1'z'r J. B. UUIIUX 4, .l. R1'1n1m1111 5, J. 0111111111111 6. 13. 1111111 7. .1, lk1111l1'1'p111'l 8. R. I. K. Rmllkvr 2. S. Ii1l1,s 3, A. 141111 4. B. Illgylm 5. R. S111'1'111 6. X, 01x:1'u 1111 7. I.. I.11x1w1' X. K, Rlrkw' Bra1I121r1l 9. T 121111 111. B. II1,13g1'11x 11. .1 S1m111h11 12. IJ, I1'ul11'1' 13, -1. R111111 14. II. I-'1'1'1'111111111 16. C1 9. Ii.Aug111I1'1z 111. N. C'11w1111 11. M. I.11w1'11111' 12. G. .1l1114'1' 13. 1. R1111111 14, 1. 11111111 15. B. R1'z11111c'1' Cu.x11i1111 17. B.S1z'4lwr 18. .l. I'111ll1px 19. S. 01111111 211. 11. S11111111x1111 21. 11. f'111m'1'1'11m 22. 11, S:k11zIIa- 16. L. Berk 17. K, Iluklf' 18, S. 61111111111 19. lx. .lI11AQ111 211. A. .-11111111111 21. 5' 111111 22. C G'1111k1' 23. T rek 23. J. A,x111m'1n11 24. .1, 1111111111115 25. R, 1111111111 26. G. 14 111111111111 27. Y. limxx 2X. IJ. IX'tllH1IIil', .Nur F1'1,x11 24. S. l.111111a11 25. ll l'1'11111111'11 26. .1. Ii11u111r111 27. CI S11yv 28. IJ. ,S'1111111x1' 29, Ii. I'11111111x111 311. S. pi1'1un'z1.' S. A11111k, R. Bu1':w1, T R11111111. .1. 0111111x. IJ. Eurmw. .11. f11'111.111111, T 1111111111114 Ii. .l1',11m, If. I.z1l11'- Gaxkill 31, M. 5111111111 .?2. .11. S11111411' .1',1'. .-1. l4'1111111'111111A1'1 14, lx. lux' 15. ll. I'1'111z'1' 36. l'. 1x'11ra11'vi1 rek, E. I11R111r'u, J. MuI11'1', W. .1I11l111'1'1, B. 'l1111111'1'1', .11. .1I1A1'1x, lx, 1I111'1'1x1'1l1', T 0'II111'a, li. 0111111111. 37. L. Ze,Qa1'1'1fi 38. IJ. Sl11x111'cu'11: 39. A. Inna 411. .11. I'111,14,1:1' 41, IJ, 1111111111 42, .SI 1111111111111 43. I', K, Parker, IJ. P1'1'ki111, W. P1111111111, IJ. 1'1'11s, T Rvzw, lx, R1fl111'11, .1, R111'1, R. ,S'1I111111x111u, 1f.,Y11111u1'1, Il. Muller' 44. .1. l'111r1'1 45. I', l,1'111'1 46. K. IIv1'111'1'11111f 47. I , 1x11'1'r1:1'x -IX. A, ,Y1111111111 4U,.Y..1111111,m11 511. Sm'11a, I.. Wc'111'1', 17. W1111l111'xA1', S, lr11f11'x111. P, GeIvu11f'1' 51. .1. W1111 52. 1. fir11111111A' 51. 11. 81111111 54. R. C'11n'111 55. S. I111'x1111 56. C' I1'1'1m'11 57. Il. C'ran11'r 58. CI 5111111111111 59. .1. 1111111111 60, II,.l11111r11 61, 5. .'V111'1. Y111p111111'1'1I' .11. 1i1'11u11, IJ, lJ11lIJqr511l1, I.. Mi11ar1'111, C. W1'11i11,1J. .1. R11xx11'1', C1 W1s1111'11, 1i.II111'm'1', H, .f1x1111'1. CI 1I111'1'11l11, T l11'1111111111r11, 270 I 11 12 I IVLVII I I ' 1 13 14 15 0 . -I . . 1' 11.., 45 15 1 6 ! 3 ' 6 8 10 ' . 3 51 1 9 11 ' , . . I 11 Q 1 Q 'i Sigma Epxilan Chi OWWEU , 71 Kvllx' 2. ll. .'II111f':1'11'.1'lv1' 1. H. Ix11ll 4. P. 81111111 5, l'. Il1'1nl1'11ll11 6. .1, ,'Il11111'1' 7. R.S1a1'fa X. 7. 1. K. Becker' 2. I . I'a11111'11111 1, I., hNl1ny1'1 4. ll. H rm' 5. S. Il: 111111111 6. S. 51111111111 7, l', Iflllerl X. I. 'vrll 9. P. S111ylz'1' 10, K. 1J1'la111'1' ll. I7.S1'111-,Ie 12. M, Kal1'1'111 11. lj. I-'rrlsrll 14. I.. S111111 15. S. .V1111 Marer 9. K. G1wl,w11 III. C. Brafllm ll. K.S1111lur 12. S. II'1'1111'11l1 11. B. l11'in1'11'11 14. I'. l'lv1'1la1l 15. . D. l'lvu.111'1l 17. G. 1Iflr11'ri.1 18, .I. Krmx' 19. K. 01111111111 20, lf K1111l11iL 21. I7. 0'Ila1'a 22. G.A1la111,s S. l:'11gw'111a11 16. li. 1111111 17. G. C'a1',w11 lfV.A..1r11-111111111 19. S. 0111111111 20. I.. 1311,1,xa. . P, 0110 24, M. Ix'la11.1'ne1' 25. .l. Rwm 26. 71 ,Vzvmlf 27. I1. C'a1'lm11 221. J. 1111111 29. M. Bfjrarzl 10. 71 'rrell 11. 71 f'111'1'1111 12. P. Ka11'1'i11 11. R. Wnlrvr 14. 7. Gzlllllwx' 15, M. Mvliill. .'V11lp11'1111'e1l.' Ii. A111111- v1, 71A11'1l, li.Alla1':l. J.Alla1'1l. 7f I1a11l1,11a, 71 B11111l111m1, C1 Bull. P. B11111l11'111Li, 71 C'r1llin,1, W. llml- 11111, l1.IIv111lfr, K,ll1111an1l, R. lI1'1111, fi. H11g111'l1'1. .1 K1'1111nl1, J, K'n11lv1', I7. lx'11p111', S. K1'a11e11l111l1l, Mal111111'1', li. .Ilurl1e'1', B. .I1z'1'c1'1, P. Ilnlwl. 7. U1'1111lv1. 7', I'11111A, J. P11pm'1111'11, IJ. P11111, J. PUIUAAI. . Rumi. B. Ruff, S.Sf'l1111i11, R, S111'1'11w11, !i.,S'1al1l. If. I mx, I'. llunlfw, ,-l. 011111. N. Burlczf, B. 1.k1'111l1. M1 f'a1l11x, I . 1J111lm1'11:. 31 31 4' Q 3' 3' 3' 17 19 zo 21 nl 25 26 21 u 35 25 7, 9 - go as 30 31 31 3' D, 13 ' X 1 Ax 3 J 6 7 5 9 10 12 15 l . Y 16 'i Omega Phi Sigma Kappa P, l'1111a1'1'lla 22. J. S:1':111'1'A' 21. J. l'l'l1x 24. Il. llzrlzfm' 25, CI 1171111111111 26. l'. l'I'al1a1'4' 27. IJ. Dv- I, .l. Raw 2. G. f'1'1y11'f1l111l 1. R. C'a1'p1'11l1'1' 4. R. liirfllm' 5. 4. 72Ik111'1lw1' 6. A. Hnllaml 7. C1 Talf 8. T 'wlu 2X. X. .'I11'1'1'1l1'1'1 29. l. SA1111m'1' 111. A. M111 11. lx, 11111111111 12. I1. 'I11111111 11. .l, Maliflm' 14. I. Ix'1',xllvr 9. M.Sl1ula11 Ill. P. B1'm'k ll. S. G'1px1111 12. R. R11l11'1 11, l'. Cullw' 14. I-1 I-1'c1'1'1' 15. P. Ring- rlx 15. J. lfwll 16, K. 111-1'lvl11'l1 17. I 1211111111 18, 41 .S'11l1'1l11 19. !'. lJn1'11q11a11 411. C If1'1'f14,m11 41. ,xlrum 16. C1 Ix'nl:m1' I7. G. Prellwil: IX. M. Sp1rak 19. U..lm1I11r 20. 7f llvlinvki 21. G, .'I4r'lm'1'11e11' 22. Klan. 11. H1'rr1amle: 21. M. .Mnrzruv 24. 71 Szffyz' 25, If K11:a11 26, 7. I 1414111111111 27. B, I4 z'xlf'1'111u11 28. J. Ra.1im 29. G.S1'l1m1'rll 10. I., An111'11 11. J. B1'1'1'xl11'1111 12. J, II w'wll,x 11. .l. I'a111lw'1u' 14. A. Ran'l.1 15. P. Tau- 111-111w1111 16, C,,S'1'll1' 17. Il,.V6l1l 18. I'. f11'111x11'1111g. Mw1p1'11111'1'1l H, I1'l1'a11, B. Plullipx. 71 Ra1ne'1', 71 Alwl, B. Blaka. K. ,V1G111r1111'11. IJ. Orfllmk. X. Harlrfrz, B, C711111lv'111u1'. R. 1Jar1flm11. IJ, Krnlzla, R, 11111 B. .S'ln1'111, M,Kl1'111, X Rl17l'IH14Q, D.P1'fle1-11111, .l. S111'1'1:1l1x, J, III-luv. lJ..l111m'1. P, Ilallv. 271 Off Cannpu Students stri 5 kfwetiiwlt' Plllllllilllif, C0lIliflItL', and Sl'l'l'fIItL' meals arc il11l Ql'llf pzzrls of Off-cwmplrs life. Off-campus living lends an excit- ing air to being a college student at Northern Illinois University. A feel- ing of independence comes over a student as he walks into his first apartment. Finally,U as one stu- dent put it, there is no one to watch over me all the time. l'm free! At Northern, off-campus living includes apartments and four dorms. Among them are University Plaza and Student House, and homes around campus Where students may rent a room or an entire floor. By living otT campus, students get to know more people better than they could in a dorm. They get a chance to participate in all the fun of paying monthly bills, buying food. cooking, house cleaning, ctc. Economy, independence and con- venience are major advantages. ve for independence -M Y, . QW y A ww? 2 'ln.,.,,, ,Q e,..:vWf - wfmm js... R i ' , , 'ly' ,.q.,.,,,,, mi Mfmww 'RN Q xfvs Q, ,N,,, X355 ,xp fig SNQPM It's a challenge. Renting a room from a family lends a different aspect to off-campus life for the student. He soon learns how adaptable he is in new situations. Some homes rent just a room and the student must make other arrangements for eating. Other homes include kitchen privileges. Homes may rent rooms from one to twelve stu- dents. Off-campus living is exciting and a challenge. Met in a positive way, it can be a rewarding experience. 5 if if x ef 'lu 4 Q fix ,Hes 4 i' M t. f iesta 'sie AV, - ' Q: in X . e--.. Q eee N QA , ' in :SW . , wg fig' Y 's Y' 1 X i Y i leaf V wk -az. s s 2 if at Q Q XX. X , , . ,. .:,- f. f an ii- - is K E X .. , X t .. f eh- --i- W Mrs .Nuns K K. k A . 1' -.tw .I XA xx A so K- ' I N . . ..tr ,Q .... Y .... N wgrlm ,..,., . - r, .,...t .... ,M .... , 1-X . 4 esg3.sm.-Lf,,t..... A we 'Nu Top and Left: A comfortable bed and soft chair provide perfect setups for reading letters and assignments. OH-campus housing must he conducive to studying. Above: Cindy Westbrook adds a new dimension to Santa Claus. ms Top: Girls at Flanigan house take a fun break from studying to play a quick game of hearts. Above left: The kitchen alsoserves as a study room in many houses, Right: A long talk sessions often helps to ease tensions of the clay. Married Student Sharing efforts brings rewards Marriage is skimping, extravagance, work, and play, love, haze-all rolled into one. 'fMaybe two can live as cheaply as one, but when I was single my dad was footing all the billsj, a senior girl sighed. Money is definitely the main problems plaguing most married college students. Itls not easy if you both want to be full-time students and work, too. And you do have to work considerably. But if there are added respon- sibilities, and added needs to fulfill, there is the gratilication of sharing the work and the troubles. And then there is the greater satisfaction of sharing the results of the effort. There's suddenly also more in- centive for married students to grad- uate from school. Suddenly youlre a family, not just a single, and you're working for the good of that family. It's a good feeling, too, this sharing of life? x. 115 x s 'wa-au.,,, fm.. Rmiwis 'mwkw' X-N-Q wg'- wg., 'Nw W, N Q. 'K N0 ,V f i . - K . . I x 1 'i g 3' gm wg 4Nl,nn-n QA SN 1.4 vm-:QU f up - if ,QQ-5' y X vt: 4 fi ,v '05 v W . . U LL., 4- A 4 w Xh.: iik. -.k: ww Q8 WF' .FP Q eff: O VCASQ Qs 5 Ve f -5 5 'K 4 E 1' s HY a fi X , S .-5, Keg NGN! Num M, Q.. wmwv- -qs-nw, ,H-N, -s ,W-Q6 - ' : if X -I Mm ...anwmkf K an .M , ,. ' ff--dh ,,,,,-ve ww... ,Av- ...vmwv .,. AM..-Q -f ,wi- ,N if-Q 1 M. ...N- Q K. xx .N W 33 2 223 ww ., Winn-f Top Left: Amidst the piles of books sits Tom Wartowski. Top Right: Comparing bell-bottomed jeans are Liz and Dan Sanders. Above: Leaning over the banister, Linda and Chuck Hojman greet their guests. Right: Space is often a scarcity, even in bathtubs. 278 Keynote: Textbook Marriages ovv I have someone to turn to, to tell my problems to Marrmge often IQ dlfflcult But mar rmge combmed wrth umversrty lrfe can compound these dlfllcultles As one mar r1ed student sud Many of the day to day problems presented m 1 norm il non umversrty m xrrragc became m tjor crises 1n a marrr lge of studentp trtncrs Among the most mentioned problems were lack of money lrttlc study trmc and even less recreatronal time The most crltlctl ftctor ln many stu dent l11dI'1'l1gCS IS money or the lack of lt In order for me to finlsh school my wrfe had to drscontmue her educatron and go to work full trmc Thls seems to be the srtuatlon IU m my student homes One newlywed sard I dont especrally llke the 1de1 of my wrfe supportmg me but rrght now this IS the most sensxble arrangement I c tn carry more hours and devote more trme to my schoolwork as long as I dont have to worry about a job However th1s lsnt always the sltua tron Both my husband I are attend 1ng school and workmg part trme Most of the t1me ends just dont meet Many of the marr1ed students 1rc ex G1 s One of the typrcal comments from them IS Thank God for the GI blll Wlthout It I just dont see how wc could posslbly make 1tl Shoppmg just 1sn t what lt used to be When I was smgle I could usually f- 5041 I buy just about ftnythmg th tt appealed to me w1th1n l1m1ts of course But now were on such a trght budget that even thmgs that I once consrdered necessltles are put off to a later and more prosper ous t1me Insuliflcrent time presents drverse prob lems w1th1n the marrmge Sometimes when I fall behlnd 1n my studles I tend to rgnore my w1fe m favor of catchmg up She resents rt When both spouses work another drflicult srtuatlon often develops One student sand It almost seems as 1f I saw my husband more often before we were marr1ed We both work and go to school so our trme together 19 kept down to a very mm1mum Some of the male students feel that they arent spendmg enough t1me wrth the1r chrldren By the trme I get home from classes and work the krds are already asleep Our soclal l1fe tends to center around our home Sometlmes we h we a few other marr1ed couples over for 1 small qulet party However the un1vers1ty commu n1ty provrdes mexpensrve recreatron such as plays art exhrblts and movles A d1s 'N tmct advantage IS seen ln th1s srtuatlon and marrrage I dont have to do every thmg by myself We share IH domg It Shar1ng seems to be the key word IH the Irfe of the marr1ed student In our apartment we cant possrbly help but to share everythmg Its so small we have to even share the one t1ny closet Psycho logrcal factors of jomt partrcrpatron are also qu1te notrceablc If lm drsappornt ed 1n a bad grade I dont have to keep It 1ns1de of me I have someone to turn to to tell my problems to to boost my Splf 1ts It s wonderful to be able to share your successes wrth someone who w1lI T6jO1CC along w1th you Because of lack of trme many mens grades take a plunge after marnage Others however contend that there was great rmprovement rn grade pomts after they tred the knot Havmg a wrfe and chlld to support rn future years IS a great 1ncent1ve to get better grades now I sometrmes feel that I have an ad vantage over the smgle guys I know what problems marr1ed l1fe entnls now whrle Im 1n school Planmng IS so much easrer when you have an 1dea of what s ahead 0 Y . C s . ' c .I I '. . . c - ' I . ' . H ' ' L 7 C ' ' . 'X ' z ' 2 - Ns I L K K - E V ' r . l If 1 r 77 i L r. I . I f, - ' - - . . ' - ' I ' ' ' .' ' . a 1 C , Q 'f ' . . . . ,' gf L L . - h ' - . 2 A s. 1 . . I cc E , t . , - ' 1 f. ., fl ' . . . 'I' Y 'J :1 E as inf I , - . Z . . . H , . ov Y--. s . . . . L . , l 2 ' pr , , C . ,, . . , . . , . c ' ' aa , Q - , U Q , . I X , I s C T . . gg . . . . , i . . ,, . . . , . H ' . . . . . . . . , L A C 2 , . . . . . . . . M , , , . . 4 , . . . . . ,, 9 . . 1 1 I ' ' Si . l - . . ' 75 H ' ' . . . . , . . . gg . . ,, c . , . s . . . . . . 3 H , . I . - . ,, . , ' . ' 5 7 . . , - . H 1 . 1 . 7 ' 7 1 ' 7 IG1 . . . ,, I . 9 ' ' 7 ' ' 77 7 ' ' I, I . My , . . .X XJ- I . . , , . . . . . H . . . l . . H . r a ' Q . , ' ,, . . . I 45 . . - . . vm A ' . . ' - - 5' gr., ,,,o- . . L . Z Y C A , . If . , ' 4 - . , . ,, . . , ,, ' v a - ' ' 279 Q Q 1 1 - .. AQ lff zz. :pf-.f,,f Q 15,1 W Y wr. ?f 1',f H A LL 1 L' 'f . - 'fx -fvf 4 .f' fMxE:XQ?. 4-'f-':jf . . I N.-. , . 4 J , -I P- V- ,MF U .I 52? li 3 ,Q ff jaw ' '.'., A I s a 5 Z-Q' , . Y L L ,-J ,, I A 1 ', ,C 'Q'-f'f!:f ,L X -I '-5 '-L , ff. Jef, f-'Y Q Ca ,..-J N Q?q.QQ:,.- Af Aff if,Q,Qj,QQQ - , XQ QQFEQ ' -. if rr. To ' Pk, -.q 1. .234 ' - -,..... Q 1 NK I' 'rlmr Q I Q 53215. , V3 . X -.1,,. . if I i f'?T39' fs xxkx -. xi ,xl 5 N. -.. N.. XC? . T. 'A 1 ,,, .Q ffl 1.1 f -'-wx, ,, .. .'-- , - R x it f' ,MV 'ff' A S O M 3- 'Q . f' lf - ' . x 4 p-, 'fy - . . ' . N, gy. .ff-.f-. .' F: fy... . M' i' ' H: ,V K ' - 6- if' . .1 . 4' f 1, , why, I Q. QI x ' ' ' .Q ,f9,g,f'Li ' r. , ' ? vQn- ,- in . ,kid-lv '11 , -' 5: wh- 6 nn,-Ig ..2L::3-1 -. Q gg! . X 0 I' .1 n Y -111 X' fi -'Ji 1 'ML' 1 V 4, u .v :. V 92? , bf' X' , 5 V1 1, xf ,wh ' 'gr A I :H , . A .ww JI ,Q r .Rn J' N '5 7 fSf Aa?iqL':jkX,,--- I 3 A , 1 s-.--v ' V X 4 y H 'Qs , .: N I V ' 17' ' E 7' I Q Nw 'j Q ' Yr'- . f' 1 QQ: J . xg 5 .A . x V'-vf-,xc-,.r, Nxr.---5 x- ' 9fEYf 3x'-' Q fi .'?-'1'ii.xSg?' 281 Government l'Callout presents new officer Responsibility is important to Bill Briska, above. and SA president, Pat McAfee. At Northern Illinois University, the Student Association is the gov- erning student organization. The SA is composed of an executive board and 49 senators from 15 districts representing approximately 16,300 students at Northern. In the spring, elections are held for the senators and executive oliicers. Elected to olice were Pat Mc- Atee, presidentg Bill Briska, vice presidentg Roy Croisant, treasurerg and Debbie Canzone, secretary. Carolyn Lyons was elected as social vice president. Introducing new ollicers, the SA sponsored an 'SA Callout' following the election. The student body met with new committees and were in- troduced to the new oflicers. Stu- dents were given the opportunity to join the many committees that help new organizations grow at NIU. 282 wwfxifw M' WAHPW' K M iff? 49, x - Vw x 3. -, -A vw. ' ' - 1 X ig .. . he X . - :.,.,4x!3 nf ' I SX Q K' N R+ Ns 'Y Wmmf, ,,,, vw W Wm V dp-W... ,Q A if W1 Wm. Keynote: SA Representatives 4' ew ideas on the role of students should be voiced. The Student Association LSAJ is a governing body of Northern, consisting of 49 senators from 15 districts and five executive officers: president, organiza- tional vice president, social vice presi- dent, treasurer, and secretary. The dis- tricts include residence halls, off-cam- pus approved and unapproved housing, Greeks, and grad students - approxi- mately 16,300 students. The executive officers coordinate the standing committees such as Internal Af- fairs, Activities Committee, Public Rela- tions, and Finance. The senators serve on committees. When an issue arises, the senators go back to their constituents and either take formal polls or go door-to- door asking for opinions and ideas. Pat McAtee, SA president, feels that it is time for the senators and executives to communicate more openly. The senate role is one of representation, a role of conscience, and an innovative body. It should be very careful in how it inter- prets its role. The senate should not act without knowing how its constituents stand. New and fresh ideas should come from the senate concerning the atmos- phere of the campus and the academic role of the students, McAtee stated. The year 1969-1970 was a busy one for the senate. For the first time in NIU's history, room visitation was approved in the dorms along with 24-hour coed lounges. Now students may study, talk. or play cards without having to leave at a specific time. Politics of power and pres- sure create new freedoms. Elections were held in October. Voting irregularities found in two districts de- manded that the election be held over again. In November, the senate held a refer- endum to see whether NIU should send a bus to Washington, D.C. for Morato- rium Day, the cost being 257500. It was approved, and then vetoed because it was felt that the money should be kept, on campus and used for all students. 'fl be- lieve the primary duty of a senator is to fairly represent his constituents, stated Ben Davenport, Senator, District 9. The money that was to be used to send a bus to Washington is now being considered as salary money for the senators. As of now, only executives receive a salary. Under a new constitution, the SA is making progress. McAtee said, 'fl felt that the student government was changing its direction from that of a service to the students toward that of a powerful po- litical force to manipulate students. My intention is to see that the student gov- ernment be reoriented so that it might more purposely serve the students' edu- cational and social needs on a college campusf, Sponsoring new clubs and controlling their finances is another function of the SA. They allocate funds to the clubs and organizations each year. Many students on campus feel that the Student Association is a farce and the senators are not representing them fairly. If the students do not take their ideas and opinions to their senators, the SA cannot be held responsible. The SA can only be as effective as the students as a whole want it to be. As Bill Briska put it, I see that the Student Association's greatest challenge in the future will be in rising above its own internal conserva- tism, as much as that of those who now actively oppose it from the outside. Hope- fully, apathy will be a disappearing phe- nomenon on NIU's campus. I-hlmnlf-1 ffm 0-O I I .Ala-s..4l+ 285 Communication '6Direetion portrays new decade 9 '! tan., Cindy Westbrook, right, shared task with Bob Meitzdl, copy, and lan Dreger, plzoto. 'Direction '70' was chosen by the Norther staff to take a look at where we've been and to skip ahead for a look at tomorrowf, said Cindy Westbrook, editor-in-chief. It is a suiiiciently dynamic theme to show the impact of Northernj, she added. Personalization of the Norther became the primary goal in the ex- ploration of the campus during the past year. Keynote articles took an in-depth look at various activities which do not regularly receive ade- quate attention. Individual action was the focus of the book. Following in the tradition of the past eleven years, last yearis Norther was given the highest rating, All American, by the Associated Col- lege Press. The Norther was award- ed the Certificate of Special Merit for Excellence from the National School Yearbook Association. M In ,. .N .Www fff' ,V y J -A , , ,W X L 1. 2 K 5? K . - 122 -1 --:f , g ii N k N 1 X. R X 1 X N xx X S Q N 5 mg W X . .. L ,. .- . w A X ' f-ff' - :f fi ' + Q -22.1, , K k Q. k kg- mga -Ir -W -.A 515 GK X ax 5 Y is , Q S is TQ W -f --.. - zg. :fax A Xi.. , N Q .gifs M Q N xx tx xx 1 2 N XG 34 K. M .gi A in Ng f f X swf- , W y . . N, A ,wxsmwsiy .. . we , A. V Q . f 1 -. ?E1iff?Zi5lff fffigifs fisi X V F? Y A :i ff ' 'ft :v,--'iN',g-X56-4' l JE-FV? ..: .: if? 1 , K 'fu fgrifff fa n - X , iii? Y x :FX xx W .X .X.. 1. V fi J 1, 4 QMMW mf XY asw- X mg- , I-ll . A-. ,-1 5-in -15111 .ff m .::vTfi3Eha1.,a::N' ., K N fm fi N: 1-is P45 w Qs S 5 ss 35? , Xxx. . wg- --1-5 SE -f-f -- an ii S 6 X my S --,fx f'55E! 1 1 - W ,N , I ' L - wa- - -- ,, . we N ' -- x N W X X N Y, QN N 'K X 3 -QQYSXS5 w X Q Sv., X N wx X W X X ,-....z--QT, . gil L, A Si SP ' ' f ZW 4 ' A 417 6 aw UH! M,-w New R if wwf' tiff 'wwf W, fl' Photo operations modify structure The l969-l97O school year saw the Photo department and Photo Service serv- ing both the Norther and Northern Star in a different capacity. According to Tom Wartowski, photo head, the function and purpose of the five-man Photo department is 'tto present what is happening on cam- pus, graphically, through pictures. The Photo Service is equipment and chemi- cals. We want to make the best news- paper possiblef' The Photo Service served the Norther with eight photographers, a manager and an editor. The purpose of having a Photo Service is to insure yearbook quality through quality pictures, stated John Patsch, manager of the Photo Service. In the future, the Photo Service and Photo department hope to have separate dark room facilities. A lack of funds is detaining the expansion. Top: Ray Gibson, .sports editor, glances up in- quisitive!-v as his name is mentioned. Left: While distributing news assignments, Carol Przepiorka, managing editor, bursts into laugh. Towers encourages fresh poetry, prose Towers, published twice yearly, is a student publication of undergraduate and graduate student prose, poetry, and short stories. g'Our goal is to do as we've al- ways done, and to do it better, said Dr. E. Nelson James, professional publication editor and adviser of Towers. Edited by Tim Doyle and Barbara Lorr, Towers is published by Sigma Tau Delta, Theta Delta chapter, national Eng- lish honorary here at Northern. Ten thousand copies of each publica- tion are distributed to students and fac- ulty members. Every publication con- tains approximately twenty-four poems, live prose articles, and fifteen student art works. This year a larger type face for poetry selections and a two-color cover gave the publication a new look. Right: Tim Doyle, crliror, Towers, has a quiet grin for one seleclion. Below: TOWERS staff weighs izmzgirmfive quality of a submitted work. 3-xxx ...N- Vlllll- it 1 'H Y Z2 .gw,iWaf.'.,f f .f,..g'. -1 W IU concentrates on news Making WNIU-AM the second media for campus news was the main emphasis of Northern's student station this year. Working in cooperation with the Northern Star, WNIU upgrad- ed the news department with the goal of informing students of important campus and community events. 'tThe purpose of the AM station was two-foldf' said Bill Blankenstein, station manager. First of all, it gave students in the dorm a high quality radio station. It interested people in broadcasting and gave them a fantastic opportunity to build their talents, he added. Expansion of production facilities to develop communica- tions between campus and community was the main objective of WNIU-FM. t'We hope to increase the number of programs in which NIU faculty and students participate so that we can bring the campus to the communityf' said Mrs. Marjorie New- man, station manager. The FM station was conducted by a professional staff sup- plemented by students. Their goal was to provide quality pro- gramming to the DeKalb area. Upper: Wes' I1'jc'1'rcgru1l'zl, bzzsizzess nzzizzugw, WNIU-AM, c'l1eck.s' hooks. Middle: Curl Slulllcini AI7lllIIf7l'l'S his Iistcllws wifli hour of l'l'CfllL'.Yl.X'. Left: Bill BlllllliClI.S'IL'fI1, smtiofi IIIUIIIIQUV, COIlfll'I71.S' llppO1lIflHC'llI for lllfC'l'l'1CH'. 295 E TERTAINME T Diversity marks UCB program 296 Ifogw' Wagner Cflf1l'llIt', L11 Cache, and HIUlI1l7l'l'.Y1IlP zlrii'c.v .S'f70lI.l'0l'Ul1 by UCB. Variety marked the University Center Board KUCBJ program for the I969-1970 school year. Ten committees made up of more than 600 members served the 22,000 stu- dents of Northern lllinois University. The Cohesive force behind the UCB was the Program and Person- nel Committee. They innovated new programs and coordinated the oth- er activities of the Committees. UCB offered students awide range of programmed lessons ranging from judo and bridge to knitting. Friday and Sunday night movies have become a favorite pastime for students. The response was so over- whelming that many nights both performances were entirely sold out. Entertainment otlered by UCB was diverse, too. Lectures, concerts, operas, and recitals were all a part of the UCB's unique program. 4 PERSONNEL ERS 'ffgfgfif W ,:,,, 5:'f5,fG! 752' fi ,-we man-auf! .nj HAIIIOP M Orchestras shower campus with music High quality musical performance was the goal of the NIU bands. The bands were directed by Dr. Gordon Bird who was assisted by John Boyd. A variety of groups and ensembles offered an assort- ment of musical entertainment to the lis- tening public throughout the year. The all-male Marching Huskies per- formed for all home football games and traveled to the Bowling Green game to play for the hosts during halftime. After the football season, the Marching Huskies and the Women's Band combined to form the Varsity Band. This group performed on its own series of concerts during the remainder of the school year. Membership in the Concert Band was received through audition. This group's repertoire ranged from classical selec- tions to popular tunes chosen to fit the mood of the occasion. Conducted by Frank Beezhold, the Symphony Orchestra presented four con- certs, including one with the University Chorus, during the year. The 100 mem- bers were chosen by audition from the student body and university community. Through participation in the orchestra, members became acquainted with and performed great works. Left: Frank Beezhoid, director of the NIU Symphony Orchestra, gets his point across to the members of the group. Upper: John Boyd, director of NIU Concert Band, winds up practice session. Lower: A trio of trumpets punctuates climactic crescendo of Concert Band selection. University choirs involve 3 0 persons More than 350 Northern Illinois stu- dents took part in the four choruses on campus. The largest, the University Cho- rus, and the Concert Choir were directed by Dr. Elwood Smith. Womenis Chorus was directed by Dr. Eleanor Smith. In December, Handel's Messiah was presented on campus. The performance was a departure from the traditional method of presenting the work. It was accomplished by the latest research on how the oratorio was done at perform- ances given under Handel's direction. Trips taken by the University Chorus included a chorale sing at the University of Illinois, Champaign, and a national convention in Chicago. The Concert Choir was featured on the Chicago Sunday Evening Club on Chan- nel ll television. They performed several selections from the Messiah. Madrigals, comprised of 16 singers and directed by Howard Dill, gave its annual Madrigal Dinner in December. Besides the dinner, they sang at off-campus or- ganizations and held a concert. Above: A porfiou of the Concert Choir enter- tuilm' :luring ll l11'r1.v.v l'II.YC'H1f7lC'. Right: Dr. Smith rel1c'ul'.s'e.Y 200-111cn1hr'r Uni1'ersity Chorus. 300 W . V Ui, 41 , rf Above: Two members of the Womenfs' Cliorus harmonize their way through group's repertoire. Lower: Dr. Smith is u .vluzly in concenlrated motion ax he direcls choir. f ig 2 3 0 1 I ff? ' Gi A . M S 'ff 4D f- .In-1 .5 if ll . I f .. 4 V Ilxfzx 21,1-.f-,f - I' 'fic M 2 LO W D E N H A LL i lg - ' If- ..M', 4 nj' 'jd 0: 'iv A '. 4 'n 'g ,.1 25512 ' f , A A rn, -MF Na? f X Y I1 3 il - L -H -LIL-i . YJ f ' ff ' 'mf' ' Eg 1 4 . vjzfwqy' 1 -, , - -'H -1 ' , 'Z-, V Zi . ' 1? is LL- if, mil X- , is QA? Njsblaxl v, I . ' 'hx FL- in A 1 11 3 V' ' 'K'-If ' ' f . -- - 'P -53: ,- 2 Jr '11-E . 1 yur IR , - , , gi. 4 ,gp f - A . - - 1. - 1 - X fp- X I I: of 'Jflf :'j f' . 1 JTTTI s Jiw X f -. H- l -F: ' , fL2':P,' ' Q. Q- ' -. AA. . , 'Bi fggvgql ' 1, ii- ., ffl N.: . E E t: A FLW'-Q ,xAx . E S N . -...-. ft . . . 54, ,VT 1' .-v,X, spring ,... 4 l SPORTS .xx , , - ' 'J -' ...- , , .. .4- M ' - 1- - . -iQ . he b '....4-,..-A-. fall ,.,,,, 314 328 winter .... Iox . 'Q'-.L..J H. .. ,..,,v ,flu- 'IT-, - X. r.' .N . -. - I-' ' .4 H 1 - , wx . 'IA-f-,:f f , V 1 '- z 'J -7- ' ' - - Jn vi - -M-.p V , ,,.'l-QI , fY--- hm. . 'OA Q4 lf-4 - HHN. 4 . sq , M.: H If -jf any .51 ,yoj- ' in lm- 1 - l 'I H 1 , 'WE 4. X pw X' xx Q P r : V 1. 5 ln: ' '-'slgf tl, V 'fkfrf f A ' ,5 , Y r,..-1 , , If ' .- fi - if J , .1 9 xl 1 3g:Jelj ?Z1 lx ,MQ Ni- X,-K1 ' X . 'Q' ,U XKYW' ff I ' - X . 'A W' ' 51' Vsffxj N -,iinjl f- '4i.b QM' J wbii xx 5.,Fb ,IJ-P.. . f 'lg H '4-.Eggs g -r4,g,f.L. xLX.,J'vt:Y, 'V A , Rai f n X 'A '- Q' ' 'A- :Q,aQ' ,T 33' ,fl . ' IN 35T.:X.k- u'p?3. 412 5 vi I4 ' , ,,f Q 4- aw ' --11 -iQ, : Q Fl n C- 151 ig - 'I -'f VI' Q 1' 3-gf Hag. - V 'rf A 51,4 5 XC, -Q' 4 4, H . 'W I I .V x E , 29.5 .awlfz 1 n 5 'nzfillnt In YKwf':,,M,d. - 4 1'-Tiff' ' W fi fm frff. Q. X f 1 A A :fu f,.A I, if If-'A f +' m ' f 1 f A J 1 . ' ' f 71 I fl, 9 '-,X lu:-5:4 4--. Fcf '1E,l'Sl. .I l -. I. Q., I Nik 303 PRING evv opponents improve results. As the competition gets tougher, concen- lrulion and second egorts are a musr. Baseball, golf, track and tennis - they're all spring sports. Representing this university, the men on these teams found them- selves facing some of the best teams in the Midwestg and undoubtedly the improvement in the competition brought about an improvement in the Huskies, performance. Facing Northwestern, Ray Hahn and Glenn Guss threw one-hitters. Gary Olen paced the hitters with an average of .358. Averaging 79.9 strokes per round, Mike Melius was awarded the Most Valuable Team Member Award. New team captain, Frank Wegzyrn, averaged 78.4 strokes for 1968. It's the 440-yard low hurdles. Doug Abbott lunged off the blocks finishing :54.5 seconds later, tieing Northern's record. Tough opponents-good results. 4 ag ' Q Y gm .4 V M x ev vi , P N 4 I a 1.76, 'Av M 5 1' r 1 'mv W 0 4 99 Q 3 yr' A9 J 5:4 ' G f 4, A fa' A ,X V 5 G We . . 3' 'M V 'B ,Q I 1 -'I M, J A J 'M M. V' 7 W A 4 W gf av ,- 'A ' ' N, . Q ' '- '?'41f'aV 7 l ,x ff J' x ' twi , y w 1 -f , if x, V Q ff ' y M CMA ff f x, sv gym Q -F -Wg nffuin 'A' f if I 7 H Q W' Wvbma' 'vi' ' ft Wj Q, ' f- . ,-4 K Y V A J f' , . M. A -if Q , Q ,K v, , Wm it L w W, I 1 I'- t ,nor ' ' vin' 'lv ff fa , K X T' , ,, 4 If ff M I , 1 ws ff be 1. W. f 1, I 1 ,214 ,, f 'ws Y.. di Iii 3 J' 5 A E .1 . 'A VJ.. . if .nl x 4 u ,, .. sv- 7 Q Q v , r ,ix 'bf QV, 1. .nu , V inn' V gf ,A ,Mu A R, K W.. mi, 'Qi af., ' 0 3 'mga .fb-,: 0 1 An V - rx, aff . Q' fan A 151' Ai 9 x 3 :M -1 9, ww 'VG -J, f, . f'f ?' 'fd' i , F 4 ,Nw 1 ' f V, ,MVV 'W V 4-f ' ,M- M, D KI' 1 .'. 3 ,4- -. -A :eq Q f. Lg' '!. f,,,.! ff . 7? aw 1 v il 5 x 1 aww! J .Ulf 2-Xww v iv? Wy, ' 'V 'Jun ,xr -' 'fyxf 5,4 wi' nf' JFM' 'I 6'f an 'ZA 1, Tennis team strongest ever The strongest team I've ever coached in my four years at Northernf, was how Coach Tom Meinhardt summed up the 1969 Huskies tennis team. Facing some of the toughest competition in the Midwest, the team compiled an impressive 12-7 dual meet record. Not only was their dual meet record commendable, but their tour- nament play topped off a fine 1969 season. The Huskie netmen placed iirst in the second annual Hus- kie Invitational Tennis Tournament, and took second in the Drake Indoor Invitational, scoring 21 points to first place Northeast Missouri's 22 points. The big surprise of the season came with freshmen Herb Nold and John Mordhorst. On a team whose nucleus centered around returning lettermen, Nold and Mordhorst broke into the starting lineup and compiled outstanding records of 15-8 and 16-7, respectively. Senior, Bob Von Boeckmann listed the best overall record of 16-5 . In doubles competition, a record of 13-4 was tallied by the combination of Dave Andich and John Mordhorst. Fol- lowing closely in doubles play were Herb Nold and Jim McCaf- ferty posting an admirable record of 11-4 for the season. For Coach Meinhardt the highlight of the season came in upsetting Notre Dame 5-4, and in beating Western Michigan 8-1, a team which he had previously been unable to defeat in either his collegiate competition or coaching career. 306 i Tom Daly-took over for Coach Tom Meinhardt who is on a leave of absence One of the youngest on the Huskie coaching team, Daly is grad student in P.E E Ll if 3 3 5 21? WW' 'Q 5 .,,. 5 s 2. ROW One, Left to Right: Manager Bill Phillips, John Mord- Tom Meinlzardt, Jim Moos, Bob Von Boeckmann, Dave An lzorst, George Martinsen, Herb Nold. ROW Two: Coach dich, Jim McCufIer1y, Assisfanr Coach Tom Daly. dia 'isa Q i,,ig5:i?,m,m f W' 512' mem, ffm: , m.3,W,, V, A- , ,,.,, - . ' 1' W 'eW'h.. ,:-w': em-mi ' e' fw-Vg' .. wf--My mu: , ffffgi ,-h z. : , ,M ,, ,. , wqfry 2 fi' ff ST '55 iff 5 1311, , , .:. 3 ,: W ,Uk , w i- - wggwggysglwgylz Mx, .,,'-.,.,,1,,,,:,, M, wif 'v , e 1' ..,, K 'W u f W Q 'sy f K TFFSQQ ff wfig? . my ,,,25M, ML HL-431 1, Q M in , V - .wp 7 ,Q fwhwlf 1, 1, ff , ,F ' , , f,,,, ' ' Me er: Individuals make the team go. W. Wiszowaty. Row Two: G. Sowa, T. Wit- la, B. Mueller, J Dillenburg. Row Three: As- tum, R. Lamb, J. Jesenskv. G. Gus, D. Hanu- sit. Coach D. Mason, W. Franke, P. Visei, Proficiency in the fundamentals of the game and individual efforts can make a baseball team, but a winning club needs something extra. It must have athletes with an unrelent- ing determination for victory. More im- portantly, the players must have pride in themselves as individuals and as a team. Coach Tom Meyer's 1969 diamondmen possessed these qualities. Although they finished the season on the short side of a 16-19 record, one must remember that their competition was the most chal- lenging that any Huskie baseball squad has ever faced. They boasted a 35-game schedule con- sisting of such nationally ranked schools as Houston, Southem Illinois and West- ern Michigan. Although they compiled a respectable batting average of .277, As- sistant Coach Dave Mason felt that they just couldn't get their hits in bunches. Led by tri-captains, Tommy Hunes, Joe Jesensky, seniors, and junior Frank Krempa, the team made progress. The strength of next year's team lies in many of the returning 'topf individuals. M. Ferguson, D. Hoppe, L. Hansen, F. Krem- pa, T. Hynes and Head Coach Tom Meyer. Kr -1 4: 1 ',svp-r u M ui ' 0 9 'Q Wx .4 ,W Jwtw Mvfw,Wv 72' X . x J wx, H? Z4 'Qfifzf few 1 K ,,g f, 1 am sg N I 'fs'-Q , .. A fm '. .V fv2, ,L'? , ihm, kwf. A,,, , 4 , , ,, ,, , ' V .f ,?wf4,i.Kl?lv'?54f'i,, . h si 'fW+'Zh:12 , V , Q, If ,mv if 3. ,, fpykm A, ,hp Q uf, rv S , ' .f AW' . k..+.X A' ' 'mfK,, . 'ffI'wg1- Ae R' f my MQ? , M, . . x, - , 2 , ,f , wx, A . , wg, v,jw,,: f J, Q. av, xx- kk Sf ' X .X wx, iq . 1 , ,. Vw vw Namfz ff mv, , 4 may :VY ,mf X A ,Q ix, 1. flaw V. N Z 1 wfhf an '-Nr The team participated in seven major events. The Huskies placed 19th out of 38 teams in the Gulf American Golf Classic at Cape Coral, Florida. NIU came in second in the Quadrangular tourney at Wisconsin. In the U. S. Collegiate Invitational Golf Championship held at Stanford, Califor- nia, Northern placed 19th out of 22 teams. In the Northwestern Quadrangular, the Huskies placed fourth, totaling a score of 605. Two juniors shared the laurels of golf. Frank Wegrzyn of North Chicago was elected as the Most Valuable Player and Mike Melius of Waukegan was elected honorary captain for the 1969 golf season. Frank Wegrzyn is regarded as possess- ing the best overall game from tee to green. He hits woods and irons equally well. By the end of last summer, he had apparently solved his putting problem. Mike Melius, although a junior, was out for the first time. His performance war- ranted the title of honorary captain. Track sets individual pace Track is considered by most to be a sport for the individual, but NIU Head Coach Harold Morris feels that team spirit is the essential factor in fielding a winning team. The new coach for the Huskies felt that one of the biggest surprises of the sea- son was the willingness with 'fwhich people worked to make a team effortf' The tracksters completed the season with a 2-4 record in dual meet competition. The team effort was evident as the cindermcn placed second in the newly organized North- ern Illinois Invitational and fourth out of I7 in the Illinois Intercollegiate Relays at Champaign. During the course of the season, there were many outstand- ing individual efforts. Senior, Doug Abbott tied the record for the 440-yard low hurdles when he was clocked at :54.5. A new pole vault record was established when senior, Bob Johnson, cleared the bar at 14' 9 . George Tyms, freshman, smashed the former shot put record with a put of 55' 6 . Assistant Coach, James Fischer, felt that as a freshman George was the second best shot putter in the state, and should play a prominent role in future Huskie track meets. J Left to Right: Jim Martin, Head Coach Hal Morris, Doug Abbott, Bob Bakshis, Rich ard Gaylord, Bob Johnson, leg Yordan, Stig 0S1,L7lIl1I'tI', Rich Koprmda, George Sladek 312 lub 'vw swf- M- ? 'T Y 1 if tv' fr Hu kie join new conference -me ,afife 'gp' CllIl'l'l'fK'!l!1UI'X spark Hllskics and furry 011 to victory 011 Aslrollrrf ax H11.i'Ai4'.x' roll. Northern Illinois University's new football coach Doc Urich has a reputation for being a football fun- damentalist with emphasis on dis- cipline and hard work. The chore of reshaping a team and building strength for the next year is under- way. The hopes for a nationally rated team aren't diminished. With the return of John LaLonde, All American honorable mention, NlU's second year on the Astroturf may prove to be too much for new conference foes in the 1970-1971 season. If the first seventy years of Hus- kie football were exciting, the next decade proves to be even more of an attraction. Entry into Univer- sity Division Status, joining a new conference, hiring a new coach and Astroturf are a beginning. There is no end to the possibilities. Zitdti, mlm . ygwwfkim Y Y ' w ill' - wrfrzf F LL ummm W-'vm Z 4 ,Lvl-, , E N, f Y' ,v.,,,-,wfr1:: Q?i7f Q m wx - ,W,,,,.,q.,M.+, V ,,.M..Ayf1fh : X- 1 2 f 1 ,ix 5 mv. 5 A 3 .V V 2 2 Na. I A ' -W--1 5 X' W' 'vu ' . V SJIIM , S - .,l - . V ' . ' -1. ' 1, r - V f 4 .. . 1 1' ' , Q' '5 Q. .' W' . , ' ',. ' ,, , ,,'- fx - , Q A ',7 7' ..-T , .1. gQQ ',.. x 'V I f -'V Un. - 'A ' ' H A ' - ,www , . , ' ' . A ' -, L H- ,ft ,ukgrzz V I ,Mn 7 I mg wi., 'NAA -Q., gf ,.-Q ,4,l1nw Y,mlI1lsA.:.' '1,..-N L ri! Q mv' , A -,x-15.-'A-gfl ,f1-I-m.,,' Q . V ' 'irq-ww, 'fwirf .J 'f,xi',,,',,' l., Y' Q , '?.,v.4'i A, v ui:Xf '? ' .: -:sw 352 .' -f' '.- 9-'. g ' fm- - . ,, - 5.41-'f 4,, g1--L ,.,',2'm' +' .L M' -, l, inwf' - ..4f 1' ,n.,' ,L', ,'-.vH'v 'A X--Af' ,f '.', y V. ,fg .' ' A ' 4' Z ' - ,, f Yu Xa 'T ku '-T -,.,-,'5 h?.' ' -1 ': vT - sf i -' lK'2,'2L,' ' A' 1 K wx - 'W ,' 'W V ' Q Y, if .-5 'I 1i ', 4.'gQ5 ,x 1 f'-' 4, 'w,1g I 'L 4 ' 'M , 1 't TR .ff Ma . .y 1 , f V. ' - , -' . ' ' I I . .f 1 -.. M ' ATA ' Q ' ' . - ' NW 4 , A AU? ' ,E - :Y ,J WJ- . M 4. 04. J gr., 4 .4 ,I . -. I, J A ,: 4..,g.v ll , ,, ,ff -A, '-' 4' - f f vi - - . A . ,M ,--- ' ' .f,-. t mx ' ' ' I P 'Q 5 V N. L ., , --,,- i',,w,,..'w ,- - g 1 9,7 . . -- , ..- V, -4' D 'L , fem 1 -yw , ,1 - ff:-,' 15 fgl1f',r.'5 'If'.'L q'TX 1 . ' ,?f:f'. ' ,x jvfxriq ,IU n ,-gg.-vw' YA: .L A '-, .4 lwj. 14. 1 M' K -Q. .D ' , .IM :A fl! at .J ,. ly .,mx.' -i M! .V -A W5 '- YW , 7, aw H '.g . V' 'V lx' 8 A' V A L F V' Z' .h 55. fx' ' - ,'. i V--E 'f FW W 5 1, Q A B' 13. 1 X If 1 qx!,',' 'A , , V 1' F ,. , l rN. 'A ' AMW. ' .V 1 ,L Q, -qn ' V' Q4' fs 1 3.5! X V. ' f , . 5 , .1 A ' f, A, :L Mm qw, y t ,JYL X W, V- E , I. 2 .. K 1 K ' AW ,.'. 'z ,-Q .,1'C '5'.l'-'I '51 1'7 xr ',' . , Y' 'f- ' -1 . 1 H 'Q -, V.. fu-.-, -A , .' -7 ' -fx!-lv ll ,wa 'Ffa' 'Q - 4- I NQYT f ' .3 rg ' .Q . V - 1, vi -' ' H'-'M ' -,,-. - A w- , - ' ' 14, ,X A xxx '12, -.,, 1 , . . A gat- M W ,nw 4, . ,,-,,., f ff , ,qw-,, rw-' .X v 1 11, ' 1' M . W ' ff 1-'Lf 'xQ .f1:- ,-A - K B' Y 5. ,- ' 1 ,-,,., X . -'Av 41 -.'. ' 'ff' , - , U - ,gyp 5 ,X 1 X V I QA rf, A ,X vig..-X :.:0-.29-a,,, ix wif-J 2 A. ,JJ cx. I, , WR ' 1, , -, . ,,, , wx- -, , .pgs ', w. ' 4, - , s ,L . QW. ,--f'1 ' -' 'W 'ff' ..1 4' ff. 'f'f5, -Q!! y' ff ' , if '. V V .' 4 'X A X 3 ' pi 7 N H X 'H . 4 ' ' 'jig 'f 3'1 ,-.5 ' f'..' Y fi! 7' - - 'A Qf uf-F -' 1 z wg? 2' ' A Q' 3, ,Q ff? 7' -6 . 7 1,N'f xvv- .- - JY' ' lx saw ,Q fi' 1' ,Q 3, ffy' 4.z9X. 'k4 ' ',.', ' . ,.ggx'f, .5,,,e , jd -13 ' 'qi ,, w' . . ,--f , , ., H 1,l',A Af, 5 Q' '81 ' 'tk ' h , . ' .' ' 'R 'P - ilk 15- 71 iffy JM' na 5, 1' ' JP- f' A P 44+ v - f -' f., f..-f1,, iQ ' ' . ' 'S 7 ' ' 'S ' Fw, My-A ' V , r X1 A V r ,. F 43' Q A - V ry i, Q.: 4 , r , - . - . U ,,,A W MT ' A ,V ' - ' f' , if ,T . M., , V, 1 1. , , V . M E 4 S -' . , ' ..g ff ,af-. ,:,'f', -9 , .1 , 4 f.: j ' Hn,- J w em ' ' Q Q15 JS ,, 47, L, , q 15 i I ' ,ig Qiffya 5 ,. , f, fx l .2 , a 1 W' , 1 , 'gi-Q ' 575. -Q - i --'f -3' , J:A , V d.h!lL.f K , 'V .fi KIA' - 4A:,Y,v55 4.1 ,,. a X f , - A A il - 4-' ' il ,, ,, ! , ln L ,. I, . 3. , ,mf ,vf ' ,ff ' ' 'T . f 1' i ' - .1'f2 3 A ,f 'jg X .A ' 5 Q 'I 5 ' ,, V it-'A 31' M ' ' 1 X Q ,QS is 9-ga.. S , -r IW r 1 ,V , vga sg- 1- A M -Q, First year on turf Although this year's varsity team Won three and lost seven, the sparkle and ex- citement of the game was there. The Huskies had a total of 23 TDs to their opponentls 39. Quarterback Steve Parker and backer .lim Patterson were picked by their team- mates as the 1969 MVP,s. Steve provid- ed our team with leadershipf, Coach Don Ulrich said. Urich awarded 40 varsity letters this year. Of the 40 letter-winners, 13 were seniors, 15 were juniors, and 12 were sophomores. All 40 will remember the thrills and disappointments of this year. The undergraduates can only look for- ward to that 'next timef Row One, Left to Right: Phil Szukis 1891, Jolzn Combs 1621, Ken Muszynski 1741, Jolzn Potocki 1771, Steve Ware 1431, John Williams 1821, Bob Hastings 1711, Rich Ciesla 1721, Jerry Weydert 1911, Rich Finley 1901, Rich Strauss 1831, Bob Rose 1651, Tom Coogan 1951, Tom Frye 1731, Lee Hudetz 1421, John Hunter 1541, Dave Weisendanger 1751, Steve Alberts 1781, and Valdis Spuris 1381. ROW Two: Scott Feaman 1861,Jim Czocher 1551, Tom Bastable 1801, Chris Richter 1311, Steve Fuller 1591, Bill Dial 1671, Ha-rold Hammerick 1791, Jef? Ainsworth 1761, Ron Hartley 1161, Larry Beasley 1871, Balint Saller 1661, Ken Cristo 1411, Wayne Fiedler 1241, Steve Goehl 1291, Galen Naumann 1631, Bob Suvada 1611, Dan DeVito 1471, Bruce Bray 1201, and Don Fanf- sinn 1571. Row Three: Bob Carpenter 1151, Dan Gorman 1221, Bob Breskovich 1681, Jim Kelly 1351, Dave Garrett 1281, Joe Shableau 1371, Roy May 1531, Jim Rhoades 1361, Paul Janik 1521, Ed Freza 1391, Tom Wittum 1931, Mike Wadzita 1641, Tom Harvey 1441, Bill Boston 1231, Cleo Husband 1301, Assistant Coach Sam Sanders, Assistant Coach Otis Wag- ner, Assistant Coach Phil Holm, Graduate As- sistant Coach Jim Faggetti, Freshman Coaclz Bob Heimerdinger and Head Trainer Al Kranz. Row Four: Head Coach Doc Urich, Gradu- ate Assistant Coach Bill Murphy, Assistant Coach Clijjford Kip Cramer, Assistant Coach Chuck Nickoson, Assistant Coach Jerry lppoliti, John LaLonde 1331, Mike Lariccia 1701, Jim Montgomery 1261, Tom Rose 1211, Jim Patter- son 1601, Steve Parker 1101, Bill Black 1141, Ernie Smith 1121, Anthony Sabtino 1111 and Wayne Tsutsumi 1561. r-we 316 W Z. .,.x-.QM . K : is, , .. 5 .. Q W N 0: Xxx X, X, 5x Q Q, K - alms ,fffifswgiiikigf Cfijg-.!'531V X ' 552- . . . ' fggsz, .Q .W - f - .E 1- x -E E- . .gm IHS a long road and We are behind other schools. But with which we new have, andthe right coaches, which We new ni ' px .1 , ,x we . I , a fi ,, , .rr 4 I F lf av ' x K an i' Q f- r . ,. f 1'.fr t 1 H+ 0-'PYT , 1 f-A , 4 I lr ' A 'H 'N F W2 Q fx r ' ' M 'Q' xx Q if QA , I' i fx 5 2 WXEXYN ,. R , Q 1 ' 2 it 4 - ' it 1 M: Z ,V . . 1 , I 4 .J . 1 i Q '!-- J ' 1741 J my 3 Eg- W 'wi MA K K I I ,A . , x 53:13 l ' Yi 3 5 M XX x an Y. .gf-1 glqn' ff t 4, H e r -. 4 K fs , Z1 ,ft gg, 3 'ff f fc 1 if ' 35: E fa Leg C, r' jk, . , f ,r, his 'Q T i, i 5 ' gr-.fx-'XR f n f, gl in ,, ' 'fl if 552325 uf If - 1 . 0 l. A if D. 1325, 1 U' 3 . 'F az, 5 if if ,z L? 1' X - x k 'W ffl 2 5 F San? if K QQ 1 . Rf: A I!! N 1 U SMC!! ff few ma. if if ,, K E i an M X 53+ Q 1' 3 X Q A V 2 gf 1 9 ,VW ,K f wi , '5 ,sf , ,afifkiam 'K Q' N N U 1 1, xx 5 I mis Playing an important role in the Huskies' soc- cer success this fall was a fine group from the Aurora area. Left to right: Bill Suylzauda, George Jablonski, Axel Elder, Coach Dave Bucher, Manuel Garcia and Joe Suyliayda. Soccer scores big with strong defense Northern Illinois University enjoyed one of its most successful soccer seasons in the schoo1's history last fall. The Hus- kies won eight of nine contests, losing only to national champion St. Louis Uni- versity before 7,500 spectators on North- ern Stadium,s AstroTurf. Forty goals were scored by the strong offensive team, being led by Eric Roy, senior, and soph- omore sensation Ed Kositzki, with 16 and 10 respectively. The defense, led by Al Zelechowski's spectacular style of attack and pursuit and Henry Wind's solid ag- gressive goal keeping, allowed opponents to score only 16 times, eight of those by the St. Louis team. Dave Bucher, coach, believes in a Well conditioned team. The future for soccer looks quite fast. -mums f '- 2 Harriers finish strongest season Coach Joe Hartley's harriers are look- ing at their best season of the last six years with pride. Northern's team finished the 1969 season with a dual meet record of nine wins, three losses, and a solid sixth in the Illinois Inter-Collegiate Cross- Country Championships. Don Sage reigned over the north forty course here in DeKalb, and took three of his seven first placings on home ground. This and his ninth placing in the state intercollegiate run made his Most Valu- able Award a reality. Don Gereau, a freshman, ran in all but one meet, and turned in the best four- mile time of the entire team. He provided much of the work that Coach Hartley predicted would be needed to erase the question marks from a season marked by the graduation of many seniors. mess mum? Kwon WW Above, Left to Right: Coach Hartley discusses one of the sporfs finer points with Don Sage and Rich Gaylord. Sage and Gaylord led the Huskies to a 9-3 record, their best in six years. Intramural sports: lt takes all kinds Basketball, volleyball, and handball - but that's only half of the story and commotion. Students also played squash, badminton, and lifted weights in the 1969-70 Intramural sports program. University men were drawn to the fieldhouse in many groups. It didnlt mat- ter whether individuals were good or not in the sport. They came with their dorm buds, frat brothers, or in their independ- ent organizations. Everyone came to have fun - and maybe, with that little extra push - win! A common problem among the parti- cipants was the lack of time to prepare for games. They practiced, played, and Watched the results of other teams, yet no one ever had Htoo mueh', of the activity or fun that would keep him from getting out to do it again. IK Front Row, Left to Right: Chris Withers, Marilee Bell, Vicki Anderson, Margie Twar- dy, Candie Carroll, cocaptain, Charlotte Freeman, cocaptain, Jeri Ness, Alice Mar, Joy Toman, Cheryl Harding, Denise Rode. Middle Row, Left to Right: Nancy Waters, Beth French, Bonnie Buchanan, Judy Sa- dowski, Sue Rishe, Sue Iverson, Lynn Lar- sen. Back ROW, Left to Right: Jean Wilkas, Carolyn Haselton, Kathy Stenman, Meryl Roberts, Charlotte Perry, Debbie Corcoran, Pam Greene, Barb Reimers. Not Pictured: Kathy Jones, Bette Beer, Jan Erickson, Lor- raine Zanarini, Terry Smith, Judy Wallin, Liz Spellmire. 325 Cheers + music 1 pulsating rhythm NIU cheerleaders are picked yearly, through a series of required practices and tryouts. There are seven cheerleaders and one alternate chosen every year. The cheerleaders practice two to three nights a week. The purpose of a cheerleader is to in- still the crowd with spirit, even if the team is not on the winning side of the score. The seven eo-eds try to organize the ex- citement of the crowd. The Marching Huskies have become a tradition at home football and basket- ball games. During football season the all male band performed at halftime. The Huskies also formed a spirit group for the basketball season. The band played dur- ing time-out, before the game. and at the end of the game. The Huskies also ac- companied the Pom Pon girls at football and basketball games. The Marching Huskies most familiar tunes range from 'fBy the Time I get to Phoenix to Classical Gas? NIU Marching Hllskiex entertain specmtors at Huskie football and brrrkelball compcftitions. 326 Above, Left to Right: NIU Cheerleaders Phylis Mclntosh, Donna Kopczynski, Barb Womer, Cathy Siwinski, Darcy Taheny and Linda Nelson take time out for a still pose. Center: Cheer- leaders in action sjur Huskies. Cheerleaders not pictured were Cindy Hybiak and Jane Hughes Winter Sport Huskies come in from the cold Darkness falls on NIU as the cold west wind beckons the Ilirill of winter sports. The DeKalb winter no longer chilled fans looking down onto the AstroTurf field. Winter had come, and although the wind grew colder every day, the spectators at NIU could now Watch from the stands inside. They watched, and saw Jorgy carried triumphantly off the court after a victory over DePaul. They saw a young gymnastics team defeat their opponents in both score and spirit. Huskie grapplers began to grow stonger as the season progress- ed, and the tankers came up with I7 surprises from Graham Hall. Hockey players kept their spec- tators in touch with victory, and the WRA program developed a highly successful Womenis basketball team. Winter also was a time for the spec- tators to become active. X N il S xi-H ' K W X UE, ff QW fy' 4 In g ' 47 , 1 Q ,X . ' 'Zh 'L '1 M, QM- K . f fmm 1 , , -ww , 5, s unsung I ff V 5 M M av Jw A ' Q Q Q ZW '?'im'f1?V Va' 1' M W v , 1 1 Q I ,. W ,Q f X ' W 5-1 4? M gw w ' gig, , '- fx pf, fn' .. mv. ti i' -' . if ' V, D' iw ,f f H ,M 'V Vx . 'x I 'V W 'fri' ,6 nv I my i A ' 4 ,V A ' 'V 434' if 'H I I hw wb ' Q,,0,f gf , N , Q? 3 n , -5' , P' 5 -f a 'J 7 M' M y ,fig Mp 2 3 W t HM M Ay ' 9 , , J 5'-, if , J' 10 ' 3. 2 I ' 1, Lf, af, FB: , 4g 5 ,V , , ' 'X kwin MM '- hy ir ' If M f- , ,': :f- W . Ziflfg Q ' All as M A av M A 4' V,,, i f ' f W if W iw' I 3 , W if fm.. 'or ,Wx fdxfn X Y 'hw Q It ik 3 1-X ' 1 iw - 5 ,E f 51,4 Coach J orgensen: Success will come He's a dynamic individual, happy in victory, contemplative and angered by unnecessary blunders, but willing to hear what anyone has to say. A strong assort- ment of individuals on a basketball team must work together for that all important win. That was the Huskie chore this year - to get together, coordinate, anticipate, and learn to rebound from mistakes. No number 12, Nate Mason, or 52, Don Russell, can help next year. The burden will fall on the likes of Ivey and Zelinski. It's a coach's job to use his men where they are most able. Jorgensen's ability to coach is best exemplified by the player that is always in there scrapping. ri f AA wmmnmm, 1N'F 'M ef' Fieldhouse makes scene with fun for players and fans There's more to basketball than basketball. Believe it or not the eye isn't aware of all it sees. What happens in a game may be part of the teamis response to its audience, to the acid air of competition, to situations or circumstances, or just plain fatigue. Watch the crowd. Reactive or complacent as any one crowd may seem, what's going to happen on the floor will be nearly directly proportional. What accounts for the ll-1 home record while the road produced 2-l 1? It's tough playing on the road in any sport, but the confines of any indoor activity as popular as basketball makes it that much more perturbing. Next year Coach Jorgensen is counting on two things: an easier schedule to open the season with, and the desire from the players to win on the road despite a hostile opponent. The new conference may offer just the right amount of fight. Huskies may do more than sweep the conference. They may even make an awkward landing on one of the major national polls. Below: Russell, do you think we should be standing here? Someone might see us. I think you're right Dennis, why don't you sit out this semester. Middle right: Don't pull the string too hard Bruce, tittered Tony. Right: Senior Pete Kontos saw lllllllfdd action, but the talented guard showed that he could handle himself any time. Shown here handling his hips. Top right: Exciting halftime show presented by the Moving Sweepers a local organization, Excitement of the game overcanze sev- eral fans. Portable oxygen masks were distributed before the game. 334 239 Q X .if ,1 fs 4 .Y fy, , If ,pm ' v ' WWW -2 H fy WW 3 W- 1 , , M Vw Q it . ,, ,, Q V , Q , ,l ,ff 4, ' . a A ff ,U , '41, ay Q P? N' F if Q Y, M 1 oh vw M ' ' '54, U if E 12 9' W g. i' 5, 5, 4 R ff? mt 6 ff' If 9 ,Q M , I' MG V f- ,, A . r l 2' .?H ' 5 E W f' YW! M A- 3 3 6 6 Q 'ET 1- S I x , ff rm , s. M Y, Q 5 ' - X m JA , I ig I ' . ' g Vik ll X3 , S ,. cv . S wi P ? v v M 5,5 2 I VU? ' .f W,-.vw-wf MW., W , 1: W mf Ai, f 9 V ,N A f ,, A ,M 4 , I' if A W X Q .1 , X M A M ,Q f F 2 9, Y u-Ugg. 41 IZQMQ 421 A f I Q ff A A , K Q2 ff f yn' K ff , , , 1' ke h nf' a , , .al f 2 Q 'UM nh'-W M A 1 . I M V, , 5 ,vm , Inn Qfa, 4 'Rf A 4 f. 5 ' J 45,996+ ' 'M rl wi 'Q X 2 5 Wa, . ,l,,,,! ,,, . , , ww ages SSS? E 5 NX. H xi MQ S 3 A N 'kLh X X f , s ! R: Q Gymnastics grows: a concerned coach Final results: 9 Wins, 7 losses, 3 grad- uating seniors, a great group of freshmen, and a future. Coach Hubert Dunn seems to be patiently waiting for his team to gain its age of reckoning. Spirit ran at a high level this year. Always present Was the extended hand of Team Captain Pat Delassandro. With the gripping tensions in a close meet, the man who can loosen up the team is a real asset to the entire effort. Hovering close to the apparatus on dangerous maneuvers, Assistant Coach Bill Spaletto, a former NIU gymnast, pro- vided the extra support for Coach Dunnls muscle men. Each performance comple- mented the efforts of the entire team. S51 111.-w P '- M41 if 2 - nf, , Q? H, Y W . L? Me' a2,:b71 ine- 3,1 A, f , ' 4 , .. . , .,,A L54 -Mf.,,ffM+Mm,,g,,5M3Q,f,,WW K A I NW 3 SX ww wk NN WM A Q3 X S X ...:rxNX'71Y'X N J N H wwf. R Q f Q f M- Nik QS 5 L:- - fa - QS Q rr ,.f:, f ak, i . ,ik Q .2 ap Mi wb Q 1 f. .f Q sg f' av 9, K 1 fha 5 he W I P, ,Q h 'Q 'f' Mn ,W I x W K Y 4 1522 , ,V 22 ., ff , iw 3521 Af, U , Q nm Ill! 2 ' SE x , A1 JL Q P ,f 5 m .awafzvX J ' gn Ax J ,WW Q a'f':a,f5fx f ' ,,,w,,g --1--,.., ,ji Q Z 3 24 4 WM.-W ..,,. W Movement, form, strength, balance, and exe- cution are the absolute concern of the coach and the team members. Nick Dallas on the rings demonstrates the Olympic cross. Charles Koules is executing the Christ carry on the high bar. David Chiclley performs a scissors kick on the side horse. Larry Reslel stoop- vaults on the long horse. Coach Dunn watches swing to lzaizdstaml and back-Hip. gf Www WM Sf W Vg 2 . X ' 'si x -If xx X. +R, NM -,..f fx. . xx A Q- ...wr K A wi Q X 155 A ig X SNQ X f wp Freshmen bolster mat staff The tensions in a wrestling match are impossible to describe effectively. Spectators stare, sweat, scream, plead, but the out- come is totally dependent on the strength of that man straining on the mat. Coach Don Flavin in his second year at Northern viewed the start of this season with some apprehension. But a young, inexperienced, talented crop of freshmen have done an outstanding job of diminishing that doubt. Fine performances by freshmen Chuck Rossetti, Bruce Chvalovsky, and John Mullin have greatly complemented the performances of veterans Pat North, Mike Cookas, and Phil Szukis. North, captain and only senior on the team, made a habit of destroying the opposition on various occasions. As impressive as the team appeared in the 1969-70 season, chances are that the next few years will prove to be some of the best that Coach Flavin and thc Husky grapplers may encounter. The experience gained this year will be tested. Below: Pat Norllz in mid-season wrestling form. Below: Cookas gain- ing riding lime against a Toledo University adversary. s 8, v I i Above: Coach Flavin directing the attack during a dual meet at Wheaton College, season record 7-8. Wrestling team, Front Row, Left to Right: Ron Weber, Joe Clifle, Chuck Rossetti, Bob Almazla, Mike Piraino, Ron Lenkowski and lolin Mullin. Second Row: Walt McNella, Ron Kyler, Jon Pa- laziola, Pat North, Ron Pearson, Bruce Clzvalov- sky and Paul Rasnzizssen. Third Row: Mike Cook- as, Jack Williams, Mike Kerr, Bob Gilman, Steve Williams, Dick London and Bob Steclzscliulte. Not pictured: Pat Higgins, Pliil Szukis and Mike Lariccia. Winning justifies Hockey Club Finishing the season with a 16-win, six-loss, three-tie rec- ord, the 1969-70 NIU Hockey Club is quite proud of its highly successful season. In the Midwest Collegiate Hockey League in Joliet, Illinois, theteam beat out six area schools, taking Hrst place rather easily, beating the nearest opponent, Triton College, by nearly 30 points. Other area hockey powers in the league include Morton College and Wheaton College. Coach Mike Breem feels that the team and hockey play- ers in general are much improved and better developed than in the past. Prospects for continued success are good since most of the players are freshmen and sophomores. There also appears to be an acceptance of hockey as a varsity sport in the near future. Within three years a rink will be built in DeKalb. Outstanding plays by goalie Bob Beranek and leading scorers John Kaptena, Ray Grobowski, and Don McClaran will continue to aid to this success. - rf-In 7 !' f mik- YQ .xi sxsx -x it tr 5 m 31' .,. , 4 l Blades slzrzfrl the ice, ilu' puck A'lifIIL'I'.3' acrf'0.x'.s' the rink as Ihc Huskiv ice lzockvy 1011111 czttenzprx Io gain points in fha las! few HIfI1IlIl'.Y of thu gauze. Far Icft is' the 1969-70l10cka,v Ivamz Back Row, left IO right: Ray Grfzlmwski, Donald Boot, Dicrkic R0l1tQl'I'S, Mike Krzy' fj'Cf1, Glwz Tonzelc, Brlzcic Bl'lU1llt'l. Tommy Sc'!1avf0r', Phil Eikasx and .wiclzavl Iircfwz. Front ROW: Allwz C0142 1,011 Jvlcflarufz, 101111 fcllifly KlIf7fl'lI!l, B011 BC'l'lHIL'k, Kwzfzeffz .WmzIi, SCOIIQ' Jzlcolnxcfl, and Tom l'r'.w1pia. i wgkxi- k s if w Jia? Xxx .aim Qffxx xxx? -an 3 , . Rxgkkk Q . 347 - -sw ii ' in ' an X x X xv. r W JR Q 5 WMV-WWE ,W Q i 5 J E '91 in-2LSLi.sfff X -' S525 ,xx ii i X A 5 :..: . .fig NYQN . fi? sw--W .. s .Qk?N:q l Wki, ,MW 'S W W, WNV :V 1 Pi M. Q M X .Q '- 35g.mgxyMAw.- ,i. M gfwywlgfgiigiv J . . wkgfifn. K. .. -y 5 46,1 : wh4,ozJ5'f ?'if9iWLf f2iW 1 - A , V , My -W , ,,. , N, V, ' ' ' W' www 'f '4fwef?2e?i2i,w,v M f ffffxfwwfafwf , I , 1 WW W an-mm, ,,,, M' vyby - M A ,,,, ni , U ' ff ' ,M i , 3 rv ,V T,,,w, f, , L V ,V,W,, , Y 1,L, , , , , ,, , ? 'iff W f, I A-,,,,,v t fx wif ff ' Q an gf , f f M L ,A ' ' , A11,Q , , 4 2.9 ag 2 11,2 ' Q 4 VZA ' H ,Z .su W M, , ji sl E3 . 1 .Q T X . i L. V by Ke, , fr ' - W Ju 1, ff , ,,,, mmxiq' WW ff 2 mr ' eww. w li I 4 ,af W A 'P ,Ji Q ,Q O 2 ,mug , 'iff' , 4 4 2 if , l 4 Si' xv x xx vim A 5-iQsa3ffi'3:1f1?g.f?f x ,- LA'Q. 1,95-.. it--7 1 fr I H .J K . I L .. Q l IAVZJ 3,f',',,,',' ' I Z ,I ,Z iff LO W D EN H A LL , ' A ..., V' - 'L ..,.. . .,,. 5 1 H - if K -wif?-M -.-.W 1 lg ' 2 -Q f MY I. gpxg- , H ' ',-:iv . -l.I.,? 3-Q,',!'f4!f! x1' 'lil .L L--rg.- I, n muh: !il'.L-.4-.4 I T457 V I .t X WA, f I. 'iii' -W A U .4 ic: W V11 Z - 7 ,. , i KfQ?iE.-L' , ' fhzxi, fp, Qi Aff m P V , Yugi- 'I X. ml-ji: - I 15, lf: - A -jf 4 fMlJf ff f.4.- -sl 'H ... T0 ,ak ' ' ' tl! 4 ' ' -: ff-- ' si. ' LABU if B4 - A - V v3 U M . : 4 f ? I ,,,v7 'fx'.:Qw3A7Q S- i. -.. ws.. P. 4 A I I ax , .f , . ' f,- '- .. 1 -gf ' 'Iwi-.iw---fj'.-- f. ' Y SENIORS .I . R, . I. - -. ' A--' . lux ,gp , I . . .. , hw J., , ' -Flax ' ' f 'f AY ,,, 0, fe., Q. , pg.: . 4 yr, ' 4-33' ' E 'A 'mf ' 'i-5. '. -1 Q-5 , -., f W , ,..,. ff'A- 'T' yn- ' -2' -f'1-:f4.ginL.?'L-A 1.-Q! If I V I V 3 , , - ' s.,' If! ' .f '4:f 'LI 77 2-4:51, Xl X, N'1:'i,--21' ,A :Af 19 f . ' f Q 7 1' I, 1 ,lf 1 I A . ' f ' Q fax? .'-, - 5 vi 'fy ,- .K D V .,.., I ,Q .4 , wh Q1 2 - - . 1, WI' -f1: -ff:.,J N ' .,. Xf53Q -nj' I x L1 XHX ,-, 'DX H25 :,-I ' 'Q A - Q, X-im lp ' Wpl ,f -, X A. X ' x. ' -. 'i atiefj 3 xA'qq+.., ,' X in - , , K A SN. 3 xi,-,IA i ' fel? w fm 1, f l. . xv! l. 1' . ff if -1 its if xef . ' .,. l:.3,,'..l -a X.-fl' N 'if' fl xg 1' ,ft I-Q: Xe I X Q ,ff r II f fi nn, xx ...., ,I . . 3 1 5127?- 'i-Q,--5 351 'f 5- l.,' - I Memories BETTY ABNEY, Dalzell, Illinois: Elementary Education: Illinois Valley Community Junior College: Naiads Swim Club, pres. and vice pres. 3. JUDY MARLENE ACHLER, Chicago, Illinois: Elementary Education, History: Sigma Delta Tau, asst. pledge trainer 2, 3: Hillel l, 2, 3, 4. CAROL ACKERMAN, Chicago, Illinois: Englislz, Anthropology: Out- door Club 2, 3, 4 sec. 3: Studio Theater 1. ARTHUR ROBERT ADAMS, Waukegan, Illinois: Physics, Math. DONALD C. ADAMS, Blue Island, Illinois: Marketing: Thornton Jun- ior College: AMA,' Intramurals. SHARYNN ADASKA, Chicago, Illinois: Elementary Education, Science: University of Illinois Circle Campus: SEA 3, 4: UCB 3, 4: St. Charles Tutor 3. STEVEN ADRIAN, Rockford, Illinois: History, Economics: Rock Valley Junior College: UCB Movie Committee. BARBARA AHRENS, Dolton, Illinois: French, English: UCB Movie Committee 3, 4: Dorm Council 1, 2: University Lutheran Parish Coun- cil 2, 3, 4. THEODORE ALBERTS, Evergreen Park, Illinois: Industry and Tech- nology: Western Illinois University. KENNETH E. ALBRECHT, Crystal Lake, Illinois: Pre-Medicine and Chemistry, Matlzeniatics: Long Beach City College: Tennis 1: Dorm vice pres. 2: RA 3. GLEN ALDEN, Dakota, Illinois: Electronics Technology: YR 3, 4: YAF 3, 4: treas. 4: Institute of Electrical and Electronics Engineers, 4. DARLENE ALLEN, Chicago, Illinois: Elementary Education, History: University Women's Choir 2,3,4: Delta Sigma Theta 3,4: Black Choir 3,4. JUDITH ALLEN, Chicago, Illinois: Art,' St. Dominic College,' Student Government cor. sec. 3. DALE ALLES, Des Plaines, Illinois: Sociology, Business Administration: Intramural Volleyball Champs 2. ROBERT ALLEXON, Grayslake, Illinois: Marketing: AMA. FRANCES ALM, Oak Lawn, Illinois: Elementary Education, Social Sci- ence: Wartburg College: Kappa Delta Pi 3, 4: Oratorio Choir I: WRA I, 2, 3: NEA: SEA 3, 4: UCB 4: Dorm Council 2. JUDITH AMBACHER, Ingleside, Illinois: Elementary Education, Phi- losophy and Sociology: SEA 3, 4: NEA 3. 4. MADGE AMBLER, Mendota, Illinois: English, History. ANTHONY JOSEPH AMELIANOVICH, Harvard, Illinois: Industry and Technology: Varsity Basketball 2, 3, 4: Epsilon Pi Tau. LINDA ANDERBERG, Rockford, Illinois: Elementary Education, Humanities, JOYCE ANDERSEN, Chicago, Illinois: Elementary Education: Wright Junior College: Grace Bible College. ALYNNE ANDERSON, Westmont, Illinois: English, Art: vice pres. of corridor 1: pres. of corridor 2. CAROL ANDERSON, Skokie, Illinois: Elementary Education,' Sigma Sigma Sigma 3, 4. CURTIS ANDERSON, Chicago, Illinois: Marketing: AMA 3, 4: Intra- murals 1, 2, 3, 4. DALE LYNN ANDERSON, Elgin, Illinois: English, Secretarial Admin- istration: Elgin Community College. JAN ANDERSON, Geneva, Switzerland: Elementary Education, French: Alpha Omicron Pi 2, 3, 4: treas. 4: May Fete Committee 2, 3, 4: SEA 4. JEFFREY ANDERSON, Chicago, Illinois: Physical Education, Driver's Education,' Kappa Alpa Psi 2, 3 4: Cross Country I, Track l. JOHN ANDERSON, Lansing, Illinois: Geography. KAREN ANDERSON, Lombard, Illinois: Elementary Education, Sociol- ogy: Alpha Xi Delta. LEIGH ANDERSON, Geneva, Illinois: Elementary Education, English: Valparaiso University: NEA: SEA 3, 4: UCB Movie Committee 2, 3, 4. MARYANNETTE ANDERSON, St. Charles, Illinois: History, English: University of Arizona. ROGER ANDERSON, North Riverside, Illinois: Spanish, English: Uni- versity of Madrid: UCB Dance Committee 2: Recreation Committee 2, Spanish Club 2, 3, 4: University Chorus 1, 2, 3, 4. 353 Now, just enjoy eaclz day to the fullest. Smile at the sun and make happy WILLARD ANDERSON, Chicago, Illinois: Zoology, Chemistry, Wild- life Society. DARRYL ANGELICO, Northbrook, Illinois: Marketing, Tau Lambda Chi 2, 3, 43 sec. 3, 4, AMA 3, 4. ELIZABETH ANSELMINO, Joliet, Illinois: Elementary Education, Joliet Junior College, SEA 1, 2. SANDRA ANTOGNOLI, Chicago, Illinois: Political Science, Anthropol- ogy,' St. Louis University. KALA ARCHER, West Brooklyn, Illinois: Women's Physical Education, Geography, Delta Psi 2, 3, 4, Major-Minor Club 1, Freshmen rep. 2,3,4, sec. WRA 1, 2, publicity chrmn. 3, 4, Extratnurals 1, 2, 3, 4, Student Advisory Committee 4. ALLIN ARENSON, Chicago, Illinois: English, Psychology, Sigma Delta Tau 2, 3, 4, Sigma Tau Delta 3, 4, Towers. SUE ARGENTI, Chicago, Illinois: Secretarial Administration, Alpha Ornicron Pi 3, 4, May Fete Committee 2, 3. KATHLEEN ARMSTRONG, Park Forest, Illinois: Sociology. PAMELA ARMSTRONG, Chicago, Illinois: English, Library Science. DENNIS ARNOLD, Mount Prospect, Illinois: Biology, Chemistry. GERALD ARNOLD, Buda, Illinois: Geography, Mathematics. DWAINE ARNSMEIER, DeKalb, Illinois: Industry and Technology, University of Wisconsin, Rock Valley College, Chess Club, JOHN ATKOCAITIS, Hoffman Estates, Illinois: Social Science, History,- Plzi Delta Theta 3, 4. PATRICIA ATTO, Rock Island, Illinois: Social Science, History, Au- gustana College, Floor vice pres. 2, Echoes 3, NEA 3, IEA 3, SEA 3. DONALD AUBRY, Marseilles, Illinois: Deaf Education, Illinois Valley Community College, CEC. ROBERT AUBRY, Marseilles, Illinois: English, Pltysical Education, Jol- iet Junior College,' Pltysical Education Club 4, Intramural Basketball and Softball 4. 4 MAURITA ANGELLO, Northbrook, Illinois: Elementary Education, Spanish, Spanish Club 2, SEA 3, 4: Food Chairman l. CHARLENE AUGUST, Chicago, Illinois: Elementary Education, Art, Wright Junior College, NEA 4: NAEA 4. GLEN AUMAN JR., Freeport, Illinois: Business Administration, Man- agment, Highland Community College. LINDA M. HOCHAUMAN, Forreston, Illinois: Art Education, High- land Cominunity College, Rockford Evening College. DE ANNE AUSTIN, Galesburg, Illinois: Art, Sociology, Geneva Tu- toring Program 1: RA 2. PENNY AVES, Kirkland, Illinois: Psychology, Mathematics, Alpha Del- ta Pi 1, 2, 3, 4: Sigma Zeta 3, 4: UCB Entertainment Committee 2, 3. RHONDA AVES, Normal, Illinois: Elementary Education, Sociology, Delta Zeta Sorority 1, 2, 3, 4, social clzrmn. 3: SEA , NEA. RAYONIA BABEL, St. Clzarles, Illinois: English, Library Science, Mil- likin University. WILLIAM BABICH, Lockport, Illinois: Special Education, Elementarv Education, Alpha Phi Omega 2, 3, 4: rec. sec. 3, historian 2: UMOC clzrmn. 3: UCB 3, 4: CEC 3,4: Marching Huskies l,2,3, Varsity Band 1,2,3. GAIL BACCETTI, Chicago, Illinois: Elementary Education, Wright Jun- ior College, NIU Chorus 3: Home Ec Club 3. PHYLLIS BACON, Kankakee, Illinois: History, Political Science. CHARLES BAKER, Chicago, Illinois: History, English, Intramurals l, 2, 3, 4: RA 3, 4. DARRELL BAKER, Fox Lake, Illinois: Biology. KAREN BAKER, Palatine, Illinois: Elementary Education, Business Education, Indiana State University. KARLA BAKER, Tonica, Illinois: Elementary Education, Illinois Val- ley Community College, Kappa Delta Pi. MARY JANE BAKER, Chicago, Illinois: Speech Correction, Psychol- ogy, Marquette University, Sigma Alpha Eta, Pi Lambda Theta, RA. MIKE BAKER, DeKalb, Illinois: Physical Education. DANIEL E. BAKSTAD, Dundee, Illinois: Mathematics, Business Ad- ministration, AMA 3, 4: YR 2: NIU Golf 2. JAMES BALD, Freeport, Illinois: Zoology, Chemistry, Highland Com- munity College, IM Basketball 3: National Wildlife Club 3, 4. RICHARD A. BALCERAK, Chicago, Illinois: Political Science, Sociol- ogy, Swim Team 1, 2, 3, 4: IM 1, 2. MADELON BALFOUR, Skokie, Illinois: Elementary Education, Sociol- ogy, UCB 4: NEA , IEA ,' SEA,' Dorm Council 3. JOHN BALK, Kankakee, Illinois: Mathematics, History, Intramural Football 3: Basketball 1, 2, 3, 4: Volleyball l, 2: Softball 1, 2, 3: Math Advisory Committee 4. ROBERT BALLENGER, La Grange, Illinois: Elementary Education, Lyons Township Junior College, College of DuPage, Sigma Alpha Epsi- lon 3, 4: Trafhc Appeal Board 3, 4: SEA 4. DENIS BALON, Broadview, Illinois: Industry and Teclznology, Epsilon Pi Tau 3, 4. DEANNA BARABAS, Florissant, Missouri: Elementary Education, Speech. ROBERT BARCLAY, Aurora, Illinois: Social Science, Sociology, West- ern Illinois University. JILL BARGER, Pearl City, Illinois: English, History, Westmar College, Western Illinois University. IRENE BARK, Wheeling, Illinois: Mathematics, Business Administra- tion, Ski Club 4: AMA 3: Clzi Omega 3, 4. PETER BARKER, Arlington Heights, Illinois: Marketing, Harper Junior College, Tlteta Chi l, 2, 3, 4: pledge trainer 4: Intramural Football, Bas- ketball, Baseball 1, 2, 3, 4. THOMAS L. BARKER, Terre Haute, Indiana: Numerical Control Tech- nology: Epsilon Pi Tau 4: Christian Church Student Association, treas. 1, 2: pres. 3: Basketball l, 2, 3, 4: Tennis l, 2: Football 2: Numerical Control Society 4. VIOLET BARNES, Glenview, Illinois: Political Science, Business Ad- nzinistration, AMA I: Pi Sigma Alplza 4: Dean's List 2, 3. JUDITH BARNETT, Wheaton, Illinois: Elementary Education, Speech Correction, Speech and Hearing Fraternity, RA 3. 355 A life of Classes, a life of clubs, a life of people, readying and remembering. MICHAEL BARRE, Quincy, Illinois: Art: Illinois Valley Community College: Student Art Competition 2, 3, 4. ANTONIO G. BARREDA, Lima, Peru: Marketing: Northwood Insti- tute: Alpha Kappa Lambda 3, 4: AMA 3, 4: SAM 4. TERRY BARRY, Chicago, Illinois: Marketing: Wright Junior Col- lege: AMA. LAWRENCE BARTHOLOMEW, Elgin, Illinois: Management: Elgin Community College. MICHAEL BARTHOLOMEW, Winnebago, Illinois: Management: Rock Valley Junior College: AMA 3: SAS 3. STEPHEN BARTON, Aurora, Illinois: Sociology, Political Science: Uni- versity of Illinois: Phi Sigma Kappa 2, 3, 4: Alpha Kappa Delta 3, 4: Cavaliers 4: IFC Intramurals 2, 3. ROBERT BARUCH, Naperville, Illinois: Accountancy: St. Procopius College: College of DuPage: Sports Car Club 3, 4: SAS 3, 4. DENISE BASKO, Crete, Illinois: Elementary Education: AWS 1, 2, 3, 4: Newman Club 1. EDWARD L. BATES, Mount Morris, Illinois: History, Political Science: Highland Community College: Grant North Interfioor Council 3. SHARON BATES, Chicago, Illinois: Sociology, Biology: RA 3, 4: Alpha Kappa Delta 4: 1970 Senior Class Project Planning Committee treas: Homecoming Court 4: Lincoln Hall Social Committee 1, 2, chrmn. 2. ELENA BATURA, Argo, Illinois: Special Education: CEC 1, 2, 3, 4: Alpha Omicron Pi 2, 3, 4: Panhellenic Council 3, 4: Lincoln Hall Dorm Council 2. ANN BAUER, Wauconda, Illinois: Home Economics, Business: Home Economics Club 1-4, sec. 2, pres. 3, scholarship 4: Home Ec Student Ad- visory Board 3, 4: State Membership clzrmn. 3: State College Get To- gether chrmn. 4. SUSAN BAUMGARTNER, Lisle, Illinois: Special Education, Physi- cally Handicapped: UCB 2, 3, 4. KAREN BEARD, Danville, Illinois: Speech-Theatre, History: AWS Freshman Christmas Queen: Kappa Delta 2, 3, 4: University Theatre 1, 2, 3, 4. THOMAS BEARD, Oak Park, Illinois: Secondary Education. TERRY BEAUDRY, Joliet, Illinois: Pre-law,' Joliet Junior College: IM 2, 3, 4. ROBERT BECHAZ, Chicago, Illinois: Management, Economics: Univer- sity of Illinois Chicago Circle: Fenger Community College: SAM 4: Intramurals 3, 4. MARJORIE BECK, Des Plaines, Illinois: Elementary Education: Beloit College: University of Oklahoma: Rock Valley College: Chess Club 4: Pi Lambda Theta 4: NEA 4. 4BEGUIN. Streator, Illinois: Business Education: Orchesis 3, 4: GEORGE J. BEIR, Lombard, Illinois: Marketing: University of Mis- souri: Vets Club 1, 2: AMA 4. JUDITH BELLFUSS, Chicago, Illinois: Biology, Education: Phi Sigma Society 3, 4: 1970 Senior Class Project Planning Committee. DIANA LEE BELL, Hanover, Illinois: English. EDNA BELL, Elgin, Illinois: History, Library Science: Elgin Com- munity College. ' JOANNE BELL, Hinsdale, Illinois: Elementary Education, Biological Science: Carthage College: SA ,' UCB: Chi Omega. JOHN BELL, Aurora, Illinois: Political Science, Speech: Sigma Nu 1, 2, 3, 4, vice pres. 2: WNIU Radio 2, 3, 4, program director 4. ROBERT A. BELTRAMO, Highwood, Illinois: Industry and Teclznol- ogy,' Sigma Pi. JO ANNE BENASSI, Marseilles, Illinois: Elementary Education, His- tory: Dorm Council 3: SEA Legislative Committee. LETICIA BENAVIDES, Northbrook, Illinois: Spanish, Home Econom- ics: Orchesis,' Spanish Club. 356 DAVID BENGSTON, Fox Lake, Illinois: Accounting: Xi Theta 2, 3, 4, treas. 3,4: SAS 2,3,4: Accounting Internship Program 4: Intramurals 1,2. ALAN BENGTSSON, Chicago, Illinois: Marketing: Bogan Junior Col- lege: Intramurals. MARILYN BENNECKE, Lake Villa, Illinois: Art, Anthropology: Alpha Delta Pi 2, 3, 4: music chrmn. 3, 4: Northern Star, 3, 4. JODY BENNETT, Springfield, Illinois: Nursing: Winter Carnival Court, Freshman rep.: Winter Carnival Committee 2: UCB Concert Committee 1, 2: Sigma Kappa 2, 3, 4, house manager 3, scholarship chrmn. 4. KATHLEEN A. BENO, Mokena, Illinois: Special Education: Thornton Junior College: CEC. JAMES BERESHEIM, Arlington Heights, Illinois: Finance: Phi Sigma Kappa 1, 2, 3, 4, treas. 3, 4. JAMES KENNETH BERGER, Skokie, Illinois: History, Political Sci- ence: University Democrats 1, 2, 3: Students for Kennedy 2: Home- coming Committee Parade chrmn. 4: Kennedy Action Corps, treas. 3: Hillel 1: Intramurals I, 2, 3: SA senator. GREGORY BERK, Flossmoor, Illinois: Speech, History: St. Mary of the Lake College: WNIU-AM 3, 4: Stevenson North Judiciary 3. MARC BERLOW, Chicago, Illinois: Accountancy: SAS 1, 2, 3, 4: Intra- murals l, 2, 3: SIO 3, 4: Dorm Council l, 2, 3. LESLIE DALE BERMAN, Skokie, Illinois: Speech-Theatre, English: National Collegiate Players 4: University Chorus 1, 2, 3, 4: Marat!Sade 3: University Theatre, property assistant 3, 4: AWS 1. RENA BERMAN, Evanston, Illinois: Special Education: University of Illinois: Hillel 3, 4, CEC 3, 4. PHILIP BERNARD, Chesapeake, Virginia: Special Industry and Tech- nology: Old Dominion University: IEEE: Sigma Alplza Epsilon. ELLEN BERNAT, Morton Grove, Illinois: Elementary Education: SEA 2, 3, 4: Alpha Sigma Alpha 2, 3, 4, sec. 3: Ski Club 4. STEVEN BERZ, Clzicago, Illinois: Political Science, Business Adminis- tration: Junior IFC, pres. 1: public relations chrntn.: Phi Epsilon Pi, vice pres. 3, pres. 3. JOSEPH BEYER, North Clzicago, Illinois: Accounting: Alplza Phi Onze- ga 2: SAS 3. JAMES BIDRO, Addision, Illinois: Finance: NIU Bowling 3, 4: SAM 1: Phi Epsilon Pi 1, 2, 3, 4, vice pres. 2. SHARON BIESCHKE, Lisle, Illinois: Home Economics, Music: Home Economics Club 3: Pleiades 4: Sigma Lambda Sigma 2, 3, 4. ROBERT A. BILLINGTON, Noble, Illinois: Physical Education, Driv- er's Education: Upper Iowa College: Alplza Kappa Lambda 3, 4: Intra- mural Wrestling Champ 3. KATHY BIRCH, Riverside, Illinois: Elementary Education: Butler Uni- versity Pom Pon: Alpha Xi Delta, social chrmn. JOSEPH B. BIZZARRI, Westchester, Illinois: Accountancy: Triton Jun- ior College,' SAS 3, 4: Sigma Iota Epsilon. VLASTA K. BLAHA, West Chicago, Illinois: Biology, Chemistry, Math- ematics: Cwens 2:Pleiades 4: Echoes 3: Symphony Orchestra 1: WRA 2, 3: Phi Sigma 3, 4, sec. 4: Sigma Zeta 4: AIBS 2, 3, 4. BRUCE BLAIR, Rockford, Illinois: Chemistry, Mathematics: Augus- tana College: Chemistry Club 4. DANIEL BLAKE, McHenry, Illinois: Marketing: Elgin Community College: Sigma Iota Epsilon: AMA. LINDA BLAKE, McHenry, Illinois: Elementary Education, French: AWS: Newman: Douglas Hall Powder Puff Tugs. MARILYN BLAKELY, Harvey, Illinois: Nursing: Thornton Junior College,' Alpha Xi Delta 3, 4: SNO l, 2, 4: Winter Carnival 3, 4: Public Relations Committee 3. CAROL BLANCO, Spring Valley, Illinois: Elenzentary Education: Illi- nois Valley Community College. WILLIAM L. BLAND, Rockford, Illinois: Marketing: AMA 2, 3, 4: In- tramurals 1, 2, 3: SAM 2. WILLIAM BLANKENSTEIN, Chicago, Illinois: Journalism, Political Science: University of Illinois: WNIU-AM, station manager 4: Northern Star 3: Theatre Play 3. BARBARA BLANTON, Chicago, Illinois: Elementary Education, Hu- manities,' Southeast: University of Chicago,' Drama Club 1: Delta Sigma Theta 3, 4, financial sec. CELESTE BLASZCZYK, Homewood, Illinois: Elementary Education, Sociology: Chi Delta Clzi 2, 3, 4. WILLIAM BLEAW, Savanna, Illinois: Management: Dorm Council 1: Phi Sigma Kappa 1, 2, 3, 4, pres. 2, 3, sentinel 2: IFC 2, 3, vice pres. 3: Winter Carnival Committee 2, 3, 4 chrmn. 3, 4. WILLEM M. BLEES, DeKalb, Illinois: Music Education: Vets Club 1, 2, 3, 4: cor. sec. 2: Marching Huskies 2, 3, 4: Orchestra 1, 2, 3: Concert Band 2, 3, 4: Brass Ensemble 2, 3: Chorus 3: MENC 1, 2, 3, 4: IEMA 1, 2, 3, 4: Intramural Baseball 1, 2, 3, 4, Football 1, Volleyball 1. 357 With coffee and cards you Worry about the hand you hold, trying to forgot tomorrow. ELISA BLITSTEIN, Park Forest, Illinois: Elementary Education, Speech: Sigma Delta Tau 1, 2, 3, 4: Hillel 1, 2. MARK BLOCKI, La Salle, Illinois: Marketing, Illinois Valley Commu- nity College: Phi Beta Lambda: AMA: SAM: Intramural Baseball 2, Basketball 2. CYNTHIA BLOOMER, Chicago, Illinois: Music Education,' Sigma Alplza Iota: Concert Choir: Madrigals: University Chorus: Varsity Band: Dorm Council. ANN BLUM, DePue, Illinois: Music Education: MENC 1, 2, 3, cor. sec. 4: Echoes: Kappa Delta Pi 3, pres. 4: Artist Series Board 3, 4: Music Department Code Committee 4: Band 1, 2, 3, 4: Chorus 3, 4. NEAL BLUSTEIN, Chicago, Illinois: Political Science: Southeast .lun- ior College: Intramurals 2, 4: Officials Club 4. BRUCE BOARDMAN, DeKalb, Illinois: Physical Education, Business Education: Phi Sigma Epsilon 2, 3, 4: Basketball 1, 2: Intramurals 1, 2, 3, 4: May Fete Committee 2: NGUC 4. VIRGINIA BOBER, Chicago, Illinois: Anthropology, Sociology: Wriglzt City College. FRANCES BOFLENS, Cambridge, Illinois: Accountancy: Black Hawk Junior College: SAS 3, 4. DEBORAH BOESCL, Bufalo Grove, Illinois: Elementary Education. GILBERT BOGS, Chicago, Illinois: Mathematics, Economics: Roosevelt University: Intramurals 1, 2, 3, 4: Ojicials Club 3, 4: Dorm Council: Tau Lambda Clzi 4. THOMAS BOJANOWSKI, Chicago, Illinois: Marketing: NIU Bands: UCB, DE Club: Marketing Advisory Committee: AMA: Speakers Com- mittee,' Bookstore Advisory Committee. ELAINE BOLATTO, Hennepin, Illinois: Elementary Education: Illi- nois Valley Community College,' Kappa Delta Pi 3, 4. BONNIE BOLLMAN, Des Plaines, Illinois: Arr: Gamma Alpha Mu 1, 2, 3, social chrmn. 3, publicity 2: Alpha Clzi Omega 4: Winter Car- nival Committee 2, 3: NAEA 4: UCB Public Relations 4. KATHLEEN ANN BOLS, Morris, Illinois: Englislz, Clzemistry: Univer- sity Varsity Band 1: Concert Band 2, 3, 4: DRA 3: Corridor Ojicer 1, 2. WAYNE BOMGARDEN, Forreston, Illinois: Biology, Chemistry: Cen- tral College: Wildlife Society 3, 4: Intramural Football 1, 2, 3, Basketball 1, 2, Volleyball 1, 2. CAROLIEAN BONIOR, Chicago, Illinois: Special Education, EMH: De Paul University. HELENE BONK, Cicero, Illinois: Elementary Education: Morton Col- lege,' Lambda Theta 3, 4: ACE 3, 4. FRANCES BOONE, Peoria, Illinois: Home Economics, Clzild Devel- opment, Family Life, Sociology: Canton Junior College: Delta Sigma Theta 93, 4, rec. sec. 3: rush chrmn. 4: Home EC. Club 4: American Home Economics Association 4: AACO, MARIA N. BOONE, Sterling, Illinois: English, French: St. Xavier of Chicago: Sigma Tau Delta 3, 4: Pacesetter Club, 2, 3, 4. LARRY BORESS, Chicago, Illinois: Political Science: Sigma Nu 1, 2, 3, 4, Blood Drive chrmn. 2, 3, Lifeline Dance chrmn. 2, 3, 4, vice pres. 3, pres. 4: Homecoming executive board 4: Jr. IFC 1: IFC 4: Intramur- rals 1, 2, 3, 4: Hillel 2, 3, 4. LAEIICE BOSS, Chicago, Illinois: Elementary Education, Speech: Calvin o ege. WILLIAM BOSTON, Park Forest, Illinois: Marketing: Sigma Pi 2, 3, 4: Football 1, 2, 3, 4. CHARLES BOTT, Broadview, Illinois: Political Science, History: Tri- ton Junior College: NIU Choir, Plzi Sigma Epsilon, sec. GARY BOYD, Dixon, Illinois: Music, Sauk Valley Junior College: Marching Huskies 2, 3: Concert Band 2, 3, 4. TERRI BOYER, Skokie, Illinois: Elementary Education, Speeclz, Sigma Delta Tau 2, 3, 4, vice pres. 3, 4. CHARLES BOYLE, Oak Park, Illinois: Physical Education, Safety and Driver Education,' Men's Physical Education Association: Major Minor Club 2, 3, 4: Tau Kappa Epsilon 1, 2, 3, 4: Tau Delta Epsilon 2, 3, 4, historian 2: Intramurals. PHILIP S. BOZA, Lemont, Illinois: Management: Veteran's Club 3, 4, sec. 4: Intramurals 1, 2, 3, 4. EIQVSQAIED J. BRADAC, JR., Grayslake, Illinois: Accountancy: SAS 358 ,av Q If BARRY BRANSTROM Evanston Illinois Marketing Roosevelt Uni- xeiszty Delta Upsilon l 2 3 4 sec 2 chaplain 3 Inttamurals1,2,3,4. PATRICIA BRAUN Woodridge Illinois Elementary Education, Speech Tlzeatrc Sigma Lambda Sigmal 3 4 BONNIE BRAY Ottawa Illinois Music Education Illinois Valley Community College Concert Chou 1 2 3 4 Chorus l 2, Opera Lab- oiatoty 3 4 Sigma Alplza Iota 2 3 4 rec sec 3 mica pres. 4. IEON BREO Freeport Illinois PolitzcalSczence Hzglzlanzl Community College. JANET BRIEGEL, Rockford, Illinois: Speeclz Pathology, Psyclzologyg Sigma Alpha Eta 3, 4. SUSAN BRIGGS, Chicago, Illinois: Home Economics, Sociology, NIU Chorus 3, 4. MARY CLARK BRISCH, Oak Park, Illinois: Elementary Education. RAYMOND BRODERICK, Danville, Illinois: Business Education, Dan- ville Junior Collegeg Tau Lambda Chi 2, 3, 4, Distributive Education Clubs of America 4, Intramurals 2, 3, 4. BETH BROOKS. Lombard, Illinois: Nursing: Dorm Council 1. MARY LOU BROOKS, Elmhurst, Illinois: Art. THELMA E. BROOKSHAW, Kankakee, Illinois: History, Spanislzg Na- tional Unirersity, Mexico City,' Dean's List 3, 4. BARBARA DIANE BROWN, Skokie, Illinois: Elementary Education, Business Education, Sigma Delta Tau 2, 3, UCB, Entertainment 3, 43 1970 Senior Class Project Planning Committee, SEA 4. HARVEY BROWN, Marseilles, Illinois: Biology, Clzemistryg NIU Wild- life Society 3, 41 Ventura Associates, agent 4. ILENE BROWN, Des Plaines, Illinois: Elementary Education, Winter Carnival Committee 2, 3, 4, dance clzrmn. 3, 1970 Senior Class Project Planning Comnzittee. LINDA BROWN, Waukegan, Illinois: Elementary Education, Sociol- ogy, NEA ,' SEA. NANCY BROWN, Elmhurst, Illinois: Elementary Education, Sociology, Graceland College, RA 3. 359 A class upon the threshold of a new adventure, new faces, new places, new ideas. ROBERT BROWN, Elmhurst, Illinois: History, Political Science, Floor pres. 3. THERESA BROWN, Freeport, Illinois: Biology, Chemistry, Finance Club. WILLIS BROWN, Clzicago Illinois: Accounting,' University of Illinois, Central YMCA Community College, Kappa Alplza Psi I, 2, 3, 4, pledge dean 4, vice pres. 4, Varsity Basketball 4, SAS 3, 4, Task Force Com- mitee 3, 4, AMA 3, 4, IFC rep. 3, 4, Intramural Basketball 3, 4. FRANK BROZIO, LaGrange, Illinois: Medical Teclznology,' Lyons Townslzip Junior College. DANIEL BROZNOWSKI, Chicago, Illinois: Marketing, Dorm social chrmn. 3, Dorm publicity clzrmn. 2, AMA 2, 3, 4, Intramurals 1, 2, 3, 4, Student Council 3, S10 3, 4. GLADA BRUBAKER, Freeport, Illinois: Medical Teclznology, High- land Community College, Mu Tau Chi 2, 3. ALICE BRUCE, Glen Ellyn, Illinois: Special Education, EMH, Eastern Michigan University, CEC. EDDIE BRUMFIELD JR., Cleveland, Ohio, Physical Education, Busi- ness Education, Kappa Alplza Psi 2, 3, 4, treas. 3, pres. 4, AACO 2, 3, 4, NIU Otfcials Club 2, 3, 4, Basketball 2, 3, 4. LENARD BRUNS, Beecher, Illinois: Accounting, Bloom Community College, SAS. RUDY BRUNSKI, Chicago, Illinois: Management, Chicago City Col- lege, Vet's Club, SAM, Intramural Softball, Bowling. SANDRA BRYANT, Auora, Illinois: Elementary Education, Sociology, Alplza Xi Delta 2, 3, 4, rush chrmn. 3, 4, WRA 2, 3, AWS 1, 2, 3, 4, Major Minor Club 1, 2,, Dorm Council rep. 1, 2, Newman Club, Appa- lachia 1970 Project, JOYCE BRYER, Waukegan, Illinois: Elementary Education, Sociology, Newman l, 2, NEA 3, 4, SEA 3, 4, Alplza Phi 3, 4, YR 1, 2. BARBARA BUDD, Yorkville, Illinois: Accounting, Aurora College, Echoes, SAS, University Food Service. ANN BUDDE, Alton, Illinois: French, English, St. Xavier College, French Club 1. SHERRY BULL, Crystal Lake, Illinois: Elementary Education, Sociol- ogy, Naiads 1, Alpha Delta Pi 1, 2, 3, 4. BRUCE BURGER, Clzicago, Illinois: History, Political Science, Foot- ball 1, 2, Sigma Alplza Epsilon 1, 2, 3, 4, History Club 2, Winter Carni- val chrmn. 4, Intramurals 1, 2, 3, 4. JAMES BURGER, Addison, Illinois: Industry and Technology, Circle K, Delta Upsilon 2, 3, 4, UCB 3, 4, Iota Tau 4. CHARLES BURKE, Clzicago, Illinois: Mathematics, Philosophy, Wright Junior College, University of Illinois, Chess Club 4, Concert Band, 3, 4, Intramurals 3, 4. RICHARD BURMEISTER, Chicago, Illinois: Marketing, Beta Phi Gamma 1, 2, 3, Sigma Nu 4, athletic chrmn. 2, Marching Huskies, 1, 2, 3, Varsity Band 1, 2, Concert Band 3, AMA 3, 4. ROBERT S. BURMEISTER, Blue Island, Illinois: History, Sociology, Tau Lambda Chi 1, 2, 3, 4, pres. 3. CYNTHIA BURTON, South Beloit, Illinois: History, Library Science, Rock Valley Junior College. THOM BUSAM, Chicago, Illinois: Sociology, Psychology, Lewis Col- lege, Phi Kappa Sigma 2, 3, 4, pledge trainer 3, athletic chrmn. 3, Intra- murals 2, 3, 4, RA. SUSAN BUSH, Elk Grove, Illinois: History, Political Science, Students for McCarthy 2, Choice '68 2, Winter Carnival Committee 3, UCB 4. ROBERT BUSIC, Worth, Illinois: Biological Science, Chemistry. DAVID BUSSE, DeKalb, Illinois: Matlzematics, Chemistry, Math Club 3. 4, Newman Club 1, 2, 3, 4, Student Advisory Committee 4. CHARLES M. BUTTS JR., Aurora, Illinois: Finance, University of Illinois. GREGORY BYRNE, Chicago, Illinois: Political Science, Economics, History, Student Advisory Committee 3, 4, Intramurals 1, 2, 3. JUDITH BYWALEC, Calumet City, Illinois: Speech Correction, Psy- chology, EAH. 360 PATRICK CAIN, Sycamore, Illinois: Chemistry, Matheniatics, Ameri- can Chemical Society, pres., UCB. CRAIG CALLAHAN, Rockford, Illinois: Accountancy, Sigma Epsilon 2. 3, 4, treas. 3, 4: SAS I, 4. JANE CALLAHAN, Lincolnwood, Illinois: Special Eflucation, Alpha Delta Pi 2, 3, 4, publicity chrmn. 2, rush chrmn. 3, Northern Star 2, 3, 4, JOANNE CALLAHAN, Chicago, Illinois, Speech, lI4lIlllL'lllllllCS,' Debate I 7, 3, Pi Kappa Delta 3, 4, Cwens 2, pres., Echoes 3, pre.s'.,' Pleiades 4. pres. PATRICK CALLAHAN, DeKalb. Illinois: Political Science, History, Pl Kappa Delta 2, 3. 41 I orensics I, 2. 3: Student Advisory Committee 4, PATRICIA CALZIA, Moline, Illinois: Anthropology, I,,S'.VC'lllIl0tQj',' Black- hawk Junior College. LINDA CAMBUZZI, Pawnee, Illinois: Home Economics, History. DAVID CAM PBELL, Maple Park, Illinois,' History, Political Science, JON CAMPBELL, Chicago, Illinois, Psychology, Sociology, Sigma Al- pha Epsilon, Psi Chi, Cavaliers, Intramural Football, Basketball, Soft- ball, Tugs, SA social vice pres., Football, 1969 Winter Carnival co-chrmn. WILLIAM CAMPBELL, Wheaton, Illinois: Marl4eting,' Lewis College 11 Tau Lambda Chi 2, 3, 4, scholarship chrmn. 3, 4: NCB 3, Newman Choir 2: AMA. LEE CAMPION, Palatine, Illinois: Marketing, LaCrosse State Univer- sity l. 2, Dorm Judicial Board 4. RONALD CANEVA, Lockport, Illinois, History, Political Science, Joliet Junior College. ALLAN CANNELL, Peoria, Illinois, Social Science, History, Carlton Community College, Vets Club, Intramural Basketball, Student Delegate SEA, Student Con-Con, Hillel. JULIA CANNELL, St. Charles, Illinois, Sociology and Anthropology, St. Dominic College. WILLIAM CARLBORG, Chicago Heights, Illinois, Accountancy, Thorn- ton Junior College, SAS 3, 4: SAM 4. SHARON CARLSEN, Chicago, Illinois, Art, Wright Junior College, Delta Psi Delta 3, 4. JOHN CARLSON, Bensenville, Illinois: Marketing, AMA 1, 2, 4, Delta Upsilon 3. 4, service chrmn. 4, Little Sister pledge trainer 4. JOHN CARLSON, McNabb, Illinois: Accountancy, Phi Delta Psi 2, 3, 4, sec. 3, Ofhciafs Club 3, 4, Intramurals l, 2, 3, 4. SHERRY CARLSON, DeKalb, Illinois: Physical Education, Dance, Or- chesis 3, 4, technique director 3, treas. 4. ANITA CARMAN, Chicago, Illinois: Biology, Kentucky State College,- Alpha Kappa Alpha 2, 3, 4, pledge trainer, 3. PHYLLIS CARPENTER, Aurora, Illinois: Home Economics. ROBERT CARPENTER, Lombard, Illinois: Physical Education, Driver Education, Froslz Football I, Varsity Football 2, 3, 4, FIO. RICHARD CARP, DeKalb, Illinois: Political Science, Economics, Pi Sigma Alpha 4, Student Advisory Committee 4. CANDA CE CARROLL, Rock Islana', Illinois, Marketing, Sigma Kappa, Co-Capt. Ponz Pon Squad, Little Sisters of Minerva, Winter Carnival Queen 1969, Mayfete Court I, 3. LINDA CARSTENS, Pentwater, Michigan: Art Education, Alpha Siglna Alpha 1, 2, 3, 4, Winter Carnival Committee 3: Art Guild 2, Delta Phi Delta 3, 4, vice pres. 4, Pleiades 4. HOWARD CARSTENSEN, Palatine, Illinois: Marketing, Intramurals I, 2, Theta Chi 2, 3. 4, asst. treas. 3, treas. 4, public relations chrmn. 4, AMA 4. NICHOLAS K. CARTER, Rockford, Illinois: Mathematics, Business Administration, University of Illinois, Rock Valley Junior College, Presi- dent of Floor, Dorm Council, vice pres. 4, Judicial Board 4, Student Ad- visory Committee 41 Mathematics Studies Board 4. RITA MADALENSKI CARTER, Chicago, Illinois: Elementary Edu- cation, SEA 2, 3, 4, Newntan Club, l, 2, 3, 4. PHYLLIS A. CARVELL, Chicago, Illinois.' Business Education, RA, Public Relations Committee, Phi Beta Lambda. BEVERLY CASCIO, Fulton, Illinois: English, Sociology, WRA rep. 2. LINDA CASPERSON, Oak Lawn, Illinois, Nursing, SNO I, 2, 3, 4, Band I. MARILYN CASTAGNA, Des Plaines, Illinois: Special Ea'ucation, Dixon Volunter 3, Corridor, sec. treas. 3: CEC 4. DONNA CASTIGLIA, Niles, Illinois: English, Sociology. SHARON CAYTON, Chicago, Illinois: Elementary Education: Wriglzt Junior College. KATHLEEN CEJKA, LaGrange, Illinois: English: Lyons Township Junior College: AWS rep. 2: Dorm Council 2. DENNIS CENTOFANTE, Lombard, Illinois: Chemistry, Matlzematics: Sigma Zeta: ODK: Intramural Football, Basketball, Softball, Volley- ball: ACS. JEAN CERNOSEK. Arlington Heights, Illinois: Textiles and Clothing, Art: Home Ec Club 3, 4. ABRAM J. CHAIT, Clzicago, Illinois: Marketing: AMA 2, 3, 4: Intra- nzurals I, 2, 3. THOMAS CHAMBERLIN, Danville, Illinois: Physical Education, Biol- ogy: University of Illinois: Danville Junior College: Major Minor Club 4: Intramurals 3, 4. RONALD CHAMBERS, Lombard, Illinois: Political Science, History: Sigma Pi, sec. 2, 3: Concert Choir I, 2, 3. DAVID CHANNEL, Kankakee, Illinois: Physical Education, Drivers Education: Varsity Football l, 2, 3: Intramurals I. 2, 3. 4: Northern Illi- nois Physical Education Association for Men I, 2, 3, 4: sec. 3. treas. 4. RALPH CHAPLIN, DeKalb, Illinois: Marketing: AMA 3, 4. LINDA CHARLESWORTI-I, Evanston, Illinois: Matlienuztics. Honze Economics. PAMELA CHASE, Ottawa, Illinois: Elementary Education: Western Il- linois University: YR: Homecoming Committee, publicity chrmn. 4. JIM CHERVENY, Streator, Illinois: Elementary Education, History: Baseball l, 2. PAUL CHESLER, Chicago, Illinois: Journalism, History: Amundsen College: Sigma Delta Chi 3: NIU Ofhcials Association 3, 4: Northern Star 3: Intramurals 3, 4, Football 4, Basketball 3, 4, Volleyball 3, 4, Softball 3. JAMES CI-IIN, Chicago, Illinois: Management: Norther 4: Sigma Alpha Epsilon 3, 4: Intramurals I, 2, 3. LINA CHIN, Arlington Heights, Illinois: Physical Education: WRA, historian. PETER CI-IIPAIN, Chicago, Illinois: Marketing: Phi Kappa Theta I, 2, 3, 4, house manager 1, social chrmn. 3, pledge trainer 3: Intramurals l, 2, 3, 4. ELIZABETH CHIVARI, Aurora, Illinois: Elementary Education: Alver- no College. STEPHANY CHIZEWSKI, Elmwood Park, Illinois: Elementary Educa- tion, Speech: Triton Junior College: SEA 4. DALE CHRISTENSEN, Streator, Illinois: Mathematics, History. LINDA CHRISTIANSEN, Wyanet, Illinois: Elementary Education, Hu- manities: Illinois State University: SEA. JOE CIELAK, Hinsdale, Illinois: Marketing: College of DuPage: Intra- mural Baseball 3, 4. GAIL CIMAROLI, Peru, Illinois: English, French: Illinois Valley Com- munity College: Floor vice pres. CONNIE CISNIA, Palos Park, Illinois: Elementary Education: Mac- Murray College: SA Elections 3: Dorm Council 3: Orchesis I, 2. WILLIAM CLAIR, Clzicago, Illinois: History, Political Science. MICHAEL CLARDY, Naperville, Illinois: Management: Wisconsin State University: Northern Michigan University. BARBARA CLARK, Beloit, Wisconsin: Elementary Education, Sociol- ogy: SEA 4: WNIU-AM 3, 4: Newman 1, 2, 3, 4: Sigma Pi Sweetheart Club 4: Dorm pres. 4: academic chrmn. 3. CHRISTINE CLARK, Rock Island, Illinois: Sociology, Psychology: Gus- tavus Adolphus College: Ski Club 3, 4: Sociology Club 4: Plaza Home- coming Committee 2, 3: 1970 Senior Class Project Planning Committee. DENNIS CLARK, La Grange, Illinois: Mathematics: Lyons Township Junior College I: College of DuPage 2: Freshman Class pres.: Tennis I: Intramural I, 2, 3: Homecoming Committee 1. MARJORIE CLARK, Oswego, Illinois: Elementary Education: Chorus I, 2, 3, 4: SEA 3, 4. JANE CLAWSON, Naperville, Illinois: Journalism, English: Westmar College: Alplza Xi Delta 2, 3, 4: Theta Sigma Phi 4: .ISA 4: PRSSA 4: Winter Carnival Committee 4: Norther, editorial assistant 4. DARRELL CLAY, Galesburg, Illinois: Finance: University of Iowa, Uni- versity of Kentucky: SAS. 362 ollege is a kaleidescope of fun, food, amd, most of all, friendship. KATHLEEN CLAY, Aurora, Illinois: English, Psycltology. JAMES P. CLINCH, Peru, Illitzois: Biology, Illinois Valley Community College. CHRISTINE CLOTHIER, Rockford Illinois: Elementary Education, So- ciology, Alpha Delta Pi 3, 4, SEA 2. CRAIG CLOUSTON, Lisle, Illinois: History, Political Science, Sociol- ogy,' Student Alumni Council 3, 4, pres. 4, University Tlzeatre Produc- tions 1, 2, 3, 4, SA Senator 3, Floor treas., dorm treas 3, Student Advis- ory Board History Department 3, 4, Housing Committee. SANDRA COBB, Freeport, Illinois: Home Economics, Home Ec Club I, 3, 4, UD 2, UCB Social Committee 3, 4, American Home Economics Association 4, Eclzoes 3. EDWARD R. CODY, JR., DeKalb, Illinois: Mathematics, Business, Vets Club 2, 3, 4, cor. sec. 3, Knights of Columbus 2, 3, 4. LORENE COFFMAN, Des Plaines, Illinois: English, Anthropology, Inter-Variety Cltristian Fellowship 1, 2, 3, 4, sec. 3. BARBARA COHEN, Chicago, Illinois: Elementary Education, NEA 2, 3, 4. HARRY CO1-IN, Chicago, Illinois: Marketing, Sigma Alpha Epsilon 2, 3, 4, AMA 4, Intramural Football, Basketball, Baseball, Volleyball 1, 2, 3, 4. BARBARA COLBY, Lincoln, Illinois: Business Education, Cwens, Echoes, Pi Omega Pi, treas. MARGARET COLLAR, Peoria, Illinois: Elementary Education, Eng- glislz, SEA, Outdoor Club. ' BRIAN COLLINS, Chicago, Illinois: Political Science, Matltematics, InterAmerican University,' Varsity Swimming 1, 2, 3, 4, captain 4, Plzi Kappa Theta 2, 3, 4, pledge trainer 4, Judicial Council 4, UCB Dance Committee 4, Major Minor Club 4, NIU Varsity Club 4, Newman Club l, 2, 3, 4, Intramurals I, 2, 3, 4, Lincoln Hall Dorm Courtcil 1. DENNIS J. COLLINS, Moline, Illinois: Accounting, Economics, Black Hawk Junior College. JERALD COLLINS, Carpentersville, Illinois: Englislt, History, Plzi Kap- pa Sigma 2, 3, 4, sec. 3, IFC 3, Norther 2. ROBERT COLLINS, Princeville,Illinois: Social Science, History, SNEA. TIMOTHY COLLINS, McHenry, Illinois: Marketing, Plzi Sigma Epsi- lon, social chrmn., pledge master 4, Intratnurals 2, 3, 4. IRIS COLTON, Clzicago, Illinois: Elementary Education, History- Speech, Sigma Delta Tau 2, 3, 4, Cancer Fund Drive, chrnzn,, par- liarnentarian. CHRISTINE CONIGLIO, Chicago, Illinois: History, Art History, Uni- versity of Illirtois Circle. V WILLIAM CONKLING, Rockford, Illinois: Accounting, Rock Valley Junior College, SAS 3, 4. WILLIAM CONNELLY, Orland Park, Illinois: History, Political Sci- ence, Wilson Junior College, Vets Club 3, 4. JERRY CONNER, Princeton, Illinois: Finance, Illinois Wesleyan Uni- versity, Sigma Phi Epsilon, SAM, Delta Sigma Pi, pres. International Business Club, Floor pres.,' Intramural Football l, 2, 3, Baseball 1, 2, 3, Softball 1, 2, 3, Northern Star, business manager 4. NANCY CONNERS, Clzicago, Illinois: Elementary Education, French, Soutlzern Illirtois University, Kappa Delta Pi 3, 4, SEA 4, RA 3, 4, Newman Club 3, 4. JIM CONNOLLY, Brookfield, Illinois: Accountancy, Lyons Townsltip Junior College, College of DuPage, SAS 3, 4, Intramurals 1, 2, 3. CAROLYN CONRAD, Chicago, Illinois: Nursing, SNO, SAC 3, 4, vice pres., 4, AWS 1, 2, 3, 4. DONALD CONRADI, Grayslake, Illinois: Business Management, Ac- counting Society l, SAM 3, 4, NIU Ski Club 2, 4, Alpha Phi Omega 3, 4, Intramurals 1, 2, 3, 4. JANET CONWAY, Peru, Illinois: Elementary Education, Illinois Val- ley Community College. KEVIN CONWAY, Aurora, Illinois: Marketing, Illinois Valley Commu- nity College, Knights of Columbus 2, 3, 4, AMA 2, 3, 4, Newman 2, 3, 4. LINDA S. COOK, Park Ridge, Illinois: Elementary Education, Sociol- ogy, YR,' Outdoor Club, UCB Public Relations Committee, Kappa Delta Pi. 363 finte prornles nternories of people, 11'I'tlllIlll', hlfilrlings aiul trailitions 'GH svn. , .,w,,!Fxw PAUL COOK, Elmhurst, Illinois: French, Spanish, French Club 3: Span- ish Club 4. JANIS COOPERMAN, Chicago, Illinois: Elementary Education, Speech. JEFFREY D. COPP, Westmont, Illinois: Art, Intramurals 3, 4: Art fraternity. MONA COPPOLETTI, Rockford, Illinois: Elementary Education, SEA 4, PATRICIA HENNESSY COQUILLARD, Elgin, Illinois: Nursing, Elgin Community College, Dean's List 3, 4, 1970 Senior Class Project Plan! ning Committee. NANCY ELLEN CORORAN, Chicago, Illinois: Art Educationg NAEA, Chi Sigma Phi 3. MARTIN COREY, Silvis, Illinois, Finance, Black Hawk College, Fi- nance Club 3, 4. MARGARET CORICH, Chicago, Illinois, Journalism, Political Science, Dixon Volunteers 1, 2: Dorm Council 1, 2. RICHARD W. COSGROVE, La Salle, Illinois: Journalism, Aelvertis- ing, Illinois Valley Community College, Vets Club 2, 3, 4, JSA 3: PRSSA 3: Intramurals 3, 43 Honors 2. DORALEE COTTEN, Chicago, Illinois: Sociology, History, Dorm Officer. ANGELO COTTONARO, Chicago, Illinois: Business Educationq Delta Upsilon 1, 2, 3, 4, sec. 3, Decca 4. VERYL COUNTRYMAN, Moline, Illinois: Ifinanceg Black Hawk Junior College, Golf 2: Finance Club 3, 4. 4 ,,.. Ruff -T1 5,1159 , WITSF W4 f H, 'sa . .. R: ..,, , ff it E sf ,ggewf Nag ij ig ,I I 5 j . l W I E brief day of Winter sun, H shared smile, and then, once again the snow. MICHAEL COURAGE, Joliet, Illinois: Marketing, Joliet Jtmior College, Hartnell College, Delta Sigma Pi 2, 3, 4, social chrmn. 3, AMA 4, Vets Club 4: SA 2, 3: Internal Affairs Committee of NIU2, 3: Intramural Softball 3, 4, Football 4, Basketball 4. JAMES COUTURIER JR., Glenview, Illinois: Personnel Management, Kendall College, SAM 3, 4, SAS 3, 4. PAUL COVOLO, Calumet Park, Illinois: Marketing, Wilson Junior Colle e. MARgI'IN COYNE, Melrose Park, Ilinois: Marketing, Triton Junior Col- lege, Wrestling. KATHARINE CRAWFORD, Kirkland, Illinois: Speech-Theater, English. DARLENE CREEK, Glen Ellyn, Illinois: Art, Alpha Delta Pi I, 2, 3, 4, publicity activities cltrmn. 2, 3, SA Senator 3, Art Guild l, Greek Week Committee, 2. NANCY CREIGIITON, Mount Prospect, Illinois: Speech Correction, Alpha Delta Pi 2: Plays 1, WRA 2, Sigma Alplut Eta 3, 4. DEBBY CROCKER, Highwood, Illinois: Elementary Education, Busi- ness Aclministration, Little Sister of Delta Upsilon 3, 4, May Fete Com- mittee 4, Sigma Sigma Sigma 2, 3, 4, treas. 3, 4, asst. pledge trainer 2, SEA 4. ROY CROISANT, Arlington, Illinois: Accounting, Illinois Valley Com- munity College, SA, treas. 4, SAM Contribution Award 4, treas. 3, membership drive 3, Research Committee 3, AMA 3, 4, SAC 3. FREDERICK CRONE, Chicago, Illinois: Spanish, Speech, UCB, Om- cial's Club. SHEILA KAY CROSS, Salt Jose, Illinois: Honte Economics, Psychol- ogy, Alpha Plti 2. 3, 4: Panliellenic rep. 2. social chrmn. 3. aluntni sec. 4, Wesley 1, 2, 3, 4, Home Ec. Club 2. 3, 4, AHEA 4, YD I, 2, Dorm Council 4, Dixon Volunteer 2. GLENDA CRUDUP, Joliet, Illinois: lvlII'.X'lll,ij,' SNO 3, 4, Delta Sigma Theta 2, 3, 4, Orchesis I. CARROLL CRUMBACHER, Sycamore, Illinois: Accounting, Kislzwau- kee Junior College, Rockford Scltool of Business. JANE CUNNINGHAM, Carrollton, Illinois: Special Education, Alpha Xi Delta, CEC. JANET MAE CUNNINGHAM, Elk Grove Village, Illinois: Elemen- tary Ea'ucation,' Alpha Sigma Alpha 3, 4. NANCY CUNNINGHAM, Belvidere, Illinois: ElementaryEducation,So- cial Science, Rock Valley Junior College, AWS 3, 4, Off Campus Hous- ing 3, 4, pres. 3. SANDRA-LEE CUPP, Aroma Park, Illinois: History, English, Psychol- ogy, Echoes 3, Pleiades 4, Phi Alpha Theta 4, RA 3, 4, AWS chrmn. 2, SEA 4. KATHLEEN CURRAN, Elmhurst, Illinois: Elementary Education, SEA. FREIDA CURRY, Chicago, Illinois: Marketing, Chicago State College,- Social Club 2, 3, 4, AMA 4. GERALD CUTHBERTSON, Oak Lawn, Illinois: Management, Wres- tling I, 3, Intramurals Wrestling Clzantpion. THOMAS CZECH, Chicago, Illinois: Management. JAMES CZOCHER, Chicago, Illinois: Physical Education, SocioIogy,' Varsity Football 2, 3, 4, Freshman Football l, Intramurals Basketball 1, 2, 3, 4, Baseball 1, 2, 3, 4, Volleyball I, 2, 3, 4, FIO I, 2, 3, 4, social chrmn. 2, 3. LAUREL DABKEY, Brookfield, Illinois: Home Economics, Sociology, Alpha Omicron Pi 2, 3, 4, lst vice pres. 4, North Neptune Dorm Coun- ctl 1, 2. DONNA D'ALESSANDRO, Franklin Park, Illinois: Nursing,' SNA lg SNO 4, Dean's List 2, 3, 4. LYNDA DALEY, Dolton, Illinois: Elementary Education, Sociology, Thornton Junior College, SEA, NEA. SHARON DAM, For Lake, Illinois: Speech, English, UCB 3, Speech Club 4, Dorm social clirmn. 4. RICH DANCA, Peru, Illinois: Physical Education, English, Driver Edu- cation,' Illinois Valley Community College, BGIO, Track. RUTHUENID DANIELS, Maywood, Illinois: Elementary Education, Humanities, SEA 3, 4, Spanish Club I, 2, Concert Choir 2, 3. 365 CONNIE DARBY, Aurora, Illinois: Special Education, Augustana Col- lege, Alpha Omicron Pi, SEA, CEC, . JOHN DATSCHEFSKI, Aurora, Illinois: Mathemat1'cs, Computer Sci- ence, Graceland College, Iowa State University, Band 1, LINDA DAUM, Chicago, Illinois: English, Speech,' Alpha Sigma Alpha 2, 3, 4, Panhellenic Council 3, Chorus 4, Winter Carnival Committee 3, Daughters of tlze Crossed Swords 3, 4. l RICHARD DAUM, Oak Lawn, Illinois: Psychology, Sociology, Niles College, Student Coordinator,' St. Charles Tutors 3. BARBARA DAVIDSON, Harvey, Illinois: Political Science, History, Thornton Junior College, YR 3, 4, WRA 3, 4. I BONNIE DAVIDSON, Harvard, Illinois: Elementary Education, Home Economics Club 4. . ' SUSAN DAVIDSON, Chicago, Illinois: Elementary Education, Art Hts- tory, SEA. I CATHY DAVIS, Elgin, Illinois: Elementary Education, Enghsh, Inter- varsity Christian Fellowship 1, 2, 3, 4. DAVID DAVIS, DeKalb, Illinois: Marketing,' University of Maryland, AMA 3, 4. JAMES DAVIS, DeKalb, Illinois: Industry and Technology, Drafting. SCOTT DAVIS, Glen Ellyn, Illinois: History, Sociology, Inter-varsity Christian Fellowship 1, 2, 3, 4, treas. 2, vice pres. 3, pres. 4, Dorm Coun- eil 2, Plzi Alpha Theta 3, 4, sec. 4, Cavaliers 4, historian 4, Judson 3, Christ's Crusaders 1. SHARON DAVIS, Freeport, Illinois: Elementary Education, Highland Community College. TIMOTHY DAVIS, East Moline, Illinois: Matlzematics, Physics, Black Hawk College, Outdoor Club 3, 4, Bridge Club 4. PAMELA DAWSON, Streator, Illinois: Social Sciences, History, Drake University, Echoes 3. JAMES DAYTON, DeKalb, Illinois: Men's Physical Education, Safety Education. BARBARA DEAN, Sycamore, Illinois: History, Political Science, Phi Alpha Theta 3, 4, Band 1, 2, 3, 4, 1970 Senior Class Project Planning Committee. DIANE DEAN, Clarendon Hills, Illinois: Spanish, French, Loyola Uni- versity, North Central College, SAB Foreign Exchange Student, Ad- visory Board. NANCY DEAN, Park Ridge, Illinois: Elementary Education, History, Sigma Kappa 2, 3, 4, pledge trainer 3, SEA 2, 3, 4. SUSAN DEAN, Melrose Park, Illinois: Special Education, EMH, Triton Junior College, SEA 3, 4, sec-treas. 3, State pres, 4, Pi Lanzbda Theta 4. JOSEPH DEAR, Chicago, Illinois: Psychology,' Chicago City College. MARY DE BATES, Malden, Illinois: Elementary Education, History, SEA 4. ANITA DE BOER, DeKalb, Illinois: Special Education, University of Saskatchewan. ANNETTE DECHAMBRE, Park Ridge, Illinois: Elementary Education, Sociology, Alpha Xi Delta 2, 3, 4, SEA 1, 2, 3, 4, CEC 4. LEONARD DEERING, Harvey, Illinois: Marketing,' Thornton Junior College, AMA. TERRY DE FRANCO, Westchester, Illinois: Industry and Technology, WNIU 1, Dorm Council 2, pres. 3. RICHARD DE JAEGHER, East Moline, Illinois: Industry and Tech- nology, Sigma Pi 1, 2, 3, 4, pledge trainer 3, Football 1, Wrestling 1. Dorm Council, Intramural 2, 3, 4. MARGARET DE KEYSER, Geneva, Illinois: Elementary Education, gligtogy, Kappa Delta Pi 3, 4, Leadership Development Committee DANIEL J. DE KOVEN, Fox River Grove, Illinois: Journalism, Phi- losophy and Marketing,' Football 1, AMA 1, 2, 3, 4, Tau Kappa Epsilon 1, Tau Delta Epsilon 2, 3, 4, omcer 3, Intramurals 2, 3, 4. DEBORAH J. DELANEY, Chicago, Illinois: Elenzentary Ea'ucation, Alpha Sigma Alpha 2, 3, 4, pledge trainer 3, NEA 3, 4, SA Speaker's Committee 3, Student Senate 3, Winter Carnival Committee 3. KEITH DELANEY, Chicago, Illinois: Marketing, Clzemistry, Phi Sigma Epsilon 1, 2, 3, 4, social chrmn. 3, vice pres. 4, Greek Week Committee 2, Football 1, AMA 3, 4, Intramurals 1, 2, 3, 4. NANCY DELCORE, Chicago, Illinois: English, Sociology,' Wright City College, Bowling Team. NICHOLAS DE LEO, Palos Heights, Illinois: Business Management, SAM 2, 3, 4, AMA 1, Flying Huskies 3, YD 3, Sports Car Club 2, In- tramurals 1, 2, 3. 366 raduation--a step toward e different and exciting Way of life FLOREE DELEVITT, Cliieago, Illinois: Elementary Etlueation, Sociol- ogy: Dorni Council l, 2: Dean's List 2: NEA 3, 4: SEA 3, 4. KEITH DE LINE, Loves Parlc, Illinois: Matlieniaties, Pliysiesg Roely Valley Junior College. JOSEPH DE LORIER, Dolton, Illinois: Speeclz Pathology, Psyelzology,' Thornton Junior College. - EDWARD L. DE MENT. Elnzliurst, Illinois: Marlcetin,e,' Wriglit Junior College: UCB 3, 4: AMA 4: Delta Sigma Pi 3, 4. LEON L. DEMERE, Kanlcalcee, Illinois: A!'L'Ulll1lIll1C-V,' SAS l, 2, 3, 41 Intramurals I, 2, 3, 4, THERESA DEMKO, Glenview, Illinois: Clothing and Textiles, Busi- ness: Alplia Clti Omega 3, 4, refreslunents eltrnzn. 3, footl manager 4: Jr. Panliellenie 3: Honle Ee Club l, 2, 3, 4, pres. 2, funcl-raising elirnin. 3, 4: Illinois Home Economies Association l, 2, 3, 4 viee pres. 3, pres. 4: AWS 2, 3, newsletter etlitor 3, IA WS representatire 3. WILLIAM DEMMERT. Mount Prospect, Illinois: Marketing, Saint Jo- sepl1's,' Dornz rice pres. 4, social elzrnzn. 2: University Coordinating Coni- mittee 4: University Living-Learning Steering Contnzittee 4: Grant Nortli Judicial Selection Contnzittee 4: AMA I, 2, 3, 4: Newman Club l, 2, 3, 4: Dorm Paper 3: Grant Nortlz Interfloor Council 4: SAM l, 2, 3. CANDICE DENK, Niles, Illinois: Clieniistry, lV1t1lllf'IIIlIliL'S,' St. Peters- burg Junior Collegef Mutulelein Collegeg NIU Cliapter Anzeriean Clzenii- Cal Sociely Affiliate, see. 3, rice pres. 4. MARSHA L. DENNISON. Slielzlon, Illinois: Soeial Scieneef Psyeliology. KEITH DEPPERT, Perkin, Illinois: Marletin,e,' SAS I, 2.3 AMA 3, 4. MARY JANE DE SALVO, Chicago, Illinois: Matlieniaties, Aeeountingg Alplia Clii Omega 3, 4: YR 2, 3, 4, Zrul viee pres. 4: SA 2, 3: Youtlz for Nixon 2, 3, Sec. 2, 3. DENIS DESMOND, Crystal Lalfe, Illinois: ACC0llllIIlltL',' MaeMurray College. DIANA JOAN DEVIN E, ,'lIIl'llZUII, Illinois: Matlzeniatiesg Pliysiesq Sault Valley Junior College: Plii Tlieta Kappa: Matli Club. DIANE DE VITO, Berwyn, Illinois: Speeial Etlueationg Kappa Delta. SUE DEWEY, Morris, Illinois: Aceountanc'y,' Illinois State Uni1'ersity,' SAS 3. 4. CAROLE DICK, Parlc Forest, Illinois: Anthropology, Soeiolo,ey,' Alplia Oniieron Pi 2, 3: publieity elirnin. 2: Italian Club 2, pres. 2. CRAIG DICKINSON, Oranleeville, Illinois: Political Seienee, Speeeli. MELVIN DIEI-IL, Carrollton, Illinois: History: Tau Lanilula Clti 2, 3. 4: Intramurals l, 2, 3, 4: Residence Hall Jiulieiary Coinniittee 2, 3. JEFF DIERKS, Libertyville, Illinois: Managenzentq Valparaiso Univer- sity: California State Long Beaeli. DAVID DIERSEN, Crete, Illinois: Maiutgententg University of Illinois Circle: SAM 3, 4: NISEC 3, treas. 4. MICHAEL DIETZ, Arlington Heigltts, Illinois: History, Politieal Seieneeg YR 3: Intraniural Football anti Baseball l, 2. SANDRA DIGGS, Calumet City, Illinois,' History, ElI,L'II.SII,' SA Elev- tions Coninzittee 2, 3: YR l, 2, 3. TYREE DIGGS JR., Chicago, Illinois: Psyclioloyyg Alplia Plii Alplut social CI1lAIIllI.,' AACO. JOHN DINGRAUDO. Franlslin Park, Illinois,' Clieniistry, A4tIIIlUIll!IIICS,' Triton College, Plti Delta Psi 3, 4, liistorian 4. Greek Week elirntn. 4. WILLIAM DE PAULO. Cliieago, Illinois: Geology: Alplia PIII Omega 2, 3, 4: Geology Clulv 3, 42 NIU Weight Lifting Clulz 4: Intraniurals l. 2. 3. 4. GEORGE DIRKSEN. La Salle, Illinois: Matlienzatiesf Illinois Valley Conzniunily Colle,ee,' College of DuPage: University of IVIIII'-Vltllill. JAMES DIRKSEN, Peru, Illinois: Matlieniaties, Aeeountingf Illinois Valley Contlnunity Colleyeg Intraniural lfootlnillg Plii Iieta Lanzbtla. DIANE DISCIPIO. OIIIX Iiroolt, Illinois: Elementary Etlueation: College of DuPa,ee,' WRA I. 2. 3. pres. 2: Ilonie Ee 1. 2: SEA 4: Floor soeial elzrrnn. 3. floor pres. 4. 367 echoes of PAMELA DMIT, Calumet City, Illinois: Education: English: Thornton Junior College. ROGER RODNEY DOBER, Chicago, Illinois: Management: Sigma Iota Epsilon 4: SAM 3, 4: AMA 4: NIU Karate Club 3, 4: Track Team 3, 4: Cavaliers 4. ARLENE DOBIE, Chicago, Illinois: Business Education: University of Illinois,' DePaul University: AWS 3, Pi Omega Pi 4. PERVIS DODD, Markham,Illinois: Accounting: Thornton Junior Col- lege: Kappa Alpha Psi 3, 4. JEANNE DOERR, Mount Prospect, Illinois: Elementary Education, Speech: University Bands, I, 2, 3, 4. GLENN DOHNER, Sterling, Illinois: Accountancy,' Sauk Valley Junior College: Murray University. JAMES DOLAN, Villa Park, Illinois: Marketing: AMA 2, 3, 4: Sum- mer Jobs Committee 4: Dormitory Council 2: Intramurals l, 2, 4. JO ANN DOKZIL, Chicago, Illinois: Nursing: SNO 4. ARNOLD DOMIN, Medinah, Illinois: Marketing: Elg1'n CIOIIIIIIIHIIIY College: Delta Sigma Pi 3, 4: AMA 3, 4. ELLEN DONALDSON, Evergreen Park, Illinois: English, History: Eng- lish Club 1, 2, 3, 4: YR 2: Winter Carnival Committee 4: May Fete Committee 4: 1970 Senior Class Project Planning Committee 4. SUZANNE DONATT, Oglesby, Illinois: French, History: Echoes 2: SEA 2. EDWARD DONNELLY, DeKalb, Illinois: Management, Economics: Sigma Alpha Epsilon 2, 3, 4: SAM 4. DIANE DONOVAN, Oak Lawn, Illinois: Special Ezlucationg Dominican College: CEC. GERALD DONOVAN, Rockford, Illinois: Marketing: Rock Valley Jun- ior Collegeg AMA ,' Advertising Club: Sky Diving Club. JAMES DONOVAN, Wheaton, Illinois: Finance: Vets Club: Newman Club: Finance Club. ANDREA DORFMAN, Chicago, Illinois: Special EllIICllIlOII,' Delta Sig- ma 2,.3, 4. SUSAN DORFMAN Chicafo, Illinois: English, Tlieutreg Si 'ma Delta i A . L Tau 1, 2, 3, 4: University Theatre l, 2, 3. 4: Studio Theatre: Dornz Spe- cial Events Committee, 1. CHERI DORNQUAST. Mount Prospect, Illinois: Elementary Education, English: Chi Omega 2, 3, 4, social clzrmn. 2, 3: Greek Week Comnzittee 3. JELIER J. DORST, The Hague, Netlierlandsg Psychology: Pl1ilosophy,' Prairie State College: pres. NISCC. SUSAN DOUBEK, Westmont, Illinois: Elementary Education: Newman 1, 2, 3: NEA 3, 4. MAUREEN DOUGHERTY, Deerfield, Illinois: History, Political Sci- ence: University of Oklahoma: Alpha Sigma Alpha. PAUL W. DOUGLAS, Chicago, Illinois: Geography, History: Bogan Junior College: Gamma Theta Upsilon. JEANNINE DOYLE, Evergreen Park, Illinois: Elenzentary Education: St. Xavier College: SEA 3, 4. SHARON DOYLE, Chicago, Illinois: Elementary Ea'ucation,' SEA 3, 4. NANCY DRAPER, Walnut, Illinois: Art Education: Beta Gamma Chap- ter of Delta Phi Delta 3, 4: Art Guild 4: National Art Education As- sociation 4. CHRISTINE DRAVS, Crystal Lake, Illinois: Special Education, Elemen- tary Education: Kappa Delta l, 2, 3, 4: CEC 4: Dorm Council I, 2. EDNA LYNN DREDZE, Clzicago, Illinois: Marketing: AMA 2, 3, 4, sec. 3, 4, executive council 3, 4: SAM 2, 3: PRSSA 4: Marketing Cur- riculum Aa'visory Board 4: Bridge Club 3: Hillel 1, 2, 3, 4, member- ship chrmn. 2, executive council 2: University Studio Theater l. LYN DREES, Oak Park, Illinois: Business Education: YR 1, 2, 3, 4, sec. 2, second vice pres. 3, hrst vice pres. 4: Phi Beta Lambda 2: Pi Ome- ga Pi 4: AMA 1: NBEA 4: IBEA 4. 368 Remember it Well .. . bitter sweet shadowed corridors, ereaky stairs. JANICE DREGER, Joliet, Illinois: English, Journalism: Norther, photo editor 3, 4: JSA 2, 3, 4: Theta Sigma Phi 4: Tri Swine Omega 3, 4. PATRICIA A. DRILLING, Chicago, Illinois: Mathematics, Psychology: De Paul University: University of Chicago: Phi Gamma Nu 1: Math Club 3, 4. SUSAN M. DRILLING, Chicago, Illinois: Business Education, Quincy College, SA senator 3, 4. WILLIAM DROBICK, Chicago. Illinois: Accountancy: University of Illinois, Clzicago Circle, Skydivers 4: Intramural Football 2, 3, 4, Base- ball 2, 3, 4, Basketball 2, 3. 4, Intramural Volleyball 2. 3, 4: SAS 3, 4: S10 2. 3, 4. CELIA DRUCKER, Rock Island. Illinois: Elementary Education, Sociol- ogy, NEA-SEA 3, 4: Floor pres. 3. CARL DU BRIDGE, Steger, Illinois: History, Sociology, Prairie State .lunior College. SALLY DU CHETTE, Rossville, Illinois: Elementary Education, Den- ville Junior College. GERALD DUDE. Wilmington, Illinois: Journalism: Cypress Junior College. TERRENCE DUFFY, Serena, Illinois: Physical Education, History, West- ern Illinois University, Intramurals 3, 4: Physical Education Majors Club 3, 4. DARLENE A. DUGO, Elk Grove Village, Illinois: Elenzentary Educa- tion, Psychology-Sociologyg SEA 3, 4. BRUCE BARTON DUGUID, Park Forest, Illinois: Music, University Chorus 3: NIU Percussion Ensemble 2, 3, 4: NIU Group for New Music 4: WNIU 1, 4, publicity director l, librarian 4: Leadership Develop- ment Committee Institute 3: NIU Fine Arts Festival Committee 3. JAMES DUKE, Peoria, Illinois: Meteorology, Mathematics, Illinois State University: Vet's Club: Gamma Theta Upsilon: American Meteorologi- cal Societv. LANNA DULL, Rockford, Illinois: Music: Sigma Alpha Iota 1, 2, 3, 4, treas. 2, 3, 4: Dorm Council 3: Chorus 1, 2, 3, 4: Band 2, Opera 3: WLC 4: Ushering 1, 2, 3, 4: Wesley Tour Choir 2, 3, 4. KATHLEEN DUMASKI, McHenry, Illinois: Elementary Education, SEA l, 2, 3. DENNIS DUMYAHN, Joliet, Illinois: Finance, Economics, SAM 3: AIESEC 4. LEO DUNDAS, Clifton, Illinois: Marketing, Sigma Alplza Epsilon, In- tramural Basketball, Football. A putting down of one's tlzoughts, perhaps dreams, upon unlined paper. 369 THOMAS H. DUNLOP, Aurora, Illinois: Social Science, Sociology: Delta Upsilon 2, 3, 4, vice pres. 4: Intramurals l, 2, 3, 4: May Fete Committee 2, 3, 4: Golf l. CATHERINE L. DUNN, DeKalb, Illinois: Home Economics: Home Economic Club I: Williston Hall Asst. R.A. 3. JOHN DUNN, Peoria, Illinois: Marketing, Accounting: Bradley Uni- versity: Intramural Football 3, Basketball 3, Bowling 4: AMA 4. JANET DUNNING, Elgin, Illinois: English, History. LINDA B. DURKIEWICZ, Oak Lawn, Illinois: Mathematics, English. MARY DURKIN. D,olton, Illinois: Journalism, English: Thornton Jun- ior College: Northern Star 3, summer news editor: Theta Sigma Phi 3, 4. PATRICIA DUSZYNSKI. Norridge, Illinois: Elementary Education, Historv. JUDY DUTENHOEFER, Dauphin, Pennsylvania: Elementary Educa- tion: Harrisburg Area Community College: NEA I, 2. SCOTT DUTENHOEFER, Elmira, New York: Management: Harris- burg Area Community College: SAM 3, 4. JUDITH DVORAK, Chicago, Illinois: English, Sociology: Loop Junior College: Loyola University: Italian Club 2: English Undergraduate Student Advisory Committee 4. sec. 4. DON DYEKMAN, East Peoria, Illinois: Political Science, History. DAN DYER, Homewood, Illinois: Philosoplzy, History: University of Illinois: Theta Chi 3. 4, librarian 4. I-IARRIET DYGERT, Woodstock, Illinois: English, Political Science: Echoes 3: Sigma Tau Delta 3, 4: Towers 3, 4: Pleiades 4: YR 1, 3. GREGORY DZURISIN, Streator, Illinois: Meteorology: Intramural Baseball 3: Special Events chrmn. 3: Math Club 4: Geology Club 4: New- man l, 2, 3, 4. DONALD G. EAMES, Rockford, Illinois: Marketing: Phi Kappa Sig- ma 2, 3, 4, vice pres., music coordinator: AMA 1, 2, 3, 4: TFC 3: DCB 4: Public Relations. IRENE EATON, Cornell, Illinois: Nursing: SNO l, 2, 3, 4 cor. sec. 4. EVALEE ECK, Glen Ellyn, Illinois: History: English-Geography: Inter- Varsity Christian Fellowship I, 2, 3, 4, sec. 4. LUCY EGAN, Hickory Hills, Illinois: Elementary Education: NEA 4. MARY T. EGER, Dale, Indiana: Elementary Education, Sociology: In- diana State University. LARRY EHRHORN, Wheaton, Illinois: Theatre, English: Theatre Work 1. 2, 31 Intramurals l. 2, 3, 4. TRUDY ELKINS, Des Plaines, Illinois: Nursing: SNO 2, 4: Sigma Alplza Pi l, 2, 3, 4. ELLEN ELLENBERGER, South Holland, Illinois: Sociology: Alpha Delta Pi. MARGARET EILERS, Elmwood Park, Illinois: Management: Newman 1, 2, 3, 4: UCB Entertainment Coordinator 3, 4: SAM 4: Lincoln Hall Council 3. BRADLEY H. ELLIS, Morton Grove, Illinois: Marketing: Phi Epsilon Pi l. 2. 3. 4: IFC.2: Homecoming Parade Committee 4. JULIE ELLIS, Peoria, Illinois: Journalism, Sociology: Alpha Omicron Pi l, 2, 3, 4, Panhellenic rep. 3, pledge trainer 4: Northern Star 4: Cwens 2: RA, Grant South, 2: Theta Sigma Phi 4: May Fete 3. ZIFNCY ELLISON, Deerheld, Illinois: French, History: University of inois. STEWART ELLISON, Crystal Lake, Illinois: Matl1ematics, Plzysics,' University of Illinois: Computer Lab asst. 4. MARTHA ELLUL, Oak Forest, Illinois: Special Education: CEC 2, 3, 4: Association for the Education of Visually Handicapped, sec.-treas. 2, pres. 3: Alpha Phi, standards chrmn. 2, rush chrmn. 3. ROSEMARY ELWOOD, River Forest, Illinois: Business Education: NBEA: Women's Chorus 2: Orchesis 2: Sigma Alpha Pi l, 2, 3, 4. MAE ALICE EMERSON, Lockport, Illinois: Marketing: Joliet Junior College: UCB Art Committee 3, 4: AMA 3, 4, publicity chrmn. 4. ELVIRA EMMA, Chicago, Illinois: English, Journalism: Wright Junior College: University of Illinois: Illinois Teachers College, North Chicago Circle: Homecoming Committee: English Club: Journalism Club. GERALD ENGELKING, Beecher, Illinois: Chemistry, Mathematics: Prairie State Junior College: Intramurals l, 2. 370 A c . .and too man klds arenlt prepared for the challenge of life. DOUGLAS ENGLEBAUGH, Villa Park, Illinois: Management, Fi- nance, Sigma Alpha Epsilon 2. 3, 4: SAM 3, 4. JAMES ENGLING. Elmhurst, Illinois: Industry and Technology: Phi Delta Psi, Epsilon Pi Tau. SANDRA ENGSTROM, Evanston, Illinois: Mathematics. HERBERT EPSTEIN, Chicago, Illinois: Physics, Mathematics, Wright Junior College. JANET ERICKSEN, Elmhurst, Illinois: Elementary Education, Dorm Ofhcer, Grant Town South, SNO, Chi Omega, SEA. CAROL LYNN ERICKSON, Chicago, Illinois: Business Education, Val- paraiso University, Chi Omega 2, 3, 4, treas., Phi Omega Pi 3, 4: SAM 2, 3, 4: Pi Beta Lambda 3, 4. JOEL I. ERICKSON, Sugar Grove, Illinois: Finance, Economics, Sigma Alpha Epsilon 2. 3, 4: May Fete Committee, treas. 3. chrmn. 4. JAIME GARCIA ESCORZA. Rockford, Illinois: Biology, Chemistry, Rock Valley College, UCB. IRENE ESQUIVEL, Chicago, Illinois: Elementary Education, Chicago City College, Association for Childlzood Education, pres, Kappa Delta Pi, NEA. SUSAN ESTKO, Westchester, Illinois: Elementary Education, Sociology. ROBERT ESTRIN, Spring Valley, Illinois: Speech lTheatreJ, Art, Uni- versity Theatre, Ali Baba, Hamlet, Oh What a Lovely War, Mar- at!Sade, Status Seeker, Horrorscope scene designer, Hail Scraw- dyke, Barefoot in the Park. GAY EVANS, Crete, Illinois: Speech Correction, Elementary Education. LEONEL EVANS, South Holland, Illinois: Management, Thornton Jun- ior College, University of Illinois, Intramurals 3, 4: SAM 4. JAMES EVERS, Freeport, Illinois: History, Cerritos College. CHRISTINE L. FAHRNER, Dalton, Illinois: Elementary Education, Sociology, Kappa Delta 2. 3, 4: Pom Pon Squad 2. 3: Winter Carnival Finalist 3. KENNETH FAIT, Niles, Illinois: Marketing, College of Santa Fe, Hall Council 3. VACLAV FAKTOR, Chicago, Illinois: Management, University of North Dakota, SAM 4: ROTC 1, 2: Intramurals l, 2, 3, 4. ELIZABETH FARASHANI, Peoria, Illinois: Elementary Education, NEA. VIRGINIA FARNUM, Chicago, Illinois: Home Economics, University of Illinois Chicago Circle, Home Economics Club, American Home Eco- nomics Association, Student Advisory Committee, 1970 Senior Class Project Planning Committee. ROGER FARRELL, Evergreen Park, Illinois: History, Political Science, Kappa Chi, Sigma Plzi Epsilon 2, 3, 4, historian 2, 3, 4, recorder 4, ath- letic chrmn. 3, 4: NIU Officials' Club l, 2, 3. 4, vice pres. 4: Newman Community l, 2, 3, 4: Newman Barker l. 2, 3, editor 2, 3. WILBUR FARRELL, Morrison, Illinois: Business Education, Intramural Basketball 2: IBEA 4. JEFF FARREN, Yorkville, Illinois: Journalism, Business Administra- tion, Southern Illinois University, Northern Star 3, 4, copy editor, asso- ciate editor 4: JSA 3, 4: PRSSA 4: Sigma Delta Chi 3, 4, treas. 4: Intra- murals 2, 3. LARRY A. FASS, Lombard, Illinois: Economics, Political Science, Delta Tau Omega 2, 3, 4, cor. sec. 2, rec'd sec. 3, lst vice pres. 4: Phi Eta Sigma 2, 3: Cavaliers 3, 4: Dean's List 1. 2. 3. 4: Intramurals 1, 2. 3, 41 Homecoming Tug Champions 2, 3. BABETTE FATTER, Evergreen Park, Illinois: English, Sociology. JOHN FATTIG, Harvey, Illinois: Management, Thornton Junior Col- lege, SAM 3, 4: Sigma Iota Epsilon. JUNE FEAGGAN, Freeport, Illinois: Biology, Chemistry, Highland Community College. STEPHANY FEHR, Deer Creek, Illinois: Special Education EMH,' Alpha Chi Omega, 4: RA Grant South 3, University Plaza 4: CEC 3, 4. JAMES FEHRENBACHER, Arlington Heights, Illinois: English. Phi- losophy: Intramurals 1. 2. 371 KAREN FEINGOLD, Chicago, Illinois: Elementary Education, Sociol- ogy: Hillel l, 2, 3, 4: NEA 1: EA: SEA 3, 4: UCB Public Relations Committee 3, Movie Committee 4. SANDRA FELDMAN, Sheboygan, Wisconsin: Elementary Education: Oshkosh State University, Wisconsin: Hillel, film chrmn. GARY FELICETTI, Steger, Illinois: Economics, History: Phi Kappa Tlzeta I, 2, 3, 4, sec. 2, pres. 4: UCB 2, 3, entertainment coordinator 3: IFC 3, 4, Judicial Committee 4: May Fete Committee 2. LYNDA GREENAWAY FERNOW, Des Plaines, Illinois: Elementary Education. WILLIAM FERNON, Des Plaines, Illinois: Finance: Delta Upsilon. STEVE FERRIN, Lisle, Illinois: Marketing: St. Procopiusg College of Dupageg Intramurals l, 2, 3, 4. CHERYL FESSENDEN, Elmhurst, Illinois: Home Economics, Sociol- ogy: Alpha Phi 3, 4, publicity chrmn. 3, rush chrmn. 4: University Worn- en's Chorus, 4. WILLIAM FEYERHERM, DeKalb, Illinois: Political Science, Speech: Pi Kappa Delta 1, 2, 3, 4, pres. 3, 4: Cavaliers. MARY FIAN, Skokie, Illinois: Social Science, English: Sigma Alpha Pi 3, 4. DAVID FIELDS, La Grange, Illinois: Management: Alpha Kappa Lambda 2, 3, 4, Rules of Standards 3, Board Rep. 4: SAM 4: Outdoor Club l,' Intranzural Volleyball 1, 2. LINDA FIGURA, Chicago Heights, Illinois: Elementary Education, Sociology: SEA. HOWARD FINE, Skokie, Illinois: Finance: Zeta Beta Tan 2, 3, 4, house manager: Finance Club 4. IRWIN FINE, Philadelphia, Pennsylvania: History, Political Science: Temple University. HOWARD FINK, Clzicago, Illinois: Finance: University of Illinois Chi- cago Circle: AMA 3: Hillel 3. RICHARD FINK, Park Ridge, Illinois: Finance, Economics: Kappa Chi, historian 2: Intramurals l, 2. DANIEL FINN, Coal City, Illinois: Chemistry, Mathematics: Phi Eta Sigma I, 2, 3, 4: ACS, Student Chapter l, 2, 3, 4, vice pres. 3. CRAIG FINNICUM, Erie, Illinois: Biology, Chemistry. NANCY FISHELLA, Oak Lawn, Illinois: English, History,' Delta Zeta 2, 3, 4, rec'd sec. 3. GERALD M. FISHER, Elk Grove Village, Illinois: Spanish, Psychology: University of Mexico: Spanish Club: Intramurals l, 2, 3, 4. M. MARGARET FITZGERALD, Morrison, Illinois: English, Spanish,- Mt. Saint Clare, Augustana: Sigma Tau Delta. EILEEN FLANAGAN, Avon, Illinois: Elementary Education, French: Clarke College. GARY L. FLANAGAN, Lake Zurich, Illinois: Journalism, Business Ad- ministration: William Rainey Harper Junior College: Sigma Delta Chi 4: Northern Star 1, 2, 3, 4: PRSSA 3, 4. RICHARD FLECK, Homewood, Illinois: Mathematics, Chemistry. PATRICIA FLEMING, Chicago, Illinois: Elementary Education. LELAND FLUCK, Geneseo, Illinois: History, Sociology: Tau Lambda Chi l, 2, 3, 4: Homeconzing Committee 3, 4: Parties 1, 2, 3, 4. JANICE FOLEY, Grayslake, Illinois: Spanish, Secretarial Administra- tion,' Spanish Club l, 2. JACK ALLEN FOLKERTS, Brookjield, Illinois: Accounting: College of DuPage,' Intramural Football, Basketball, Baseball: SAS. PAUL FONFERKO, Chicago, Illinois: Accountancy, Finance: SAS I, 2, 3, 4: Intramurals 2, 3. LINDA E. FOREMAN, Glen Ellyn, Illinois: Music: Sigma Alpha Iota l, 2, 3, 4: MENC 1, 2, 3, 4: YR 4: AWS I: Choir I, 2, 3, 4: Chorus l, 2: Madrigal Singers 2, 3. LINDA FORGACZ, Chicago, Illinois: Special Education EMH,' Wright Junior College: Sigma Delta Tau 2, 3, 4, vice pres. 3, 4: Newman Club 2, 3, 4: CEC 3, 4. MARILYN FORMAN, Highland Park, Illinois: Elementary Education: National College of Education: Hillel 2: Floor vice pres. 2: SEA 2, 3, 4: UCB 3, 4. RUSS FORRER, Wedron, Illinois: Mathematics, Art. 372 What was I here for? 7 77 t reall doesn t matter much now, does it? JANICE SUSAN FORSBERG, La Grange Park, Illinois: Elementary Education,' Carthage College. NANCY FORSTER, Glen Ellyn, Illinois, English, History: Schiller Col- lege,' Sigma Kappa 1, 2, 4, treas. 2: UCB 2. JOSEPH R. FORTUNATO JR., Melrose Park, Illinois: Political Science, History: Theta Delta Xi 3, 4, social chrmn. 4: Intramurals 1, 2, 3, 4: Dorm Government 1, 2, 3. ANNE FOSSIER, La Grange Park, Illinois: Elementary Education: Lyons Township Junior College. JANE FOSTER, Chicago, Illinois: Elementary Education, Art History, YR 1, 2, 3, 4, sec. 4: SEA 3, 4: WRA 1, 2: SA Activities Committee 4. JOHN FOSTER, Oak Lawn, Illinois: Managementg Bogan Junior College. ROBERT FOSTER, Clzicago, Illinois: Political Science, Economics: YR 2, 3, 4: Newsletter Editor: SA Activities Committee 4: AAG 3, 4. WILLIAM FOSTER, Aledo, Illinois: History, Sociology: Drake Univer- sity, Black Hawk College: YR 3, 4. JOYCE FOWLER, Granite City, Illinois: English, Journalism, Northern Star 1: UCB 3. PAUL FRAGALLE, Harvey, Illinois: History, English: Theta Delta Xi 3, 4, 1st vice pres. 4: Newman Community 1, 2, 3, 4: Intramural Foot- ball, Basketball, Softball 1, 2, 3, 4. DONNA AHLSTROM FRALEY, Naperville, Illinois: Elementary Education. GREGORY T. FRANKLIN, Mundelein, Illinois: English, Psychology: Niles College,' Newman,' Intramurals 1. CANDACE FRANTZ, Itasca, Illinois: Sociology, Psychology: Central YMCA Communitv College: Wlto's Who in Junior Colleges: Grant Tow- ers Nortlt Dorm Council 4: Floor pres. 4: WRA 3, 4: Recreation Com- mittee 3. LINDA FRECH, Highland Park, Illinois: Speech, English: St. Mary-of- the Woods: Orchesis 2: St. Charles tutor 2, 3, 4. ERNEST FREDENDALL, Chicago, Illinois: Art,' UCB Art chrmn. 4: Exhibition Committee Art Department 4: 1970 Senior Class Project Planning Committee. PAUL M. FREDERICKS, Chicago, Illinois: Economicsg Illinois Insti- tute of Technology,' Newman Club 3: Economics Club 3. JANICE FREESTROM, Chicago, Illinois: Elementary Education, Biol- ogy: Pleiadesg Pi Lambda Tl1eta,' Outdoor Club,' Inter Varsity Christian Fellowship. JAMES FRESSO, Chicago, Illinois: Finance: Slzorei Goju Karate Club 3, 4: Finance Club 3, 4: Intramurals Football, Basketball, Volleyball, Softball 1, 2, 3. 4: Scholarship Committee 2. BARBARA FREY, Tinley Park, Illinois: Elementary Education: ACE 3, 4: SEA 3, 4: Sigma Lambda Sigma. KATHRYN G. FRIER, Naperville, Illinois: Marketing: North Central College: Lincoln Junior Colleges. RITA FRIESTAD, DeKalb, Illinois: Elementary Education, Speech: Marauette University. GAYLE FRIG, Ottawa, Illinois: Elementary Education, Sociologv: UCB Entertainment Committee 3, 41 1970 Senior Class Project Planning Committee. BARBARA FROHAN, Dundee, Illinois: Elementary Education, St. Dominic Colleee. GORDAN FUIST, Maywood, Illinois: Marketing: Delta Tau Omega, social chrmn. 3: Intramurals. CHARLES FULLER, Aurora, Illinois: Biology: Intramurals 1, 2, 3, 4. JACK FUNCIK, Berwyn, Illinois: Advertising, Graphic Design: Delta Upsilon 2, 3, 4, chapter relations chrmn. 3, art director 3, 43 Intramural gzotgall 2, Basketball 2, 3, 4: Volleyball 2, 3, 4: Softball 2, 3, 4: Hand- a . WILLIAM FUREY, Oak Park, Illinois: Marketing, Speech: Tau Delta Epsilon 2, 3, 4, vice pres. 2, activities chrmn. 3, pres. 4: AMA I, 3: SAB Public Relations Committee 3: Intramurals. RICHARD FURST, Mount Prospect, Illinois: Marketing: Sigma Alpha Epsilon 2, 3, 4: AMA 4: Intramurals 1, 2, 3, 4. 373 K Szeady hands reach ahead toward the future somewhere beyond the self. TERR.4.N'CE GA ERTNER, Blue Islanil, Illinois: .4eCounring,' Them Chi: ,-IMA: SAS. JEFFREY GAGLER, Chicago, Illinois: Zoology. Clzernistry: Intramur4 als I. 2, 5. 4: Wildlife Soeieiy 2. 5,41 Tlzeazer 1, 4: B.-IZ 1. LINDA GALBREATH. Chicago, Illinois: Elementary Eilaeaziong Loop Junior College: Dlllil Sigma Them, cor. see. 2. 3, 4. COLLEEN GALLAGHER. Downers Grove, Illinois: 'llarlxelingg Easi- ern Illinois l 'iiwrsi1y.' A U,-I -1. LJAIL GALLAGHER, Woodstock. Illinois: Special Eiliieaiion. DALE E. GALLEIN. Seliaimilviirg, Illinois: Business L':LIllCLlIl0Il,' Univer- siiy of Illinois: Triion Junior College. NICK GALLINA. I'VL'SllIl0llI, Illinois: llflarkeiingg SAS I. YVONNE GALLO, Palos Heigliis, Illinois: Special Eiliieaziong CEC 2, 3, 4. .IUDITH GALYON, Arlington Heights, Illinois: Elementary Eduealion, English. DIANE M, GANGE. Cicero, Illinois: Elemenlary Eilueation: Morton College. ,IOANN GARBACZ, Park Foresz, Illinois: Elementary Edi4c'ation,' Prai- rie Sraie College: SE.-I: Si. Charles Tutor, JAYNE GARBER. Chicago. Illinois: 'llarkeiingq UCB Public Relations 3. 4: Alklfi 41 Sileina .VII Swee1ie 3. -1, JANICE GARDNER, For Lake, Illinois: Physical Education, Driver Eilicciziion, WRA l, 2. 3. 4: Major iylinor I, 1. 3. 43 IAHPER Area ehrrnn. 1. SUSAN L. GARIEPY, L0IIlLYLIl'Ll, Illinois: History, Soeiologyg Lyons Township Junior College: College of DuPage. JAMES W GARLANGER, Chicago. Illinois: .'IL'L'0llIlflllH.' Wilson Jun- xor College: Phi Kappa Theza 3, 4: Inzernship in Aeeoioziing 4g Aeeouni- ing Soeieiy 3, 4, Inirainaral Baseball 3. 4. PAUL GARNETT, Passaic. New Jersey: Managenieni, Personnel: Tern- ple Universiiy: Dralx e University: 5.4.41 2. 374 lx 'K iii. .Q qw N V 4 A :Q . K A mm A I K A .e...,...--- ' M-Q.. ,W .. I I I EDWARD GAROFALO, Chicago, Illinois: Elementary Education, Math- ematics: Alplza Phi Omega 3, 4, vice pres. 3. NANCY GARRETT, Chicago, lllinois:Elementary Education, Sociology. BONITA GARRINGER, Bensenville, Illinois: Nursing: Western Illi- nois University l: SNO 2, 3, 4. REGINA GASCOIGNE, Amboy, Illinois: Sociology: Sauk Valley Col- lege: Sociology Club 3, 4: UCB 3. RUTH GASIECKI, Chicago, Illinois: Speech!Theatre, English: Univer- sity Studio Theatre Productions 1, 2, 3, 4. KALYNN GASSMAN, Lena, Illinois: Business Education: Pi Omega Pi 3, 4: Phi Beta Lambda 3, 4. RITA GASSMAN, Morton Grove, Illinois: Speech Correction, Psychol- ogy: Chi Delta Chi 2, 3: Panhellenic rep.: class coordinator 3: Alpha Chi Omega 4: pres. 4: Sigma Alplza Eta Honorary 2, 3, 4. ALICE GATTONE, Chicago, Illinois: Elementary Education, Sociol- ogy: Alpha Phi l, 2, 3, 4, social chrmn. 2, rush chrmn. 2, 3. IANICE GATZ, Glenview, Illinois: Home Economics: Education: Chi Delta Chi, historian: Alpha Chi Omega, cor. sec.: American Home Eco- nomics Association. DAVID GAUB, Des Plaines, Illinois: Special Education: Kappa Chi 2, 3, cor. sec., 2, 3: SEA 2, 3, 4: Cavaliers 4: CEC 2, 3, 4, vice pres. 4. STEPHEN GAULRAPP, Freeport, Illinois: Accounting: Highland Com- munity College: SAS 3, 4. STACIE GELLER, Skokie, Illinois: History, Political Science, Spanish: Kennedy Action Corps. HOWARD GELLERMAN, Chicago, Illinois: History, Political Science: Amundson Junior College: Intramurals I, 2, 3, 4: Cavaliers 4: Phi Alpha Theta 3, 4: Sigma Alpha Epsilon 1, 2, 3, 4, Midway chrmn., Winter Car- nival, chaplain: Judicial Board 3, 4. PAMELA GENTILE, Oak Park, Illinois: Elementary Education, Sociol- ogy: Kappa Delta 1, 2, 3, 4: NEA 3, 4: Sigma Pi Sweethearts. HARRY GEORGAS, Chicago, Illinois: Marketing. SALLY GERBER, Lombard, Illinois: Early Childhood Education, Psy- chology: May Fete chrmn, 3: School Spirit Committee: Alpha Sigma Alpha 2, 3, 4, rush chrmn. 4. PATRICIA GERKEN, Elmwood Park, Illinois: Elementary Education, History: Newman Club 1, 2: SEA 3, 4. KATHRYN GETZLAFF, Chicago, Illinois: English, Political Science. JULIE GETZOFF, Northbrook, Illinois: Elementary Education, French, Spanish: DePauw University: Sigma Kappa 2, 3, 4, treas., 2, 3, 4: SEA 2, 3, 4: Pleiades 4: Dean's List 3, 4: Kappa Delta Pi 3, 4, treas. 4. ROSEMARY GHETZLER, Skokie, Illinois: Special Education, CEC 4. DENNIS GIBULA, Chicago, Illinois: Marketing: Christian Brothers College: Alpha Kappa Lambda 3, 4: Intramural Football 4, Softball 3, 4, Basketball 4, Bowling 3, 4: Alpha Kappa Public Relations. alumni dinner chrmn. JAMES GIENKO, Mundelein, Illinois: Management: Phi Delta Psi 2, 3, 4. DAWN GIFFORD, Belvidere, Illinois: Elementary Education: Wartburg College: Chorus 3, 4: UCB 4: Sigma Alplza Iota 3, 4, 5: MENC 3, 4. DIANE GILBOY, Chicago, Illinois: Social Science, History: Alverno College: Wright Junior College. MYRA LYNN GILIO, Glenview, Illinois: Elementary Education: Mich- gan State University: Sigma Kappa 3, 4. CHARLES GILL, Cahokia, Illinois: Political Science, History: Theta Chi, pres., vice pres.: IFC Judicial Commission, chrmn. IAMES GILMOUR, Oswego, Illinois: Social Science, Business Educa- tion: University of Hawaii: Aurora College: Waubonsee Junior College: Vet's Club: SEA. SHARON F. GILMOUR, Aurora, Illinois: English, Sociology: Aurora College: Southeastern Illinois College: SEA 4: Sigma Delta Tau 3, 4. IANEEN GINGHER, Streator, Illinois: Elementary Education, Psyclzol- ogy: Chi Omega 2. DARLENE GIOVANAZZI, Chicago, Illinois: History, Political Science: Kennedy Action Corps. CONNIE GISEL, Crystal Lake, Illinois: Elementary Education, French: Iowa Wesleyan College: SEA-NEA 3, 4: Alpha Xi Delta. CAROLE A. GIROUX, Aurora, Illinois: Special Education: St. Mary's Notre Dame Aurora College: CEC: Pi Lambda Theta: NEA. 375 Graduatlon a tlme to move a tassel, to recelve a d1pl0ma,at1met0 begm JOHN GIUDICE, Wlteaton, Illinois: Englislt, History, Intramurals 1, 2. PHILIP J. GIUNTOLI, McHenry, Illinois: Mathematics, Sociology, Matltetnatics Club 4: Sociology and Anthropology Club 4. MARSHA GIVERTZ, Chicago, Illinois: Elementary Education, Speech, Wright Junior College, Sigma Delta Tau 2, 3, 4. NANCY GLANDER, Des Plaines, Illinois: Elementary Education, SEA 4. LOREL GLASSNER, Skokie, Illinois: English, Journalism, CEC 1, 2: JSA, 2, 3: Sigma Delta Tau 2, 3, 4. LINDA GLATZHOFER, Naperville, Illinois: Marketing, Kappa Delta 2, 3, 4: AMA 4. BRUCE GLEASON, New Lenox, Illinois: Art, Joliet Junior College, Sports Car Club 3, 4: YD 3, 4. SANDRA L. GLEASON, Leng, Illinois: English, Psychology, Psi Chi 2, 3, Wesley Foundation 3. MARSHALL GLEISTEN, Crystal Lake, Illinois: Finance, College of Marin, Vet's Club 3, 4, historian 3. GERALD GLENN, Joliet, Illinois: Journalisnz, Joliet Junior College. GUSTAFSON GLENN, Chicago, Illinois: Special Education, RA 3, 4. PAUL EDWARD GLOVER, Waukegan, Illinois: Economics, History- Business, Finance Club 4: Economics Club 4: RA 4: Dixon Volunteers 3: Intramttrals 1, 2. THEODORE GLOWIAK, Homewood, Illinois: Marketing, Prairie State College, AMA. JERRY GODDARD, Moline, Illinois: Accounting, Black Hawk Col- lege, SAS. PAMELA GODLEY, Naperville, Illinois: Secretarial Administration, History. CAROLYN GODMAN, Norridge, Illinois: Elementary Education, Biol- ogy, University of Illinois, Clzi Omega 3, 4: SEA 3, 4. JAMES GODMAN, Melrose Park, Illinois: Marketing, Loyola Univer- sity, Sigma Pi 3, 4, rush comtnittee 3: Intramurals 1, 2, 3, 4, AMA 1, 3, 4. RICHARD GOFF, DeKalb, Illinois: Marketing,' AMA 2, 3, 4: SAM 2, 3, 4, pres. 4, prospectus editor 3: Delta Sigma Pi. SHERRY JOY GOLD, Chicago, Illinois: Speech, Political Science, Uni- versity Women's Chorus 2, 3, 4: Floor Office 2, 3. FRANCINE GOLDBERG, Skokie, Illinois: Elementary Education, English. MARILYN G. GOLDENBERG, Rockford, Illinois: Elementary Educa- tion, Home Economics, Bradley University, SEA 4. MARK GOLDMAN, Chicago, Illinois: Biology, Chemistry, University of Illinois Clticago Circle, Intramurals. ROBERTA GOLDMAN, Chicago, Illinois: English History, NCTE. JOSEPH M. GOLDYN, Chicago, Illinois: Marketing: UCB Movie Cotn- mittee 3: Karate Club 1, 2, 3, 4, Dorm Council 3: AMA 3, 4. DIANE GOLNIK, Chicago, Illinois, Psychology, Sociology, University of Illinois. JUDITH GONSIOREK, Park Ridge, Illinois: Elementary Education, History, Marquette University. THOMAS C. GONSIOREK, Niles, Illinois: Marketing, Intramural Foot- ball 1, 2, 3, 4, Softball 1, 2, 3, 4, Volleyball 1, 2: Phi Signza Epsilon I, 2, 3, 4. PAT GONZALES, Sterling, Illinois: Spanish, Business Administration, Sigma Delta Pi, pres. 3, 4: Echoes 3. 376 VINCENT GONZALEZ, Chicago, Illinois: History: Wright Junior Col- lege: Collegiate International: Student Faculty Committee: Circle KS DIANA GOODMAN, Stillman Valley, Illinois.' Elementary Education,' Rockford College: Rock Valley Junior College: Outdoor Club 2, 3: UCB 3: RA 4. MICHALE GOODMAN, Park Forest, Illinois: History, English: Phi- losophy Club, sec. 1: Undergraduate History Advisory Committee 4: Phi Alpha Theta. SUSAN GOODMAN, Midlothian, Illinois: English. BARRY GOODRICH, Chicago, Illinois: History, Geography: Wright Junior College: Hillel 3, 4: Intramural Football 3, 4, Baseball 3, 4. DALE GOODRICH, Park Ridge, Illinois: Elementary Education, Mathe- matics, Science: Niaids Swim Club I, 2: Outdoors Club lg Douglas Hall Council 2: Douglas Hall Food Service l, 2, 3, 4, supervisor 4. STEPHEN GOOLD, Streamwood, Illinois: Mathematics, Sociology: Lin- coln Hall Council 4. JOHN GORECKI, Chicago, Illinois: Management: SAM 2, 3, 4: Intra- murals l, 2. DANIEL GORMAN, Naperville, Illinois: Philosophy: St. Louis Uni- versity: Nortlz Central College. EUGENIA GOROWSKI, Mount Prospect, Illinois: Matltematics, His- tory: AWS rep: West Neptune Hall Council, vice pres.: RA: Tutor, Pro- bation Officer 3: Student Assistant Mathematics Department, Computer Services. KENNETH GORSKI, Sycamore, Illinois: Management: Freeport Col- legee Community: Elgin Community College: SAM. KATHLEEN GOSCINSKI, Mount Prospect, Illinois: Elementary Edu- cation, Sociology: Chi Sigma Phi 2, 3, sec. 3: Delta Gamma 4, sec. 4: Sigma Pi Sweetheart: Campus Crusade for Christ. SHARON GOSS, Woodridge, Illinois: Physical Education, Dance: Delta Psi Kappa: Major Minor Club: Orchesis: AHPER, Women's Extramural Basketball: 1970 Senior Class Project Planning Committee. JOHN GOYACK, Bellwood, Illinois: Marketing: Wriglzt Junior College: AMA,' Vet's Club. LINDA GRAMS, Rock Island, Illinois: History, Political Science. LORNA GRANZOW, Roscoe, Illinois: Elementary Education: Illinois State University: Kappa Delta Pi 4. SUSAN GRASSER, Woodstock, Illinois: Medical Technology: Outdoor Club lg Medical Technology Club 1, 2, 3, 4. PAULA GRAVELLE, Homewood, Illinois: Management,' Chi Omega 2, 3, 4, vice pres. 3: Dorm Council 1: Winter Carnival Committee 2, 3, 4, co-chrmn. 3: Phi Beta Lambda 2. ELLA GRAY, Chicago, Illinois: English, History: Alpha Kappa Alpha 2, 3, 4, rush chrmn. 3, pres. 4: AACO. ELLEN GRAY, Hanover, Illinois: History, Library Science: Student Marshall 3. STEVE GREENWALD, Skokie, Illinois: Journalism, History, Hills- dale College: Student Committee for Peace 3: Student Mobilization Committee 4: Northern Star 4: JSA 3: United Mutations 3, 4: Tri Swine Omega 4: College Avenue Liberation Front 4. JANE GREGORIN, Waukegan, Illinois: Business Education: Phi Beta Lambda 2: Cwens 2: Echoes, sec. 3: Pi Omega Pi 3, 4: NBEA: IBEA: AYA: IVA 4: RA 2, 3. HENRY GREGORY, DeKalb, Illinois: English, Philosophy: Elgin Com- munity College. LAWRENCE GREGORY, Morton Grove, Illinois: Biological Sciences, Chemistry. PHYLLIS GREGORY, Oak Lawn, Illinois: Political Science, History, Economics: Alpha Delta Pi, social chrmn., scholarship clzrm. SUSAN GREGORY, Skokie, Illinois: Elementary Education, Art, Speech: Dorm Committee. DENNIS GREGIER, Freeport, Illinois: Mathematics, Political Science: Highland Community College. MARIJEAN GRENNAN, Nortlzbrook, Illinois: Elementary Education: SEA 3, 4: Chorus 2, 3. WILLIAM G. GRICE, Des Plaines, Illinois: History, English: Backdoor l, 2, 3, director 2, 3: UCB Social Committee 3, 4: Guitar Instructor UCB: 352 Club, pres. 4. TERRY GRIDER, Harvey, Illinois: Biology, Chemistry: Tlzornton Jun- ior College: Dorm Council: BGIO. PATRICIA GRIFFIN, Rockford, Illinois: History, Sociology: Marquette University: SEA ,' UCB Usher Corps. LESLIE GRIFFITH, Mount Prospect, Illinois: Special Education, Vis- ually Handicapped: SEA 3, 4: Dorm rep. 2. 377 STANA GRIM, Morton Grove, Illinois: Spanish, Sociology: Alpha Xi Delta 2, 3, 4. NORMAN GROSS, Evanston, Illinois: Geography, Sociology: Pl1i Kappa Sigma 3, 4: Delta 4: Gamma Theta Upsilon 4. MARILYN GRUMMEL, Hillside, Illinois: Physical Education: Echoes 3: Pleiades 4: Delta Psi Kappa 3, 4: Major Minor 3, 4: Alpha Omicron Pi 2, 3, 4. KARL-HEINZ L. GRUNS, Justice, Illinois: Accounting, Mathematics,' Delta Sigma Pi 3, 4, treas. 3: AMA 2, 3, 4: SAS 2, 3, 4: Mathematics Club 2, 3, 4, treas. 3: AMA Computer Games Committee 3, 4: Account- ing Internship Program 4: Soccer 1, 2, 3: Intramurals l, 2, 3, 4. LYNN GRUPE, Elgin, Illinois: Elementary Education, French: Alpha Sigma Alpha 1, 2, 3, 4, social chrmn. 3, 4, Homecoming cltrmn. 3: Uni- versity Chorus I, 2, 3: Kappa Delta Pi 3, 4: Delta Upsilon Little Sister 4. CANDY GRYZIK, Elmwood Park, Illinois: Special Education, Physi- cally Handicapped Sigma Kappa l, 2, 3, 4: CEC 3, 4: May Fete elections chrm. 3: Pom Pon 2: Dorm rep. I: Little Sister of Minerva 2, 3, 4: Kish- waukee Polar Bear Marching League. RONALD GAUGLIARDO, Rockford, Illinois: Mathematics: Golf team l: Matlzematics Club. PAUL LOUIS GUALDONI, Joliet, Illinois: History, English: Joliet Junior College: Theta Chi 3, 4. FRANK GUARINO, Rockford, Illinois: Elementary Education: High- land Community College. KATHLEEN GUENTHER, Palatine, Illinois: Elementary Education. BLOSE GULLO, Rockford, Illinois: Management: Rock Valley Junior College. WILLIAM J. GUNDERSON, Chicago, Illinois: Marketing: Wilson Jun- ior College. RANDALL L. GUNTHER, Palos Heights, Illinois: Art: Western New Mexico University: University of New Mexico: Mountain Climbing Club: Chess Club. KENNETH GUSTAFSON, St. Charles, Illinois: Marketing: Tau Delta Epsilon 2, 3, 4, treas. 4: AMA l, 2, 3: PRSSA: Public Relations Com- mittee Student Government: Intramural Football, Baseball, Basketball I-4: co-chrmn. Winter Carnival Committee 3, 4: co-clzrmn. Winter Car- nival Committee 3, 4: co-clzrmn. Winter Carnival Snow Games. BARBARA GUTH, Chicago, Illinois: History, Sociology: Bogan Junior College: Chi Omega, activities chrmn.: Midway chrmn., Winter Carnival: Lincoln Hall Floor treas. SHELDON HAAG, West Chicago, Illinois: Management: Wisconsin State University. CANDACE JOY HAALAND, Chicago, Illinois: Education, Sociology: University of Illinois Circle: UCB Recreation Committee 3: Movie Com- mittee 4: NEA: IEA: SEA 4. ARLAN HAASE, Hinsdale, Illinois: Special Education: CEC. MARGE HABAS, East Hazel Crest, Illinois: English, Library Science, Catacombs 1, 2: English Club 3, 4: Dorm Council treas. 3. JOYCE HABERKORN, Sheldon, Illinois: Elementary Education, Eng- lish: Dorm Council rep.: SEA 3, 4. ROBERT HABES, Berwyn, Illinois: Political Science, Physical Educa- tion: Delta Upsilon l, 2, 3, 4: Track l, 2. PETER G. HADLEY, Western Springs, Illinois: Speech-Theatre, His- tory: College of DuPage: Plays 3, 4: National Collegiate Players 4. KERN HAGG, Arlington Heights, Illinois: Marketing: University of Colorado: AMA 4: Intramural basketball l, 2, 3. PETER HAHTO, Chicago Heights, Illinois: Finance: Wayne State Col- lege: Prairie State College: Baseball I: Football l: SAM: Intramurals. RICHARD HAILSTONE, Bourbonnais, Illinois: Chemistry, Mathematics. KARIN HALE, Dixon, Illinois: English, History: Sigma Tau Delta 3, 4: Towers 3, 4: Pi Lamba Theta 3, 4: YR 3, 4: Italian Club 3, Homecoming Committee 4, asst. chrmn. of publicity. SUSAN E. HALEY, Joliet, Illinois: Political Science, History: Joliet Junior College,' Midwest Model United Nations 3: Homecoming Com- mittee 3: Outdoor Club 4: Flying Huskies 4, floor pres. 3. MICHAEL HALLORAN, Chicago, Illinois: Management: Delta Sigma Pi 3, 4, vice pres. 4: SAM 3, 4: Intramurals I. 2, 3, 4: Phi Eta Sigma 1: Cavaliers 4. DORIS HALVORSEN, Harwood Heights, Illinois: Physical Education, Sociology: Delta Zeta rush chrmn., spirit chrmn.: Delta Psi Kappa: Major Minor Club: 0rchesis,' WRA rep.: May Fete Committee. SHARON HAMANN, Peoria, Illinois: Nursing:Alpha Omicron Pi:SNO. BRUCE HAMILTON, Oak Park, Illinois: Mathematics, Physics: Ripon College: Mathematics Club 3, 4: Physics Club 4, RAYMOND L. HAMMAR, South Holland, Illinois: Management: Thornton Junior College,' SAM 4: Karate Club 4. 378 HAROLD HAMMERICH, La Salle, Illinois: Industry and Technol- ogy,' Football 1, 2, 3,' FIO. KATHY HAMMETT, DeKalb, Illinois: Business Education, Univer- sity of Wisconsin. JAMES HANNA, Villa Park, Illinois: Marketing, Economics: Intramur- als l, 25 AMA 3, 4. JAMES HANNA, Peoria, Illinois: Marketing, Journalism, NISCC 11 Douglas Hall vice pres. 4: AMA 4: Intramurals 3, 4. LAURA HANSEN, Barrington, Illinois: Art Education, NAEA 4. ROBERT HANSEN, St. Charles, Illinois: Zoology, Chemistry. JANET HANSON, Bellwood, Illinois: Elementary Education, English- Speechg SEA 2, 3. LINDA HANSON, Streator, Illinois: Elementary Education, Sociology: NEA 3, 4. RAY E. HANSON, Maple Park, Illinois: Industry and Technology, In- dustrial Personnel .Supervisiong Epsilon Pi Tau 2, 3, 4, sec. 3, vice pres. 4. ROBIN HARACZ, Chicago, Illinois: French, Sociology: Northwestern University: AWS, rep.,' French Club 3, 4. HELEN HARBUZIUK, Elmhurst, Illinois: French, Psychology. RALPH HARDESTY, Hammond, Indiana: Political Science, History, Augustana College: Indiana Universityg Theta Chi 2, 3, 43 Football 2. WITH DRAWALS PASS FAIL 'f-WI N DOW S -4 SELECTIVE SERVICE T RANSCRIPT REQUESTS GRADUATION APPLICATIONS TEACHER CERTIFICATION OVERLOAD PERMITS NAME CHANGE . After four long years I still haven't figured it all out. READMISSION CUNDERGRADSJ CURRENT ENROLLMENT FORM COURSE TRANSFER REQUESTS 379 ow is the time The stage is set, the curtain opens, it's time to go on MARY HARDIMAN, Chicago, Illinois: Elementary Education, Humani- ties: Clarke College. ELIZABETH GRAY HARSIN, Deerfield, Illinois: History: Mount Mary College. DAVID HARING, Elburn, Illinois: Mathematics, Chemistry: Bethel College: UCB 3, 4: IUCF 2, 3, 4. JOSEPH HAROLD, Chicago, Illinois: Accounting: Loop Junior College: SAS 3, 4: Intramurals 1, 2, 3, 4: Student Government 1, 2. JOHN HARRENSTEIN, Forreston, Illinois: History, Geography: Higlz- land Community College: Loras College: Gamma Theta Upsilon. DALE HARRINGTON, Genesco, Illinois: Hisfory, Psychology: Black Hawk College. JAMES HARRINGTON, Skokie, Illinois: Physical Education, Driver Education: University of South Carolina: Swimming 1, 2, 3: Delta Upsi- lon 2, 3, 4, sec. 3. JANE MARIE HARRIS, Wauconda, Illinois: Medical Technology: Echoes 3: Mu Tau Chi 2, 3: Ski Club 2. JEAN ELLEN HARRIS, Skokie, Illinois: Nursing: SNO 1, 2, 3, 4: Hall Council 2: Echoes 3: RA 3. JANICE KAY HARRISON, Tinley Park, Illinois: Elementary Educa- tion: Alpha Phi 2, 3, 4, asst. rush chrmn. 4: Northern Star 2. RONALD HARRISON, Moline, Illinois: Marketing: University of Illi- nois: Black Hawk Junior College: Intramural Football 3: AMA Basket- ball 3, 4, Softball 3, 4. SUSAN EILEEN MILLER HARRISON, Glenview, Illinois: Elementary Education, Sociology: Loyola University: Roosevelt University: Hillel. PAT HART, Oak Lawn, Illinois: Special Education: St. Xavier College: Delta Zeta 2, 3, 4, historian 4: Little Sister of Theta Chi 3, 4: CEC 4. RICHARD HART, Deerfield, Illinois: Marketing: Hillel Counselorship 1, 2, 3, 4, pres. 2: AMA 1, 2, 3, 4: PRSSA 4. RUTH HART, Lee, Illinois: Business Education: Pi Omega Pi 3, 4, vice pres. 4. CAROLE HARTEL, Hinsdale, Illinois: Elementary Education, History: Western Illinois University. MARY HARTIGAN, Palatine, Illinois: Accounting: Alverno College: Pleiades 4, sec. SAS 3, 4: Accountancy Student Advisory Board 3, 4: 1970 Senior Class Project Planning Committee. CAROLYN HASELTON, Rockford, Illinois: Nursing: SNO 1, 2, 3, 4: Chi Delta Chi 1, 2, 3, 2nd vice pres., treas. 3: Alpha Chi Omega 4, rec'd sec. 4: University Chorus 3: Pom Pon Squad 4: 1970 Senior Class Project Planning Committee, LINDA HASEMAN, Des Plaines, Illinois: Art Education. JEAN HAUFE, Skokie, Illinois: Special Education, Deaf Education: Pleiades: Gamma Alpha Mu 1, 2, 3: NEA 2, 3, 4: UCB 4. WILLIAM HAUSER, Hinsdale, Illinois: Spanish: Spanish Club 1, 2, 3, 4: Farwell Halls pres. 4: Intramurals 1, 2, 3, 4. MARY PAT HAUSMAN, Skokie, Illinois: Elementary Education. RONALD HAVELKA, Downers Grove, Illinois: Marketing: SAS 1, 2, AMA 3, 4: Intramurals 1, 2, 3, 4. CAROLYN HAY, Mundelein, Illinois: Elenzentary Education, Sociol- ogy: Sigma Kappa. PRISCILLA HAYES, Maywood, Illinois: Elementary Education, Busi- ness: Alpha Sigma Alpha 2, 3, 4, standards chrmn. 2, 3, pres. 3, 4: Sig- ma Pi Sweetheart 3, 4. JOHN HAYNA, Chicago, Illinois: History, English: University of Illi- nois: Kendall College: Intramurals 3. THOMAS HAZARD, Chicago, Illinois: Management: Phi Kappa Sigma 1, 2, 3, 4: AIVIA 2: SAM 3: Greek Week Election Committee 2, Intra- murals 1, 2, 3, 4. DALE TERRY HEDBERG, Prospect Heights, Illinois: Nursing: Uni- versity of Hawaii: University of Illinois: University of Maryland: Austin Peay State College,' Vet's Club 4. 380 JOHN HEDGES, Robinson, Illinois: Finance: Baseball 1, 2: Intramurals Education: Trinity College: Clzorus 4, PATRICIA HEDSTROM, Higlzland Park, Illinois: Home Economics l, 2, 3, 4: Finance Club 3, 4: SAM 2, 3:Dorn1 Council l, 2, NANCY I-IEFFERNAN, Clticago Ridge, Illinois: Medical Technology: Medical Technology Club. LILA I-IEFTMAN, Skokie, Illinois: Elementary Education, Speech: Sig- ma Delta Tau 2, 3, 4, pres. 3, 4: Mixed Bowling League 3. ROBERT HEIDER, Clticago, Illinois: Accountancy: Chicago State Col- I6IgA,R2lfi'SgRET HEINISCH, DeKalb, Illinois: Elementary Education, ROSE HEINRICH, Danville, Illinois: Elementary Education: Humanities: Danville Junior College: Chi Omega 3, 4: Plzi Rho Pi 1, 2: T.iAV4ONNE I-IEINTZ, Oak Lawn, Illinois: History: Concordia College. SANDRA HEINZEROTH, Dixon, Illinois: Elementary Education: Sauk Valley Junior College. DAVID HEMMINGER, Dixon, Illinois: Mathematics, Chemistry: Sauk Valley Junior College: Mathematics Club 3, 4: Marching Band 2, 3, 4: Varsity Band 2: Concert Band 3, 4: Plzi Tlzeta Kappa. JUDITH HEMPEL, Chicago, Illinois: Elementary Education, Mathe- matics, Science: Sigma Kappa 2, 3, 4: SEA 4: NEA 4. LINDA HENDERSEN, Lombard, Illinois: Medical Technology: Band I, 2, 3: Echoes 3: Mu Tau Chi 1, 2, 3, treas. 3. MARK K. HENDRICKS, Moline, Illinois: Physical Therapy, North- western Medical School: Alplza Omicron Pi 2, 3, 4: scholastic chrmn, 3: Cwens: Echoes: Winter Carnival Committee 3. LINDA HENDRICKSEN, Wheaton, Illinois: Spanish, Political Science: Spanish Club 1, 2: May Fete Committee 3. MICHAEL FRANK I-IENN, Indianapolis, Indiana: Finance: Butler Uni- versity: Phi Delta Psi 2, 3, 4, vice pres. 3. JOSEPH HENNEN, Brookfield, Illinois: Management: Morton College: SAM 3. LAUREN R. I-IENRICH, Dolton, Illinois: Biology: Evanston Hospital School of Nursing: University Chorus 1, 2, 3, 4: University Chorus 1: Folk Music Club 2: Mixed Bowling League 1, 2, 3, 4: Northern Star 1, 2: Corridor Oyicer 2: UCB 4. ROBERT HENRY JR., Aurora, Illinois: Marketing: AMA. RO JEAN HEPNER, Aurora, Illinois: Elementary Education, Social Sciences: Hall Council rep. 3, cor. sec. 4: University Chorus 2. BARBARA I-IERBST, Steger, Illinois: Secondary Professional Educa- tion: Prairie State College: National Council of Teachers of English. MARGUERITE HERNANDEZ, Ontarioville, Illinois: Elementary Edu- cation, English-Speech: Elgin Community College: Kappa Delta Pi. JAMES HERSMA, Dolton, Illinois: Marketing, Distributive Education: Western Illinois University: SAE 2, 3, 4. PAMELA TERESE HESLER, Elmhurst, Illinois: Elementary Education. ZUFAN HESS, Deerfield, Illinois: History, Sociology: Brenau College: e ta Zeta 1. JOHN HEUBERGER, Chicago, Illinois: Accounting: SAS 1, 2, 3, 4. ROBERT HEYER, Waterman, Illinois: Chemistry, Mathematics: Sigma Zeta 3, 4: Ganzma Delta 3, 4. SANDRA HIBBARD, Waukegan, Illinois: Sociology: PhiBeta Lambda 2. SUSAN HICKS, Chicago, Illinois: History, Political Science: Delta Zeta 1, 2, 3, 4, sec. 3, vice pres. 4: 1969 Homecoming Committee, sec: 1970 Senior Class Project Planning Committee. ROGER A. HIEBER, Chicago, Illinois: Industrial Education: Wright Junior College: Iota Tau: Intramural Football: Dorm Scholarship Com- mittee, dorm decorations. RICHARD HIERA, Chicago, Illinois: Marketing: Phi Eta Sigma: Dorm Council: Intramurals I, 2, 3. MARIANN HILDEBRAND, Kankakee, Illinois: History, Political Sci- ence: Loyola University: Alplza Sigma Alplza 2, 3, 4: Dorm Council. JAN HILGOE, Plainfield, Illinois: Elementary Education, Sociology: Kappa Delta Pi 3, 4, vice pres. 4: SEA 3, 4: Dixon Volunteers 3. 381 EILEEN HILL, Elgin, Illinois: Marketing: AMA 3, 4. THOMAS HILL, East Moline, Illinois: Accounting: Loras College: SA: SAS: Finance Club: Intramurals. RICHARD HILLIARD, Clzicago, Illinois: Management: Wilson Junior College, Bogan Jr. College: SAM: AMA 1. DAVID HINTZ, Brookfield, Illinois: History, Political Science: RA. BRUCE HIRSCH, Evanston, Illinois: Sociology, Psychology. KATHLEEN A. HOBART, Berwyn, Illinois: Business Education: .Mor- ton Junior College: Newman Club 3, 4: SEA 3, 4: NBEA 4. MARGARET HOCKEY, Naperville, Illinois: English, Sociology: UCB 3, 4: A WS 2. CAROLINE HOECKER, Chicago Heights, Illinois: English, Latin. STEPHEN HOEHNE, Peoria, Illinois: Management: Robert Morris Jun- ior College. WILLIAM HOFFER, Aurora, Illinois: Accountancy, Business Adminis- tration: Southern Illinois University: Intramurals 3, 4. DONALD HOFMEISTER, Franklin Park, Illinois: Marketing: Physical Education: University of Idaho: Wright Junior College: AMA 3, 4: Vetls Club 4. NANCY HOHMANN, Skokie, Illinois: Elementary Education, Mathe- maticj: Alpha Sigma Alpha 1, 2, 3, 4: Chorus 2: Daughter of Crossed Swor 3, 4. VIRGINIA HOLAK, Leyden Township, Illinois: Home Economics: Home Economics Club: American Home Economics Association: New- man: SEA. BARBARA HOLDER, Malta, Illinois: Elementary Education, Sociology. BARBARA HOLECEK, Cicero, Illinois: Physical Education: Morton College: WRA, publicity chrmn. 4: Gymnastics 2, 3: Softball 2, 3. CHARLES HOLINKA, Aurora, Illinois: Management: Alplza Kappa Lambda: AIESEC: SAM: Management Advisory Board. KENNETH HOLLAND, Chicago, Illinois: Industry and Teclznology: Phi Sigma Epsilon 1, 2, 3, 4, rec'd sec. 2, 3: Iota Tau 3, 4: sec., treas. 3, 4, Intramurals 1, 2, 3: Norther 2, 3, 4, ass't business manager 2, business manager 3, 4. NANCY HOLM, Rockford, Illinois: Sociology: Rock Valley College: YR 1. REBECCA HOLMES, Kewanee, Illinois: History, Anthropology: Phi Alpha Theta 3, 4: UD 3: Students for Kennedy 2. KATHY HOLTAM, Naperville, Illinois: University of Northern Iowa: Alpha Delta Pi: Pi Tau Phi. JOAN MARIE HOLZBACK, Glen Ellyn, Illinois: Home Economics Education: Alpha Sigma Alpha 1, 2, 3, 4: Home Economics Club 2. RONALD HONICK, Norfolk, Virginia: Industry and Technology: Old Dominion College: IEEE. ARDEN HONIG, Chicago, Illinois: English, Art: Sigma Delta Tau 1, 2, historian 3, Standards Board 4: Teacher Evaluation Committee 3: Floor art chrmn. ROBIN HOOGSTRA, Oak Park, Illinois: Sociology, Home Economics: Illinois State University: Sigma Lambda Sigma 3. 4, lst vice pres. 4. TIMOTHY JAY HOOKER, Bradford, Illinois: Economics, Music: Phi Mu Alpha 2, 3, 4, House mgr. 2: Marching Huskies l, 2, 3: Varsity Band 1: Concert Band 2, 3: Deans of Swing 1, 2, 3, 4. MARY THERESE HOOVLER, Bellwood, Illinois: Speech-Theatre, Art: Orchesis 1: University Theatre 2, 3, 4: Sigma Lambda Sigma 1, 2, 3, 4. GREGORY HOPTON, Marseilles, Illinois: Elementary Education, Bi- ologyi SEA 3, 4: Wildlife Society 4. GALE HORN, Forest Park, Illinois: Speech-Theatre, English: RA 2, 3: Play Crews 1. 2, 3. 4. JANET HORNER, South Holland, Illinois: Elementary Education: Thornton Junior College: Alpha Phi: SA Election Commission: NEA. JOHN HORWATH, Joliet, Illinois: History, Sociology: Interamericana University: Sigma Pi 2, 3, 4: Intramurals 1, 2, 3, 4. MARTIN E. HOSKINS, Oak Lawn, Illinois: Speech, Math: Phi Kappa Sigma 2, 3, 4, pledge trainer 3: Newman Club 1, 2, 3, 4 sec. 2: RA 2: Football: Intramurals I, 2, 3. LORETTA HOUGH, Homewood, Illinois: Administrative Secretarial. 382 Transition from the end of one phase of life to the beginning of another. ROBIN HOUNDT, Morton Grove, Illinois: Psychology: UD 1, 2, sec. 2: Kipp 2: Physical Therapy Organization 3: RA 3, 4. ROBERT HOUSTON, Bellwood, Illinois: Mathematics, Physics: Track 1: Delta Upsilon 2, 3, 4, vice pres. 3. pres. 4: Phi Eta Sigma: Omicron Delta Kappa: IFC. KATHLEEN HUBER, East Moline, Illinois: Elementary Education, Sociology, SEA 2, 4. ROBERT HUETTEMANN, La Salle, Illinois: Industry and Technology: Illinois Valley Community College: NIU Sport Parachute Club 3, 4, treas.: Epsilon Pi Tau 4. JANE HUGES, East Moline, Illinois: Physical Education: Sigma Kappa I, 2, 3, 4, cor. sec. 2: Delta Psi Kappa 2, 3, 4: Cheerleader 2, 3, 4, co- captain 3, captain 4: 1968 Runner-Up Miss Cheerleader USAF ROBERT HUGES, Naperville, Illinois: Economics, Political Science: Robert Morris College: Economics Club. ROBERT G. HUGHES, Hoffman Estates, Illinois: Music: Plzi Mu Alpha 2, 3, 4: Music Educators National Conference 3: Student Advisory Com- mitteeg Code Committee, Music Department. SUSAN HUGHETT, Chicago, Illinois: English: University of Illinois Circle. SUSAN HUHTA, DeKalb, Illinois: Music: Kendall Junior College: Memphis State University: Concert Band 1, 2, 3, 4: University Orchestra 1, 2, 3, 4: Brass Ensemble 1, 2, 3: Woodwind Quintet, 2, 3, 4: MENC 3, 4. CATHERINE HULSBRINK, Milan, Illinois: Art,' Black Hawk Junior College: SEA: Winter Carnival Committee 3, 4. GAIL HUMMEL, Lombard, Illinois: Home Economics, Art: Alpha Del- ta Pi 1, 2, 3, 4, pres. 3, social chrmn. 4: SA Election Commission 2, 3. PAUL HUMMEL, Des Plaines, Illinois: Speech-Theatre, Mathematics,- Carthage College: Alpha Phi Omega 2, 3, 4: Alpha Psi Omega 1, 2, 3, 4: UCB 3, 4, Technical Director 3, 4: Concert Choir 1, 2. MICHAEL HURSEY, Palos Hills, Illinois: Geology, Mathematics: Geol- ogy Club, Ski Club. ALICE KAY HUTCHISON, Western Springs, Illinois: Elementary Edu- cation: DePauw University: UCB 2, 3, 4: NEA 3, 4: Chi Omega 3, rec. sec. 4. SANDRA HYMAN, Oak Park, Illinois: Special Education: Wayne State University: Norther 1: UCB 2, 3, 4: CEC 2, 3, 4: State rep. 3, 4. JERRY IGNATIUS, Melrose Park, Illinois: Managementg SAM: Dorm Council 2: Intramurals 1, 2, 3, 4. BARBARA INGEBRETSEN, Homewood, Illinois: Clothing and Tex- tiles, Business: Pom Pon Squad 2, 3. GUY INMAN, Waukegan, Illinois: Mathematics, Chemistry. MARY ELENA IODICE, Mount Prospect, Illinois: Elementary Educa- tion: AWS 2, 3, social chrmn: Chi Delta Chi 2, 3, 4: Pi Lambda Theta 3, 4. BARBARA IRVINE, Forest Park, Illinois: Elementary Education, Psy- chology,' Kappa Delta Pi 3, 4: Culture and Scholarship Floor chrmn 3, 4. KERRI ISAAC, Chicago, Illinois: Elementary Education: SEA 2, 3, 4. RANDALL IVERSON, Chicago, Illinois: Mathematics, Physics: UD 3, 4: Physics Students Committee 4. ALAN IVES, Chesapeake, Virginia: Industry and T echnologyj Old Do- minion College: Institute of Electrical and Electronics Engineering. JUDITH IZBICKY, Lincolnwood, Illinois: Elementary Education. SEKIZIDI JACKSON, Mount Prospect, Illinois: Philosophy: Philosophy u . RICHARD JACKSON, Batavia, Illinois: Political Science, Geography, scholarship chrmn. 2: Gamma Delta 1, 2, vice pres. 2: Outdoor Club 2, 3, 4, treas. 3: IVCF 2, 3, 4: Economics Club 2. MARIA JACOBS, Niles, Illinois: History, Political Science. THOMAS JACOBS, Elgin, Illinois: Meteorology, History, Elgin Com- nunity College. 383 Places to go, things to do, people to inzpress . . E' the world of tl1e graduate. DONALD JACOBSEN, Momence, Illinois: Accounting: Alpha Kappa Lambda: SA S. JANIS JACOBSEN, Oak Lawn, Illinois: Elementary Education: Alpha Omicron Pi l, 2, 3, 4: Winter Carnival Committee 3: SEA 3, 4: UCB l, 2. JO ANN JACOBSON, DeKalb, Illinois: Elementary Education: SEA. ELLEN JAEDTKE, Homewood, Illinois: French, Sociology: Alpha Omicron Pi 2, 3, 4. JANICE JAKUBKA, Westchester, Illinois: Elementary Education: SEA 3, 4: SA Housing Committee: 1970 Senior Class Project Planning Com- mittee. JOHN JAMES, DeKalb, Illinois: English: Johns Hopkins University: AXE,' English Student Advisory Committee, chrmn,' United Mutations. SHARON JANOCHA, Waukegan, Illinois: Elementary Education: SEA 3, 4: Newman Club l, 2, 3, 4. RAYE JANOUSEK, Cicero, Illinois: Economics, Political Science: Mon- ton College: Spanish Club: Economics Club. MERLE JANOWITZ, Chicago, Illinois: Elementary Education, Art,' SAS. ROBERTA JANSEN, Chicago, Illinois: Elementary Education, Spanish: University of Americas: Newman 1, 2, 4: Cwens 2: Foreign Exchange Student Scholarship 3: UCB 4. DANIEL JANYJA, Mundelein, Illinois: Marketing: NIU SCC I, 2: AMA 2, 3, 4: Intramurals 1. SUSAN JARVIE, Westchester, Illinois: Elementary Education: Triton Junior College: Sigma Kappa: Ski Club. ' MAUREEN JASKIER, Des Plaines, Illinois: Elementary Education, Math: SEA 2, 3, 4: Outdoor Club: Dean's List. GEORGE JAUCH, Troy Grove, Illinois: Finance: Illinois Valley Com- munity College: Finance Club 3. JO ANN JEFFREY, Freeport, Illinois: Special Education EMH,' Higlz- land Community College: CEC 4: NEA 3, 4. LUISE JEFFREY, Aurora, Illinois: Theatre. 384 ilu-16434 -.,3u,,Q. 5 Graduation - when experience picks up Where formal education left off LORETTA JELINEK, Berwyn, Illinois: History, Business Education, Orchesisg Alpha Xi Delta 2, 3, 4, house manager 3, corres. sec. 3. JEFF JENNETT, Deerfield, Illinois: Political Science, French: Phi Eta Sigma, treas. 2: Pi Sigma Alpha 4. ROBERT JENNINGS, Niles, Illinois: Management, Accounting: Roose- velt University: Theta Delta Psi,' Student Alumni Association: SAS: SAM. ANNE JOFFE, Chicago, Illinois: Special Education: Hillel 4: CEC 3, 4: AEVH 3, 4. TERRI JOHANNSEN, Lombard, Illinois: Home Economics: Clzi Omega 2, 3, 4, vice-pres. 3: Greek Week Committee 3: Winter Carnival Com- mittee 2: Homecoming Committee 3: Home Economics Club 2, 3, 4. SHARON JOHANSSON, Chicago, Illinois: Elementary Education, Art,' Chi Sigma Phi 1, 2, 3: Delta Gamma 4: Kappa Delta Pi 3, 4. CAMILLE JOHNSON, Maple Park, Illinois: Elementary Education, Sociology,' Illinois Wesleyan University. CHERYL FRANCHI JOHNSON, Palos Park, Illinois: History, English: Sigma Sigma Sigma 2, 3, 4: RA 2: Relations Committee 3. CHRISTOPHER JOHNSON, Chicago, Illinois: Finance: Nlayfair Jun- ior College. CLAUDIA JOHNSON, Deerfield, Illinois: Elementary Education: West- mont College: Campus Crusader for Christ. DENNIS JOHNSON, Chicago, Illinois: Psychology, Biology: Biology Club, Newman Club. EVELYN JOHNSON, Arlington Heights, Illinois: Marketing: Dorm Council l,' Northern Star 4: RA 3. GERENE JOHNSON, Elgin, Illinois: Special Education EMH,' CEC l, 2, 3, 4: Sigma Lambda Sigma 2, 3, 4 rush chrmn. 3. JEROLD P. JOHNSON, East Moline, Illinois: Speech, Economies, Carthage College. JERRY JOHNSON, Crete Illinois: Marketing, Prairie State College: AMA 3, 4. KAREN JOHNSON, Blue Island, Illinois: Sociology, Anthropology: Valparaiso University,' Thornton Community College. KAREN JOHNSON, Joliet, Illinois: Special Education, Physically Han- dicapped: Joliet Junior College: CEC: Dixon volunteer. LINDA JOHNSON, Lee, Illinois: Elementary Education, Humanities: UCB Entertainment Comlnittee,' Women's Chorus,' University Chorus,' ACE: 1970 Senior Class Project Planning Committee. LINDA JOHNSON, Prospect, Illinois: Speech Correction, Psychology, Sigma Alpha Eta 2, 3, 4, vice-pres. 3, pres. 4. PAMELA JOHNSON, Clarendon Hills, Illinois: Special Education, EMH,' University of Kentucky, Dorm Advisory Council 1: CEC 3, 4, SEA 3, 4. SHARON JOHNSON, LaGrange, Illinois: Home Economics, Family Life and Child Development, English. CLAUDIA JONES, Peoria, Illinois: Nursing: Alpha Sigma Alpha: SNO. DONALD JONES, Summit, Illinois: Marketing: Intramurals. KATHY JONES, Skokie, Illinois: Elementary Education, Spanish, Kappa Delta l, 2, 3, 4: SEA 3, 4: Pom Pon Squad 2, 3, 4. SAUNDRA JONES, Chicago, Illinois: Accounting: UCB, Public Re- lations Committee 1,' Delta Chi Omega 2, 3, treas. 2, pres. 3: Delta Sigma Theta 4, financial sec. 4. MARSHA JOSEPH, Park Forest, Illinois: Mathematics, Psychology, Northern Star 2, 3: Intramurals l. MURAL JOSEPHSON, Chicago, Illinois: Accounting: University of Illinois, Circle: Zeta Beta Tau 2, 3, 4, pres., vice-pres., social chrmn,' Interfraternity Council 3: Sigma Iota Epsilon 3, 4: Intramurals 2, 3, 4, Accounting Internsltip 4. RONALD JURGOVAN, Berwyn, Illinois: Industry and Technology,- Morton Junior College: Monmouth College: Sigma Alpha Epsilon. 385 Today, anticipation ...to1norrow, realization. ff '3 was ,V , M xg A i gh Q, so 3:1565 LW Q ilyqpncn? 'M M4 qs. rs, , S lg' 'si:0,Q. 'li .1 V4.3 ,,.4l'hiz iw' 4, 0 6 1 Y ' 'W ' K 0 M qi 5T '1.g?z.5. 'Lv?,.'fv237P:5l':a' ta5f+-ff' J' , -1 ' fa,,'!g:',.Qmt5n' . V, W, in Nj .3-TFOLQQI1-fa' 2- f. ,Two ,',, C 3 -3'-v.iH '2 : . +4Ff 1?: 4. f'f7 '5if'5ar31f .'w 5f 34-' 42- t 2' 04- ,AJ ga, JV Q ,M ' arg. ina- yq mix:-f':'f., avian Zgjiitf ny, gd. ,,:t' 7-412.1 WZ:-'3. , 1-uf ua-2' 'g KY ' W- OW 1 ' m,,' at' it . Q. i .'...a,r. lvY '.,q.W W . ive 1' 'g 4 U, 5P.fa', if .. -4 ,, ' .M . 0 4 .Q.',Q.u,,q gn Q sf 5 'OI if 9 J! Q D .. .I stiints XE. 4.6 Q 5:0513 U, t M ' O 4 Q W::..5 2-U'1'? 4' '-'E ' 7 1rf.w' a 'i-. a. a 'f 1 , 1121, +164 ,oo if 4 9 ,'Qs. pro. 'f i o L, 0 v Q it 19' i an qw 'iw -fs -v' af' 1 .mi '. ' .,, 5 18' ,i , .V Wd gdvf fffzgvgzqii I' 3t,nm' i'ui ' i3? A fag. i' A Vi 34 ,. , ,A ,W - ' f 1. .wi is . .ff f- rf Q any , .di , YQ V 1, . ij. . M ,Q zfizf P, so ftigvav do . M, ggi t 'wa fm. if .-ass ' -M e : f at-'f xr' ' -'..'?'a ' 'Y' 'ova' 'f 18, Jaszfiar' '44 ext , 7 it -P '35 3' 1.5- ' ' ' 0 n'!'f-sa We t , Q W' A 'ZS' at .L . i :yi t . V' , A4 Q. If XD w ' - 'nm f fm if 5 in 5 mam f Q' . W haf av.' Qafft W SHARON JURS, DeKalb, Illinois: Elementary Education, University of Denver, NEA 3, 4, CEC 4. REX KABRICK, Plainyille, Illinois: Marketing, Northeast Missouri State College, AMA 3, 4. JUDY KADISON, Skokie, Illinois: Physical Education, Alpha Sigma Alpha 2, 3, 4, chaplain 4, PomPon Squad captain 2, 3, Orchesis 2, 3, 4, vice-pres. 3, May Fete 2, 3, 4, chrmn, Little Sisters of Minerva 2, 3, 4. GREGG KALATA, Glen Ellyn, Illinois: Marketing, Triton Junior Col- lege, AMA 3, 4. DIANE KALISZ, Chicago, Illinois: Secretarial Administration, Mc- Cormack Junior College. JUDITH KALLAS, Newark, Illinois: Elementary Education, SEA 2, 3. GERALD KALUZNY, Evanston, Illinois: Marketing, Mayfair Junior College, AMA 3, 4, Intramurals 2, 3, Economics Club 3. LINDA KAMBA, Berwyn, Illinois: Journalism, Sociology, Theta Sigma Phi 4, PRSSA 4, JSA 4, Review Board for Choice '68, 3, Leadership Development Committee I. 2. RICHARD KAMERLANDER, McHenry, Illinois: Psychology, Soci- ology, Intramurals I, 2, 3, 4, Alpha Phi Omega I, 2, Delta Tau Omega 2, 3, 4. JOANNA KAMIN, Brookfield, Illinois: Elementary Education, So- ciology and Anthropology, Alpha Xi Delta 2, 3, 4. asst. pledge trainer 31 pledge trainer, 4, SEA 3. 4, NEA. KATHY KAMRATH, Mount Prospect, Illinois: Elementary Educa- tion, Rockford College, SEA 2. 3, 4,' Kappa Delta Pi 4. JERRY EUGENE KANAK, Clarendon Hills, Illinois: Sociology, Morton College, University of Illinois-Chicago Circle, YR. BARRY KANNER, Clzicago, Illinois: Philosophy, History, Southeast Junior College, Intramurals, Football l,Softball 2: NIU Bowling League. DORIS KANTOLA, Waukegan, Illinois: Elementary Education, Sigma Lambda Sigma, SEA. NANCY KARALEVICZ, Oak Lawn, Illinois: History, English, Corridor pres. 2, Echoes 3, Newman Club I. 2, 3, 4. LINDA KARKOS, Berwyn, Illinois: Elementary Education, Morton Junior College,' NIU Orchestra 3, 4. RICHARD KARLIN, Elmwood Park, Illinois: Ifinance, University of Illinois, Sigma Phi Omega. ANNETTE LEA KASPER, Addison, Illinois: Speech, Political Science, UCB 1, 2, Debate Team 3. ELIZABETH KASPER, Park Ridge, Illinois: Social Science, History, UCB Public Relations Committee, Alpha Chi Omega 4: Gamma Alpha Mu I, 2, 3, University Usher and Tour Guide. WILLIAM KASS, Rock Falls, Illinois: Physics, THOMAS C. KAUFFMAN, Normal, Illinois: Accounting, YR 2, 3, 4. pres. 4, treas. 3: SAS I, 2, 3, 4. ROBERT KAVALUNAS, Chicago, Illinois: Elementary Education, Thornton Junior College. MARY K. KAVENEY, Joliet, Illinois: Medical Teclmology, Joliet Junior College, Mu Tau Chi, Sigma Zeta. HENRY KAWA, Chicago, Illinois: Sociology, Economics, Sigma Nu 3, 4. STEPHANIE KAY, Chicago, Illinois: Sociology, Psychology. MAUREEN KEEVAN, Round Lake, Illinois: Business Education, Pi Omega Pi 3, 4, sec. 4, NBEA, IBEA, AVA, IVA,' Sigma Alpha Pi 4. MARTIN KELLER, Bensenrille, Illinois: Political Science, Business Administration, Phi Epsilon Pi 2, 3, 4, social chrmn. 3, Gilbert Dorm Council I, YR I, NIU Homecoming Committee asst. parade chrmn. 4, Intramural Volleyball 3, 4. PETER KELLER, Chicago, Illinois: Finance, Econolnics, Finance Club vice-pres., Intramurals I, 2: Faculty Review Committee for Finance. R. GREGORY KELLER, Moline, Illinois: International Marketing, Political Science, Sigma Alpha Epsilon I, 2, 3, 4, AMA 3, 4, Varsity Tennis 2, Leadership Development Committee 3, 4, Rockford Youth Development 3, Intramurals I, 2, 3. DANIEL KELLY, Peoria, Illinois: History, Political Science, Canton Community College, Winter Carnival Committee 4. JAMES M. KELLY, Plainfield, Illinois: Psychology, History, Lewis University, Joliet Junior College, University Democrats, Psychology Club, 1970 Senior Class Project Planning Committee. WILLIAM KELLY, Morris, Illinois: Geography, School of Associated Arts, Joliet Junior College, Gamma Theta Upsilon 3. 4, pres. 4. 387 ship I. NIU: An atmosphere of learning quiet contcmplatnt studv in a cultural baclsgtounc PAMELA KELSO, Dolton, Illinois: Physical Education: Naiads, pres. 2: Student Director of Show 3: Major-Minor Club I, 2, 3, 4: WRA l, 2, 3, 4: Orchesis 3,' Swim Team I, 2: Inter-Varsity Christian Fellow- DALE KEMMERICK, Streator, Illinois: Meteorology, Sigma Zeta 4. MARIANNE KEMP, Chicago Heights, Illinoisg Home Economics, Alpha Delta Pi 1, 2 ,3, 4, sec. 3: Home Economics Club 2, 3. JAMES S. KENDRICK, Arlington Heights, Illinois: lndustry and Technology, Industrial Personnel Supervision, Drake University, Iota Tau 2, 3, 4: YR 2, 3: SAM 4. CAROL KENNEDY, Seneca, Illinois: Elementary Education, Speechg NEA, SEA. CATHERINE KENT, Libertyville, Illinois: Elementary Education: Dominican College: SEA 4: Newman Club 3, 4. LINDA KENYON. Chicago, Illinois: English, Journalism: Wright Junior College, JSA 2, 3: Norther 3, 4. NEIL G. KEPNER, DeKalb, Illinois: Accounting, Eastern Illinois University. GARY KERR, Kewanee, Illinois: Political Science, Economics, Cava- liers, pres. 4: Student Alumni Council I, 2, 3, 4, pres. 3: University Democrats I, 2, 3, 4, program chrmn. I, treas. 2, pres. 4: Pi Sigma Alpha 3, 4, treas. 4: Students for Kennedy 2, ehrmn 2: KIPP 2, chrmn. 2: Kennedy Action Co1'ps 3, pres. 3,' President Smith's Student Advisory Committee 3. FRANCES KERZICH, DeKalb, Illinois: Accotmtingg Sigma Lambda Sigma 2, 3, 4, 2nd vice-pres. 3: SAS 1, 2, 3, 4: Newman Club 1, 2, 3, 4. SUSAN KESSELL, Quincy, Illinois: Political Science, History: Sigma Delta Tau I, 2, 3, 4, treas. 2, rush clzrnzn. 3: Hillel 23 Winter Carnival Committee 4: Political Science Curriculum Committee 4. WILLIAM KESTED, Dixon, Illinois: History, Englislig Bradley Uni- versity. 388 0 longer being judged b the group, out being judged by individuals as an individual RONALD M. KEWDZIERSKI, Elmwood Park, Illinois: Physical Edu- cation, History: Wright Junior ColIege,' YR: Beta Phi Gamma, vice- pres.: Sigma Nu: NIU Soccer manager 2. RONALD G. KETTMAN, Streator, Illinois: Economics, Mathematics: Southern Illinois University. KENNETH KIELBAS, Chicago, Illinois: Marketing: Sigma Phi Epsi- lon. JANE KILEY, Atwood, Illinois: Nursing,' SNO. STEVEN KILGARD, Moline, Illinois: Finance: Alpha Kappa Lambda 2, 3, 4, treas. 3, pres. 4: Intramurals l, 2, 3, 4: Finance Club, vice- pres. 2: Scholarship Chairman of Dorm Floor 2: Presidents Council of IFC 4. MICHAEL KILLEN, Roselle, Illinois: Marketing: Elgin Community College: Delta Signza Pi 2, 3: AMA 3, 4: SAM 3: Student Advisory Council of Marketing Department 4. JOHN P. KILPATRICK, Hanover, Illinois: Social Science, History: Sigma Nu l, 2, 3, 4: Intramural Basketball 2, 3, 4: Intramural Volley- ball 3, 4. ADAM KING, DeKalb, Illinois: Home Economics Education: Home Economics Club l, 2: Outdoor Club 2. CAROL KING, Dixon, Illinois: Psychology, Sociology: University of Iowa: Psychology Undergraduate Advisory Committee. DAUNICE KING. Bensenville, Illinois: English, Math: Dorm News- paper, rep. l, social clzrmn 2: Alpha Chi Omega, parliamentarian 2, Zna' vice-pres. 3, alumni chrmn. 4. HOLLIS KING, Brookfield, Illinois: Home Economics, Business: Home Economics Club 1, 2, 3, 4. STEVEN M. KING, Itasca, Illinois: Finance: University of Illinois- Chicago Circle: Triton Junior College: SA 4. MARK KINGSBURY, Davenport, Iowa: Spanish: Black Hawk Junior College: International Culture Club. CAROL KINNIBURGH, Chicago, Illinois: Elementary Education, Psychology: Chi Sigma Phi 2. 3: Delta Gamma 4, vice-pres. 4: Kappa Delta Pi 3, 4: AWS: Intramural Volleyball. GARY KIPER, Dwight, Illinois: Accounting: Tau Lambda Chi 2, 3, 4: SAS 2, 3: AMA l, 2. TERRY L. KIRCH, Blue Island, Illinois: Marketing: University of Illinois: Thornton Junior College: Sigma Pi l, 2, 3, 4: AMA 4: Intra- mural Football I, 2: Volleyball 2. ROBERT KIRCHHERR, Evergreen Park, Illinois: Speech, Psychology: WNIU-FM production director 2, 3: stat? announcer, disc jockey. HAROLD KIRSHNER, Chicago, Illinois: History, Sociology: Dorm Council 2: Ski Club 2: Intramural Softball l, 2, 3: Handball 3: Illinois Youth Committee for Humphrey '68. LLOYD KISSICK, Rockford, Illinois: Accounting: Rock Valley Col- lege: Theater l, 2. PAMELA L. KLECKLER, Freeport, Illinois: Accounting: Freeport Community College. KAREN M. KLEIN, Elgin, Illinois: Sociology, Psychology: WRA I, 2, 3, 4, rec'd. sec. 3: Extramural Swim Team 1, 2, 3, 4, captain 2, 3. LINDA KLEINHANS, Cary, Illinois: Elementary Education, History: Alpha Delta Pi 2, 3, 4: May Fete Committee 2, 3: UCB Promotion Committee 3: Senior Class Project Planning Committee. EDWARD KLEMP, Worth, Illinois: Music Education: Phi Mu Alpha: Concert Choir: Chorus: Music Education,' National Conference: Opera Workshop. EDWARD KLEN, Joliet, Illinois: Chemistry, Math: Chemistry, Stu- dent Advisory Subcommittee 4. DENIS GEORGE KLEPAC, Cicero, Illinois: Accountancy: University of Illinois: Alplza Phi Omega 1, 2, 3: Delta Tau Omega 3, 4, sec. 3, 4: SAS 3, 4: Illinois State Legislature Scholarship 3, 4. DANIEL KLICK, Chicago, Illinois: History, Physical Education: NIU Hockey Team l, 2, 3, 4, pres. 2, vice-pres. 3, Intramurals l, 2, 3, 4. PAULA KLIMA, Berwyn, Illinois: Elementary Education, Sociology: Loyola University. DONALD KLINE, Harvey, Illinois: Zoology, Chemistry: Thornton Junior College: American Institute of Biological Sciences 4: ACS 4: Wildlife Society. 389 RAY KLINGELHOFER, Peoria, Illinois: History, German: Illinois Central College: Grant North Hall Council l, 2, 4: SA Student-Faculty Library Planning Committee 4: Dixon Volunteer 3: Marching and Varsity Band I, 2, 3, 4: NIU Outdoor Club I, 2. 3, 4: Ski Club 2, 3. SHARON KNIGHT, Dixon, Illinois: Mathematics, History: Sigma Zeta 33 SEA 4. ANITA KNIPPEN, Harvard, Illinois: Business Education: SEA: IBEA: VBEA. LARRY KNIPSCHIELD, Freeport, Illinois: Business Education: Higlz- land Community College. ELAINE KNIZE, Schiller Park, Illinois: Elementary EIIIICZIIIOIIQ YR I, 2. 3, 4: SEA 2. 3, 4. CORAL KOCH, Forest Park, Illinois: Elementary Education: Math- Science: A WS rep I, 2, dance committee chrmn. I. EDWARD KOCH, Chicago, Illinois: Accounting: University of Illinois: SAS: Intramurals 2, 3. THOMAS KOCIM, Park Ridge, Illinois: Marketing: Lincoln Hall Social Conzmittee 2: AMA 2, 3, 4: Program and INTRO Committee: Intramurals I, 2, 3, 4. JOHN KOEHLER, Sugar Grove, Illinois: Political Science, Physical Education: Intramurals 2. BRENDA KOENIG, Clticago, Illinois: Elementary Education, English: UCB 2, 3. 4: SEA 3, 4: Hillel I, 2, 3, 4: English Club 2. 3, 4. LYNNE KOENIGSBERGER, Glenview, Illinois: Art, English: Taylor University: Campus Crusade for Christ. PAULA KOLBERG, Elgin, Illinois: Mathematics, Chemistry: Elgin Community College. ROBERT KOLCZ, Chicago, Illinois: Political Science, Sociology: Wright .Iunior College: Sigma Pi 3, 4, scholarship chrmn., vice-pres. I: Sigma Nordic Sigma 2. 3, 4: May Fete Committee. JAMES KOLDER, Barrington, Illinois: Math, Industry and Tech- nology: Phi Sigma Epsilon 2, 3, 4, treas. 4: Intramurals I, 2, 3, 4. ELAINE KOLKMEYER, Clarendon Hills, Illinois: English, Journalism: UCB Social Committee. WILLIAM KOLIN, Cicero, Illinois: Political Science, History: Morton Junior College: Western Illinois Unix'ersity: Delta Upsilon: Varsity Football I: Student Officer Security Police. LOUIS KOMER, Glenwood, Illinois: Industry and Technology, Art: Epsilon Pi Tau, treas. 4: Golf I, 2: Student Advisory Committee to College of Fine and Applied Arts. JOYCE KONTOS, Downers Grove, Illinois: Elementary Education: Douglas Dorm Council. THOMAS KOOP, Mendota, Illinois: Accountancy: Illinois Valley Community College: SAS. PATRICIA KOPERA, Chicago, Illinois: Elementary Education, Social Psychology: Alpha Delta Pi l, 2, 3, 4, asst. treas. 2, treas 3: NEA: SEA 3 ,4. SHARON KOPITZKE, Lake Zurich, Illinois: Elementary Education, Social Science: Elgin Community College: Alpha Chi Omega. ROBERT KOPPE, Niles, Illinois: Biology, Clzemistryg Delta Tau Omega 2, 3, 4, rec'd sec. 3.4: Phi Sigma 3, 4. KIMBERLY KORAL, Skokie, Illinois: Business Education. IUDITH KORB, Chicago, Illinois: Elementary Education, Speech: Sig- ma Lambda Sigma I, Z, 3. 4. social chrmn. 2, house manager 4: SEA. MICHAEL KORCEK, Mount Prospect, Illinois: Journalism, Political Science: Northern Star I, 2, 3, sports editor 4: Sigma Delta Chi 3, 4, sec. 4: Tri Swine Omega 3, 4: Intramurals I, 2, 3, 4: University Rela- tions 4, assistant sports information director 4. CLAUDIA KORTUS. Villa Park, Illinois: Special Education: Echoes 3: Pi Lambda Theta 3, 4: Floor Social chrmn. 3: University Chorus 2. KENNETH KOSAN, Western Springs, Illinois: Marketing: Lyons Turn- pike Junior Collegef College of DuPage: YR 2, 3, 4, precinct captain 3. 4: AIESEC 3: AMA 4. NATALIE KOSAR, I3'ensenville, Illinois: Elementary Education, So- ciology: Chi Sigma Phi 3: Delta Gamma 4: Dixon Volunteers 3: UCB Social Committee. ELLEN KOSCIOLEK. Chicago Heights, Illinois: Speech Correction, Psychology: Sigma Alpha Eta 4. DONALD KOSIK, Brookfield, Illinois: ACCOIlIIllIllC,V,' College of Du- Page: SA S. JAMES KOSTEK, Elk Grove Village, Illinois: Marketing: St. Bene- dict's,' Alpha Kappa Lambda: Intramural Softball 3, 4: Volleyball 3, 4: Basketball 4. LINDA KOSTER, Sterling, Illinois: Elementary Education, Music. 390 PAULINE KOSTNER, Chicago, Illinois: Elementary Education, Hu- manities: SEA 3, 4: UCB Movie Committee 3, 43 NIKI 2, 3, 4. JUDITI-I KOTEK, Berwyn, Illinois: Business Education: Morton Col- lege,' Pi Omega Pi 3, historian 4. NANCY KOTESKI, Rockford, Illinois: Elementary Education, Soci- ology: A WS, social chrmn,' SEA. CAROL KOULOS, Park Ridge, Illinois: Elementary Education, Speech, Theatre,' Sigma Kappa 2, 3, 4, 2nd ricelpres. 4: University Chorus I, 2, 3: SEA 3, 4. NORBERT W. KOWAL, Chicago, Illinois: Managenzentg Wright Junior College: Varsity Tennis l, 2: Phi Beta Lambda I, 2, 3: Intramural Foot- ball 3, 4: SAM 3, 4: Floor vice-pres. 4. IRENE KOWALCHUK, Chicago, Illinois: Physical Education, Driver Education: WRA I, 2, 3, 4: Major-Minor Club I, 2, 3, 4: Extramural Volleyball l: Fencing 3, 4. DENNIS KOZELSKY, Westchester, Illinois: Physical Education, Bi- ology,' Soccer 2, 3, 4: Intramurals 2, 3, 4: Mens Physical Education Association: SEA 4. JEROME KOZMIC, Chicago, Illinois: Biology, Education, Bogan Junior College: Student House Dorm President 4. ROBERT KRAFT, Palatine, Illinois: History, Political Science: YR 3, 4. JANICE KRASA, Downers Grove, Illinois: Elementary Education, WRA Swim Team 1, 2, 3: SEA 3, 4: Cwens 2: Pleiades 4, vice-pres. 4. THOMAS KRASK, Chicago, Illinois: Finance, Business Administrationg Chicago City College: Plzi Theta Kappa. DONALD KRAUSE, Chicago, Illinois: History, Library Science, In- tramurals. CLAYTON KREGOR, Lostant, Illinois: Social Science, Historyg North Central College,' YR. MARGARET KREITLOW, Rockford, Illinois: Elementary Education, Sociologyg SEA. DIANE KRETSCH, Antioch, Illinois: Art,' Illinois State University. LOUIS KRUEGER, Northfield, Illinois: Art,' Southern Illinois Uni- rersityj UCB Art Committee: NIU Advisory Council: Student Fine Art Committee chrmn. :ir H Yfl I , , f Q fail '18-wb i V IX 9 5 aug- wg 5? we ,L 55? V Deg FEES ,,,.,,, O m ef' QEMEASLQ. of success cannot he measured through accumulations of knowledge, LYNN KRUPA, Chicago, Illinois: Elementary Education, Speech, Wright Junior College. LINDA LEE KRZEMINSKI, St. Clzarles, Illinois: Physical Education, Western Illinois University, Major-Minor Club 25 Delta Psi Kappa 4. JOANNE KRZYMINSKI, Des Plaines, Illinois: Art, History, Delta Phi De ta. DAVID KUBES, Melrose Park, Illinois: Marketing, Kemper Military College, Triton Junior College, AMA. JAMES KUBIK, Mount Prospect, Illinois: Marketing, University of Mississippi,' Sigma Pi 1, 2, 3, 4, vice pres. 35 Varsity Wrestling 3, Intra- mural Wrestling Champ 2, 35 Campus Crusade for Clzrist 3, 4. LINDA KUBO, Chicago, Illinois: Mathematics, Chemistry, RA 2, 3, Math Club 3, 4: Student Advisory Committee, Echoes 35 Sigma Zeta 3, 4. CHRISTINE KUHNKE, Evanston, Illinois: Physical Education, Mathe- matics, Gamma Alpha Mu 1, 2, 3, treas. 35 Alpha Chi Omega 4: Delta Psi Kappa 3, 4, pres. 45 WRA Golf 1, 2, 4. ROBERTA KUKOLICH, Glenwood, Illinois: Nursing, Illinois Masonic School of Nursing, DePaul University, Thornton Junior College. PHYLLIS KUKULA, Medinah, Illinois: Accountancy, SAS 1, 2, 3, 4, vice pres. 45 Phi Beta Lambda 35 Finance Club 25 YR 1: Lincoln Hall Dorm Council, treas. 2. FRANK KULIG, Rock Island, Illinois: Economics, History, Black- hawk Junior College, St. Ambrose. DAVE KULWIN, Chicago, Illinois: Elementary Education,' Southeast Junior College, Phi Epsilon Pi 3, 4, rush chrmn. 4, judicial council 45 Jr. IFC pres. 35 Karate Club 4. CAROL C. KUNKEL, Franklin Park, Illinois: Elementary Education, Sociology, SEA 2, 3, 4, vice pres. 45 Sociology and Anthropology Club 2,3. ROBERT ROY KUNKEL, Chicago, Illinois: Political Science, Psychol- ogy, St. Procopius College, Elmhurst College, Amundsen Junior College, Sigma Pi 3, 45 SAB 35 SAM 3, Sigma Nordic Sigma 3. JEANNETTE KUSHMUK, Niles, Illinois: History, Political Science, LARRY KUSHNIR, Skokie, Illinois: Marketing, Delta Tau Omega, In- tramurals 1, 2, 3, 4. BARRY KUSHNIR, Skokie, Illinois: Marketing, Delta Tau Omega 3, 4, chaplain 35 Intramurals 1, 2, 3, 4. STEPHEN KUSNER, JR., Bridgeview, Illinois: Industry and Technol- ogy, SEA, Floor chrmn., Intramural Football, Basketball, Baseball. FRANK KUZAN, DeKalb, Illinois: Biology, Zoology, Chemistry, Phi Sigma Kappa,' Intramurals 2, 3, 4. RONALD E. KUZERU, Posen, Illinois: Marketing, Thornton Junior College, AMA 3, 45 Circle K 4. MARY A. KVIETKAUSKAS, Chicago, Illinois: Art History, Delta Phi Delta. ROGENE ANN KYLE, Harvard, Illinois: Elementary Education, Science. DONNA LACOSSE, Elburn, Illinois: Mathematics, Accounting, Cwens 2, pledge trainer, Echoes 3, treas.,' Pleiades 45 Sigma Zeta 4, treas. 45 Baton Twirler 1, 2, 3, 4, Head twirler 4. LARRY LA FOLLETTE, Lansing, Illinois: Marketing, Intramurals 1, 2, 3, 45 SAS 1: AMA 4, Douglas Hall Publicity Committee. RICHARD LAGER, Palos Park, Illinois: Management, Bogan Junior College, SAM 4. WALTER LAGERHAUSEN, Des Plaines, Illinois: History, Economics, YR 3, 4. SHERRY LAING, Clzenoa, Illinois: Biology, Bradley University, Sigma Kappa, Student House Dorm Council 25 Review Board 3, Intramural Bowling 4. SHIRLEY LATEANO, Chicago, Illinois: Elementary Education, Speech, Chi Sigma Pl1i 2, 35 Delta Gamma 45 University Chorus 1, 2, 45 Uni- versity Theater 2. SUSAN LALLEMAN, Elgin, Illinois: Elementary Education, Elgin Community College. CHERYL A. LAMB, Glenview, Illinois: Special Education, EMH, SEA, CEC. RONALD R. LAMB, Chicago, Illinois: English, Physical Education, Varsity Baseball 2, 3, 45 Hockey 1, 25 Phi Sigma Epsilon 1, 2, 3, 45 IFC Representative 35 Intramurals 1, 2, 3, 4. SUSAN LAMB, Niles, Illinois: Art Education, Pasadena City College, Sigma Kappa 1, 2, 3, 4. THOMAS W. LAMBERT, Wheaton, Illinois: Microbiology, Chemistry, Elmhurst College, University of Illinois, UCB 4, Phi Sigma 25 Dean's List 2, 3. 92 Pushed into a World sculptured b another generation JOHN LANDSTROM, Wheaton, Illinois: Sociology, History: Delta Up- silon 2, 3, 4, ltistorian 3: UCB 3, 4. JERRY GWIN LANE, Joliet, Illinois: Psychology: Joliet Junior College: Adams Award l: Wesley 2, 3, 4: Tour Choir 3, 4: Backdoor 2, 3: AMC 3, 4: UCB 3, 4: Students for Non-Violent Action 3, 4, pres. 3, 4: Judo Club 4: Draft Counselor 3, 4. LAWRENCE LANE, Effingham, Illinois: Physical Education, Business Education: Intramural Football, Basketball, Volleyball, Softball 1, 2, 3, 4: Major Minor Club l, 2, 3, 4: Varsity Football Manager 1, 2, 3, 4: Offcials Club 4. LEONARD LANE, Effingham, Illinois: History, Business Adtninistra- tion, Secondary Education: Rugby Club 3: SEA 4: Dorm Council 3: Intramural Football l, 2, 3, 4: Basketball l, 2, 3, 4: Volleyball 1, 3, 4: Softball 1, 2, 3, 4, CRAIG LANGE, East Moline, Illinois: Marketing: AMA 4: Circle K l, 2: Intramurals l. KATHLEEN LANGE, Chicago Ridge, Illinois: Pltysical Education: Wartburg College: WRA: Major Minor Club. MAIE ANN LANGE, East Moline, Illinois: Secretarial Administra- tion: Illinois State University: Student Wives Club 4: Phi Beta Lambda. RITA LAROI. Winnetka, Illinois: Art: Stephens College: Eta Epsilon Gamma: Clti Omega: Fine Arts Festival Committee: Environmental De- sign Club. KAREN LARSON, Peoria, Illinois: Elementary Education, Socio1ogy,' Alpha Omicron Pi l, 2, 3, 4, pres. 4: Cwens 2: Echoes 3: Pleiades 4: Pi Lambda Theta 3, 4: Kappa Delta Pi 3, 4: Winter Carnival Com- mittee 2, 3: co-chrmn. 3. LOREEN LARSON, Evanston, Illinois: Elementary Education, Sociol- ogy: SEA 3, 4. SALLY LARSON, Aurora, Illinois: Psychology, English: Aurora College. SANDRA LARSON, Rockford, Illinois: Elementary Education: UCB Movie Committee 3, University Lutlzeran Parish l, 2, 3, 4. ROBERT M. LASKEY, JR., Woodridge, Illinois: Management: Wright Junior College, DuPage Junior College: SAM 3: Intramurals 3. PATRICK M. LAWLER, Waukegan, Illinois: Political Science, Philos- ophy: Sigma Phi Epsilon 2, 3, 4, parliamentarian vice pres., senior board: Northern Star 4: Ass't dortn social chrtnn. l, 2: Intramural Football, Wrestling. KENNETH LAURENCE, McHenry, Illinois: Business Management, Personnel Management: Elgin Community College: Varsity Football l, 2, 3: Delta Upsilon 2, 3, 4: NIU Ofj?cial's Club: YR,' Beavers Inde- pendent Association. PAMELA LAZARZ, Des Plaines, Illinois: Mathematics, Cltemistry. LORETTA LEARY, Green Bay, Wisconsin: English, Art. LINDA LEATHERS, Aurora, Illinois: Home Economics Education: Graceland College: Home Economics Club 1, 2, 3, 4: WRA rep. 1, 2. JEFFREY LEAVEY, Aurora, Illinois: History, Sociology: Aurora Col- lege: Intramurals 2: Dorm Council: Undergraduate History Committee. JOHN LEAVITT, East St. Louis, Illinois: Management: Belleville Jun- ior College: YR: UCB: SAM. LINDA L. LECHERT, Northbrook, Illinois: French, Spanish: Alpha Xi Delta. RICHARD LEFF, DeKalb, Illinois: Biology, Chemistry: Phi Sigma Kap- pa: Intramural Swimming 1, 2, 3, 4: Football. TERESE LEGARE, Villa Park, Illinois: Special Education: Honzecom- ing Court 3: Lincoln Hall social chrmn. RANDY LEHMANN, Danville, Illinois: Journalism: Sigma Plzi Epsi- lon: Basketball l: Northern Star. ROBERT LOWELL LEID, Freeport, Illinois: Industry and Technology: Highland Community College. JAMES S. LEIFEL, Chicago, Illinois: Business Education: Wright Jun- ior College: North Park College: Intramurals 1, 2: YR l, 2: Phi Beta Lambda. JAN LEIFER, Skokie, Illinois: English, Journalism: Theta Sigma Phi 4, JSA 3, 4: Math Club 3: Outdoors Club 1: SNEA I, Northern Star 3: Homecoming dortn decorations 1: Volunteer tutor, DeKalb County Juve- nile Court 3: Hillel 3, 4: Senior Class Project Planning Committee 4. GAYLE FOWLE LEKKI, Chicago, Illinois: Speech Correction, Ele- mentary Education,' Grant South Dornz Council 2: Floor pres. 2: SEA 4. 393 Rain, sleet and slush are as much a part of Nortl1ern's life as the Uprising DAVID LELI Chica 0 Hei lzts Illinois. Marketin ' Universit 0 Ari , fe e , A ' ' e, y f - zona: Prairie State College,' Plzi Sigma Epsilon 3, 4, standards 3: Intra- murals 3, 4: AMA 4. ALLEN LENKOWSKI, Clzicago, Illinois: Management, Roosevelt Uni- versity, Wright Junior College, SAM,' AMA. STEVEN LEONARD, Chicago, Illinois: Management: Triton Junior College, Elmhurst College. CHARLES LESEBERG, Palatine, Illinois: Marketing, AMA 2, 3, 4. MARY LESTHAEGHE, Hampton, Illinois: Elementary Education, Hu- manitiesg Mount Mercy College, Alpha Omicron Pi 3, 4, rush chrmn. JAMES LESTIKOW, Niles, Illinois: Marketing, Business Administra- tion: Delta Sigma Pi 2, 3, 4, sec. 3: Circle K 1, 2, treas. 2: Cavaliers 4, AMA 3, Intramurals, Football 2, 3, 4, Volleyball 1, 2, 3, 4, Softball 3, 4. LINDA LEURQUIN, Lombard, Illinois: Elementary Education, Wis- consin State University: Alpha Omicron Pi 3, 4. DENNIS LEVANDOWSKI, Chicago, Illinoisg Social Science, Psychology. RONNIE LEVINE, LaSalle, Illinois: English, Sociology, Illinois Vallev Community College. RONALD LEVITSKY, Morton Grove, Illinois: History, English, Plzi Alpha Theta 3, 4. STEVEN LAVROUW, Nortlz Chicago, Illinois: Industry and Technol- ogy, Chenzistry,' Dorm Council 1, 3: Iota Tau 4: Chemistry Club 2. EARL LEVY, Chicago, Illinois: Psychology: Chicago City College,'AA. GREGORY LEWIS, Maywood, Illinois: Mathematics, Business Admin- istration, Sigma Phi Epsilon 2, 3, 4, social chrmn. 3, 4, Showtime co-chrmn. 4. JUDITH LEWIS, Clzicago, Illinois: Art,' Loop City College: UCB Art coordinator 4. NATALIE LEWIS, Oak Lawn, Illinois: English, History, Baha'i Club 3, 4. CHERIE LIESSE, Skokie, Illinois: Spanish, French. 394 The rh thm of learning is sometimes humdrum, sometimes stimulating. DAVID LIESSE, LaSalle, Illinois: English, Journalism: Illinois Valley Community College: UCB 3, 4: YR 3, 4: Senior Class Project Planning Committee 4. CLIFFORD LILL, Oak Lawn, Illinois: Marketing: Bagan Junior Col- lege: AMA 2, 3, 4: SAS l:SAM 4: Circle K 1, 2. DENNIS LIND, Woodstock, Illinois: Marketing: Northwestern Uni- versity: Phi Eta Sigma 1, 2, 3, 4: Vet's Club 1, 2, 3, 4: Dean's List l, 2, 3, 4: Straight UA Honor Roll 3, 4: Graduation Marshall 3, 4. KAREN LINDENBERG, Chicago, Illinois: Elementary Education, His- tory,' Northeastern Illinois University: UCB: Hillel. JACK LINDER, Garden Prairie, Illinois: Biology, Chemistry: Alpha Phi Omega 2, 3, 4: Gilbert Hall Council l, 3, sec. 3: UCB Public Rela- tions 3, 4, Entertainment 3. JEANETTE LINDERS, McHenry, Illinois: English, Journalism: RA Ski Club 2, 3, 4: NCTE 4. CECELIA LINDGREN, Chicago, Illinois: Mathematics, Psychology: Northeastern State College: Co-rec. chrmn. 2: House President 2: Extra- mural Volleyball 2, 3: Dixon Volunteer 3. DONALD LINDMARK, Arlington Heights, Illinois: Political Science, History: Eastern Illinois University. LARRY LINHART, LaGrange, Illinois: Accounting, Marketing: SAS 1, 2, 3, 4: AMA 3. 4. JOHN LIPNISKY, Chicago, Illinois: Physical Education, Safety and Driver's Educa'ion: Wright Junior College: Phi Kappa Theta: Intra- murals, Baseball, Basketball: Varsity Baseball 3. ROBERT LISTMAN, Elgin, Illinois: Marketing, Psychology: Elgin Community College: AMA: SAM: Outdoor Club: Delta Sigma Pi, sec.: Intramurals, Swimming: Karate Club. JULIE LIVACARI, Lincolnwood, Illinois: Elementary Education: Sig- ma Kappa l, 2, 3, 4, chaplain 2: Little Sister of Minerva 2, vice pres. 3, pres. 3, 4: SAE Sweetheart 3. LANA LOGSTON, Olgesby, Illinois. DAVE LOHRKE, Mtmdelein, Illinois: History, Sociology: Oklahoma Military Academy: Basketball 3: Tau Kappa Epsilon 2: Tau Delta Ep- silon 3, 4, pres. 4. MARC LONGINO, Midlothian, Illinois: Chemistry, Biology: RA: Sig- ma Zeta 3, 4, vice pres. 4: Track 1. GARY LONGMAN, Joliet, Illinois: Accounting: Joliet Junior College: SAS 3, 4. LARRY LOOMIS, Lena, Illinois: History, Geography: Highland Com- munity College: University of Illinois: Gamma Theta Upsilon: Plzi Alpha Theta. BERNARD LOONEY, Lincoln, Illinois: Business Education: Univer- sity of Illinois: Lincoln Junior College: Illinois State University: Distribu- tive Education Club, treas. SANDRA LORIN, Chicago, Illinois: Nursing, Sociology. BARBARA LORR, LaGrange, Illinois: Englislt, History: Pi Lambda Theta: Echoes: Towers,' Sigma Tau Delta. SHEILA LOTHIAN, St. Charles, Illinois: Elementary Education: Elgin Community College: Sigma Sigma Sigma. THOMAS LOVELY, Somerville, Massachusetts: Elementary Educa- tion, Spanish: Boston State College: Aurora College: SEA 4. KATHLEEN LOVINS, Huntley, Illinois: Home Economics, Sociology: UCB Entertainment Committee: Douglas Hall Dorm Ohicer: Family Life and Child Development Club. BILLY LOWE, Belvidere, Illinois: Management: Rock Valley Junior College: SAM 3, 4. KATHLEEN LOZAR. SANDRA LUCAS, Chicago, Illinois: Physical Education: Delta Psi Kap- pa 2, 3, 4: WRA vice pres., sec., intramural chrntn.: Dorm Representa- tive: Major Minor Club treas.: Hockey I, 2, 3, 4: MCFHA pres., vice pres.: MWFHA, Second and Third team. WILLIAM LUCAS, Chicago, Illinois: Marketing: UCB: Newman Club: AMA. WILLIAM LUDEKE, Chicago, Illinois: German, French: Wright Jun- ior College: German Club 4, pres. SHERAN LUDOLPH, Freeport, Illinois: Elementary Education, High- land Community College. MARY LUDWIKOWSKI, Chicago, Illinois: Elementary Education, Loop Junior College, SEA 4: Dorm Council sec. 4. JAMES LUEBCHOW, Lincoln, Illinois: Accounting, Sigma Phi Epsilon 2, 3, 4, treas. 3: Phi Eta Sigma 1, 2, 3, 4, pres. 2: Cavaliers 3, 4: SAS 1, 2, 3, 4: Intramurals 1, 2, 3, 4: Accounting Internship 4. JACQUELINE LUETY, Franklin Park, Illinois: Elementary Education, Sociology, Alpha Sigma Alpha 1, 2, 3, 4: Pom Pon. JOSEPH LUKE, Chicago, Illinois: Psychology, Political Science, Uni- versity of Illinois. JANICE LUKES, Chicago, Illinois: Elementary Education, History, Dorm Council, Softball Intramurals. JACK LUTZ, Aurora, Illinois: Marketing, SAS l, 2: AMA 2, 3, 4. JAMES LUTZ, Aurora, Illinois: Marketing, SAS, AMA 3, 4. KATHLEEN LUX, Chicago, Illinois: Special Education, Sigma Sigma Sigma 2. 3, 4: CEC. ROBERT LUX. Alsip, Illinois: Speech, Business, Wilson Junior College, Phi Sigma Epsilon 2, 3, 4, pres. 4: May Fete Court 4, IFC 3, 4. LYNNE LYLE, Chicago, Illinois: Elementary Education, History, En- glish, Wright Junior College,' Alpha Xi Delta 2, 3, 4. JUDI LYNCH, Westmont, Illinois: Elementary Education, History, Kappa Delta Pi. KENNETH LYTHGOE, Rockford, Illinois: History, Rock Valley Col- lege. LAURIE MCALLISTER, Ohawa. Illinois: History. Psychology, Illinois Valley Community College, Pi Alpha Theta, Phi Lambda Theta, Psych Club, treas. KATHRYN MCATEE, Viola, Illinois: Elementary Education, SEA. JOHN MCCLAY, Altona, Illinois: Management, Alpha Pl1i Omega 2, 3, 4, alumni sec. 3, asst. UMOC chrmn 2, Intramural Track Ig SAM 3, 4. THOMAS L. MCCLINTOCK, Peru. Illinois: Management, Illinois Val- ley Communitv College, SAM 2, AMA 2: Phi Beta Lambda 4, pres. 1: Stuflent Coordinattine Committee 2: SA 1. ROY MCCOMAS. Melrose Park, Illinois: Accounting, Triton College, Finance Club: SAS. JAMES MCCRAIGH, St. Charles, Illinois: Marketing, Economics, AMA l, 2, 3: UCB 4: Intramural Football 1, 2. SCOTT MCCULLAGH, DeKalb, Illinois: Music Education, Concert Band 1, 2, 3, 4: Symphony Orchestra 1, 2, 3: Phi Mu Alpha Sinfonia 1, 2, 3, 4, sec. 2: MENC 2: NIU Brass Ensemble 1, 2, 3: Marching Huskies 1, 2, 3, 4. SUE ANN MCCU LLY, Lacon, Illinois: English, Psychology. JOYCE MCDONALD. Channahon, Illinois: Secretarial Administration, Chi Siema Phi 2. 3, historian 2, treas. 3: Delta Gamma 4, treas 4. JACQUILYN MCDUGLE, Pontiac, Illinois: Business Education, Illinois State Universitv: SA B,' Phi Beta Lambda. WILLIAM MCELWAIN. Rolling Meadows, Illinois: French, German, French Club 4: German Club 3. KATHY MCGEE, Des Plaines, Illinois: Special Education, CEC, RA 3: Dorm Council. JUNE MCGILL, Chicago, Illinois: Elementary Education,' DUR Coun- se or 3. EMYLA MCGIRR, DeKalb, Illinois: Elementary Education, Augustana College: Mount St. Clare Junior College. CHRISTINE MCGOWAN, LaGrange, Illinois: Elementarv Education, Lvons Township Junior College, College of DuPage, SEA 4: SAE Little Sister 3, 4: SA Public Relations 3. 396 Securit ends: students claim adult status MARGARET MCHOGH, Chicago, Illinois: Interior Environmental De- sign: Environmental Design Group, sec. 4. JAMES MCILRATH, Evanston, Illinois: Marketing: Theta Chi: Intra- murals I, 2: AMA. FRANK MCKENNA, Chicago, Illinois: Mathematics, Pltysics. MARY MCKENNA, Rock Island, Illinois: Mathematics, Chemistry. JENIFER MCKENZIE, Milan, Illinois: Elementary Education, Humani- ties: Dorm Council l: Alpha Delta Pi 2, 3, 4, social cltrtnn. 3, pres. 4. WILMA MCKENZIE, DeKalb, Illinois: Women's Physical Education: WRA 1, 2, 3, 4: Major Minor 1, 2, 3, 4. KATHY MCKIERMAN, Chicago, Illinois: Nursing: University of Illi- nois Circle: SNO 2, 3, 4: Echoes 3. MICHAEL MCKITRICK, St. Louis, Missouri: Political Science, History: Southern Illinois University: YR 4: Sigma Alpha 43 International Rela- tions Club. DENNIS MCLAUGHLIN, Rockford, Illinois: Speech, History: Western Illinois University: Forensic Team: Debate Team,' Orchestra. KATHLEEN MCMAHON, Chicago, Illinois: Spanish, History,' St. Xavier College. JOHN MCMANUS, Chicago, Illinois: Zoology, Chemistry: Chicago City Junior College: University of Illinois Circle. MARGARET MCMILLAN, Dundee, Illinois: German, French: St. Dom- inic College: Albert Ludwig University: German Club 4. WENDY MCNAIR, Evanston, Illinois: Elementary Education, Sociol- ogy: RA 3, 4. MIKE MCNAMARA, Pecatonzica, Illinois: Finance: Blackburn College, Rock Valley College. THOMAS D. MCNAMARA, Elgin, Illinois: History, Philosophy: Intra- mural Football I, 2: Basketball 1, 2. VICKI MCNASH, Kankakee, Illinois: Physical Education, History: WRA: Major-Minor Club 4. LINDA MCNAUGHT, Rockford, Illinois: Elementary Education: Rock Valley Junior College,' Kappa Delta Pi 4: SA Housing Committee 3: SEA 4. GEORGIA MCNIFF, Joliet, Illinois: Elementary Education: Joliet Junior College. HELENE MCNEIVE, Chicago, Illinois: English, Library Science. MICHELE MCWAYNE, Wilmette, Illinois: Elementary Education: Clarke College. KENNETH MAAS, West Chicago, Illinois: Mathematics, Physical Edu- cation: Intramural Football l, 4, Intramural Softball 2, 3, Intramural Vol- leyball l, 3, 4. LIELA MABES, Maywood, Illinois: Biology: University of Illinois Cir- cle: Phi Sigma Society 2. KATHLEEN MACDONALD, Riverdale, Illinois: Elementary Educa- tion: Thornton Junior College. BARBARA MACEK, Niles, Illinois: Elementary Education. SANDRA MACEK, Calumet Park, Illinois: Elementary Education: Thornton Junior College: UCB Social Committee. KATHLEEN MACIEJEWSKI, Berwyn, Illinois: French, English: De- Paul University. MICHAEL MACK, Highland Park, Illinois: Marketing: Quincy College. THOMAS MACK, Glenview, Illinois: Psycltology, Sociology: DePaul University: Kendall College. KATHLEEN MACKIE, River Grove, Illinois: Elementary Education, History: Triton College. THOMAS MACKIE, Franklin Park, Illinois: Zoology, Chenzistry: Con- cert Cltoir l, 2, 3, 4: Madrigal Singers 3, 4: Newman l, 2, 3: Intramural Sports 1, 2, 3: RA 4. SHARON MACLEAN, Peoria, Illinois: Speech Correction, Psychol- ogy: Sigma Alpha Eta. PATRICIA MADDEN. Evergreen Park, Illinois: Speech Correction, Elementary Education: Sigma Alpha Eta: Echoes: Pi Lantbda Theta: RA. 397 J obs and responsibilities the beginning of an infinite chain of events SUSAN MADDEN, Oak Forest, Illinois: English, Political Science: Dominican College: Student Government 1: Concert Clzoir l: UD 2, 3, 4: UCB 3: Band 2: Dorm Council 3,' Resident Assistant 4: Kennedy Action Corps 3, 4, sec. 3, pres. 4: Phi Si'gma Kappa Little Sis 3. THOMAS MADDEN, Villa Park, Illinois: Marketing: Loyola Uni- versity: AMA: SAM: Intercollegiate Marketing Games, captain. RICHARD A. MADUZIA, Chicago, Illinois: Management: South East Junior College: Bogan Junior College: SAM 2. TERRY MADSEN, Hinckley, Illinois: Biology, Chemistry: Equestrians l, 2, 3, 4. DREXEL MAGGIO, Wonder Lake, Illinois: History, English: Uni- versidad Inter-Americana,' Wrestling 1: Intramurals I, 2, 3, 4. GARY MAGNUSON, DeKalb, Illinois: Electronics Technology: IEEE. ROBERT J. MAI-IER, DeKalb, Illinois: Accounting: Joliet Junior Col- lege: Plzi Kappa Sigma, treas., vice-pres: SAS. THOMAS MAHONEY, Joliet, Illinois: Meteorology: Joliet Junior Col- lege: Swimming 2: WNIU 3, 4: Phi Delta Psi 2, 3, 4, rush cltrmn. 3, sec. 4: May Fete 3, 4. JUDY MALIS, Skokie, Illinois: Elementary Education, Psychology: Roosevelt University: Kendall College: Hillel I, 2, 3, 4. ROBERT T. MALITO, Matteson, Illinois: English, Physical Education: St. Mary of the Lake Sentinary: Prairie State College. LARRY MALKOWSKI, Algonquin, Illinois: Biology: Elgin Com- munity College. SARA MALLO. St. Clair Sltores, Michigan: Art, Spanish: St. Dominic College: Dorm Officer 3. DENNIS MALMGREN, Aurora, Illinois: Management, Sociology: Aurora College: Intramural Basketball 2, 3. 4: Intramural Softball 2. 3, 4: Intramural Hana'ball,' SAM 2, 3, 4: Vet's Club 2, 3, 4. KATHLEEN MALONEY, Lansing, Illinois: English, Journalism: Alpha Xi Delta 1, 2, 3. 4: RA 2. MARY MALONEY, Chicago, Illinois: Art: University Theatre l: Fine Arts Festival Committee 3: Sports Car Club 2, 3. MARGARET MALY, Berwyn, Illinois: Elementary Education, Art: Alpha Xi Delta I, 2, 3, 4. BARBARA MANCHEN, Villa Park, Illinois: Accounting: Chi Delta Chi 2, 3. house manager 2, treas. 2: Alpha Chi Omega 4, treas. 4: SAS I, 3, 4: Plzi Beta Lambda 2, 3, 4, treas. 2, 3: YR 3. CHRISTINE MANCZYNSKI, LaSalle, Illinois: Physical Education: Illinois Valley Community College: WRA: Outdoor Club: Major-Minor Club. FRANK MANDERSHEID, Dixon, Illinois: Management: University of Maryland: Sauk Valley College: Vet's Club 2, 3, 4, pres. 2: Intra- murals 3, 4. BONNIE MANNARELLI, Lansing, Illinois: Journalism, Speech: Alpha Omicron Pi 2. 3, 4, song chrmn. 3, publicity chrmn. 4: Winter Carnival publicity co-chrmn. IRENE MANZER, Downers Grove, Illinois: Special Education: CEC l, 2, 3, 4. KATHERINE MARCHOK, Villa Park, Illinois: Chemistry, Matli,' Echoes, 3: Chem Club 2, 3, 4, sec-treas. 4: Chemistry Advisory Com- mittee 3. CRAIG FRANK MAREK, Hoffman Estates, Illinois: Accountancy: University of Illinois Clticago Circle: North Central College: SAS 3, 4, SUSAN MARINO, Melrose Park, Illinois: Speech Correction, Psy- chology: Alpha Phi 1, 2, 3, 4: rec. sec. 2: Sigma Alpha Eta. JOYCE MARISKA, Evergreen Park, Illinois: Mathematics, Psycl1ology,' Western Illinois University: Math Advisory Committee 4: NCTM 3, 4. CHRISTIE MARK, Chicago, Illinois: Sociology, English: Sigma Kappa 2, 3, 4: Sister of tlze Red Rose 4: Orcltesis 1, 2. RONALD MARKS, Chicago, Illinois: Marketing: Plzi Kappa Theta 2, 3, 4, rush chrmn. 3: AMA 3, 4: Intramural Football 1, 2, 3, 4: In- tramural Basketball l, 2, 3, 4: Intramural Softball I, 2, 3, 4. DANIEL J. MARRON, Bridgeview, Illinois: Finance: University of Illinois Chicago Circle: Chicago City College: Ski Club 4: Intramurals 3, 4. 398 BARBARA MARSELOS. Chicago, Illinois: EI1,QlI.K'II, Political Sc'ienc'e,' North Central College,' Echoes 3: Christian Science Organization 2. 3. 4. Corres. see. 2. 1'ic'e-pres. 3. reader 3. reeortling sez: 4. SHARON MARSH. Waulcegan, Illinois: iVIII'Sl'lI,L',' Alpha Chi Omega 2, 3. 4. set-at-arms 3, ass't. pledgze trainer 4: SNO 2, 3. 4, rife-pres. 4: Stutlent Representathe Nursing School Faculty 3. 4: Senior Class Pro- ieet Plannine Conttnittee. JOHN MARTIN. Cliicayo, Illinois: lVIarlceting,' AMA: Intranzurals I. 2, 3. JOHN MARTIN. Joliet, Illinois: Biolokqy, Clienzistryg Football I: Signza Zeta 3. 4. SHERRIE MARTIN. Waterman, Illinois: Elententary Ezlueation, Cont- IIIIIlII!'lIIIOII,' SEA 3. INES MARTINELLO. Chicago, Illinois: Spanish, Italian: Italian Club 2. 3. treas. 31 Spfinislz Club I, 2, 3. 4. soeial ehrtnn. 4. ALICIA MARTINEZ. Sterling, Illinois: Elementary Education, So- c'ioloL'v,' SEA 3, 4: UCB 3. KRISTIN MARTINEZ. Aurora, Illinois: ACC'UIIIIlIlI,Q,' Elgin Community CIIlIC',i,7C',' SAS 3, 4. LYNN MARZEC, Palatine, Illinois: Special Education, EMH,' Alpha Signza Alpha I, 2. 3. 4. corres. sec. 2: Winter Carnival CIOIIIIIIIIIIFK' 2. JOANNE MARZOWSKI. Calumet City, Illinois: Matlienzaties, Clzenzis- Irv: Thornton Junior College: Illinois Institute of Tt'C'IIlIOIUtL,'-V,' WRA I: Alpha Xi Delta 2, 3. 4, treas. 3: Chenzistry Student Aflvisory Coln- fnittee 4: Winter Carnival Committee 4. VALERIE MASESSA, Chicago, Illinois: Elementary Ezluc'ation,' West- ern Illinois Unix'ersity,' Miflwest Model United Nations 3: Winter Carni- val CIIIIZIIIIIIUKA 3. BRYAN MASLANKA. Chicago, Illinois: .lVff1l'Iil'IIII,i,',' I c't1,tJer Junior College: AMA 1. 2, 3, 4: Intramural Basketball I, 2, 3. 4: Intramural Softball I. 2. 3. 4: SIO 3, 4. 'IW' 4 aus., an.-'So I gi - iz g Q5 1 fi . r 'si 5' 2 I Q., , , A 0 Was. -. -1 .31 g K' az ' 1 1 i' ,ffl J. - . 45.2 1 ,lkxx -V Q - : . gs ' 1 i 1 ff' fr V. QF'-3 i fr ,ff 3 5? gf 5233 ,. .sf 455, me s' LM? JS! a:4nWf.Iq,I,..,1,,,Q :ff An...-.f . .. . or-. 'V P 4: .MW -J .. ., L J . 5' 5' I, ' 1 P' I I'ni not for nzyself who am I, if I'nz for myself alone what arn I, if not now, when . . 399 Graduation - a time to stand back and take a closer look at life ANNE MASTERS, Cherry Hill, New Jersey: Elementary Education, SEA 2, 3, 4, UCB 2, 3, 4, Board Coordinator 4. PAT MASTORES, Clzicago, Illinois: Sociology, Delta Zeta 2, 3, 4, corres. sec. 3, scholarship chrmn. DONNA MATHEW, Shannon, Illinois: Special Education, EMH, High- land Community College, CEC. ERIC MATSON, Marklzam, Illinois: Economics, Cornwall College, Sigma Alpha Epsilon 3, 4, Economics Club. MARY MATTHES, Woodstock, Illinois: Home Economics, Home Economics Club 2, 3, 4, treas. 4, Pleiades 4, Asst. RA 3, Newman 2. BARBARA MATTHEWS, Oak Lawn, Illinois: Elementary Education, Loyola University, Saint Xavier College, NEA. DAVE MATTIO, Chicago Heights, Illinois: Physical Education, His- tory, Football l, 2, RA 3, 4, FIO l, 2, 3, 4. SANDRA MAURER, Spring Valley, Illinois: English, Philosophy, Il- linois Valley Community College. ROGER ALLEN MAUSEHUND, Peotone, Illinois: Business Edu- cation, Journalism, Phi Beta Lambda 3, 4, JSA 2, 3, 4, YR 2, 3. DIANA MAXWELL, Deerfield, Illinois: Accounting, Western Illinois University, SAS 3, 4. CAROL MAYER, Chicago, Illinois: English, History, Pi Kappa Delta 3, 4, Sigma Lambda Sigma 3, 4, pres. 4, Cwens 2, Echoes 3, vice- pres. 3, Pleiades 4, Forensics 1, 2, 3. THOMAS MAYERLE, Des Plaines, Illinois: General Science, University of Illinois, University of Illinois Chicago Circle. JAMES MAYWORM, Norridge, Illinois: Marketing. STEVEN MAZZEI, Broadview, Illinois: Marketing, University of Il- linois Chicago Circle, Triton Junior College, Dorm Judiciary chrmn. 3, Intramural Football, Basketball, Softball 2, 3, 4, AMA. DAVID MEDLEY, South Holland, Illinois: History, Sociology, Thorn- ton Junior College. RAYMOND MEGYERI, Joliet, Illinois: Marketing, Joliet Junior Col- lege. GEORGE H. MEIER, Hobart, Indiana: History, Anthropology, Vin- cennes University. ARTHUR MEIERDIRK, Antioch, Illinois: Business Management, Hall Council 3, Intramural Football, Softball 1, 2, 3. JAMES MEINKEN, Skokie, Illinois: Mathematics, University of Il- linois, Phi Delta Psi 2, 3, 4, scholastic chrmn. 2, 3, 4, pledge trainer 4, Dixon Volunteers 3, St. Charles Tutors 3, Newman 2, 3, 4, WNIU-FM 3, 4, SA 4. BARBARA MENGE, Woodstock, Illinois: Physical Education, Psy- chology, Delta Psi Kappa 2, 3, 4, Major-Minor l, sophomore rep. 2, 3, senior rep, 4, Extramurals 1, 2, 3, 4. GREGORY MENNE, Peru, Illinois: Marketing, Illinois Valley Com- munity College. JACK MEREDITH, Waterman, Illinois: Mathematics, Chemistry, Track 1, 2, Cross Country 1, 2, NISCC 4, NIU Equestrians 3, 4. SANDRA MERRILEES, Chicago, Illinois: Art, Chi Omega, Environ- mental Design Group, treas. 4, Fine Arts Festival 3. WILLIAM MERZLICKER, Waukegan, Illinois: Business Education, Phi Beta Lambda. BARBARA MARIE MESICS, Rolling Meadows, Illinois: Elementary Education, English, Panhellenic, pres. 3, Pom Pon Squad, Delta Zeta. PATRICIA MESICS, Rolling Meadows, Illinois: Marketing, AMA 3, 4, Delta Zeta 2, 3, 4. MARY METTELKA, Palatine, Illinois: Art Education, Kappa Delta 2, 3, 4, Newman Club 1, National Art Education Association 4. DEAN METZ, Peru, Illinois: History, Mathematics, Illinois Valley Com- munity College, Intramural Basketball 2, Intramural Football I. 400 LINDA METZGER, Rochelle, Illinois: History, Sociology: Alpha Cl1i Omega, rec'd. sec. 3: Panhellenic rep. 2: SEA: Sociology Club: YR. JOHN MEYER, Chicago, Illinois: Accounting: Phi Kappa Sigma: SAS. LOIS MEYER, Evanston, Illinois: Elementary Education: Chi Omega 2, 3, 4: Ski Club 2, 3, 4: SEA 4: Dorm Culture Committee. RITA MEYER, Harmon, Illinois: Elementary Education, Art: SEA: Pi Lambda Theta. WILLIAM MICELI, Chicago, Illinois: History, Political Science: Amundsen-Mayfair Junior College: Floor pres. WAYNE MICHALESKO, Chicago Heights, Illinois: Finance, Ac- counting: SAS 1: Finance Club 3. CLAIRE MICHELS, Aurora, Illinois: English, Art: Kappa Delta 1,2, 3,4. LAUREL MICKOW, Elmhurst, Illinois: Elementary Education: Alpha Xi Delta 1, 2, 3, 4, pres. 3, 4: Outdoor Club: Living-Learning Com- mittee: Vocal Ensemble: Dorm Council: UCB Movie Committee. EDWARD MICULINICH, For Lake, Illinois: Mathematics, Chemis- try: Tau Lambda Chi: Intramurals: Hockey Club: Basketball 2. GARY MILANO, Dixon, Illinois: Biology: Sauk Valley College: Cul- tural and Scholarship Committee. RUSSELL MILANO, Chicago, Illinois: Accounting: RA 2: UCB 4: SAS 2, 3. JANET MILES, Palos Heights, Illinois: History, Speech: Dorm Council 1: Interhall Council 1. CYNTHIA MILLARD, Loves Park, Illinois: Medical Technology,' Rock Valley Junior College: A WS: Mu Tau Chi, pres, DON MILLER, Champaign, Illinois: Industrial Personnel Supervision, Chemistry: Epsilon Pi Tau: Iota Tau: IIIEA, historian 4: Dorm Coun- cil: Floor pres. 2: Intramurals 1, 3, 4. JAMES RICHARD MILLER, Evergreen Park, Illinois: German, Ma- thematics: German Club 2, 4. JILL MILLER, Libertyville, Illinois: English, Speech: Sigma Tau Delta 3, 4: Towers, editorial staff 3, 4. MARLENE MILLER, Freeport, Illinois: Marketing: Wisconsin State University: AMA. PAMELA MILLER, Glenview, Illinois: Speech Correction, Psyclzology: University of Dubuque: Alpha Delta Pi 2, 3, 4, rec'd sec. 3: UCB 3. SARIN ANN MILLER, Elmlzurst, Illinois: Elementary Education. CAROL MILLS, Bushnell, Illinois: English, French: Sigma Tau Delta 3, 4: Towers 4. RICHARD J. MILNE, Chicago, Illinois: Finance,' Wright Junior College: Finance Club, treas.: Flying Huskies, treas. LYNEE MINARICH, Joliet, Illinois: Art Education: Sigma Sigma Sig- ma 2, 3, 4. LAURANE MINER, Markham, Illinois: Spanish, Sociology: Inter- American University. THOMAS E. MINER, Savanna, Illinois: Finance: Highland Community College: Finance Club 3, 4: Flying Huskies 4. ROBERT MINOR, Chicago, Illinois: Marketing: Intramurals 1, 2, 3, 4: AMA 1, 2, 3, 4: IMA 2, 3, 4, rec'd sec. 3: 1970 Senior Class Project Planning Committee 4, vice-clzrmn. 4: Dorm Council 1: Newman 2, film chrmn. JAMES P. MINTER, Des Plaines, Illinois: Accounting: University of Illinois, Chicago Circle, Milton College: Sigma Pi: SAS 3, 4: Intramur- als 2, 3, 4: Bowling League 3, 4, sec. 4. GENE MIRWALD, Rockford, Illinois: Accounting,' SAS. THOMAS O. MISEK, Berwyn, Illinois: History, English: Morton Jun- ior College: Orchestra 3. TERRY MISKOWICZ, Chicago, Illinois: Physical Education, Drivers' Education: FIO: Basketball 1: P.E. Major Club: Official's Club. DEAN MITCHELL, Riverdale, Illinois: Speech, History: Thornton Jun- ior College: Sigma Pi 2, 3, 4, social chrmn. 3, 4: Student Advisory Board 3: Finance Committee 3: IFC 2. CHUCK MOCKBEE, Danville, Illinois: Business Management: Danville Iunior College. ROBERT MOLEK, Stickney, Illinois: English, History: Morton Junior College: Orchestra 3, 4. 401 JEANETTE MOLIDOR, Libertyville, Illinois: Elementary Education: Ottumwa Heights Junior College: Chi Omega 3, 4: SEA 3, 4. JOHN MOMSEN, Coal City, Illinois: Accounting: Joliet Junior Col- lege: SAS. KENNETH MONSESS, Waterman, Illinois: Economics, History: Phi Eta Sigma 1, 2, 3, 4: Gamma Delta 2, 3, 4: 1970 Senior Class Project Planning Committee. JERI MONTAC, Clu'cago, Illinois: Mathematics, Psychology: Illinois State University: NIKI 2, 3: Committee on Visitation: Wonzen's Intra- mural Bowling League 1: Floor Ofhcer 1, 2: vice pres. Inter-Hall Coun- cil: Dorm Culture and Scholarship Commission 1, 2: Dorm Council 1, 2: Torchlight Parade: Pep Rally, Bonfire for Homecoming, chrmn. ARDIS MONTGOMERY, Morrison, Illinois: Special Education, Vis- ually Hamlicapped: AWS 3: AEVH 2, 3. 4. ELAINE MOON, Jasonville, Indiana: Nursing: Indiana University. RONALD MOORE, Genoa, Illinois: Math, Physical Education: 1970 Senior Class Project Planning Committee: Varsity Basketball Manager 2, 3, 4: Intramurals 1, 2, 3, 4. JAMES MOOS, Lincoln, Illinois: Pre-dental, Chemistry: Intramurals 1, 2, 3, 4: Tau Delta Epsilon: Tennis 1, 2, 3, 4. CORINNE MORANDA, Chicago, Illinois: Physical Education, Sociol- ogy: Major Minor Club 1, 2, vice pres. 3, pres. 4: WRA 1, 2, 3, 4: Echoes 3. WILLIAM MORES, Joliet, Illinois: Accounting: SAS 3, 4: Accounting Internship 4. KENNETH D. MOREY, Marseilles, Illinois: History, Sociology: Black- burn College. ELIZABETH MORGAN, Moline, Illinois: Elementary Education: Black- lzawk Junior College: Fine Arts Festival 3. LAURIE MORGAN, Glen Ellyn, Illinois: Nursing: Southern Illinois University: Delta Zeta 2, 3, 4: University Chorus: University Women's Clzoir. MARY MORIARTY, Crystal Lake, Illinois: Home Economics: UCB,- Newman Club: Home Economics Club. PATRICIA MORRISON, Chicago, Illinois: Elementary Education: Kap- pa Delta: YR: SAB: Wonzen's University Chorus. THERESA MORRELL, Elmhurst, Illinois: Nursing: SNO 1, 2, 3, 4, sec. 4 402 BRENDA MORRIS, Bement, Illinois: English, Theatre: Lincoln Col- lege: Phi Theta Kappa: Dranzatic Act. PAULA JANE MORSE, Addison, Illinois: Special Education, Deaf: Band I, 2. 3: CEC 3: Deaf Club 3, 4. DEANNE MOSER. LaGrange, Illinois: Physical Education, Business Education: Eclzoes 3: Delta Psi Kappa 2, 3, 4: Extramural Tennis 2: RA 3: Major-Minor Club 1, 2, 3, 4: Naiads Swim Club l, 2, 3. CHERYL MOSES, Villa Park, Illinois: Special Education, Visually Handicapped: CEC: Outdoor Club sec.: SEA. CHERYL MOSTEIKA, Oak Lawn, Illinois: Biology: Sigma Lanzbda Sig- ma 2, 3, 4, house manager 4. SANDRA MOTT, Roselle, Illinois: Special Education: NIU Student Wives 1, 2, 3: CEC 2, 3, 4: NEA 2, 3, 4. JEAN MOTTINGER, Yorkville, Illinois: Elementary Education: Aurora College: UCB: Choir: YR. MARSHA MOUNTAIN, Park Ridge, Illinois: Speech, English. MARILYN MOYE, Elnzhurst, Illinois: Journalism, Political Science: Kappa Delta l, 2, 3, 4: Little Sister of Minerva 3, 4. SUZANNE MROTEK, Chicago, Illinois: Physical Education, Sociology: WRA: Intramurals 1, 2, 3: Extramurals li. 2, 3: Delta Psi Kappa: Major- Minor Club l, 2, 3: UCB. JERRY MUCCIANTI, Oak Park, Illinois: Physical Education, Safety and Driver Education: Tau Delta Epsilon l. 2, 3, 4, sergeant at arms 1: Wrestling 1, 2, 3. Q JOANNE MUCHA, Villa Park, Illinois: Elementary Education. BERNARD MUCHIN, Rockford, Illinois: Accounting: Rock Valley Junior College: SAS 3: Weightlifting Club 3: Floor pres. 3, 4: Phi Delta Psi. TERESA MUDRAK, Cicero, Illinois: English, History: Newman l,2, 3, 4. SANDRA MUEHLHAUSER, Ottowa, Illinois: Elementary Education, Language Arts: William Wooa's College: SEA: Alpha Phi. JAMES T. MUELLNER, Chicago, Illinois: History, Library Science: Wright Junior College, Inter-America University: UCB Entertainment Committee: IFC, Judicial Committee: Phi Kappa Theta pres. LESLEY MUIR, Dundee, Illinois: Music Education: Sigma Alpha Iota l, 2, 3, 4, music clzrmn. 3, pres. 4: MENC: Wesley Lounge Club 3: Wesley Tour Choir 1, 2, 3, 4: CliH Queen 3: Concert Choir I, 2, 3, 4: Varsity Band 2: Opera Workshop 2, 4. DENISE MULCRONE, Niles, Illinois: English: St. Dominic College: McAuley Hall sec, 3: Committee for Excellent Teacher Award 3. JANET MULDER, Des Plaines, Illinois: Sociology, Psychology: Psy- chology Club 3, sec., Sociology Club I, 2, 3, 4: Sociology Undergrad- uate Advisement Committee 3, 4: Dorm Scholarship Committee 2. JUDITH MULLADY, Momence, Illinois: English, Speech: Karate Club: UCB Recreation Committee 2, Social Committee 3: SEA 3, 4: Dorm Council pres. 3. DANIEL MURPHY, Peuely, Missouri: Speech Correction, Psychology: Lincoln Junior College: UCB, Public Relations Committee: YR: Circle K. JAMES MURPHY, Chicago, Illinois: Marketing: AMA. JOHN MURPHY, Oak Lawn, Illinois: Economics. ROBERT MURRAY, Arlington Heights, Illinois: Physical Education, Business Administration: Wright Junior College,' Football l: Major- Minor Club,' SAM. KENNETH MUSZYNSKI, Chicago, Illinois: Physical Education, Driver Education: St. Joseph College: Varsity Football 2, 3, 4: Tau Kappa Ep- silon 2: Tau Delta Epsilon 3, 4, sergeant at arms 3, rush chrmn. 4. JOAN MYERS, Lacon, Illinois: Nursing: SNO I, 2, 3, 4, pres. 4. MARK MYERS, Toulon, Illinois: Accountancy: Intramurals l, 2, 3: AMA 3: SAS 3, 4. ROBERT MYERS, Ottowa, Illinois: History, Physical Education: Phi Sigma Epsilon: Track l, 2: Intramural Football I, 2, Basketball I, 2, 3, Swimming Z, 3. ANN NAGEL, Joliet, Illinois: Elementary Education: Joliet Junior Col- lege: SEA 2. PAUL NAGEL, Moline, Illinois: Sociology, Anthropology: Augustana College. LAURA NAGORSKY, Chicago, Illinois: Elementary Education: North- eastern Illinois State. LINDA NAGORSKY, Chicago, Illinois. 403 DONNETTE NAILOR, Pecatonica, Illinois: Special Education, Deaf: CEC I, 3, 4. DENNIS NANNINI, Oak Lawn, Illinois: Biology, Chemistry: AIBS. SANDRA NASH, Elmhurst, Illinois: Elementary Education, English. PHILIP NAUGHTEN, Evergreen Park, Illinois: Management: Wilson Junior College. DAVID M. NAYLOR, Joliet, Illinois: Biology: Joliet Junior College, Theta Chi 2, 3. 4, special events 3, historian 4. MARI NEIS, Crystal Lake, Illinois: Englt'sl1, Journalism: Norther pho- tographer: JSA 2. 3. 4. ARDINE NELSON, Franklin Park, Illinois: Art Education: Delta Phi Delta 3, 4, treasurer 3, 4. BARBARA NELSON, Oak Lawn, Illinois: Elementary Education, Art: SEA 2. DAVID NELSON, St. Charles, Illinois: Marketing: Phi Sigma Epsilon 2, 3, 4, social clzrmn. 3: Homecoming King 3: Varsity Track I, 2, 3: AMA 4: May Fete JuniorRepresentative 3. LAWRENCE ALAN NELSON, Caledonia, Illinois: Accounting: Rock Valley College,' SAS 3, 4. pres. 4: Delta Sigma Pi 3, 4, vice pres. 3. LINDA NELSON. Morton Grove, Illinois: Elementary Education, l rench: Delta Zeta 2, 3, 4: Little Sisters of Minerva 4: Cheerleader 3, 4. NORMAN NELSON, Belvidere, Illinois: Marketing, Finance: Rock Valley College: AMA: SAS. ROBERT NELSON, Lockport, Illinois: Speech Correction, Psychology: Illinois State University: Sigma Alpha Pi, treas.: Varsity Band: March- ing Huskies: Tau Lanthda Clti,' Flying Huskies, treas. WILLIAM NELSON, Wheaton, Illinois: History, Political Science: Christian Brothers College: Delta Upsilon 2, 3. 4. LINDA NEPIL, Western Springs, Illinois: Elementary Education,' Illi- nois College of DuPage: UCB. DOUGLAS NEPTUN, Peoria, Illinois: Biology, Chemistry: Warthurg College. JERI NESS, Genoa, Illinois: English, Music: Alpha Signtu Alplta I, 2, 3, 4: Pom Pon squad 2, 3, 4Q0l'Cl1l'SIl'fl I, 2, 3: Winter Carnival Queen finalist. KATHLEEN SUE NEWCOMER, Chicago, Illinois: Elementary Edu- cation, Sociology: Little Sister of Phi Sigma Kappa 3, 4: Dean's List 2. DIANE NEWELL, Harwood Heights, Illinois: English, History: Inter- varsity Clzristian I ellrm'ship l, 2, 3, 4: English Student Advisory Board 4. LINDA NEWELL, Chicago, Illinois: Business Education. NANCY NEWKIRK, .Ioliet, Illinois: Art: Joliet Junior College NAEA 4: SEA 4: SCC 2. 3, 4: Fine Arts Guild 2, 3, 4. CAROLINE V. NEWMAN, Kingston, Illinois: Mathematics, Chemistry,- University of Illinois: University Theatre, Delta Zeta. NANCY NEWMAN, Elgin, Illinois: Elementary Education: Elgin Com- munity College: NEA-SEA. ECFALD NEWQUIST, Roclzelle, Illinois: Accounting: SAS 3: Chess u 3. RICHARD NEWTON, Aurora, Illinois: Mathematics, Chetnistry: Dorm president 3: Intratnurals 1, 2, 3, 4: RA, Douglas Hall 4. GERARD NEYBERT, Chicago, Illinois: Earth Science: Wilson Junior College,' Student Government 1, 2: Swimming team l, 2: vice pres. Ca- duceus Premedical Club 1, 2: Floor vice pres. 3: CCC 3: NIU Sky Div- ers 3, 4: Newman Club 3, 4. SUSAN NICKELS, Chicago, Illinois: Art: Sigma Sigma Sigma 2, 3, 4. MYRON NIELSEN, Tampica, Illinois: Accounting, Finance: SAS 4: Intratnurals l, 2, 3, 4. EDWARD NIEMAN, Bedford Park, Illinois: Industrial Art Education: La Grange Junior College,' College of DuPage: EPT 4. TERRY NOE, Dolton, Illinois: Biological Science, Chemistry: Thornton Community College,' Sigma Pi 3, 4. JOYCE NOORLAG, Chicago, Illinois: Business Education: Alpha Sig- ma Alpha l, 2, 3, 4: rec. sec. 2. PAULA NOORMANN, Freeport, Illinois: History, Sociology: Highland Community College,' Middle Tennessee State University: Board of Stu- dent Directors I, 2: Tennessee Education Association. 4 CYNTHIA L. NORAK. Melrose Park, Illinois: Elementary Education, Music: Sigma Alplza Iota I, 2, 3, 4: MENC 1, 2, 3: NEA-SEA 3, 4: Uni- versity Clzorus l, 2: University Band 2. RAYMOND H. NORLIN, Hampshire, Illinois: Zoology, Clzenzistry. PATRICK NORTH, Crystal Lake, Illinois: Management, Marketing: Sig- ma Pi 1, 2, 3, 4: treas. 2, pres. 3: Wrestling I, 2, 3, 4, Frosli captain, Varsity 4. BONNIE NOVAK, Montfort, Wisconsin: Home Economics Etlucation: Wisconsin State University: Home Economics Club 3, 4. MELODY NOVAK, LaGrange, Illinois: Elementary Education: SEA 2, 3, 4: Dorm Council l, 2: UCB 3: Little Sister of Pl1i Kappa Sigma. GEORGIA NOVOTNY, Bartonville, Illinois: Englisli, Plzilosopl1y,' New- man 1, 2, 3, 4: AWS: NIU Student-Alumni Council 4: SEA 4: YR 1: English Club 4. KATHY NOVOTNY, LaGrange Park, Illinois: English, IIistory,' Col- lege of DuPage. RAYMOND NOWICKI, Calumet City, Illinois: Marketing: University of Illinois: Wilson Junior College: AMA 3, 4: UD 3,' SAM 4: Circle K 4. MARY JEAN NOWIK, La Salle, Illinois: Elementary Education: IUCC Junior College: ACE: AWS. HENRY NRZESINSKI, Clzicago, Illinois: Accounting: Thornton Junior College: Intramural Softball 3: SAS 3. ADRIENNE NUCKOLS, Chicago, Illinois: Elementary Education: His- tory: Delta Sigma Tlzeta 3, 4: Womenys Clzorus 2, 3: University Chorus l, 2, 3. JOHN NURRE, Downers Grove, Illinois: Marketing: Alplza Plzi Omega 2, 3, 4: Farwell Hall vice pres. 3: Intramurals l, 2, 3, 4: AMA 4. BARBARA NUSSLE, Lockport, Illinois: Special Education, EMH: Jol- iet Junior College. RAYMOND OBLOUK, Fairbanks, Alaska: History, Political Science,- Intramurals l, 2, 3, 4. JANICE OBRECHT, Geneseo, Illinois: Nursing: Inter-Varsity 2. ANNE O'CONNOR, Joliet, Illinois: Art Education: College of St. Fran- cis: Fine Arts Festival, publicity cltrmn. 3: Delta Phi Delta. Now, enjoy the last moments of the day's sun before the evening rain comes. 405 It has been said that every man has his own lasting formula for success LINDA O'CONNOR, Polo, Illinois: Journalisnig Alpha Phi Gamma 2, 3. 4: Nortltern Star 2, 3. 4: .ISA l, 2, 3, 4: Journalism Department Curriculum Conintittee 3, 4: Theta Sigma Phi 3, 4. ENRIQUE OCHART. Clticago, Illinois: Earth Seietieeq Soutlteast City College: Researeli Assistant,' Gamma Theta Upsilon. SHARON ANN O'CONNELl., Oak Forest, Illinois: Iflententary Educa- tion, Psyeliolog-v,' Dominican College. JANE O'DONOVAN, Evanston, Illinois: Special Ezlueation,' College of St. Teresa: Delta Zeta 2, 3. KATHLEEN OELSCHLAGER, lblarsilles, Illinois: History, Biology, Illinois Valley Community College. CATHRYN OETKE, Eltnlturst, Illinois: Nursing: SNO 2, 3, 4. MARTY OGBURN, Chillicothe, Illinois: hlatlienzaties, Business Ad- niinistrationq Intraniurals l, 2. 3. 41 RA 3. 4: lwlllll Club. EILEEN O'HARA, Chicago, Illinois: Nursing: Kappa Delta l, 2, 3, 4: SNO 1. 2. 3, 4: Elections Committee. VICKI OKONEK, Parl: Ridge, Illinois: Speech Correction, I:'len1entary Education: Alpha Xi Delta l. 2, 3, treas. 2: Pltilanthropic 3: Sigma Alpha Eta 3. 4: WRA I, 2, 3, 4: Newnian l, 2: Grant North Dorm Council l: NEA 3, 4. FRANK OLES, Chicago, Illinois: Political Science, History: Flying Hus- lsies l, 3: Italian Club 2: Intramurals 1. 3. JULIA OLMSTEAD. Libertyville, Illinois: Home Eeononzies Education: Unix'ersity of Minnesota' Home Economics Club 2. 3. 4: Home Ee. rep. l. 43 YR 3. PAMELA ANN OLSEN. Chicago, Illinois: Elementary EIlllCllll0ll,' Gam- nta Delta 2, 3, 4. ll't'tI.Y. 3, rice pres. 4. CHRISTINE OLSON, Newarlc, Delaware: History, Englislig Dorm Coun- cil I. 2. 3, pres. 3: Interlutll Council 2, 3: Living Learning Committee 3, 4: University Chorus 1, 2. 3, 4: Aa'visory Committee to President. JAMES OLSON. Wasco, Illinois: Industry and Technology: Elgin Com- munity College: EPT 3, 4: NISCC 2, 3, 4. JEAN OLSON, Oneida, Illinois: Physical Education, Sociology: Major Minor Club I. 2, 3, 4: RA 2, 3. NORMA OLSON, Moline, Illinois: Honze Economies, Art,' AWS 2. RIJBBIN OLSON, Rockford, Illinois: Medical Teeltnologyg University of I inois. MARGARET O'MALLEY, Wellington, Illinois: History, Sociology: Sauk Valley College. SUSAN O'MALLEY, Chicago, Illinois: Speech Correction, Psychology: University of Illinois Circle, Newman 3. MARGARET O'NEILL, Glen Ellyn, Illinois: Elementary Ea'ucation. MICHELE ONDERA, Midlothian, Illinois: Zoology, Cliemistryg Aurora College: Phi Sigma Society 4. ROBERT OPAL, Chicago, Illinois: Political Science, History: Band 1, 2, 3, 4: Pi Sigma Alpha 4: Cavaliers 4, treas. 4. ELLYN OPPENHEIMER, Chicago, Illinois: Elementary Education: Sig- ma Delta Tau 2, 3, 4, treas. 4, rush chrmn. 3, 4: UCB: Delta Upsilon Little Sister 4. BECKY ORDLOCK, DeKalb, Illinois: Elementary Education, Sociologyj RICHARD ORDLOCK, Niles, Illinois: Speech, History: Phi Sigma Kap- pa 2, 3, 4: Flying Huskies 1, 2, vice pres. l, 2: WNIU-AM 3: Foren- sics 3: Debate Teanz 3, 4. BARBARA O'REILLEY, Wheeling, Illinois: Journalism: Northern Star l, 2, 3, news editor 3, managing editor 3: Theta Sigma Phi 3, 4, treas. 3, 4: JSA 3, 4: Alpha Phi Gamma 1, 2, 3, 4. GARY OSBORNE, Moline, Illinois: Accounting: Blackhawk Junior Col- lege: Intramural Baseball 3, 4, Football 3: AMA 3: SAS 3, 4. MARY O'SHEA, Winfield, Illinois: Political Science, Sociology: Dorm Council 1: Political Science Undergraduate Association, sec-treas. 4. 406 JAMES OSKANDY. Oswego, Illinois: I-'iiiance, Econoinicsg AIWA 21 Finance Club 4. LINDA OSPALIK, Joliet, Illinois: Journalism, Political Science: Joliet Junior College: JSA 3. 4: Theta Sigma Phi 3. 4. Vice pres. 4 SYLVIA OSTERBERGER, Freeport, Illinois: Elenzenlary Ealueation: Highland Cominunity College. SONIA OSTERGREN. Aurora, Illinois: History, Biology: Lincoln Hall Dorm Council 3. JOANNE L. O'CONNOR, Dixon, Illinois: Special Etlucation, Physically Hanclicappecl: Dorm Social Committee l: CEC 2. 3. AL OSTERMAN, Niles, Illinois: Finance: Sigma Phi Epsilon 2, 3. 4. 5, pledge boarcl 5, alumni sec. 2, 3, 4, historian 2. 4, purcliuser 3. 4: Fi- nance Club 3. 4. MARK OSTREICHER. Chicago, Illinois: Marlfeting, Finance: Sigma Alpha Epsilon l, 2, 3, 4, plezlge trainer, athletic chrnin., social chrinn.,' Baseball l, 2, 3: Football 2: Intran1in'al Football, Baslfethall, Baseball. JANET OSUCH, Molfena, Illinois: Mezlical Tecliiiologyp Phi Sigma So- ciety, Mu Tau Chi: Student Coniinittee for Peace. JANICE OTT, Barrington, Illinois: Textiles aiul Clothing, Business: AWS Basketball 2: Home Economics Club 3, 4: Phi I?eta.Luinbzla 3: SAM 3. HOWARD ALLAN OVERHAUG, Maple Park, Illinois: History, Physi- cal Eclucationg Wisconsin State Unix'ersity,' Football l. CHARLENE OVERLEY. Chicago, Illinois: Sociology: Bogart Junior College: Intraniural Volleyball: Dorni Social Coinniitteeg Sociology Club. DENNIS PATRICK OWEN. Des Plaines, Illinois: Management, Pre- Law: Alpha Phi Omega 2, 3. 4, pres. 4: Sigma Iota Epsilon 4: SAM l, 2, 3, 4: Dorin Council pres. 3: Cavaliers 3, 4: IJean's List: Intramural Bas- ketball, Softball, Football I. 2, 3, 4. GREG PACELLI, St. Charles, Illinois: PoliticalScience, History: SAB,- SA, senator: Signza Alpha Epsilon, rush chrinn., pres. JUDITH PAEGLOW, Rolling Mearlows, Illinois: Eleinentary Ezluca- tion: SEA. PHILIP PAGE, Chicago, Illinois: Accountancy: 0Hicial's Club pres. 4: Inti'an1ural Senior Supervisor 4: Phi Kappa Theta 2. 3. 4. DAVID PAHL, Chanzpaign, Illinois: Economics, Political Science. DENNIS PAIGE. Scltauinbuig, Illinois: History, Sociology: Intrainural Baseball I. 2, 3, Football I, 2, 3. Basketball lg UMUC Coinniittee. ROBERT PAKENHAM. Earlville, Illinois: Electronics Teclinologsy' Illi- nois Valley Coininunity College: IEEE. SALVATORE PALANDRI. Elinhurst, Illinois: Accouiitaiicyf Univer- sity of Illinois: SAS 2, 3, 4. JOSEPH PALU MBO, Bellwoozl, Illinois: Speech-Theatre, Englislig University Theatre 1, 2. 3. 4: UCB 2. WILLIAM PANEK, Chicago, Illinois: Marketing: Theta Chi 2, 3, 4: AMA ,' Intramurals I. 2. JOHN PAPADIA, Chicago, Illinois: Marketing: AMA l, 2, 3, 4 LINDA PAPPAS, Argo-Suniinit, Illinois: Journalism, Home Economics,- Bradley University: Chi Omega 2, 3, 4, asst. pleclge trainer 3, pres. 4: Nortlzern Star 3, 4, copy desk 3, librarian 43 JSA 2, 3, 4: Theta Sigma Phi 3, 4: Greek newspaper 4, news editor. GERRY PAPROCKI, Oglesby, Illinois: Business Erlucationg Illinois Val- ley Community College. WAYNE PAPROCKI, Oglesby, Illinois: Business Ezlucation: Floor Pres. 1, 2: Dorm Council l, 2, pres. 3, sec. 3: Farwell Bowling League: Intra- murals 1, 2, 3: Presulential Council 3. KAREN PARDA, LaGrange Park, Illinois: Elementary Education, Hu- nianitiesj Lyons Township Junior College I, 2: SEA 3, 4. CAROL PARISH. Arlington Heights, Illinois: Elementary Education, Art,' Wonzen's Clzorus l. 2. 31 Alpha Delta Pi 1. 2, 3, 4, rush chrntn. 3, reporter-historian 2. DON M. PARK, Aurora, Illinois: Accounting: SAS l, 2. 3, 4g Math Club 3: Phi Eta Sigina: Dean's List 31 Intramural Basketball 3, 4. Volleyball3. KENNETH PARKER, Chicago, Illinois: Management, Accounting: Loop Junior College: SAM. DONALD PARTIPILO, Chicago, Illinois: Math, Business Adminis- tration. CARROL PASCUS, Broaa'1'iew, Illinois: Elenzentary Education, English: SEA-NEA 4. MARY PASKVAN, Chicago, Illinois: Pliysical Ea'ucation, Bogart Junior College: Major-Minor Club: UCB: WRA,' Extramural Volleyball l, 2, 4, Volleyball sportsleader 2. 4 LEROY PASTERNAK, Chicago, Illinois: Economics, Business Aa'- nzinistration. ROBERT PAVEL, Berwyn, Illinois: Sociology, Political Science: Mor- ton College. JAMES PAZDUR, Calumet City, Illinois: Microbiology, Cliemistryg Alpllll Phi Omega 3, 4: UCB 3, 4. GERALD PEARCE, Lisle, Illinois: Finance: University of Illinois Circle,- Western Illinois University. KIMBERLY PEARCE, Homewood, Illinois: English, Sociology: Sigma Lamhzla Sigma 4. GAYLE PEARSON, Chicago, Illinois: English, Sociology: Taylor Uni- versitv. RONALD PEARSON, DeKalb, Illinois: Physical Ezlucation, Drivers Eilucation: Sigma Pi 2, 3, 4: Men's Physical Ezlucation Association I, 2, 3, 4. oflicer 3. 4: Football I: Wrestling I, 2, 3, 4: llonorary Atltletic 4: Intramurals I. 2. 3, 4. DENNIS PEDDILORD, DeKalb, Illinois: Biology, Chemistry: Southern Illinois University. SHARON PEDE. Clarenalen Hills, Illinois: Elementary Ezlucationq Sig- ma Lambtla Sigma 2, 3. 4. rec. sec. 3. 4: UCB 3, 4: SEA 3, 4. JAMES PEHTA, Glen Ellyn, Illinois: Finance: Arizona State University. DIANE PEIFFER, Genesco, Illinois: Special Education, EMH: UCB: NEA: CEC: Sigma Sigma Sigma: Homecoming Committee 4: 1970 Sen- ior Class Project Planning Committee. ROBERT PELLINO. Prospect, Illinois: Marketing: AMA I, 2, 3. KAREN PELLMAN, West Duntlee, Illinois: Elementary Ezlucation, So- ciology: Delta Zeta 1.2.3, 4: IEA: NEA. CHRIS PEPOL, Chicago, Illinois: Social Sciences, History: Wilson Jun- ior College: ISA: John Howartl Association: American Civil Liberties Union: YR. KATHLEEN PEPPERS, Rockford, Illinois: Special Etlucation, EMH: Rock Valley Junior College: CEC I. 2. 3. 4: Dorm Council I, 2, social chrmn. 2. PENNY PERHAM, Chicago, Illinois: Special Eilucation: Wright Junior College: CEC 3. DAVID PERILLO. Chicago, Illinois: Marketing: Intramurals I, 2, 3, 4: FIO 4: Paupers I, 2, 3: AMA 4. DONALD P. PERRY. Harvey, Illinois: Biology: Thornton Junior Col- lege,' Yale University. RICHARD PERRY, Evanston, Illinois: Speech, English: Kendall Col- lege: Xi Theta Xi, pres. 2. WILLIAM PERRY, Carpentersville, Illinois: Marketing, Economics: Sig- ma Alpha Epsilon I, 2, 3, 4:11-'C 2, sec. I, 3, 4, rush chrmn. ROBERT PERVEILER, Chicago, Illinois: Earth Science: University of Illinois Circle: Gamma Theta Upsilon 3, 4. CAROL PETERSEN, Chicago, Illinois: Business Education: University of Illinois Circle,' Pi Omega Pi, DANIEL PETERSEN, Clinton, Iowa: Accounting: SAS I, 2, 3, 4: Intra- murals 2, 3: RA 3. MARY PETERSEN, Arlington Heights, Illinois: Elementary Educa- tion, Sociology: UCB 3: AWS 2, 3: Canterbury I, 2, 3: University Wom- en's Chorus 2, 3. PAULETTE PETERSEN, Serena, Illinois: Elementary Ezlucation: SEA: NEA 2: Echoes 3. JEANYEETERSON, Willow Springs, Illinois: History, Political Sci- ence: . LAURA PETERSON, Barrington, Illinois: Elementary Education: Val- paraiso University. NANCY PETERSON, Harvard, Illinois: Music: Concert Choir I, 2, 3, 4: Chorus I, 2, 3, 4: Madrigals 2, 3: Wesley 1, 2, 3, 4: Cliff Queen 4: Sigma Alpha Iota I, 2: social chrnzn. 3, program chrmn. 4: MENC 2, 3, 4. THERESA PETERSON, Elgin, Illinois: Home Economics Etlucation: Dorm Council 2. ANN PEYRONNIN, Deerfield, Illinois: Elementary Education, History,- Chi Omega 3, 4, chapter correspondent 4: Newman 1, 2, 3, 4: NEA 2, 3, 4. FREDERICK PFEIFFER, Oak Lawn, Illinois: Management: Officials Club I, 2, 3, 4: Shorei-Goju Karate 2, 3: Intramurals 1, 2, 3, 4: Football, Basketball, Volleyball, Softball. MICHAEL PFEIFFER, Oak Lawn, Illinois: Management: Ofbcials Club 1, 2, 3, 4: Shorei-Goju Karate Club 3, 4: Dorm Council I, 2: Intra- murals l, 2, 3, 4, Football, Basketball, Baseball. 8 People inaeourately being people, almost always a little more than less. GAIL PFLUM, Naperville, Illinois: Elementary Education, Sociology, SEA 3, 4: Dornz Council 2: AWS rep. l. DONNA PHILLIPS, Park Ridge, Illinois: Elementary Education, Eng- lish: Sigma Kappa 1, 2, 3, 4, vice pres. 4: Panhellenic rep. 3: AWS: SA Election Committee 3, 4: NEA. MICHAEL PHILLIPS, Rockford, Illinois: Graphics and Advertising De- sign: Wisconsin State University Whitewater: Freeport Community Col- lege: Delta Phi Delta. NANCY PIASECKI, Chicago, Illinois: Elementary Education: Morton Junior College: St. Procupius College. PEGGY LEE PICCO, Spring Valley, Illinois: Business Education: Illi- nois Valley Community College: UCB 3. SUSAN PICK, Chicago, Illinois: Home Economics, English: Alpha Omi- cron Pi 2, 3, 4, costume chrmn., Showtime 2, activities chrmn. 3: Dorm Council l. WILLIAM PILKINGTON, Elk Grove Village, Illinois: Political Sci- ence, History: Tri Swine Omega: Students for Kennedy 2: YD 3, 4: Dorm vice pres. 3, pres. 4: Photo Service l, 2: Political Science Undergraduate Advisory Committee 4: Selection Committee, College of Education Dean: Kennedy Action Corps 3: Living-Learning Coordinating Committee. ROBERT PINTA, Chicago Ridge, Illinois: Accounting: Tau Delta Epsi- lon 2, 3, 4: SAS l: Intramurals 3, 4. ' LINDA PINZKE, Des Plaines, Illinois: Biology: Pleiades 4: SA: Internal Affairs Committee 3, 4: Sigma Zeta 3, 4: UCB Entertainment Commit- tee 3, 4: SAB Election Committee l: Dixon Volunteers 2: Winter Car- nival 4. JOANNE PIOTROWSKI, Cicero, Illinois: Elementary Education: AWS: OCCO: Chi Delta Chi. SAM PIRRELLO, Rockford, Illinois: Management. FRANCINE PISAREK, Alton, Illinois: English, Psychology: St. Xavier's College: Ski Club 4: Sigma Tau Delta 3, 4. THOMAS PITELLO, Forest Park, Illinois: Social Sciences, History: Orientation RA 2, Grant North pres. 3. GEORGE PLACHER, Lostant, Illinois: Geology, Chemistry: Kendall College: Geology Club 3, 4, pres. 4. JANET PLANZ, Chicago, Illinois: English, Sociology: Wright Junior College: Bowling League. STEVEN PLETSCH, Granville, Illinois: Geography, History. DONALD PLOCHOCKI, LaSalle, Illinois: Management: Illinois Val- ley Community College: Phi Beta Lambda 3, 4: SAM 3, 4. MARY PLUNKETT, Chicago, Illinois: Elementary Education: Illinois Teachers College: SEA 4. OLGA POCHODENKO, Melrose Park, Illinois: Elementary Educa- tion, Biology,' AWS rep. I: Judicial Council 2: floor pres. 3: Dorm Council 3. LARRY POGOFSKY, Lincolnwood, Illinois: Finance: Phi Epsilon Pi, soc. chrmn.: AMA. MARCIA POLCHOPEK, Oak Lawn, Illinois: Home Economics Educa- tion,' Alpha Sigma Alpha 2, 3, 4, sec. 3, 4: May Fete rep.: Daughter of the Seven Stars 3, 4. JERRY POLIVKA, Hanover Park, Illinois: Spanish, History: Elgin Com- munity College: Universidad de Valencia: International Club. ROBERT POINDEXTER, Aurora, Illinois: Journalism, History: Lyons Township Junior College,' Waubonsee Community College: Sigma Delta Cl1i,' JSA: Northern Star. HARVEY POKORNY, Chicago, Illinois: Geology: Intramurals 1, 2, 3: ACU Chess Team 1. RONALD POPE, Moline, Illinois: History, Economics: Black Hawk College: SEA 4. LINDA POPLE, Wheaton, Illinois: History, English: Bradley University. ARLENE PORCARO, Niles, Illinois: Elementary Education: Delta Zeta 2, 3, 4: Pom Pon Squad 3: SEA 2, 4: Dauglzter of the Crossed Swords 3, 4. DALE PORN, Chicago, Illinois: Physical Education, Drivers Education: Phi Sigma Epsilon l, 2, 3, 4: Norther: Basketball 2, 3: Baseball 2, 3: Football 2: Intranzurals I, 2, 3, 4. 409 Patterns of overpopulution and zuzclerdevelopinent direct us toward our destiny I .f ' fag X . V SANDRA PORTER, DeKalb, Illinois: English, Driver Educzifiong AWS 2, 3, 4. ROBERT POSPISCHIL, South Beloit, Illinois: Mf1IIIIAL'l'lIIl'IIl,' Rock Val- ley Junior Collegeg SAM 41 Inlrmnurnl Football 2, 3, 43 M!lIIt1AL'l'I7IL'I1f Consultant Colnlnittee. SANDRA POWELL, Rockford, Illinois: Eurlh SClf'I1C'l',' Gainrnn Theta Upsilon 3, 4. RICHARD POTENZA, DOI1'IIf'I'.X'kGI'0I'C', Illinois: Eeononiics' Sigma Alpha Epsilon, song Chrnzn., soeizil ehrinn., 1'ice-pres.: Unix'ersity The- uIrz',' UI1Lll'l'Ql'HtIlIUlC Student Ailvisory Conzniirteeg UCB: Winter Car- IIIl'lIl,' Italian Club, pres.,' Econonzics Club, pres.,' Dorin Council. TERRANCE POUCHER, Blue Islurul, Illinois: MlIl'kL'llI1tQ,' Them Chi. DONALD POWER, Franklin Park, Illinois: Pliysieul Eeluculion, His- roryg Major Minor Club l, 2, 3, 43 Wrestling lg OHiciul's Club 3, 4, Intra- murals I, 2, 3, 4. JACKIE PRATER, East Ilfiielcrest, Illinois: Ell'IIIt'IllIII'-V Educaliong Alpha Chi Omega 3, 43 UCB, public relulions 3, 45 AWS I, 2, 33 Campus Crusrule for Christ 2, 3, SEA 4. MARGARET PRATT. Roclfforzl, Illinois: Elementary Education, So- ciology: Pi Lanibfla Them 3, 4, Leadership Conzinirtee chrinn., vice press' SEA 4. DONNA PRENNER, Des Plaines, Illinois: Mrztlienzalies, Psycliologyg RA 2. 31 Cwens 2. SUSAN MARIE PRESTON, Vero Beach, Florida: English, Library Sci- eizc.'e,' Dorm Council l. 2, 3: Inter-Dorm Council 31 UCI1' l, 2, 3, 41 Stu- dio Theulre 3. ELLEN PROHASKA, Rozrkforfl, Illinois: Anthropology, Alverno College. LINDA S. PROKOP, Cvllflftlllfll, Illinois: Elenienlury Education, Sociol- ogyg NEA 3, 4. 410 GEORGIANA PROKSA, Oak Park, Illinois: Nursing. JOHN PRUSILA, Waukegan, Illinois: History, Political Science, Intra- murals 2, 3. WILLIAM PRY, Mettdota, Illinois: Social Science, History, Illinois In- stitute of Technology, UCB 3. CYNTHIA PRYOR. CHERYL PUCKETT, Aurora, Illinois: English, Political Science, Eastern Illinois University, Phi Sigma Alpha 3, 4: Sigma Tau Delta 3, 4: Towers 3, 4: UCB 2: JSA 2: Italian Club. JOHN M. PUGH, Rockford, Illinois: Management, SAM, Alpha Phi Omega 4, 5: Rugby Club 5: Intramurals l, 2, 3, 4. SUSAN KRAMER PUGH, Niles, Illinois: Biology, Sigma Sigma Sigma 2, 3, 4, house manager 3, 4: Dorm Council 1, 2, pres. 2. DONA PUERACKER, Watseka, Illinois: Psychology, Mathematics. FRANK PUTZ, Berwyn, Illinois: Marketing, Morton Junior College, Bogart Junior College. KENNETH PUTZ, Villa Park, Illinois: Political Science, Sociology, St. Procopius College, Chess Club 3, 4: Political Science Dept. Advisory Committee 3, 4. DARLENE PYKTEL, North Chicago, Illinois: Elementary Education, Humanities, St. Charles Tutor 2. CYNTHIA PYTEL, Cicero, Illinois: English, History, Morton Junior College. ANITA QUANE, Chicago, Illinois: Elementary Education, Wriglzt Junior College, SEA 2, 3, 4. BILL QUANTOCK, Aurora, Illinois, Marketing, Intramurals I, 2, 3, 4: Officials Club 4: Kappa Chi 2, 3: Sigma Phi Epsilon 4, vice-pres. 4. ROBERT QUEBBEMAN, Glen Ellyn, Illinois: Music, Phi Mu Alpha, treas. 3, pres. 4: Band 1, 2, 3, 4: Orchestra 3, 4: Choir 3, 4: Cavaliers 4: Fine and Applied Arts Constitution CIUIIIIIIIIICC' 3, 4: MENC 3, 4. LOIS QUICK, LaSalle, Illinois: English, Sociology, Illinois Valley Com- munity College. DOYLE QUIGGLE, Rochelle, Illinois: Business Management, Political Science, Highland Community College, Veteran's Club. PAT QUILLINAN, Chicago, Illinois: Elenzentary Education, Chicago Teachers College, ACE, SEA, Kappa Delta Pi. ALBERT QUIRIN, Aurora, Illinois: Mathematics, Economics, Varsity Golf 2, Intramurals 1, 2, 3, 4: Phi Eta Sigma 1, 2, 3, 4: Sigma Zeta 3, 4: Cavaliers 4: Math Club 3, 4. LYNNE RABE, Skokie, Illinois: English, Sociology, Northeastern Ill- inois State, Delta Sigma. BRUCE RABIN, Skokie, Illinois: Business Education, Mayfair City Col- lege 2: Hillel l, 3, 4: UCB Movie Committee 3, 4. WILLIAM L. RACKOW, Bedford Park, Illinois: Chemistry, Mathema- tics, Chemistry Club 4: Intramurals 1, 2, 3, 4: Outdoors Club 1. MARY JANE KNEEN RADTKE, Geneso, Illinois: History. KEITH RAFTREE, Freeport, Illinois: Marketing, Highland Community College, SAM, AMA 4: Phi Mu Alpha. RUTH RAGNES, Morris, Illinois: Home Economics,' Jolliet Junior Col- lege, SEA I, 2, pres. 2: Home Economics Club 3, 4. MARILYN RAGUSA, Norridge, Illinois: English, Geography, Dorm Council 2, 3: Floor publicity chrmn. 2: Newman Club 2, 3: Gamma Theta Upsilon 3, sec. 4: UCB Entertainment Committee. BARBARA RAHN, Elgin, Illinois: Nursing, Sigma Kappa 1, 2, 3, 4, treas. 3, scholarship chrmn. 4: Pom Pon Squad. DAVID RAKE, Chicago, Illinois: Management, SAM, SAS, YR, Alum- ni Association. JEFFRY RATKOWSKI, Danville, Illinois: Management, Dorm vice- pres. 3. JANIS RATHJE, Manteno, Illinois: Elementary Education, Math, Alpha Omicron Pi 1, 2, 3, 4, treas. 3: May Fete co-chrmn. 3, Island Act Co- chrmn. 2. ALAN RAWLS, Hillside, Illinois: lndustry and Technology, Phi Sigma Kappa 2, 3, 4, vice-pres. 2, 3, social chrmn. 2, 3. BARBARA RAYCRAFT, Calumet City, Illinois: Elementary Educa- tion, Purdue, University. 411 I bet all this red tape is to keep the university employees busy. DONNA REARDON, llflount Prospect, Illinois: Marketing: Della Zeta 2, 3, 4g AMA 3. 4. LAURICE REAVER. Dixon, Illinois: Elementary Education: Sauk Val- ley Junior College. PAT REDDINGTON, Chicago, Illinois: Ilistory, lfIIAL,'lI.YII,' Alpha Chi Omega 2, 3, 4, Ways anzl llfleans C'lIl'lIIIl 3, e,x'ee11tire eo-ordinator 4: Grant North Dorm, soc. chrmn, lg Douglas Ilall Council 3: Greek Week Colnlnittee 4. RENEE REDLICH, Milwaulsee, Wisconsin: Special Education, Deafq Lincoln Junior College, UCB5 CEC5 ITIIl,' Judson Fellowsliip. RICH REDMAN. Homewood, Illinois: Ilistory, Soeiololgyq SA ,' Douglas Hall Dorm Council, ehrmn. scholarship committee, judiciary lioardg In- ternal Affairs Committee. SUSAN F. REED, Evergreen Purls, Illinois: Ilome Economies, Psy- clzologyg Alpha Phi: Lincoln Ilall Dorm, social clirmnf Child Develop- ment Area Club. PERRY REEL, Paw Paw, Illinois: Marlfetingf Eastern Illinois Univer- sity, NISCC, pres,,' NIU Karate Clulvq NIU lllarlxeling Cluli. TONY REES, Moline, Illinois: Aceoantiiigq Blucly Ilawlf Collegeq Phi Kappa Sigma: SAS,' Student Advisory Board to Accounting Department. KAREN REESE, Arlington Heights, Illinois: Art, Education: Lincoln JIIIIIOI' College: YR 3, 4. PATRICK REGIS, Joliet, Illinois: Electronic Teclznologyg Joliet Junior Collegef IEEE 4. CLIFFORD REI-IBERG. Peotone, Illinois: Management: Prairie State College. DONNA REID, Arlington Heights, Illinois: Theatre, English: Alplza Delta Pi 2, 3, 4. viceepres. l. pledge trainer 3, 4. SUSAN REID, Chicago, Illinois: llfledical Technologyq Clarke Collegeg Medical Technology Club 3, 41 Newnuin l ,2, 3. 4, VALERIE REILLY, Aurora, Illinois: Elementary Education. THOMAS REINEMANN, DeKalb, Illinois: Physical Education, Bi- ologyf Men's Physical Education Assoeiation,: Intramurals. KAY REKAU, Steger, Illinois: Mathematics, Accounting, SEA l, 2: UCB 3, 4, promotion ehrmn. 3. PATRICIA RENNER, Libertyville, Illinois: Marketing. SUSAN REYNOLDS, Chicago, Illinois: Elementary Education, So- ciology. E. J. RHODES JR., Skokie, Illinois: Accoiuztingg Wright Junior Col- legeg Amundise-Mayfair Junior College. DEBRA RIBBLE, Dixon, Illinois: Nursing, SNO 1, 2, 3, 4. LINDA RICE, Dundee, Illinois: Eeletnentary Education, Aurora Col- lege: UCB Dance Committee 1: Dorm rep. l. DEBORAH RICH, Saunenzin, Illinois: Nursingg SNO. LYNN RICHARDS, Wilmette, Illinoi.s: Elementary Education, Musicg ge Paul University: Alpha Omicron Pi l, 2, 3, 4: Kappa Delta Pi 3, 4: EA 4. JEFFREY RICHARDSON, Oak Lawn, Illinois: Psycliologyg St. Mary of tlze Lake Seminary. NORMAN RICHTER, Elgin, Illinois: Accountingg Elgin Community College, SAS 3, 4. KEITH RIDDELL, Chicago, Illinois: Mathematics, Plzysicsg UCB,' Phi Kappa Sigma. CHERYL LYNN RIEKEN, Mount Morris, Illinois: Art. GEORGANN RING, Chicago, Illinois: Elementary Education, Uni- versity of Illinois Circleg SEA. 412 3 1 .I x fi Z K 2 E , 2? ff , ' ? gi? 5 is 8' ii as Q E s ,ww W 1: NH-in wwmmfwm ,Q 5 . M 2 si MQ V 'I E A5 Pia? kan 5 wg 1452 Hi? if-iggk 31331 l Six 5313 PAUL RINGSTROM, Joliet, Illinois: Matlzematics, Chemistry, Joliet Junior College, Phi Sigma Kappa 2, 3, 4, alumni chrmn. 3, 4, house manager 3, 4. KATHLEEN RIORDAN, Deerfield, Illinois: Physical Education, Ele- mentary Education, Major-Minor Club 1, 2, 3, 4, WRA publicity chrmn. 4, Extramural Golf team 1, 2, 3, 4, Extramural Volleyball Team 3, 4. JUDY RISILY, Niles, Illinois: Englislz, Spanish, Sigma Delta Tau, Towers. DIANNE RISSER, East Peoria, Illinois: Biology,' Wildlife Society 4. SUSAN RITTER, Harvey, Illinois: Political Science, History, Thornton Junior College, YR 3, 4, Stevenson North Dorm Council 3, Floor pres. 3. KAREN ROBBINS, Park Ridge, Illinois: Elementary Education, Uni- versity of Kentucky, Alpha Lambda Delta. NANCY ROBERTS, Berwyn, Illinois: Elementary Education, Morton Junior College, Homecoming Queen's Court 1968. EVELYN ROE, Midlothian, Ilh'nois: Elementary Education, Sociology, UCB 3, Kappa Delta Pi 3, 4, Pleiades, 4, RA 3, 4. THOMAS ROEGNER, Blue Island, Illinois: Marketing, Trinity Chris- tion College, Illinois Institute of Technology, AMA 2, 3, 4, SAM 1. RUSSELL ROHRS, Barrett, Illinois: Zoology, Chemistry, Intramurals 2, 3, 4, IFC exec. council 3, 4, May Fete 3, 4, Greek Week chrmn 4, Plzi Sigma Kappa 2, 3 pres. 4. GERALD RONSPIES, Chicago, Illinois: Accountancy, Thornton Junior College. DARYL ROOS, Beason, Illinois: Accounting, Intramurals. PATRICIA ROSE, Chicago, Illinois: Psychology, University of Illinois, Chicago Circle, Dixon Volunteer. NANCY ROSENACKER, Cincinnati, Ohio: Sociology, History, Marian College, Class Social rep. 2, Sociology Club 3, 4, UCB 3, 4, NEA 1, 2, 4, ANNETTE ROSENOW, Morrison, Illinois: Nursing, SNA 1, 2, SNO 3, 4, RA 3 1970 Senior Class Project Planning Committee. RUTH L. ROSENTHAL, Morton Grove, Illinois: History, Political Science, Sigma Delta Tau 2, 3, 4, social chrmn. 3, Panhellenic Council 3, 4. TOM ROSE, Chicago, Illinois: Physical Education, Driver Education, Football 1, 2, 3, 4, Intramurals 1, 2, 3, 4, Tau Kappa Epsilon 1, 2, 3, 4, Tau Delta Epsilon 2, 3, 4, pres. 2, Men's Plzysical Education Major- Minor Club 1, 2, 3, 4, sec. 4. DIANE ROSGA, Niles, Illinois: Mathematics, Psyclzology, Kappa Delta 1, 2, 3, 4, treas. 3, 4, Pom Pon 2, Outdoor Club 1. ELOUISE ROSOL, Maywood, Illinois: Speech, Theater, Saint Dominic College, Orchesis 3, University Theater 3, 4, Forensics 3. IUNE SCHOEPKE ROSS, Arlington Heights, Illinois: Elementary Education, Sociology, Dorm Food Service 2, 3. SUSAN ROSS, Chicago, Illinois: Zoology, Chemistry, Drake University. ALBERT R. ROSSI, Chicago, Illinois: Political Science, History, Loyola gIgQ1egsity,' Undergraduate Political Science Advisory Committee 3, 4, DAVID ROSSI, Chicago, Illinois: Social Science, History, Tlzeta Chi 2, 3, 4, social chrmn. 3, 4, Intramurals 1, 2, 3. VICTORIA ROSSI, LaGrange, Illinois: English, History, College of DuPage. RONA ROTHENBAUM, Chicago, Illinois: Elementary Education. BEATRICE ROSY, Chicago, Illinois: Marketing, Wright Junior Col- lege, UCB 4, AMA 3, 4, Marketing Student Advisory Committee, sec. 4. PAMELA ROUSE, Danville, Illinois: Elementary Education, Philosoplzy. TOM ROUSE, Moline, Illinois: Marketing. KURTIS ROWE, Elgin, Illinois: Mathematics, Plzysics,' Elgin Com- munity College. CHRISTINE ROZAKIS, Clzicago, Illinois: History, English, Dorm recreation chrmn. 1, Norther 1, 2. MONA RUANE, St. Charles, Illinois: Elementary Education, Social Science. SHARON RUBIN, Chicago, Illinois: Speech Pathology, Sigma Alpha Eta 2, 3, 4, publicity chrmn. 3, 4, Dorm Council 1, 2, WRA. 414 ' ear, prejudice, ignorance' our year fight and you've only made a dent. MARCY RUDSINSKI, Iluntley, Illinois: Ilome Economics: Illinois State University: Home Economics Club 2, 3, 4: Winter Carnival Com- mittee 2. LYNN RUMEL, Addison, Illinois: Elementary Education, Sociology,- UCB Entertainment Committee 4: 1970 Senior Class Project Planning Committee. MARY JO RUNNING, Arlington Heights, Illinois: Elementary Edu- cation, Sociology: Alpha Delta Pi l, 2, 3, 4, corres. sec. 2, second vice- pres. 3, 4: SAB 2. CYNTHIA RUPPRATH, Chicago, Illinois: History, Art: Alpha Sigma Alpha 2, 3, 4, editor 3: Delta Phi Delta 3, 4: Phi Alpha Theta 3, 4: Cwens 2. CHERYLL RUSZAT, Riverside, Illinois: Home Economics: Delta Gamma l, 2, 3, 4, pledge class pres. l, vice-pres, rush chrnm. 2, 3: Pom Pon 2, 3, 4. RICHARD RUSZAT, Riverside, Illinois: Marketing,' Sigma Phi Epsilon 2, 3, 4, pledge class pres. 2. JAMES RYAN, Streator, Illinois: I inance,' Saint Procopias College: Intramural Sports 3, 4. PATRICIA RYAN, Harvard, Illinois: Elementary Education. VICKI SAAS, Chicago, Illinois: Elementary Education: University of South Dakota: Alplza Xi Delta 1, 2, 3, 4, rush chrmn. 3, pledge trainer 4: Homecoming Committee royalty chrmn. 3, 4: University Women's Chorus 2: Little Sister of Minerva, 2, 35 SEA 4. KENNETH SACHSEL, Chicago, Illinois: Finance: Colorado Alpine College. BEVERLY SAELENS, Hillsdale, Illinois: Elementary Education: SEA 3, 4. WALLACE SALABURA, Chicago, Illinois: Industry and Technology: Thornton Junior College. LYNNE SALO, Waukegan, Illinois: English, Spanish, Political Science. BETTIE SALTZMAN, Chicago, Illinois: Medical Technology: Medical Technology Club: Echoes. ALICE SAMILOW, Waukegan, Illinois: English. JAMES SAMPLES, Downers Grove, Illinois: Business Management: SAM. MANUEL SANCHEZ, Chicago, Illinois: Political Science, Education: Cavaliers 3, 4: SA 1, 2, 3, vice-pres: Phi Delta Psi 2, 3, 4, pres.: rush chrmng Pi Sigma Alplta 4: Intramurals I, 2, 3, 4: Committee on Com- mittees clzrmn. 2, 3: Internal Affairs Committee 3: May Fete 2, 3: Win- ter Carnival 2, 3: Dorm pres. l. BEVERLY SANDERS, Westmont, Illinois: Elementary Education, Mathematics. ROBERT SANDORA, Chicago, Illinois: Accounting: Delta Upsilon 2, 3, 4, treas. 3: Varsity baseball 1, 2: Intramurals 1, 2, 3, 4. KATHRYN SANDVICK, Newark, Illinois: Elementary Education: Joliet Junior College. CHERYL SANFORD, Rockford, Illinois: Speech-Theatre, Sociology: Afro-American Cultural Organization 2, 3, 4: WNIU 4: Black Arts Festival Drama Director 2, 3, 4: Assistant Director 4: Stage Manager I, 4: Acting l, 3, 4: Black Tlzeatre History 3, 4: Studio Theatre Play Director 4. RICHARD SARAGA, Lisle, Iliinois: Geography: St. Procopius Col- lege, Western Illinois University: College of DuPage: University of Illinois Chicago Circle. JOHN SATTERTHWAITE, Rockford, Illinois: Marketing: AMA 3, 4: SAS l,' Michigan State Computer Games Team 4. DONNA SAVITZSKY, Elementary Education, Speech: Sigma Delta Tau 2, 3, 4: Spirit and Publicity chrmn. 3, 4: SEA: NEA: IEA 4. ANNA SCANLON, East Hazelcrest, Illinois: Art,' Thornton Junior College. KATHY SCARRY, Palos Park, Illinois: Nursing: SNO 4. THOMAS SCARTOZZI, Riverdale, Illinois: Psychology: Thornton Junior College. KAREN SCATURO, Morton Grove, Illinois: Special Education, Ele- mentary Educationg Wright Junior College: CEC 3, 4: SEA 3, 4. MARTHA SCHAAFSMA, South Holland, Illinois: Elementary Educa- tion, Kappa Delta 2, 3, 4, Kappa Delta Pi 3, 4: UCB lg SAB, womenfs rep. 2, 3, Homecoming Committee 2: Pleiades 4. MARIO SCHACHER, Des Plaines, Illinois: Spanish, Sociology, Var- sity Soccer 2, 3, 4, Xi Theta Xi 2, 3, 4, SIO 2, 3, 4. GARY SCHEIDER, Freeport, Illinois: Psychology, Biology, Psi Chi 3. 41 Biology Club 1. MYRA SCHNEIDERMAN, Skokie, Illinois: Elementary Education, English, NEA. SUSAN SCHEIWE, Homewood, Illinois: History, English, Alpha Omi- cron Pi, Russian Cluhf Newman, 1970 Senior Class Project Planning Committee. TERRY SCHERMAN, Bellwood, Illinois: Physical Education, History, F10 2, 3, 4, Intramurals I, 2, 3, 4, PE Club 1, 2, 3, 4: Officials Club I, 2, 3, 4: Manager Grant Snack Bar 4. BARBARA' SCHICK, Heidelberg, Germany: Elementary Education, English, RA, Kappa Delta Pi. TIMOTHY SCHIRMER. Freeportylllinoisz Political Science, History, Highlanrl Community College. DONALD SCHLEEF, Crescent City, Illinois: Accoimting, SAS l, 3, 4, Accounting Internship 3. KATHLEEN SCHLEEF, Crescent City, Illinois: Elementary Education, Olivet Nazarene College, ASE 3, 4, sec-treas. 4. DANA SCHLENK, Geneva, Illinois: Nursing, Delta Zeta 2, 3, 4. GARY SCHMIDT, Woodstock, Illinois: Nlatliematics, Chemistry, Phi Sigma Kappa 1, 2, 3, 4, house manager 2: May Fete Committee lg Gamma Delta I, Intramurals 1, 3, 4. NANCY SCHMIDT, Morton. Grove, Illinois: English, Sociology, UCB Movie Committee 3,' Floor President 3: Outdoor Club 1, 2: Karate Club 1. CONSTANCE SCHMITT, DeKalb, Illinois: Physical Education, Driver Education, Delta Psi Kappa, Major-Minor Club, WRA. JOHN SCHMITZ, Streator, Illinois: Mathematics-Economics, PEACE 3, 4. BONNIE SCHNEIDER, Chicago, Illinois: Elementary Education, Speech, Northeastern Illinois State, Hillel 2, 3: NEA, SEA. DARLYNE SCHNEIDER, Downers Grove, Illinois: History-Education, English, 1970 Senior Class Project Planning Committee. LOIS SCHOLTEN, Chicago, Illinois: Special Education, CFC. PATRICIA SCHREIBMAN, Elgin, Illinois: Elementary Education, Western Illinois University, NIU Concert Choir 3. MARJORIE SCHRIER, Skokie, Illinois: Art, Education, Sigma Sigma Sigma 1, 2, 3, 4, ruslz chrmn. 3, pres. 4: NAEA 3, 4: Miss Northern 4: UCB 3. SANDRA SCHUESSLER, Chicago, Illinois: Elementary Education, Psyclzology. SHERMAN SCHUETT, Elgin, Illinois: Accounting, Sigma Phi Epsilon 2, 3, 4, treas. 4: Baseball l, 2. MARY LEA SCHULER, Morrison, Illinois: Special Education, CEC I, 4, NIRC 4. JAMES SCHULTZ, Chicago, Illinois: Marketing, Wright Junior Col- lege, Wrestling I, 2. KATHLEEN SCHULTZ, DeKalb, Illinois: Biology, Chemistry, Phi Sigma 4: Sigma Zeta 4, Anzerican Institute of Biological Sciences 2, 3, 4, Orclzesis 3, 4, vice-pres. 4, National Wildlife Society 4. LINDA SCHULTZ, Lansing, Illinois: Elementary Education, Art, Thornton Junior College. LINDA SCHULZ, Downers Grove, Illinois: Elementary Education, Earth Sciences, National Geography Fraternity, RA. ROBERT SCHULZ, Park Ridge, Illinois: Marketing, AMA. 416 J eb interviews a sobering step into the future. and I will always remember the first days of spring, hinting at the approach of summer. far- si? JUDY SCHUMACHER, Hinckley, Illinois: Music: Aurora College: Sigma Alpha Iota, MENC: Concert Choir: Madrigals. MARY SCHWABA, Chicago, Illinois: Elementary Education: Marquette University. RUSSEL SCHWANTZ, Waukegan, Illinois: Meteorology, Mathematics,- Dorm Council 2: Interhall Council 2, 3. CAROL SCHWARTZ, University of Illinois Chicago Circle: Elemen- tary Education, Sociology: Kappa Delta Pi 3, 4: SEA 2, 3, 4: Hillel 2, 3, 4. JUDITH SCHWEISTHAL, Aurora, Illinois: English, French: French Club 2: NEA 3: SEA 3: UCB 3: Dorm Council 1. WILLIAM SCONZA, Chicago, Illinois: Industrial Personnel Supervi- sion: Phi Kappa Theta 2, 3, 4: Intramurals 1, 2, 3, 4: SAM 4. STEVEN SCOTT, Glenview, Illinois: Marketing: University of Illinois: Sigma Alpha Epsilon 1, 2, 3, 4: Herald 2, 3: Gymnastics 1, 2, 3.4. LAURA SECLER, Chicago, Illinois: Medical Technology: Hillel 2, 3: Medical Technology Club 3. PAUL E. SEILS, Mount Prospect, Illinois: Marketing: AMA 3, 4: Sigma Nu 2, 3, 4, sec. 3: IFC 2, 3, 4, sec-treas. 3, 4: Standards Committee 3, 4: .Iudicial Commission 3, 4: Intramurals l, 2, 3, 4. TIMOTHY SEITZ, Walnut Creek, California: Earth Science: Triton Junior College: RA 3: Intramurals 2, 3: Cavaliers 4: Gamma Theta Up- silon 4: Oriental Sport Club 2. CHARLES SELLE, Mundelein, Illinois: Journalism, History: Phi Sigma Kappa 2, 3, 4: Sigma Delta Chi 3, 4. LAWRENCE SELZO, Kingston, New York: Marketing: Greenville College. PATRICIA J. SEMON, Shreveport, Louisiana: Special Education, Vis- ually Handicapped: Marillac College: CEC 3, 4: AEVH 3, 4. DANIEL SENESE, Maywood, Illinois: Marketing: Triton College: Phi Sigma Epsilon 2, athletic clzrnm. 3: social clzrmn. 4: AMA. EILEEN SENNOTT, Streator, Illinois: Accountancy: Delta Zeta: SAS: Pom Pon Squad 3. ROBERT SEPICH, Canton, Illinois: Finance: Carlton Community Col- lege: Finance Club: Douglas Hall vice pres. 3. 417 RONALD SEROLKE, Chicago, Illinois: Indutsry and Technology, Bi- ology: Coe College, Wilson Junior College: Epsilon Pi Tau. KATHY SESTAK, La Grange Park, Illinois: Art: Alpha Delta Pi, pub- licity chrmn. I, 2. WILLIAM SETLAK, Chicago, Illinois: Zoology, Chemisty: University of Illinois: Intramurals 3, 4. CHRISTINE SETZKE, Rockford, Illinois: History, Sociology: UD l, 2. HENRY SETZLER, Wonder Lake, Illinois: Electronics Technology: Grinnel College, Illinois Institute of Technology: University of Illinois. MARGARET SHALES, Aurora, Illinois: Elementary Education, Mathe- matics: A WS 1, 2, 3, treas. 2, vice-pres. 3: RA 3. THERESA SHALLCROSS, Elk Grove Village, Illinois: Mathematics, Art: Cwens 2, Echoes 3: Sigma Zeta 4: Dean's List. MARJORIE SHALETT, Elk Grove Village, Illinois: Mathematics, Art: Cwens 2, Echoes 3: Sigma Zeta 4: Dean's List. BENJAMIN SHAMES, Chicago, Illinois: Accounting: Wilson Junior College: Resident Hall-Judiciary: SA S. LEONARD SHARBER, Rockford, Illinois: Plzysics, Mathematics: Jud- son Baptist Fellowship l. 2, 3, 4: RA 2, 3, 4, LISA SHARRING, Glen Ellyn, Illinois: Art Education: Monticello College,' Sigma Kappa l, 2, 3, 4: chapter correspondent 3, 4, Standards Committee 3: Pom Pon Squad 2: HOIlIL'L'fJlIlIIlg Queen l968. CYNTHIA SHAYNE, Chicago, Illinois: History, Political Science: Rus- sian Club 2, 3, 4: Hillel 1, 2: SEA 1, 3, 4. JOSEPH SHEEDY, Rockford, Illinois: Biological Science, Chemistry: SAM 4: AMA 4. MARSHA SHEPARD, Aurora, Illinois: Home Economics, Business: Eastern Illinois University: AMA 4: Home Economics Club 4. JANICE SHEPPARD, Pekin, Illinois: Special Education: Alpha Chi Omega, exec. coordinator 1, sec 2, 3: Junior Panhellenic l, CEC. MARY ANN SHERWIN, Aurora, Illinois: Elementary Education, Speech: Sigma Lambda Sigma 2, 3, 4, lst vice-pres. 4: UCB 1, 2, 3, 4: SEA 3. 4. WALTER SHIFFER, Lafjrange, Illinois: Elementary I:'ducation,' Col- lege of DuPage: Christian Science College Organization: RA: SEA, pres. ANNE SHIFFLETT, Winnetka, Illinois: Business Education: Phi Beta Lambda 1, Election Commission 2: Sigma Lambda Sigma, 2, 3, 4, treas. 4. SARA SHIGLEY, Rockford, Illinois: Elementary Education,' Rockford College: Orchesis l: Intramural 4. JOHN SHIPPERT, Dixon, Illinois: Art: St. Ambrose, Sauk Valley Jtmior College: Sports Car Club 4: Phi Beta Lambda: Wrestling l, 2: Football l: Track 1, 2: Philisophy Club 2: Newnzan Club 3, 4: Dramatics Club, vice-pres. FRANK SIBLEY, Chicago, Illinois: Marketing: Phi Kappa Theta. GARY SIEVERS, Wyoming, Iowa: Meterology: North Iowa Area Com- munity College. GEORGE SILAGYI, Blue Island, Illinois: Mathematics, Physics: Mathe- matics Club: Intramural 1, 2, 3, 4. FORREST SIPIORKIN, Chicago, Illinois: Marketing: Wright Iunior Col- lege: Alpha Kappa Lambda 2, 3, 4. RITA SIRVIDAS, Waukegan, Illinois:Speech, Sociology: Dorm pres. 1, 2, 3: SEA: WRA: Theater: Floor vice-pres. 3: Theta Delta Xi Little Sister. DONALD J. SITARZ, Riverdale, Illinois: AMA: Intramurals. JEFFREY RAY SKLAR, Chicago, Illinois: Marketing: Phi Delta Psi 2, 3, 4, pres. 4, vice-pres. 3, treas. 3,' AMA 2, 3, 4: SAS l, 2: Intramurals 1, 2, 3, 4. CHARLOTTE SKOCZ LOUIS A. SKOGG, Gurnee, Illinois: Mathematics, Philisophy: Wrestling l, 2: Intralnurals 3, 4: Veterans Club 3, 4, ELLEN SKOGLUND, Arlington, Illinois: Elementary Education: Alpha Delta Pi 2, 3, 4: Daughters of the Crossed Swords 3, 41 Floor sec. l. THOMAS SKOMSKI, Summit, Illinois: Art. GARY SKOVRONSKI, Kewanee, Illinois: llflanagemenl. 418 othing great was ever achieved Without enthusiasm VIRGINIA SKWERES, Westchester, Illinois: Elementary Education: Alpha Xi Delta 1, 2, 3, 4: Quillboarcl 2: SEA 3, 4. PAMELA SKWIRA, Tinley Park, Illinois: Sociology. CHARLES SLAGLEY, Alton, Illinois: History, Economics: Southern Illinois University. TIMOTHY SLEDGISTER, LaSalle, Illinois: Social Sciences, History,- 'llinois Valley Community College. IAMES SLOAN, Elmhurst, Illinois: History, Sociology: Elmhurst Col- lege: YR 3. WILLIAM SMALL, South Holland, Illinois: Political Science: Loyola University,' Academic Advisory Committee to College of Liberal Arts and Science 3: Advisory Committee to Department of Political Science. ROBERT SMETANA, Cicero, Illinois: Accounting: Morton Junior Col- lege: BGIO 3, 4. ADLYN SMITH, Chicago, Illinois: Geography, History: Loop Junior College: AACO 3: Newman 3, 4: Dorm social chrmn.: International Club 4: WAA 3. ANN SMITH, Oak Park, Illinois: Special Education: Mayfair Junior Col- lege: ACE 3. BERNICE SMITH, Villa Park, Illinois: Home Economics Education: Blackburn College. DOLORES SMITH, Chicago, Illinois: Business Education: Loop Junior College: Wilson Junior College: IBEA 4: AMA 4: SAM 3: St. Charles tutor 4. EDWINA SMITH, DeKalb, Illinois: Nursing: SNO 4. EVIE SMITH, Skokie, Illinois: Elementary Education. GERALD D. SMITH, Niles Illinois: Accountancy, Finance: SAS I, 2, 3, 4: YR 2: Flying Huskies 2, treas. 2. JAMES SMITH, Perkin, Illinois: Marketing: AMA. Marcia SMITH, Joliet, Illinois: English, French: College of St. Frances: University Symphony Orchestra: Sigma Tau Delta: Towers. RICHARD SMITH, Skokie, Illinois: Special Education: Kendall Junior College: Tau Lambda Chi 2, 3, 4: CEC 4. ROY SMITH, Elgin, Illinois: History, English: Elgin Community Col- lege: History Undergraduate Committee: History Club. SUZANNE SMITH, Springfield, Illinois: Elementary Education: Spring- field College. TERRI SMITH, Lincoln, Illinois: English, Library Science: Pom Pon Squad 2, 3, 4: RA 2, 3. WILLIAM G. SMOIVER, Park Forest, Illinois: Political Science, His- tory: Varsity Band 1, 2, 3, 4: Marching Huskies I, 2, 3, 4: Phi Mu Alplza 2, 3, 4, pres. 3, treas. 2, 4. JEFFREY SNEED, Streator, Illinois: Mathematics, physics: Folk Music Club 2: Dorm scholarship chrmn. CHERYL SNIDER, Arlington Heiglzts, Illinois: Special Education: Pi Tau Omega 1, 2: CEC 4. YVONNE SNIECHOWSKA, Berwyn, Illinois: Sociology, Biology: Uni- versity of Illinois: Morton Junior College: Alplza Kappa Delta 3, 4. STEPHEN SNITOWSKY, Chicago, Illinois: Marketing: Southeast Junior College: AMA. CHRISTINE SOBEK, Norridge, Illinois: Elementary Education: Alplza Sigma Alplza 2, 3, 4: Northcr 3. DENNIS SOCHA, Chicago, Illinois: Chemistry, Mathematics, Business: Phi Kappa Sigma 2, 3, 4: UCB 4. SHERYL SOEDLER, Spring Valley, Illinois: Elementary Education: Il- linois Valley Community College: UCB Entertainment Committee, Scholarship Committee. 419 B making the best of all things, we make the most of ourselves. ADRIENNE SOHN, Joliet, Illinois: History, Speech-Theatre: Norther 2, 3, 4, Dorms and Services editor 3, Year-in-Review editor 3, 4: Winter Carnival Committee 3: Tri Swine Omega 2, 3, 4. CARL SOLOMON, Waukegan, Illinois: Marketing: Lincoln Junior Col- lege. TERRI SOLOMON, Lincolnwood, Illinois: Elementary Education: Lin- coln College: Dorm Council 23 SEA 3, 4. HOWARD SORKIN, Chicago, Illinois: Political Science, History: Hillel 1, 2, 3, 4, treas. 2, pres. 3g Band 1, 2, 3. JAY SORKIN Chica o Illinois: En lish, Library Science s I3 , L' - TIMOTHY SPACKMAN, Chicago, Illinois: Marketing: Folk Music Club, sec,,' Intramural Softball 1, 2, 3, 4. BILL SPAIN, Chicago, Illinois: Management: Wright Junior College: Newman Club 2: Intramurals 2, 4: SAM 4: AMA 2. EDWARD SPALDING, Wood Dale, Illinois: Political Science, Business Administration: College of DuPage, Florida State, Triton Junior College, Austin Peay State College: Vet's Club, SAM: Pi Sigma Alpha: Political Science Undergraduate Association. LINDA SPECKMAN, Chicago, Illinois: Elementary Education, Art: Chi Sigma Phi 2, 3, publicity chrrnn.: Kappa Chi Sweetheart: Delta Gamma 4. TERRY SPEER, Geneva, Illinois: Art: University of Minnesota, Uni- versity of Kansas: Art Acquisitions 3. THADDEAUS SPEISER, Chicago, Illinois: Political Science, Business Administration: Wright Junior College: Association for the International Exchange of Students in Economics and Commerce: Political Science Undergraduate Advisory Committee SUZANNE SPIRES, Naperville, Illinois: Biology. JUNE SPITLER, Elmhurst, Illinois: Mathematics, Chemistry: Band, UD. JULIE SPIVEY, Kankakee, Illinois: Elementary Education: Eastern Illinois University,' SEA. JOAN SPOLARICH, Joliet, Illinois: French History: College of Saint Francis: French Club. BARBARA SPORN, Chicago, Illinois: History, Political Science: Roose- velt University: Hillel 1, 2, 3: YD 1. JAN SPRAGUE, Montgomery, Illinois: Speech - Communications, Eng- lish: Illinois State University, Waubonsee Community College: Pi Kappa Delta 1, 2, 3, 4: 1970 Senior Class Project Planning Committee: Speech Individual Events Team 3, 4: Speech-Communications Major Organiza- tion. JOLENE SPRINGMAN, Sterling, Illinois: Elementary Education Black- Hawk Junior College, Sauk Valley Junior College. SHERRY SPRANEK, Highland Park, Illinois: Elementary Education: University of Illinois, Kendall College, Wisconsin State University. WILLIAM STADE, Chicago, Illinois: Sociology, Political Science: Uni- versity of Illinois Circle: Alpha Kappa Delta 2, 3, 4: Sociology Club 4, public relations chrmn.: Sociology Underground Advisory Committee 3, 4, communications chrmn. JILL STAFFORD, Evergreen Park, Illinois: Elementary Education, Eng- lish: NEA: English Club: Intramurals. KATHRYN STAGCKER, Tinley Park, Illinois: Sociology, Psychology: Leadership Development Committee 2, 3, 4: UCB Program Development Committee 4: Sociology Club 3, 4: Dorm Council 1: Cwens 2: cultural chrmn.: Echoes 33 tutoring chrmn.: Pleiades 4: RA 2, 3: Dean's List 2: Alpha Kappa Delta 3, 4. LOIS STAGE, Blue Island, Illinois: Biology: Lake Michigan Jun- ior College: Clzorus 3: SEA 3, 4. SUSAN STARBUCK, Rockford, Illinois: Biology: Lake Michigan Jun- ior College: Phi Sigma treas. 4: Student Senate sec. 25 Phi Theta Kappa l, 2. MARY STARKEY, Dolton, Illinois: Sociolvgy, History: Thornton Jun- ior College: UCB 3. CATHERINE STASZAK, Berwyn, Illinois: Elementary Education: AWS 1: Dorm Council 3, 4, sec. 3, 45 May Fete Committee 3, 4: SEA 2, 3, 4. DIANE STASZEL, Schaumburg, Illinois: Elementary Education, Sociol- ogy: Delta Zeta 2, 3, 4: Kappa Delta Pi 3, 4: SEA 2, 3, 4. KATHLEEN STEARNS, Brookfield, Illinois: Elementary Education. 420 SHARON M. STEARNS, Rock Island, Illinois: Home Economics, Art. BETTY STECKEL, La Moille, Illinois: Home Economics, Education: Huntingdon College. STEVEN STEIN, Chicago, Illinois: Management: Zeta Beta Tau 1, 2, 3, 4, pres. 3: vice-pres. 2, sec. 2: SAM 3, 4. CHERYL STEINBERG, Lincolnwood, Illinois: Elementary Education, Sociology. EDWARD STEINMANN, Des Plaines, Illinois: Speech, History,' Uni- versity of Illinois, Triton Junior College: School Spirit Committee 2: Dorm Social Committee chrmn, 4: Intramurals 2, 3. SUSAN STEINMEYER, Hinsdale, Illinois: Special Education: Illinois College: CEC 3, 4: ITHI 3, 4: Sigma Lambda Sigma 3, 4. CYNTHIA STEISKAL, Hinsdale, Illinois: Special Education: CEC, Alpha Chi Omega 2, 3, 4. CHERYL STANFELT, Canton, Illinois: Nursing: SNO 1, 2, 3, 4, treas. 3, 4. MARIE STENGER, Cary, Illinois: Physical Education, Driver's Educa- tion: Extramural 1, Golf 1, 2, 3: Naiads 1, 2: Major-Minor Club 1, 2. MIKE STENGER, Rockford, Illinois: Marketing: Dorm Council 3: Intramurals 1, 2, 3. THOMAS F. STENSON, Chicago, Illinois: Psychology: St. Mary of the Lake Seminary: Intramurals 3, 4: RA 4. THERESA STEPENSKI, Harvey, Illinois: Elementary Education: Tlzorn- ton Junior College: WRA 3, 4: SEA 3, 4. MARILYN STEPHENS, DeKalb, Illinois: Elementary Education: Drake University, DePauw University, University of Wisconsin: SEA,' Dames Club. JOHN STEVENS, Elgin, Illinois: Biology, Chemistry: Carroll College. CYNTHIA STEVO, Blue Island, Illinois: Business Education. CLAUDE STEWART, Des Plaines, Illinois: Biology, Chemistry: Uni- versity of Illinois: Tau Lambda Chi 3, 4. SUZANNE STOCK, Homewood, Illinois: Journalism, Home Economics: JSA vice-pres: Tlzeta Sigma Phi: NISPA Newsletter Editor. SUSAN STOLGREN, Rockford, Illinois: Special Education, EMH. JOHN STONER, Plain Field, Illinois: Personnel Management: Joliet Junior College: RA 2, 3, 4: parliamentarian, Douglas Hall 4. KATHLEEN STOTT, Wheaton, Illinois: Elementary Education, His- tory, National College of Education: Human Relations Club 1, Chorus 2. MARY ANN STOTT, Franklin Park, Illinois: Special Education. BONITA STOWE, Wenona, Illinois: Accounting: SAS 2, 3, 4: Echoes. CARLOTTA STRAUB, Chicago, Illinois: Elementary Education: SEA 3, 4: Dorm Council 1, 2. ROBERT STRAUB, Wood Dale, Illinois: Mathematics, Physical Educa- tion: Dorm Council vice-pres. 2, Plzysical Education Association 3, 4. LES STRAUSS, Chicago, Illinois: History, Library Science: Roosevelt University: Culture and Scholarslzip rep and chrmn. of Committee 2: SAB 3: Hillel 4. KATHERINE STREIT, Aurora, Illinois: Home Economics Education: Stout State University: Home Economics Club 2: Echoes: Pleiades: Pi Lambda Theta, UMOC. CHRISTINE STRELECKY, Chicago, Illinois: English, Sociology: Carth- age College: Chi Omega 2, 3, 4: May Fete Committee 3: English Club 3, 4: Ski Club 4. GAIL STROM, Rockford, Illinois: Elementary Education, Mathematics: NEA: IEA,' SEA 3, 4. PATRICIA STRONG, Ottawa, Illinois: Elementary Education, Humani- ties: Illinois Valley Community College. WILLIAM STRONG, Ottawa, Illinois: Elementary Education,' English: Hanover College, Illinois Valley Community College: Intramurals 3. BRUCE STRUTZ, Summit, Illinois: Marketing: University of Illinois Chicago Circle: AMA 4: Bowling 2, 3: Ski Club 4. ' MARY ANN STUBLER, Joliet, Illinois: Elementary Education: Joliet Junior College,' SEA 4. 421 SANDRA STURTEWAGEN, A tlcinson, Illinois: Elementary Education,- Blaclchawk Junior College. DENNIS SULLIVAN, Wheeling, Illinois: Music Education, Concert Band 1, 2, 3, 4: Chorus 4. MONICA SULLIVAN, Warren, Illinois: Elementary Education. SHERYL SUOMI, Western Springs, Illinois: Nursing, SNO 4. JOHN S. SUSMURAS, Chicago, Illinois: Journalism, Northern Star: Intramurals. GAIL SUTTON, Bellwood, Illinois: Elementary Education, Pi Lambda Theta 3, 4: Dean's List I, 2, 3, 4, Graduate with Honors. WILLIAM SVENNINGSEN, Algonquin, Illinois: Comprehensive Man- agement, Elgin Community College, SAM 3,' Intramural Basketball 3, 4: Intramural Softball 4. ELAINE SVOBODA, Marseilles, Illinois: Elementary Education, Illinois Valley Community College. RICHARD SWAIN, Oglesby, Illinois: I-'rench, History, YR, Northern Star 2: Dorm pres.,' 1970 Senior Class Project Planning Conzrnittee. ROBERT SWAIN, Streator, Illinois: Microbiology, Chemistry. JANIS SWAN, Des Plaines, Illinois: Elementary Education, Art. ANNE BARRETT SWANSON, Coal City, Illinois: Chemistry, Mathe- matics, American Chemical Society l, 2, 3, 4, pres. 3: Echoes 3,' Sigma Zeta 4: Dean's List 1, 2, 3, 4. CAROL A. SWANSON, Chicago, Illinois: Elementary Education, Earth Science, University of Illinois Chicago Circle, SEA 3, 4. DAVID K. SWANSON, Belvidere, Illinois: Physics, Matlzematicsg Phi Eta Sigma 2, 3, 4: Dean's List 1, 2, 3, 4gSigma Zeta 4:Pysics Club 1, 2, 3, 4. SHARON SWANSON, Elburn, Illinois: Special Education, De Paul University, Sigma Kappa 2, 3, 4: Little Sisters of Minerva. SUSAN SWARTWOUT, Skokie, Illinois: Art,' AID 3, 4: NSID 4: En- vironmental Design Group 3, 4, pres. 4: JEZ 2, 3, 4. 422 and believe me, anything is better than the food served in the dorm! X5 RUTH SWENSON, Wheaton, Illinois: Elementary Education, Music: Betlzel College: Sigma Alpl1a Iota, education chrmn. 3, 4: SEA 4. MICHAEL SZOSTAK, Chicago, Illinois: Management: Chicago City Junior College: SAM 3, 4: AMA 3, 4. DARLENE SZUMIGALSKI, Chicago, Illinois: Elementary Education. GERALD SZWAJKOWSKI, Chicago, Illinois: Sociology, History: Soutlz- east Junior College: Phi Kappa Theta 3, 4: YR 3. DIANE SZWED, Clzicago, Illinois: Elementary Education, Social Science: DePaul University. ALEXANDRIA ANNE SZTUCKO, Des Plaines, Illinois: Elementary Education: Wright Junior College: Harper Junior College. EVELYN TAMA, Wheaton, Illinois: Child Development and Early Childhood Education: College of DuPage: Rosary College. JOSEPH TAMULIS, Western Springs, Illinois: Political Science, Mathe- matics: Chemistry Club l, 2: NISCC 3, 4: ACS l, 2, 3: Intramurals 1, 2, 3. JULIE TAPPAN, Woodstock, Illinois: Elementary Education: St. Dom- inic College. KATHARYN TARPLEY, Walnut, Illinois: Social Science, History. DONNALOU TARVIN, Park Ridge, Illinois: Psychology, Sociology: Wartburg College: Echoes: YR. ELMER TAU, Franklin Park, Illinois: Industry and Technology: Dorm Council I, 2: Iota Tau 3, 4: Epsilon Pi Tau 3, 4, sec. 4: Intramurals. BARBARA TAYLOR, Long Grove, Illinois: Elementary Education, Social Science: Southern Illinois University: Harper Junior College: SEA 4: St. Charles tutor 4,' YR 4. SHERI TEICHNER, Lincolnwood, Illinois: Special Education, EMH: Sigma Delta Tau l, 2, 3, 4, first vice-pres. 2, 3, pledge trainer 2, 3, rush chrmn. 3, 4: Hillel 3, 4: CEC 3, 4. MARK TEIPEL, Joliet, Illinois: History, Political Science: Joliet Junior College: Foreign Study 3. GARY TELFORD, Emington, Illinois: Marketing: AMA 1, 2, 3: SAS l: YR 1: Intramurals 3, 4. JEAN TEOFILO, Bellwood, Illinois: English, History: Signza Lambda Sigma, historian 3, 4: Newman Choir 3. JOHN TERRY, Chicago, Illinois: Political Science, Economics: Sigma Alpha Epsilon l, 2, 3, 4, sec. 2, 3: Homecoming Committee, treas. 2, assistant chrmn. 3, cochrmn. 4: Political Science Undergraduate Com- mittee, chrmn. 3: Football 1, Cavaliers 3, 4: Phi Pi Epsilon l: Pi Sig- ma Alpha. PETER TERRY, Chicago, Illinois: Earth Resources, Economics: Intra- murals I, 2, 3. 4. THOMAS THEIS, North Aurora, Illinois: Finance: Waubonsee Junior College: Vet's Club 1, 2, 3, 4, sergeant at arms 4: student marslzall. KATHLEEN THEISS, Elmwood Park, Illinois: Elementary Education, Psychology: Kappa Delta I, 2, 3, 4: Greek Goddess Finalist 3: SEA 2, 3: Sigma Pi Sweetheart 3, 4. MARJORIE THILL, Aurora, Illinois: Elementary Education: Sociology: SEA 4: Dorm Council 1. PEGI THINGER, Chicago, Illinois: Elementary Education: Alpha Delta Pi: Kappa Delta Pi. BETTY THOMAS, Chicago, Illinois: Elementary Education, Sociology: Wilson Junior College: Chicago State College: Biology Club 1, 2, pres. 2: Newman Club 3: Orclzesis 3: AWS 3, 4: AACO 3, 4: Women's Chorus. CAROL THOMAS, Crystal Lake, Illinois: Elementary Education, Speech: Western Illinois University: Pom Pon Squad 3: Delta Zeta 2, 3, 4, pledge trainer 3, 4. DAVID THOMAS, Northlake, Illinois: Music: Phi Mu Alpha Sinfonia l, 2, 3, 4: historian I. vice-pres. 2, 3: Concert Band 1, 2, 3, 4: vice- pres. 3, pres. 4: MENC-IMEA I, 2. 3, 4: Marching Huskies l, 2, 3, 4: Drum Major 2, 3, 4. DONOFRIO. THOMAS, LaGrange, Illinois: Math, Chemistry: Intra- murals l, 2, 3, 4: RA 3, 4: Sports Car Club 2. JANET I. THOMAS, Chicago, Illinois: Management SAM 4: Newman Club l. 2, 3, 4: AWS I, 2, 3, 4: Interltall Council l. JOHN THOMPSON, Round Lake, Illinois: Accounting: Alpha Phi Omega 3, 4, corr. sec. 3, historian 4: Intramural Basketball, Baseball 3,4. JUDITH THOMPSON, Lemonr, Illinois: Art: University of Paris, Ecole Nationale Superiere des Beaux Arts: Ski Club 1, 2, 3: Art Guild l, 2, 3. NANCY E. THOMPSON, Manteno, Illinois: Psychology, Sociology: Cwens 2: Dorm Council l, editor I: Alpha Chi Omega 2, 3, 4, vice- pres. 3, house manager. ALISON THOMSON, Elmhurst, Illinois: Speech, English: Sigma Kappa 2, 3, 4: fines chrmn. 4, rush committee 4. 423 GEORGE THORSEN, Itaska, Illinois: Management: SAM pres.,' Weightlifting Club,' President's Council for College of Business Organi- zations: Management Student-Faculty Advisory Committee. DONNA TICHLER, Morrison, Illinois: Special Education,' CEC: SEA: Alpha Omicron Pi. ROBERT C. TIEHEN, Rockford, Illinois: English. PAUL TILBURY, Rockford, Illinois: Eartlz Science: Ganzma Theta Up- silon: UCB Billiards. ANN TIMAN, Mundelein, Illinois: Psychology, History: Western Illi- nois University: Dixon Volunteer. DAVID TIPPET, Galena, Illinois: Industry and Technology: Newman Club l, 2, 3, 4: Phi Sigma Epsilon 3, 4: Iota Tau 3, 4: Photo Service 1. JOEL TIRA, Coal City, Illinois: Industry and Technology. J. CHRISTIANE TISKUS, Bll0'Ill0 Grove, Illinois: English, Journalism: Northern Star. SUSAN TOBIANSKY, Morton Grove, Illinois: Speech-Theatre, Eng- lish: Northeastern Illinois State College: Interpreters' Theatre I: Univer- sity Theatre 2, 3, 4: Hillel 3. DIANE TOMBLIN, Peoria, Illinois: Special Education: CEC: EESAC. MARCIA TOMPOLES, Zion, Illinois: Speeclz Correction, Psychol- ogy: Sigma Alpha Eta 3, 4: Showtime 3. MARY ANN TONI, Highland Park, Illinois: Elementary Education, Italian: Italian Club 2: Eclzoes 3. LINDA COOK TOWNSEND, Elmhurst, Illinois: Elementary Education, Sociology: RA 3: 1970 Senior Class Project Planning Committee. ROBERT TOWNSEND, McHenry, Illinois: Marketing, Economics: RA 2, 3: AMA 1, 2, 3: Delta Sigma Pi, cl1rmr1.3, 4. LINDA BURT TRAKSELIS, Lombard, Illinois: Home Economics Edu- cation: SEA: Home Economics Club. TERRY TRAKSELIS, Lombard, Illinois: Marketing: Aurora College, College of DuPage: AMA 3, 4, Finance and Budget Committee: North- er 3, 4, advertising manager. ROBERT TRANSON, Merrionette Park, Illinois: Sociology, Psychol- ogy: St. Mary's of the Lake, Lewis College: Dorm Council 3: Beavers 3, 4: Dixon State Volunteer 3, 4. KENNETH TRANTOWSKI, Hamtramck, Michigan: Journalism, Speech: Wayne State University: Delta Upsilon, chapter relations sec. 3: Sigma Delta Chi: Journalism Students Association: Nortl1ern Star, man- aging editor 4, associate editor 4, editor 4: May Fete Public Relations chrmn.: 1968-69 Thomas Fullmer Award: Intramural Football, Basket- ball, Baseball. JAMES TREACY. CHARLES TRIOLO, Rockford, Illinois: Accountancy: Rock Valley Junior College: Intramural Football, Volleyball 3: SAS 3, 4: Account- ing Internship 4. KAY ELLEN TRONSEN, Berwyn, Illinois: Elementary Education,' Morton Junior College: Alpha Phi 2, 3, 4, sec. 4. FRANCES TROPSTEIN, Lincolnwoood, Illinois: Elementary Educa- tion, Science: Loop Junior College: Northeastern Illinois State College. KATHRYN TROTTA, Chicago, Illinois: Elementary Education. EDNA TRUESDALE, Springfield, Illinois: Sociology, Spanish: Inter- national Club 1, 2, 3, 4, sec. 3: Sigma Delta Pi 2, 3, 4: Alpha Kappa Delta 3, 4: Sociology Club 1, 2: Spanish Club 1, 2, 3. RUTH TRUHLAR, LaGrange Park, Illinois: Speech, English: Lyons Township Junior College: UCB 2, promotion coordinator 3: Book- store Advisory Committee 3. KATHRYN A. TSUNETA, Lincolnwood, Illinois: History, English: University of Hawaii,' Midwest Model United Nations 2, 3, 4: Interna- tional Club 2, 3, 4: Southeast Asian Interest Club 2, 3. CAROL TUMA, Western Springs, Illinois: Mathematics, Biology: Lyons Township Junior College: University Women's Clzoir 2: SNEA 4: Bridge Club 3: Science Club 1. gg'-I4AI5lLiENE TUREK, South Holland, Illinois: Elementary Education: THELMA TUREK, Dixon, Illinois: Special Education,' Sauk Valley Junior College. ELIZABETH TURNROTH, Sterling, Illinois: Elementary Education, Sociology: Sauk Valley College. JANICE TURSMAN, Chicago, Illinois: English, History: SEA:May Fete. KAREN ULMENSTINE, Midlothian, Illinois: Mathematics,' Math Club, sec.: RA 2, 3: Sigma Zeta 3, 4: Student Advisory Committee. 424 -at VICKI ULVESTAD, DeKalb, Illinois: Elementary Education: Chi Ome- ga 2, 3, 4, social chrmn. 3, 4: May Fete Committee 3: SEA 2, 4. DIANA UNDERWOOD, Lombard, Illinois: Elementary Educa- tion: UCB. SUSAN M. URBANIAK, Evergreen Parak, Illinois: Medical Technol- ogy: Mu Tau Chi 2, 3: YR 1, 2. MARIAN URNIKIS, Chicago, Illinois: Accounting: Sigma Lambda Sig- ma 2, 3, 4, treas. 3: Cwens 2: SAS 2, 3, 4. MARK UTTICH, Wlteaton, Illinois: Speech: Delta Upsilon 2, 3, 4: Election Commission 1: WNIU-AM: WNIU-FM. ESTHER MARIA VALDES-CRUZ, DeKalb, Illinois: Spanish, History: Chi Omega 2, 3, 4, activities chrmn. 3: Spanish Club 1, 2, 3, 4, vice pres. 2: Cwens 2, pledge trainer: Sigma Delta Pi,' International Club 1, 2, 3, 4: Newman Club 1: UCB 4. WILLIAM VANATTA, Kaneville, Illinois: Industry and Technology: Alpha Phi Omega 3, 4, pres. 4: UCB 1, 2, 3, 4, coordinator 4. DENNIS VANCE, Aurora, Illinois: Industry and Technology: Illinois Institute of Technology. PATRICIA VAN DE MERKT, Arlington Heights, Illinois: Elementary Education: Central College: SEA. PATRICIA VAN DE NORTH, River Forest, Illinois: Special Educa- tion: Rosary College: RA 3, 4. DEBORAH VAN DER VEEN, Naperville, Illinois: Elementary Educa- tion,' Henry Ford Community College: University Women's Choir 3: Campus Crusade for Cltrist 3. DARRYL VAN KAMPEN, Mount Prospect, Illinois: Mathematics, Bio- logical Sciences: Math Student-Faculty Committee 3, 4: Math Club 4. JUDITH VAN KANEGAN, South Holland, Illinois: Physical Educa- tion, Driver Education. JAMES VASEK, Steger, Illinois: Management, Mathematics: Prairie State College, Fenger. ARMANDE VASILOPOULOS: DeKalb, Illinois: History, English: Eng- lish Club 1, 2. JACQUELINE VAUGHN, Romeoville, Illinois: Medical Technology: Joliet Junior College: Alpha Phi 2, 3, 4, historian 3, publicity chrmn. 3: Med Tech Club 2, 3, 4, vice-pres. 3. RICHARD VAUPEL, Ashton, Illinois: Geography: Wartburg College: Gamma Theta Upsilon 3, 4, treas. 4: Geography Council for Student Representation 4. STEPHEN VERMEERSCH, St. Charles, Illinois: Clzemistry, Mathe- matics: Chemistry Club 1, 2, 3, 4: Intramural Football, Basketball 1, 2. RALPH VERRECCHIA, Chicago Heights, Illinois: Marketing: Tau Delta Epsilon: Football 1: AMA 3, 4. CHRISTINE VESLEY, Cicero, Illinois: German: UCB Public Rela- tions 3, 4: Russian Club, sec. 3: German Club, sec. 4. RONALD VICTOR, Chicago, Illinois: Marketing: Zeta Beta Tau 2, 3, 4, corr. sec. 2: AMA 4. JOYCE VIDINICH, Chicago, Illinois: Elementary Education, Sociol- ogy,' Delta Gamma 2, 3, 4, vice-pres. 3, pres. 4. JILL VINKE, South Holland, Illinois: Marketing: SAB: AMA: Dorm rep. LEONARD VITALE, Rockford, Illinois: Marketing: AMA 4: Intra- murals 2, 3. SUSAN ANN VOELZ, Elmhurst, Illinois: Elementary Education: Uni- versity of Illinois: Alplta Chi Omega 3, 4: SEA 3, 4: Dean's List 3, 4. LINDA VOGEL, Fulton, Illinois: Nursing: Cwens 2: Pleiades 4: SNO 1, 2, 3, 4: May Fete Committee: Dorm Council 1, sec. 1: RA 2, 3: 1970 Senior Class Project Planning Committee. DANIEL VOJIR, Berwyn, Illinois: Speech, Music: Morton Junior Col- lefe, University of Illinois Circle: SEA: UCB. ROBERT C. VOSS, Waukegan, Illinois: Marketing: Phi Sigma Epsilon: Intramurals: Pledgemaster: Homecoming chrmn. WILLIAM J. VOVES, LaGrange, Illinois: Marketing: Delta Upsilon 2, 3, 4: AMA: Varsity Baseball 1, 2: Intramurals 1, 2, 3, 4. MARY WACH, Villa Park, Illinois: Speech Correction, Elementary Education: Mount Saint Clare College: Alpha Delta Pi, ass't member- ship chrmn. 3. NAN WAGNER, Wheeling, Illinois: French, Dance: French Club 1, 2, 3, 4: Student Wives Club 2, 3, 4: Orchesis 2, 3, 4, publicity chrmn., historian. MARY WAINSCOTT, Justice, Illinois: Elementary Education: SEA 3,4. Sometimes it seems as if luek is the only thing you'x'e g0I going for you. JAMES WAIS, Lake Forest, Illinois: Matlzeniatics, Physics. SAU-LING WAIS, Lake Forest, Illinois: Business Adntinistrationg West- ern Illinois University RICHARD WALLACE, DeKallt, Illinois: AL'C0llIlIIIllCy,' Delta Sigma Pi 2, 3, 4: SAS 1, 2, 3, 4: Accounting Internship 4, Intramurals 2, 3, 4. RAYMOND WALSH, Joliet, Illinois: History, Psyclzologyg Joliet Junior College: Mount Carmel College, SA Senator. CAROLYN WALTERS, Chicago, Illinois, Elementary Education Echoes 31 Alpha Phi 3, 4, scholarship chrnzn. 4: Concert Band lg YR 2 ROBERT WANAT, Oak Lawn, Illinois: AMA l, 2, 3, 4: Intramurals I ANN WANNEMACHER, Hooppole, Illinois: Elenientary Education, Sigma Sigma Signza 2, 3, 4: Panhellenic Council 2, 3. aetis'ities ehrnzn. 2, 3, Dorm Council 1, social chrinn. I: Cwens 2. MARY WARD, Bellwood, Illinois: Psychology, Secretarial Administra- tion: Cartilage College. JOSEPH WARGIN, Chicago, Illinois: Sociology, Spanislzq La Salle .IllIZ- ior College: College of Saint Francis: Dorm Council: Intramurals 3, 4: JISA 4. CARYN WARMAN, Flossnzoor, Illinois: ElC'IIlL'IIllIl'j' Ezlucationg Speechg WRA I: Hotneconting Conzinittee 2, 3: Sigma Delta Tau 2, 3, 4: Hillel. ANNA KUNACH WARTOWSKI. Chicago, Illinois: Russian, History,- Northeftstern State College. CHRISTINE WASIK. Palatine, Illinois: Iflententary Ezlueation. PHILIP WASILEWSKI, La Salle, Illinois: English, History: Illinois Val- lev Contniunitv Colleeeg Saint Bezle Junior College. SUSAN K. WASNER, Streamwood, Illinois': Elementary ISIIIICIIIIOH, Psychology, Lyons Township Junior College: College of Du I'age,' SEA 3, rice pres. 41SIEA 4, publicity flirector 4. JOHN WATSON, Evanston, Illinois: Finance' Chicago City College Finance Clult. PATRICK WATSON. Sycamore, Illinois: Iflenzentary Ezlueation. 426 ERNESTINE VVEBBER, Downers Grove, Illinois: Special Education: Bridge Club. NEITA WEBSTER, Pold, Illinois: Medical Technology: Western Illinois University: Mu Tau Chi 3, 4. ROBERT WEEKS, Crete, Illinois: Biology: University of Illinois Chi- cago Circle: Prairie State Junior College. BARBARA WEGRZYN, Chicago, Illinois: Elementary Education: Wright Junior College. PATRICIA WEICKLE, Chicago, Ilinois: Marketing: Alpha Sigma Alpha 2, 3, 4: Panlzellenic Council 3: AMA 3. MICHAEL WEIDNER, Dundee, Illinois: Management, History: Var- sity Soccer 1: Sigma Alpha Epsilon 2, 3, 4: Dorm vice pres. 1. REBECCA WEIMER, Chicago, Illinois: Elementary Education, Sociol- ogy: Dorm vice pres. HOLLY WEINDORF, La Salle, Illinois: English, Sociology: Illinois Valley Community College. MICHAEL WEINSTEIN, Skokie, Illinois: Marketing: University of Tampa: Alpha Phi Omega 1, 2: Delta Tau Omega 2, 3, 4, publicity chrnzn. 2, lzistorian 3: pres. 3, 4: Intramurals 1, 2, 3, 4: AMA 3, 4. SHERRY WEINSTEIN, Morton Grove, Illinois: Speech Correction: Hillel: Sigma Lambda Sigma, vice pres.: Sigma Alpha Eta. DOROTHY C. WEISE, Burlington, Illinois: Business Education: Pi Omega Pi 4: NBEA 4: IBEA 4: AVA 4: IVA 4. HELGA WEISE, Elmhurst, Illinois: German, Englisl1,' UCB 3: Chi Omega 2, 3, 4: WRA: 1970 Senior Class Project Planning Committee. CRAIG WEITZMON, Skokie, Illinois: Psychology, Sociology: Loop City College: UCB 3: Experimental College Committee 4. THOMAS WELCH, Peoria, Illinois: Management: Phi Kappa Theta 2, 3, 4, ruslz chrnzn. 3: Intramurals 1, 2: SAM 4. JEFFREY WELCKER, Napperville, Illinois: English, Eartlz Science,' Western Illinois University,' Nortlz Central College. DANIEL WELKER, Glenview, Illinois: Geography: Gamma Theta Upsilon: Northern Star 1: Undergraduate Rep. to Faculty Committee. HARRIET WENNERSTROM, Antioch, Illinois: Special Education, EMH: University of Illinois: Christian Science Organization 1, 2, pres. 3, 4. CAROL JEANNE WENZEL, Des Plaines, Illinois: Elementary Educa- tion, Sociology: NEA, SEA 2, 3, 4. CRAIG WESTBERG, Palos Heights, Illinois: Accounting: Intramur- als 1, 2: SAS. CYNTHIA WESTBROOK, Alameda, California: English, Journal- ism: College of Guam: Norther 2, 3, 4, copy editor 3: editor-in-chief 4: Echoes: Pleiades: Sigma Tau Delta, treas. 4: Homecoming Committee 3, 4: JSA 2, 3, 4: Theta Sigma Phi 4: Towers 3, 4: Sigma Delta Chi, vice pres. 4: Dorm Council 2, 3. HAROLD WESTENDORF, Chicago,' Illinois: History, Physical Edu- cation: Plzi Delta Psi: NIU Ojficials Club: Major Minor Club,' History Undergraduate Advisory Committee: Weightlifting Club. THOMAS WESTMAN, Rockford, Illinois: Management: Rock Valley Junior College: University of Illinois: YR 3, 4: SAM 3, 4. PATRICIA WETZEL, Berwyn, Illinois: Elementary Education: Mor- ton Junior College. KATHLEEN WHERREY, Lake BluH, Illinois: Elementary Education: Dorm Council 2, 3, 4: Inter-Neptune Council 2, 3, 4, sec. 2, pres. 3, greg. 2: Inter-Hall Council 2: Residence Hall Presidenfs Council 3: VICTORIA WHIPPLE, Elk Grove Village, Illinois: Elementary Edu- cation: SEA 2, 3: Douglas publicity chrmn. 2. JOHN WHITE, Lyons, Illinois: Industry and Technology: Bowling League: Intramurals 2, 3, 4. JOSEPH WHITE, Rockford, Illinois: History, English. LYNNE WHITE, Chicago, Illinois: Elementary Education: Wright Jun- ior College: Loyola University: SEA: NEA 3, 4. MICHAEL WHITE, Waukegan, Illinois: Accountancy: Intramurals 1, 2: SAS 1, 2, 3, 4. JOANNE WICKS, Aurora, Illinois: Art: Dorm Council 2: Floor treas. 2: NAEA 3, 4: Newman, 1, 2, 3, 4. DOROTHY WIESE, Burlington, Illinois: Business Education: Pi Omega Pi 4: NBEA 4: IBEA 4: IVA 4: AVA 4. SUZANNE WIGHTMAN, Galena, Illinois: Elementary Education: SEA 3, 4, sec. 4: Sociology and Anthropology Club 2. DAVID WILES, Rockford, Illinois: Mathematics and Accountancy: Intra-varsity Christian Fellowship 1, 2, 3, 4: SAS 4: Intramurals 1, 2, 3. PATRICIA WILHELM, LaGrange, Illinois: Art, English: Alpha Omi- cron Pi: Symphony Orchestra: YR. SANDA WILKENS, Morrison, Illinois: Elementary Education, Eng- lish: Sauk Valley College. JEAN WILLE, Tinley Park, Illinois: Elementary Education: ACE 3, 4: SEA 3, 4: Saint Charles tutor 4. CAROL WILLIAMS, Dolton, Illinois: French, Anthropology: French Club 3, 4. KAREN WILLIAMS, Mundelein, Illinois: Elementary Education, Math- ematics: Iowa Wesleyan College: YR 1, 2: SEA 1, 2, 3: Concert Band 1: Pom Pon Squad 3. MARSHA WILLIAMS, Richmond, Illinois: Special Education: Kappa Delta Pi 3, 4: SEA 2, 3. JUDITH WILSON, Soutlt Beloit, Illinois: Elementary Education: Mu- sic: Chorus 2, 3, 4: SEA 3, 4: Scuba Club 3, 4. DELORIS WILT, Thomson, Illinois: Elementary Education: Sauk Val- ley College. NANCY WILTZ, Peroria, Illinois: Speech Correction: Sigma Alpha Eta 3, 4. JOANNE WILTSIE, Maple Park, Illinois: Nursing: SNO 1, 2, 3, 4: UCB 4: Dean-Student Advisory Committee 4. FRED WINKER, Clzicago, Illinois: Mathematics, Business Adminis- tratiott: Wright Junior College: Mathematics Club 4: Ski Club : Mathe- matics Faculty-Student Advisory Committee. JULIE WINKLER, Savanna, Illinois: Elementary Education: Newman 1, 2, 3, 4: University Band, 1, 2, 3, 4: SEA 3, 4: Sociology Club 3, 4: Illinois Sociological Association 3, 4. ALICIA WINTER, Freeport, Illinois: Political Science, History: Free- port Community College: South East Asia Studies Club. SHIRLEY WIRE, Winslow, Illinois: Elementary Education,' Highland Community College: Phi Theta Kappa,' SEA 4. BARBARA WISNIEWSKI, Des Plaines, Illinois: Art Education: SEA: NAEA: Outdoor Club: Gamma Delta Iota. MARY LYNN WITEK, Palatine, Illinois: Elementary Education, His- tory: Dorm Council: Newman: SEA. SUZANN MARIE WITRY, Chicago, Illinois: Special Education, Physi- cally Handicapped. DENNIS WITTENBERG, Oak Lawn, Illinois: Psychology: Saint Pro- copius College: Intramurals 3, 4: Psychology Club: Newman. LINDA WITTIG, Highland Park, Illinois: Special Education, Visually Handicapped: Norther 2: SEA 2, 3, 4. JOAN WITTRUP, Downers Grove, Illinois: Elementary Education: Chi Omega 3. JEANNIS HARTFORD WODARCZYK, Prairie View, Illinois: Mathe- matics, German: UCB 3: RA 2, 3: Mathematics Student Advisory Com- mittee 3. JUDY WODARZYK, Calumet Park, Illinois: Elementary Education, Sociology,' Alpha Delta Pi 2, 3, 4: activities chrmn. 3, 4: NCTM 4: UCB 3, 4. CHRISTINE WOERFEL, Western Springs, Illinois: Art: Parsons College. JANIS WOHLERS, Elmwood Park, Illinois: Sociology, Speech: Saint Charles tutor. CHARLENE WOKER, Stockton, Illinois: Elementary Education, Eng- lish: Kappa Delta Pi 3, 4: SEA 3, 4: Pleiades 4: Echoes 3, tutoring chrmn.: Campus Crusaders for Christ 1, 2. STEVEN WOLF, Chicago, Illinois: Marketing, History: AMA. SUSAN WOLFE, Lombard, Illinois: Elementary Education, English: Newman: McAuley pres., social chrmn. RONALD WOMELDORFF, Glen Ellyn, Illinois: Political Science, His- tor: Sigma Nu 2, 3, 4. GARY WOOD, Glen Ellyn, Illinois: music: Phi Delta Psi 1, 2, 3, 4, 5, pres. 2: Inter-Fraternity Council 1, 2, 3, 4, sec. 3, vice pres. 4: pres.: NIU Orchestra 1, 2, 3, 4: Marching Huskies 1, 2, 3: Presidenfs Advis- ory Committee on Student Life 4, 5: NIU Brass Ensemble 4: Intramur- als 2, 3, 4, 5: Inter-Fraternity Council Judicial Committee, chrmn. 4: Greek Week chrmn. 3, 4. KATHLEEN PIERUCCI WOODIN, Chicago, Illinois: Special Educa- tion: CEC 1, 2, 3, 4: Deaf Education Majors Club 3, 4: RA 3. JOHN WOODS, Waterman, Illinois: Numerical Control Technology: Alpha Kappa Lambda 2, 3, 4: UCB 2. , 428 FRANK WOOLEY, Oswego, Illinois: Marketing: AMA 3, 4: Phi Eta Sigma. NANCY WORTHINGTON, Park Forest, Illinois: Elementary Educa- tion,' University of lllinois,' Prairie State Junior Colle,Qe,' Homecoming Queen Committee l: Dorm Cultural Club: Scholarship Committee 3: SEA 4. CHARMAINE WRIGHT, Deerfield, Illinois: Elementary Education, Mathentatics-Science: Iowa Wesleyan College: SEA 3: Dorm Council 33 Outdoor Club 4. THOMAS WUICH, Wheeling, Illinois: Management: Theta Chi, l, 2, 3, 4, treas. 2, 35 Intramurals 2, 3, 4. KATHLEEN WYSOCK, Chicago Heights, Illinois: Home Economics Education: Bloom Junior Collegeg Home Economics Club 3, 4: YR 1. PAMELA YACK. Villa Park, Illinois: Mathematics, Business Adminis- tration: Ski Club 4. JERRE YEAGER, Sycamore, Illinois: Marketing, Kislzwaukee Junior College: Intramurals l, 2, 3, 4: Tau Lambda Chi 1, 2, 3, 4. TAMRA YESNIK, Elmhurst, Illinois: Elmentary Education: SEA 2.3,4. JEFFREY YORDON, Chicago, Illinois: Political Science, History, Foot- ball I, 2: Track I, 2, 3, 4: Sigma Pi,' Inter-Fraternity Council 2. KAREN YOURISON, Galesburg, Illinois: English, Sigma Tau Delta 3, 4, pres. 4: Towers 3, 4, poetry editor 4: YR 1, 3, 4. DIANNE ZACK, Streator, Illinois: Elementary Education: AWS 1, 2. KAREN ZAHNLE, Deerfield, Illinois: Elementary Education, Sociol- ogyg Cwens: Women's Choir. CAROLYN ZAJICEK, Cicero, Illinois: English, History, Morton Jun- ior College. LORRAINE ZANARINI, Highland Park, Illinois: Elementary Educa- tion, Speech: Delta Zeta l, 2, 3, 4, ruslz clzrmn. 2, 3, .social chrmn. 4: Pom Pon Squad 2, 3, 4, sec. 2, 3, 4: Homecoming Committee 2, 3, 4, coclzrmn. 4, royalty chrmn. 3, assistant publicity chrmn. 2: AWS: SEA. MARIANNE ZANDECKI, LaSalle, Illinois: English, History: Illinois Valley Community ColIege,' AWS: Newman. WAYNE ZEBRON, LaSalle, Illinois: Mathematics, Industry and Tech- nology, Illinois Valley Community College. 2.0 ...uf- ' After four years of waiting, you can finally step to the head of the line. M ,,,. 3 429 LINDA ZEGARSKI, Norridge, Illinois: Education: Sigma Sigma Sigma: Kappa Delta Pi: NEA. DONNA ZELISKO, Chicago, Illinois: English, History: Chi Delta Chi 2, 3, 4, vice pres. 4, publicity chrmn. 3, house manager 3: English Un- dergraduate Advisory Committee 4: English Club 1, 2, 3, 4: AWS 1. JAMES ZELKO, Joliet, Illinois: Biology: Joliet Junior College. MARY ELLYN ZELKO, Chicago, Illinois: Mathematics, Sociology: Delta Zeta 2, 3, 4: Panhellenic Council 1, 2, 3, vice pres. 3. MARY ZELL, Berkeley, Illinois: History, English: Chi Omega 2, 3, 4: Echoes 3: SEA 2, 3, 4. JAMES ZEMAN, Steger, Illinois: Management, History: Students for Kennedy 3: Kennedy Action Corps 4. LESLIE ZIMMERMAN, Chicago, Illinois: Elementary Education, Speech: Wright Junior College: University Theatre: Dorm Council: YD. PEGGY ZIMMERMAN, Washington, Illinois: Marketing: Alpha Phi 2, 3, 4, pres. 4: Floor vice-pres. 1: East Neptune Standards Coun- cil 1: AWS. SANDRA ZIMMERMAN, Huntley, Illinois: Home Economics, Sociol- ogy: NAEYC. PATRICIA ZINSER, Park Forest, Illinois: Nursing: Thornton Junior College: Winter Carnival Ticket Committee 4: SNO 4: Alplza Xi Delta 3, 4. PHYLLIS ZIPP, Chicago, Illinois: Special Education, EMH: Univer- sity of Illinois Circle: CEC 3, 4: Hillel 3, 4. SANDY ZOLPER, Aurora, Illinois: History, Sociology: NEA: IEA. HERBERT M. ZORN, Morton Grove, Illinois: German, Engineering Graphics: Wright Junior College,' Soccer 1, 2: Iota Tau 1, 2, 3: Epsi- lon Pi Tau 4: German Club 4. PETER P. ZORN, Morton Grove, Illinois: German: Northeastern Illi- nois College: Soccer 1, 2: German Club 4. DENNIS ZUM BAHLEN, Matteson, Illinois: Physical Education, Driver Education. HELEN HARBUZIUK. Elmhurst, Illinois: French, Psyclzology. GREGORY HORWITZ, Medinah, Illinois: Microbiology, Chemistry: Southern Illinois University: Intramurals 4: Theta Epsilon 2, 3, treas.: RA 4: Dorm social chrmn. 1. MICHAEL E. PHILLIPS, Berwyn, Illinois: Personnel Management: Morton Junior College: SAM. DAVID SNOW, Naperville, Illinois: Marketing: Broome Technical Community College: AMA 3. NANCY THOMPSON, Manteno, Illinois: Psychology: Alpha Chi Omega 2, 3, 4: Cwens: SEA: North Neptune Newspaper, editor 1. I To accomplish great things, we must act, dream, plan, believe-and love. 430 Progression of thoughts for tomorrow .... .QUAW fs f KR ,,,,.r 432 g L QMS Sameness Ju seen j pl through new eyes. ld. 'H' Leaving bleakness never seeing beauty, beauty found in patterns in new direction. I-11 Wf I1, n f 1' -,,' , WM, ,,. A...,.x.,,, M wwfMQf'i'5'M T - gi ii-. iz?iiiE Qigi:SJ W N Tiigfiwg latLE S axiifiigil. A 353, LW,. 'fffi N51 Xiemi fi .xii , 3 M I I , 5gi1gQM1iQQ 3 ? L3 ffN,:,f 'L Q M,w N rx! N QW ,waewwm W f A WH 4 , www 'W Q 435 ...---.umm-n-n-M Where ure you going, friend? Out of yesterday into tomorrow. Life leads, twists, and bends in a new direction. ,...-.---- ...qqp-an-anew 437 BEST WISHES T0 THE CLASS OF 1970 rom APEDA STUDIO 250 WEST 54th STREET NEW YORK N Y 10019 Tel 586 5755 OEEICAL PHOTOGRAPHER tothe 1970 NORTHER W 7 I I You May Purchase Additional Portraits at the Special School Rates ofthe Photo Which Appears in This Book. A dlvlslon ol Apco -Aveda Photo Co., Inc. AmericanAssociation of - - A Abbott, Doug. . . . Abe1,T ..,,, Abney, Betty . . Abrams, B.. . . . Abrams, Peter D. . . Accounting Dept. . . Aocredidation- Colle eof Business . Achlerj. ..... . Ackerman, Carol . . Activities Fair . . Adams,Arthur . . . Adams, Donald C. . Adams, G.. . . . Adams, K. .... . Adaska,Sharynn . . Ademeck,J, . . . Adler, G. .... . Administration 62 Services, Head . . Adrian, Steven . . Adult Education . Ah1berg,G. . . Ahrens, Barbara . Aikens, R ..., Aile ,Alvin . Airrlf T ..... Alaimo, R. . , . A1amprese,L. . . Albers,T .,..., Alberts, Theodore. . . Albrecht, Kenneth E. . Alden, Glen .... Alfredson, Tom .... Alice in Wonderland. . Alien Faculty Committee Allabastro,B.. . . . . Allard, B. ...,. , Allen, D.. . . . Allen, Judith . . Alles, Dale .... Allexon, Robert. . A11ison,J .... Alm, Frances. . . Alpha Chi Omega. . Alpha Delta Chi . . Alpha DeltaPi . . . Alpha Kappa Alpha . . Alpha Kappa Lambda . Alpha Omicron Pi . . . Alpha Phi .... . Alpha Phi Alpha . . Alpha Pl-ti Omega . . . Alpha Sigma A pha . , Alpha Xi Delta . . . Alter, C. ..., . Ambacher, Judith . . Ambler, Madge .... Amdur, M. ,.,,. . Amelianovich, Anthony J. . . Collegiate Schools of Business ..... American Heart Association. . V . . Amencan Marketing Association ...., Ames,D. . . ..,.. . , , Amicks, S. . . . Ander,C ...,. Ander, P. .,.. . Anderberg, Linda . . Anderson,Alynne. . Anderson,B.. . . . Anderson, C.. . . . Anderson, Dale Lynn Anderson,J .,.... . . . Anderson, K. ..,.. . . Anderson,L, . . . . Anderson, Maryannette Anderson, Roger .... Anderson, S. .... , Anderson,U., . . Anderson,Vicki, , . Anderson, Willard. . Anderson Hall . . Andich, G.. . . Andrae,Reed. . Andrews, P. . Ange1ieo,D. . . Angotti, Rodney . Ann,R .....,. Annen,L .... . . . . Anselmino, Elizabeth Arithropolo . Antognolhsailndra. . A uari-ice . . . Arsher, Kala . . Arends, Jack . . Arendt, G. . . Arenson, Allin . Argenti,S. . , . . Armenise, C. . . . . Armstrong, Kathleen Armstrong, Pamela . Amistrong, V. . . . Amo1d,B ...., Amold, Dennis . . Amold, Gerald . . 304 271 . . . .353 . . . . .261 . .52,72, 140 , . . .122 . . .122 . .255, 353 . . .353 . .176 . . .353 . .353 . .266 . .242 . . .353 . .223 . . .241 110 353 136 256 . .353 225 176 271 . .238,240 , . .222 245 353 353 . . .353 . . .292 . . .269 . . 79 . . . . .243 . . . . . .271 . . 88,248,353 . . . . .353 . . . .353 . . .353 . . .250 . . .353 . .184,198, ..184, , I f182,'229,' . .i9s, 234, . .182, 199, 239 266 222 224 . 223 . . .197, 228 198 236 225 267 183 226 . . . . .255 353 353 . . .250 . . .331 353 . . .120 . . .236 Amsm eier,Dwaine . . Aronson,B. . . . . Arrington, T.. . . . Art Bu ilding ..... Art Department . ..,. Art Department, Head . . An Festival ..... Asaro, Ashley, B. . Ask1a.nd,A. . Asmus sen, S. . . Assistant to the President ...... Associated Women Students ....... Association of Educational Sororities ...... Astar, B. ....... . Asumendi,J. . . Atkocaitis, John. . Atto, Patricia. . Aubry, Donald . . Aub ,Robert . , Augmo,Maurita . . August, Charlene . . Augustyn,E .... Auman,B.. . . . Auman,GlenJr. . . Auman, Linda M. . , Aurelio, M. ,... . . Austin, De ....... Avery, Dr. Clarence G. . . Aves, P .,...... Aves, R. ,.... . B Baarts, Dianne . . . . Babel, Rayona . . Babich,B ..... Babich, William. . Bacceti,J ..... Bacceti, Gail. . . . Bachel orof' Science . . Bacino, S ..,... Bacon Ph llis , y . . Baer,L ..,. Bailey, L.. Baileys, D. .... . Baines,B ....... Baa Marimba Band. . Ba1rer, Charles . . . Baker, Daniel. . . Baker,.1.. . . . Baker, K. . . . . Baker, Baker, Baksta Ma Jane. . Dnrgrville. . d, Daniele . . Balcerak, Richard . . Bald, James . . . Baldwin, M.- .... Balfou Balk, J r,Made1on . . ohn .... Ba11ant,B. . . . . . Ba11enger,B ....,. Ballenger, Robert. . . . Ballenggr, Dr. James. . . Balon, ennis ,,,. Barabas, Deanna .... Barcheski,P ...... ADS and INDEX . . .354 . . ,241 . . ,225 . . .104 104 104 150 . . .228 . . .270 . , .265 , , .250 . . 62 . . . , 68 . . . .234 . . .226 . , .264 , , .354 354 354 354 355 . . .355 . . .265 . . .245 . . . .355 . . . , .355 . . .240,244 . . , .355 . . , .122 . . .222,355 355 . . .246, 227 355 226 . . .355 . . .225 . . .355 . . . 67 . . .242 355 255 289 239 . . . , ,261 . . ,149, 153 . . , .355 . . .355 . . .242 355 . . . .355 . . .78, 79 . . ,355 . . .355 . , .355 222 355 355 245 , . .226 . . .245 . , .107 , . .355 . . . , . . . . .355 Everything Muslcczl Slnce 1890 229 E Lincoln Highway Palmer Mu ic House, Inc. , ..... 234 . .264 . .255 . .255 . . . .353 . . . . .353 . . . .261,271 . ,244, 250, 353 , . . . . .353 228, 244, 257, 353 . . . ,231,353 . . . 224,353 . . .353 . .353 . .238 . .244 . .325 . . .354 . . ,116 , . .255 . . . 72 . . .257 . .256,354 . . . 94 . .253 . .268 . . .354 . .100 . .354 . .197 . .354 . , .104 . , .234 . . .354 . 228,354 . . .252 . . ,354 . .354 . . .268 . . .232 . . .354 . , .354 Barcla ,Roben .,... BaretJ6otinThe Park . Bartield, President .,.. Barger, Jill ..... Bar ,I ...... Barker, Peter, . . Barker, Thomas. . Barnard, B.. . . Barnes, B. . . , Bames, Violet . Bamett, Judith . . Barney, N.. . . Barre. Michael . . Barreda, Antonio . . Barrenda,T .... Barret,B. . . . . Barrett,F ...... Ban-ios, Enrique . . Barry, K. .... . Barry, M .... Barry,Terry . . Bartels, L .... Bartels, Martin . . Bartels, R .... Bartholomew, L. . Bartholomew, M. . . Bartness, P.. . . . Barton, S ..... Baruch, Robert . . Basara, B .... Basko,B. . . . . Basko, Denise . . . Bateast, Mitchell . . Batchman,A.. . . Bates, Edwardl. . Batina,M .... Batjes, P.. . , Batura, E. . Bauer, Ann. . Bauer, E.. . . . Baumgart, L.. . . Baumgartner. G. . . . . . . , . .355 . . . . . . , . .195 . . . 76 , .... 355 . . .267, 355 355 355 . . .227 . . .252 . . .355 . , ,355 244 1 1 fsss 356 223 . . .232 . . .252 . . . 79 . , .250 . . ,250 . . .356 . . .239 . . 73 . . .229 . . .356 . . .356 . . . . .65 . . .271, 356 356 242 256 356 190 . , ,230 . . .356 . . .254 . . . 234 . . .356 , , .356 . . .255 256 ' f 1238 Baumgartner, Susan. . . . Bautista, T.. . . . Bean, M, .... . Beard, K. . . . Beard, Thomas . . Beas1eyR .... Beasley, L.. . . Beaudry, Terry . . The Beavers . . . Becaras, N.. . . Bechaz, Robert . , Beck,L ....., Beck, Marjorie . . Becker,D .... Becker, 1. . . Becker,K .... Beckwith, J. . . . Beer, B ....... Beezhold, Frank . Beguin, Susan . , Beier, George J.. . Be1ford,R. . . . Bell, Diana Lee . . 356 271 243 253, 356 356 256 244 356 .216 . 234 .356 .265 .356 .245 .261 .267 .245 . 234 .299 ,356 .356 .260 .356 356 356 325 356 356 356 Blumm, Ann . . B1umer,J ..... B1ustein,N. , . . . Boardman, Bruce . . Bober, Virginia , , Bock,S ..... Boelens, Francis . Boesch,D.. . . Bags, Gilbert. . . Bo 1er,T ...... Bo'anowski,Thomas. . Bo1atta, Elaine , . . Bo1da,D. . . . , Boldy, L.. . . , Bo11entio,M. . . . Bol1man,B. , . . . Bols, Kathleen Ann . . Bo1t,D ...,... Bombinski, P.. , . . Bomgarden, Wayne . . Bonetti, S ...,. Bonior, Carol . , Bonk, Helene . . Bell, Edna . , . . . B0gnc,F. , , , Bell, J. .... , - 4 2267, Boone, Maria. . . Be1l,M' ' - - 4244, Borchers,J.. . . Bellfuss, Judith , . . .... Bofeckij, , , Beltrano, Robert , . . . . B01-e55,A, , , Benassi, Joanne. . . . Bm-eS5,L, , , BLUEBIRD DIAMOND RINGS 315 E. Lincoln Hwy. 756-2512 239 248, 347, RENDELL IEWELERS Benavides, L.. . . . .356 Borghi, . . Bender, L .-,-4 h .223 Bor owiqz, J. . , Bengston,A .,... . .231 B0SSJa'1'9'.- - - Bengstrom, Alan . . . .357 B0St0n.W1ll1am- - Benstrom, David . . . .357 B05YvB- A 4 ' ' Bennecke,M.. . . 222,357 Botbc- - - 4 A Bennegn .... . .230 B0uchard.T44 - - Bgnnet,E' A , ,261 Bowen,P ..., . . Bennet,Jim , 4 4159 BOWHMS- ' J ' ' ' ' Bennett, J. I I , 4261 Bowers, Dr. Richard , . Bennett, Joa . . . .357 B0yd.Gafy- - 4 - - Benni,David,. . 1 ,213 Boyd-John' ' ' ' Bennis,M.. . . .258 BOYCUTH ' - 3cnnis,T, , I , ,260 Boyle, . . Benno,Kathy, . . .357 B01-3,PhE15P 4 4 Benson, John. . . .331 BFKUHC, ward- ' Benson, L.. . . . ,243 Bradford,R09 4 Berchtold, L. . . . .244 Brad1ey,C-' V - Beresheim,.1., , 263,357 Bfadnelw- - - Bei-g,K, ,,,, . .235 Branstrom,B.. , Barge,-James, , . .357 Braun, Pat. . . Befgel-,R, , . . .261 Bray, B. . . . . Ber and, B. . . . ,229 Bree1and,B. . . BerEGre ory , . . .357 Brehn, N. . . , Ber1ow,1v?ark. . , . .357 Brennan, B. , . Berman, Leslie . , . ,357 Brennen, J.. . Bennan, Rena . . , .357 Bre0.LC0l1- 4 - Bemard,P.. . . 245, 357 Bretlingtf, L- - 4 Ben-131, E, , 240,357 Briege1,J. . . Ben-y,M, , . .260 Briesch,J. . . Bers,S ..,. . .255 'The Brig . . . , Bertani,A.. . . .256 Briggs, P. . . . 4 . Berz, S .,.. 261, 357 Bnggs, Susan ..... Best,C ..,.. . .261 Brig am,D1'4R0bCf1- A BetaAl ha Psi . . . .122 Bl1mm,W-- r r 4 A Beyenfdseph. . . .357 Brink,D-- 4 - A - Bialas, Daniel . . 4195 Bl'!nkman-B- - - Bicicchi,M. . . ,250 Bl'l5Ch,M31'Y - f Bidro, James , . . .357 BFOCK, 4 4 4 4 Biesche,Sharon. , . .357 BroderiCk,M3UdC4 ' Bieze, R. ..,.. . .261 Brodenck,R-- 4 4 - Bil man, J. ..,,, . .265 Broderick, 1123111011414 - Bi15n ton, Robert. . . .357 Bronstorom, - - - - Bi11s,5 ....,,, . .265 Brooks, Beth . . . . Biology .,.... . . 84 Brooks, Mary Lou, . . Biology Deptql-lead , . . 84 B1'00kS,P ...... . . Biossat,B ,..... . .261 Brookshaw, Thelma F, . . Birch, K. ..... 231, 357 Brostrom, D. .... . Bird, Dr. Gordon . . . .299 Brown, A, . , . . . Birt.hda Party . . . .195 Brown, B. . . Bishop, Igr. George , 124,229 Brown, C. . . Bizamjgseph . , . , ,357 Brown, G. . . . B'erregaard, Wes . . . .295 Brown, Harvey . . B1ack,A. ..... . .224 Brown, Ilene . . Black, Lloyd . , . . . 89 Brown, Linda. . B1ackbum,J. ,,,. . .225 Brown, Nancy . Blackhawk Room. . . .107 Brown, P. . . . . B1aha,M ..... . .228 Brown, Robert . . B1aha,V1asta . . . .357 Brown, Theresa . , B1ahut,P. . . . .261 Brown, W.. . . . . Blair, Bnice . . ,357 Brozio, Frank. , . . . Blair, L. . . . .227 Broznowski, Daniel . . Blake, B.. . . . ,271 Brubaker, D.. . . . Blake, Daniel. . . .357 Brubaker.G1ada . . Blakely, L.. . . .261 Brubaker, J. . . . Blake, Linda . . . .357 Bruce, Alice . . Blakely, M.. . . . .357 Bruck,P., . . Blanco, Carol. . . . .357 Brucker, T.. . Bland, William . . . .357 Bfllhll, C- - - - Blank, C. , , . . . . .226 Bl H'l15Cld,E-4 - Blank, D. ..... . .247 Brunner- B-4 4 4 - Blankenstein, William 295, 367 BT11111511-Cllafd 4 - B1anton,B. ..... 248,357 Brumsktkudy A V Blaszczyk, Celeste. . . .357 Bl'y2Ull.M-- - - - Bleau, . ..... . .271 Bryant, P. . . . Bleaw, William. . . .357 Bryanks- 4 4 Blechman, J. . . . .255 Bryef,-VOYCC - - - Blees, Willem. . . .357 Buchanan, B.. . . . Bliss, G.. . , . .259 Buchanan,R0b9fl- - Blitstein, E.. . . ,358 Bucher, Dave. . . B1itz,D ...,. . .243 Buc1dey,D. . . B1omquist,J. . . . . .242 Budd, .. . Bloomer, Cynthia. . , .358 Budde, Ann , 271, 255, A 4255 . .lm A 4244 A '244 . 1231 . i261 v Bunl, , . . Bu , e . , Bultinckgli . . Burda,L. . , Burger,B .... Burger, Bruce. . Burger, J. . . Bur ,L .... . Burke, Charles . . Burke, N. . . . Burkett, L. . . Burmeister, R. . Bunneister, S. , Bumett,B., . . . Burnett, C.. . . . Burrichter, Dr. A. . Burski,T ,..., Burtness, Paul , , Burton, Cynthia, . Busam,T ..,.. Bush,S ...., Busic,Robert. . Business .,,,. Business Club ,... Business Education Busse, David . . . Busse, L. .,.. . Butendorf,D.. . . Butler, D ..,,, Butler,J.. . . 3. Butts, Charles M. Jr Buzanis, G.. . . . Buzanis, S.. . . . Byczek, R. . . . Byme, Gregory . . Byron, I.. . . . Byster,D ..... Bywalec, Judith. . Cain, Lonny , . Cain, Patrick . . Calams, N. . . Caldwell, C. , . Callahan, C. . , Callahan, J, . . , Callahan, Patrick , . Callo P . g, .,.. Calvey, J. . . . Calzia, Patricia . . Cambell, Z. . . . Cambridge, B ...., Cambruzzi, Linda Cameron, M. . . Cammarratta R. campbeu, David f f Campbe1l,J. . . Campbell, Roy . f Campbell, Wi liam Campion, Lee . , . Caneva, Ronald. . . Cann, B. .... . Cannell, Allan . . Cannell, Julia . . Capelle, T. . . . . Caputo, B. .... . C 261 360 226 . . .232 . . , .245 . . . . .360 . . .225,360 . . . .244 , . 247,- 360 271 , . 243 360 . . .256, 360 . . . .253 . , .234 . . .138 . . . .245 . . .82, 83 , . . . .360 , . .270, 360 . . .227, 360 . . . .360 . . .123 . . . .125 . , 76,123 . . .360 . . .267 . . .260 . . .264 . . .222 360 250 . , .250 . . ,250 . . . ,360 . . .240,244 ....244 ...360 . . .290 . . .361 . . . .253 . . . . .225 . . 250,361 . . .222, 361 361 . , .226 . , .265 . . ,361 . . .224 . . .271 . . .361 . , .242 . . . .242 . . .250, . f 1238, 361 361 291 361 361 361 240 . . . .361 361 243 223 361 361 266 361 Castiglia, Donna . . Catardi, S. . . . Cavaliers .... Cebulski,L .,... Cejka, Kathleen ..,. Centofante, Dennis . . Cerk1eski,C. . . . . Cemosek, Jean . . Cettadino, F. . . . . Chairman's Trophy . . Chait, Abram J.. . . . Chamberlin, Thomas . Chambers, Ronald . . Chan, J. ..... . . CHANCE rogram . . Chandler, . . . . Channel, David . . , Chapin, D. . . . . Chaplin, Ralph . . Chapman, D. . . . . Chappel, G ...,.. Charlesworth, Linda . . Charneis,D ...... Chase, Pamela . . . Cheerleaders . . , . . Chemistry Dept. . , . . Chemistry Dept.,1-lead. . Cherven ,J ....., Chesler,l'au1 . .... Chestnut, Jim. . . Chi Omega .... Chiaverina, M. . . Chin,J ...., Chin,L .,.,. Chipain, Peter . . Chitjiar1,S, ,,,. , Chivari, Elizabeth. . . Chizewski,Stephany. . Ch1apecka,M ..... Christensen,Dale. . . Christiansen, Linda . . Ciame11o,R. . . . . Ciecko,C ..... Cielak, Joe .... Cimaroli, Gail . . Cione,H .... Cipol1a,P. . . . Cisna, Connie . . Clair, William . . Clardy,Michae1. . . Clark, Barbara . . . Clark, Christine. . . Clark, Dennis .... Clark, Marjorie, . , Clark, P. .,.. . Clark, T.. . , . Clavery, K.. . Clawson,J.. . . Clay, Darrell . . Clay, Kathleen .... Clayton, Sharon . . . Clettenber Dr, Jose h g. Cliff, G. ..... P . . Clinch, James P. . . , Clossen, D. . . . . Clothier, C. . . , . Clouston, Craig .,,. Cobb, Sandra ..,,. 85 362 362 76 267 264 362 362 362 265 362 362 244 362 362 223 227 362 362 256 232 362 362 362 362 362 362 362 . . . . .234 226 227 362 362 363 362 138 223 363 234 363 363 363 363 363 363 255 264 264 271 363 259 363 230 246 363 121 . .362 . .253 216 222 362 362 227 , .362 225 199 362 362 362 226 f f 64,163,525 250 362 250 362 240 . .260 . .362 . .240 . .362 . . .326 85 1 I 1231, 245, 288, . . . .252, f f f 227,42t18,4 1 f i222,' Carlborg, William . .... . Carlsen, Sharon. . ..,... gggkfivlifili' C2-115011-BH - ' A -'-- 256, Cohen, Barbara. . . . . . Carlson, J. . . . . .225, 257, Cohen C -'.'l I I I I Carlson, M. . .... 140,225 C0lfle,l'D I,II 247 Carlson, S.. . . . .250, 361 C0l,en'gI I A ' A ' Cm-am V . - 140.361 661...,L1.. . 5 I 3 3 Came11,H., . . .... 225 Colm HII I I I 250 Carpenter, J. . . . . . .252 Cl-,lm'MI I I I I ' ' ' ' Carpenter, Phyllis . . . . . .361 Colby Bal-lm-3 I I ' ' ' ' Carpenter, R.. . , . .268, 361 Cole lg II,, I I ' ' ' ga1'r,IRichIa5rd. , ....,. 361 Colelmm C IIIII I arra er, . . . 'A-A 225 Collar, Margaret , . , , . . . gaffollv - ' - A -26113253 361 c611ege6fBusiness . . . .l20, arson' ' ' ------ 267 Collegeof Continuing C2rSlenS,L. . . - - . 234,361 Education ...... . .136, 201 gafslensenifl' - ' - 4 142- 361 College of Education . , , . 76,108 anervx' '- 4 ' A -243 College of Fine andApplied Carter.M ....... . . .230 Am 'I'IIIIIII l02 Carter,N1cholas K. . . .361 Coll, e0fLlbemlAl-ls ' A ' CBffefVR1'a , AAA- V A A361 amisciences . . . , . .82-3, 65 Carvel1,PhP'111s A.. . . .361 Colleges II,IIII I I I 80 SBWPNO1 - 3 V - - - 4222 c611i6r,Dean136y. . . . . .69 aSC19,B9vef1y- - - V -361 Collins, Brian, . , . , . . .363 CSSHIOHJC- ,V - - - - -264 Collins, DennisJ. . . . . . . .363 CaSP9fS0nJ-11143 V A - V V -361 c611ins,1 ..,.. . . 270,363 025196111 Mafllyn- V - 4361 c611ins,R6ben . . . . . . .363 CSSKCLA --AAA - - -231 c611ms,T .... . . 271,363 ' 101112911 ' Robert Bruce ' Cricketeer ' Manhattan ihh . H l ' Clapps Ltd. 0 Iockey 112 Q51 iii ii 440 Co1son,S ..... Colton, I. .... . Community Theater Series .... . . Comptom, J. . , . Concert Band. . ConcertChoir . . Coniglio, Christine . Conk ing, William. . Connell, J.. . . . Connelly, William. . Conner, Jerry, . . Conners,Nancy, . Connolly, Jim . Connor,J ..... Conrad, Carolyn , Conrad, D. .... . Conradi, Donald , . Conway, A. . . . Conway, Janet . . Conwa , Kevin . . Cook, Kinda S. . Cook, Paul, , . Cookas, M.. . . . Cooperman, Janis. . Copp,Je1TreIyIP.. . . Coppoletti, ona. . Coguillard, Patricia enness .... Corchin,lvl1 .... Corcoran, Debbie . . Corcoran, Nancy Ellen . . Corey, Martin . . . Corich, Margaret . . C0miola,C ..... Cosgrove, Richard W. Costa, P. ..... . Cottonaro, Angelo. . Couch,D ...,. Cough1in,J ..... CountryMixer . . . Countryman, Veilyl . Courage, Michae . . Couturier, James Jr. . Coveny, B. ..,. . Covolo, Paul . . . Cowan, N... . CowheyfB.. . Cowhey, K. . . Cowie, Linda. . Cowin, R. . . Cowsert,T.. . Cowsills. . . Coxon,C ..., Coyne, Martin . Cozad, B. . . . . Cramer, D. ..,. . Crawford, Katharine Creek, Darlene . . , Creighton, Nancy . . Crew, D. .,.., . Crocker,D. . . . Croisant, Roy. , . , Crone, Frederick , , Cross,S.. . , . , The Crucible . . . Crudup, Glenda . , Crumbacher, Carroll . Culbertson,D .... Cu1hane,J.. . . . Culler, P. , . Cummings,M. . . Cunning am,J.. . . Cunnirggham, Nancy . Cupp, andra-Lee. . Curran, Kathleen . . Curran, T. . . . . Cu ,Freida .... Cugl2,r,B. .... . Cuthbertson, Gerald . Cwcns. ...... . .260, . ,178, f i268,A f I229, Q I325Q . f161,' f 1229, 1 1222,- . 265, 24o,'244,' f f365,' .227,'234,A 234 363 190 225 299 300 363 363 239 363 363 363 363 292 363 231 363 234 363 363 363 364 254 364 364 364 364 235 243 364 364 364 223 364 254 364 253 223 268 364 365 365 250 365 265 256 244 289 265 237 189 223 365 226 265 365 365 365 252 365 365 365 365 160 251 365 261 242 268 225 365 365 365 365 266 365 225 365 216 257 266 Czajkowski, E. . . . . . Czech, T. . . , , . Daar, S. .... ..... .... 2 5 9 Dabke , Laurel . . . . . . 228,365 Dahl,Ji , . , . .... 239 Dakie, K. ..... . . .265 Daldegan,D. , ..... . . .270 D' Alessandro, Donna . . . . .365 Caps and Gowns Produced Here' OUR G1-:NE1zoUs, com- pounded earnings - added to your regular savings - can see your child throu h colleg . DeKALB SAVINGS LOAN ASSOCIATION Third 8 Locust Streets DeKalb IIImo1s . i e' 8. Daley, Lynda . . Dam, Sharon . . Danca, Rich .... Daniels, L. .... . Daniels, Ruth Enid . Danielson, J. . . , . Darby, Connie . , Darner, L. . . . Data Processing Machines . . . Datschefski, John . . Daum, Linda , . . Daum, Richard . . Davidson, B. . . Davidson, R. . . Davidson, Susan . Davis, C. . . . . Davis, David . . Davis, James , . Davis, K. . . Davis, S. . . . . Davis, Timothy . . Dawson, K. . . . Dawson, Pamela . Dayton, James . Dean, Barbara . Dean, Diane . . Dean, N. . . . Dean of Men . . . Dean of Women . Deans .... . . . Dean's office .... Dean, Dr. Sanford J. . Dean, Susan .... Dean, Jose h . . . DeBates, Nljary . . DeBoer, Anita . . , Dechambre, Annette . Deering, Leonard . . Deerins, K. . . . . DeFranco, Terry . DeFrang, B ..., DeGroot, L ..... Deist, R. ..... . DeJaeIgjher, Richard . DeKa Hospital . . DeKalb Nursing Home DeKeyser, Margaret . DeKoven, Daniel J . . Delaney, D. . . . . Delaney, K. . . . Delcore, Nanc . , DeLeo, Nichollas . Delevitt, Floree . . Deliganis, .Iim . DeL1ne, Keith . . Dellenbach, J. . . . DeLorier, Joseph . . Delp, B. . . . . . Delta, Gamma . . Delta Sigma . , . . Delta Sigma Epsilon . Delta Sigma P i . . Delta Sigma Pi . . Delta Sigma Theta . Delta Tau Omega . . Delta Upsilon . . , Delta Zeta ...,. DeMent, Edward L. . Demere, Leon L. . . Demko, Theresa . Demmert, William . DeNico1a,Darice . . Denk, Candice . , . Dennison, Marsha L. DePhilips, R.. . . . De pert, Keith . , . Degalvo, Mary Jane . Desmond, Denis . . Desser, Steve .... Deutsch, B, .... . Devine, Diane Joan , DeVito, Diane . . . Dew,J ...... Dewe , Sue . Dial Xccess. . Diaz, B ...., Dick, Carole . . . Dickerson, Craig . . Dicklow, W ...,. Diehl, Melvin. , Diener, Ron . . Dierks, Jeff ..., Dierson, David . . 365 365 365 . . .237 365 226 . .23l,366 239 . . .112 . . . .366 . . 234,366 , . . .366 . . .366 . . .271 . . . .366 . 366,227 . . . .366 . . .366 . . .243 . . .366 . . .366 . . .260 . . ,366 . . .366 . . .366 . . . .366 . .261,366 . . 66,69 . . . 68 . . 68 . . 69 . .231, . .234, . 234, 98 366 366 366 366 366 366 227 366 232 239 252 366 117 246 366 366 366 366 . . .366 . . .366 . . .367 . . .259 . , .367 , . . .251 . . . . .367 . . . . . .256 . .1s2,197,19z1 243,269 . . . .236 . . .246 . . .257 . . .229 . . .248 . .155,l84 186,232 . .19s, 199,233 . . .198,246 . . . .367 . .239, . .239, . .253, 254: 367 367 367 267 367 367 225 367 367 367 257 255 . . . , 367 367 . . . , .244 . . . .367 . . .123 . . .245 . . .367 . . .367 . . .256 . 256,367 . . ,268 . . .367 367 Dundas, Leo .,... Dietcher, R. . . Dietz, Michael . Diggs, Sandra . Diggs, Tyree Jr. . Di l, Howard . . Dingraudo. John . Diorio. D. . . DiPaolo, B. . . DiPompeo. L. . Dipori, T. . . . Direction 70 . . Dirksen, George . Dirksen. James . Discifnio, Diane . . Ditel 0. I. . . . Division oflnstruction Dixon State Mental Hosgital . . . Dmit, amela . . . Dober, Roger Rodney Dobie, Arlene . . Dodd, Pervis . , . Doering, S. . . . Doerr, eanne . . Dohner, Glenn . . Dolan, James . . . Dolezil, JoAnn , . Domin, Arnold , . Donahue, L, . . Donald, O. .... . Donaldson, Ellen . . Donatt, Suzanne . . Doneen, J. ..,. . Donka, D ...,., Donnelly, Edward . . Donovan, Diane . , Donovan, Gerald . , Donovan, James . , Doran, C ..... Dorfman. Andrea . . 255 Durst. Jelier J. . . . . .367 Doubek. Susan . . . . ,367 Dougherty, Maureen . .225, 367 Douglas ,,.... 300 Douglass, Paul . . . 257, 367 Dow. J. , -. . , , ,261 Doyle, Jeannine. . , , 226, 367 Doyle. Sharon , , . . 250 Doyle. Tim . , , 242 Draper. Nancy , , ,4, 201 Draper. W. . , , , ,367 Draus. Christine . . 367 Dredze. Edna . 367 Drees, Lvn . 231 Dre er. Janice . . 201 Drelich, J. , . Drew, Sharon . , . Drilling, Patricia A. . , Drillin ,Susan M.. . Drobici, William . , Druckner, Celia. DuBrid e. Carl . . . . Ducak,IE. . . . . . DuChette, Sally . . , Dude, Gerald. , . . Dudle, N . , . . Dudnwitz, F. . Duensing, D. . . Duff, R. . . . . . . Duffy, M. . . . Q I 1244, . . Duffy, Terrence . . . . . . Dugo, Darlene A. . . Duguid, Bruce B. . . . Duke . . . . Duke, James . . . , . . Dull, Lanna . . . . . . Dumaski, Kathleen . . . . Dumyahn, Dennis . . . 268 368 368 368 368 228 368 368 368 368 . , 229,368 246 225 368 368 243 , 242 . . .250,368 368 368 368 Duncan, Dr. Margaret . . Dorfman, Susan . Domquast. Cheri . RELAXA TION CONCERTS INSTRUCTION ART EXHIBITS ,,,......267, 243 , .368 . . .368 368 Dunlap,J ...,., Dunlop, T.. . . . Dunn. Catherine L ....,, . .368 Dunn, John . . . , ,370 . . . .368 Dunn, Kathy . . . . . . .251 . .234, 368 Dunne, D. . . . . . .256 . . .244 Dunning, Janet ...., . . .370 Durkiewicz, Linda B. . . 370 Durkin, Mary . , '. . , .370 . .368 Durley, Jerald . . . . . 64 - .368 Duszynski. Patricia . . .370 - -294 Dutenhoefer, Judy . . .370 A - -363 Dutenhoefer, Scott . , , 370 - - - '225 Dutkeiwicz, L. , . . .244 -260. 368 Dvorak. Judith . . . . .370 A A 1363 Dyekman, Don . .... .370 368 Dyer. Dan . . .242, 370 -369 Dygert. Harriet , . ,,., 370 Dzurisin, Gregory . . , . ,370 369 E .369 Eames, D. . . . . . .270 ' Eams. Donald G. . . . .370 ' Laton, Irene . . . . . .370 ' Eclhogs I. . . . . c , va ee , . . . . . ' ' Economics . . . . . . 86 1 1253 Acting Head. Economics Dept. . . . . . . .86 - -27' Ede1hen.R, ....... . . .259 ' ' Edison,S .......... . . .228 ' ' Education Acting Dean . . , . . . 108 145 225 ' ' Educational Administration 369 369 98 369 and Services ...,... ..... 1 10 ' ' Edwards, G ........ . . ,225, 259 ' ' Edwards, R. , .... 225 1 Egamrlxiucy. . . . er. . . , , . . . , r - Q23 einen. P. . , . . . . .267 ' ' '369 Ehrhorn, Larry , . . .370 ' 'H6 Ehrlich, M. . . . . .243 ' ' '369 Eichler, T ...... . . .251 ' ' '246 Etsendori C. . . . . . . .255 '225370 Ekstrom, S. , 1. V , , . , .228 ' ' ' 370 Election Commission . . . .... . .266 Elementary Education , , ........ 111 orthern Illinois mversit UNIVERSITY CENTER Head, Elementary Education Dept. . . . . Elias,L. . ,... . . Elias, P ..... Elitstein, E. . , , Elder, Axel Elkins, Trudy . Ellenberger, E. . Eller, R. . . . , Ellers, Margaret .1 , Elliot, James . . Ellis, B .... Ellis, J. . . Ellis, S. . . , Ellison. Nancy . , Ellison, Stewart . . Ellul, M. , . . . Elwood, Rosemary . Emerson, Mae Alice Emma, Elvira .... Engelking, Gerald . . Engerman, S. . . . Englebaugh, D. . . Engling, J ...... English Defft. . . . . Ensglish an Undergra tudies Director. . Engstrom, Sandra . . Epsilon Delta . . . Epsilon Pi Tau . . Epsteim, Herbert . . Erhart, K ..... Ericksen, Janet . . Erickson, C. . . Erickson, D. . Erickson, G. . Erickson, J. . . Erl, B. . . . . Erlander, B ..... Ermilio, R. . . . . Escorza, Jame Garcia Eskinazi, A. . ., . . Eslinger, L. . . . . FORMAL DINING ROOM CAFETERIA SEATING FOR 750 TWO PRIVATE DINING ROOMS SNACK BAR SEATING FOR 645 ENLARGED BOOKSTORE GALLERY LOUNGE TWO BALLROOMS IOO GUEST ROOMS I8 MEETING ROOMS LECTURE HALL SEATING FOR 995 GAME ROOM I6 BOWLING LANES I8 BILLIARD TABLES . fm' 111 250 250 255 321 370 370 241 370 70 . . I f261,' . .231,29I, f f2d4,' . .245,' . . . .251 370 370 265 370 370 370 370 370 370 370 267 371 371 87 duate . .2s9, . .261 . .223, . .250, . .240, 76 371 236 106 371 261 371 371 . . .257 371 253 244 225 229 371 235 267 SERVICE DINING HOSPITALITY RECREATION O O O O MEET YOUR FRIENDS AT THE Esquivel, Irene . . Essary,B .... Estes, T. . . . Estko, Susan . . Estrin, Robert . . Evans, Gay. . . Evans, Leonel . . Evans, S.. . . . Evers, James . . . Evers, T. ,,... . Experimentation . . Eysenbach, Alice . . . F Fabian, C .... . . . Faculty Committee for Social Responsibility. Fahrner, Christine L. . Fait, Kenneth . . . Faktor, Vaclav . . Falen, J. ,.., . Fancher, L. ..., . Fancher, P. ..... . Farashahi, Elimbeth . . Farber, B .,..,. Farkas, L ..... Farnsworth, K, . . Farnum,'Virginia . . Farrell, R ..,.. Farrell, T .... Farrell, Wilbur . . Farren, Jeff . . Farrish, N. . . . Fass, Larry 11 . . . Fatter, Ba ette . . Fatti ,John . . FaulEner, L ,... Feagan, June .... Featherstone, John . Fechner, K. . . . Fehr,Stephany . . . Fehrenbacher, James . Feingold, Karen . . Feld, E ...... Feldman, J. . . . Feldman, Sandra . . Felicetti, Gary . . . Felix, Judith . . Fellows, C. . . . Ferguson, P .... Fernow, Lynda . . Fernow, William . Ferrante,J.. , . Ferrin, Steve . . Ferris, L. ..., . Ferrone, S. . . . . Fessenden, Cheryl. . Fessenden, S. . . . . Fetters, Frank . . Feusahrens,M. . . . Feyerherm, William . . Fian, Ma ...., Fiedler, .... Fida ,D. . . . Fields, D ...., 223, 371 232 256 . .371 371 371 371 . .244 . .371 . .231 . . 85 . .178 . .252 . . .177 260,371 . .371 . .371 . .234 . .250 . .227 . .371 . . . 26 1 .240, 244 . . . 244 . .371 371 . 252, . . .266 371 292,371 . . .244 . .371 . .371 . .371 . .237 . .371 . .259 . . .243 239,371 . .371 . .372 . .261 255 372 372 267 260 243 . .372 . .372 . .232 . .372 . .261 . .251 . .372 . .244 190 234 372 372 . .250 226 372 155 372 Forsberg, Janice S. . Forsner, Sue . . . Forster, N. .... . Fortunato, J. . . . . . Fortune, Helen Joyce . . Fossier,Annc ..... Foster, Jane .... Foster, John . . . Foster, Robert . . Foster, William . . Fowler, Joyce .... Fox, Dr. Amold. . . Fra elle, P.. . . . Fraiey, Donna . . Frale ,S. . . . Franlz S.. . . Franke, W.. . . . Frank1in,C ..... Franklin, GregoryT. . Fransen,P.. . . . Frantz, Candace . . Franzese, J. . . . Fraser,E .... . Fraser, R. ..... Frech, Linda ..... Frendendall, Ernest . . Fredericks, Paul M. . . Fred1und,J ..... Fredrickson, S. . . Freeberg,B ..... Freedman, Harley. . . Freeman,C ..... Freeman, P. . . . . Freestrom, Janice . . French, Beth. . . Fresso, James. . Frey, Barbara. . . Friedlung,M.. . . . Frier, Kathryn G. . . Frierman,S .... Frindell, K. . . Freund, R. . . Frey, F. . . Freyre,F. . . Friestad, Rita. . Frig, Gayle. . . Frish, T. .... . Fritsch,E ...... Frohan, Barbara . . From, D. ,... . Froom, William. . Fn1g,P ..... Fryendal,P. . Fuhs, Ted . . . Fuist, Gordon . . Fulbright .... Fuller, Charles . . Fulton, Cliff . . Funcik,J .... Furey,B.. . . . . Furey, William . . Furst,R.. . . . Fury,Biu . . . . . G 240, 241, ..f25 . . .26l, 237, .373 150 373 373 267 373 373 373 373 373 .373 76, 77 373 373 ' 4253,'324,' ' A 4200,'253,i 232, 1 Q 1225, 0, 228 254 260 265 373 253 373 261 257 261 373 373 373 238 247 228 264 325 246 373 325 373 373 258 373 261 253 235 225 268 373 373 265 266 373 227 66 228 223 264 373 79 373 331 373 254 373 373 200 Fifth Dimension . . . Gach, J. ....... . . 266 Figura, Linda. . . . Gaertner, Terrance . . . . 374 Finest D1n1ng Downtown 143 N. Second St. Filerman, F ...... . . .260 Gaffney, T. .... . . 266 Finance Department. . . . .124 Gagler, Jeffrey . . . . 374 Finance Dept., Head. . . . .124 Gagliano, S. . . . . . 240 Finch, D. . ..,, . . .231 G:-gl1iano,T ..., . . . . 261 Fine Art Festival . . . . .151 G reath, L. .... . . .248 374 Finfer, J. ..,... . . .235 Gallagher, Colleen . . . . . 374 Fine A Applied Ans, Gallagher, Gail . . . . . 374 Dean ...... . . .102 Galle, K.. . . . . . . 225 Fine, H ...... . . .243 Gallien, Dale E. . . . . 374 Fine, Irwin . . . . .372 Gallina, Nick . . . . 374 Fink, Howard . . . .372 Ga1l0,YV0l1I1C - 4 - - 374 Fink,R ..,.. . 243,372 Gal0wick,E. - - - . 239 Finn, Daniel . . . . . .372 Galy0l1,-llldilh - - - - 374 Finnicum, Craig . .... 372 Gamma Omega f - ' ' 235 Fishella, Nancy . . . . .246,372 Gamma R110 4 - 4 - - - 245 Fisher, Gerald M. . . .... 372 Gange,DlfiIlC M- - 4 - - 374 Fitzankav ...... . . .228 G2wsler,D. . 4 . - - 242 Fitzgerald, L. . . . . . . . .228 GHHDOH, K- - - - - 266 Fitzgerald, M. Margaret . . . .372 GarbaCZ4 Joann - - - - 374 Fitzpatrick,T. .... . . .232 GarC1a,Manuel. - - - 321 Flaherty, N ...... . .258 Gafbet D -4-- 4 4 250 Flanagan, Eileen . . . .372 Garber.J2yH9 - - - 4 374 Flanagan, Gary L.. . . .372 Gardner,Jan1ce- - 4 - 374 Fleck, Richard . . .... 372 Gardner-J0hH B- - - - 62 Fleming, Ban. . . .... 195 Gar1epy,SuSan L- - - - - 374 Fleming, K. . . . . . .240,244 Garlanger, James W. . . . 374 Fleming, Patricia . . . .372 GBUICN- P31-ll ----- - - 374 Flower, P ....... ......... 2 50 Gamfabl E- -4-- - - 226 F1,,ckILI, ,,,,,, ,,,,,,, 2 56I372 Garofalo, Edward. . , . 375 Flnnkie Independent ......... 155, 184 Garrett. D- ---- - - 244 Organization .... . 188, 216, 217, 218, 219 Garrcllt NHHCYI - - - - - 375 Flynn,G. ..... ...... . .232 Garringer,B9n1t2- - - - 375 plynnIMI I I ,,,,,,,,, 260 Garrts0n,Wtll1am. . . . 146 Foe,-,5chIRI I , ,232 Garrity, Diane . . . . 258 Foley, Janice . . . . .372 Gafflly, P- - - I4 4 - 4 4 245 Fo1kerts,JackA. . . .312 Gaseolgpe,Reg1HH - - - - 375 Fonferko, Paul . . . . .372 GGSIGC 1, Rllih 4 - 4 4 4 375 Ford, D. ....... . .228 gaskilhs-K I- - 4 4 4 -- 4 ' ' assman, a nn. . . . . FSfSg2,E5'e'fdfh'PI , I I I246 Gassmmg. . . . 239,375 Foreign Language Dept. . . . 88 Gfm0IlC,Al1CC - - - - - 375 Foreign Lantguagg, Head . . . . 88 Ga1f0r12-T-- - - - ' - - 244 Foreign Stu ies Rice . .78,79 GMZJ' ' ' ' ' '239' Foreign Studies Program . . . . 67 GaUb1DaVld - - - - - ' 2 2 F0reman,LindaE. . . .... 372 GaUFUS4P-s- 4h- 4 - - - 325 Forgacz,L. ...... . .z55, 312 GQUHPP- WP en 4 - 4 - -244 Forman, Marilyn . . . .372 GaUmef-K- - - - - 4 - Forrer,Russ . . . . .372 Gawnevii -'--- - - - 234 Gebauer,P. . . . . . .159,265 Gendelman, Jeff . . . . . 225 442 Ge aran, M ..... Geilback, L. Q .... Geigle, Francis R. . . Gelasi, S. .... . . .234 . .265 . . 65 243 Gorman, D. . . Gosch,Cindi . . Goscinski, K. . . Gould, Stephen . . 254 181 243 377 .377 377 377 377 377 Geller, Stacie . . . . . .375 Gorecki, John . . . . Gellerman, H. . . . 250, 375 Gomian, Daniel . . . . Geltner, C. . . . . . .255 Gorowski, Eugenia . . . . . Gelner, H. . . . .261 Gorski, Kenneth . . . . . Gempeer, M. ..... . . . .245 Goscinski, Kathleen . . . . . Gentile, P. . . ,... . .260, 375 Goss, Sharon ...,.. . . .377 Geograghy Dept. . . . . . . . 89 Gouzin,D. ,,.. . . . . . . 244 Hea , eography Dept. - . . 89 Goyack, John ........ . . .377 Geology Dept ...., . . 90 The Graduate fKeynoteJ . . . .164 Georgas, Harry . . . . . .375 Graduate School . . . . . . .128 George, G. . . . . .... 234 Dean, Graduate School . . . . . 128 Gerber, S .... . .234, 375 Graff, S. ........ . . .260 Gergits,D. . . - - .229 Graham, A. ..... . . .270 GCISHU, D011 - - - 4322 Grams, Linda . . . . . .377 Gergori, T. . . . - .238 Grant, C. ....... . . .234 GBIEUSOH, L- ---- - -242 Grant Towers North. . . . . . 58 Ger en, Patricia . . . . -375 Granzin, S.. .... . . . .244 Gershon, S. .... .... 2 34 Granzow, Loma . . . . .377 Getzlaff, Kathryn . . . ..... 375 G1-35531-Isugan I I I I I377 0012001 Julie 4--- - - -261, 375 Gravelle, Paula . . . . .377 Ghesko, J. ...... .... 2 25 G,-,WCSI 1 ,,,II I,I,I 2 50 Ghetzler, Rosemary . . . . .375 Gray, E, ,,,, -, I I , ,230I 377 GibS0Il, C4 ------ - -233 Greek-to-be-Dance . . . . . .263 Gibson, Ray .... - -293 Green, Charley . . . . . .292 Gibllla, P -4-- 4 -223 Green, N ..... . . .228 Gibula, Dennis - - . .375 Greene, P. . . . . . .253,325 G1eIlkO, James . . . . .375 Greenberg, T, I I I I ,259 Giermak, C. . . . . 195, 243 Greenwald, Steve . . . . .377 Schultz Bros. Co. , . DeKalb s Largest Vorlety Store Downtown DeKalb Gifford, Dawn . . ....... 375 G1-eg0riIT, , , , . . 238 Gilbert, T .... ........ 2 38 Gregorin, Jane . . . . 377 Gilbert Hall . . . . . . 182, 198, 208, 214 Gregory, Henry . . . . . 377 Gilboy, Dianne . . . . .... . . .375 Gregory, Lawrence . . . . . .377 Giles, Jan ...... .... 2 43 Gregory, P. .... . . . .230, 377 Gilio, Myra Lynn . . . ..... 375 Gregory, Susan . . . . 377 Gill, C. .... '. . . . .242, 375 Greier, Dennis . . . . . 377 Gillespie, A .... .... 2 43 Greiss, D ....... . . 225 Gillog y, U. .... . . .232 Grennan, Marijean . . . . 377 Gilmour, James. . . . .375 Grice, William G, . . . . 377 Gilmour, Sharon . . . .375 Grjdcr, Terry . . . . . 377 Gin her, Janeen . . . .375 Grig5iak,B, . . . . 323 Ginaler, B. ...... . .238 Griffin, Patricia . . . . 377 Giovanazzi, Darlene . . . . .375 Griffith, Leslie . . . . 377 Gipson, S ....... . . .268 Grim, Stana . . . . 378 Giroux, Carole . . . . .375 G,-ime5IjI I I , . 228 Gisel, Connie. . . . . .375 G,-immI5I I I , , 227 Giselson. K- - - - - - -257 Gmsonieo. . . . . . . .235 Giudice, John . . . .... 376 Gross, N, .... 264, 378 Giuntoli, Philip J. . . ..... 376 GmbbID0na1d , , , , 92 Givertz, M. .... . . .255,376 Gmbe,-1, KI I I . ,222 Glajsek. B- ----- ---- 2 28 Gmmmel, M. . . 231, 378 Glander, Nancy. . . . . .376 Gmnd I JI , I , I . 224 Glasser, Katy. . . .... 251 Grunkiol-51, TI I I , 270 Glassner, Lorel . . ..... 376 G,-uns, K IIII 231, 378 Glatzhofer, L. . . . . .260, 376 Gmpg-:I L III,I 234, 378 Gleason, Bruce . . . .... 376 G,-yZikI C ,,,,,. 258, 378 Gleason, Sandra L. . . . . .376 Guagjiardo, Ronald . . . 378 Gleisten, Marshal . . . . . .376 Gua doni, Paul Louis . . . 378 Glenn, G ...... . . .376 Guarino, Frank .... . 378 G1ennon,D .... . . .242 Guenther, Kathleen . . . 378 G1inke,C. . ,. . . . . ,265 Gu1brandson,G. . . . . . 245 Globetrotters .... . .178 Gullo, Blase ...... . . 378 Glover, PaulE. .... . .376 Gunderson, William J. . . . . 378 Glowiack, Theodore . . . . .376 Gunning,T ..... . . . 270 Glusek, R. ...... . . .232 Gunther, Randall L. . . . . . 378 G1uszek,J. . .... . . .340 Guss, Glenn .... .... . 304 Goble, T. . . . . . .237 Gustafson, K.. . .I 260,378 Goddard, Jerry . . . . .376 Guth, B. . . . 267,378 Godley, Pame a. . . . . .376 Gutmann, R. . . . . . .247 Godman, Carolyn . . . . . .376 Gutshell, J. . . 181, 225 Godman, James. . . . . .376 Gygsler, T. . . . . . . . . .225 Goeh1,S. .... . . .231 Goff, D. ...... . . .229 Goff, Richard .... . . .376 H Go 0, Dr. G. Allan ............ 119 Goiain, B ................. 250 Haag, P. ....... .......... 2 56 WAYMANS ACE HARDWARE DOWNTOWN Sycamore Road 756 2413 DEKALB ILL 758 441 1 I - I . .- Golbrecki, J ..... ......... 2 38, 340 265 Golbus,J ..... Gold, She J .... Goldbergfgancine . Goldberg, L ..... Goldenberg,MarilynG. . . . Goldenberg, S .... Goldfedder, B .... Goldman, Mark . . Goldman, Roberta . Goldstein, B. . . . . Goldyn, Joseph M. . Goller, W. . . . . Golnik, Diane . . . Gonsiorek, Judith . . Gonsiorek, Thomas C. Gonzales, Pat .... Gonzalez, Vincent . . Goodman, Diana . . Goodman, Michale . Goodman, Susan . . Goodrich, Barry . Goodrich, Dale . . Gordon,G. . . Gordon, S. . . Gore,P. . . 376 376 227 376 255 . .259 . .376 . .376 . .259 . .376 . .244 376 376 376 . . .376 377 377 377 377 377 . .377 241 267 229 Haag, Sheldon ..... ........ Haaland, Candace Joy . . Haars, L. ....... . Haase, Arlan ..... Habas, Mar e . . Habecost,Kg . . . Haberkom, Joyce ..... Habes, Robert ....... . . Hackamack, Dr. Lawrence . . . . Haddock, Dean Ruth . . . Hadley, Peter G ..... Hagberg, R ....... 1-la elman, Charles W. . . Hain, Ray ...... Hahto, Peter .... Hai1Scrawdyke . . Hailstone, Richard . . Haines, S ...... Hale, Karin . . . Haley, J. .... . Haley, Susan E. . . Halliwell, David . Halloran, M. . . Halm, T. . . . . Halvorsen,D.. . . Hamann, Sharon . . fffzi . . .zslv 9, 378 378 243 378 378 239 378 378 125 68 378 231 87 304 378 195 378 223 378 223 378 195 378 252 378 378 Hamilton, Bruce . . Hamilton, L. .... . Hammar, Ra mond . . Hammerich,lilarold . . Hammerman, Donald R, . . Hammett, Kathy . . . Hande1's Messiah . . . Hanley, J ,.... Hanley, T. , . . Hanna, James . . Hannibal, Melvin . . Hansen, Laura . . Hansen, M. . . . Hansen, Robert . . Hanser, B ..., Hanson, C. . . . . Harbuziuk, Helen . . Hardesty, Ralph . . Hardingg Cheryl . . Hardy, . ,... . . Hardiman, Mary . . . Hardin, Elizabeth Gram Hardt, L. ...... . Haring, David .... Harlem Globetrotters . Harms, G. .... . Hame ,B.. . . . Haroldi Joseph . . Harrenstein, John . . Harrington,J, . . . Harris, Dr. Edward . . Har'ris,Jane Marie . . Harris, Jean Ellen. . . Harrison, Janice Kay . Harrison,K ...... Harrison,M ...... Harrison, Ronald . . . Harrison, Susan Eileen Miller .....,. Harshman,D. . . . . Hart,P ..,., Hart, Richard. . . Hart, Ruth. . . Hartel, Carole . . Hartigan, Mary . . Hartley, Joe . , Hartzell,M. . Harvat, L. . . Harvey, T. . . Hasek, T. . . . Haselton,C .... Haseman, Linda . . Hass, Kem .... Haufe,Jean .... Hauser, William . . . Hausman, Mary Pat . . Hausman,P, .... . Havelka, Ronald . . Hay,C ...... Hayes, C. . . . Hayes,G ..... Hayes, Priscilla . , Haymaker,C, . . . Hanson, Emest E.. . Hanson, Janet . . Hanson, Linda . . Hanson, Ray E.. . Hanssen,Sissel . . Happach,B. . . Haracz, Robin . . Harb, R. ..... . Harbuziuk, Helen. . . Hayna, John ..... Hazard,T. ..... . Health,.Center . . . . Heart and Torch Award Hedberg, Dale Terry. . Hedges, John ...,. Hedstrom, B. . . . . Hedstrom, Patricia . . Hedstrom, W. . . . Heffernan, Nancy. . . 378 228 378 . . .379 . . . 114 . . .379 . . .300 . . .234 . . .242 . . .379 . . . 195 . . .379 . . .222 . . .379 . . .259 . . .246 . . .430 . . .379 . . .325 . . .224 . . .380 . . .380 . . .231 . . .380 . . .178 179 234 270 380 380 380 . . 231, . . .77, 76 . . .330 . ..... 380 . ...... 380 . . . . 240,244 222,225,235 . ...... 380 f I 246, 380 238 380 380 380 380 . . .380 322 261 238 254 257 239,325,380 380 Heftman, L. . . Hegner, R. . . . Helden, F. . . . , Heider, Robert . . . Heilman, Donald . . Heinisch, Mary . . Heinrich, B ..., Heintz, La Vonne . . Heinz, A. . . . . Heinz, M ..... Heinz, S. ...... . Heinzeroth, Sandra . . Helford, L. .... . Helmick, K ,..... Hemminger, David . . Hemcpel, , ..... Hen erson,J. .... . Hendricks, Mary K. . . Hendricksen,L1nda . . Hendry, B. .... . Henn,M, . . . . Hennen, Joseph . . Hennigfr, D. . . . . Henric , Lauren R. . . Henry, Robert ..... Herbert, Dr, Edward. . . Herbert, G. ..... . Herblick, K ..... Herbst, Barbara . . Herman, C. . . . Herman, E, .... . Hermann, William . . Hepner,RoJean . . . Hernandez, D .,.... Hernandez, Marguerite . Hersma,J. ...... . Herzing,J. ..... . Hess, Susan . . . Hesler, Pamela . . . Heuberger, John . . Heun, R. .... . Heyer, Robert . . Heyderhoff, K. . . Hibbard, Sandra . . Hicks, D. . . . . Hicks, S. .... . Hieber, Roger A. . . Hiera, Richard .... Hi ins, B. ...,.. . Hiifebrand, Mar'iann . . Hil oe, Jan ...,.. Hilf Eileen .,... Hill, Thomas . . NEIL ELLIOTT Music Center 132 E. Lincoln Highway Downtown DeKalb . . .258, 378 380 380 380 230 . . . .380 380 234 225 380 260 65 . ..., 379 379 379 156 250 . .379 257 379 380 380 74 236 380 381 . .239 381 271 381 Hilliard, Richard . . Higgens, C. . . . . Higgins, B. . . . Hi twein, J. . . . Hintz, David . . Hirsch, Bruce ...... Hirschtick, S, ...... . History Dept. Acting Head . . History Dept. . ...... Hlavaty, L. ..... . Hobart, Kathleen A. . . Hockey, Margaret . . . Hoecker, Caroline . . . Hoecker, T. A .... Hoehne, Stephen . . Hoerdeman, B. . . Hoerdeman, M. . . Hofbauer, C. . . . Hoffer, William . . . Hoffman, R ..... Hofmeister, Donald . . Hogan, M. .... . Ho mann, N.. . . Holak, Virginia . . . Holder, Barbara . . Holecek, Barbara . . Holinka, C. . . . . Holland, A. . . Holland, K. . IU QfQ23 SUPER 61 The Voice of .l. U. 255 267 zss, 257, 381 260 271 381 66 381 381 381 227 225 237 381 253 267 381 381 247 381 381 271 381 381 225 381 . .381 77, 76 238 267 . . .Boy ' 246, Q Q i223, 271,- 381 234 230 73 381 268 381 381 226 381 381 381 271 381 265 381 225 381 381 381 264 381 381 382 382 .382 .258 .265 .252 .382 .382 .265 . 91 . 91 .244 .382 .382 .382 .245 .382 .237 .237 .229 .382 .257 .382 .251 4,382 .382 .382 .382 382 268 382 JOLLY S In Downtown DeKalb Tuxedo Sales and Rentals Satisfaction Always Guaranteed 758 3331 COMPLETE MEN'S WEAR Holm, Nancy . . . Holmes, Rebecca . . Holtam, Kathy . . Holzbach, J ....,.. Homecoming ...... Homecoming Committee . . Home Economics .... Home Ec 180 ...... Home Economics Head Dept. ....... Honeg, R ....... Holik, D. .... . Honick, Ronald . . . Hongg, A ..... Hoo , B. .... . Hoogstra, Robin . . Hoo er, Timothy J. . . Hoover, Mary T. . . Hoover, M. .... . Hopton, Gregory . . Horgan, M. . . . Hom Gale . . . Homer, J .... Horras, G. . . . . Horwath, John . . . Horwitz, Gregory . . . Hoskins, Martin E, . . Hough, Loretta . . . Houndt, Robin . . Houston, B. . . . Houston, Robert . . Hourihan, B. .... . Howard, N. ..... . Howland, Dr. Richard . . Huber, Kathleen .... Huber, P. ..... . Huffman, M. . . Hughes, D. . . Hughes, J ..... . . . Hughes, Robert ...... Hughett, Susan . . Hu uelet, G. . . . . Huita, Susan ..... Hulsbrink, Catherine . Hummel, G ...... Hummel, Linda . . . Hummel, Paul . . Hunsbergger, P. . . Hunter, . . . . Huskies . . . Hustad, C. . . . Huebner, Max . . Huertz, S ..... Hulka, B. .... . Huetteman, Robert . . Hunter, E ........ Huntington, Raymond F, . . Hursey, Michae .... Husa, Harold E. . . . . Hutchison, Alice K. . . Hybent, H. .... . Hybiak, Cindy . . Hyman, Sandra . . . I lacobazzi, J ..... I natius, Jer .... Iiinois Boariillof Higher Education . . . Illinois State Training School for Boys at St. Charles ...... Industry and Technology . . Ingebretsen, Barbara . . Inman Gu . , y I .... g. Inter-FraternityCouncil . . International Programs. . Intramural Basketball Championship . , . Intramural Champs . . . .l80, 382 382 382 . . .234,382 266 246 . .l05, 102 105 105 222 . . . .257 . . . , .382 . . .2so,3s2 . . . .244 . . .382 . .332 . .382 . .242 . . ,382 . . 244, 223 382 382 257 382 . .430 . .382 . .382 . .383 . .224 . .383 . . .246 . . . . .248 . . 126,529 . . . . 83 . . . . .225 . . . . . .253 . . . . . . .246 . . . 261,327,383 Investment Management . . Iodice, Mary E. . . . . Ireland, K. ..... . Irvine, Barbara . . Isaac, Kerri . . Isaacsan, J. . . . Island Acts . . . Iverson, Randall . Iverson, S .... Ives, Alan . . . Ivey, C ..... . Izbicky, Judith .... J Jablonski, George. . . Jablonski, R. . . . . Jackson, C. . , . Jackson, D. . . . Jackson, J. . . . . Jackson, Richard . Jackson, W. . . . Jacobs, J. . . . Jacobs, M. . . . . Jacobs, Maria. . . Jacobs, Thomas . . . Jacobsen, Donald . . Jacobsen, J. . . . Jacobsen, R .... Jacobson, A .... Jacobson, JoAnn . Jacoby, G. . . . . Jaedtke, Ellen . . Jakubka, Janice . . James, D ..... James, John . . . James, Nelson . . Janicki, G. . . . Janik, P. ...... . lan Cgtfl Svltnp nr mhz fling: Exfferent Enmntnmn ilbpialh . . ...... 383 . .383 . .271 . . .383 . . . .383 . . .230, 383 . . . .150 . . .383 . .226 . .234 . .304 . .222 . .118 . .228 . .228 . .383 . .244 . . 99 . .383 . . 66 . .383 . .222 . .327 . .383 . .256 . .383 . . X60 . . . . 67 . .102, 140 . . .383 . . .383 . . 69,268 . .78, 79 . .266 . .266 1 J anocha, Sharon ...... Janousek, Raye . . Janowitz, Merle . . Jansen, Roberta . . Janus, B. . . . . Janyja, Daniel . Jares, B. . . . . Jarvie. S. .... . Jasack, J. ..... . Jaskier, Maureen . , Jasper, M ..... Jauch, George . Jeffrey, Jo Ann . . Jeffrey, Louise . . Jelinek, Loretta . . Jennett, Jeff . . Jennetten, S. . . Jennings, B. . . . Jennings, Robert . . Jerozal, J ..... Jeske, Bill . . . Joffe, Anne E. . . Johannsen, Terri . . Johanson, D. . . . Johansson, Sharon . Johnson, Camille . . Johnson, Cheryl .... Johnson, Christopher . . Johnson, Claudia . . . Johnson, D. . . . . Johnson, Evelyn . Johnson, G. . . Johnson, H. . . Johnson, J. . . . . Johnson, Karen . . Johnson, L. . . . Johnson, M .... Johnson, Pamela . . Johnson, R. . . . Johnson, S. . . . Johnson , T. . . , Jones, Claudia . . Jones, Donald . . .240, 230, 33 1, . .225, . . 228, . .231, . .260, . .258, 1 240 . .231 f f fzso . 223, 243 . .258 . . 226 . 243,265 Reach For Star a THE NCRTHERN STAR Jones, K.. . . Jones, R. . . . Jones, S. . . . , Jones, Saundra . . Joos, G. . , . Jorgenson, Tom . . Joseph, M. . . Josephson, J. . . Josephson, M, . . Joumalism Dept. . Joyce, Joanne . , Juen lin ,J .... Jukicit, I5 ...... Jurgouan, Ronald . . Jurs, Sharon . . . Kabarec, M ...., Kabrick, Rex ..., Kaczmarek, Claude . Kadison, J. .... . Kadison, Judy . . Kahler, C. . . Kahn, J. . . , , Kalata, Gregg . Kalber, S. . . Kalind, J .... Kalisz, Diane . , . Kallas, Judith. . . Kaluzny, Gerald . . Kamba, Linda . . . Kamerlander, Richard . . Kamhi, J ...... Kamin, J. .... . Kamin, Joanne . . Kampere, R .... Kamrath, Kathy . Kanak, Jerry . . Kane, K. . . . Kanner, Barry . Kantola, Doris . . . .253 330, 332, 334, . . .237 f .235 . . 92 385 230 248 385 244 331 336 385 243 385 , 239 239 242 265 385 387 226 387 72 234 387 242 256 387 226 237 387 387 387 387 387 235 227 387 223 387 387 258 387 387 Kantor, J .,.. Kappa Alpha Psi Kappa Chi . . . Kappa Delta . . Kappa Sigma , . Karabinus, Robert Karalevicz, Nancy Karkas, Linda . Karlin, Richard . Kasper, Annette Kasper, B .... Kasper, Elizabeth Kass, William . Katrein, M. . . Katrein, P, . . . Katschke, D. . . Kauffman, Thoma Kauts, J. . . . . Kavalunas, Robert Kavene , Mary . Kawa, . . . Kay, Stephanie . Kazumis, N. , . Kedzuch, T, . , Keeley, K. . . . Keevan, Maureen Keilman, T. . . Keller, G .... Keller, R. Gre o Keller, M. . Keller, Peter . . Kellerstrass, S. . Kelley, J. , . . Kelly, Daniel . . Kelly, J .,,. Kelly, T. . . . , Kelly, William . Kelso, Pamela . Kemmerick, Dale Kemcp, M .... Ken rick, James Kennedy, Carol . Kennedy, J. . . S . . .255 . . . .244 . . . . .252 . . 184,200 . . . .267 . . .69,7l . , .387 387 387 387 . . .239 . .387 . . .387 . . . .266 . . . . .266 . .264, . . .247, 288 387 225 387 387 387 387 235 247 251 387 226 250 . . . . .387 . . 261,387 . , . .387 , . .243 . . .229 . . . .387 . . .244,387 . . . . .266 . . .387 , . . .388 . . . , .388 . . .230,388 . . . .388 , . .388 271 Kent. Catherine, . Kenyon, Linda . . Keogh, C .... Kepner, Neil . . Kerr, Gar .... Kerzich, lgrances . Kessel, S. . . . . Kessell, Susan , . Kested, William. . Kettman, Ronald . Kewdzierski, Ronald Kielbas, K, . . . . Kielbas, Kenneth Kifowit, R. . . , . Kilbride, R. . , Kiley, Jane . , Kil ard, S, . . Ki1Facky, J. . , Killen, M. . . Kilpatrick, J. . . Kimball, R. . . King, Adah . . King, C. , . . , King, Carol . . King, D. . . . . King. Hollis . . . King, Steven . . , Kingsbury, Mark . 9. 223 231 247 239 388 388 246 388 388 388 255 388 388 389 389 252 389 242 229 389 389 251 389 389 225 389 244 389 389 389 389 389 244 389 389 389 389 255 Knudson, G. , . Knutson, Larry . , Koch, Coral . . . Koch, Edward . . Kocim, Thomas . . Koehler, John . . Koenig, Brenda R. . Koenig, Susan . . . Koeni sberger, Lynne Kohn,gB. ,.,.. . Kohnke, F. .,., . Kolber , Paula . . Kolcz, Robert . . Kolder, James . . Kolin, William , . Kolmeyer, Elaine . , Kolzow, C. . . . . Komer, Louis . . Kontos, Joyce . . Kontos, Pete . , Koop, Thomas , . Kopac, D ..., Kopczewski, D. . . Kopelson, C. . . . . Kopera, Patricia . . Kopitzke, Sharon . . Kopp, R. .... . Koppe, B ..,.. Kinnally, S. . . . . Koppe, Robert . . Kinniburgh, C. . . 243, Koral, Kimberly . . Kiper, Gary , , , Korb, Judith D. . . Kirch, Ter . . . Korcek, Michael . . Kirchherrfllobert , 'Kornecki, B. . . Kirchler, J. ..,, Kortus, Claudia , . . , , GORDON HARDWARE 6. SUPPLY 512-514 E. Lincoln Hwy. 756-4511 Ben W. Gordon Mcrx Gordon Kirshner, Harold . Kiss, J. .... . Kissick, Lloyd . . Kistler, T .... Kitcoff, S, . . . Klass, E. .... . Klausner, M, . . . Kleckler, Pamela . Kleen,J.. . . . . Klein, Karen . . Klein, M. . . Kleinedler, J. . . Kleinhans, L. . . . Klemm, R. . . . . Klemp, Edward . , Klen, Edward . . Klepak, Denis . , Klick, Daniel . . . Klima, Paula . . , Kline, Donald . . Klingelhofer, Ray . Klippert, B, . . . Klitsch, B ..... Kloss, N. . . Kna , K. . . . Knegllit, T. . . . . Knight, Sharon . . Knippen, Anita . . Knipschield, Larry Knize, Elaine . . . Knox, J. .,.. , THE UP RISING 156 East Lincoln Cocktails DeKalb, niinoi. 601 15 Dancing . .23 0, 389 231 389 268 257 267 266 389 260 389 271 237 389 223 389 389 389 389 389 389 390 260 271 228 244 223 390 390 390 390 266 Kosan, Kenneth .... Kosar, Natalie . . Kosciolek, Ellen . Kosik, Donald . . Koski, J , .... . Kostek, James . . Koster, Linda . . Koster, Pauline . . Kotek, Judith . . Koteski, Nancy . . Kotstanis, G, . . . Kotulas, G. . . . Kouak, J. . . Koules, C. . . Koulos, Carol . Koutnjk, F. , . Kovacevic, V. . . Kovanic, B. . Kovanic, P. . . . Kovieh, B ..... Kowal, Norbert , . Kowalckuk, Irene . . Kowalski, R .... Kozak, J , . . . Kozak, S, . . . Kozelsky, Dennis . . Kozich, Jim . . Kozmic, Jerome . . Kraft, Robert . . . Krahenbuhl, S, . . Krask, Thomas . . Q,-44 444 -Z UNIVERSITY CITY PHARMACY Cosmetics - School Supplies Kraska, Janice . Kratky, J .... Krause, S .... Krausse, D. . . . Kre or, Cla ton. . . Kreilow, Mitrgaret . . Kreps, E. . . . . Kretsch, Diane . . Krick, J. . . , . Krohta, D, . . . Krueger, D. . . . Krueger, Louis . . Krueger, S. . . . Krug, B. . . . . Krupa, Lynn . . Krymski, G .... Kryzan, K, ,... . Krzeminski, Linda L. . Kxzyminski, Joanne . . Kubes, David .... Kubik, James . . . Kubo, Linda ,... Kuhnke, Christine. . Kukolich, Roberta . Kukula, Phyllis . . Kule, Rogene . . Kuljg, Frank . . Kull, M. . . . . Kulwin, Dave . . Kunkel, Carol C. , Kunkel, Robert R.. . Kurtz, C. ...... . Kushmuk, Jeannette. . Kushnin, Larry , . . Kushwin, Barry , . Kusman, B. . . . Kusner, Stephen . Kuzan, Frank . . Kuzeru, Ronald E. . Kvietkauskas, Mary . . Kyriazes, V ...... La Instituto Nacional de la Juventad Mexicana La Cache ....., Lab Schools .... Lacey, G. . . . Lach,C. .... . LaCosse, Donna . Ladd, John ..., Ladendor1',P,. . . . LaFoIlette, Larry . , Lager, Richard . . . Lagerhausen, Walter. . Laing, Sherry .... Lair ,T. .... . La'eano, Shirley . Lakin, L, ..,. . Lalleman, Susan . Lamb, Cheryl A. . Lamb, Joe .... Lamb, Ronald R. . Lamb, Susan .... Lambert, M .... , . Lambert, Thomas W, . Lam arter,S.. . . . Lanclstrom, J.. . . Landstrom, John . Lane, C,. . . . Lane, Jerry G. . . Lane, Lawrence. . Lane, Leonard . Lang, Q.. . . Lange, Craig . . Lange, J.. . . . Lange, Kathleen . Lange, Maie A. . . Lanterman, R. . Lapecek, Ed . Lapetina, R. . Larkin, M. , . . LaRocca, Ed, ,. . LaRoi, Rita . . Larsen, L nn . . Larson, . . Larson, L. . , Larson, S. . . Lascoe, L. , . 239,- 268,- 226 391 391 258 391 230 271 223 391 244 225 392 223 257 392 392 392 392 392 392 392 392 392 392 266 392 392 392 228 392 392 392 242 392 392 392 Lasiewicz, K. . . Lask, P ...... Lasker, L ...... Laskey, Robert M. . Lasky, D, . . . . . Lata a, J. .... . Latecki, D. .... . Latino, C ,.... . Laurence, Kenneth . Lavalunas, Bob . . . Lavodny, L .... Lawler, E .... Lawler, P, . . Lawless, B. . . . Lawrence, G. . . . Lazarz, Pamela . . . Leander, C. . . . Leary, Loretta . . . Leat ers, Linda . . . Leavey, Jeffrey . . Leavitt, John . . Leavy, P. .... . Leazzo, R ..... Lechert, Linda L. . . Lecuyer, D. . . . Lee, . . . . . Lee, C. . . . Leesman, K ..., Lefft Richard . . . Lelkowitz, Annette . Leller, J. ..... . LeGare,Terese . . . Legris, S. .... . Lehman, G. . . . . Lehmann, Randy . . Leid, Robert L, , . . Leifel, James S. . . Leifer, Jan .... Leitheit, Lt. Paul . . . .225, Q fzsz, . 1271, THE VILLAGE COBBLER SHOES 209 E Lincoln Highway Sbicco 1- Personality -- French Shriner ' 2-io, 392 265 79 296 1 19 241 223 392 71 257 392 392 392 392 223 392 234 392 392 291 392 392 227 392 243 225 393 254 393 393 Lekki, Gayle F. . . Leland, J ..... Leli, David .... Lemke, J. .... . Lenkowski, Allen . . Lenoff, E ..... Lentz, J. .... . Leon, B. .... '. Leonard, Lloyd . . . Leonard, Steven G. . Leone, S. . . . . Leonhard, G, . . . Lepianka, Chris , . Lerguin, L. . . . . Lesebepg, Charles . . Leslie, ..... Lestaghe.M. . . . Lester, J. ..... . Lesthaeghe, Mary . . Lestikow, J. . , . . Leurguin, Linda . . . Levandowski, Dennis . . Leventhal, J ...... Levin, J. ..... . Levine, L .... Levine, Ronnie . . Levitsky, Ronald . . . LeVrouw, Steven C. . . Levty, J. ..... . Levv, R. .... . Levy, Earl . . Levy, J, . . . f2-io, f f2i9,' Q 1235, Secor s Bookstore For Over 50 Years Your Friendly College Supply Store . .240'. 228, 231, 265, 393 241 393 243 393 393 242 270 223 243 270 393 325 393 393 393 255 Levy, M. . . . Lewan, M. . . . Lewand, L, . . . Lewis, C. .... . Lewis, G. .... . Lewis, Gregory A. . . Lewis, Judith . . . Lewis, Mike . . Lewis, Natalie . Lewis, Randy . . Liberal Arts and Sciences ,... Library Science Department . . Liesse, Cherie J.. . Liesse, David . . Lightner, D, . . f f224,' 181, 184, . . . . 60 . . 93 . .394 Likes, L. .... . . . Lill, Clifford . . . . . Lind, Dennis. . . . . . Lindah1,C. ..,.. . . . Lindenberg, Karen . . . . . Linder, Jack .... , , . Lindgren, Cecelia . . . . . Lindmark, Donald . . . . . Lindquist, B, .... . . . Linhart, Larry . . . . . Liowald, B.. . , . . . . Lipnisky, John , , . . . 243 395 395 250 395 395 Linders, Jeanette C. . . . . .395 395 395 260 395 223 395 247 Lippert,Je1T . . . . . . Mally, Margaret . . . Malmgren, ennis . . Malone,C. .... . Maloney, K .... Maloney, Mary . . Maloney, R. , . Maloney, T .... Maly, M. ..... . Management majors. . Management Dept. . . Mana ement Dept., Head MancEen, B ...... Mandle, K, .,... . Mannarelli, B ..... f f f231,' f f fiisf . Q ' f i 1239,- 398 398 258 398 398 225 226 227 125 125 125 398 256 231 398 398 398 398 325 225 251 299 326 Lipsman, J, . . . ...., 235 Manczynski, Christine . . . . Ligtman, B019 , , . , .229, 395 Manderscheicl, Frank . . . . . Little, Nanc . . . .,.. 289 Mannarelli, Bonnie . . . . . Livacari,Jullie , . . , . ,26l, 395 Manzer, Irene . . . . . . . Live-Learn Proggam . . .... 211 Mar, A. . A .... . . .267, Live-Learn foot all . . .... 58 Marcantonio, R- - - - r - Live-Learn Center. . . . . . 98, 123, MafCh?Ser C' - 5 - - - - - 143 Marching Huskies . . . . .268, 1360 AM 92.5 FM STEREO - Local Rclcllo Locascio, J.. . . . .247 Marchok, Katherine . , . . .398 Lodin, B, , , . , .232 Marco, D ....., . . .259 Loggston, P. . . . . .246 Marcus, C. . . . . . . .261 Lo ston, Lana . . . , . .395 Marczewski, H. . , . . .266 Logrke, Dave . , . . .260, 395 Marek, Craig . . . . . .398 Long, R, ,,,, .... 2 47 Marino, S .,.. . , .244, 398 Longino, Marc . . . . . .395 Mariska, Joyce . . . . . .398 Lgngman, Gary, , , . . .395 Mark, Christie . . . . .398 Loomis, Larry . . , . , .395 Mark, S. . , . . . . . .258 Looney, Bernard . . . . .395 Marketin Dept, . . . . 126 Lopez, T. .... . . .235 Markin, . . . . . . .260 Lore, T ..... .... 2 57 Markis, L .... ..... 2 65 Lorin, Sandra . . . ..... 395 Markman, M. . . . .240, 241 Lorr, Barbara . . . . .294, 395 Marks, J, . . . . . . .234 Lothian, Sheila . . . . .265, 395 Marks, R. . . . . .238, 398 Loughlin, Leo J. . .... 110 Mm-lier, B, , . . . . . .271 Lovasz, M. ..... - A -239 Marron, Daniel . . . . .398 Lovely, Thomas A. , , - - -395 Marsan, L. .... - . -230 'Loverude, M. .... . . .265 Mai-selos, Barbara . . , . . ,399 L0vi, M. ..---. . - -243 Marsh, s. ..,.... . . .239, 399 Lovins, Kathleen . . - r ,395 Marszalwk, L. .,.. . - - -232 Lowden, Frank O. . . . . . .201 Marte, N ..... , . . . .246 Lowe, Billy ------- A 4 -395 Martellaro, Dr. Joseph A. . . . . . . 130 Loyola University in Martens, G. ..... . . .246 ome ......, . . . 79 Martin, F ,,,,,,, . . .223 Lozar, Kathleen. . . . - .395 Martin, John . . . . .399 Lucas, Sandra . . . . .395 Ma,-lin, L, , , . . .230 Lucas, William . . . , .395 Martin, M. . . . . . .242 Luck, Emory . . - - -331 Martin, Sherrie . . . i .399 LHCKOW, C -4-- - A -240 Martinello, lnes . . . . -399 Ludeke, William . . - - ,395 Martinez, Alicia . . . . .399 Ludlow, S. ..r- - - -253 Martinez, Kristin . . . . .399 Ludolph, Sheran . . . . - .396 Martinez, L .... . . -222 Ludwig, Tom ...... --Ar 3 31 Martini, J .... - - -229 Ludwinkowski, Mary . . .--r- 396 Martino, M .... - . -239 Luebchow, James . . . - - 92521 396 Marz, Groucho . . . . .243 Lueck, Marlies . . . ..,. 149 Manco, Lynn , , . , .399 Luety, Jacqueline . . 4 - -396 Marzinel11,L. . . - . -250 The Diczrnoncl House In the I-leort of Downtown DeKalb Luke, Joseph . . . , .396 Marzowski, J. . . - - 227, 399 Lukes, Janice , . . . .396 Mascaro, N .... . . . .223 Lutz, J. .... ,.., 3 96 Masessa, Valerie . . 4 - .399 Lux, Kathleen . . . . .265, 396 Maslanka, Bryan . - - - -399 Lux, Robert . , .... 396 Mason, B ..,.. .... 2 23 Lyle, Lynne . . . . . .396 Mason, Nate . . . t .33l, 332 Lynch, Judi .... , . . , . .396 Master Plan . . . . . . . 60 Lythgoe, Kenneth ...., . . .396 Masters, Anne . . . . . - .400 Mastores, P ,...., . , . .246, 400 M Mathematics ..,.. . . . , 62 Math Dept. .,... . . . 94 Maggio, Drexel ...... . .398 Math Dept., Assistant Head . . . . , Magnuson, Gary ..... . .398 94 Magny, K. ..... . ,265 Mathers, W ...... . . .270 Ma uire, G .... . .231 Mathew, Donna . . . . , .490 Maiane , Mike . . . . 181 Matson, E. .... . . .245, 400 Maher, ..., - .270 Matthes, Mary . . . . . . .400 Maher, Robert J, - - - 4 -398 Matthews, Barbara . . . . .400 Mahoney, K. ,... ..... 2 60 Mattio, David .... . ,400 Mahoney, T ...... . . ,257, 271 Maurer, Sandra .... . .400 Mahoney, Thomas . . ,... 398 Mausehund, Roger Allen . . .400 Maier, R. . ..,. . . .247 Maxwell, Diana, . . . . .400 Maison, J ,.... , .252 Maxwell, Dr. Lyle . . . . . 123 Maksa , C, . . , . .228 Mayer, Carol .... . . , . .400 Malcolym, N, . . . .232 Mayer, L ..... ...,. . 267 Malidor, J, . . . . .267 Mayerle, Thomas . . . . . , . . .400 Malis, Judy .... . .398 May Fete .... 159, 266, 155 Malito, Robert T. . . . .398 Maylield, R. . . . . - . . .225 Malkowski, Larry . . . .398 Mays, R. ...., . . , . .248 Mallo, Sara .... . .398 Mayworm, James . . - -400 Malloy, B ..... . . .231 Mazan, P ..,.. - -261 Malloy, M. ................ 225 Mazvr, N ..... , . . .246 Malloy, William ............. 125 Mazzei, Steven .,.. ......... 400 lnweor for Men THE BULL PEN ln University Clty 445 N Nagel,Ann. . . . . McAllister, Laurie M. . . . McAndless, R ..,. McAtee, Kataryn . . McAuliffe, E. , . . Mc Avo ,S. . . McCart1i,y, R. . . McCashis,A. . . . . McClay, J. .,.. . McCleary, John . . . McClintock, Thomas L. McComas, Roy . . . McCraigh, James . . McCu11agh, Scott . . ' 226, 396 223 396 230 228 250 271 396 84 396 396 396 396 260 396 McCullock, P. . . . . McCully, Sue Ann . . . . McDermott, M. . . . . .52, 67 McDonald, D ..,.. .... 2 29 McDonald, J. .,,. 243, 396 McDonou h, S. ...... . . . 234 McDonalcE Dean Keith . . . . 66 McDugle, E .,.,... ' . . McDug1e, Jaceluelyn . . , . McE1wain, Wi liam . . . . McEnroe, M. ,... . . McGee, Kathy . . McGee, R. . . . . McGill, June . . McGill, M. . . . McGillivary, P, . . McGirr, Emylou . . McGlennon, K. . . . McGowan, Christine McGrath, C ..... McGuinness, K. . . Mclilogh, Margaret . Mclcra t, James . . Mcllrasi, Dean Wayne Mclnerney, G .... McIntosh, Phyllis . . McIntosh, S .... Mclntyie, B. . . McKackeran, R. . McKay, D. . . . . McKee, P. .... . McKenna, Frank . . McKenna, Mary . . McKenzie, J. . . . McKenzie, Wilma . . McKiemtan, Tom . . McKieman, Kathy . McKieman, T .... McKil1iIp, T ..... McKitrick, Michael . McLan hlin, Dennis. McLauP1in, D .... McMahon, Kathleen McManus, John. . . f . Q f 76, ' -222, ' ' '2-io, McManamin, T. . . . . McMillan, B. . .... . . McMillan, Margaret . . . . . McNair, Wendy. . . McNamara, N. . . . McNamara, Thomas D. McNash, Vicki . . . McNaught, Linda . . McNaughton, J.. . McNaughton, M. . . McNeive, Helene . . A A ' 253, McNeive, T ...,. . . McNiff, Geor ia , . . . McReynolds, . . . McShe , P. . . . . . McVeyTEli. .... . McWayne, Michele . Medler, D. .... . Medley, David . . . 222 396 396 243 396 251 396 266 261 396 244 396 270 271 397 397 128 268 327 267 270 254 234 260 397 397 397 397 331 397 225 260 397 397 241 397 397 245 255 397 397 397 397 397 397 256 222 397 237 397 255 260 237 397 255 400 Mendralla, P. . . . Menge, Barbara. . . Men e, C ....,... . Menne, Gregory .,... . Men's Physical Education . . Meridith, Jack . . , . . Merke, C .... . . . Merrilees, S ..., . . . Mervis, Ron ..... . . Merlicker, William . . . . Mesics, Barbara Marie . . . . Mesics, Patricia ..... . Messiah ..,.. . . Messics, P. . . . . Mettelka, M, . . . . . Metz, Dean . , . Metz, J .... . . . 267, 260, Metzger, L. . . . . .239 Mell, K, . . . , . . . . Mevorah, S. . , . . . . Meyer, J.. . . , . .257, 264, Meyer, Lois . . Meyer, P. . . . , . Meyer, R, . . . . Meyers, B. . , . . Miasco, John . . . Miceli, William . . . Michel, P ..... , Michels, Claire . . . Michula, C. . . . Micik, A. . . . Micelli, J , . . . . Mickel, A. . . . . , Mickow, L. ...,. . . . Middleton, D. ,... , . Miculimich, Edward . . . . Midnight Plowboy . . Midway ...... . Miene, M ...... . Mikels, M. . . . Mikkila, M. . . . Milano, Gary .... . Milano, Russell .... . Miles, Janet ...... . Militag' Science Dept . . . Millar , Cynthia . . . . Miller, B, ..... . Miller, C. . . . . . Miller, D, . . . , Miller, F, . . . . Miller, G. . . . . . . . . .222, . .225, 231, Miller, J. .... . M Miller, ...... Mi1ler,P, ..... . Miller, Dean Mary . . Miller, R. ..... . . . Miller . .,... . . . , S Mills, Carol . . . . , Milne, Richard . . . Milroy, F .... . Milus, T. . . . . Miltimore, G.. . . . Minarich, L. . . . . . Miner, Laurane . . . . Miner, Thomas . . . Minor, M ...., . Minor, Robert . . . Minott, K, .... . Minnis, M, ..... . Minter, James P. . . . Mion, O. ..... . Mirwald, Gene . . . Misek, Thomas O, . . . Misichko, J. , . . . . Miskowicz, Terry . . . 258, 227, 266 400 244 400 1 15 400 244 400 98 400 400 400 300 246 400 400 223 401 244 255 400 401 222 401 271 195 401 271 401 227 259 225 234 401 235 401 198 198 239 270 261 401 401 401 99 401 242 242 257, 401 85, 226 . .265 232, 401 255, 401 222, 401 . 68 252 259 223 401 270' 401 401 261 237 254 401 401 401 224 401 257 267 401 231 401 401 239 Me eri Ra mond 400 4 401 Mgy 6 Y H - - ' ' 400 MissNorthem . . . . . 188 Cleft eorge ' ' ' ' ' Mitchell, Dean . . . . 401 Mexerdirk, Arthur. . . . 400 MMI I' I I I 228 M.k J 257 iIer,.I . ,. el en ' ' Mniszewski,A. . . . . . 243 Metndlik- '4'- - - 286 Moekbee, Chuck , . . . 401 Meinken,James. . . . . 400 Moglcy AII I I I 260 Mekin,R ,... .... 2 55 Mo,s,m'L ' ' 254 Me1ius,M.. . 237,304 Malek glgbgr, A ' I 40, M5111-A ' 4 ' ' 244 Motif ,... f f . f f 229 Melzefi R- 4--- -4------- 252 Mmm, William R. ........... 97 QF Xxx: f N 42 4 Vs n . I ,f v J 1 , .-. ,' I l I 'I A I ' 1 lHH ki'miF'mm:i in : I lf . ,. , f . . 1 ' ' . Q , , 1 I V 7' T .-j.5-'fgfZ'sl.Zf..,- rv ,-. NH 2:--1 111- A r:'- - . ' rtlfx. -X, ., ve- 1 -- Nw I Lf 1 ' ?.f..,'.f-wc' .' .1 3711- xi' S Yrs+.-3.1,-Ti.-f2-'I' m:ucious.Y cnisr PIZZA HOUSE Fine Charcoal Steaks 128 N. 3rd. ww'-w 758-8168 DeKalb 446 PRINTING and LIIHUGRAPHY at its finest For All Student and Faculty Requirements 2105 SYC Monsess, Kenneth . . Molidor, Jeanette . . Molway, S. .... . Momsen, John , . Monroe, M. . . Montag, Jeri .... Montgomery .... Montgomery, Ardis . . Montgomery, J. . . . Montiglan, A. . . . Moore, J. . . . . Moore, P ..... . Moore, Ronald . . . Moore, S ...,. Moon, Elaine . . . Moose, J. .... . Moranda, Co1'inne . Morris, Brenda . . Morriss, S. . . . . Morse, Paula-Jane . . Morris, G. . . . . . Morisette, K. . . . Mortenson, L. . . Moser, Deanne . . . Moses, Bemadette .... Moses, Cheryl ..... Moss, R. ....... . JOHNSON printing corporatio Letterpress and Offset AMORE ROAD, DE KALI. ILLINOIS 50115 O AREA CODE 815 - PHONE 755-4551 . 254, Most Valuable Team Mem- ber Award ...... Mosteika, Cheryl .... Motcka, J ..... Motrey, C. . , . . Mott, andra . . . Mottinger, Jean . . Mountain, Marsha . Moye, Marilyn . . . Mozcren, M. . . . Mroczek, L. . . . Mrotek, Suzanne . Mrotick, R. . . . . Muccianti, Jerry . Mucha, Joanne . . Muchin, B. . . . . Mudra, M. . . . . Mudrak, Teresa . . Muellen, K. , . . Mueller, K.. . , . . Muehlhauser, Sandra . Muellner, James . . Muir, L. ..... . Mulcrone, Denise . . Mulcrone, E. . . . Muldner, Janet . . Mullady, Judith . . . J ullady, Judith . . Muller, P .... Mu h , B. . . . Murrghy, D. . . Murphy, J. . . Murphy, M. . . Murray, R. . . Musia , L .... Muscianti, J ..,. Musial, L ....... Music Dept ....... Music Dept., Head . . . Muskie, Senator Edmund Music Dept. Opera . . . Musynski, K. .... . Myers, Jo Ann . . Myers, Mark , . Myers, Robert . . Mylott, S .... . . Nagel, Paul , . . . Nagorsky, L. . . . Nagorsliy, Linda . . Nat or, onnette . . Nannini, Dennis , . Napalm .,,.. Napelilli, B. . . . . Napelilli, P. . . , . . Nash, Sandra ..,... National Achievement Award ....... National Panhellenic Conference .... Nau, S ....... Naughten, Philip . . Naves, D ...... Naylor, David . . . .257, . . 222, . .247, . .225, . ,102, , .254, . .255, . .244, 402 402 22 8 402 26 8 402 . 9 402 244 244 266 230 402 26 1 402 402 402 403 23 5 403 266 270 25 8 403 243 403 23 1 304 403 223 228 403 403 403 403 245 237 403 223 403 403 403 247 403 227 227 403 403 403 403 223 403 403 403 265 257 225 403 225 403 244 254 244 107 107 170 188 403 403 403 403 261 405 403 403 403 404 404 .4 237 237 404 267 236 266 404 331 404 Neal, C. . . Neifine, J. . Neis, Mari . . Nellis,J.. . . . Nelson,Ardine . . Nelson,B .... Nelson,C .... Nelson, David . . Nelson,J .,.. Nelson, K. . . Nelson, L ..... Nelson,M.. . . . Nelson, Norman , Nelson,P ..... Nelson, Robert . . Nelson, William . . Nemanich,B,. . . Nemeth, J.. . . Neno1T,T ,... Nepil, Linda . . . Neptun, Douglas . Nesheim,E .... Ness, Jeri .... Newcomer, Kathleen Neukirch, S .... Neuman, B. . . . Newell, D. . . . Newell, Linda . . Newkirk, Nancy . Newlin, B. . . . . Newman, C, . . Newman, K .... Newman, Nancy . Newman, S .... Newmann, Caroline Newton, Richard . Newton, T. . . . . New York University in Madrid . . . Neybert, Gerald . Nickels, Susan . . Nickerson, B. . . Nieken, B. . . Nielsen, K. . . . Nielsen, Myron . . Nielson, B. . . . . Nieman, Edward . Nitch, T. .... . Noe, Terry . . . Nolan, J.. . Nold, H. . . . . Noonan, D. . . . Noorlag, J. . . . , Noormann, Paula , Norak, Cynthia . . Norlin, Raymond . North, Patrick . . Northcroft, N, . Norther ..... Northem Illinois University . . . Northern Star . . Norum, A. . . Norum, D. . . Norwalk .... Novak, Bonnie . . Novak, Melody . , Novosel, L. . . . . Novotny, Georgia . Novotn ,Kathy. . Novy, ..... Nowicki, J. . . . . Nowicki, Raymond Nowik, Mary Jean . Nrzensinski, Henry Nuckols, A. . . , Nurre, J. .... . Nussle, Barbara . . Nystrom, G. . . Oblouk, Raymond Obrecht, Janice. . . O'Briari, P. . . . . O'Brien, B. . . O'Brien, M. . . O'Brien, R. . . . , Ochart, Enrique. Ockerlander, A. . . O'Connell, Doreen 0'Conne1l, Sharon O'Connell,T.. . . . Q f f23i,'256,' . . .242,243, '23i,'2A6,' ...ii2, f Q i223 ' 1240, 324, 325 . . 226, . . .259, . . .225, . . .238, . . .234, 327, 222 229 404 226 404 404 244 404 253 228 404 229 404 253 404 404 260 250 266 404 404 229 404 404 258 253 404 404 404 261 255 239 404 255 404 404 231 79 404 404 245 257 261 404 226 404 240 404 226 268 247 404 404 405 405 405 258 266 1, 50, 55, 58, 60, 62, 63, 64, 66, 76 67, 246, 266, 267, . . . 125, . . .251, . . 226, 268 231 261 79 405 405 222 405 405 265 206 405 405 405 405 405 405 242 405 405 259 222 242 242 406 251 289 406 238 Quane, Anita ...... . .l32, O'Conner, G.. . O'Conner, J. . . . O'Connor, Anne . . O'Connor,J ..., O'Connor, Linda . . O'Donovan, J. . . O'Donne1l, J.. . . . O'Donnell. K. . . . Oehm,G ...... Oelschlager, Kathleen Oetke,Cathryn. . . Ogbum, Marty . . . O den, J. . . . 08-1alloran,K. . . O'Hara, D.. . . O'Hara,E. . . O'Hara, T.. . . Okonek, Vikki . . Oldtie1d,D. . . O'Leag, T.. . Olen, ary. . . Oles,Frank . . Olipra, S. . . O1iver,J.. . . . Olmstead,C.. . . 01mstead,Ju1ia. . . Olsen, B, .... . Olsen, H. . . . Olsen, M. . . . Olsen, Pamela . . Olson, Christine. . . Olson, D. . . . . Olson, J. ,,.. . Olson, Norma . . Olson, Robbin . . Olszewski, N.. . O'Ma1ley, D. . . O'Malley, M. . . O'Malley, S. . . Ombudsman. . . Ondera, Michele . . 0'Neil,B ..... O'Nei1P. ...,. . O'Neil,R ...... O'Neill, Margaret . . Opal, Robert .,,. Op enheimer,E, . . Ort11ock, Becky . . Ordlock, D. . . Ordlock, Richard . . 0'Rei1ley,Barba.ra . 0m1sby,T. .... . Oma, . .... . Orroyo, A. . . Ortiz, O.. . . Ortman,G.. . . Osbome, Gary . . 0'Shea, Mary. . . Oskandy, James. . . Oslewski, W.. . . Ospalik, Linda . . Ossenbeck, M. . . Ostergard,1. . . Osterman,A. . . Osterman, L.. . . Ostreicher, M. . . Otten, B. .... . Otto,P ....... Outdoor Education Department, Head Owen, D. .... . Owen, Patrick . . . Owens, D ..... Owens, Robert . . , Pace11i,G. . , Pach, Denise . . Padgitt, D.. . . . Paeglow, Judith. . . Page, Philip .... Pa liai,Jim , . . Pail, David .,,, Parge, Dennis . . . Pakenham, Robert . Palandri, Salvatore . Palermo,M ..... Palumbo,J. . . . Palleva,L .... Panek, William . . Papadia, John . . Paper, Jackie. . . Pappas,L ...... Paprocki, Wayne . . Paprucki, Gerry. . . Parda, Karen. . . Parish, C. . . . Park, Don M.. . Parker, B. . . Parker,C. . . Parker, K. . . Parkin,R ...... Parod,C. .,.. . Parson Library, Swen Partipilo, Donald . . Pascus,Camol . . . Paskvan, Mary . . Pasczak, B.. . . Pasqua,S .,.. Pasquya, S.. . . . Pasternak, LeRoy . . Pate,B ..,..,. Patsch,John . . . Patterson, Dale . . Patton,L .... Patton,R ..,. Patsman,O. . . . . .229 . . . .255 . . . . .405 . . .243,407 . . .291,406 . . .251,406 I I I 1222, 264 244 . . .... 241 . . .406 . . .406 . .261 . . .228 . . . .266 . . .260, 406 . . . .270 406 232 . .226 . .304 . .406 . .234 . .225 . .239 . .406 . .222 . .261 . .225 . . .406 . . .245,253 . .406 . . .265 . . . .250 . .244,406 . .244,406 . . . 67 . .406 . .242 . .227 . . .231 . .255,406 . .271 Paulson, M. . . Paulauski, T. . . Pauss, M Pautz, B. Pavel, RobertF. . . Pazdur, James . . Peace Corpsman . . Pearce, Gerald . . . Pearce, Kimberly . . Person, Gayle . . . Pearson, Ronald . . Peck, Mary Kay. . . Peddilord,De11nis. . . Pede, Sharon .... Pederson, D. . . . Pehta, James E. . . Pei1Ter,D ..,. Pekoven, D. . . Pe11ettiere,J. . . . Pellino, Robert . . Pe11man,K. . . . Pepe, C. Peppers, Kathleen. . . Pepol, Chris .... Perce, W Percy, Charles . . Peresek,J .... Perham, Penny . . Perkins, D.... Perkins, P. . . . . Perillo, David. . . Perri, B. Perry, B. Perry, C. Perry, Donald P. . . Perry, J. Perry, Richard M. . . Perry, William . . Perry, V. Perveiler, Robert J. . . Peter, D. Peters, J. Petersen, Carol .... Petersen, Daniel L. . . Petersen, Maiiy . . . Petersen, Pau ette . . . Petersohn, D. . . . . Peterson, J. . . . . Peterson, Jean . . . . .231 . . .225 . . .239 . . .228 . . . .408 226, 408 64 265, Q 1 1251,- f f 5251,- 408 408 408 408 181 408 408 271 408 408 254 256 408 408 231 408 408 259 . . 153 223 408 270 258 408 261 250 325 408 256 408 408 224 408 222 240, 241 408 ' f f 1408 408 234, 408 . . . .257 250 . . . .408 GLIDDEN CAMPUS FLORIST 917 W. Lincoln Hwy. DeKalb, 111. 758-4455 406 406 271 252 . . . .232 . . . . .232 . . .225, 270 . . .407 . . .252 . . .407 . . . .237 . . . . .225 . . .252, 407 . . . .253 . . .250 . .225 . .266 . . . . 114 . . .231 . . . .407 . . . . .241 218 ...245, 407 261 . . .234 . . .407 . . .407 . . . 157 407 407 407 . .... 407 . . . . .261 . . .254,407 . . . .228 . . .267,i 407 407 . . 243 407 407 . . . .407 . . . . .407 . . .230,407 . . . .407 . . . .237 . . . . .231 . . .270,407 . . . .226 . . . .258 . . . . .201 . . . .407 . . .407 . . .407 . . .232 . . .260 . . .260 . . .408 . . .229 . .293 . . 71 . .261 . .245 . .260 Peterson, Peterson, ,Nancy . . Peterson, Peterson Petraitis, Pevonka, Keith. . . Laura. . . Theresa . . M .... Peyronnin, Ann . . . Pfeiffer, Frederick . . . Pfeiffer, Michael . . Ptlum, Gail ..... Phelus, N ........ Philadel hia Orchestra . . Phi1lips,q3. ..... . . Phillips, D. ..... . Phi1lips,J ...... Phillips, Michael . . Phillips, P.. . . . P111111ps,v.. . . Phillis, L. ...... . Philosophy Dept ..... Philosolphyz Dept, Chrmn . . Phi De ta si .... . . Phi Epsilon Pi .... Phi Kappa Sigma . . Phi Kap aTheta . . Phi sigfoo .... PhiSigmaDelta . . Phi Sigma ?silon. . . Phi Siggna appa. . . Photo ?t ....... Physical ducation Dept.. . Physics Drelpt.. . . . . . Piasecki, ancy .... Piaua,R ..... Piccioli, D.. . . . Picco, Pe Lee . . Pick, S. .... Piech, Robert ..... Pierson, Dean James. . Pietkiewicz,G ..... Pi LambdaTheta . . Pilkinggon, William . . Pinta, . ..... . Pinta, Robert. . . Pinter, Harold . . . Pinzke, Linda ..... Piotrowski, Joanne . . Pirrello, Sam .... PisaEek,Francine. . . Pite o, Thomas. . . Pitrowski,J .... Placher, George. . . Plagge, M.. . . . P1anz,Janet . . Pleiades ..... P1etica,D ...... P1etsch,Steven,. . . . Plochocki, Donald. . . P1otnick,W ..... Plumb,D ..... Plunkett, Mary . . Pniak,T. ..... . Pochodenko, Olga. . . Pogofsky, Larry. . . Poindexter, Robert . . Pokorny, Harvey . . . . .291 . . .408 408 408 . . .232 . . .261 . . .408 . . .408 . . .408 409 . .244 . . 152 . .271 261, 409 . .264 409, 430 . .222 . .230 . .244 . . 95 . . 95 . . 182 162, 182 197, 259 184, 185, 264 19s, 263 . .198 . .235 . .266 268, 198 . .293 . .115 . . 96 . .409 . .254 . .261 . .409 228, 409 . .195 . . 69 . .246 . . 105 . .409 . .254 . .409 . .195 . .409 . .409 240, 409 409 409 239 409 265 409 68, 216 251 409 409 270 241 409 271 409 1 :409 . .409 . .409 Polchopek, M ...... Political Science Dept. . . Polivka, Jerry .... Pollworth, D. . . Polonskg, C .... Polzin, ona1dE. . . Pomerant.s,R. . Pom Pon .... Pope, Ronald . . Popernick,J. . . Pople, Linda . . Porcaro, A.. . Porn, D. . . . Porter,C. . . Porter, Sandra . Portschy, M .... Pospisc il, Robert . . Potenza,R.. . . . Potenze, Richard . . Potocki,J ...... Poucher, Terrance . . Powell, B ..... Powell, Sandra . . Power, Donald . . Powers, B .... Powers,J .... Powers, P. . . Pow1es,S. . . Prafer,J.. . . . Prater, Jackie. . Pratt, Mar aret . . Prellwitz, G .... Prenner, Donna. . Prepeicha1,G. . . . Prepe lica, T.. . . . Preston, Susan Marie Price, T. ..... . Price, Dr, William , . Pritchett, Dr. E. M. . Priut, G. ...... . Proqlfct Upward Cound , . Pro aska, Ellen .... Prokop, Linda S. . . Proksa, Georgina . . Pros, D ...... Prus, V ...... Pnxcha, R. . , . Prusila, John . . . Pry, William, .... Pryor, Cynthia . . . Przepior a, Carol . . Psyc ology Dept. . Puchalski, G, . . . Puckett, Cheryl . . . Pueracker, Donna . . Pugh, D. . .... . Pugh, John M ...... . .240,-109 597,79 . .409 . .251 . . .241 . . .195 . . . .228 . 236, 246 . . .409 . . .271 . . . .409 . .246,409 . .27I,409 . . .222 . . .410 . . .244 . . .410 . . .250 . .195,410 . . .271 . .410 . .250 . .410 . .410 . .226 . .251 . .251 . .238 . .239 . .410 . .410 . .268 . .410 268 245 . .410 . .261 . . 71 . .117 260 67 410 410 411 270 231 231 . .411 . . 41 . .411 . .293 . . 98 . .265 . .411 . .411 . .232 411 Rees, Perry. . . . . Rees, Tony ....... Reese, Karen ...... Re ional Services Director, N5'il1iamFroom .... Re is, Patrick ...... Re5berlg,C1i1Tord . . Reich, . . . . . Reid, Donna . . Reid, M.. . . . Reid, Susan . . Rei er, P .... Reiiy, Valerie . Reimann, H. . . Reimers, Barb . . Reinbo1dt,J. . . . . Reinemann,Thomas. . Rekau,K3' .... Rembos, eorge . Renn,J.. . . .. Renner, Patricia. . Resczek,C. ...... . Research ........ Reserve Ofticers' Training Corps Program Resident Assistant Key- note ........ Rettke,Cindly. . . . Rewers, Pau ette . Reynolds, Susan . Rezabeck,D. .... . Rhinesmith, Lynda . . Rhode,D ...... Rhodes, E.J., Jr.. , Ribbing, S.. . . Ribble, Debra . Rice, Judy. . . Rice, Linda . . Rice,S ..... Rich, Deborah . Richards, Lynn , . Richarfs,P. .... . Richardson, Jeffrey . . Richter, Kris .... Richter, Norman . . , Ricken,Chery1 Lynn. . Ridlr-1ell,Kiet . . . Ri 1, Luc . . . RiE:y,Kat11y . . . Rile ,John James . . Rim1Jy, Robert . . Rimd?1a,T. . . Ring, . .... . Ring, Georgann. . Rin ,R. .... . Ringstrom, Paul ..... Riordan, Kathleen . . . Courtesy of BRIGGS PRINTING, INC. Offset cmd Letterpress . .412 270,412 . .412 . . 66 . .412 . .412 . .240 230,412 247,261 . .412 . .250 . .412 . .258 . .325 . .264 . .412 . .412 . .225 . .266 . .412 . .227 . .140 ' ' 99 . .215 . .244 228 412 242 289 237 412 . .271 . .412 . .261 . .412 . .242 . .412 . .412 261 . . .412 228,265 . .412 . .412 270, 412 234 . .234 . .270 . .237 . .242 . .232 . .412 . .242 268, 414 . .414 Pugh, Susan Kramer . . Putz, F ....... Putz, Kenneth . . . Pyktel, Darlene . . . Pytel, Cgynthia . . Pytlik, . . . . . Quantock, Bill . . . . . Quebbeman, Robert . Quick, Lois ..... Quiggle, Doyle . . . Qui ,E. .... . Quillinan, Pat . . Quinn, D ..... Quirin, Alben ..... R Rabe,L nne . . . . . Rabin, gruce . . Racek,A ..... Rackow, William . . Radiker,K, . . . . Radtke,MaryJean . Raftree,Kieth . . . Ragalla, B.. . . , Ragnes, Ruth. . . Ra usa, Marilyn . . Rain, Barbara , . Rahn, S.. . . . Raiber, J. . . Rainey,T. . . Rake, David . . Ramsey, C.. . Randour, L. . . Rank, A.. . . Rankin,J .... Rasins,J ..... Rasmussen, P. . . Rathje, Janis .... Ratkowski,Je1Try . . Rauch,L ..... Rauser,B ..... Rawls, Alan . . . Raycraft, Barbara. . Raymond,J .... Reach, Damon D.. . Reardon, Donna . Reardon, Lucy . . Reaver,Laurice. . Rebechini, H.. . . Reberg, Jo Ann. . Reddington, Pat . Redlich, Renee . . Redman, Rich . Reed,M.. . . . Reed, Susan . . f f223,' 411 411 . . .411 . .411 . .411 260 . .252, 411 411 . . .411 . .411 . .411 . .256 . .411 . .253 411 Q Q .240, 411 411 256 411 265 411 411 241 . . . .411 . . .411 . .411 . .261 . .241 . .271 . .411 . .247 . .222 . .264 . .222 . . .268 . . . .259 . .231,411 . . .411 . . .265 . . . .226 . .268,4l1 . . .411 . . . .232 134 . .246,412 . . .261 . .412 . . .239 . . . .227 . .239,412 . . .412 . . .412 . . . .244 . .244,412 Rishe, Sue ....... Risily, Judy . . . Risser, Dianne . . Rissman, L. . . Ritter, Susan. . . Rizzo, T.. . . . Roadruck, D.. . . Robbins, S.. . . Roberson, R. . . Roberts,J.. . . . Roberts, Meryl . . Roberts, Nancy. . Roberts, R.. . . , Robertson, M. . . Robey,L .... Robins, Karen . Robisch, A. ..... . Robison,G ....... Roche, S. . .... . . Rockwood, Dr. Catherine Rode, Denise ...... Rod ers,K .... . . . Rodiin, D.. . Roe, Evelyn . . Roeck1ein,J. . . . Roegner, Thomas . . Roewer, Doug . . Rohlman, Art. . . Rohrs, Russel .... Ronspies, Gerald . . Roos, Daryl . . . Rose,J ...... Rose, Patricia. . Rose,Tom. . . . Roseberg, K.. . . . Rosenbacker, Nancy. , Rosenbaum, L. . . . . Rosenow, Annette. . Rosenthal, Ruth L. . Rosga, Diane .... Rosol, Elouise .... Ross, June Schorpke. . Ross, Susan .... Rossi, Rossi, Rossi, Rossi, Rossi, Rossi, Albertk... C,.' .... David .. G.. .. M. ... Victoria . . Rosy, Beatrice . . Rosy, R, .... . RO C. . . . . .. Roth,N. ...... . Rothenbaum, Rona . . Rothman, D. .... . Rouse, Pamela Jane . . Roush, Tom .... Rowe, Kurtis .... Rozakis, Christine . . Ruane, Mona . . . . .325 . .414 . .414 . .228 . .414 . .245 . .260 . .261 . .244 . .244 325 414 . .254 . .253 . .244 . .414 . .239 . .237 . .225 . .105 . .325 . .248 . .241 . .414 . .231 . .414 . .218 . .331 268,414 . .414 . .414 . .268 . .414 254,414 . .261 . .414 . .261 . .414 260,414 260,414 . .414 . .414 . .414 . .414 . .239 242,414 . .237 . .271 . .414 . .414 . .256 . . 99 . .230 . .414 . .244 . .414 . .414 . .414 . .414 . .414 447 Auben, M.. . . . Rubin, Sharon . . Rubinstein, G. . Ruda,S. .... . Rudsinski, Marcy . Rufll B. . . . . . Rumel, Lynn. . . Running, Mary Jo . Rupprath, Cynthia Rurka,B ..., . Rurka,G .,.., Rusniak, C. . Russell, Bill . Russell, C. . . Russell, Ron . . Russler, J. . . Russo, P.. . . Rustabucrsgi K. . Ruszat, eryll. . Ruszat, Richard. . Ruwe, C.. . . . Ryan, James . . Ryan, K.. . . . Ryan, Patricia . Rydelek, C. . Ryden, C. . . Ryder, T. . . Rydzen, J. . . Saas,V .,... Saoco, P. ,... . Sachnofl',R .,,. Sachsel, Kenneth . Sadkin,H.. . . . Sadlicki, D. . . Sadlis, K. . . . Sadowski, Judy. . Saeks,S. ,... . Saelens, Beverly. . Sage,C ..... 234 414 . .255 . .229 . .415 271 . .415 230, 415 234, 415 . .286 . .246 . .244 . .175 . .234 332, 334 . .270 . .227 . .222 . .415 260, 415 . .222 . .415 . .231 . .415 260 247 226 239 231, 415 242 255 415 232 247 . . .234 325 261 415 265 322 257 240 Sa e, Don . . . . . . St.gl-lilaire, B. . . . . . . Sajewick, R. . . .238, Sa na', D .... ..,. 2 42 Sala, ..... . . .223 Salabura, Wallace . . , . .415 Salata, A. ,.,. . . .245 Saletta, J .... . . .226 Salo, Lynne . , , . .415 Saltzman, Bettie . . . .415 Salvation Army . . . . .267 Samargis, J. . . . . .245 Samborski, B. . . . . .253 Samet, M ..... . . .261 Samilow, Alice . . . . .415 Sammul, A. . . . . .260 Sammuli, A .,,. . . .260 Samples, James . . . , .415 Samuel, C. . . . . . . .239 Samuels, J, . . .... 255 Sanchez, M. . . . .261,415 Sanders, Beverly . .... 415 Sanders, Henry . , . . . 168 Sanders, M. . . . . . .223 Sandora, B. . . . . . .225 Sandora, Robert . . . . .415 Sandvick, Kathryn . . . .415 Sandwell, M. , . , . , .231 Sanes, J. ..... . . .256 Sanford, Cheryl . . . . .415 Santucee,B. . . . . .252 Sapa, G. .... . . .223 Sarallan, M .... . . .245 Saraga, Richard . . . . . .415 Satterthwaite, John . . . . .415 Saunders,A ..... . . .261 Sauodny,S. . . . . . .252 Saver, L. . . .... 261 Savitsky, D. . . .255,4l5 Savodny,S. . , . , .252 Scallon,J ...... . . .244 Scanectady ,,.,. . . . . 79 Scalon, Anna ..,.., . . .415 Scaperlanda, Anthony . . . . . 86 Scarry, Kathy ..... . . .415 Scartozzi, Thomas . . .... 415 Scaturo, Karen . . .... 415 Schaafsma, M. . . . .253,416 Schaafsma, R. . ..., 270 Sehaa , S .... . . .253 Schacher, Mario . . . .416 Schatz, L ..,., . . .255 Scheider, Gary, . . Seheri, B. ....... . ..... . . Schiewe, S. .............. 228 ....416 .222 ,416 Schennan, Terry . . Scheussler, Sandra . . Schick, Barbara. . . Schindler,J ..... Schimier, Timothy . . Schleef, Kathleen. . . Schleff, Donald. . , Schleicl1er,J. . . . Schlenk, D.. , . Schlicting, D. . . . Schlottman, D. . . Schmaltz, B. . . Schmidt,G, . . Schmidt, J. . . . . Schmidt, Nancy. . . . Schmidt, S.. . . . Schmitt, C.. . . Schmitt, S.. . . Schmitz, John . . Schneider, B. .... . . Schneider, Darlyne . . . Schneider, Robert W. Schneidennan, Myra Schnel1,M. ..... . Schockow,T.. . . . Scholten, Lois . . Schon, S. .... , . School of Nursing . . . . . Schreibman, Patncia. . . . . , Schrier, M. ...... . . . 18 Schroeder, C. .... . . . Schuett, S ..... Schuler, Mary L. . . . . Schultz, J ..... Schultz, L. . . . . Schultz, P. . . , . Schultz, Robert . . Schumacher, Judy. . . . . Schuman, C. . . . . Schwaba, Mary . . Schwanz, Russell . . Schwartz,Carol. . . Schwebke,J. . . . . Schweisthal, Judith Schweitzer, B. . . Soonza, William . . . . Scott, S ....., Scrog 'n, T. , , Seays ...... Sec er, Laura . . . 8, Schultz, Kathleen. . . . . 181, 246, 268, 244, 258, 416 416 416 222 416 416 416 243 416 245 . .261 239 416 223 416 267 416 271 416 416 . .416 . . 91 . .416 . .265 . .239 . .416 . .255 . .113 . .416 265,416 . .234 252,416 . .416 231,416 . .416 244,416 184,261 . .416 1245, 417 265 417 417 417 261 417 . . .234 417 417 257 256 417 112 70 70 Secondaig Education . . Security ffice . . . . Security Police . . . , Seggerman, D. . . . . .242 Segura, G. . . . . . .229 Ser s, P ..... . . .247 Sells, Paul E. . . . . .417 Seitz,M.. . . . . . . .238 Seitz, Timothy . . . , .417 Selan, R. .... . . .256 Selle, C .... .268, 417 Sellers, J. . . . . . .239 Selmartin, K. . . . . .231 Selon, S. ..... . .255 Selzo, Lawrence . . . .417 Semon, Patricia J. . . .417 Senese, D ..... . . .266 Senese, Daniel . . . . .417 Sennott, E. .... .246, 417 Sepich, Robert . . . . .417 Seralin, N. .... . . .239 Serge, T. ..... . . .268 Serocke, Ronald . . . .418 Sestak, K ..... .230, 418 Setlak, William . . . . .418 Settino, L ..... . . .243 Setzke, Christine . . . .418 Setzler, Henriy ..... . . .418 Seymour, S. rederick . . . . . 100 Shales, Margaret ..... . . .418 Shalett, Ma orie . . .418 Shallcross, 'llheresa . .418 Shambo, J. ...,.. . .264 Sliames, Benjamin. . .418 Shapin, R. .... . . .247 Shapiro, R. ..... .... 2 34 Sharber, Leonard . . ..... 418 Sharring, Lisa . . . . .258, 418 Shayne, Cynthia . . . .418 Sheade, R. .... , , .241 Sheedy, B. . . . . .239 Sheedy, Joseph . . . . .418 Sheehy, R. . , . . .265 Sheel , D ..... . . .245 Sheldalm, S. .... , . .228 C0 GRATULATIO 448 Shell, T. .... . Shenkin, Herb . . Shepherd, Marsha . Sheppard,J .... Sherman, R .... Sherwin, Maryann Shevin, D ..... Shiffer, Walter . , Shil'11ett,Arrrre . Shig1ey,Sa.ra . . Ship ert, John . Shirllzn ,G. . . Short, . . . Shulman, T. . Shuman, R. . Shutan, M. . . Sibley, Frank . . Slegal, J.. . . Sieman,J ..... Sievers, Gary. . . Sigma Alpha Epsilon Sigma Delta Pi . . Sigma Delta Tau . Sigma Kappya. . . Sigma Lam da Sigma . Sigma Nu .... Sigma Nu Blood Drive . Sigma Phi Epsilon . Sigma Pi ..... Sigma Pi Playboy Dance . . Si ma Si ma Si ma silforskiiv. .5 . Sila i, Geor e . . Silv5iYman,Gg. . Simon, N. . . Simons, K.. . . Simonson, M. . . Sim son, B. . . Singqar, P .... Singler, T ..... Siprorlrin, Forrest . Siporia, F ..... Siracuse, D. . . Sirvidas, Rita . . f i239,' 245 288 418 418 251 418 228 418 . . .418 418 418 226 250 255 261 268 418 244 222 418 . . .198 245 268 184 .l60, . 198, .l83, 186, :181, . .l95, 255 258 262 247 265 252 199 269 265 226 . . .418 255 255 227 264 245 266 245 418 223 265 418 Spalding, Edward . Spalding S. . . . Special d. Dept. . Speckmarrn, L. . . Speech Dept.. . . Speer, Terry . . . Speiser, Thaddeus . Spellmire,L .... Sperla.k,J ..... Spil1man,J. . Spina, R.. . . . Spingola, Jan. . Spires, Suzanne. . Spitler,June . . Spittal, B. . . Spivak, M. . . Spivey, Julie . . . Splap!,R ..... Spoc , Dr. Benjamin. . . Spolarich,Joan . . Spom, Barbara . . Sports ..... Sprague, Jan . . Spring ...... Spnng sports . . . Springman, Jolene Spums, V. . . . . Srananek, Sherry . Stach, J. .... . Stach, J. .... . Stade, William . . Stafford, J.. . . . Stafonic, K. . . . Stagckler, Kathryn Stage, Lois .... Sta 1, G. .... . Stahlheim, Curt . . Stamm, K. . . . . Stamos, G. . . . . Stamper, W .... Stana e, Sherman . Stanisiawski, E. . . Starbuck, Susan . . Starfa, R. . . . . Starkey, B.. . . Starkey, Mary . . SWEDEN HOUSE SMORGASBORD 928 West Lincoln IAI1 301 81 5f758-7421 Sitarz, Donald . . . Siwinski,Cathy. . . Skamser, I.. . . . Sklar,J ...... S1dodowski,K .... Skocz, Charlotte . . Skoczek, G. . . . Skoll LouisA. . . Skomski, Thomas . . Skovronski, Gary . . Skulls ....... Skweres, Virginia . . Skwira, Pamela. . . Sladeck,G.. . . . . Slagley, Charles. . . Slattery, B. .... . Sledgister, Timothy . Sle o,F ...... S1iAa,J. .... . Sloan, James . v. Small, William . . 257, Stark1anct,J. . . Starkman, E. . . . Starzyk,J ..... Sraskrewicz, D. . . Staszak, Catherine . Staszel, Diane . . Stazel, D. . . . . Stearns, Kathleen . Steckel, Bettye . . Stecker, B. . . . . Steffen, L .... Steger, R ..... Stern, S. .... . Steinber , Che l . Steinberg, R. .ry. . Steinmann, Edward Steinmeyer, Susan . Steit, Kathy . . . Stejskal, C. . . . . Stendet, K.. . , Stenfelt, Cheryl . . 250, 420 227 117 420 . . . .101 420 420 246 . . .238 246 243, 232 288 420 420 252 268 . .420 . .233 . .192 . .420 . .420 . .302 . .420 . .146 . . Q 1223, 304 420 260 420 240 244 420 420 265 420 . .420 27 1 295 234 259 242 95 226 420 266 252 . . .420 3, 9. GRACIOUS DINING WITHOUT EXTRAVAGANCE 418 241 327 260 267 244 418 265 244 420 418 420 226 246 418 420 Skoglund, E. .... 222, 418 Steams, Sharon M. . .421 418 421 418 264 264 232 419 231 419 24 421 225 421 419 257 270 421 419 421 252 152 239 23 421 419 246 419 421 421 325 Smetana, Robert . . Smith,A. . . . . Smith,Bemice . . Smith, D. .... , Smith,E.. . . . . . Smith, Dr. Eleanor . Smith, Dr. Elwood . Smith,Evie ..... Smith,G ,..., Smith, J.. . , Smith, L. ..... . Smith, Marcia . . . Smith, Pres. Rhoten . Smith, R. .... . Smith, Suzanne. . . Smith, Terri .... Smojver, William . . Sneed, Jeffrey . . . Snider, Cheryl . . . Snider,K ...... Sniechowska, Yvonne Snitowsky, Stephen . Snow, David .... Snyder, Cathy . . So ek, Christine . . Socha,D. ..... Sociolo ..... Soc. 8 ilhthro. Dept., Head . . . , . . Soedler, Sheryl . . . Sohn,Adrienne. . . Sokolow,D .... Solomon, C. . . Solomon,Terri . . Solway,J .... Sommer, B. . . Sondell,J ..... Sonik,S. ..... . Sorensen, Geoffrey .. Sorenson,R ..... Sorkin, Howard. . . Sorkin,Jay. . . , . Southeast Asian Studi Center ...,.. Sowa, G. ...,. . Sowka,C ...... Spackman, Timothy . Spain, Bill ..... CS . .2S6,. . .419 419 .224, . .419 258,419 195,419 . .300 188,300 . . .419 .226,419 .291,419 . .250 . .419 58, 60, 65, 64 419 . .419 . .419 . .419 . .419 . .419 . .267 . .419 . .419 . .430 159 419 419 100 270, 62, 288, 244, 100 419 420 261 420 420 261 . .247 . .231 . .254 . .148 . .271 . .420 420 . . 79 . . 225 . . 226 . . 420 . .420 Stenger, M.. . . . Stenman, Kathy . Stennman,C.. . . Stenson, Thomas F. Stepenski, Theresa Stephens, Marilyn . Stephens, Thomas . Stemfeld, D. . . . Stevens,John. . . Stevens, P.. , , Stevens,S.. . . Stevenson, R.. . . Stevenson South . Stevo, Cynthia . . Stewart, C.. . . Stock, D.. . . . Stock, Suzanne . . Stocklin, K. . . Stoc1din,M. . . Stoh1,L. .... . Stolgren, Susan . . Stone, P.. . . , Stone, S.. . . Stoner, John . . Stonich, R.. . Storm, B. . . . Stott, Kathleen . . Stott, MaryAnn . Stowe, Bonita. . . Strand,T ...,. Slratland, J. . . . Straub, Carlotta. . Straub, Robert . , Strauss, Les . . . Streit, Katherine . Strelecky, Christine Strill, Donald. . . Stringer, M. . . . Str-itzel,J. . .. Strleck ,C.. . StrobeHL. . . . Strom, Gail . . Strong,C ..... Strong, Patricia . . Strong, William. . Strutz, Bruce . . . Strzelecki, D.. . . Stubler. Marv Ann Student Association . .246 . .421 . .421 . .421 . . 71 . .255 421 258 224 222 186 421 256, 421 222 421 243 250 266 421 240, 244 259 421 225 271 421 421 421 227 235 421 421 421 . .421 . .421 . . 150 . .225 . .250 . .267 . .259 . .421 . .234 . .421 . .421 . .421 . .244 . .421 . . 76 1 SA Senate ,..... Student Mobilization Committee ,... p . . . Student Personal Services . Student Personnel Services . . Student Teaching .....- Studio Theatre 81 University Theatre Series ...... Stulges, L ...... . . . . Sudoma, D. . . Suhr, Virtus . . Sullivan, M. . . Sullivan, T. ....,... . Summer .......... Summer Foreign Study Program Summer Session ...... Sumsky, D. ..... . Sundquist, Sue . . . H. . Superintendent of Public nstruction ,..... Suveizdis, J. . . . . . Suyhauda, Bill . . Suyhayda, Joe . . Svoada, B. . . . Swank, B. . . Swano, A .... Swanson, B. . . Swanson, S. . . Swenson, R. . . Swinski, C. . . . Switzen, N. . .d. . S m hony Ban . Szaflgirski, P .... Szcurek, J. . . . Szkudlarek, M. . . . Szostak, Michael ..., Sztucko, Alexandra A. . . . T Tadd,G... .... Taff,C .... . . Tahaney,D ..,. Taheny, Darcy . . Talbot,P .,.. Tama, Euelyn . . Tamulis, Joseph. . Tangorra, M. . . Tappan, Julie. . . Tarpley, Katharyn. . Tarnin, Donnalou . . Tarnofl',S. . . . . Tasky,T.. . . . Tassio, P. . . . Tau, Elmer . . . Taubenheim, P. . . Taubin,C. . . . . . Tau Delta Epsilon . . Tau Gamma .,.. Tau Lambda Chi . . Tavormina,M. . Taylor, Barbara. . Taylor, Dennis . . Teacher exchange . . Teichman, M. . . . Teichner,S. . , Tei el, Mark . . '1'e1l?ord, Gary. . Teolilo, Jean . . Tem le, T. . . Terega,R. . . Terry,J. . . . Terry, Peter . Testa, K.. . . Theille, A. . . Theis, Thomas . . .177 132, 242, . .254 . .268 . .246 . .327 . .253 . .423 . .423 . .244 . .423 . .423 . .423 . . .261 . . . .261 240, 241 . . .423 . .268 . . .255 . .186, 198 200, 184, 199, . .423 255, 423 . .423 . .181,24 5, 423 Theiss, K. . . . .260, 423 Therriault, M. . ---- 238 Theta Chi .... . . 197, 242 Theta Delta Xi . . - - 198, 237 Theta E silon . 4,-, 233 Thill, Nlgiaorle . . . .... .423 Thin er, . .... . .230, Thisgewaite, Robert Thole, J. .... . Thomas, Betty . . Thomas, C. . , . Thomas, D. . . Thomas, Janet 1. . Thomas, K. . . Thomas, L. . . Thomey. J. . . . Thompson, J. . . Thompson, N. . Thompson, P. . . Thompson, R. . Thompson, S. . . Thomson, A. . . Thon, M. . . . . Thorsen, George . Thorton, S. . . . . Thurlow, B. . . . Tichler, D. . . . . Tiehen, RobertC. . Tilbury, Paul . . . Timan, Ann . . Tippet, David . . Tira, Joel .... Tiskus, J. Christiane Tobiansky, Susan . Todnem, M .... Tokarski, A. . . Toman, J ..... Tomaszewski, M. . Tomblin, Diane . . Tompoles, Marcia . Toneff, G. . . . . Toni, Mary Ann . Tookey, S. . . . . Topp, Dr. Robert , Towers ..... Townsen, B .... T wnsend Linda Cook . . o 1 Townsend, Robert. Trainor, L. . . . . Traister, G. . . . . Trakselis, Linda Burt Trakeselis, Terry . Trampas, C .... Transon, Robert . Trantowski, K. . Treacy, James . Treacy, M. . . Trechter, S, . . Trident . . , . Triolo, Charles . . Tronsen, K. . . . Tronsen, Kay Ellen Tropstein, Frances Trotta, Kathryn . . Trotter, P ..... Truesdale, Edna . Truhlar, Ruth . . Tstsumi, W. . . . Tsuneta, Kathryn A. Tucker, Dr. Charles Tuma, Carol . . . Turek, Charlene . Turek, Thelma . . Turner, L ..... Turner, S ..... Tumroth, Elizabeth Turzer, M. . . . . Twardy, M. . . . 226, 247, 246, 248, 239, 261,- 228, . . .325, Q f 1255,- 423 1 20 23 8 423 423 423 423 250 246 239 423 423 229 22 5 24 1 423 239 424 . .246 24 1 424 424 424 424 424 424 424 424 225 268 3 5 3 250 424 424 226 424 222 76 . . .294 . . .231 . . .424 . . .424 . . .225 257 424 424 234 424 29 1 422 424 23 1 256 2 14 424 244 424 . . . 424 . . . 424 . . . 245 . . .424 . . . 424 . . . 254 . . . 424 . . . 101 . . . 424 . . .424 . . .230, 424 331 . . . .238 424 258 243, 325 Uehara, Susan Edith. . , Uhmt, J, ....... . uhm, C. ..... . Uhruh,T. . . U1brecht,C. . . Ulgel,L.. . . , . Ull-l3SZ,C .,..... Ulmenstine, Karen . . U1vestad,D ..... Ulvestad,V .... UMOC ...... Underwood, Diana . . . Underwood, Linda . . . UNICEF ....... University Center Board University Center .... University Chorus . . . University Council . . . University Lab School University Master Plan University of lllinois University of Illinois in France ....... University Schools . . . U.S. Pub ic Health Service Hospital ..... . . Unruh, T ...... . Upward Bound . . . Urbaniak, Susan . . Umikis, Marian . . . Uttich, M ..... . . V Valdes-Cruz, Ester . . . Valentine, L. ..... . Valenze, S. . . . . Valpe, M. . Vana,T. . . . . Vanatta, B. . . . . Vanatta, William . . VanBrunt, Vicki . . . Vance, Dennie ..... Van DeMerkt, Patricia . . VanDeNorth, Patricia . . Variderby, J ....... Vanderpoel, John H. . . . Van Der Veren, Deborah . VanF1cet, D. .... . . VanGelder, B ...... VanKampen, Darryl . . , VanKanegan, Judith , . . Vanstrom, F. .... . Varland, Jerzy . . Varsity Band ..... Vasek, F. ...... . Vasek, James . .... . Vasilopoulos, Armande . Vaslus i, L. ..... . Vaulglm, J. ..... . Vaug n, Jacqueline . . Vaupel, Richard . . Venzke, S ..,,. . . Vermeersch, Stephan . . Verrecchia, Ralph . . . Vesley, Christine . . Vet's Club .... Vicks, Linda . . Victor, R. . . . . Vidinich,Jolyoe . . Vignocchi, . . . Vinke, Jill . . Hovhtiylufi 1 Q 1267, 258 246 234 237 225 231 . . .227 424 266 425 153 425 248 262 176, 236, 267, 268, 296 . . . . . . . . . 195 . ........ 300 . . .6O, 67 114 110 300 . . 79 . .119 . .246 . .237 . . .168 . . . .425 . . . . .425 . . .225,425 . .425 . .239 . .252 . .253 . .252 . .226 . .425 . .267 . .425 . .425 . .425 . .268 . .264 . .425 . .254 . . .225 . . .425 . . .425 . .250 . .252 . .299 . . .223 . . .425 . . .425 . . .234 184, 216,217, ' f Q 1235, . . .425, 244 425 425 228 425 425 425 . . . . . 198 218 289 425 243 268 425 Vitcle, Leonard . . Voelz, S. .... . Vogel, Linda . . . Vogt, L ..... The Vogues , . Vo'ir, Daniel. . . Volk, L ..... Vo1lers,D. . . Vol1ers,K. . . Vol1ers,P. . . Voltz, G., . . Vondra,J. . . Voss,B ..... Voss, Robert . . . Voves, William . . Wach, Mary . . . Wagner, Nancy. , Wainscott, Mary . Wais, James . . . Wais,Sau-Ling . , Wallace, Richard . Walsh, Ra mond . Walters, Cjelrolyn . Waters, Nancy . . Wanat, Robert , . Wannemacher, Ann Ward, Mary . . . Wargin, Joseph . . Warman,Caryn. . Wartowski, Anna . Wasik, Christine . Wasilewski, Philip . Wasner, Susan . . Watson,John. . . Watson, Patrick. . Wayne,G.. . . . Wa ne University in germany . . . Webb, B. . , , . Webber, Emestine Weber,J. . , , . Weber, P: ..,. Webster, Neita . . Webster, S.. . . Weckerz, R. . . Weeks, obert . . Wegner,D.. . . . Wegner, L.. . . . Wegerzyn, Barbara Wegzym,F .... We r ',J .... . Weicle,P ..... Weickle, Patricia . Weidner,M .... Weidner, Michael . Weigel, George. . Weimer, Rebecca . Weimholf,J .,.. Wcinbcr ,M.. . . Weindori Holly . Weinstein, M. . . Weinstein, Sherlisy . Weisandanger, .. Wcise, Dorothy. . Weise,H. . . . . Weisman, R. . . . Weiss, Malcom . . Weitzman, Craig . Welch, Thomas. . Welchans,S .... Welker, Jeffrey . . Welker, Daniel . . Weloomer, Joe . . Wells,J. , . . , Wells, P.. . . Wells, R.. . We1sh,J.. . 239, . .180, 425 425 425 . . .239 185 425 258 240 . .241 237 223.. 239 253 271 425 425 425 425 425 426 426 426 426 426 325 426 426 426 426 426 426 426 426 426 426 426 247 79 251 427 271 245 427 239 245 427 227 239 427 304 239 240 427 250 427 108 427 223 234 . .427 232, 427 427 254 267,' 1 427 427 235 90 427 427 257 427 427 33 1 250 227 244 245 n 449 kv mg L f fi? :-' 351- . A x si l , Q 3 3 Q i X ix f 5 931 :rf V 5 - Q5 N ii K ,IA 'Q iii? N mk :ww 5 ' in SA? ,Q xv W f EW Q TR W W 4-' Tri Swir tlzvir uc' IU Onzvyu ffUlllOIl.S'II't1ll'.Y before Kf.S'fl!l'l1llkL'L' Hull pr0Iv.s'1ir1,g' c'0H1pIiSf11'cl fratc'rl1iIy'.s' luck of pulllicily in Ihr' Norllzvr. ., , ' ,nw , . ' - 1 V - A ' f' mf Q , Wim if 'Wm xi' ., M55 .2 y MQW 434354 , ,V,. , WV '5 A 2 1 Z f 2 K Y? , , 4 W X. V if ,,.4.,,N ,, S MZ.. 1 jr E ' fm' f Yan' 4 Q v 1 1 rw: V W- Q ng ww ww M ' as W 5 xx., gba: 'Q -Q ,fm S, in if 8 fx? 1lf'!x. -M, U Q 5 '44 s 5 f , A ,sw 3 We It if , !'f w ?Lt ,z'3?::M' , , sg we 4 3121- f51wf:,+ V A 9, ,Q-,f ,jg v,.N,,.,,,,,. 'Q-gyv . M Ae- sham. fm'-fax QEXLRLSXU2 bf w- -7,124 f 6 1553213 ',,r,,fjff,' W 3, ,, ''.m?QS'egvx'33,'e!f:m:,fgf,fflM..g4 f MK: ffsffffffff 4 44,1 'Kw',,,, N. gnzfcz ,-:,,f :f RTif '4- 1 i , LQ, ' 124, f-f.jf'ff'N' QV.. r , Q i','ffff14:c,Q,fX7. ,,,,, W, I ,, is ff, Ir' ' w -- IV ,,4 .569 Jw, 599k f Q .sf - du., f A wif ,fxwfm ',,2'f-fffgxtf , 1 f , ,gg M41-'f I ' 9.3-jw?7Q,fQ-Q., V A , 'K ' xx-fff?fGf - we sm . Q, ,..,, ,, W is ,J W ,Z ' ::.AZf9f' , 'hkwmigw k'71i1:E,52 f , jj! ,. , ff 1, 1 95247. 5 f,,w'fwff'N. , my ,. , ,ggyiygf gy Xfifzwf 7 Y , if' , ff , 1 A - , :VL ' ,Y ,CLK ,W jp? 2, f ,fi 1112 A 4' ' fn , ff .m' , lf , L H cf' F, .4 , f, U ' .Q ' 4 'M ,ws 1,-M sz s Q in I f ,pf ' ,V f ,W , W A, , ,E A , e, ,Vi V? ,Mya-W af ? an , ff Ax 1? i , v ,Rs Q if ,L 2, ,, . 2 J t. ii A Photographers Tom Alfredson, Richard Anderson, Apeda Studios, Dave Benni, Tom Byrnes, Jim Chin, Skip Diemer, Ray Goettch Charlie Green, Al Hippensteel, Will Howe, Tracy Jones, Lynn Kamba, Jon Lawrence, Eric Matson, Mark Mnieszewski, Gene Mustain, John Patsch, Jim Polaski, John Samargis, Nick Samar- gis, Don Schuemann, 'Herb Shenkin, Sports Information Bureau, Gail Tennant, John Tindell, University Relations, Tom War- towski, Cindy Westbrook. Colophon Set in Intertype Times Roman, an updated version of the traditional Goudy typeface, at Wheelwright Lithographing and Publishing Company, Salt Lake City, Utah. Body copy was set in 10f12 Times Roman, senior credits and ctulines in 8X8 Times Roman italic, index and Greek group identifications in 6X6 Times Roman italic. Headlines were done in 24, 30, and 36 point Century Noble phototype. Press run for the 1970 Norther totaled 15,000 copies. Printed on 80 pound Warren Patina, the book consists of 456 pages, 32 of which are 4-color process. Endsheets are 65 pound Beckett Antique. The method of printing was offset. Cover design The cover, designed by Paul Ringstrom, was produced by Durand Manufacturing Co., Chicago, Illinois. Direction '70 symbol designed by Cindy Westbrook and executed by Goff Dowding, Wheelwright Lithographing and Publishing Company. Base color is Royal Blue on Sparkle grain. Overlay color is Orange. Lettering is hand drawn. orther staff Executive editor ....... ....... ..... C i ndy Westbrook Business manager ..................... ....... K en Holland Assistant business manager ...... .. .... Steve Franks Advertising manager ............. ..... T erry Trakselis Copy editor .............. ........ B ob Meindl Layout editor ..........,.................., .......... L arry Bailey Photo editor ...................................... .................. J an Dreger Administration and seniors editor ..... .....,.. D oreen O'Connell first semester .................................................... Pam Hansen assistant .............................,.............................. Susan Strauss Colleges and academics editors..Linda Kenyon and Linda Vicks assistants .................... Nancy Little, Lynda Rhinesmith and John Yedinak Dorms and services editors .... Jane Baldwin and Mary Pignotti first semester ...........,...... ................................... K ay Soder Greek editor .......................................................... Jan Spingola assistants ................................ Jane Clawson, Dick Katschke Special essay and introduction editor .................... Linda Cowie assistant ...............,.......................................... Pat Engleking Sports editor ........,.... ........ H erb Shenkin first semester ........,.. ....... J ohn Samargis Year-in-review editor ...... . . .......... ...... A drienne Sohn J oanie Voigt assistant .....,................... ............................... Other editorial assistants ......,..... Bob Ramsey and Barb Rurka Reflections The promise has become a reality. All the mind pictures have crystalized. Four hundred and fifty six pages of thoughts and mind explosions have become the U 1970 Norther - an experience in itself. G And now it's time to look back and look ahead. I have special thoughts and much love for my staff who recognized that respect and responsibility create the difference between a good staff and a bad staff. , , , They shared respect for each other and molded a 'responsive responsibility to the best in themselves, which, in turn, became the best in the book. My thoughts ramble on . . . there were late night Simon and Garfunkel talks about the nature of infinity, God and Ray Gibsonls super delicious spaghetti . . . last minute sprints up to the post office in Altgeld Hall . . . one wild, free afternoon when we all drove out Annie Glidden Road as fast as we could . . . a kind of bouncy exuberance bounding around the Norther office when the staff was func- tioning at its best under normal conditions - controlled crisis . . . the day the first proof came back and we all felt like Neil Armstrong . . . all these crosshatched memories are as much a part of the book as the pages themselves. Kudos are in order. I have a wall to wall smile for Larry Bailey, layout editor, who remained calm on deadline days, when I thought, surely, the sky must be fall- ing. Bob Meindl lent a note of stability to the office with his careful work on the copy desk. Jan Dreger, photo editor, who has a funny way of walking and an equally funny way of doing things, still kept photography running smoothly. I thank Mr. Robert LaConto, adviser, for having the wisdom to leave the driving to us. The patience and cooperation of Goff Dowding, Arvin Mineer, Peggy Quist and Max Wheelwright of Wheelwright Publishing Co. was an immense help. Dave Benni and Mary Pignotti, my favorite twosome-yousome, were an immeasurable help on days when deadline panic had reached its height. Adrienne Sohn has the distinction of being the only Norzher section editor to have all her pages done early, and still not blow her cool. Linda Cowie, special essay and introduction editor, took our theme, 'fDirection '70', and made it a beautiful reality. Sam Kassakoff, of Apeda Studios, is one of the most personable photographers going and succeeded in making our seniors look like people rather than just mere images. All of these people did their jobs and much, much more. The 1970 Norther is a reflection of all the work that went into it. lt is also a reflection of something more - the students and faculty of NIU. They are on the verge of something new, something better, and this is what Direction l70 is all about. Involved in the process of molding a new concept of social reality, they are becoming to themselves new people, capable of defining new possibilities for a world of tomorrows. Cindy Westbrook X Executive editor X 1970 Norther ,tunic W' ' sm 1 ms 5 c 1 v V 'lmao no '
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
