North Fort Myers High School - Lance Yearbook (North Fort Myers, FL)

Text from Pages 1 - 304 of the 1982 volume:

JFTRJWJ UL U VII. UKJI I lSI TU LN Wl'I J UW II DFI IJIL NIU VIZ. Ckll l'l'il Y - :I I WHEN YOU'VE GCT PPIIlRE IT SHGWS WHEN YOU'VE GOT pride pride pridexpriderlpride pride pride pride pride prid ,X I xr , L J 5 I fi I Q I KN Ui , if GJ N p E X ei 5 Lb 'D A I K., O fx, 5, M .- were I I W I If 5 W Q gk K i, efir I Q- E 1 '55 fail I W Tix, d G' I I fi? I wif ci if -O EIO I f 1 L-I f I ,I E IL ': f CFL! , U I , LV- Q3 FILL B N ry ,i 1 II' ,pq ,M bf GJ ' N I I fi IULIL ,D T9 VII CL V ff I If fl 'TC ' ' , xv X , 4! J ,3 . w I XAKAF I V TQ Q. an p H vivo E Qi? we Q, 72 iii? ragga We if ri irrefee 5 GQ 5. 5 5. fa' Sride pride pride pride pride pride pride pride pride pride JHEN YOU'VE GCT PRIDE IT SHOWS WHEN YOU'VE GOT PR IT PRIDE IT SHOWS WHEN YOU'VE GOT PRIDE IT SHOWS 2 de pride pride pride pride pride pride pride picgpride il: p Q I is if '4 it P f I ra IW E GCI 695 VIII QTTJGGQQQLZSS E: III I JQQ Wim fin? new 2 Ig! I Kjavflji 2' 'U iw W I diese 2 3 It iffqefsffm Sf wg o pride pride pride pride pride pridem 5, .g YOU'VE GOT PRIDE IT SHOWS WHEN .E Z 35 TABLE or coNrENrs 72 ,,, opening ........ 2 O. GJ 3 student life . . . I. 8 Tag events . . . . .20 I I I: orgonizotions .... 44 f T5 5 stcrfflcurriculum . . .74 SEE- underclossmen .... 92 'IS ' TQ I- seniors .... . . 152 PM 0- 8 athletics ....... 180 jg Q advertisements . . .224 rIG pride pride prideE. index ..... . . 274 'RIDE rr sHows WHEN s- Cl0Sin9 Q - . .282 ..,4?a L 2 6 1 I I 3 1 LANCI-31932 3 Volume XXI North Fort Myers Senior High School 1000 Grange Grove Boulevard North Fort Myers, Florida 33903 ' - 4 i':'Lf iii, - ' -I --:Efffz.ff.21?hisK1:+i':Seal-5221:axial-z2E':-226,'f25:e,.e: . -- f- V V, sefewfev-faawfzasswefaaiiffrffesfzaf:gsfffS1 . . gf-1'-'y,-,Jf'f2?,3ew:f'f ,.-1 , T l-'Ce-w:2w 'w1:.e:.-:'r-A11 of f V '..af1J1P: - will-ff'fa gl fi-P: PRIDE the very word expresses the feelings of the people of the United States of America towards their nation. Wherever we look American pride is evident, from the Lady in the Harbor representing our precious liberty, to the majestic mountains peering over our beloved land. Our founding fathers chose ordinary items from everyday life to create a univer- sal understanding of the ideals upon which our country was built. Old Glory sym- bolizes the American way of life. Its bold colors of red, white, and blue uniquely com- municate a message of courage, purity, and justice. The American Bald Eagle is another symbol of America's pride. The powerful wingspread of this distinctive and rare bird expresses our strength and unityg its daring and courage reflects our historical struggles and victories. America's real pride is more than just symbolsg it is her people. The promise of freedom has attracted people from throughout the world to her shores. They T13 4' V 2 X Opening have arrived with their varied customs and cultures and been assimilated into one pro- ud people - the citizens of the United States of America. We have learned to ap- preciate our people's differences, their in- dividual contributions to our country's heritage. All Americans have helped to build a powerful and respected nation, a na- tion of contrasts but one with a single pur- pose, Liberty and justice for All! From the moment Ronald Reagan was in- augurated as the 40th President of the United States, he has dedicated himself to the reaffirmation of the national spirit and pride among the citizens of our country. His faithfulness to our basic principles and his firmness in following the Constitution have served as examples to all the people. The students, faculty, and staff of North Fort Myers High School share this imm. ise feeling of pride and love for our country t id her people. Proudly we raise our voices 1 echo the famous words: God Bles. America, Our Home, Sweet Home! 1 l l . QP! .fa WY' .ldv ,T I Ja J. t I ' if gg, ff' :ft t M 1' 1 - Lee County's Iwo lima Statue is one of three in the United States that honors those who have fought for their country's freedom. 2 - Power is achieved through unification. 3 - Ronald Reagan, the 40th President of our United States, speaks for peace throughout the world. H HIGH 6 4 - America's national bird, the Bald Eagle, represents Liber- ty, Freedom, and Iustice for All. 5 - O, beautiful for spacious skies, for amber waves of grainy For purple mountains majesty, above the fruited plains , . 6 - North High's ROTC is one of many across the nation, who raise their flag daily with pride and dignity. Opening X 3 Bursting With Progress Travel brochures describe Southwest Florida as a tropical paradise. Lee Countians point with pride to their magnificent sunsets, stately palms, beautiful beaches, and sparkling waters. These fac- tors attract thousands of people yearly and continue to make Lee one of the fastest growing areas in the country. Lee County is bursting with development. Everywhere land is being cleared and buildings of various sizes and shapes take form. Developers provide multiple hous- ing alternatives and are bringing shopping centers and banks into local neighborhoods. Residents of North Fort Myers 4 5 , are proud of their growing business community. There are new fast food establishments, restaurants, supermarkets, special- ty shops, and at long last - a three screen movie theater. Bowling, roller-skating, go-carting, and swimming are finally available on our side of the Caloosahatchee River. Transportation in and out of Lee County has always been a pro- blem. With the completion of I-75 and US 41, motoring again pro- mises to be a pleasurable and safer experience. The regional jetport, presently under construction, will open this area to more of the world and allow Lee Countians to travel 6 farther, faster. School and county officials con- tinue to show their interest in the needs of the North High communi- ty. A combined effort by these two governmental bodies has provided numerous recreational facilities. North High students show their in- terest in Lee County affairs by registering to vote and par- ticipating in community, civic, and charitable projects. We are proud of everything we have in North Fort Myers and Lee County and our pride grows every year, week, and hour. With all this pride, we know we are and will continue to be the best. 1 - The Caloosahatchee Bridge is highlighted each day at sunset. 2 - Lee County Supervisor of Elections, Enid Earle, registers Iim Cooper, Kathy Bloomfield and Mary Barnes as voters at her office in the Lee County Courthouse. 3 - The most recent addition to the Dunbar Community, the First National Bank is being constructed on Anderson Avenue. 4 - The ever-growing North Fort Myers area finally acquired its own public library. This facility will aid all residents in broadening their cultural horizons. 5 - True to the Democratic system, our Student Government President Tara Max- ey, confers with Lee County Superintendent of Schools Ray Pottorf, over matters of student concern. 6 - Answering the mandate of Congress, Robert Carrillo, Chris Woods, and Iackie Dixon register for the draft at the North Fort Myers Post Office. Opening X 5 1 6 X Open ing Red Knight Mania From the second North High students pour onto campus before dawn, until their last class ends, their school spirit soars like the eagle that represents our whole nation. Red Kni hts demonstrate their national pricfe as they stand at attention in homeroom each morning and listen to the national anthem, recite the Pledge of Allegiance, and bow their heads for a few moments of silent meditation. This same pride is evident at home football and basketball games as both fans and opponents partici ate in singing the national anthem before the competition be ins. Red Knights express sclgiool pride in many ways. During Homecoming Week students and faculty participate in a variety of events that build up enthusiasm for the big game on Friday night. Classrooms, allways, offices, and windows repeat the message of North High's confidence in their team's ultimate triumph. This type of spirit exists throughout the year. Red, white, and black banners hang on the walls before all athletic events to assure everyone that North is iii in all sports. Every loyal Knight owns at least one piece of red clothing that they proudly wear on spirit days. Nothing is more inspiringlthan a sea of screaming red-s irted fans at a pep rally, competing for the spirit stick, and urging the athletes to victory. Spirit and ride are part of the daily life at North. Everyone is extremely helpful and willin to extend the hand of friendship. Different clubs and organizations take advantage of the patio area, cafeteria, and hallways to entice new members and 4 advertise their projects and purposes. Agricu ture classes elp beautify the campus by planting flowers, trees, and shrubs and distribute potted plants to classrooms and offices to bring nature indoors. Even as inflation caused the price of school lunches to jump to 81.30, the spirit of North's students was not diminished. Many coped with the situation by brown bagging and a few added a touch of humor by carrying Star Trek, Rocky Roug-lhneck, and Holly Hobby lunc boxes. The North Fort Myers campus is home to over 1,500 students for six hours a day. It may not be new, but over t e twenty years it has existed on Orange Grove Boulevard, our beloved Red Knight Country has become an important part of the community. .1-rl 1 2 t l'1'.r',:.:.L,- .11 V- i :.-A s ' i... . 1 ' 3 , 6 1 - Lee County buses await the final bell. 2 - Lunch boxes make their comeback at North. 3 - Adorned with Red Knight finery, Louise Adams states North is 111. 4 - Loyal Knights of all ages stand at a football game for our National Anthem. 5 - I pledge allegiance, to the flag of the United States of America 6 - North students socialize and grab a bite to eat in the cafeteria. A ' ful ' X PRIDE PRIDE PRIDE PRIDE PRIDE PRI P3 de 'fe student life ' e DE PRIDE PRIDE PRIDE PRIDE PRIDE PRID udent life student life student life student PRI stu nt I1 student I1f in X Cgtudent :life student life stI1dent life st PRIDE PRIDE PRIDE PRIDE PRIDE Life , IE PRIDE PRIDE PRIDE PRIDE PRIDEPRI p student life student life student life 'U FE CD gg EI 5 E :f D FDR FJ 'U student life student life E 5 PRIDE PRIDE PRIDE rn LTJ P E E as H rn.. I C7 pq if e 'P' E LTJ f-I E P-PQ -E ga P EJ . Cn E ,lent lIfe student Q., RIDE PRIDE PRIDE Student Life North Hi h students may all engage in similar routines under uniform re ulations during their six hour school day, but when tlgie final bell sounds to end the day, their interests and activities are as varied as the atterns and colors of a kaleidoscope. Many are invoqved with campus activities such as clubs, organizations, and sports. Others pursue off campus activities that lead them into challenging fields of per- sonal satisfaction and development. Our ample sup ly of sun and water even affect Red Knights differenfly. Strenuous pastimes like sailing and water skiing compete with the lazy life of sunning on the beach or fishing from the Edison Bridge. Daring, concentration, and skill are the prime pualities needed by our more adventurous peers that ind their energies directed toward 4-wheelin and bull riding. Traits of endurance, stren th, and deter- mination are developed and perfectecf by those who prefer long-distance running or body building. All teenagers today seem to need more and more money to finance transportation and social events. In order to afford these luxuries, North students take a variety of jobs ranging from bagging groceries to cookin burgers, mowing lawns to moving furniture. Nortlfs students, like all teenagers, have been stereotyped because of their blue jeans and loud music. The truth is there are no two students exactly alike. Each is uni ue, save for the way they unite in the spirit of the Rez Knight. Std tLf X9 Knights on Location In between the two school years there was an explosion a summer explo- sion. Individual enthusiasm sparkled through the hot summer air in Red Knight country. Under the shining sun, different interests and activities kept Red Knights on the move. They desperately attempted to cram their summer dreams into the few short months. Some fortunate North High students discovered the adventure of traveling across the open seas to foreign coun- tries. France, Sweden, Venezuela, Ger- many and Egypt were just a few of the ports-of-call for these wandering Knights. The student who couldn't find time to travel was still not idle. Everyone knows that going slow just isn't the Red Knight 1 - Tennis has become quite popular at North High as Tom Montefinese demonstrates at Rivers Trails tennis courts. 2 - With the addition of bumper boats at the Shell Factory, North students find a wet and wild way to spend a Saturday after- noon. 3 - Setting sail for a pleasant afternoon on the Caloosahatchee River are Christine Gartner and Steve Hurley. 4 - Music follows Brouth Har- ris throughout Red Knight Country. 5 - An outstanding Red Knight swimmer Debbie Siltzer displays her many trophies and awards by the pool. 10 f Student Life Style and to prove this many North students have entered the World of Wheels. Cycling or just cruising were the most common, but 4-wheeling has quickly gained in popularity. A few more daring Knights hit the speedways in go-carts, stock cars, and motorcycles. Small wheels also keep North students in the fast lane. Roller-skating, long a favorite pastime, became even more accessible as a new roller rink, the Palace, opened on US 41 in North Fort Myers. To make all this motion more en- joyable, an item was borrowed from our northern big-city cousins, the Ghetto Blaster. This large, portable stereo- radio soon surrounded North students with music as they moved through the hot days and nights of summer. T2 fn., 1 i , i vu-wif, In --- ' 1 . L- X, 1 --0 ,, . , K. vmnsp-.m5::u . . 1. 1... .. -'A -r Q ----mu-fx-L--f r . Tiirx- -A- was-41.-..,w. ..-., - , : ' J u KJ' ' 'XMI iw ' L sw ' .- ' - 4 5 - .i..,Y- ,-,NH ' 4 Qi 3 J V. Student Life f 11 The Active Set North students expand their horizons through many different experiences dur- ing and after school. They engage in ac- tivities that challenge them, entertain them, and help them to succeed in life. Personal satisfaction, group recognition, and scholastic awards can all serve as in- centives in their quest for individual fulfillment. All teenagers appear to be constantly in motion. Their unlimited energy keeps them in the center of a whirlwind of ac- tivities. Some attempt to channel this energy into the field of physical competi- tion either as members of North's athletic teams or as individuals, competing against others or oneself. Physical fitness has become the by- word. The urge to be one of the slim and beautiful has served as a motive to some Red Knights to begin jogging, play rac- quetball, learn aerobic dance, lift weights, and - diet, diet, diet. Students attending classes at North High often find themselves developing intense interest in certain aspects of their academic Work. As these interests take root, many develop into full-time hobbies and career-orientated projects. Those whose future plans include higher educa- tion often find scholarship aid in these specialized areas. ,ef Q Va--V 1 ,. :Sq The world of entertainment has beckoned young people throughout time and North students are no exception. Talent abounds in the fields of art, music, dance, speech, comedy, and dramatics. Many already use their talents to provide others with pleasurable moments and themselves with the magical sound of ac- ceptance, applause. Animals of all kinds serve as pets for teenagers today. The macaw, wolf, monkey, snake, and skunk have joined the cat, dog, and horse as man's best friend. As North's teens learn to care, and handle their animals, they learn love, pa- tience, and responsibility, traits needed -Q .iaifaf-m-J.-fa ' - 1 3 12 X Student Life H Hs. , ,, . 'S' f 45: , im. . 3' ',- 2' ',3,gu : f, , Lf? '5 Lf ' - 'L ' ' 12.41151-f23,f4:':',gfQ , 1f,g.1i W ' - gg. ' 912 ..:g if 5' ,f 11' - '::,1, , iff 3511,'if-.TKQQQEE1 1- 1 'R' J WQ151 11-11+ if ki: 1 45, gg 21+ Y 4 1 1' -. ,, ,i.',:e'A . ' AAAA L : ,:,.f,,a-wx-fe ' 1 3 . 'T' ' , ,,., , , .M . , . .,.:'w,, ,Q ff., J ni I 1 f, jf X, -. J E dv 4 ff PQ-Q 2 1 - As if peering into the heavens to find the endless mysteries of the earth, Pam Oakes intently studies the stars for the answers. 2 - Athletics is not all smiles and victories. Eddie Brown grimaces in pain due to an injury sustained during the annual Red and White football game. 3 - Still another form of competition exists here at Fort Myers. The annual World of Wheels lures Neal Trombley to maintain his truck in top notch condition with hopes of taking first place another year. 14 X Student Life . The Active Set in all fields of endeavor. The search for excitement and adven- ture has led many Red Knights into ag- gressive activities. Some students have been enticed by the challenge of con- quering the heavens and engage in fly- ing, ballooning, and parachuting. Others have turned to the rodeo circuit where danger and the thrill of competition led them to barrel racing, bull and bronco riding, and bull dogging. Still others pursue the sport of racing, on land in stock cars, go-carts, and motorcycles, and on the water in speedboats and sailboats. Whatever the activity, it is the thrill of danger and the conquest of the unknown that keeps them striving to perfect their individual skills. A large majority of students at North High School find it necessary or advan- tageous to seek employment after school and on week-ends. Often some obtain positions that allow them to become familiar with a particular field in which they have an interest. Other positions permit them to gain a variety of ex- perience to assist them in obtaining employment after graduation. These jobs can vary from answering phones to pumping gas, from counting money to delivering pizzas. Whatever the posi- tion, these employment opportunities can be very helpful in gaining ex- perience in today's fast-paced world of work and help students move into the future. 5 4 - Expressing martial arts through the exhausting per- formance of Tai Kwon Do, Andy Iohns has become a familiar figure at North High. 5 - Most of us don't know sodium triphosphate from zinc iodide, though there are exceptions. Lynn Pepkowski was awarded an eight week chemistry scholarship for the summer session at the University of Florida in Gainesville. 6 - Clowns for Christ add humor and entertainment to their strong dedication to their religious beliefs. Performing with a troop from St. Michaels Lutheran Church, Nick Cooley, Pam, Kim, and Sue Clouse visit various homes and hospitals in Lee County. Student Life f 15 1 - Mixing business with pleasure, Rueben Garces and his band do gigs for fun as well as the profits. 2 - Always prepared for any emergency, the Bayshore Fire Department and Paramedic Team still finds time to encourage students such as Scott Luders, who har- bors the desire to help people in dire need. JN' 1215-11 Sig We lil gg f f5f2'3 3e. 4 '- 3 ' ' - ' , ,.1- -f -- 1'-1 f : 7571i5.59 ,'fi,?Q,?f:tfiJa53f'L fl ' v ,-Kg' V15 ffl? ' A , P- , , .-- -'- - - 1 - ,- - s-.- rw ETH f '.. ,JI-' ,Eli V V .f J' Q:'Ei'v,3?'! .s sw ',f1FfJ '1,.E5iSEf:' 3 .1,4-q'j'SgJ- 5.5-57: ?'i 12:52 Td:h.1Q?,Q ,ISCS1-,T'2'1f QQ,-55' J-gafjg-113535 Lax: 5-Us J,1l,,:, QT5f3Lg,i'5-fri -ig, - ' a ,' 2 16 X Student Life 'R 1 - Rita Scott and her co-worker, Todd Krishbaum, give Wendy's customers no reason to go any place else. 2 - Meat cutting can be a risky business without the experience and knowledge which Bill Collins obviously has. .ww ' J-95 I ii Working Da and ight Dolly Parton may sing about working nine to fivef' but for many North students their working day begins after 12:00 noon and goes on till the wee hours of the morning. Like most teenagers, Red Knights seem obsessed by an uncontrollable desire for money. Car payments, in- surance, and the price of gasoline and car maintenance, make it impossible for a student who wants wheels not towork. Although they go to school four to six hours a day and work, the majority of teens still take advantage of whatever free time is available. Whether they relax at the movies, rollerskate, or just cruise around, it still takes money. Of course, we c,an't forget our ward- robes. Fashions change at least twice a year andwith the high price of clothing, a teen who wants to be in style, finds there isn't much money left for anything else. Whoever said education was free never attended school today. There may .L..g4nl not be charges for the courses taken, but often there are laboratory fees, material fees, or breakage and insurance fees. Who doesn't want to take advantage of some of the extras, such as spirit rib- bons and tickets to plays, athletic events, concerts, or dances? When you arrive at the pinnacle of your high school career, your senior year, the need for money becomes even greater. There are com- mencement caps and gowns, an- nouncements, and calling cards to pur- chase and the yearning to participate in those high cost events such as Grad Nite, the Prom, and the Senior Bahama Cruise. Some students work to meet their family's needs instead of their own. As prices increased rapidly, many were forced to supplement the family income, often becoming the sole bread winner. Many Red Knights prefer to volunteer their time at local hospitals or with charitable organizations. Their main Student Life X 17 Working reward is the personal satisfaction they gain from helping other people. Whatever the incentive, work is an important part of the high school stu- dent's world. Without careful budgeting of time and energy, they find their par- ticipation in school activities and sports limited. Red Knights find employment all over Lee County. They may clerk in stores, fry hamburgers, bag groceries, lay pipe, wash windows, deliver packages, or pump gas. Some even discover more unusual and challenging occupations as musicians, butchers, paramedics, or a veterinarian assistant. From the moment North High students open their eyes each morning until they close them again at night, they are constantly on the move. Their endless tide of activity keeps them in the main flow of life. As they touch all facets of their existence, these ex- periences will enable them to look back on their high school days with fond memories. 2 18 X Student Life it! 1 f, ,-ff!! sl 3 4 W as w an an 5 1 - Ina Cooke helps Ronald McDonald please his customers. 2 - Pine Island Lumber worker, Mark Ieter, helps put plywood on display. 3 - Ever wonder where all those flashing bar- ricades that are all over town come from? Albert Iohnson from Bob's Barricades constructs them at his after-school job. 4 - Serving it up in style, Rick Botelho, hands it over to the guests at Mariner's Inn. 5 - Mary Massoth adds money to her pocket while learning more about modern technology. Student Life X 19 PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRID events events events events events eventst I 1 I. rmuL I-mul: rmul: rmulz r-'mulz r'lXlLJl: rmull r'l'xllJl: ENTS EVENTS EVENTS EVENTS EVENTS EVENTS EVENTS EV 2 I - events events events events events event PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRID 4 I PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE events events events events events events K TITS events events PRIDE PRIDE PRIDE FD 4 FD 3 '-I' U3 af -IGF' fb 4 FD 2 U3 EVENTS EVENTS EVENTS gf PRIDE PRIDE PRIDE PRIDE CU Events Ll.I if Q Throughout our life, we are affected by C m everything around us. World events and political GJ D- leaders, top movies and local happenings, school 5 activities and friendships, all occupy special places in our memories. GJ Ll-I The year 1981-82 was one of turmoil and triumph for people all over the world. We were shocked y in Q the assassination attempts on our President and 4- E Pope Iohn Paul II, angered by the kidnaplping in C Ita y of General Iames Dozier, dismayed w en the Q. Polish Communist glovernment dec ared martial GJ law and took away t e rights of the Polish people, 5 LI-I saddened by the multiple deaths resulting from the GJ Florida Air Lines crash in Washington, and thrilled Q by the successful flight of Space Shuttle Columbia. E Silver Screen smashes and the popularity of jf HBO enlivened our evenings and week-ends. A C' Q. new roller-rink in North Fort Myers, the Lee Coun- ty Fair, the Edison Pageant of Light, and the con- gj Ll-I certs at the Lee Civic Center kept us involved in community events. GJ D Endless Love by Diana Ross and Lionel Ritchy, ' and Kim Carnes' Bette Davis' Eyes both held 111 m on the charts for many weeks, while anything coun- jf Q.. try continued to be a top seller. T.V.'s soaps grew in C popularity as students rushed home after school to watch the latest episode of General Hospital. GJ LL' At North High Homecoming highlighted the fall P season with its multiple activitiesg spring brought GJ Q the Prom, Crad Nite '82, and the Senior Trip to the Z Bahamas. Each day at North will be remembered D- by some student as an especially important one in his or her life . . . because it is here that friendships are begun, love stprings into bloom, challenges are encountered, an another link is forged in the memories of our life. EV Ilcld HCI Ilcld EICI Ixdcl EICI lldd EIC CD 3 ,-.- In X lv I4 School Da s . . . Golden Moments The beginning of any school year is a time of anticipation and excitement. Although many students refused to admit it, a summer away from their friends and from the campus routine, had begun to pale by the time the end of August arrived. Teenagers glowed under the welcoming cries of their friends and acquaintances. Even the minor in- conveniences of confused schedules and elongated homeroom period couldn't dampen their spirits. They rushed towards each class, eager to discover who would occupy the other MW seats and share in new learning experiences. North High lives because of her .W students an staff. Without these peo- sawed ple, she is merely an empty collection of rooms . . . silent, uncaring, and un- productive. Each person who has stepped upon the campus has helped f to create a bond, the unity of oneness df' that is called Red Knight Spirit and Pride. f X 'Sl Q :ml . .j,!.32l'35' A .L w V 'u yf My 'I'tl3E'ii,,1-fff f SCH00 1 - Bus 80 arrives early in the morning at North Fort Myers High. 2 - Students pour from the buses at 7:25 a.m. and greet their friends who they have been separated from over the summer. 3 - Passing from one class to another allows students to engage in a few minutes of friendly conversation. Z2 I Events 3 1 - The counseling staff at North High deals with the momentous problem of arranging and changing .fi '1'1 5 schedules at the beginning of the school year. 2 - A , lull in the scheduling routine gives Ms. Terry A Wieland a chance-to talk to her associates, Mrs. Iune Herrell, Mr. Bill Bauman, and Ms. Melody Mitchitell. - AW' WWW MM' Maud, ,qw if MMV' W A,gqw0 awwwww MMM!! WASHINGTON President Ronald Reagan being shoved into a limousine by Secret Service agents after being shot outside the Washington Hilton Hotel on March 30, 1981 Six shots were fired, one penetrating the brain of Press Secretary Iames Brady, and two others hitting a Washington police officer and a Secret Service agent Iohn W Hinkley, Ir , 26, son of a well to do oilman from Evergreen, Colorado, has been charged wlth the shootings Events X 23 af '. .Wfffg f 1' iw 7 V. f Y f I L, '. f- y' 5 , 0. ' , I X V M4 f, it W M, I ,V 4 7 f My , V X V 4-,fwww f ' l , M 7 f ,,,, f ' ' if 7 .MW , M . ww, f V , f ' I 9 MW ' . ' f ff ,MM . . ff .f ,, W A ' fy -'ff f-1 W I .M H MM. W f ff . f, , U WW ,,,. . f ff I M,wrff'0t' 1 ff 7 I .. fff f M , 5, f f I , , , I 'W' e 4 1 f .Z . Ji- ff . . . . . . . Campus Under Cover Many things happen at a busy high school at the same time. One look at North's weekly activity schedule proved this. Clubs, organizations, and teams vied for participation and support from the student body, staff, and community. At times certain areas of the campus seemed overburdened with multiple activity. During the year the North library often served double or triple purposes. Not only did class groups use the facility for research, but on election days, pollworkers took over the west end for voting procedures. On one such day in early November, scholars and voters had to compete with 2 1 - North students line up to purchase photo packets from LANCE staff members prior to having their pictures taken. 2 - Lisa Adams makes sure every hair is in place before going in front of the camera. juniors and sophomores decorating doors with their Homecoming artwork. Another popular place in Big Red Country was the gymnasium. P.E. classes often competed with preparations for a pep rally or assembly. The lobby of the gym became a photo studio three times during the year as students posed for class or graduation pictures. No one at North has sacred areas or positions. In order to educate the whole student, every nook and cranny is utilized from pre-dawn to late evening, and personnel double as coaches, advisers, and fee collectors. YM? 4 3 - North freshmen find plenty of opportunity to practice patience while waiting for their turn with the photographer. 4 - Connie Iocke lines up on another smiling North face. 5 - LANCE Business Editor Pam Clouse assists Bryn-Alan photographers in making sure every student is properly identified. 24 f Events 1 f Q f li . M f. ,W .f ' t I -f 'g5,,ff.,,z,,..51,3,.. , V. ,. 22? 15 ., , . 6 .,.f H . f V A' If ' ' f X . ROME: A handgun, circled at left, is pointed at Pope Iohn Paul II during an assassination attempt in St. Peter's Square, May 13, 1981. A Turkish terrorist, Mehmet Ali Agca, was sentenced to life in prison, the maximum under Italian law, for the shooting of the Pope and two American women. X wa! 1 - Lee County's Precinct 30 takes over North High's Library during election times. 2 - Election workers, while waiting for voters to . cast their ballots, watch juniors decorate the front library door for the approaching Homecoming week. 3 - Mrs. Barbara Vagle, Library Aide, assists in the collection of fees 3 and fines at the end of each grading period. Events X 25 1 - The members of the Red Knight family joyfully acknowledge the return of the magic pigskinf' 2 - Slimy Green Alan Saunders gets a word of encouragement from a member of his swamp, lack Bovee. 3 - The Good Guys in the Red Hats point the way to a Red Knight victory. -10.4 2 26 X Events UNITED STATES: Early in 1981 a puzzle craze swept across the land. The Rubik's Cube was seen in the hands of young and old, as it was twisted and turned to make solid col- ored sides. Invented by a European, it has become America's newest mind boggler. 4 3 . may , ,.,,,,K,,.,,s,.g.. A ,H k.., X 5,-,om ' Homecoming Highlights The fun-filled and memorable 1981 Homecoming week offered all types of activities for North students to participate in and to enjoy. Monday festivities began when North's halls turned into a veritable history book. Cavemen, colonials, flappers, and greasers filled the places normally held by our modern teenagers. Tuesday, Punk Rock Day, offered spirited Red Knights the opportunity to don black glasses, wild make-up, and garbage bags as they pogoed to the sounds of Devo and Blondie. On Wednesday students sported red, white, and black colors and wild chapeaus for the traditional Shorts and Hat Day, otherwise identified as Field Day. The in- teresting thing about Field Day this year was its settingg it was held in the halls as opposed to its tradi- Mother Nature have rained on our tional site, the stadium. field of play, but didn't dampen the Red Knight spirit or morale. Thursday saw the school draped in white as Grecian gods and god- desses sporting modified sheets flowed through the halls, toasting victory and eating grapes. An event filled Friday kept all participants on the run. A tremen- dous parade, topped off by a skit- filled pep rally at the stadium, got everyone ready for the big game that night against our arch-rivals, the Green Wave. Though in score-board points we trailed, we pulled through triumphant when Fort Myers was found to have played an ineligible student. Homecoming festivities were climaxed on Saturday night with an original and stunning ball held at the Elks Club from 8:00 p.m. to midnight. Queen Frazier and King Sweeney reigned over this final evening of our Endless Knight. 2 3 Oropallo, ,' fi A l 1 - Punk Rockers Rick Morales, Heidi Tietjen, Robin Mandy Smith, Wendy Kelleher, and Sylvia Freeman, take a few moments to pose for the LANCE photographer. 2 - Iuniors Laura Davis, Dawn French, Debbie Bradley, Pam Boyette, and Patti Trealout adorn- ed themselves in the hottest punk rock fashions. 3 - Principal Ed Stickles enjoys a ride in the rumbleseat of a vintage vehicle, chauffeured by Mrs. Linda Fowler. 4 - The First Annual Legs Contest, sponsored by the year- book staff, gave everyone a chance to ogle the legs of North's masculine population. Events X 27 Regal Ro alt The crowning of the Homecoming Queen and King is perhaps one of the most memorable oc- casions of any school year. This important evening in 1981 began with the display of floats for the Homecoming game crowd. Classes and organizations displayed con- test entries that their members had worked on diligently with high hopes of placing in the com- petition. Chauffeured cars cruised intermittently around the track carrying the couples of the Homecoming Court. Preceding the annual Homecoming football game, the Red Knight Band lined up across the field with the Flag Corps forming an archway through which each Homecoming Court couple made their triumphant entry. As each couple ap- peared, their names were announced along with the class they represented and a small sum- marization of school activities and future plans. As always the final announcement of the King and Queen was met with thunderous applause. The 1981 Homecoming King and Queen were Greg Sweeney and Kristy Frazier. 1 1 - The 1980 Queen Barbara Gurgol adjusts the royal robes of her successor, Kristy Frazier, while the newly crowned King, Greg Sweeney awaits his royal partner. 2 - North High's 1981 Homecoming Queen and King, Kristy Frazier and Greg Sweeney. 3 - The 1981 Homecoming Court poses for their official portrait with the 1980 Homecoming Queen and King, Barbara Gurgol and Mike Scott and North High Principal Edmund Stickles. 28 X Events 3 Senior Representatives Senior Representatives Senior Representatives Mike Greenwell and Kim Hughes Linda Drew and Dusty Boyd Zona Henry and Parrish Hill i r i 2 i S 1 Iunior Representatives Iunior Representatives Kim Kibler and Ioey Cross Shawn Smitter and Cathy Kubesh Sophomore Repfgsgntatives Freshman Representatives Ioe Flinn and Susan Penpell Mark jenkins and Tiffany Touchstone Events X 29 Formal Fun At the end of Homecoming Week, the big moment arrivedg one that all Red Knights had been anticipating for weeks - the Homecoming Dance. The '81 Ball was held on November 8 at the Elks Lodge in Fort Myers from 8:00 p.m. until midnight. The theme Endless Knight was ap- parent throughout that building due to the many decorations SGA members spent hours constructing and installing. As the evening progressed many Red Knights were seen doing their thing to record music provided by the 97-Rock Disc Iockey Tom Trumbell. For hours the fun radiated through the building. When the dance came to an end, the tired Red Knights hopped into their cars and sped home, across the river to the land of their pride - Big Red Country. The Homecoming Dance was surely a night to remember, an endless night of fun. , L ,ff 2 1 - King Greg Sweeney and Queen Kristy Frazier reign over the Homecoming Dance. 2 - Sophomores Ina Cooke, Kim and Sue Clouse, and Dana Cooke present their tickets to Kim Bitter so they can join the Endless Knight. 3 - A slow dance brings romance to North couples. 4 - Troy Simons and Michelle Kittle enjoy their first formal dance. 30 X Events 3 1 - Dancing up a storm, Mr. and Mrs. Bohannon move across the dance floor. 2 - Queen Kristy Frazier shares a few quiet moments out of the spotlight with her date, Iohn Rummans. 3 - Knights gettin' it down at the Elks Lodge during the 1981 Homecoming Dance. 4 - 97-Rock Disc Iockey, Tim Tromble, spins the discs so students can dance the night away, Q 2 V' xi g-. u 1. fl ,Dil 'xp' ii l LONDON: England's Prince Charles and Lady Diana Spencer, his new Princess of Wales, smile and share a private moment as their carriage draws away from St. Paul's Cathedral shortly after their wedding on Iuly 29, 1981. Events X 31 1 - Horse and rider became as one as Lana Flint skillfully rounded the corner striving to cut her time in the Barrel Racing Contest. 2 - Participating in the Grand Entry for the North Fort Myers Chapter of the F.F.A., Iulie Barber and Robyn Bowker carried the banner while Shirley Stewart followed with the flag. 'fini A wwf! 'H nr-v-M-ww ,, an ,mm-, unnwn-qw ,,,,,,,, ,Mena av 4-.M-H... wal 2 3 3 - Coming out of Chute 111, Robert Pohle pitted his skills against the brute strength of the bull. 4 - North's Tracy Mann centered her concentration on her upcoming bareback ride. 32 X Events ,....ll1 W.-u--4...-K Mlm 2 E 1 2 N 4 lui as A .,,. p Xl: , The Buck Stops Here! The Lee County Sheriff's Posse Arena was full of spirit and excitement on December 4 and 5 when the North Fort Myers Chapter of the F.F.A. sponsored their annual rodeo. Cowboys and cowgirls from all over Southwest Florida gathered to compete for prizes in different events. Bareback Riding was a popular event for both males and females. To qualify, all contestants had to ride for 8 seconds from the time the horse left the Chute. The main difference was that girls were allowed to use either one or two hands to grip the rope, while boys were restricted to one. Any rider was disqualified if his or her hand touched the animal. Team Roping called for real cooperation between a pair of riders. The team was on- ly allowed three throws, and time was taken when the steer was roped, head and heels, and both horses faced the steer with ropes dallied and tight. Barrel Racing and Poles were exciting events for the ladies. Riders and their steeds raced against the clock as they ex- ecuted the necessary patterns in the cor- rect sequence. A knocked over barrel or pole cost the rider a 5 second penalty. Only the bravest cowboys entered the Bull Riding competition. They were al- lowed to hold on with only one hand and had to ride for at least 8 seconds to qualify. If the rider touched himself, the animal, or the equipment with his free hand, he was disqualified. Raging, bucking, and twisting, these giant animals did their best to rid themselves of their unwelcome burdens. In Goat Tying, a goat was secured to a stake 100 feet from the starting line. A cowgirl on horseback raced the distance, dismounted, and threw the goat, tying three of its legs together. The legs had to remain crossed and secure for 6 seconds. The final event of the rodeo was Steer Decorating. It involved a pair of con- testants and a steer. The obj-ect was for one of the pair to hold the steer by its horns, while his partner tied a ribbon to its tail. The rodeo was a tremendous undertak- ing for North's F .F.A but well worth the ef- fort. Intrepid cowboys and cowgirls pitted their skills against seemingly insurmoun- table odds to thrill and delight the audience. ,df W, 3 1 - At full gallop, Tracy Cannon and her horse executed the complicated pattern in Pole Racing. 2 - Team Roping requires lots of patience and coordination as Arcadia cowboys, Tom and Iohn Lipe, demonstrated at the F.F.A. Rodeo. 3 - Par- ticipating in perhaps the most humorous rodeo event, North's Rick Woodall and Riverdale's Bupky Tipton tried to tie the ribbon on the steer's tai . Y VV Mk . rf., .5 Q. , gf 4. Q4 -. cg Events X 33 va 11: pv' EGYPT: On October 6, 1981, as Presi- dent Anwar Sadat of Egypt and a large number of his cabinet were watching Egypt's Armed Forces Day Parade, four men in military uniforms jumped from a jeep and began throwing grenades and firing automatic weapons. President Sadat's resulting death shocked the world and threatened to disrupt the already shaky peace in the Middle East. The captured assassins were identified as Islamic fundamentalists opposed to Sadat's overtures to Israel and the West. .gl Y 'iw 34 X Events Ile m,,ew 1 - Pam Boyette practices life-saving techniques on Annie, 2 - Under the supervision of CPR Instruc- tor Debbie Henzler, Warren Williams searches for the pressure point on the model's neck. 2 4- Assorted Flavors of Life Savers On October 28 and 29, sixty students participated in a CPR course. The course lasted four hours and was given by three paramedics, Richard Burgquist, Bob Macko, and a North High graduate, Debbie Henzler. ' During the course, the proper methods of Cardio Pulmonary Resuscitation used on heart attack vic- tims were demonstrated and practiced. The students were required to take a written test and CPR technique exam using the mannequin, An- nie. Sixty students participated in the course and fifty-six became certified. Two other participants had already received their certification before the course was offered to North High students. Towards the end of the CPR course, the par- ticipating students were shown methods of reviv- ing a choking victim. Students who participated in the course are able to take care of any emergency situation and would definitely be a safe date on any weekend. L 4 1 - Using the CPR technique, North students learn how to help save lives. Z - Scott Sushil pushes on Annie's chest to keep her breathing. 3 - Often a thigh pressure point is difficult to find as Yolanda Iohnson discovers during her CPR training. 4 - Doug Edlund makes sure Annie is breathing and has no obstructions in the throat. Events X 35 I , anim 3 1 - The sun and water attract thousands of vacationers Gulf-side each year. 2 - A typical condo where people from all over the world can enjoy vacation-by-the-slice. 3 - The Estero Island Beach Club is just one of the many interval ownership con- dominiums available in Lee County. 4 - You can easily enjoy the comforts of home while vacationing at the beach. 5 - The Beach Royal Club sign welcomes vacationers to fun and adventure in Southwest Florida. 36 f Events Z ,V 5 27 if fw .X M 'MW 1 A ' , , if 0 . Slice-of-Life Une thing that every North High student looks forward to is vacation. Whether it's the summer months or the numerous breaks during each year, it is eagerly anticipated time-off. Red Knights enjoy different activities during these breaks. Some leave Lee County for a fun- filled day at Walt Disney's Magic Kingdom or Busch Gardens Dark Continent. Others travel farther seeking adventure throughout the United States and the world. Still others remain at home, enjoying Lee County's famous attrac- tion, the beaches. Most North students who seek fun in the sun on our Gulf beaches, pack their cars with paraphernalia for a few hours of relaxation. A few students though are hitting the beach in a new style, that of interval ownership. Their families have invested in a new concept, vacation-by-the-slice. This new way to enjoy beach living with a minimal investment became extremely popular during 1981-82. People bought into Lee County beachfront condominiums for one or two weeks, or whatever period of time would fit their life style, preference, and pocket book. They could enjoy the sun, the warm waters, and the beautiful beaches each year in the luxury of a beautifully furnished apartment with the resort extras of a pool, tennis court, hot tub, and sauna. With inflation and the continuous growth of tourism in Lee County, this may be the vacation answer for more and more North High families . . . especially if they want to enjoy one week of heaven on the nearby beaches. 'W perse . j,,,, ,,.,,,, M LQCM- ff at I 14, ,.AKR '-5 ww LOCALO N sumti QQKX, NEW YORK: 12,000 members of PATCO lProfes- sional Air Traffic Controllers Organizationj walked off the job on August 3 in a dispute over pay and working conditions. President Reagan gave them one day to return to work. When they didn't, he fired them. Public support was not with the strikers such as Bill Haney and his family, shown here on the picket line at LaGuardia Airport. PATCO predicted dire consequences but with supervisors, non-striking air controllers, and military filling the towers, there were none. By year's end PATCO was decertified as a bargaining agent by the National Labor Relations Board and prospects of the striking controllers return- ing to their old jobs was nil. Events X 37 1 38 f Events f 'f 'fx,wf-..-, f H 2 1 - Even at night cars pack the parking spaces out in front of North High as the community uses the campus. 2 - Coordinator of Adult and Communi- ty Education, Mr. Stan Mulford, works day and night arranging classes for interested citizens of Lee County. 3 - New Knight students register for a nine-week session of classes. 4 - Mr. Tom Pacl, North's popular daytime business education teacher, does extra-duty by teaching accounting at night. 4 - Adults wanting to earn their high school diploma enroll in G.E.D. class under the direction of North teacher, Mr. Mario Verde. 6 - The hallways may look deserted, but the classrooms at North are alive with learning from 6:30 to 9:30 p.m. -M0411-4Y4' if wstexg pf. V. Wiz, 'Mfg ff IWW! 4 in ' f 'MM ,, .. . 'iii' she is 15. he is ll the love every parent fears endlesslovendlesslovendlesslovei i P0lyGram Pictures presents a keith harish-dyson lovell production a film by franco zeffirelli brooke shields martin hewitt endless love shirley knight don murray richard kiley penelope milford bealrice straight based on the book by scott spencer screenplay by judith rascoe executive producer keith barish produced by dyson lovell i directed by franco zeftirelli , nun, 14.1 .... .f:.:sr::sev..'2:LseSs. HOLLYWOOD: Two of the most popular movies to hit the screen this year were Raiders of the Lost Ark and Endless Love. Endless Love was a controver- sial R-rated film dealing with teenage love and sex. Young peo- ple filled movie theaters across the nation to watch Brooke Shields and Martin Hewitt bring to life this modern rendition of first love. Raiders of the Lost Ark, starr- ing Harrison Ford, wasconsidered the adventure epic of the year. Through terrorizing encounters with spiders, curses, snakes, and villains, Harrison as Indiana Iones, searched for the Lost Ark of the Covenant. Both of these films were given 4-star ratings by high school audiences. LL C 'IEEE' 1 nf, i ir I , 6 , l.l1. ' if 'MBV ' s? From the creators of JAWS and STAR WARS comes Indiana Jones. The ultimate hero in the ultimate adventure. Alpine: ' UffhELC'57'l-YRK. , f 4 . 1 'A . at . iifl ' 6 iw .A Lrkl .h 'xg A . - . V.. .F . We 19911 1 J' Q 'mn wh., . ' I y be ,X , fl 6 IT X ' QW! t-27.5-,sg ' f 4' 1 A ' . A 115.5 ,. 'mf I if L ii if 7 .41 I. gait'-..'-I 'tri F , 41, .fi i-cyl. ff- 1 ill Q xxx' 'X . f E 01 ff! DEQ 'H if ' wtf ' ff ff t 5 1 M W' 'ip 11 rfi-MH:-lf 4 'fi -. . ' iAk1'1.- . 1:3-321 . ' SPECIAL STUDIO SNEAK PREVIEW TONIGHT 8:00 PM. HAFTHSUN FURU 'JL55'JllL:N DDUL IQFEMAN PUNALU LNQEY JUHN PWS WHES OENHULM ELUDTT JUHN WLUAMS GEORGE LUOSS HUWI-IRD KMAPUIAN LAWRENCE KASUAN Emil LUULS PHIUV KBUWAN FRANK WIPSPIALL STEVEN SHELBERG mgli' ,l3G.'W WHmAlIsuserrlm 2: Mum Q P' wquftmwmva ..i.s..e-.ii--. ight Knights North High doesn't close as her students and staff leave campus each dayg in fact, another side of North life begins promptly at 6:30 p.m., Monday through Thursday. Classes in everything from slimnastics to Spanish, floral design to Florida Gun Safety, sewing to shorthand are offered through the auspices of Lee County Adult and Community Education. The community education program at North High is administered by Mr. Stan Mulford. It offers opportunities for citizens, 8 to 80, to further their personal educational and recreational interests. Although classes run for nine weeks, this unique night school operates under an open enrollment policy which means individuals may enter class at anytime and work at their own pace. There are two extremely popular programs on North's campus each session. One is the G.E.D. class, which helps adults prepare to take the General Education Development Test, which when successfully passed grants them a high school diploma. The other is the series of high school classes in math, American History, language arts, and Americanism vs. Communism, designed to allow juniors and seniors and adults to earn credit towards their regular high school diploma. One thing that is very special about this school is that the halls are never crowded and there are no bells to direct the students. Mr. Mulford attempts to keep the teacher-pupil ratio close to 1 to 15 so instruction can be in- dividualized and relaxed. The community owns the school .. . with this program, they ' i use it. E vents X 39 Preceptors Many years after students leave North WASHINGTON: President Ronald Reagan and Supreme Court Iustice Sandra Day O'Connor walked outside to pose for photographers after she was sworn in on September 26. O'Connor, a 51-year-old former Arizona appeals court judge, was the first woman to be nominated to the court in its 191-year history. Although the far right attempted to marshall opposi- tion to her confirmation because of a pro-abortion vote she cast as a member of the Arizona legislature, she was approved by the Senate, 99-0. High, they remember with fondness a teacher who took extra-time to be a friend, to give them additional knowledge, to ex- plain a complicated procedure to force them to complete a difficult task, to show them they care about who they were, what they learned, and where they were going. Often when this occurs, the student and teacher have drifted far apart and it is too late for a verbal expression of appreciation. For this reason a group of students at North, the Key Club, attempt each year on behalf of all students, past and present, to say thanks to the faculty and staff for the tremendous effort they put forth. This year these feelings were conveyed at an Ap- preciation Breakfast held on Monday, Ianuary 18 in the North Cafeteria. After a meal of eggs, grits, sausage, and biscuits, and a short program was presented by Key Club officers, Russ Carver, Linwood Schultz, and Iohn Kanell. Mr. Stan Mulford, Key Club advisor, the guest speaker, told of the history, goals, and pur- poses of Key Club and how the Teacher Appreciation Breakfast was a way for the Key Club members to applaud all the teachers for their efforts in and out of the classroom. During the breakfast, nine plaques were presented to teachers chosen by junior and senior students as outstanding educators at North High. These teachers were each designated as a 'Key Club Teacher-of-the- Month. A great way to say a very big thank-you to some very special people. 40 f Events i T 1 - Winners of the 1982 Teacher of the Month awards line up with their hosts, the members of North's Key Club. 2 - Teachers en10y their early morning breakfast courtesy of the Key Club. 1 . .ll wmuu..,, 5 7 9 2 1981-82 Key Club Teacher-of-the-Month: 1 - September, Mrs. Rachel Murray, 2 - October, Mrs. Bobbie Dewey, 3 - November, Mr. George Mayo, 4 - December, Mrs. Shirley Gebhard, 5 - Ianuary, Mr. Leroy Dewey, 6 - February, Ms. Peg Flaherty, 7 - March, Mrs. Carol Pim, 8 - April, Ms. Andrea Getzlaff, 9 - May Ms. Betty Sheffield. r Events f 41 1 - Part of the fun at the Southwest Florida Fair was sampling all the fabulous food. 2 - Bright lights and thrilling rides drew students to Midnight Madness. 3 - Visitors to the fair see through pictures why Pride Is Being a Red Knight. 4 - A variety of daredevil rides invited the more courageous fairgoers. ,1 n 42 X Events 1 it S-.. FLORIDA: The space shuttle Columbia lifted off from Kennedy Space Center on November 12, 1981. This second Columbia flight was delayed several times, and then halted after 54 hours and 13 minutes three days earlier, due to a broken fuel cell. With astronauts Ioe Engle and Richard Truly aboard, the Columbia's two day flight, marked the first successful mission by a reusable space vehicle. W Fair Frolic Cotton candy, a million sparkling lights, and the noise and confusion of the midway, all added up to a gala, week long attraction, known as the Southwest Florida Fair. This yearly event, sponsored by the Araba Temple Shriners, was just what the students at North High needed to add excitement and zest to an otherwise dull january. Upon arriving at the fair, visitors filed through the pavilion housing business, club, and organizational displays. Here loyal Red Knights and their friends could pause and reflect over a beautiful pictorial display of life at North High created by Mrs. Nancy DeShazo, photos courtesy of the Lance. Then it was on to the 4-H building where displays of plants, sewing projects, and other creative efforts gleamed with colorful award ribbons. Each day the animal pens and show ring were alive with excitement as North's FFA members showed animals or judged contests. No visit to the fair would be complete without stopping at the various eating booths. Here sausage sandwiches smothered in onions and green peppers, oriental delights, ribs, pizza, or the old stand-bys, hot dogs and hamburgers, were served as inviting main courses, followed by elephant ears, fat boys, or powdered waffles for dessert. The most exciting aspect of the fair for most North High students was the midway. Whether during the day or evening, or the two special 12 midnight to 5:00 a.m. bargain extravaganzas, called Midnight Madness , the daredevil rides and sideshows echoed with the screams and laughter of happy participants. It may seem like a long time to wait, but we all know we can count on the Shriners to give us another enjoyable week next january at the Southwest Florida Fair. Events f 43 PRIDE PRIDE DE PRI DE PRI DE PRI DE PRI DE DE PRIDE PRI PRI II:- Ie. x O 5 an an :I PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PP. E organizations organizations organizations I organiza U1 C .Q 4- o .51 C o ow L- o LD C M W .Q 4- o .E c: G Q O izations 4 f, W , V A ! .N A. . 5 . ' - ' Aff M - M' '- C , 1, ,- 5. f-4: 'frr-P05-sie-aw s -vw 0 ,,-f Hfm.-Qyqfw Ji , 4, , I., ,, L fra W M: L fyqfyigfjf ,5 . A VL 5M,,7,,,. ,,. ,l I . ff:-sus f .E+ ' iv' ' 5 organizations organizations organization PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE I 4 DE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE gonizotions orgonizotions orgonizotioos 'U IE I LO U 3 I'l'I 5 s any I'l'I 2 orgonizotions orgonizotions iq PRIDE PRIDE PRIDE PRIDE LLI Q S EE C LLI 3 Q O E Ll.l Q V7 i .S Q 4- L.l.I .S Q C 1 83 D.. 5 QJ . . 1 1 orgonlzotlons Q. DE PRIDE PRIDE PRIDE v ......-.4-nlbf Organizations Have ou ever wanted to see some changes made at schoolf but just didn't know how to get your ideas across? Do you wish to be an active member in our class and would like to help get things accomplish- ed, but you don't know who to turn to? Do you want the opportunity to enjoy yourself while learning about foreign cultures? Perhaps you should join one of the man clubs and organizations active here at North Higff. With the variety of groups there should be at least one to spark your interest. Most clubs and organizations meet after school or in the early evening, but some utilize our monthly activity period so students who have limited transportation can also participate. On any given day, long after the final bell has rung, N orth's hallways are still filled with the commotion coming from the supposedly abandoned classrooms that have been converted into clubhouses Iwithout the treesj. The following ages are packed with the pride that fills our school, and on these ages our students are making their dedication obvious they are letting their PRIDE show. O g nizationsf 4 Perspicacious Pupils An invitation to become a member of the National Honor Society has always been an honor. This academically elite group has customarily opened its membership to juniors and seniors with a 3.5 or higher grade point average. They must also have demonstrated outstanding character, leadership, and service during their years at North High, and be approved by a teacher- administrator selection committee. New candidates are inducted in Oc- tober and February. During this initia- tion ceremony, the lighting of the candles occurs, symbolizing the four qualities valued in an NHS candidate - scholarship, service, leadership, and character. North's NHS during 1981-82 was led by President Ed Garner, Vice-President Belinda Takach, Secretary Lynn Pepkowski, Treasurer janet Collins, and Sergeant-at-Arms Lisa Finley. Mrs. Carol Pim and Mr. Walter Skiff served as chapter advisers. The major aim of National Honor Society members has been to promote , I 1 - james Lee gets inducted into NHS as veteran Denise Morgan looks on. 2 - Filling the Christmas box with gifts for needy children is NHS member Lynn Pepkowski. . 3 - Lynn Pepkowski, Phil Baker, and Richard Frank await the new inductees' entrance . 4 - National Honor Society: Sitting - Pam Hagie, Denise Morgan, Kim Kirby, Lynn Pepkowski, Lisanne Banta, Phaladya Dean, Ieri Cunningham, Kathy Kubesh, janet Collins, Lisa Finley, Tara Maxey, Belinda Takach. Standing - Mrs. Carol Pim, Shawn Lingle, Bonnie Bouch, Todd Spurlin, Ron Merritt, Linwood Schultz, Richard Frank, Phil Baker, jeff Hayworth, james Lee, Ed Garner, Manley jaquiss, Karen Tillie, Lynn Stauffer, 46 X Organizations scholarship among students at North High. They have shown their individual acuity by vying for district positions on the Brain Brawl team. Yearly, this team has represented all high schools in our area who compete against other in- tellectual giants throughout the state at the spring convention. The members have also engaged in social endeavors for either fun or profit. Skating parties, bake sales on teacher duty days, and french fry sales during Homecoming have proved that even the main brains can have fun while being spirited Red Knights. Service to the community has been a developing trait of NHS. Yearly there have been parties at the children's home and Lee Memorial Hospital. This year's Christmas project was the collection and donation of toys and games to the Salvation Army. North High's NHS members pos- sessed not only brains but also deter- mination and dedication. They believed and lived the old adage, 'Knowledge Is Power. .4 .,.-. -... . .YL t -x 'Rffii 2' 4 A fy, f frfigk .as r 3- kay 1,- 3- QU.. .f, Mg' V? t jj 1 -Q 4, , V , V .,s4,, ., .V i J., 7 , V A, - 1-4 4' ff' 4 1- ' up V 'Q V, in , . ' K' ' 3 - iii- f ? 5 In vi' M l, I i ,xf3,-1 Q, V sf? 1 1 f W 1 A , ig, Z V. 1 U . V ,v,r,t Q r -W A , ' ii-f , !',' f f I ' .f f ' ,.,,. ,- I -X - '7 ' '- ' '. ' 1 . ,4 ' Mfta. 4 ' ,, - Q34-. 9' eo '. f . fl , . . ,-. ..1: - -4- , .. fa- , k ', c fi, ,. .-4 , ', ,, W KK .f . 4, , . . Y: ,W ., , , - f ',,- . -, Qi . L fy , if Z, A , , Y V 4, ,,,. , , W , M ., ' 4 K. ' f -M el i f 35'f1':s.f4f . ,,,.. . - A 15 Ui, , W V Vp, '. ' f 3.i,fef.,,, . -' 9 :45531 . ,, Q , . . 353 rm ,- --4, .Y V., , ... .ang .,. .1 .235-,. .,Q,:.'.s'-1,7 , ,g,' fy 'fa , . .Qftff f ree? , 9 , NNN 1 - Quill and Scroll: IL to R1 Mrs. Virginia Branson, Mrs. Martha Richardson, Debbie Hills, Terri Cochran, Laurie Parish, Marilyn Burkett, Dusty Boyd, Manley Iaquiss, Wan- da Newman, Tina Scott, Pam Clouse, Shawn Lingle, Michele Markovits, Mr. Allen Caraway. 2 - Mr. Allen Caraway works around the light table with the Knight Life's Quill and Scroll members, Shawn Lingle, Dusty Boyd, Linda Iacobsen, and Deborah Hills. 3 - Lance's contributions to Quill and Scroll, Wanda Newman, Manley Iaquiss, Marilyn Burkett, and Barbara Mueller, work on layouts with Mrs. Branson. 4 - Michele Markovits and Terri Cochran from Excalibur, are actively involved in the production of their literary magazine and Quill and Scroll activities. 'Z-'S' 3 Members of the Press For the many North High students who have developed outstanding journalistic skills during the countless hours spent producing North's student publications, Quill and Scroll, the International Honorary Society for High School Iour- nalists, was reactivated on cam- pus this past year. Iunior and senior students who had corn- pleted a semester of work in the production of the school's year- book, newspaper, or literary magazine, ranked in the upper third of their class scholastical- ly, and were recommended by the publication sponsor, were invited to become members. Twelve students accepted this initial invitation and were in- itiated during a ceremony on Ianuary 27. A second series of invitations were extended in March, with a second initiation held in April. During this initial year North's chapter dealt primarily with organizational matters, membership growth, and the recruitment of in- terested students to the various staffs for next year. Officers for Quill and Scroll were Co-Chairmen Manley Ia- quiss and Dusty Boyd and Secretary Terri Cochran. Ad- visers were Mrs. Virginia Bran- son, Mrs. Martha Richardson, and Mr. Allen Caraway. Stressing the importance of improving their individual publications while encouraging and recognizing the individual achievements of students engaged in journalistic activity, the Quill and Scroll has been an important addition to North's honorary organizations. The en- tire North family extends a warm welcome to our newest group' Organizations f 47 Innovative Interpreters North's Forensics Club is an organiza- tion that encourages its members to par- ticipate in scholastic speech competition. It is a club for students who know or want to learn how to use their voices to convey emotions, to inform, to persuade, or to entertain and wish to have their proficien- cies in these skills judged. Speech competitions, either in in- dividual or group categories, were available at the various forensic tour- naments held within the district and state. Under the experienced and creative eye of Mrs. Suzanne lager, Forensics Sponsor, many hours were spent choosing, practic- ing, and perfecting the needed skills in ex- temporary or interpretive speech. In February, North High's Forensic Club hosted a district speech competition. Twenty-eight schools from Southwest Florida met to compete in the categories of debate, extemporary oratory, oratory, dramatic interpretation, humorous inter- pretation, congress, and group interpreta- tion. Parish Hill took lst place in humorous interpretation at district and state. Forensics was a fantastically fun-filled learning experience for individuals, but it was hard work. Many hours of research and practice went into every piece before the contestant was ready to step into the spotlight of competition and be judged. xx is... -.,,, vu, 2 1 - Practicing her humorous interpretation selection before the February competition is Tammy Saucier. 2 - A moment of seriousness for Iohn Prickett as he per- forms. 3 - Scarlett Edge, Stephanie Iuba, and Casey Hanger seem to be throwing it, but Iohn Preuss and Iohn Panio certainly don't want to catch it, as they practice their group interpretation. 4 - Forensics QL to Rl: Row 1 - Iohn Prickett, Parrish Hill, Ioe Fortini, Ray Garner, Todd Spurlin, Iohn Panio, Mark Arlington, Ed Garner, Iohn Preuss. Row 2 - Lisa Witte, Clayton Stumpp, Stephanie Iuba, Michell Willis, Molly Brodeur, Terrie Cochran, Casey Hauger, Lisa Beller, Tim Hay. Row 3 - Sonya Merritt, Darlene Sapp, Pam Wilmot, Scarlett Edge, Heidi Tietjen, Tammy Saucier, Francine Rubin- stein, Lisa Finley, Tara Maxey, Michele Markovits, Mrs. Suzanne lager. 48 X Organizations aww, mam 'Z l i 3 4 1 - A serious moment in Go Ask Alice , finds Thespians Chris Siegel and Robin Ferrell center stage. 2 - Ms. Andrea Getzlaff and Thespians Terrie Cochran and Cindy Barnes enjoy a good story at the 1981 Thespian Banquet. 3 - Thes- pian Troupe 112519: Row 1 - Nicole Vracar, Beatrice Rosario, Teresa Rhodes, Chris Siegel, Tim Hay, Michele Markovits, Debbie Bradley, Francine Rubinstein, Terrie Cochran, Mark Arlington, Robin Ferrell, Pam Volk, Iohn Prickett, Stephanie Iuba. Row 2 - Nick Cooley, Pam Boyette, Scott Luders, Connie Bedford, Ioe Fortini, Rick Bacon, Pam Wilmott, Michele Willis, Molly Brodeur, Lori Pastirik, Ray VanRyckeghem. 4 - Thespians Scott Luders and Ioe Fortini look for approval as they read for roles in the Christmas plays. Best Act iii Town North High's Thespian Troupe 112519 was established to recognize those students who have made notable contributions in the field of theatre arts. To be considered for membership in this honorary organization, a student must earn ten points by his or her participation in theatrical productions. The number of points awarded is determined by the degree of participation as an actor or actress or a member of a support crew. After earning membership and being initiated, Thespians continued to accumulate points to earn themselves stars and finally the ultimate award, that of recognition as an Honor Thespian. Only two North Thespians, Robin Ferrell and Mark Arlington, accumulated sufficient points to achieve this exalted goal and the recognition of their peers. The North High Thespian Troupe is responsible for producing two shows yearly. In October 1981, they sponsored North's first dinner-theatre program, Knights on Broadway. After eating a delicious chicken dinner, the audience was treated to a collec- tion of variety acts starring North students. On March 25, 26, and 27, they presented the musical, Godspell. Later in the spring Troupe H2519 collaborated with their counterparts from Cape Coral High School and presented a Thespian Extravaganza , a series of variety acts and scenes from various plays. In addition to performing locally, the Thespians competed in district and state sponsored play festivals and individual com- petition. This year the district meeting was held in Ianuary at Lemon Bay High School and the state was in Orlando in April. Red Knight Thespians were led during the 1981-82 season by President Mark Arlington, Vice-President Robin Ferrell, and Secretary-Treasurer Terri Cochran. Sponsor of the Troupe was Ms. Andrea Getzlaff, North High's Drama Coach. Our Thespian Troupe continued to be an active and en- thusiastic addition to the extracurricular side of high school life. Their professionalism and talent entertained and delighted their audiences. Organizations X 49 A 4 Keys to Success Key Club is a world-wide youth ser- vice organization in over 14 countries on the North American continent and in the Caribbean. The North Ft. Myers High School Chapter, like the Interna- tional organization, is dedicated to ser- vice for the school and the community. Sponsored by the Ft. Myers Edison Kiwanis Club, North's Key Club members profited from leadership and interest shown in them by these dedicated members of the adult community. Each year Key Club members work diligently on their service projects and fund raising activitiesg 1981-82 was no exception. They volunteered many hours organizing charity drives, pro- moting leadership training sessions, pro- viding services for people in rest homes and hospitals, and participating in divi- sional and recreational activities. In Ianuary they expressed the appreciation of the entire student body towards the faculty by entertaining teachers and staff at breakfast in the cafeteria on their Teacher Duty Day. Fund raising activities such as the dunking booth on Homecoming Field Day and the Christmas tree sales pro- vided the club with the monies needed for their service projects and participa- tion in the Key Club District Conven- tion. North's Key Club has always been active and influential at the district level, having two former district of- ficers, Todd Spurlin and Linwood Schultz, as members of the chapter. North High's Key Club adviser, Mr. Stan Mulford, worked throughout the year with officers, President Russ Carver, Vice-President Iohn Kannell, Secretary Ron Merritt, Treasurer Steve Martin, and Lt. Governor Linwood Schultz, to keep the members involved and to make all North students aware of the need and value of involvement in the community. t Mx: . 1 - Selling Christmas trees is a lot of fun for Mike Ennis and profitable for North's Key Club. 2 - Key Club members prepare the cafeteria for their Ap- preciation Breakfast honoring the North High staff on Ianuary 18. 3 - Mr. Stan Mulford, Key Club Adviser, shares the speakers table with Russ Carver, Ron Mer- ritt, and Mike Ennis. 4 - Key Club: IL to Rl Sitting - Iohn Prickett, Todd Spurlin, Ron Merritt, Key Club Sweetheart Dayna Cobb, Steve Martin, Larry Ennis, Barry Frey, Iohn Crawford, Phil Wagner. Standing - Mr. Stan Mulford, Iohn French, George Parze, Steve Pate, Mike Ennis, Linwood Schultz, Russell Carver, Iohn Kanell, Manuel Cox, Ellis Baumer. Standing by Knight - Dennis Anderson, Paul Kelly. 50 X Organizations . , . . ,,,, 1 - Interact: IL to Rl Row 1 - Heidi Tietjen, Sylvia Freeman, Sue Marks, Mr. Ed Stickles, Steve Muri, Richard Muri, Ieri Cunningham, Beth C-urnham. Row 2 - Chris Hartnett, Cindy Weber, Brian Makar, Scott Sushil, Dusty Boyd, Patty Trealout, Ioey Cross. 2 - Interact officers Cindy Weber, Beth Gurnham, Sylvia Freeman, and Ieri Cunn- ingham talk things over before a general meeting. 3 - After the Pepsi sponsored Knight Classic 10 kilometer run, In- teract members served the hot and thirsty participants. 4 - Getting canned food ready to take to the Salvation Army for distribution to the poor is Interact V.P. Ieri Cunningham. . f , sir People ho Care Interact is a club that has been at the top of school involvement for many years. Sponsored by the North Fort Myers Rotary Club, it has two very special advisers for 1981-82, Principal Ed Stickles and Assistant-Principal Steve DeShazo. They helped the members reorganize the club this past year and attempted to increase member- ship and student involvement. Members of Interact are encouraged to lend a helping hand to the needy and less fortunate throughout the North Fort Myers Community. They strive to recognize and to help develop the potential within themselves and other individuals. Respect and caring are two important words to every Interact member. Under the leadership of President Sylvia Freeman, Vice-President Ieri Cunningham, Secretary Cindy Weber, and Treasurer Beth Gurnham, Interact members undertook the collection of canned goods to be donated to the Salvation Army and then distributed to needy families at Christmas. A large col- lection box placed in the center of the office quickly filled due to the generosi- ty of the entire North High family. People who care about other people are important in our busy, ever- expanding world, and Interact demonstrated throughout the year that they were an organization who were in- terested in the welfare of others and in promoting home and family. Thoughtfulness, helpfulness, and awareness were three adjectives that described the Red Knight Interact members. Organizations X 51 Knight Right-Fighters The Student Advisory Council was formed to provide students an easily ac- cessible forum through which to express their concerns regarding all areas of discrimination. They attempted to design and conduct activities which would enhance cultural understanding, develop handicap awareness, and over- come the effects of sex or race stereotyping. After electing Darell jackson, Chair- man, Willie White, Co-Chairman, and Rita Scott, Secretary, the S.A.C. held meetings to develop a plan to increase student participation in activities during the 1981-1982 school year. Thanks to their interest, monthly activity periods were continued during the school day to allow bus riding students to become involved. Near the beginning of the school year, 1 1 - SAC members Kim Kelly, Yolanda Yslas, and Kathy Toro show their spirit as Scott Sushil drives them in the 1981 Homecoming Parade. 2 - The members of the Student Ad- visory Council attend to business at one of their numerous meetings. 3 - 1981-82 S.A.C.: IL to R1 Row 1 - Mrs. Marie Thomas, Kathy Toro, Rita Scott, Kim Kibler, Scott Sushil, Mrs. Bobbie Dewey. Row 2 - Zona Henry, Dandria Henry, Yolanda Yslas, james Giles, Willie White, Kim Kelly, Donna Howard, Frank jenkins. Standing on Knight - Carolyn Dickerson, Connie Bedford, Shawn Lingle, Nok Hunter, Darrell jackson. 52 X Organizations the S.A.C. conducted a survey under the guidance of Dr. Dan Kennedy, Florida International University psychologist, to find out the reasons for the poor student participation in organizations and sports. The results indicated that for freshmen and sophomores transporta- tion was the main drawback, while juniors and seniors felt their jobs had first priority. All classes felt some sub- culture group pressure not to engage in certain sports or organizations. To work to remedy this situation, S.A.C. members decided to work through Ms. Melody Mitchitell with members of the 9th and 10th grade on values clarifica- tion and decision making. On February 25, members of the Stu- dent Advisory Council traveled to St. Petersburg with foreign language 3 students to enjoy the International Folk Festival. This outstanding event, featur- ing authentic displays and food from various cultures, inspired the North students to organize a Lee County Inter- national Folk Exhibition fL.I.F.E.j on May 1. Working closely with the S.A.C.'s from other Lee County high schools, members of the foreign language departments, and the Lee Alliance for the Arts, different com- munity groups participated in organiz- ing displays and exhibits. S.A.C. sponsored field trips for various groups throughout the year to enjoy local cultural programs. They felt that the more people from various, dif- ferent backgrounds, the more they would understand them and appreciate them. 1 - Attempting to improve the quality of school lunches, Y.A.C. members talked over their ideas. 2 - Youth Advisory Council: IL to R1 Row 1 - Mrs. Elizabeth Culleton, Elizabeth Corbitt, Glenda Ander- son, Denise Dixon, Cynthia Iiles, Coury Macdonald, Mrs. Bertha Stevens. Row 2 - Elease Scurry, Iavanda Thomas, Marilyn Smith, Lisa Crews, Angela Scurry, Cathy Kubesh, Ioe Fortini. 3 - This stu- dent planned meal proved to be another taste of success for Y.A.C. 4 - Patience is a virtue when waiting for your school lunch. Food Is First Priorit Have you any ideas how to make North High's cafeteria more attractive? Maybe suggestions of new dishes or kinds of food students would like to eat? These types of topics crowd the agenda of each meeting of the North High Ad- visory Council. Y.A.C., under the direction of Mrs. Bertha Stevens and Mrs. Elizabeth Culleton, attempted to improve the quality of food served in the lunchroom, to instruct students in positive eating habits, and to make them aware of the basic daily nutritional requirements. Of- ficers President Corey Macdonald, Vice-President Denise Dixon, Secretary April Brown, and Treasurer Marie Smith and council members, often found themselves attempting to deal with the most often voiced complaint of the student body, the high cost of cafeteria food. The money that Y.A.C. earned through fund raising activities was used to help defray costs for members to at- tend the annual state convention. At the convention they discovered that high schools throughout the state had been 93,gpi:at.zP':?'2.. 4 experiencing similar cafeteria problems due to inflation, a decrease in federal aid, and the poor eating habits of many teenagers. The various delegations worked together to find answers to the more pressing, common problems. Providing good food, pleasant sur- roundings, and a congenial atmosphere during lunch periods were the major aims of the Y.A.C. They realized it all could not be accomplished at once, but in 1981-82 they took positive action to get things started. Organizations X 53 Congress b Knight The S.G.A. fStudent Government Associationl, chaired by President Tara Maxey and sponsored by Mr. David Ciompalo, is an organization that uses parliamentary procedure in represen- ting the student body. As our flag represents our country, S.G.A. represents the leadership of all the clubs and organizations here at North High. S.G.A. is operated like our Congress in Washington, D.C. There are Senators picked by the membership of each club, class, or organization to express their opinions and to direct campus-wide in- volvement in activities. This year, the S.G.A., was in charge of 1 - Tara Maxey and her officers welcome the Freshman Class to North High and explain the up- coming class officer's election, 2 - Homecoming plans were formulated by S.G.A. Senate members, Lisa Finley, Ioni Ieffcoat, Rita Scott, and Christy Boring. 3 - Student Government Association: lL to R1 Sitting - Lisa Finley, Lisa Adams, Bonnie Bouch, Kim Bitter, Mr. David Giompalo, Tara Maxey, Louise Adams, Michelle Waser, Vicki Cooley. Standing - Kim McCook, Tammy Saucier, Terri Osborne, Mark Arlington, Lynn Pepkowski, Michele Markovits, Patty Talley, Teri DuBrule, Rick Morales, Manley Iaquiss, Ed Garner, Terri Cochran, Kim Kibler, Kallyn Har- mon, Kim Adams, Robin Ferrell. 54 X Organizations arranging and directing Homecoming Week. Through their Senate, decisions were made as to dress and activity days, procedures for the Homecoming Court's election and Coronation, and the ap- pointment of F.F.A. to plan Field Day and the Lance Staff to organize the Homecoming Parade. For the first time in many years to the S.G.A. also fell the task of arranging for the traditional Homecoming Dance. Ioining Tara at the helm of this busy organization were Vice-President Kim Bitter, Treasurer Robyn Bouch, and Secretary Louise Adams. They and the members of the Senate were devoted to improving the facilities and activities at North High. One highly successful pro- ject was the installation of bulletin boards in the patio area so clubs and organizations could post an- nouncements of upcoming events. In the month of hearts and love, February, the S.G.A. sponsored a Sadie Hawkins event. This enabled the Lady Knights to choose the man of their dreams, carry his books, open doors for him, and take him to a dance. This role-reversal event was a unique function and hopefully it will be carried on for years to come, a tradition started in 1982 by the S.G.A.! .1 I 1 I f W tl. s u ,, .nf nw, an H.. .,,. . Q. me vw we - mu an -M -1 'X 1 - LTC Linwood Schultz and Cpt. Ronald Merritt sat at the ROTC display table prepared to pass out pamphlets and answer questions. 2 - North High ROTC: Row 1 - LTC Linwood Schultz, Maj. Tara Maxey. Row 2 - Lt. Annette Hernandez, Cpt. Brett johnson, Lt. Carole Worthington. Row 3 - Lt. Phil Leite, Capt. Ron Merritt, Lt. Chris Meyers, Lt. Sean Meyers, Cpt. Tom Montefinese, Lt. Ed Grabowski, Lt. Russ Graettin er. Row 4 - Mark jeter, Ralph Roberts, Steve Pate, Marie Smith, April Brown, Kim Hutcliins, Cliff Ebert, Stuart Martin, Gene Williams, Richard Dobson, Art Velez, Pam Hanley. Row 5 - jenny Nicks, Tony Mellema, jerry Whitaker, Mark Beattie, james Curls, Steve Muri, Paula jones, Chuck Mc- Clure, Iohn Hills, Mike Tarver, Row 6 - Tom Hard , Robert Lannen, Dan Loghren, Keith Edge, Paul McDonald, johnny Giddens, Mark Kingsbury, Tom johnson, Warren Salvatore. Row 7 - Wayne Pearce, Susan Horne, Larry Brown, Linda Walker, Angela Scurry, Gene McMullen, Gary Melvin, Greg Morris, Doug Gibson, Brian MacDougall. Row 8 - Larry En- nis, john Kanell, Carey Ross, Loretta Thomas, David Hand, Dale Maynard, Lloyd Sawyer, Tony Myrick, Dale Mathewson, David Smith. Row 9 - Tommie Cole, Brian Aalto, Penny Quetel, Paul Harris, Manuel Cox, Susan Brady, james Defaira, Charles Williams, Mike Ennis, Ken Sapp. Row 10 - joe Barley, Gary Richardson, Chuck Gilbert, Mike Zolno, Phil Perry, Ellis Baumer. 3 - ROTC Officers: Kneelin - LTC Linwood Schultz, Maj. Tara Maxey. Row 1 - Lt. Annette Hernandez, Cpt. Brett johnson, Lt. Carole Worthington. Row 3 - Lt. Phil Leite, Cpt. Ron Merritt, Lt. Russ Graettinger, Lt. Chris Meyers, Lt. E Grabowski, Cpt. Tom Montefinese, Lt. Sean Meyers. 4 - Cpt. Tom Montefinese inspects Company B. lDut,Ilonor. The Eagle has landed on the front lawn of North Fort Myers High School. After three years, North's ROTC has developed its own battalion and secured a portable from which it can operate its complete program. Under the experienced guidance of SFC james Scofield, U.S. Army Retired and Student Assistant to the Battalion, Lt. Colonel Richard Todd Spurlin, the North IROTC membership has grown to over 100 cadets. These cadets form two companies. As in other IROTC units, the cadet leadership is a vital factor in a suc- cessful program. N orth's Battalion Com- mander, Lt. Colonel Linwood Schultz is ably assisted by Battalion Executive Of- ficer, Major Tara Maxey. Comgy A is 2 ..CounU' under the direct command of Captain Ronald Merritt, while Company B is headed by Captain- Thomas Montefinese. The Reserve Officers Training Corps' program drills the cadets in many of the same military skills they would en- counter during their first six weeks of basic training in the U.S. Army. In addi- tion they also received instruction in developing the desirable traits of responsibility, loyalty, dependability, enthusiasm, respect, and tolerance. They quickly learned that a soldier obeys orders and treats others with con- sideration and tact. N orth's IROTC unit spent many hours practicing marching and drill forma- tions to achieve parade readiness for their participation in the Cape Coral Water Festival Parade, the North Homecoming Parade, and the Edison Pageant of Light Parade. These events helped them prepare for the Annual Federal Inspection of the Troops held at Cypress Lake High School. At this in- spection active U.S. Army officers grade the respective units in appearance and performance. Twice in the last five years, Lee County's IROTC has been rated the 111 Corps in the nation. Everything in ROTC is done in a military fashion. Students are initiated into this new way of life and introduced to a potential career in the Armed Forces. Organiza tions X 55 Sparkling S ncopators The blaring of trumpets and the cadence of drums announcing the ap- proach of a band has caused the pulse of Americans to quicken throughout ithe ages. Loyal Red Knights have always eagerly anticipated the appearance of their marching band. Stepping smartly in their red and white uniforms, band members continually add to North's pride and spirit. y Many outsiders have no idea how much time these talented musicians spend on preparations for each perfor- mance. Long, agonizing hours during the summer and fall, under the blazing Florida sun, were consumed with marching so that every line was straight, every marcher in step. Then came fthe job of learning and perfecting theiin- tricate patterns of the half-time routines. Practicing new and difficult pieces of music on their individual instruments, blending their sound with those of the others in their section, and then combin- ing these into a melodic entity took time and dedication during and after school. When not entertaining at football games and pep rallies, the marching band proudly carried the school banner in community parades and through competition at the county, district and state level. There was also a more sedate side to the North High Band, their appearances in symphonic con- cert. This totally different look, style, and sound delighted audiences wherever they performed. The expenses of operating a band, maintaining instruments and uniforms, and supplying new copies of musical selections, kept band members and their parental unit, the North High Band Boosters, busy throughout the year. The football game concession stand, candle and waste basket sales, and drawing for a whole hog, were but a few of their fund raising activities. The 1981-82 Marching Red Knights were under the direction of Mr. Keith Stark and Drum Major Ieff Hayworth. Assisted throughout the year by their able officers, President Belinda Takach, Vice-President Sam Wood, Secretary Christine Gartner, Treasurer Denise Morgan, Librarian Kim Bitter, Quarter- masters George Parze and Robert Childers, Senior Representative Nicole Harmon, Iunior Representative Patty Tally, Sophomore Representative Darlene Williams, and Freshman Representative Glenn Bitter, they com- municated the knowledge that Red Knights were and are 111 in Lee County and the state of Florida. -f T 1 - 1981-82 Band Council: IL to Rl Row 1 - leff Hayworth, Christine Gartner, Belinda Takach, Sam Wood, Denise Morgan. Row 2 - Nicole Harmon, Patty Talley, Darlene Williams, George Parze, Kim Bitter, Robert Childers, Glenn Bitter. 2 -f Marching Red Nights: Drum Major - Ieff Hayworth. Maj orettes - Kim Bitter, Stephanie Dodd, Christine Gartner, Nicole Harmon, Sue Marks, Iennifer Maxey, Denise Morgan. Percussion - Billy Atkins, Connie Bedford, Darrell Davis, Iohn French, Ruben Garces, Oui Hunter, Tim Malone, Duane Nash, Pam Oakes, Bill Peace, Richard Ratliff, Hugo Smith, Glenn Taylor, Raedene Turco, Kevin Wambolt, Ioe Young. Sousaphones - Robert Childers, Ioel Corbin, Dennis Martin. Baritones - Mark Bitter, Scott Cottrill, George Parze, Trombones - Glenn Bitter, Todd Kirby, Curtis Thomas, Ioe Williams, Sam Wood. French Horn - Lori Hayworth. Trumpets - Amy Ashton, lim Bembrey, Bob Carrillo, Ianis Cottrill, Marlene Hart, Iohn Kanell, Ethan Ledford, Troy Lister, Andrew May, Angela Morrison, Scott Ower, Patty Trealout, Iohn Wild, Darlene Williams, Heidi Williams, Iulian Wood. Tenor Sax - Ioe Dziewik. Bass Clarinet - Mark Arlington. Clarinet - Louise Adams, Heidi Altvater, Kathleen Beebe, Betsy Coffin, Ianet Collins, Valarie Erwin, Yvonne Frey, Sharoyn Harris, Dianna Heinkel, Shawn Lingle, Kim McCook, Iames Nolan, Cathy Smith, Doris Soler, Ann Sykes, Regina Varn, Sulyn Wenrich, Deborah Williams. Flutes - Lisa Adams, Iulie Crocker, Lisa Finley, Toni Griffin, Sharon Hadsock, Sandra Hassenzahl, Robin Hess, Amy Iuliano, Tammy Lentz, Kyna Lister, Robyn Maker, Ioyce Malone, Michele Markovits, Anita McLeod, Michele Olson, Susan Smith, Maxine Soler, Belinda Takach, Patty Talley, Kim Tomlinson, Ioy Wagener, Lisa Wasser, Michele Wasser, Donna Wilson, Lisa Wilson. Alto Sax - Diane Brazill, Kallyn Harmon, Lisa Iones, Greg Pike. Flags - Christy Boring, Iulie Britton, Dayna Cobb, Laura Davis, Toni DeVito, Carolyn Dickerson, Tanya Lust, Tara Maxey, Barbara Mueller, Lori Pastirik, Toni Ponte, Karen Putmon, Rose Reid, Iodi Reigle, Cindy Summerall, Brenda Takach, Sandy Thayer. ,i,.+ ,.........-M T, ,Y 1 - Drum Major Ieff Hayworth stands at attention. 2 - Band members respond to North's gain during the football game. 3 - Spirited notes radiate from Darlene Williams' trumpet during the half-time show. r 1 lww 3 Organizations X 57 Sparkle of the Knight The section of the band that receives a tremendous amount of special attention, regardless of where they perform, are the majorettes. Although they do not play in- struments while performing with the mar- ching band, this does not mean they are not talented musicians. One of the re- quirements of becoming a majorette is to first become a member of the marching or symphonic band based on your musical ability. Throughout the summer the majorettes work to design their uniforms and to perfect the baton routines they will use throughout the year. When school begins, their work is doubled by the required daily rehearsals with the band and as a fully coordinated corps. Even then practice does not end. They must stand for hours in front of a mirror perfecting their routines and personal showmanship. Maj orette sponsor, Ms. Andrea Getzlaff, and majorette captain, Christine Gartner, are continually on the go coping with foot- ball game performances and marching contests. It's a full-time job just making sure Capes, top hats, and the flaming batons are ready for every performance. Though serving on a Maj orette Corps re- quires hours of hard work and dedication, not one of our Red Knight maj orettes would dream of missing the experience. All those blisters and bruises are worth the applause of the crowd and the personal satisfaction of knowing you add sparkle to the Marching Red Knights. I pf'-1 Z 1 - Susan Marks stands proud during a half- time show. 2 - jennifer Maxey, Stephanie Dodd, and Denise Morgan lead the Homecom- ing Parade with style. 3 - With top hat and white boots, Kim Bitter proves every maj orette possesses charm and beauty. 4 - 1981 Ma- jorette Corps and Drum Major: Kneeling - Kim Bitter, Susan Marks, Stephanie Dodd. Standing - Denise Morgan, Capt. Christine Gartner, Drum Major jeff Hayworth, jennifer Maxey, Nicole Harmon. 58 f Organizations 4 lin1 1 - 1981-82 Flag Corps: IL to Rl - Brenda Takach, Lori Pastrick, Sandy Thayer, Barb Mueller, Carolyn Dickerson, Rose Reid, Tonya Lust, Cindy Summerall, Tara Maxey, Iodie Reigle, Tony Ponte, Toni DeVito, Christy Bor- ing, Laura Davis, Iulie Britton, Karen Putmon, Dayna Cobb. Z - The Flag Corps stands pro- udly on the field following their Homecoming performance. 3 - Toni DeVito shows her en- thusiasm for the Flag Corps and the routine she is executing. 3 - Iodi Reigle and Iulie Britton practice in step with the rest of the corps. A Flash of Class What's new with the band? Well this year the Marching Knights added a flashy new auxiliary unit, the Flag Corps. These young ladies faithfully appeared on the field in their snappy red, white, and black uniforms with rippling red and white flags. This being their first year, it was a real challenge to learn the routines, but by the end of the football season they looked as though they had been performing for years. The Flag Corps' numerous se- quences of front spins, butterflies, and rowboats might look simple, but in actuali- ty took countless hours to perfect. The seventeen girls worked during second period and after school daily on their part in the show. Getting the Flag Corps started was a ma- jor undertaking for Mr. Keith Stark, Band Director and Ms. Andrea Getzlaff, their sponsor. Uniforms had to be designed, made, and fitted, hats ordered, and flags constructed. Then the girls had to learn to march in correct cadence with the band. Routines were created by different groups within the Corps. These would then be taught to the rest of the Corps, and altered and perfected until everyone was satisfied with the finished product. lust prior to all performances, excite- ment and nervousness raced through the Corps as girls attempted to locate their per- sonal boots, hats, and flags. By the time they had passed inspection under the meticulous eyes of the Drum Major, Mr. Stark, and Ms. Getzlaff and were ready to march on the field, the calmness of the professionals they had become, took over. At the end of their performance the sound of applause could be heard and a smile ap- peared, even though smiling wasn't allowed. Organizatio nsf59 Sweet Sounds of Success The talented young men and women who composed the North Fort Myers High School Chorus knew what it meant to practice and train. Beautiful vocal sounds did not just occur by opening one's mouth. It took many hours of long, hard practice to improve and perfect tone, diction, breathing techniques, and harmony for their concert performances. During 1981-82, the Chorus, under the direction of Mrs. Pruella Niver, per- formed throughout Lee County giving concerts at churches, luncheons, and club meetings. At Christmas, they presented The Night of Miracles Can- tata at the Methodist Church in North Fort Myers and entertained their fellow students by caroling in the patio area. Eight students from the North Chorus were chosen this year to participate in the Miami University Honor Choir dur- ing the fall. They were Marie Schoonover, Lori Lawrence, Kelly Bright, Tammy Smith, Scott Cottrill, Steve Callhan, Iason Cash, and Ellis Baumer. Ten students were selected as members of the Lee County Honor Choir, Melody Addison, Lori Lawrence, Shelly Wild, Paula Iones, Cynthia Iiles, Scott Cottrill, Iason Cash, Phillip Ayers, Scott Luders, and Ellis Bauman. Preparations went on all year for the district and state vocal competitions held each spring and for the group's participation in the combined Lee County Massed Chorus. Topping off their busy year was the annual perfor- mance of the Chorus at the North High Baccalaureate Ceremony on May 23. Chorus officers for 1981-82 were President Lisa Clark, Vice-President Elease Scurry, Secretary Shelly Wild, Corresponding Secretary Paula Iones, Treasurer Andrea McCrea, Librarians Tammy Smith and Paula Iones, and Coordinator Cherie Gerald. These leaders and their fellow vocalists are to be congratulated on the dedication they showed, the entertainment they provid- ed, and the honor they brought to their Alma Mater. an 3 1 - Iason Cash hits his note during practice for the Lee County Honor Choir performance. 2 - Ready for the center ring, Chorus clown Carole r Worthington, makes her entry in the Homecoming parade. 3 - North Fort Myers High School Chorus: IL to Rl Row 1 - Shelly Wild, Teri DeBrule, Carole Worthington, Michelle Iohnson, Ellis Baumer, Greg Sweeney, Tammy L. Smith, Pam Volk, Kelly Bright, Ioyce Vathis. Row 2 - Tammy Lawrence, Lori Lawrence, Marie Schoonover, Cynthia Iiles, Sally Vaughn, Shauna LaPosta, Scott Cottrill, Scott Luders, Shezell Putmon, Casandra Whittye, Shirley Connors, Paula Iones, Mrs. Pruella Niver. Row 3 - Denise Dixon, Elease Scurry, Melody Addison, Marie Smith, Iason Cash, Phillip Ayres, Carolyn Dickerson, Sharon Ervin, Andrea McCrea, Carol Lindhout, Michelle Ward. 4 - Lee County Honor Choir par- ticipants: IL to R1 Sitting - Lori Lawrence, Scott Cottrill, Shelly Wild. Standing - Iason Cash, Melody Addison, Phillip Ayres, Cynthia Iiles, Scott Luders, Ellis Baumer, Paula Iones. 60 f Organizations 4 1 - The North High Chorus entertains the student body in the patio area. 2 - Chorus officers pose in their formal attire. Row 1 - Elease Scurry, Paula Iones, Shelly Wild. Row 2 - Andrea McCrea, Tam- my L. Smith. 3 - Members of the Miami Honor Choir pose outside of Maurice Gusman Concert Hall. 1 Wi Strings Thls year you might not have heard too much about the North High Or chestra but it was in existence under the name of String Ensemble Only four students made up this group at the beginning of the year but the sounds they produced more than made up for their small number Phil Leite and Susan Nein played the violins in this unique group while For shunder Ward and Robert Nein were featured on the cellos. The String Ensemble was under the direction of Mrs. Marilyn Hogan who taught only one period at North daily. The rest of her day was spent at Suncoast Middle School where she directs the orchestra and chorus and teaches general music classes. The String Ensemble performed minor concerts for Mrs. Iagers speech classes and for an assembly at Suncoast Middle. In the future we know we will N01-th High String Engemblg hear more from them as they build their Phil Leite, Susan Nein, Mrs, Marilyn Hogan, Forshunder Ward, Robert Nein numbers toward full-orchestra strength, Organizations X 61 The sun spotlights Pam Boyette as finishing Spotlight, Center Stage The smell of grease paint, the allure of bright lights, and the magical sound of applause have drawn many Red Knights to join North's Drama Club. At some point in each of these students' lives there was a need to be recognized by others because of a special talent or achievement. They decided to seek this recognition by performing before or behind the footlights in the world of theatre arts. North's Drama Club has grown in size and undertakings since Ms. Andrea Cetzlaff assumed sponsorship three years ago. Regardless of limited stage facilities, many quality productions have been presented. Spring '81, the students and com- munity were delighted by the musical extravaganza, Grease , presented in cooperation with musicians from the North High band and produced by the Class of 1981. First semester this year found the group undertaking two pro- ductions, the dramatic presentation of Go Ask Alice , the story of a teenage girl and her desperate attempt to break free from the addiction of drugs, and a dinner show spotlighting the talents of North students in a succession of variety acts. During the Christmas season drama students traveled to the Edison Mall and local elementary schools to present two one-act plays, The Littlest Angel and It's Sad, So Sad, When an Elf Goes Bad. Spring '82 again saw music enter the scene with the Thespian production of Codspell , a fast moving, heartwarming, modern rendition of the Book of Matthew. Leading Drama Club during the 1981-82 year were President Robin Fer- rell, Vice-President Mark Arlington, Secretary-Treasurer-Historian Terri Cochran, and Publicity Director Tonya Becker. K is 1 1 touches are made on the Go Ask Alice scenery. 2 - The cast of The Littlest Angel listen intently to their student directors. 3 - Drama Club IL to Rl: Row 1 - David Bechtol, Iennae Wierengo, Wende Hughes, Sheryl Miller, Todd Hughes, Parn Volk. Row 2 - Sonya Merritt, Monica Haggard, RoseAnn Ulino, Nicole Vracar, Tonya Becker, Terri Cochran, Mark Arlington, Robin Ferrell, Dawn Minnick, Laura Dunn, Lori Deitz. Row 3 - Zana Auldridge, Kenny Collins, Chris Siegel, Tim Hay, Michelle Markovits, Debbie Bradley, Francine Rubinstein, Beatrice Rosario, Patty Trealout, Debbie Raulerson, Patti Talley, Iohn Prickett, Teresa Rhodes, Stephanie Iuba. Row 4 - Angie Varner, Nick Cooley, Pam Boyette, Scott Luders, Connie Bedford, Ioe Fortini, Rick Bacon, Pam Wilmot, Michelle Willis, Molly Brodeur, Lori Pastirik, Kim McCook, Ray VanRyckeghem. 62 X Organizations 3 LQUE PASA? 1 - Practicing their commercial for the International Dinner, Louise Adams, Maxine Soler, Philip Baker, and Cathy Boring, pay close attention. 2 - Spanish Club lclockwisel: Inner Circle - Mary Massoth, Doris Soler, Kathy Prickett, Traci Davis, Cathy Boring, Melissa Roof, Donna Schoneman, Allyson Iones, Candy Boring, Renee Murphy, Iohn Eichner, Ellen Ayres, Christy Boring, Raedene Turco, Cathy Smith, Wendy Kelleher, Ieri Cunningham, Rose Ulino, Kim McCook, Mark Arlington, Ianet Collins, Iohn Panio, Phil Baker, Patti Haley, Lynn Pepkowski. Outer Circle - Monica Haggard, Rita Scott, Michelle Markovits, Richard Frank, Lisa Finley, Louise Adams, Donna Bennett, Theresa Roof, Kathy Kuhs, Lisa Adams, Maxine Soler, Sue Clouse, Kim Clouse, Karen Snodgrass, Ray Garner, Ieanette Dials, Darlene Dials, Francine Rubinstein, Clayton Stumpp, Beth Parrish, Rick Morales, Tammy Saucier, Heidi Tietjen, Casey Hauger, Iohn Prickett, Iohn Kanell, Traci Walter, Cathy Kubesh, Kim Rutherford, Ienny Thomas, Laura Davis, Tammy Lentz, Chris Siegel, Lisanne Banta, Lori Douglas, Sandy Wallace, Debbie Ripple, Cindy Clark. 3 - Representing Spanish Club in the Homecoming Parade, Rick Morales exhibits some Spanish culture. El Circulo de Espanol is the name of one of the largest clubs at North High, the Spanish Club. This extremely active organization has prospered over the years due to the devoted sponsorship of Ms. Peg Flaherty. Serving as president for his second year, Rick Morales received outstanding support from his fellow officers, Vice- President Casey Hauger, Secretary Louise Adams, Treasurer Heidi Tietj en, Coordinator Ieri Cunningham, and Sergeant-at-Arms Lisa Finley. This board planned the multiple activities and fund raising projects for 1981-82. On October 26, all the foreign language clubs met for their Annual In- ternational Dinner. Students brought cultural salads, entrees, or desserts to share with others in this culinary adven- ture. Spanish club members performed Q in commercials they would see in Spanish-speaking nations. Homecoming Field Day was enriched with the Club's famous Taco Stand. When not preparing or serving this authentic dish, members were occupied running the two-man tricycle race. Super salesmanship seems to be a synonym for Spanish Club members. These personas put forth time, effort, and dedication in each fund raising ac- tivity but especially successful were their Tom Watt suitcases The collec- tions of intriguing items netted the club over S2,700. Christmas was an exciting time for Spanish Club members, Former North teacher Ed Krupo acted as D.I. for an evening of dancing, eating, and playing games, topped off by the breaking of the traditional pinatas. In February, the club members traveled to St. Petersburg for the Inter- national Folk Fair. There they enjoyed many cultural exhibitions of crafts and food prepared by the various cultural centers in Tampa and St. Petersburg. Spanish Club sent may students to local and state Spanish conferences to compete in various competitions bring- ing honors to themselves, their club, and North High. At the end of the year, members took their annual trip to Tampa to experience Ybor Square and the cuisine of the Valencia Gardens. Trips to Busch Gardens and Adventure Island topped off a wonderful Spanish adventure and a tremendous year for the members of El Circulo de Espanol. Organiza tions X 63 D'Anglais a Francais French Club may appear to be just another foreign language club to the or- dinary student at North High, but once inside the doors of room 115, it's another story entirely. The French Club sponsor, Mdme. Benkhatar, feels her club is a bit more exclusive than the others because she required its members to belong to a French class before joining. This made it easier to pass on news regarding club meetings and activities. As with most organizations, French Club had a need to replenish its club treasury during the year. This they did with the usual car washes and bake sales throughout the year. Soon they had raised a tidy sum which enabled them to participate in a full array of social and educational events. All members looked forward to the St. Petersburg's International Folk Festival in February with enthusiasm. This event offered the students the opportunity to observe and learn about various cultures through their displays. EX- hibitors, dressed in native costumes, served authentic food, displayed their crafts, demonstrated their music and dance, and discussed their customs and heritage. French club is certainly not all fun and games. French students and club members began practicing in the fall for spring competition at district and state levels. Entries in these contests were in fields of oral recitation, written transla- tion, and artistic interpretation. Led during 1981-82 by President Robyn Bouch, Vice-President Laurie Parish, and Secretary-Treasurer Valarie Nottingham, French Club members were easily identified in North's classrooms and hallways by their white T-shirts with red sleeves, bearing the slogan, Souriez si vous parlez francais . . . Smile if you speak French. 44, 1 eg . 1 - Pausing for a moment of quiet contemplation during the foreign language's skating party was French Club member, Hezy Hemed. 2 - Mrs. Benkhatar enumerates her expecta- tions on participation in club activities. 3 - Ienny Nicks, An- f dy Iohns, and Kim Moody get information from Mrs. Benkhatar on their trip to the Folk Festival in St. Petersburg. 4 - French Club IL to Rl: Kneeling - Caroline Normandin, Katherine Yoder, Valarie Nottingham, Anita McLeod, Denise Nolan, Cindie Esquivel, Lynn Truskey, Bonnie Bouch, Robyn Bouch, Dennis Anderson. Standing - Ienny Nicks, Ienny Genesky, Dawn Iackson, Karen Bussey, Kim Moody, Andy Iohns, Carla Dudley, Denise Morgan, Dawn Hepp, Cheryl Martin, Coury Macdonald, Mrs. Cathy Benkhatar. 64 X Organizations 4 gtlm I si Wi! l X ,Af , 1-T -- 4 j M 1 - German Club lL to Rl: Row 1 - Kathy I-lupp, Suzy Peckham, Theresa Tyler, Mercy Welch, Aleen Orstrom, Ina Cooke, Bob Peckham, Wendy Tillery, Olivia Topchy, Iulie Szulczewski, Susan McDermott, Ianelle Whetton, Regina Varn. Row 2 - Tom Hardy, Brett johnson, Steve Muri, Richard Muri, Mike Mc- Quinn, Steve Martin, Wade Smallwood, Richard Hornberger, David Cooke, Chris Presnell, Bill Fussell, Tim Sushil. Row 3 - Richard Whitney, Don- na Kelly, Debbie Kirby, Patty Tally, Kim Thoman, Beth Smith, Molly Brodeur, Dana Cooke, Lynn Stauf- fer, Terri Osborne, jill Wallace, Velvet Huffmaster, Kathleen Beebe, Ann Robinson, Mike Ennis, Linda Hissam. 2 - German Club does the honor of uniting Red Knight couples at the Old Hitching Post. 3 - German Club members enjoyed The Omph-pah-pah Man at the Heidelburg Castle in Sarasota. 4 - The selling of Gummi Baren was a major fun-raiser for the German Club. .W E? , ,, i ,a Gaste + Ausflfige : Arbeit K' J Mrs. Linda Hissam began another Calendars. ? year as German Club advisor with the same energy and enthusiasm that she had when she began the organization eleven years ago. Helping her organize activities were the 1981-82 officers: President Bob Peckham, Vice-President Brett johnson, Treasurer Dayna Cooke, and Secretary Lynn Stauffer. This year's German Club showed a definite increase in both membership growth and unity in group activities. The students began with an initiation ceremony on Fort Myers Beach and soon attacked each project with a spirit of invincibility. After initiation, the club started their fund raising projects. The annual Gum- mi Baren sales and Christmas Candy- Grams proved to be great successes. Christmas was also the time for the sale and distribution of German Advent All work and no play was definitely not the rule for members of the German Club. The Foreign Language Skating Party and the German Christmas Party were just two of the popular social outings for members. The trek to the Heidelburg Castle in Sarasota to enjoy an authentic German meal and the marvelous dancing and entertainment was educational and enjoyable. The biggest event for the German Club came during Easter when students from West Germany visited our campus. Those foreign guests were taken to Walt Disney World, the Everglades, and the Asolo Theater in Sarasota. Perhaps though the highlight of their entire trip was attending North I-Iigh's Prom. This gave them a real glimpse into an ex- citing evening in an American teenager's social life. Organizations f 65 Roving Reporters Room 23 took on the appearance of a journalistic complex during fourth and fifth periods daily. It was here that the Knight Life, North Fort Myers High School's student newspaper, came alive. Mr. Allen Caraway, Knight Life spon- sor, pushed the staff to publish ten monthly issues of the paper during 1981-82. The newspaper, produced completely by Iournalism I and II students, reflected the creativity of the staff and the flavor of life at North High. During the 1980-81 school year, a press center was obtained which greatly reduced the monthly production cost of the Knight Life and offered the staff an opportunity to become more completely involved in the actual production of the newspaper. This center, consisting of two typesetting machines, a headliner, a light table, and other equipment, allows the staff to completely set up each issue of their paper. The only thing not actual- ly handled by them was the press run. Being a member of the Knight Life staff was a large and serious respon- sibility. Everyone had to pitch in selling ads, interviewing students and teachers, searching for unusual articles, covering sports, organizational, and social events, and writing, rewriting, and then editing their creative efforts. The rewards were tremendous though as each issue was produced and they saw their work recorded in print and enthusiastically read by the entire North High family. 2 1 - Processing headlines, Lisanne Banta looks over the machine's read-out. 2 - Michelle Waser works on the new typesetter. 3 - Mr. Allen Caraway super- vises his staff during paste-up at the light tables. 4 -- Knight Life Staff IL to RJ: Front Row - Michelle Mease, Tami Parker, Diana Bishop, Allen Caraway, Debbie Hills, Connie Burke, Back Row - Dusty Boyd, Stacy Williams, Elizabeth Corbitt, Laura Flem- ing, Komona McGriff, Lisa Long, Linda Iacobson, Tammy Mattox, Marshall Upshaw, Mike Tam, Lisanne Banta, Troy Simons, Steve Maitland, Michelle Waser, Wade Smallwood, Shawn Lingle, Ed Ieleniewski, lim Thompson, Tamara Bragg, Richard Alfano, Paula Howze. 66 X Organizations -if .ff A. 1 5 l 1 5 , fi iEZ32iE33iiE?' -n-n.....,, W 7 fm 9 1 - 1982 Excalibur Staff: IL to R1 Kneeling - Ienny Nicks, Doreen Makar, Tami Parker, Diana Bishop, Nichole Vracar, Valarie Nottingham. Standing - Mrs. Martha Richardson, Todd Mik- kelson, Michele Markovits, Ioe Fortini, Cindy Es- quivel, Karen Bussey, Mike McQuinn, Donna Schoneman. 2 - The Excalibur staff gets together for a work session. 3 - Staff members Ioe Fortini and Marie Kapcin discuss layout designs used in last year's Excalibur. 4 - Checking for mistakes in copy is Excalibur Art Editor Doreen Makar. fl Medieval Magic The magical days of knights and their ladies in the medieval times of King Arthur, live on at North High through the literary magazine, Excalibur. Named after the legendary sword Ar- thur used to right injustices dur- ing his reign as King of England, North's Excalibur is used to showcase the creative talents of student writers, poets, and artists. The Excalibur staff, under the direction of Mrs. Martha Richardson, solicited the con- tribution of original stories, ar- ticles, essays, poems, and draw- ings from the students at North throughout the year. The staff then proceeded to turn this pot- pourri of creative efforts into an attractive edition of the annual magazine. Our modern day knights spent hours designing layouts, reading, editing, and typesetting copy, and choosing and prepar- ing original artwork and photographs. They were involv- ed in all stages of production, even to selling advertisements and securing contributions to finance the production. Their reward came with the publica- tion and sale of the magazine in the spring and the knowledge they had helped budding writers, poets, and artists see their original efforts in print. Excalibur's Editor Diana Bishop, Assistant Editors Terri Cochrane and Michele Markovitz, Art Editor Doreen Makar, Photo Editor Ienny Nicks, Poetry Editor Mark Kinder, and Publicity Editor Mil-fe McQuinn worked with their staff in producing an outstanding magazine for North High 1882. It was enteraining, innovative, and something that all Red Knights could enjoy with pride- Organizations f 67 1 - F.F.A.: IL to Rl Row 1 - Danielle Curry, Sheryl Miller, Tiffany Touchstone, Vickie Helms, Kim Rudnik, Dorothy Roberts, Mike Roe, Bill Kurz, Linda Larson, Tracy Mann, Teresa Landress, Eric NeSmith, jimmy Bayliss, Sonja Kelly, Ioyce Deaver, Kevin Kelly. Row 2 - Ricky Whitten, Robert Hammesfahr, Ioel Corbin, Shirley Stewart, Bobby Harrell, Tami DeBrule, Shad Dean, Ioby Gay, Craig Giovan- nelli, Greg Marinell, Rick Woodall, Rick Eash, Wayne Pearce. Row 3 - Kevin Snyder, Delisa Carter, Kim Moody, lim Rowan, james Holland, Ion McMann, Greg Thompson. 2 - F.F.A.: IL to RJ Row 1 - Tracy Mann, Ioby Gay, Linda Larson, Robbie Noble, Mercie Welch, Cathy Edwards, Mandy john, Mende Hughes, Carol Petry, Dawn Matson, Brady Scott, Cheryl Bauchert, Robyn Bowker, Gary Richardson. Row 2 - Teresa Landress, Blaine Touchstone, Nina Adams, Staci Ludwig, Teresa Hanson, Wende Hughes, MaryAnn Karn, jim Hepp, Billy Smith, Linda Smith, Lana Flint. Row 3 - Wayne McKibbins, Robert Pohle, Craig Giovannelli, Bill Kurz, Tim Corkhill, Scott Fussnecker, Sharlene Whidden, Scott White. 3 - The prize-winning F.F.A. float. 4 - The F.F.A. corn-on-the-cob booth was a culinary and financial success on Homecoming Field Day. 2 sg f 1 Sod-busters and Cattlemen Future Farmers of America continued as one of the most popular and rapidly expanding organizations at North High during 1981-82. The continuous guidance of Ms. Nancy Ward for the past three years, has enabled the group to develop leadership abilities and to spread their devotion to rural America throughout the community. The F.F.A.'s motto, Doing to Learn, Learning to Do was exemplified by members whether they were fund rais- ing, competing at the local or state level, working for their organization, school, or community, or just enjoying social events. This year they accepted the responsibility of organizing North's complicated Homecoming Field Day. 68 I Organizations Not only were they responsible for allot- ting refreshment booths and setting up the activity schedule, but when rain caused a last minute alteration in plans, they reorganized the entire event throughout the halls, patio area, and bus ramp. When F.F.A. decided to get involved, they went all out. During Homecoming their hot, buttery' corn-on-the-cob was again a itl attraction, and their float en- try garnished the blue ribbon. The F.F.A. Rodeo in December provided a full array of exciting events for both par- ticipants and spectators. Liquid soap sales, the continuous production and sale of produce and plants, and the an- nual drawing for a side of beef also add- E l s 5 -. nn X , 5 ,1 bl rj .W . 1 1,1 'S ii ' . X an ed dollars to their treasury. A major portion of the club's funds went toward their favorite project, an F.F.A. Leadership Training Center. This center will provide an educational and recreational environment for all con- tests, meetings, and seminars involving vocational agriculture members and personnel. Coordinating the F .F.A. activities this past year were President Linda Larson, Vice-President Bill Kurz, Secretary Tracy Mann, Treasurer Teresa Lan- dress, Sentinel Ioby Gay, and Reporter Craig Giovannelli. These officers and the other F.F.A. members made North proud it has a little bit of country on Orange Grove Boulevard. Stoppers of Extinction Green-Peace is a relatively new organization on the North High campus. The group is committed to helping its na- tional organization in halting international whaling, Canada's annual Harp Seal hunt, and Iapan's killing of the dolphins. The members of the club strove to help the national affiliate in their efforts to discontinue all of the above unnecessary and inhumane acts by raising funds to keep the public informed of these atrocities. During Homecoming Week, Green Peace sponsored a drawing. Tickets were purchased, for 1011: each, by North students and the lucky winner became the proud owner of an adorable, soft, white toy seal. The second prize winner received a smaller version of this cuddly creation. Donations from members and bake sales throughout the year also brought in money. Officers of this organization during 1981-82 were President Pam Hagie, Vice- President Terri Osborne, Secretary Iill Wallace, Treasurer Karen Snodgrass, and Coordinator Christy Boring. Their adviser was Mrs. Betty Kayusa, Science Depart- ment Chairperson. Best of luck to these dedicated students in Green-Peace in their truly worthwhile crusade. They have shown everyone that Red Knight concern reaches around the world. 1 ,M . kg, .- A ,gpm . an Q .3 will . . VV 4 R X.. 1 - Green Peace sold tickets for their toy seal drawing dur- ing Homecoming Field Day. 2 - Displaying the Green Peace t'emblem is member Susan Panrell. 3 - Green Peace officers, Terri Osborne and Pam Hagie talk things over with Mrs. Kayusa. 4 - Green-Peace: Row 1 - Karen Snodgrass, Terri Osborne, Pam Hagie, Iill Wallace, Christy Boring. Row 2 - Molly Brodeur, Maxine Soler, Francine Rubinstein, Sandy Holt, Iulie Crocker, Iohn Crawford, Steve Martin, Larry Ennis, Amy Austin, Phil Wagoner, Ioyce Malone, Mark Westra. Row 3 - Mrs. Betty Kayusa, Heidi Tietjen, Sue Clouse, Kim Clouse, Donna Bennett, Stephanie Dodd, Ioe Fortini, Sharon Hadsock, Sandy Hassenenzahl, Darlene Williams, Anita McLeod, Oui Hunter, Ellis Baumer, Ray Garner. Row 4 - Ieannine Dugan, Rhonda Mason, Tracy Crain, Rhonda Weber, Susan Panrell, George Parze, Dennis Anderson, Phil Perry, Diane Brazill, Iohn Kanell. Organizations X 69 Domestic Engineering The F.H.A., Future Homemakers of America, is a very popular organization at North High. All students, presently or previously enrolled in a Home Economics course, are eligible for membership. Under the guidance of ad- visers, Ms. Debbie Stotz and Ms. Linda Wilson, the club's program has grown to offer many different services to both the student and the community. Every year the club adopts an elderly, needy woman as their grand- mother. They see to many of her needs and make sure she is remembered on holidays and her birthday. Unfortunate children are also an important service project of the F.H.A. During the Christmas holidays members visited the Childrens Home in Ft. Myers to present gifts to these youngsters. Throughout the year the club held various fund raising activities which enabled them to continue their com- munity service projects. During this school year they sold cookbooks and posters, and ran the egg-toss contest during Homecoming Field Day. Leading the F.H.A. during 1981-82 were President Nanette Gill, Vice- President Tracy Iverson, Secretary Mis- ty Lovett, Historian Debbie Paulerson, and Treasurer Donna Howard. These able young ladies led their fellow club members in projects that would help others because they knew that positive community action enabled them to also improve their outlook on themselves. ' 1 :Gi 1 - F.H.A. President Nanette Gill enjoys play- ing backgammon in the fresh air and sunshine. 2 - F.H.A. members take a 5-minute breather before entering their float in the 1981 Homecoming Parade. 3 - A happy moment between big and little Red Knights. 4 - Future Homemakers of America: IL to Rj Sitting - Ms. Deborah Stotz, Ms. Linda Wilson, Susan Rensch, Toni Reist, Carletha jewett, Zana Auldridge, Nanette Gill, Tracy Iverson, Melissa Lovett, Debbie Raulerson, Donna Howard, Valerie Spikes, Michelle Stephens, Kamona McGriff. Standing - Tami Reist, Kim Finch, Darlene Sapp, Cheryl Martin, Lisa McAbee, Dawn Hepp, Cindy Petty, Robin Reed, Carla Howard. uafvztg 3 li 70 X Organizations f,-m'li Caution: Knights at ork The Cooperative Business Education lC.B.E.j program was operated during 1981-82 in conjunction,with the Future Business Leaders of America lF.B.L.A.j organization. Although enrollment in C.B.E. classes mandated membership in F.B.L.A., all other business education students were invited to join. This com- bined group, F.B.L.A.!C.B.E., offered students the opportunity to gain insight into various aspects of a business career. Through club, class, and individual service projects, the members gained skill in the job oriented fields of typing, shorthand, stenography, filing, account- ing and human relations. They were in constant demand to type, reproduce, and collate programs, newsletters, and mailings for North High and community groups. F.B.L.A. is a national organization with chapters in all 50 states. The North High chapter, led by President Debbie Stokes, Vice-President Doreen Graff, Secretary Kim Hughes, Treasurer Bren- da Massoth, Reporter Mary Massoth, Historian Kim Kibler, and Parliamen- tarian Beverly Stevens, stressed the im- portance of the concept upon which the national organization is based, the free enterprise system. All year members worked with their sponsor, Mrs. Becky Pacl, to perfect skills they would be tested on during their district, state and national competi- tions. This year's district meeting was held at Cape High. Students who placed in the top threeplaces in all contest categories advanced to the State Leader- ship Conference in Orlando in April. This 4-day meeting was an expensive trip for members, but their year long Avon sales helped to defray costs. Once a month F.B.L.A.!C.B.E. members left North for breakfast at a local restaurant. This was not a mere social gathering, but a time when they were enlightened by guest speakers on the various facets of the business world and the occupational opportunities available to them in the future. North's F.B.L.A. members joined their associates from all the other Lee County high schools in sponsoring an Employerflilmployee Banquet at the Cape Coral Country Club just prior to the end of the school year. It was their way of saying thank-you to the various members of the business com- munity who had shown their patience and understanding and taken these fledgling business leaders into their companies and businesses. 1 - F.B.L.A.!C.B.E. IL to R11 Sitting - Sherri Sullivan, Debbie Hills, Kim Kibler, Brenda Stres ing, Becky Crawford, Doreen Graff, Kim Hender son, Beverly Stevens, Kim Hughes, Desiree Golden, Debbie Stokes. Standing - Mary Massoth, Robyn Filkill, Karen Butsch, Debbie Roberts, Tracy Becker, Karen Tillie, Maureen McHugh, Brenda Massoth, Mrs. Becky Pacl. 2 - During a Mary Kay make-up session, FBLAXCBE members learned how to properly apply a new look. 3 - Selling Avon isn't all salesmanship as Robyn Filkill found out when she worked on the monthly group order form. Organizations X 71 orking ith Class The Distributive Education Club of America lD.E.C.A.l is a nationwide organization. North's chapter members, under the guidance of Mr. Robert England and Mr. Bruce Forster, learned to com- municate with others and to demonstrate pride in all their undertakings. ii D.E.C.A.'s elected officers for 1981-82 were President Ieff Dillon, Senior Vice- President Natasha Webster, Iunior Vice- President Karen Putman, Treasurer Kelly Crager, Secretary Wanda Brown, Parliamentarian Theresa Smith, Historian Gary Martin, Reporter Rose Reid, and Chaplain Rick McComb. During their two to three period classes, the thirty D.E.C.A. students explored the world of marketing and merchandising. Specific areas they received instruction in ranged from communication skills and I 5 I retailing to the more advanced fields of advertising, finance, credit, and real estate. They continually perfected their skills in the classroom and on the job. They entered the annual district competitions to demonstrate their proficiences. The com- petitions dealt with problems and situa- tions they encountered in the work field in which they had found employment. Win- ners at the district level then entered state and even national competition. Goals are important to all clubs and organizations. D.E.C.A.'s particular goal was to help their fellow students deal with their future, and to establish and promote PRIDE in themselves, their school, and the community. D.E.C.A. members felt the key to all success was positive thinking . . . to believe and to seek the extreme. 2 1 - During their two hour class period, DECA students study marketing and merchandising techniques. 2 - DECA President Ieff Dillon sells Natasha Webster some paper from the DECA store. 3 - i'Winter Reflections, a DECA fashion show, kept students entertained during their lunch period. 4 - DECA: IL to R1 Row 1 - Sherry Rudd, Debbie Zabinofsky, Matt Sturm, Ieff Dillon, Todd Oliver, Rick Mc- Comb, Dave Ryals, Robby Ower. Row 2 - Karen Putman, Theresa Smith, Robin Enf- inger, Tami Hottensen, Gary Martin. Row 3 - Mr. Robert England, Lisa Clark, Kelly Crager, Sylvia Cavazos, Latrice Blue, Rose Reid, Natasha Webster, Mary lane Barnes, Debra Gary, Robin Sylvester, Wanda Brown. 72 X Organizations 4 llllllllll if 1 i w pe 'hiflfilhi ' , .. WWUMHM 1 - Mr. Milner's D.C.T. IL to Rl: Sitting - Sandra Gurley, Harold Olmstead, Billie Monroe, Pat Diggs, Robert Rodgers, Ed Klapper, Iames Garner, Greg Thompson, Michelle Manuel. Standing - Mr. Frank Milner, Iames Beckos, John Ammons, Lloyd Sawyer, Greg Marinell, Chuck Gilbert, Dar- rell Beller, Ray Rowland, Randy Ross, Doug Gordan, Iack Trammel. 2 - Mr. Bohannon's D.C.T. IL to RJ: Sitting - Iohn Gibbons, Tony Land, Tari Burton, Dyan Cosby, Laura Bahrs, Denise Cody, Bob Shreffler, Ion Goodwin. Standing - Mr. Iames Bohannon, Robert Lawrence, Blaine Touchstone, Don Maxwell, Lyle Warner, Paul Petersdorff, Frank Kelly, Charlie Wise, David Rosario. 3 - Driving off to a D.C.T. breakfast are Paul Petersdorff and Ion Goodwin. 4 - Using their class time constructively to perfect skills are North's D.C.T. students. 2 S Learning While Earning D.C.T. is a state youth organization operating through public schools in Florida that at- tracts young people to careers through cooperative training. It is one of the oldest vocational work programs within the state. The purpose of D.C.T. is to pro- vide a vocational program with a diversified job outlook for high school students who wish to gain work experience in line with their future goals and in- terests, while still attending classes in their high school. North's D.C.T. students par- ticipated in a two hour block of class instruction in addition to a daily minimum of three hours on-the-job training. This was coordinated and supervised by their D.C.T. instructor and com- munity employers. The club aspect of the program involved fund raising projects, breakfast meetings, and district and state competition under the auspices of the State Cooperative Club of Florida At North High there were two Diversified Cooperative Train- ing fD.C.T.1 programs. One was taught by Mr. Frank Milner, the other by Mr. Iames Bohannon. Each group selected a president and vice-president who also served as representatives to district meetings. Mr. Milner's officers were Iohn Ammons and Darrell Beller, Mr. Bohannonis officers were President David Rosario and Vice-President Diana Cosby. In addition, Mr. Bohannon's class elected to name other officers to direct their activities. These were Secretary Denise Cody, Sergeant-at-Arms Ion Goodwin, Reporter Robert Shreffler, Treasurer Charlie Wise, and Social Chairmen Candis Glen- dinning and Tari Burton. D.C.T. students felt they had the best of all possible worlds, they earned high school credit for working in jobs of their choice, and received instruction in skills that would enable them to secure even better positions in the future. Organizations X 73 PRIDE DE PRI DE PRI DE PRI DE PRI DE PRI DE IDE PRI PR DE PRI PRIDE X CD f-+ D9 F6 Ph PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE srofffcurriculum srofffcurriculum sroff! curricul sroff FTI rriculu CU X wl- wl- STG rrlculum CU fl C curriculum srof ff I STG TJ 3. I Z iw,-fwf-M ' ' I iff' - f 7'-YKQIHZ4, , 2: fe, ffgiegff - flislffff, srofffcurriculum sroff I curriculum srofffcurricul PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE P PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE 5 um srofffcurriculum srofffcurriculum stofffcurr Sfflffgrr Q 5 3 - n 53 S 5 Q. 5 C rn 3 'U 'ff 3 Q., F? f 'U 91 2 ,-5.3, S. Lunlnouino 14,1 HCIIXCICI EIGIXCICI Elfllldd EI l..l.I EQ -Q1 DD. is 3E bo. 5-I-I 125 EE Q5 2:02 D. SLU ago iv-,E l.l.l Jm srofffcurriculumg more PRIDE PRIDE E 5 Staff Curriculum Through the years North Fort Myers High School has earned the reputation of having a staff com osed of outspoken, determined, dedicated professionallperson- nel. They have come to North High from all over the country, bringing with them their individual strengths and academic acuteness. Thou h they have different backgrounds, interests, and ca agbilities, the are united in their determination to see tffat every student is given the opportunity to receive a uality education. North staff members willingly extend the hand of friendship to ,students and co-workers. They give their time, effort, and enthusiasm to see that thin s run smoothly and a mood of cooperation permeates Sue en- tire campus. No one is a stranger very long when they venture into Big Red Country. It seems one self-imposed requirement to employ- ment at North Fort Myers High School is to quickly ac- quire a red, black, and white wardrobe. Ioinin in the spirit of the Red Knight is one way for the staff to ac- c aim their PRIDE in the school, its students, each other, and the united education in which they all share. St ff-C ' I X75 Knights at the Top The Red Knight Castle on Orange Grove Boulevard is a well organized, friendly place for students and staff members to work and learn. Credit for this goes to the Knights at the Top. Mr. Edmund W. Stickles, Ir. is in his third year as principal of North Fort Myers High School. He runs the school with such outward ease that one often forgets the tremendous responsibilities and duties of his position. To him goes the task of co-ordinating all the special interests of the students, faculty, staff, and community so that North runs smoothly and provides superior educa- tional opportunities and experiences for all her students. Sharing the second level of command are Mrs. Harriett Bohannon and Mr. Steve DeShazo, Assistant Principals. Mrs. Bohannon's specific title is Assis- tant Principal for Curriculum. Her Mr. Edmund VV. Stickles, Ir. Principal 76 X Administration duties consist of preparing the master schedule, adjusting class loads, super- vising program changes and guidance problems, ordering and inventorying all textbooks, completing all local, state, and federal reports, overseeing all data processing systems, making faculty observations and evaluations, and reviewing, revising, and innovating cur- riculum. Even with her never-ending duties this lady remains continually calm and in control and always has time to stop whatever she is doing to help a student or faculty member solve their seemingly momentous problems. Mr. DeShazo, Assistant Principal for Administration, is usually seen out in the halls making sure everything is run- ning smoothly. Securing teacher substitutes, overseeing all maintenance, custodial work, and repairs, organizing and maintaining all locks, keys, and security systems, supervising all home athletic events and student activities, and observing and evaluating teacher performances are but some of the responsibilities of this head Knight. Mr. Robert Trombetti and Mrs. Virginia Cassell share the disciplinary chores that go with their positions of Dean of Students. Both handle these chores with the authority expected tempered by compassion and understanding. Mr. Trombetti, who joined the staff in the spring of 1981, is also charged with controlling the parking facilities and assisting at all home athletic events. Mrs. Cassell supervises all attendance procedures and the yearly production of the student handbook and chaperones many student social affairs. The North Fort Myers Advisory Board members, Ed Stickles, Principal, Dee Henry, student, lack Kleitz. community leader, Bernice Battle, faculty, and Tara Maxey, student, get together to discuss Red'Kn1ght business. Even the Knights at the Round Table can be nonnegotiable. AQ., Mrs. Harriett Bohannon Asst. Principal for Curriculum Mr. Steve DeShazo Asst. Principal for Administration Mr. Robert Trombetti Dean of Students Mrs. Virginia Cassell Dean of Students Administration X 77 Brain Drain A.P.'s lAdvanced Placementsj are courses designed for those students who are college bound. These courses give seniors a chance to take a step into college work while still in high school. Advance Placement classes in science, mathematics, foreign language, art, music, and English are taught at the various high schools in Lee County. At North Fort Myers High, Mrs. Carol Pim, Language Arts teacher, initiated and taught the first A.P. class this year. She gave her students a full year of col- lege level work emphasizing world literature the students from certain beginning college classes or places them in advanced honor courses. Grades in Advanced Placement courses are weighted as an incentive to enroll up- per level students. A grade of A earns 6 points, instead of the customary 45 a B earns 5 points, instead of 35 a C earns 4 points, instead of 23 a D earns 3 points, instead of 1. For the fourteen students enrolled in North's A.P. English this year, the content presented was new and demanding. The and critical writing. These classes help prepare the students for National Advanced Placement Examinations. An acceptable grade on these tests exempt 1 - Shawn Lingle, Lynn Stauffer, Robyn Bouch, and Chris Meyers know that it takes lots of books, long hours, and brain power to pass A.P. English. 2 - Louise Adams and Lisa Finley talk about a Knight at the theatre seeing A Streetcar Named Desire. vw- difficult work and the extra time required helped them master advanced skills and should prove advantageous as they en- counter future academic challenges. .ffzffff 3 78 X Staff - Curriculum Z gli, Mr. Anthony Ambrosia Custodian Mrs. Terry Andrews Language Arts: Sophomore Class Sponsor Ms. Candice Arndt Bus Driver Mr. C. Howard Baier Work Experience, Employment Skills Mrs. Bernice Battle Librarian, Iunior Class Sponsor Mr. Bill Bauman Sophomore Class Counselor Mrs. Kathryn Benkatar French, Spanish, French Club Mr. Howard Benneit Bus Driver Ms. Marsha Bishop Biology: Asst. Coach Varsity Girls Basketball Mrs. Marie Bitter Principal's Secretary Mr. Robert Bjurstrom Alternative Education: Math, Civics, American History, A vs. C Mr. Iames A. Bohannon D.C.T.g D.C.T. Club Mr. lack Bovee American History, Geography, World History: Social Studies Department Chairperson, Sophomore Achievement Program Mrs. Virginia Branson Compensatory Education Language Arts, Yearbook, Lance Adviser, Quill and Scroll Mrs. Iohnnie Burger Cafeteria Mrs. Ella Butsch Math Aideg Wrestling Cheerleader Sponsor Mr. Allen Caraway Speech, English, Iournalismg Knight Life Adviser, Quill and Scroll Mrs. Iuanita Carrillo Bus Driver Mr. Ierry Chestnut Math, Geometry Mr. Steve Conley Health: Head Coach Varsity Boys Basketball. Mrs. Peggy Cooper Data Entry Clerk Mrs. Mapi Cuevas Chemistry, Physical Scienceg Fresh- man Achievement Program Mrs. Liz Culleton Family Living, Family Economics, Fundamental Home Economics, Foods and Nutrition, Clothing, Y.A.C. Mr. Robert Curry Algebra I, College Review Mathg Asst. Coach Varsity Football Staff- Curriculum f 79 Mr. Iames Davis Sites Crew, Asst. Coach I.V. Football Mrs. Nancy DeShazo Occupational Specialist Mrs. Bobbie Dewey P.E., P.E. Leadership: Coordinator of Girls Sports, Activities Director, Equity Coordinator, Student Advisory Committee Sponsor Mr. Leroy Dewey Psychology, A vs. C: IV Volleyball Coach, Boys Golf Coach Mr. Millard Doss Building Superintendent Mrs. Susie East Bus Driver Mr. Robert L. England Marketing and Distribution, D.E.C.A. Mrs. Dorothy Evans Physical Education, Physical Edu- cation Department Chairperson Mr. Iames Farrell Environmental Science, Alternative Education Science 1 g , ...eww ., 1 f mmwafmg ,M L, f - ,aaa iw' 1 W'sfm..lf5f,l'l' wgpx aw? ,4 ,gl f 1 1 - Kellie Rex helps Heidi lager leave the climb- ing tower. 2 - Big Red Knights provide helpful pushes in our child care program. 3 - Amy Browskowski tries for a perfect 10 on the balance beam. 80 X Staff- Curriculum Kiddie Knights Five years ago Room 9 at North Fort Myers High School was renovated and redecorated. Under the careful supervi- sion of Ms. Linda Wilson, Home Economics Department Chairperson, a juvenile world of miniature furniture, out- door play equipment, toys and tricycles suddenly appeared. The school within a school was born, The Little Red Knight Playschool. Boys and girls ages three and four are eligible to be enrolled in the school for a monthly fee of 354000. Only eight little ones can be accommodated so there is always a long waiting list for any openings that may occur. North students may enroll in Child Care classes as tenth, eleventh, and twelfth graders. The pre-requisite course is Human Care Services, an Introduction to Child Care. In class they receive instruc- Mr. Ted Ferreira Driver Educationg Head Coach Varsity Baseball, Asst. Coach Varsity Foot- ball Ms. Charleen Fischer 9th and 10th Grade Compensatory Education Language Arts, Reading for Pleasure, Freshman Class Sponsor Miss Margaret Flaherty Spanish, Spanish Club, Foreign Language Department Chairperson Mr. Bruce Forster Work Experience: Cooperative Business Chairperson Mrs. Linda Fowler Compensatory Education Language Arts, English I Mr. Stephan Frank Art, Ceramics: Asst. Coach Boys Varsity Basketball Mrs. Linda Futral Librarian Mrs. Norma Garrison Cafeteria Ms. Beverly I. Gaudelli Healthy Freshman Class Sponsor tion in all aspects of caring for and teaching these tiny tots. When their initial training period is completed, they are ready to assume the role of teacher's aide and continue to perfect their skills by working directly with the children on a daily basis. Playschool Directors, Ms. Wilson and Ms. Deborah Stotz, oversee the entire operation. They assure the safety of our smallest students and see that they receive continual growth experiences in language arts, science, mathematics, music, arts and crafts, etiquette, social interaction, and physical activity. Lots of fun and tender loving care com- bine to make these first school experiences happy for our littlest Red Knights. Our big Red Knights profit too by preparing for their future and experiencing the satisfac- tion of helping a child grow and learn. Staff- Curriculum X 81 Mr. Fred V. Gebhard American History, Civics: Senior Class Sponsor Mrs. Shirley Gebhard American Literature, Composition, Power Reading: Senior Class Sponsor, Sophomore Achievement Program Ms. Andrea Iean Getzlaff Drama, Speech, Compositiong Drama Club, Thespian Troupe 2519, Flag Corps, Majorettes Mr. David Giompalo Industrial Arts, Student Government, Industrial Arts Chairperson Mrs. Reggy Grime Cafeteria Mrs. Iune Herrell Senior Class Guidance Counselor Mr. Lynn Hinkle Compensatory Education Mathematics, Head Coach Varsity Volleyball Mrs. Linda Hissam World History, German 1, 2, 3, 4, Pass- portsg German Club, German-American Partnership Program Mrs. Lynette Hitzing A.V.-Media Aide Mr. Ron Hoover Study Hall, Internal Suspension, Athletic Director, Head Coach Varsity Football, N Club Mr. Wade Hummel Internal Suspension, Driver Education, P.E.3 Asst. Coach Varsity Football, F.C.A. Mrs. Pauline Hutchison Clinic Aide Mr. Sylvester Isaac Physical Science, Earth Science: Coach IV Girls Basketball Mr. Charles lager P.E. Mrs. Suzanne Iager Speech, American Literature, Lang. Arts 93 Forensics Mrs. Pauline Iarvis Cafeteria Mr. Wayne Iensen ESE Civics and Math: Coach IV Base- ball, ESE Chairperson Mrs. Betty Kayusa Biology I, Biology IAQ Green Peace Science Department Chairperson Mr. Michael F. Kayusa Industrial Arts Mr. Robert Kayusa A vs. C, Civics Mrs. Wayles Kimpland Iunior Class Counselor Mrs. Ioyce Lamm Attendance Secretary Mrs. Ianice Longfellow English I, Composition, American Literature Ms. Ioanne S. Matson Compensatory Education Mathematics, Consumer Math, Iunior Class Sponsor Mr. George Mayo Civics Mrs. Iune McConville Guidance Secretary Miss Sandra McCready Typing I, Personal Typing, VCT, IV Cheerleaders, Asst. Swim Coach Mrs. Sonya McDaniel Dean's Secretary, A.D.'s Secretary Mrs. Lynne McDill Human Physiology, Biologyg Spirit Club Mrs. Diana Mendez Language Arts 9, American Literature, Composition, Speech 82 X Staff - Curriculum Technology for Today CLS:F:1:IF, L1 D 50, or Y3 D 0, or C2 P 50 then GOSUB 700 . . . intrinsic function, hexadecimal number, band, alphanumerics. Do you know what that equation represents? Do you know the definitions of these terms? Maybe you think the definition of argument is a discussion in which there is a disagreement, but in computer terminology it real- ly means the value which is supplied to function and then operated to derive a result. Still interested? If you are, then computer technology could be a part of your future plans. - Hopefully in the near future North High will offer classes revolving around computers. Presently there are six computers on campus. Four are located in the Business Department, two of them being business models composed of a printer and disco drive. Mrs. Becky Pacl, C.B.E. instructor, feels these computers have not been used to their maximum potential because students do not know enough about them and thus have not expressed their interest. The Mathematics Department owns the other two computers. Mr. Steve Wise, Advanced Mathematics teacher, had four students enrolled in an independent computer study this year. The big disadvantage to this was that by working on their own they were not able to get continuous attention from the instructor. In order to have a regular computer course next year sixteen students must preregister. So if you want to get a step ahead of your classmates and take a step into the world of the future, computers may be the answer. Linda Larson programs the computers, while Iodi Iohnson and Sharlene Whiddon look on. Staff - Curriculum 1 83 Physics, Earth Science, Biology, Sophomore Adventurous Apprentices Many high school students look for alternative ways of gaining an education and preparing for the future. One way students do this is by attending the Lee County Area Vocational Technical School. ' Of the 530 students that attended Lee Tech during the 1981-82 school year, 177 were high school students and 48 were from North Fort Myers High. Even though these students attended voca- tional school, they were still very much a part of North. They took part in North's extracurricular activities and ultimately returned to North to graduate with their class. Students at Lee Tech can expect pro- fessional instructors, small classes, and individualized learning experiences. It, like all area high schools, is accredited by the Southern Association of Colleges and Schools. Applicants must be at least Mr. W. Milton Meyer 2.3. . Engineering Drawing I, II, Archi- y tectural Drawing Mr. Frank Milner ' D.C.T., D.C.T. Club A Miss Melody Mitchitell 1 A Freshman Guidance Counselor, Cross 1 Country Coach, Varsity Cheerleaders, Track Coach ...J ,,Z7:,:' Q' f. .f,.W,.. .1 - . Mrs. Elmarie Moore Custodian Mr. Stan Mulford Community Education Coordinator, Key Club Mrs. Rachel Murray American Literature, English Lit- erature, Language Arts 95 Senior Class Sponsor sixteen years of age and once accepted must attend Lee Tech full time. The school year corresponded with all other Lee County schools, though the class hours were from 7:45 a.m. to 1:15 p.m. Lee Tech offers thirty different courses of study. Some of the courses taken by North students are Drafting, Automotive Repair and Refinishing, Automotive Mechanics, Cosmetology, Diesel Mechanics, Machine Shorthand and Secretarial Occupations, Plumbing, Printing and Graphic Arts, and Radio and Television Service. Upon completing their training at Lee Tech, students are assisted in locating permanent employment. Most students who attend Lee County Vocational School find it the best of two worlds, they learn a trade while still attending highschool. ' T i' 1 Y -Mu 1 ,- ,' - ,X 4 ,J 1 , ,I W , , -1 ,M ffam, , IKVV , ' , ,,.,' , '1' t. .' 1 , 1 1 fwaif ' f' . 21.-A , 'iv f Q f if ,, . 4 1 f A Mrs. Pruella C. Niver Voice, Chorus, Business Math: Chorus Mrs. Emilia 0'Grady Class Sponsor Mrs. Becky Pacl C.B.E., Advanced Typingg F.B.L.A. 84 X Staff - Curriculum ,Al 1 - Tami Green sets about to give a customer that curly look. 2 - Is Paul Spicer in a draft? No, he's drafting his future at the Lee Votech. 3 - Diesel engine mechanics, Chris Spillman and an assistant, are learning a life-long trade. 4 - Nancy Mof- fler perfects her secretarial skills for a future in the business world. XB 3 4 11121 V J Mr. Thomas Pacl Accounting, Law, Business Mathg Girls Softball Coach Mr. Iohnny Pate Earth Science, Physical Science: Head Coach Girls Varsity Basketball, Boys and Girls Tennis Coach Mrs. Mildred Perkins Business Math Mrs. Carol Pim Word Power, English Language, Advanced Placement English, Vocab- ulary, Humanitiesg National Honor Society Mr. Don Plunkett Security Guardg Athletic Trainer Mrs. Iulie Previty Compensatory Education Mathematics: Mathematics Department Chairperson Mr. Roger Pritchard P.E.g Asst. Coach Varsity Football, Wrestling Coach, Track Coach Mrs. Pat Radomski Compensatory Education Language Arts Aide Mrs. Anne Ragland Composition I, American Literature, Reading for Pleasure Staff- Curriculum f 85 Sagacious Students So what if the National Honor Society is restricted to juniors and seniors with a 3.5 or above scholastic average? Now there are forms of this type of honor group formed at North High for freshmen and sophomores with high grade point averages. Mrs. Mapi Cuevas is the adviser for the F.A.P., Freshman Achievement Program, which began during the 1980-81 school year. Its membership is limited to ninth graders with a 3.5 average at the end of the first grading period. Mrs. Shirley Gebhard and Mr. lack Bovee share the respon- sibility of heading the S.A.P., Sophomore Achievement Program. The same scholastic requirement as that of F.A.P. is required for S.A.P. After each nine-week grading period, those students who fall below a 3.5 grade average are put on probation Seldom is a student dismissed from either honor group, as the members are academically inclined and strive to retain their membership. F.A.P. and S.A.P. participate in many fund raising activities to help finance the field trips taken throughout the year. These trips serve to broaden the students' academic horizons. Membership in these two groups is designed to help college bound students prepare for future high level courses and academic excellence. They are important steps toward the goal of future membership in National Honor Society. JW? 'Q Iamie Black and two assistant mad scientists work diligently in the I.P.S. lab. 86 X Staff- Curriculum '96 Mr. Iames Repp Geometry, Applied Geometry, Con- sumer Mathg Head Swim Coach Mrs. Martha Richardson English IA, Composition, Language Arts Department Chairperson, Quill and Scroll, Excalibur Mrs. Louise Rogers Cafeteria Mr. Alan E. Saunders ESE: American History, A vs. C, Science SFC Iames Scofield IROTC Mrs. Appie Scott Business Education, Typing I, Shorthand I Ms. Betty Sheffield Clerical Office Practice, Personal Shorthand: Business Education De- partment Chairperson, F.B.L.A. Mrs. Beverly Silvester Cafeteria ' Mr. Levon Sims Art, Art Department Chairperson, Head Coach IV Football, IV Coach Boys Basketball Mr. Walter T. Skiff Calculus, Trigonometry, Algebra, Consumer Math: National Honor Society, Girls Golf Coach Ms. Nancy Soelberg Alternative Education English and Speech Mr. Keith Stark Stage Band, Concert Band, Symphonic Band, Marching Band, Intermediate Band, Music Department Chairperson, Band Director Mrs. Eloise Stearns Bus Driver Mrs. Barbara Stevens Cafeteria Mrs. Bertha Stevens Lunchroom Manager, Youth Advisory Council Mr. Richard Stevens Language Arts 9 Ms. Deborah Stotz Vocational Home Economics, Child Care: Future Homemakers of America Mrs. Connie Taylor Assistant Bookkeeper Mrs. Ianet Thomas Head Bookkeeper Mrs. Barbara Vagle Librarian Aide Mr. Mario Verde ESE Mathematics Mrs. Andreina Walters Bus Driver Ms. Nancy Ward Agriculture, F.F.A. Mrs. Carolyn Whitehurst ESE Health, P.E., Mathematics, Biology Ms. Terry Wieland Occupational Specialist: Boys Cross Country Coach Mrs. loAnne Williams Cafeteria Ms. Linda Wilson Child Care Services, Child Develop- ment, Home Economics Department Chairperson, F.H.A. Club Mr. Phil Woodard A.V. - Media Mr. Steve Wise Math, Algebra I and II, Computer Programming: Asst. Varsity Baseball Coach Mr. Iohn Yeomans Civics, Law Studies Staff - Curriculum X 87 Moonlight Madness Many North students believe that teachers have no life outside of their 7:00 a.m. to 2:00 p.m. school day. This is far from true, Although a large portion of their day is tied up in teaching, class preparation, and paper grading, their lives away from North are as varied as those of their students. Money has long been a problem for teachers. On a teacher's salary scale, many find it difficult, if not impossible, to support their families. Moonlighting, the practice of securing another full- time or part-time job after a regular working day, has long been a necessity for many teachers. They clerk in stores, sell real estate, run their own lawn care or landscaping businesses, become bartenders or waitresses, paint houses, lay tile, make commercials, style hair, or work at a multitude of otherfnon-school related positions. Some teachers do use their professional skills to secure addi- tional income by teaching evening classes through the Adult Community School Program, tutoring, coaching, or refereeing and umpiring athletic events. A teacher's education never ceases. Additional degrees or recertification re- quirements keep them returning to the classroom evenings and Saturdays as students. The University of South Florida, Nova University, and Miami International draw the majority of teachers during the regular school years, but in the summer months faculty members attend colleges and univer- sities all over the Country. During their leisure time staff members like to do things that enable them to gain personal satisfaction. Physical activity rates high on their list and may be as vigorous as a 5-mile run, a fast game of handball, or a grueling workout at a local health club. Others may prefer a less strenuous routine and look forward to camping with their family, a few hours of quiet fishing, or a weekend sail upon the sparkling waters of Southwest Florida. As with all adults, the faculty 1 - A good sales pitch by Ms. Charleen Fischer gets her another account. 2 - Mrs. Nancy Ward lets her nature charms catapult her into the landscaping business. 8 I Staff- Curriculum 2 I . .. , -V 1 - Mr. Iim Farrell announces his second career via the radio waves from 96 Super-Q. 2 - Mr. lack Bovee is hoping to make some extra Penney's with after school employment. 3 - After conferring with the captains of the Bishop Verot and Evangelical Christian volleyball teams, Ms. Peg Flaherty and Mr, Leroy Dewey will begin judging others. Staff- Curriculum f 89 ? 'x 3 I 7 ? 8 V, ' Mm-Aw 2 90 X Staff - Curriculum 'S 1 - Besides running after students all day, these staff members have enough energy for a 5-mile workout. 2 - Teachers now become students as they attend graduate level classes at Nova University on Satur- days. 3 - Aside from teaching together, the Pacl's also have a racket on the court. 4 - First Mate, Mrs. Carol Pim gets ready to set sail with the skipper, Mr. jerry Pim and crew member Iason. 5 - Mrs. Sonya McDaniel can run the barrels just as well as she runs her position as Secretary to the Deans. ,,. .. . .,,, L , , Z 51 Moonlight Madness members must perform the less exciting routine tasks of daily life. Chores such as shopping for groceries, maintaining their residence, cooking meals, doing the laundry, supervising their children, and running numerous errands may not be exciting, but are all necessary. Several members of the staff also find time to devote to their favorite charities, civic organizations, or churches. They can be found coaching Little League, teaching Sunday School, singing in the church choir, working as aides at the local hospitals, driving the elderly to the grocery, or soliciting donations for M.D.A. or the Heart Fund. As good citizens of their county, state, and coun- try, they stay informed on important issues and support candidates of their choice by voting on election days, No matter where North Fort Myers High School staff members spend their off campus hours, you can be sure they are representing themselves and our school with dignity and pride. Our faculty is composed of professional educators and this professionalism makes them very special Red Knights. a,, fn KL! 1. PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRI underclossmen underclossmen underclossmen PRIDE Ll.I Q 1 C 0- CD Lu 5, Q 3 E 'Q QIIH IERS CD Lu Q 13 if 1 5 D- C ' IIII i Lu GJ I,I,,,,II S I 2 E fl 3 Lu E Q 8 QC fl S E C E CD Q- 5 Lu cn Q -E-3 Q, GJ PRIDE underclossmen underclossmen underclossmen PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRI DE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE underclossmen underclossmen underclossmen E C 'U a 2 , Q2 rn 3- 'U I Um 1 U' U I'l I I 3 FD . 'U D . I 7 d I men underclossm U -fIQ un eff: Q55 I'l'I L. CD E PRIDE PRIDE PRIDE PRIDE e Q 3 Lu C Q Underclassmen GJ m The most important people at North Fort Myers High E Q- School are the students. They are the purpose of North's creation, they are the reason for her continued ex- U1 Ll-I istence. They are here to learn and to develop needed Ln skills, values, knowledge, and ex eriences, that will Q Q enable them to enter society as productive, happy, con- Lj 1 tributing adults. L. During their four years as high school students, young GJ D- people undergo tremendous changes. As freshmen, they -O enter our midst with the blush of childhood still on their C Lu gheeks, eagler to enterlthis world of semi-adulthood, to cc te on otegro . D Q eVl1lhe31Iij theyesreagh their sophomore and junior years, K weualready see the shadow. of maturity creeping into their a pearance and behavior. Now to prove their 1n- C 5 Q- depen ence, to be recognized and appreciated as in- CD dividuals is becoming more and more important. E I-LI North's underclassmen are important to her, they are in Q all the ufreslilmen, sokphognores, and juniors, present and in ..-. upcominggt ey are er uture. G 1 - D. U X-I GJ Ll.I 'O Q C 1 underclossmen :Q Q. DE PRIDE PRIDE PRIDE Underclassmen X 9 94 X Freshmen Each fall North Fort Myers High School opens her doors to a new group of very special people, the Freshman Class. They arrive, eager to be absorbed into the hectic high school routine. After two weeks of adjusting to their class schedules, the ninth graders were called to the gym to meet the administration and have the rules of NFMHS clarified. Then their class sponsors, Ms. Beverly Gaudelli and Ms. Charlene Fischer welcomed them to the wonderful world of North and stressed how much more they would enjoy it, if they would par- ticipate in the athletics andfor ac- tivities offered to enrich their academic life. Brian Aalto Kimberly Adams Lisa Adams Nina Adams Beverly Addison Marsha Addison Denay Alfred Brian Ambler Iackson Amerson Rhonda Archer Michael Ashcraft . A A Barbara Asher t . -. Steven Asselin ,,,,, ilis t wifi I vs Amy Ashton Freshmen rallied to the call and circulated petitions to run for class of- fices. When the balloting was con- cluded they had elected Iulie Szulczewski, President, Susan Smith, Vice-President, Iennifer Genesky, Secretary, Kallyn Harmon, Treasurer, and Lynn Truskey, Class Coordinator. ' These officers and their sponsors set to work immediately organizing their Freshman Executive Council. Before they knew it they were thrust onto the long train of Homecoming bustle. Ninth graders helped decorate the school by participating in the traditional window painting. Their artistry in color graced the side panels of the cafeteria door. Spirit and vitality increased as they entered the Homecoming Parade and a small group produced and acted in their first pep rally skit. Quickly they were blending into a cohesive group. Building momentum as the year progressed, the first year Knights in- volved themselves in more and more activities as either participants or spectators. Each realized early seasoning would affect their future enjoyment at North High. Throughout their first year the freshmen attempted to channel their enthusiasm to complement the other classes. They knew they might not be 111 their first year . . . but they were certain everyone would know the Class of 1985 had arrived. Carrie Arciszewski ' i -'l'ff ffl- 2 'YW X , William Atkins Sherwood Ball Iulia Barber Linda Barksdale Donald Barnes M '4- Q. .-,: i L:,Ii:.fS.5 U ...... I I 'VVV ff 1 V',. 2.11: QVQV 1 5 stt r . A A. .V .gg i k t A V - . 'l 2 4 , . ,L17'V ' ' , ,. . ' L i'- - .' , ' Li-in V f T t' vtu I X U86 x 1 Freshman Executive Council lLeft to Rightj Front Row: Ms. Beverly Gaudelli, Randy Wyatt, Caroline Normandin, Karen Bussey, Denise Nolan, Valerie Nottingham, Lisa Gar- rett, Susan Smith, Kim Adams, Cindy Weber, Kallyn Harmon, Lisa Wilson, Lisa Adams, Ms. Charleen Fischer. Row 2: Simonne LaFrantz, Iulie Szulczewski, Toni Giffin, Staci Ludwig, Ienny Genesky, Amy Iuliano, Michelle Olson, Lynn Truskey, Dianna Heinkel, Stacy Williams, Beth Gurham, 2 - Freshman Class Officers: IL to Rl Lynn Truskey, Class Coordinator, Susan Smith, Vice-President, Iennie Genesky, Secretary, Iulie Szulczewski, President, Kallyn Harmon, Treasurer. -f7 3'7kQW6Z' fZ7Wf. . :fm v K ff! ,,.:2-' if 3 if iz ' f -40, . '- 212: , ' f, I 1 .. 1 'ww' V31 Q I 4' ' -in ef. g W- ' I . .5 ,Z W , Li.. 'W ' ' H , 26 1 , nf 4. fs J Af 9 .1 jg X I 1 'if Michelle Barnhill Cheryl Bauchert Michael Baudino Iulie Baumgardt Iames Bayliss Herbert Bechtol Christine Beckos Iimmy Bembry David Billings Vicky Bishop Glenn Bitter Iamie Black Candace Boring Annie Bostic Tony Bouie Robyn Bowker Marc Boyden Tamara Bragg Nathanial Brand Kelly Bridges Freshmen X 95 Reginald Bronson Tina Brooks AV A, Gary Brown ' A ff ,.f ' 9 IoAnn Brown ' Larry Brown .gf Marian Brown -V V : Robert Brown Hrvr . , l Tarsha Brown , i Blake Bryant as I Susan Burford 'yvz 4, .4 ,V,. 2 F Byrn Constance Burke Ioyce Burkes Karen Bussey William Canova Lorry Caputo Kimberly Carter Rodger Carver Ruth Cascio Maria Castaldo Marie Catania 1 96 X Freshmen E 1 - Adjusting to the hustle of North's busy schedule, the Freshmen find friendship in the hallways leading them to their next class. 2 - Freshmen find time for a quick get together with friends between classes. 3 - Locker dilemmas face freshmen Connie Burke and Randy Wyatt as she stretches to reach her locker and he crouches to open his. ' tif 'N Gidget Ceslok Lena Chance Shelly Chandler Anthony Chapman Mark Chester 2... Eric Christianson Iennifer Christy Felicia Clark Mike Clevenger Ioseph Clore Timothy Coblentz Brenda Conley - Carl Connors . Ieffrey Conrad Debra Conway 'Gym' Thomas Cook David Cooke Vicki Cooley Iulie Cooper Margaret Corbett x g 2 I' 5 , 15 x . XXQX I I i 1 v I ,,, XX EX ? is New Kids on the Block When the freshmen poured onto cam- pus in August they were confronted with a multitude of new faces, new ex- periences, and new challenges. This was very exciting, while at the same time, very frightening. Immediately they were instructed to report to homerooms. That alone, for someone who was unfamiliar with the school layout, was similar to engaging in a treasure hunt. Who knew where room 21 was? Why wasn't room 45 next to room 46? After finding their homerooms and receiving their schedule cards, the con- fusion continued. Why do I have math two different periods? Do they really teach English IB in the Orchestra room? When the bell rang and it was time to reenter the milling, smiling multitudes out in the halls, it seemed as if they had been thrust into a technicolor nightmare. So many people hurrying here and there, screaming hello to friends not seen over the summer. As the days slipped by, 9th graders quickly adjusted to the daily routine. They learned who to ask for help and who not to, how to get from class to class without being trampled, and to endure the gentle barbs from upperclassmen about their minute stature and lowly status. One problem continued to exist, no lockers were assigned. As each teacher assigned books, the student had no choice but to lug them all from class to class. Finally, after a month of school, locker numbers were assigned. To their dismay, many found themselves as- signed to a locker with strangers, or to one without a lock. As if fate were really against them it was inevitable that the tallest members of the class were as- signed the bottom lockers, while the shorter students got the top, higher ones. Though all the trials they encountered in their first year seemed quite over- whelming, they survived. Soon they began to look forward to next year, when as sophomores they could look with amusement at the bewildered faces of their successors. Freshmen f 97 ff .Q - 6' sf Michelle Core Sherie Counts Richard Crager Kimberly Culver Shairon Curry Deborah Cusic Travis Dantley Kenneth Davidson Carla Davis Darrell Davis Tyrone Davis Shad Dean Ioyce Deaver Iames Defaira Eric DeLong Ellen DeLyser Iames DeMoss Ieanette Dials Richard Dodson Dee Dockstader ' 1 Z x ,V , 53352 S 'ii 1 - Fun and car washing boost the financial situation for the Freshman Class. 2 - Beth Gurnham uses her sales pitch to get Mr. Frank to buy Christmas candles. v . -: .sq g. .112 few.-za '. ' . 1 - 27? 'ilzfw-ff?iff'Yif4f A 1. 12' N ,, W, Mr -w,g:g.. f' ' uf . ,:,:' '. .5 4. . W . J kd ',k V l 1 - 1 I sl rx i 2 Ywbfwm-...,..... fi Mini-Money Makers Soon after the Class of 1985 elected their officers and formed the Freshman Executive Council, they were called together to set their priorities for the com- ing school year. Ms. Beverly Gaudelli and Ms. Charleen Fischer, class sponsors, surprised the coun- cil with wonderful news. Upon graduation the previous Iune, the Class of 1981 had donated 8200.00 to the incoming Freshman Class treasury. Knowing they would have to finance all their ac- tivities during their four years at North High, they quickly formulated plans to add to this monetary nest egg. Bake sales, car washes, and a Christmas candle sale all proved to be successful due to the en- thusiasm of these newest Knights. When all their bills were paid, the ninth graders managed to end their first year with a healthy balance in their account. They had taken a giant step into their future while learning to work together and enjoy themselves in Big Red Country. Calvin Douglas Carla Dudley Keith Edge Sharon Ervin Shelia Erwin Cynthia Esquivel Donna Facella Patricia Fargnoli Brenda Flener Lana Flint 'An 'CID' Mark Flynn Iames Foriest Kenneth Foskey Elizabeth Frazzini Iohn French 191' Yvonne Frey Iohn Fuentes Angela Gainer Denise Gallagher Sandra Garcia Freshmen X 99 Alicia Garrett Sheila Garringer Iennifer Genesky Douglas Gibson Pamela Gibson Toni Giffin Susan Gilbert Roderick Gilyard Ieffrey Giunta Thomas Glenn David Goodwinn Scott Gordon Dennis Graves Carmen Green Thomas Greene ,yy MW at Z f ,fff V 72? f f ' A ii'i , fgsf., .5 'V' ,1 5 Q 4 iii Movin' Out, Movin' In, Movin' Up . . . Upon leaving middle school where they had been the top dogs, freshmen suddenly found themselves low men on the totem pole upon entering North High. For some this proved to be a perplexing experienceg others overcame this dilemma by immediately becoming involved in new and exciting activities. Using their natural talents, many freshmen found the athletic world was a rewarding one for them. Whether play- ing football, wrestling, cheerleading, or marching, they proved to be assets to teams and organizations whose memberships were composed mostly of upperclassmen. Some ninth graders chose to become active in exclusively freshman organiza- tions. The Freshman Executive Council and the F.A.P. prospered under the direction of dynamic young men and women. Musically talented freshmen found fulfillment in joining the orchestra, band, or chorus, while their counter- parts, whose interests lay in the theatrical vein, entered the fields of dramatics or forensics. Foreign language clubs drew a large percentage of their membership from the freshman class. As students perfected their skills in a second language, they found enjoyment in club functions. By joining the various teams, clubs, and organizations that interested them, ninth graders beganto feel they were becoming important members of the Red Knight family. Participation is an important part of belongingg and belonging hopefully leads to satisfaction and happiness. i 1 A 5 1 1 - Lori Pastirik adds flash to the Flag Corps as she does to high school dramatic productions when she is center stage. 2 - Freshman band members Lisa Wilson, Toni Giffin, Susan Smith and Amy Iulian march in style with Iunior Mark Arlington lsecond from leftj. 100 X Freshmen 2 ' S i V s ff X f X ' ff? 1 ,J , if f ff '44-aaa QU y ., 434, f f f 1 ,4 , f W f z ff 7 , , M f f fa W , ff 1 E 5 1 . I f f f f I 1 and 2 Athletlcally talented Rusty Wenrich and David Cooke made the Varsity Football team during their freshman Gloria Greenwood Dawn Greer Curtis Gully Beth Gurnham Norma Gutierrez Sarah Hale Iames Hall Scott Hall Patricia Hammond Kallyn Harmon Lori Harper Tina Harper Bobby Harrell Paul Harris Sheila Harris Tinita Harris Marlene Hart Iames Hayne Lori Hayworth Dianna Heinkel Vickie Helms Iacob Hemel Iames Hepp lose Hernandez Lisa Hernandez Iames Holland Michael Holmes 102 X Freshmen 1 - Coach lim Repp and Tracy Iordan discuss regional and state swimming times before she dresses for practice. 2 Freshman Cheerleaders Connie Burke and Tiffany Touchstone vigorously practice their routines. Richard Hornberger Susie Horne Katherine Horner Brigitte Horton Tryee Howard Karen Howze Mende Hughes Tammy Hunt Reggie Ivy Carolyn Iackson Felcia Iackson Wesley Iackson Iohn Ieleniewski Mark Ienkins Stephanie Iiles 1 R W ff ff W Z is V frf f , ff 7 4 f Amanda Iohn Ierry Iohnson Iodi Iohnson Karen Iohnson Kerry Iohnson M , W ,Il 'iwmvf 1 - Freshmen Kain Richmond and Brian Whitmore enjoy a moment in the spotlight at the Winter Sports Pep Rally. 2 - Four ultra-active ninth graders, Melissa Roof, Kathy Kuhs, Iulie Szulczewski, and Lisa Adams, stop for a few minutes of conver- sation during their busy day. 1' - f ff 4 , in vm 1 f 7 A, ' K 4 'fait ,sq Z 57, , , I - AVIII H ' 3:2235 A , A flu fl ,f 7 X V I ,VfV, lm VV V J, ' f 'W fwfr ftte 74, ' ' X 'f ' 1.11 , ff nJ9,fC ' f f',f, A I , f M- M, If gi A gf. , 5 y C l.,. if X nrfffzfz A Thomas Iohnson Anna Iones Delretta Iones Tracy Iordan Amy Iuliano Marie Kapcin Theresa Kappel Christine Karcher Mark Kaufman Iackie Keister Donna Kelley Kevin Kelly Michael Kelly Sonja Kelly Craig Kerik Hector King Todd Kirby Susan Kline Albert Knighton Pamela Kohn Freshmen I 103 Initiation to the Knights A new experience, a definite challenge, that is what Homecoming '81 was for the Freshmen. Within two months of the opening of school they found themselves in the midst of preparing for the biggest week of activities held annually at North Fort Myers High. Since these first year Knights had never before been involved in the multiple efforts asked of each class during Homecoming Week, they decided to limit their participation to those projects they felt they could accomplish. Number 1 on their list was the win- dow decorating contest. In two days they transformed the side panels of the cafeteria door to a colorful pro- clamation that The Green Wave Have Red Tide. During Field Day, the Freshmen limited themselves to an activity booth. Knowing the popularity of the Rubik Cube and arm wrestling, they staged contests in both. At the Homecoming Pep Rally, the Freshmen presented their skit entitled, Lady in Distress. The acting talents of Lynn Truskey, Randy Wyatt, and Ms. Charleen Fischer, Class Sponsor, helped them gar- nish a fourth place award. Homecoming '81 was an exciting one for the Freshmen. It gave them a tremendous introduction to Red Knight Spirit. 1 M if ,t,' 2 1 1 . Christopher Kosarich 1 ff Katherine Kuhs Simonne LaFrantz - 1 . Shauna LaPosta ' ' f 2 ., Donna Lampert 1 it f 5 ..,.' if Nw O7 Op V If , ,--r fi? ad' f y 46- f 4 Hn I M 4, X 1 Vf M ' Kimberly Lawton Gerald Leaphart Shannon Lee David Lemieux Stephen Lesh Terry Lester Sharon Lias Carol Lindhout Delores Linnon Kyna Lister Richard Long ,M Daniel Loughren t'g 4'5 Staci Ludwig , Patricia Luster , Brian MacDougall LA Lf 104 f Freshmen M K 211 f 1 L iz wx' ,Z 1, V45 Q is 6 W xt J.- 5 ' f X , 1 - North faculty member, Mrs. Linda Hissam, gets soaked due to the accurate throwing of a freshman during Field Day. 2 - Freshman Homecoming Court Representatives, Tiffany Touchstone and Mark Ienkins, circle the football field during the Pre- Coronation Parade. 3 - Big Red Pride spreads everywhere at North High, as proudly proclaimed by the Freshman Class in their window decorating con- test entry. LA 'Qi- '59 pf i sz, - avf2'fZf2'2 'ff , , WE , f - 41 ff, . My-vf4,5 V - f- 1 . .CQKTW A -N ,gi ,,,,,,V g ,, I A , ,K I- . L , V, y .,gv3, , u . 53, fy ,V , 77 .A 1,54 Z V tti,yt.y,l 'XY George Mach Robyn Maker Timothy Malone Michael Mann Frederick Marengo Amanda Marinell Loretta Marinell Charles Marquiss Laura Marsh Dennis Martin Kent Martin Stuart Martin Tommy Martin Dawn Matson Tammy Mattox Andrew May Homer Maynard Eleanor McCaffery Sunee McClanahan Charles McClure I Freshmen X 105 Wayne McKibbins Todd McLain Michael McQuinn Gary Melvin Todd Mikkelson Glenn Miller Tamara Miller David Milliron Pleshette Mims Serlene Minatree Scott Minnick Iennifer Moll Todd Moody Ronald Morgan Gregory Morris Angela Morrison Dawn Morrison Lisa Morrison Leslie Morrissey 1 106 X Freshmen 1 - Freshmen enjoy a quiet moment off the dance floor at their first Homecoming Dance. 2 - Randy Wyatt saves the day for Iulie Szulczewski by coming to her aid with a trusty can of Red Knight Spirit Disinfectant as they participate in the Freshman Class Skit during the pep rally. if I iz 1 2 !y!1!. 'fi Q-1 ,Q ff 1 ,A xf7A 'Xu . I A ,e t , f 'X Y ,, ' 'Cf ., 4.f 1 5 gi J Eggs, ' I Q . t nur , a ,, ' 'I 'ff 1, ' .J V, a V 4 T , wwf, i ,ills sk, 'ji 1 65 x t f Duane Nash Mary Neal Ioe Nelson Eric NeSmith Denise Nolan Caroline Normandin Forrest Norton Valarie Nottingham Michelle Olson Carla Palmer Paul Parker Lori Pastirik Stephen Pate Kathleen Paul Iames Pearce r . 9 ,Q . f ff ,f f , f, f f 1 1 1 W V' J ' . f f f wwf ,Q , i ff 'P 'ff ,iff A, 4 ', , , qi' if A ,, ,X '. K ff , i,, ,' f A f f f ff ff fi ,ff X f 1 Qi? QW A0 y45wW,7fQ'f'z1' 'ff ' A . 0 2587? i isss i we if ff 1 fdiv- rrrr 5 Qi ,, MJ ff ff! f f 41,1 7 1 is 4 '? f Z X f fi , 2 - 446' 'iff' 'xx V I !!'! V Q! at ff? y 4 l Q I 1 f 1 , f W '2?, ,L K W f ,fy K , V. ' 445?Qj1 ,:. ' ,ff wry 1 f '- -454 g in 4 ,,,, f l , , fl f if X7 - aafx Brian Peisch Betsy Petry Carol Petry Anthony Pierce William Pierce Iennifer Poel Arlisa Powell Vivian Price take a few minutes to pose for the camera while participating in one of North's dress-up days during Homecoming Week. 2 - Coach Pritchard chauffeurs Mark Ienkins and Tiffany Touchstone in a unique Red Knight chariot during the Homecoming parade. 1 - Freshmen punk-rockers 1 - Linda Smith enjoys a few minutes with her Roan Ap- paloosa, KiKi. 2 - North High's very own Lady Knight leads the 1981 Homecoming Parade. 3 - Linda Smith and KiKi make a Knight-time appearance during football season. 1 2 108 f Freshmen Matthew Pritchard Amy Pulsifer Marie Quetel Frederick Raby Sherry Ramage Craig Ramsey Tangela Reid Tami Reist Lee Rhodes Kane Richmond Patrick Ritter Chris Roberts Rhonda Roberts Beverly Robinson Michael Roe Melissa Roof Carey Ross George Ross Melissa Ross Iames Rowan R M, 5, J 'Uv Us-4 ' AD- if Heigh-Ho KiKi! No one can say that the freshmen don't have spirit! A living example is Linda Smith, who masquerades as the helmeted Red Knight at our foot- ball games. Prior to enrolling at North High, Linda attended North football games and was impressed by Tami Ellsworth's exhibition as the Lady Knight. She became obsessed with the thought of becoming the Knight after Tami's graduation. When school began this year, she stopped by to discuss her availability for the job with Mr. Stickles and was given the go-ahead. A quick phone call to Tami secured the use of the costume as Tami wanted to see the tradition continued. KiKi, the white horse that Linda performs on, is her own. She keeps it on the five acres surrounding her family's home. Having had the horse, a Roan Appaloosa, for five years, she has appeared in shows at the arena with it for about a year and a half, already winning fifteen trophies and twenty ribbons. Great support from her parents and friends, Cheryl Bauchert and Dawn Minick, help make each performance run more smoothly. Her father helps her transport the horse in its trailer and her mother helps her don her costume and keeps it in good repair. The Lady Knight enjoys her role of representing the spirit of North Fort Myers High School. Her one wish is that every year more and more touchdowns will be scored, so she and KiKi can go thundering down the field more often. 1 I Kimberly Rudnik Christopher Sammons Linda Schoonover lack Scott Terri Scritchfield Febra Scudder .1 Michelle Selby L Andrella Seymore Donna Shoultz Troy Simons X Alicia Singletary Margaret Singleton Scott Singleton Monica Skinner Ted Skinner David Smith Iolena Smith Larry Smith Linda Smith Susan Smith Freshmen f 109 Tracy Smith Wayne Smith Kevin Snyder Debra Spencer Carrie Sproul Robert Stancil Terry Starnes Debra Stevenson Ieffrey Strecker Cindra Summeral Scott Sutton Danny Swindle Iulie Szulczewski Matthew Tanner Bryan Tatum Elgron Taylor Kimberly Thoman Pamela Thompson Paul Thompson Vanessa Thompson , i it fi fa . wt We Are Family The hand of friendship reaches be- tween students and faculty at North High and unites them in a close rela- tionship of common goals and com- mitments. This creates for all the feeling of family, of being at home among those who really care during the school day. Within this illusionary school family exists true family units. Many husband and wife combinations teach or work at North High: Mr. and Mrs. Dewey, Mr. and Mrs. DeShazo, Mr. and Mrs. lager, Mr. and Mrs. Gebhard, Mr. and Mrs. Pate, Mr. and Mrs. Pacl, and Mr. and Mrs. Kayusa. The Kayusas' son Mike also teaches at North, making them a real family of Red Knight teachers. Throughout North's existence on Orange Grove Boulevard, the children of North's staff members have attended as students. This year there were eight parentfchild combinations on campus. It's often difficult for these sons and daughters to remember, that while in the classroom their Mom or Dad is really Mr. or Mrs., and that the entire student body shares their parents with them. You see at North High We ARE Family! 110 X Freshmen ,iff ev f' . - X '-'. . - , tx 1 Q -1 ,,,. I -.-.. ,,- . V' .5 A ji 59? -'iv' t I 1 - Faculty members Mr. and Mrs. lager, Ms. Proffitt, and Sgt. Scofield proudly present their Little Knights who attend North's Pre-school. 2 - Family members who go to North together are forced to stick together. Pictured here are: IL to RJMrs. Ella Butsch and her daughter Karen and grandson Rusty Crager, Mrs. Marie Bitter and sons Glenn and Mark and daughter Kim, Mr. and Mrs. Iohnny Pate and their son Steve, Ms. Andrea Getzlaff and her daughter Lori Pastirik, Mrs. Peggy Cooper and her daughter Iulie and son lim, and Mrs. Appie Scott and her daughter Rita. Vin bali. 3' 5 4 W - ASL Louis Tillman Thomas Tisell Tiffany Touchstone Lynn Truskey Wendy Tryon Donna Twardokus Tammy Tyler Michael Tyndall Diane Tyre Leola Upshaw Eric Van Dyken Lisa Van Valen Regina Varn Leticia Velez Renda Wallin Paul Walsh Lisa Waser Rickey Washington Cynthia Weber April Webster 2 ,,,, , ,, M., Wm., ,, ., ,, -.fa -in 2 T l Freshmen X 111 Mercedes Welch Beth Wendland Rusty Wenrich Michael Westra Mary Whelan Sharlene Whidden Iackie White Brian Whitmore Donald Whitten Ray Whitten Iohn Wild Eugene Williams Greg Williams Heidi Williams Kevin Williams 2 ii fi 1654. ,,A,,,,,,,,,,'.v1-rv-f'A f ,ZZ , 1 112 I Freshmen 1 - Robyn Maker and Ieff Giunta sign up to see the freshman counselor. 2 - Rapping with Melody. 3 - Come on ing sure, I've got time to talk. . . 2 2' l I v x we 'f' L x fi Bosoni Buddies Everyone needs a friend sometime, someone to turn to when things aren't going well. Someone you can trust and feel comfortable with, who will talk things over with you, who will listen while you talk. Miss Melody Mitchitell is such a person, a friend and adviser to North I-Iigh's freshman students. She likes to become acquainted with ninth graders before they begin high school. She endeavors to do this by going to the area middle schools each spring and speaking to the eighth graders. She shows them films or brings guest speakers on subjects she knows young teens are interested in. By doing this, the students gradually become acquainted with her and begin to turn to her as their friend. When students feel they need to talk to Miss Mitchitell, they either sign up for a conference on the list outside her office door or if she isn't Stacy Williams Wendy Williams Keith Williamson Dean Willis Donna Wilson Kathy Wilson Lisa Wilson jesse Witte Robert Wolff Iulian Wood Cheryl Woods Michael Wright Randy Wyatt Ioseph Yerkes Allen Young Iohnny Young Debbie Zabinofsky Michael Zolno Shawn Zyderveld busy, just drop in and pull up a chair. At the first meeting she usually starts out doing most of the talking, Gradually, as the students begin to feel comfortable and know they can trust her, they start to open up. The majority of concerns students come to discuss are family problems, sex, drugs, relationships with male and female friends, peer pressures or academic difficulties. Miss Mitchitell likes to get students with similar problems together for group sessions. Talking things out with peers helps them discover that they are not so dif- ferent and alone, that other people have the same hang-ups. When you finish your freshman year, it doesn't mean you have to find someone new to talk to and help you think things out. Once you have this lady as a friend, you'll find yourself returning to her office for a chat throughout your high school years . . . the welcome mat is always out. Freshmen f 113 The traditional meaning of the word sophomore is wise fool, and this year's tenth grade class ex- emplifies this definition by working hard but enjoying themselves along the way. A major reason for the class' success in fund raising and spirit was the large number of active members on their executive council. Hard work by council members paid off in large accomplishments accord- ing to the Sophomore Class officers and advisers. This year's officers were elected in the spring of 1981. This allowed them to use the summer formulating plans for a successful school year. Officers elected were Heidi Tietjen, Presi- dent, Kim Moody, Vice-President, Mandy Smith, Secretary, Tracy Can- non, Treasurer, Steve Martin, Class Coordinator, and Ray Garner, Sergeant-at-Arms. The council and officers volunteered many hours of hard work and demonstrated real dedica- tion this year promoting school ac- tivities. The encouragement of their advisers, Mrs. Emelia O'Grady and Mrs. Terry Andrews was a tremen- dous asset. Council meetings were held after school or scheduled on activity days. During these meetings problems were discussed and solutions refined by council members. A combined effort of officers, council members, and the rest of the Sophomore Class boosted tenth grade participation in North's 1981 Homecoming Week to an all time high. It paid off as the class won awards in window decorating, pep rally skit, and parade float competition. The sophomores had a great year. Everyone can look with pride to the Class of 1984. Sophomore Executive Council fLeft to Rightl Front Row: Anita McLeod, Trent Bowers, Ethan Ledford, Phil Perry, Chris Garrow, Shawn Gurnham, Christine Tillie, Iennifer Nicks, Monica Haggard, Sue Green, Ioy Wagener, Tami Hottensen, Melanie Ioslin, Cindy Clark, Sharon Hadsock, Wendy Tillery, Kenny Miller. Middle Row: Tracy Cannon, Donna Schoneman, Lisa Iones, Kim Moody, Marie Smith, Sue Clouse, Kim Clouse, Stephanie Dodd, Darlene Williams, Dana Cooke, Ienny Thomas, Sandy Hassenzahl, Iohn Kanell, Ray Garner, Mark Bitter, Tammy Lentz, Diane Brazil, Cathy Boring, Darlene Dials, Pam Volk, Kim Smith, Rose Ann Ulino, Leah Iohnston, Donna Bennett. Top Row: Mark Westra, Ioe Fortini, Steve Martin, Ioyce Malone, Raedene Turco, Betsy Coffin, Amy Austin, Molly Brodeur, Lori Lukitsch, Allyson Iones, MaryAnn Karn, Heidi Tietj en. Iody Alvarez Dennis Anderson Iennett Anderson Amy Austin Susan Baker Ioseph Barley Lori Battles Ellis Baumer ' Mark Beattie David Bechtol Tonya Becker A J ifit 531 ., Kathleen Beebe M- Mark Beigh if is, Donna Bennett Z -'K ' I ' Veronica Bergman gfii 4 if S ' 'iti-ii.- is I . M- l I 4 1 -9 X' 1 'Jfv f-my ,, , f if ll I M ff ls 2 W5 gg- I 2 gi ,I 777127, ff, fv ,4 1 - Sophomore Executive Council meets to discuss plans for their future. 2 - The Sophomore Class Of- ficers: fStandingl Heidi Tietjen, President, Kim Moody, Vice-President, Tracy Cannon, Treasurer. fKneelingJ Steve Martin, Class Coordinator, Ray Garner, Sergeant-at-Arms. Missing: Mandy Smith, Secretary. ,L x R A 'W Georgia Bishop Mark Bitter Cathy Boring Trent Bowers Eugene Boyden 'Q Susan Brady Paula Branch Diane Brazill Kelly Bright Donna Brightbill Qv Regina Brightbill Molly Brodeur April Brown Luvenia Brown Ray Brown Sophomores X 115 William Brown Denise Burchfield Lester Burdick Arthur Burge Karen Burkett Tab Burnett Raymond Butler Ray Byrd, Ir. David Campbell Tracy Cannon Delisa Carter Tracy Carver Angie Caudill Amy Chirco Carl Christianson 1 - Trent Bowers transforms into a NFM cheerleader during Homecoming Week. 2 - Ioe Flinn aims for his target at the sponge-throw stand. 3 - Sophomores endeavor to earn their funds by running a Pepsi stand at Field Day. 4 - Creenvvave Graveyard. 5 -- Iennifer Kniestedt pauses for a photo of her participation on Punk Rock Day, 116 X Sophomores L. s g Q 3 x, ? Debora Cira Cynthia Clark William Clifford Kimberly Clouse Susan Clouse ,, f l Ray Cobb ,:,. if liil K Mark Coe 2 wr Elizabeth Coffin v-wif is If Ierry Cohen K, ,, f4 f , Terri Cole ' A 1 an X . X if - if ! wi riiir I i Toni Cole f-555' Kelvin Collins 5.5, e, ff Larry Connors if byyq Willie cook K. -QQP Dana Cooke l asii' 7 ff' if ' +25? Sophomore Participation Floods North Campus Homecoming has become a very special event in most schools across the nation. The sophomore class made North High's traditional happening an important occasion for themselves by getting involved in all the various Homecoming activities. Sophomores expressed their en- thusiasm throughout the week by dress- ing up on all the special days. Everything from love childreni' to 'tpunk rockers to Greek gods and god- desses could be found in the halls as the sophomores displayed their creative costumes. The 10th grade Homecoming float, a graveyard scene, included tombstones bearing threatening warnings to the Green Wave from the Knights. Special thanks went to the many loyal sophomores whose long, hard hours of work paid off when the class received the third place ribbon in the Homecom- ing parade. Not only was the float successful but the sophomores did quite well in North High's traditional window painting con- test. Their message, Creen Wave Crash into the Endless Knightsn was drawn and then painted on the inside library doors and won the second place award. To top off their list of Homecoming accomplishments, the sophomores add- ed a third place win in the skit competi- tion at the pep rally before the big game. All in all, it was an important week of accomplishment and fun for the Class of 1984 one they would not forget for many years to come. 4 5 P Sophomores X11 44 Ina Marie Cooke Ioel Corbin Ianis Cottrill Acee Couch Manuel Cox Mitzi COX Tracy Crain Iohn Crawford Iulie Crocker Zetha Crummell Iohn Cummings Iames Dahlberg Cynthia Davis Paul Davis Traci Davis Lori Deitz Iames Delaine Ieffery Dennis Timothy Deno . -3,1-ffm'-ggi?-ja., , 1 . 'f , .:' '- , fi 1. 4-' 1 - -1 -'f J '-'- V f 'Q 1 - K 4 , fffff ' 1 Y' 4 ifff 4 . ' 1 ' , 1 -.V gg ji , f.j,f:-ij: 1 C 'N ll ii' 1'f:jf' as . 9 f, vw a i.. :Q ':.fgg:,1,:,,g2g ' - 7 V 1.1-. k ' A L -5 .3-if '-t , ,,.., . , ,, i,,. ,,.,, . . ., ,, ,, , - ' - ig-6? ff , -1 f5i ':- I f if , f my Sf. Q . 1 I .K ,Mg ' . :rf-M ' Q 1 - Haifa? ,M iv ' f , .. 1, if, ' I 7 3, l N J it V 9 1 - Sophomores really get it down during their Homecoming skit, 2 - Artistic waves decorate the library door. 118 X Sophomores i L, ,.i, , .,,, , ,t,.,.4 , ,7 ,,r.. , ,, f,,,. 3 z ga 5.1 it , any ff . V .u,.w:f,w,z2. rf' 1 ' M, ag: , ,,g,L+ ' ' My W- . v J: f ff 1 9 ' ras? if' f , yy! ! , 5' x ala 55 , Viv -. 5 1 A x it 'A 1. s fm f. is .p ATAV gms 1111? .ge-V I ,f V .. WV- 'vi - ,r -- i r Q fn 1 X 1 S: ,, F '- I . . ii ...Q 3 I as if E 6 f fa' . Q, 1 5 , , nf '1 ,. .HA '5,, 'QVA Antoinette Devito Darlene Dials Gary Dickey Denise DiCiacomo Lori Dill Robert Dillon Denise Dixon Stephanie Dodd April Driggers Franklin Driskell Ieannie Dugan Michael Dukes Laura Dunn Clifford Ebert Catherine Edwards Michael Edwards Matthew Ellis Lawrence Ennis Michael Ennis 1 - Sophomore Homecoming Court Representatives Susan Panrell and Ioe Flinn ride in style. 2 - Knights show spirit in a new fashion. Sophomores f 119 S...P...I...R...I...T... School spirit is often talked about but an elusive thing to demonstrate and maintain. No one can say the Class of 1984 did not put forth the effort to show everyone they had an abundance of it this year. The tenth graders proved their outstanding spirit early, by being the first sophomore class ever to win the spirit stick at a pep rally. Their combined exuberance and en- thusiasm rocked the gymnasium walls more than once and served as a fine example to all Red Knights. At the third pep rally, Mr. Ed Stickles presented the spirit stick to Heidi Tietjen, Sophomore Class President, and commented on the sophomores' outstanding achieve- ment. The stick was proudly displayed throughout the day to demonstrate to the entire North High campus the sophomores' belief in and enthusiasm for their school. Never let it be said that underclassmen are not true and dedicated Red Knights. They have learned early what it takes to be spirited members of the North Fort Myers High School student body . . . PRIDE! Beverly Ervin Tracy Everett Iames Ferris Annette Fine Laura Fleming Ioseph Flinn Ioseph Fortini Robert Frank Barry Frey Charlene Fricke Amy Gardner Raymond Garner Troy Garrett Christopher Garrow Angela Gibbons Athon Gilbert Charles Gilbert Melissa Gist Shavon Golden Charlotte Green W0 X Sophomores ' 14.1 1 - Sophomores show their spirit and then their pride at win- ning the Red Knight Spirit Stick. 2 - Red Knight fever's comin' down . .. Red Knight fever's goin' round . . . Red Knight fever's comin, down . . .On you. .On you . .On YOU! 2 4401 ' 'TIN I . ,fs ids- Susan Green Tracy Greer Beverly Griffith Randy Grise Shawn Gurnham Sharon Hadsock Monica Haggard Rebecca Io Haller Beverly Hames Robert Hammesfahr David Hand Teresa Hanson Thomas Hardy Scott Hartwig Sandra Hassenzah Dale Heinkel Patricia Helms Brenda Hickman Iohn Hills Erik Hirshals Sophomores X121 Kevin Holley Del Holloway Sandra Holt Franklin Hopper Wayne Horne Nancy Horstman Andrew Howard Steven Hudson Cheryl Hughes Todd Hughes Wende Hughes Miranda Hughett Oui Hunter Kathleen Hupp Dora Hurley Melvin Idlette Lisa Irizarry Dawn Iackson Subrina Iaokson Todd Iaokson Ieannine Iaschob Regina Ienoks Alphonzo Ienkins Keith Ierz Andrew Iohns Audrey Iohnson X ickel and Diming It Fund raising is the main goal of all ex- ecutive councils. The Sophomore Council worked hard to make fund raising an en- joyable but monetarily rewarding project this year. Candy canes that sold for a mere 106: a stick were the sophomores' most successful fund raiser during 1981-82. Strawberry, cherry, green apple, grape, and other assorted flavors proved that North High students definitely have a sweet tooth. The tenth graders also sold key chains at 7513 each. They were a must for any student lucky enough to have car keys, or even for those of us who just needed a place to put our house key. With the help of bake sales and a newly initiated membership donation of 31.00, the Sophomore Executive Council was able to raise a substantial amount of money for their projects and to build their treasury for the next two years at North High. j... . . Danny johnson 1 ' .A I L ll'l if Edward johnson ' ' Q ji ' Kenneth johnson -. njv.. Merlinda johnson f u p , Michelle johnson yi , . .jf 7 'J Russell johnson Leah johnston Allyson jones Lisa jones Melanie joslin Lisa joyner john Kanell MaryAnn Karn ' ts j -ff-is if Angela Kelly . , f Karren Kibler I . 43, A ,A V ,V V V 'V nf ,V 'A 5 gh.. 1 Y . . 3 Marjorie Kinchen Karan King Lisa King Gregory Kirby jennifer Kniestedt Sophomores X 123 Ramona Kozlowski Lisa Lawton Ethan Ledford Dallas Lee Tammy Lentz Charles Lindenmuth Harry Loggins Lisa Long Steve Longbrake Iames Ludt Diane Lytle Coury Macdonald Thomas Maitland Eugene Major Theresa Major Ioyce Malone Michael Maloy Denise Marcel David Markovits Cheryl Martin l 124 X Sophomores ,, ' -gf. 4 of When a student has two unexcused absences the Dean Students Virginia Cassell calls parents, such as Mr. Pol1ng.t0 inform them of their son or daughter's impending failure. 4 'PN Steven Martin Rhonda Mason Willie Matheny Dale Mathewson Lisa McAbee Michael McCarthy Eugene McCartney Malcolm McCollum Gerald McDermott Paul McDonald Shannon McIntosh Anita McIntosh Gene McMullen Crystal McNally Michelle Mease Anthony Mellema Robert Melock Peggy Mendez Kenneth Miller Sheryl Miller 1, 2, 3 . . . and You're Cut! For years teachers in Lee County have complained about how many times students were out of class with unexcused absences and still manag- ed to make up sufficient work to pass the course. This year the Lee County School Board decided to do something about it, they passed At- tendance Policy 35.11. This policy states that when a stu- dent has two unexcused absences from class in a nine-week grading period, the teacher shall notify the Dean. The Dean in turn will notify the parent, that one more unexcused absence will result in the failure of that class for the nine weeks. If the student then misses one more class without an excused absence, he is issued a failure notice and the grade of F is recorded. Only the principal of the school may grant a waiver if he feels after reviewing the facts of each individual case that the student deserves another chance. Rewards are being given to students with perfect attendance, but woe be to the student who decides to take three days off without his parents' permission. His only reward will be a grade of F in all his courses. Unbeknown to many North students all student excuses are filed in their individual folders in the dean's office by aides such as Donna Howard and Bobby Carrillo. Sophomores X 125 Hats Gff for the Leave your hats at home! That's one rule disliked by the students at North Fort Myers High, but strictly enforced by the entire faculty. Even though this policy has been in force for two years, it is still actively resisted. Many students feel hats are a fashion accessory, a conversation piece, and demonstrate their in- dividuality, but the administration and faculty feel they can be a real source of trouble. Hats often take at- tention away from the real business of school, education, and have caused student fighting and other disciplinary problems. To eliminate a source of trouble, the hat policy was initiated. Seniors are the only students allowed to break the Hat Law. On Sarah Mitzel Kim Moody Colleen Moore Fred Moore Regen Moore Red Knights pep rally days, North seniors can legally don hats if they wear their Senior Derbies. During Homecoming Week, a shorts and hat day was allowed. Everything from cowboy hats to baseball caps, and even Mickey Mouse ears, appeared all over North's campus. On the last day of Homecoming Week, a special pass was sold by the Student Government members that allowed its purchasers to wear the hat of their choice all day. This proved a tremendous success. Although hats continue to be a very popular fashion item, the students at North High have learned to only wear them on weekends and after school. Hats off Red Knights, at least from 7:00 a.m. to 2:00 p.m., Monday thru Friday. - . .Tatu V fe..-. .- .41 i, WM v V! far 1 v.,,Vi . ,, it I , 225325 '443i, Wx, 4 Wendy Moreaux Nancy Morris Renee Murphy Tony Myrick Robert Nein Susan Nein Brian NeSmith Iennifer Nicks Iames Nolan Peter Normandin '41-me Ieffrey Norton Pete Novatney Russell Nyberg Todd Oliver Robin Oropallo 126 X Sophomores 'H'-wr-,, 4 72 gf Qff We 1 W If 1 - Tammy Sawyer, Greg Marinell, and Eric NeSmith exhibit their headwear on one of the Hat's On Days, which are few and far between. 2 - Mr. Steve DeShazo enforces the Hat Law by confiscating George Tisell's and Frank Kelly's hats. 3 - Any kind of headwear can be collected by the deans if you don't obey the rules. 4 - Dana Cooke says Howdy! on Hat Day dur- ing Homecoming Week. 'W 4 Aleen Orstrom Scott Ower Susan Panrell Catherine Park Marion Parker George Parze Sandy Pass Maria Paz Tracey Peacock Suzanne Peckham Phillip Perry Monica Peters David Poling Toni Ponte Kathy Prickett Franklin Putnal Susan Rasbeck Richard Ratliff Kellie Rex Kristin Rice Sophomores f 127 128 f Sophomores Gary Richardson David Rise Dorothy Roberts Ralph Roberts Suzanne Roberts Cheri Rose Iames Rose Iada Ross Randy Ross Bryant Rowland Francine Rubinstein Kim Rutherford Dawn Salomone Timothy Sands Blanca Santos Kenneth Sapp Super Sophomores The steady stream of scholastic work for a North High student sometimes seemed overwhelming, but with the variety of extracurricular activities available, the workload seemed lighter. Interested, hardworking members were always needed by clubs, organizations, and teams. Sophomores joined these groups for a variety of reasons, but their main thought was to have fun and to meet new and interesting people. One sophomore, joe Fortini, was an active member of the Drama Club and Forensics. joe, who acted in the dramatic productions, Go Ask Alice and Grease, also participated in the various Forensic meets held throughout the year. Stephanie Dodd was another active tenth grader. She was a member of the Sophomore Executive Council, the Red Knight Band, and was the only m.,.L.Z,' 'f f - K ' ' V '.'ffl'i-'W' ' f wyfwffdf VW f' ., ff, 4 ,.fff,,gfw .cf,ff,2w7.f-' .'C'1.fvMW 122417, fam, .,,..f,,4,, I f, wwf vw Mc- V' f f Z sophomore majorette. Dana Cooke was an excellent exam- ple of underclassman involvement. While keeping up her grades, Dana played varsity volleyball and basketball. She was president of the Sophomore Achievement Program and a member of the Sophomore Executive Council. Dana was also German Club Treasurer and a IV Cheerleader. Other tenth graders who held major offices this past year included George Parze, Band Quartermaster, Darlene Williams, Sophomore Band Represen- tative, Tammy Smith, Chorus Librarian, Tonya Becker, Drama Club Publicity Director, jenny Nicks, Excalibur Photo Editor, john Kanell, Key Club Vice- President, Steve Martin, Key Club Treasurer, and Cindy Clark, Spirit Club Vice-President. The entire Executive Council of the Youth Advisory Council were sophomores: Corey MacDonald, President, Denise Dixon, Vice President, April Brown, Secretary, and Marie Smith, Treasurer. Sophomores who weren't able or in- terested in getting involved in after school activities, still showed their spirit by attending athletic contests and cheer- ing for the red, black, and white. Par- ticipation and involvement were key words in making tough school days bearable and enjoyable for tenth graders at North Fort Myers High. 1 - Sophomores Tony Myrick and Acee Couch demonstrated their talent, dedication, and promise as members of the 1981 Varsity Football Team. 2 - Raising money for Spanish Club and earning points for herself, Betty Coffin sells orange juice as well as donuts at a bake sale. 3 - The only Sophomore ma- jorette, Stephanie Dodd, adds sparkle to a half-time show. 4 - Gorgeous Legs contestants, Kenny Miller and Coach Steve Conley, compete for the money during Homecoming '81. 5 - Raeden Turco sun- bathes before swim team practice at the North pool. Frederick Satchel jodylynn Saucier Donna Schoneman Russell Sessions Clifford Sheehan -A Laurie Sheets Donald Shorten Kimberly Simons Derek Sliman Amanda Smith sr Sophomores X 129 1 130 f Sophomores Billy Smith Catherine Smith Kimberly Smith Lizzie Smith Marie Smith Tammy Smith Tracey Smith Maxine Soler Valerie Spikes Skeeter Stanford if ff Stephen Steiner Shirley Stewart 7 ll N MiohaelStoops f f W f Timothy Sushil few y, Ann Sykes S' 'W T T Robert Sykes Brenda Takach Iennifer Thomas Michael Thomas Steven Thomas .QU 1 - Sophomore Ioe Fortini, caught unaware by the Lance photographer, pauses before entering a pep rally and transform- ing again into Mr. Activity. 2 - Always ready, Lori Dill awaits the next volley. ,N I K 1 i f Q f ' 1 Y i V., , 1' '9Zj 9- Michael Thumm Heidi Tietj en Kimberly Tomlinson Kathryn Toro Sue Torvinen A404-a,. Christine Trammell If W Donald Tucker Raedene Turco Chris VanBuskirk 1 Ioyce Vathis 'N k2,,. .df -.,- , fi'-f Sally Vaughn Pamela Volk Richard Vracar Ioy Wagener Philip Wagner Zoe Waldron Linda Walker Traci Walter Darla Waltman Michelle Ward 2 1 - Striving to help her team win, Dana Cooke gets ready to put the ball over the net. 2 - Proud to be Marching Red Knights, Ioel Corbin and Ioe Williams perform smartly on the football field during a half-time show. Sophomores X 131 Rhonda Weber Sulyn Wenrich Mark Westra Sarah Whelan Bruce Whitaker Ierry Whitaker Lori Whiteford Kim Whitney Iennae Wierengo Darlene Williams 5 ,.- , Edward Williams Ioe Williams .V Lisa Williams Shelly Williams Paula Wilson ii,i 1 Carolyn Winegardner Charles Woods LaDonna Wright Gregory Yeater Katherine Yoder Ring Daze All sophomores looked forward to spring when they could order their class rings. Graduation might be years away, but the right to select and order a ring made them feel the Class of 1984 had arrived. The wide selection of ring designs and styles, offered by North's Balfour representative, presented the prospective buyers with challenging tasks. The numerous metals, exotic stones, and con- temporary artwork gave each student in- numerable combinations from which to design a personal ring. Class rings were a real financial invest- ment. A deposit in the spring and delivery in the fall gave them the opportunity to work over the summer to meet the final payment on this lasting keepsake. No one will be prouder than the sophomores when their rings arrive. It will have that certain stone, be personalized with thoughtfully chosen artwork, and of course, contain those four important numerals . . . 1984. 1 - It's easier to select a ring if you can see it on your finger. 2 - Sophomores Regina Brightbill and Gina Downing enjoy choosing a personalized class ring. 3 - lust a few of the pamphlets one must wade through before ordering a class ring. 132 X Sophomores p W IW rv' ' fb 'f 29' f 7 ' . A g , ..ff gt' ,V i 4 W .,WcvW,,V ' Q. K Q 1 1 2 , 6 ff Q1 .1--wp ff f.--.,- f.-, -,'- 4 5 ' if .r.. 17 V in I W 1 .fa 1'1iiz 4 1 1 1 W W Us, 4 f Q W . . . .. ..,.,, . .44 .. if 5 W 9 9 tn 1 fl Q fa 9 ,Q 1 1 1 ,,,,,.t.,,.. sf. 1 if Q 0 fa 0.2 1 fin. ' 1 . 1.6. k- q 4 4' .7 -wr Q .g 'f0ug9 Q QQ , 'hifi 4 is 0 Z M 4 ft . 0 fi R' . 1 - f it 3 f+J'-1-lr Never let it be said that the Class of 1983 doesn't believe in equal rights for women. They proved their back- ing of this controversial national issue in May of 1981 by electing a complete slate of female officers to lead them through their junior year. These love- ly ladies, Kim Kibler, President, Rita Scott, Vice-President, Kathy Kubesh, Secretary, Tammy Saucier, Treasurer, Christy Boring, Class Coordinator, and Terri Osborne, Sergeant-at-Arms, proved that a woman's place was on the North Fort Myers campus. The junior Executive Council join- ed the elected officers in chartering a year full of hard work and total com- mitment. They realized they would have to discover new fund raising devices if they were to raise enough money to finance their major project for the year, the junior-Senior Prom. Under the direction of their spon- sors, Mrs. Bernice Battle and Ms. joanne Matson, the council set their course early by deciding to undertake the sale of snacks and candy during summer school. During each class break their school snack shop opened for business in the doorway of Room 9. Their next big fund raising project Z junior Executive Council jLeft to Rightj Front Row: john Ammons, Doris Soler, Robin Sylvester, Polly Lovett, jill Wallace, Debbie Bradley, jodi Reigle, john Prickett, Karen Snodgrass, Debbie Kirby, Christy Boring, Mary Massoth, Patty Haley, Brenda Crosby, Nick Cooley, Tammy Saucier. Middle Row: Ms. joanne Matson, Sponsor, Elese Scurry, julie Brihon, Dawn French, Kim Kibler, Tammy Sawyer, Randy Ross, Cathy Kubesh, Terri Osborne, Glenn Nesta, Patty Talley, Donna Howard, Komona McGriff, Paula jones, Bonnie Bouch, Michelle Wasser, Pam Boyette, Kim Rewis, Mrs. Bernice Battle, Sponsor. Top Row: jeri Cunningham, Shawn Smitter, Rita Scott, joni jeffcoat, Kelly McConnell, Kelly Frognollie, Kim Richards, Ellen Ayres, Dee Henry, Rose Reed, Annette Hernandez, Denise Chaplow. 'dy-.ff fir ,xi vs... ff 1 Tony Acitelli Ronald Adamcik Melody Addison Kelly Ahlefeld Richard Alfano Heidi Altvater john Ammons Mark Arlington ,. ,1..:t.uf- - in-,QQ-Q-sm-5-wwf Kevin Arnett Michael Asselin Zana Auldridge Phillip Ayers juniors X 133 Ellen Ayres Laura Bahrs Lisanne Banta William Barnes Sheri Baudino Laura Baxter Ianet Bazzle Michael Beatson Darrell Beller Lisa Beller David Blum Christy Boring Iuniors was their annual cheese and sausage sale prior to the Thanksgiving and Christmas holiday seasons. This was a resounding financial success as who could resist Mr Z's tempting crocks of cheddar, swiss, or port wine cheese and the spicy beef sausage. During Homecoming Week, the Iunior Executive Council manned the Pepsi-Cola booth, a tremendous monetary success. Add to this the popular North pins they sold throughout the year and the early morning bake sales and the money quickly rolled into the treasury. A winning combination of officers, Executive Council members, and sponsors made 1981-82 a very ex- citing and memorable one for all juniors. Participation and spirit ran very high, showing that they would be ready next year to take over the top spot as Seniors. I - Rising to the school's demand and the Iunior's need, Kathy Kubesh, Walter Ratliff, and Rita Scott sell candy during summer school. 2 - Kim Kibler, Walter Ratliff, and Ioni Ieffcoat found Mr. Z's cheese and sausage an easy product to sell in their effort to raise money. 134 X Iuniors f ug. .4 s 3,15 1.1. , Huw ,. ., as. ,. 1-1.-::ff.:f-:fr ,KV , as e ' 4 4? W 1 1 W? f f '32 A V' '-,t :ivy 1 213' ' -L 1' fli-Q7 Qu '- f , I f f ', iii' Y Y , x x t f f W 4 If 4 X 'WLM '-ww.-4 5.-. ,. ,- i 7 oi ,'i.x47,wvWf::2:-pf:'KWV' 'Q' if . BYITTT' new 5' ,W Nas.,-v' A., ,Q ..,,.,, ..-t. s Bonnie Bouch Pamela Boyette Debbie Bradley Shelly Brewster Iulie Britton Lisa Brooks Scott Brown Marilyn Burkett Tari Burton Carolyn Busbee Steve Callari Thomas Campbell Robert Canova Christopher Carpenter Regina Carter Iason Cash Denise Chaplow Robert Childers Iunior Class Officers: ISU-mdingj Kathy Kubesh, Secretary, Kim Kibler, President, Rita Scott, Vice-President, Tammy Saucier, Treasurer. fKneelingl Terri Osborne, Sergeant-at-Arms, Christy Boring, Class Coordinator. Iuniors X 135 Pride-Filled Competition Involvement was the key word for Iuniors during the 1981 Hdmecoming. Their willingness to work and to par- ticipate brought satisfaction to themselves, enjoyment to everyone else, and recognition to the class. After a late start and a lot of misgiv- ings, everything seemed to fall in place. Workers showed up for all the projects and material donations for the float poured in from every direction. Within four days, the Iunior Executive Council members had decorated the library doors, built a float, and written a skit for the pep rally. The colorful painting on the outer library doors heralded the message, Knights Part the Wave this Endless Knight to anyone arriving at the front of the school. The Homecoming float entered in the parade depicted 'Knights' Dreams Come True on this Endless Knight. It contained a Knight dreaming of slaying a Greenie. This unique float was awarded the third place ribbon. Lisa Clark Tina Cole Kenneth Collins Nick Cooley Elizabeth Corbitt Michael Cornele Tanya Cornelison Scott Cottrill Lisa Crews Catherine Crocker Brenda Crosby Ioey Cross Dana Cunningham Ieri Cunningham Kerrie Cusic Steven Dahlberg 136 fluniors During Field Day, the Iuniors found the answer to increasing their class treasury while quenching everyone's thirst by selling Pepsi. At the Homecoming Pep Rally, the Iuniors really starred. A tremendously well written skit was acted out by Ellen Ayers, Debbie Bradley, Dawn French, Ioni Ieffcoat, Laura Iohnson, Kim Kibler, Cathy Kubesh, Kim Richards, Rita Scott, and Robin Sylvester. These ladies told of how the coaches trained the team and how special the Homecoming game was to them. They walked away with second place honors. To top off the week of festivities and fun, the Iuniors cheered loudly for their four representatives on the 1981 Homecoming Court: Ioey Cross, Kim Kibler, Cathy Kubesh, and Shawn Smitter. Hats off to the Iunior Executive Coun- cil and Iunior Class officers. When things got tough, these hard-working people got tougher. '86 QQ., .4 ,X I -K, -mfg, gm M-ff . i l vga- Y V 1 - The Iunior Class Homecoming float offered tough competition for all the other entries. 2 - Members of the Iunior Class skit built a pyramid of spirit during the Homecoming pep rally. 3 - Debbie Bradley and Dawn French punk out during Homecoming dress-up days. Er 3 ' Debbie Davis Laura Davis g Patricia DeRosia Michael DesFosses Patrick Diggs Melissa Dominiak Iohn Drawdy Tammy Drawdy Paul Drew Tami DuBrule Rick East Robin Enfinger 4 'v-1 Paul Engelhart Serdarryl English W' Gina Erwin - Valerie Erwin ,v Y ew A ,J,w W. 1 - The Iunior boys tow the line for victory over the Seniors in the Annual Homecoming Tug-of-War. 2 - Rose Reid, Zona Hendry, Dandria Hendry, and Eric Null show off their original costumes on Punk Rock Day. 3 - Pepsi salesmen, Debbie Williams and Pam Hanley, work hard during field day. '? '---,,,-- X X 'V 1 l Roger Hahrner Kelly Fargnoli X Henry Field 4 Q5 px Billy Floyd ML ff Willy R , t C 'D MQW? W l 'WOW Wilma Fluker , , X o! 1 Neil Fowler R ' Sylvia . , m fm YR! 1' X l EPB! XV L, Q ,lf jf Q ,V Vi V Richard Gadson l ' Lorie Gage Annette Gannon dl jx Iames Garner 138flunio s jx! 'fri 1 - Iohn Panio and Ellen Ayres get hitched during Field Day activities. 2 - The Iunior Class took 'Lpride- in their entry for the annual Homecoming window competition. G -wlrngju on, 15 TEWLESS 2 3 Shelli Garringer Ioby Gay Iohnny Giddens Craig Giovannelli iffy wr' 7, Ben Gittleman Candace Glendinning Melody Goff Iodi Gogolin tg, 'll Rachel Goodwin Douglas Gordon George Gottfried Edmund Grabowski Russell Graettinger , Lury Graham Gennie Green m y - Nora Green KMGHT luniors f 139 Love on Hold Willie Green Iessie Griffin Robin Haddaway Pamela Hagie Patricia Haley Pamela Hanley Ramona Harris Debra Harwood Christopher Hartnett Casey Hauger Hezy Hemed Dandria Henry Dawn Hepp Annette Hernandez Beth Hochstetler Brenda Horn y ' W W vW7't'4eg7 142' 77 Zig. ff 1 ' i I V4 - -A , 22- f If you were to walk up to most North students and ask how their personal life was going since the passage of the t'No Love Policy, their answers would vary greatly. This new policy was passed to pro- hibit kissing, hugging, and other over- whelming demonstrations of affec- tion on school grounds. The only sign of true love that was permitted under this policy was hand-holding or an affectionate arm around another's waist. Some students felt they suffered a real crimp in their romantic style with the passage of this policy. The new rule proved to be quite a 140 X Iuniors challenge for blossoming relation- ships, but faculty, administration, and many students were glad to finally be able to walk down the halls without feeling they were witnessing an X- rated movie. Students still counted the minutes until their classes were over and they could rush out to see their favorite friend, but they had to wait for the last bell to ring and be off campus before they could meet their boyfriend or girlfriend for a more af- fectionate rendezvous. Free love, not at North High here it is called restrained affectionf' 1 A Ben Houser Mary Hribar Velvet Huffrnaster Darrell Iackson Ioni leffcoat Richard Iencks David Ierz Brett Iohnson Laura Iohnson Mary Iohnson Bobbi Iones Paula Iones 1 Donna Bennett IS personally and properly escorted to her next class by her beau Dusty Boyd 2 - A wistful look at the old style now outlawed on the North High campus. 3 - April Brown and Tony Myrlck enyoy a quiet fand allowedl bit of Frank Kelly Tina Kenyon Kimberly Kibler Edward Kinder Deborah Kirby Edward Klapper Kathleen Kosko Catherine Kubesh Knights-on-the-Go Showing enthusiasm and willingness to join in school activities and functions was common ground for North's juniors. Their participation in various organiza- tions was overwhelming. Many not only served but also led by holding very im- portant and specific offices. juniors felt that by being active, they could show their school spirit and achieve personal satisfaction. One Knight-on-the-Go was Mark Arl- ington, who held the offices of President of the Thespian Society and Vice- President of the Drama Club. Mark was also active in Spanish Club and the Red Knight Band. Red Knights Brett johnson and Lisa Clark kept busy during the 1981-82 year. Brett was Vice-President of the German Club and a ROTC Captain, while Lisa served as President of Chorus and a member of the junior Executive Tony Land john Lannen Robert Lannen Lori Lawrence I Robert Lawrence james Lee janet Lee Robert Lennon 142 X juniors Council. junior Class officers did not limit their participation to junior Class activities, but spread their energies and talents to other areas as well. President Kim Kibler devoted some of her time to be- ing a wrestling cheerleader, a member of the SGA Council, and was a junior Representative on the 1981 Homecom- ing Court. Vice-President Rita Scott stayed active in her spare time with Spanish Club activities and the SGA Council. Things were never dull for junior Class Secretary Cathy Kubesh. She was a Varsity Cheerleader, member of Na- tional Honor Society, Spanish Club, Student Government, and Thespian Society and a junior Representative on the 1981 Homecoming Court. Terri Osborne, Class Sergeant-at-Arms, was also Vice-President of Green Peace and a member of the German Club and Lance Staff. Another activity motivated junior was Nick Cooley. Armed with 35 millimeter camera, he could be seen around campus taking pictures as part of his duties as a photographer for the LANCE. Still he found time to be active in Drama Club, SGA, junior Executive Council, and Thespian Society. If all that wasn't enough, he served as an- nouncer for all varsity home basketball games and extended his church work by being a Clown for Christ. These are only a few of the juniors who put in countless hours improving their leadership capabilities and helping their organizations, clubs, and sports get ahead in the t'Red Knight Way. All those who became involved knew their devotion and effort were well worth ity it helped them to enjoy life at North High. r . Ianine Lesh Iulie Liberty Theresa Lohness Albert Lopez Polly Lovett Mike Luders Manuel Luna Tanya Lust 2 1 - Nominees for North's Skip Bafalis In- ternship, Kim Kibler, Cathy Kubesh, leri Cunningham, and Bonnie Bouch, talk things over as they wait to see who will spend a week in Washington. 2 - Par- ticipants in the first Flag Corps, Iulie Britton and Karen Putnam march in the Homecom- ing Parade. Michael MacDonald Brian Makar Tracy Mann Dayna Mansfield Alice Manson Michelle Manuel Susan Marks Mary Massoth Iuniors X 143 'l 144 fluniors Sheryl McCartney Shawn McClure Kelly McConnell Donna McDaniel William McDaniel Lisa McFarland Komona McGriff Iohn McMann Nancy Mendez Ronald Merritt Sean Meyers Dawn Minick Rodney Minnick Vincent Mitchell Steven Moll Iames Moody HC 3 eff Wow! 1 - Enjoying her second year as a cheerleader for North, Cathy Kubesh was proud to be an example of Red Knight Spirit. 2 - Kim Kibler and Brett Iohnson get together for a quiet moment of conversation during their otherwise hectic schedules. 3 - Proud to be part of the Red Knight Marching Band, Scott Cottrill and underclassman George Parze show their enthusiasm through music. 4 - An active participant in all dramatic pro- ductions, Thespian President Mark Arlington practices his lines. Rufina Morales Stuart Moriconi Barbara Mueller Richard Muri Steve Muri ,Wg Paul Murphy at 4 Stephanie Nelson Glenn Nesta Pamela Oakes Terri Osborne Diana Owens Tami Porter ew Marshall Parr K K Beth Parrish K Richard Parson Randall Pelton Paul Pennington Cindy Petty N Iuniors f 145 L. . Gregory Pike Paul Poirier john Preuss john Prickett jeffrey Prince Edgar Pugh Karen Putmon Walter Ratliff Deborah Raulerson Iocelyn Ray Robin Reed Rose Reid ' ..,. ,.,r r .. 1 Alma mana AVA: We . r ,aff 2 ' H d t 1 146 X juniors 1 - During one of his frequent visits to North High, Air Force Recruiter Sgt. Al Freeman explains the many opportunities available through a career in the military. 2 - Math Compen- satory Education teacher Lynn Hinkle takes time to verify that Vincent Mitchell and Tracey Smith understand what is re- quired of them to earn their diplomas. 3 - Testing can certainly be tedious as these students discovered in one of the many ex- ams they were subjected to during their junior year. 4 - Always willing to help students, Senior Guidance Counselor june Her- rell shows juniors Tim Parker, Valerie Dickerson, Chris Presnell, Rich East, Brett johnson, and Iavanda Thomas how to use the college directory. 5 - Occupational Specialist, Ms. Terry Wieland, takes time to go over work-orientated materials with Olivia Topchy and Bernicine Coleman. 3 W 2' 1 if M 5 , I 44' f W f M f f ZH X few A 1 eu . ,fwrjf 7 'fa .f, 44... M, 3. ,J -th. -W Looking to the Future jodi Reigle Ronald Renfroe Suzette Rensch Kimberly Rewis Kimberly Richards Debra Ripple Pamela Ritter Deborah Roberts Debra Robinson ' Iohn Rodgers XA Teresa Roof David Rosario Everyone needs a time to find out about life and what they want from it, a time to explore the alternative paths that lead into the future, a time to discover their strengths and weaknesses. For many North students, this time is their junior year. An abundance of testing is available at the third year of high school to help the student make in- telligent and productive decisions about himself and his future. Testing usually begins with the PSAT, Preliminary Scholastic Aptitude Test. This serves as a trial run for the SAT or ACT, which are taken by college bound students during their senior year. The PSAT rates the student in the academic areas of English and mathematics and can serve as a predictor of future academic success. Also available is the ASVAB, Armed Services Vocational Aptitude Battery test. This evaluates a student's strengths and weaknesses in more oc- cupational related fields such as elec- tronics, mechanics, general tech- nology, and clerical administration. The State of Florida has mandated assessment testing on basic com- munication and mathematic skills. Each part of these tests is very impor- tant to the Class of 1983, as that is the year that demonstrated profi- ciency in all skills will be necessary if one is to be awarded a high school diploma. The Guidance Department at North remains a very busy place for enlightening, counseling, and guiding juniors as they search for the right answers for their personal tomor- rows. Mrs. Nancy DeShazo and Ms. Terry Wieland, North's Occupational Specialists, keep up to date on course offerings at Lee Tech, current job op- portunities in the community and county, trade and intern programs, and a hot-line to the local Armed Forces Recruiters. Mrs. Wayles Kimpland, junior Guidance Counselor, spends much of her time discussing with students their academic problems and in- terests. An hour spent with this lady can be very profitable in insuring you are making satisfactory progress towards graduation and adequately preparing for your future. As juniors begin to dream of and plan for their life after high school, they find themselves conferring more often with the people in Guidance and taking test, after test. It's time well spent if it helps them prepare for the rest of their lives. juniors X 147 Amanda Ryals Tammy Saucier Lloyd Sawyer Marie Schoonover Elaine Schulte Rita Scott Robert Shreffler Tina Sickler Debra Siltzer Alan Sliman Bob Smith Denise Smith Leigh Smith Theresa Smith Tina Smith Shawn Smitter . Aa fr, 1 148fll1l'1i 1 - Eleventh Grade Counselor Wayles Kimpland administers the PSAT to juniors who want to get a head start in planning their future. 2 - The Cosmetology exhibit presented by Lee County Vocational students, gave the North High student body an opportunity to look at materials and ask questions. OPS ,Ian 7 Alix Sh Karen Snodgrass Scott Snyder Doris Soler Chris Spillman Celina Stanford Clayton Stumpp Sherri Sullivan Scott Sushil Tux Robin Sylvester Patti Talley Michael Tam David Tanner , r.,,.., ,WN ,,. . g ' f i W3 is ry,y,viry px, Q Q Q 9' 1 Eileen Teter Iavanda Thomas Gregory Thompson Iames Thompson 2 1 - Endeavoring to cope with her heavy workload, Mrs. Kimpland depended on the help of aides, such as senior Phil Baker. 2 - Mrs. Nancy DeShazo, Occupational Specialist, explains the procedure for using a computer to help find out about careers and educational opportunities. Iuniors X 149 a gic ,82 Success was in the air at the 1982 Iunior-Senior Prom held on April 8. It had taken eight months to plan this gala even- ing and cost the junior Class over S1800.00. All the hard work was worth it as the handsome Knights and their beautiful ladies danced the night away to music that ranged from country to the Top 40. Planning and constructing the decora- tions took many, many weeks. Since the prom was held on a Thursday night, the prom committee had to leave school early to decorate the Moose Lodge in Ft. Myers. Within hoursnthey had transformed the hall into a garden of Springtime Magic. Nearly 300 students enjoyed the Prom from the moment it began until they bid their dates goodbye in the wee hours ofthe morning. The Class of 1983 had certainly added to the memories the Class of- 1982 would take with them when they graduated from North Fort Myers High School. Ioseph Thumm Olivia Topchy Blaine Touchstone lack Trammel Patty Trealout Theresa Tyler Roy VanRyckenham Angela Varner Betty Volovek Kenneth Walker Iill Wallace Danny Wallin Michele Waser Yvonne Washington Carlis Wheeler Willie White 150 X Iuniors .pie U X. .X K s bmw 5- Q eg, i 71 7-7.1 4601 ,aflisipir f 1. V .a g r 1 X pr' vt' YS ., f naalfliia 'Us 4... f., l I' '?s..':,s 1 Q-f ' i nl. .,.. F. 'VUTP' 961. -7 ' a. , l-gg 1 - Ideas were listened to with genuine interest at the Iunior Class Prom Committee meeting, as they strived to make the 1982 event a very special one for the Senior Class. 2 - Knight-Time Magic was in the air at the 1981 Prom. 3 - Present planners of the Prom, these ex-sophomores gained experience while keeping up the tradition of serving food at the '81 event. 4 - Chris Inbody and Dayna Cobb enjoy a quiet moment on the dance floor. ,X f . fl I 4 Richard Whitney Michele Whitten Liana Whyte Angela Wille Daniel Williams Debra Williams Warren Williams Michell Willis 43 Qwwy Charlie Wise Lisa Witte Carole Worthington Angie Zurcher ,na ,J - E , 4 1 ' XT. an 1 Iuniors! 151 PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PR Luseniors seniors seniors seniors seniors seniors PRIDE PRID seniors e FSA nio W , S LJJQ Q cr o. SGDIOTS Ll.l PRID SGDICTS LLI Q 1 Q. LL.I SGD OTS Q pg.- Q. SGD CFS L.l.I Q E Q-.- Ll.I niors Q or D. Ll.l Q SL. seniors seniors seniors seniors seniors seniors PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PR , SE' IDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PR seniors seniors seniors seniors seniors seniors 'O 2 E7 I'l'I U o 3,5 gm 'U 32 QU Om 'O 2 U l'l'I 'U 2 U rn 'O 2 U IT' 'U 2 U rn 'U 23. U rn 1 U, geniors seniors seniors sen cv U1 E E U5 Q: FD -1 rg' I U1 3 E 5' W ix Q ,,f..'i, N . , 3 SSDIOTS SGUIOTS SGDIOTS SSDICD H'-n naw P+ - Eg-2 eqiggi. S5259-gf FSE? ggmggg-mcqg-gm ggQ,,'351sS.o.3g::-3,0 iw pcngg-'.-fcD 45D,. gargh. cn..--D.-qogsgw o0JcnoOCL- CDH1 DDD-G ':1 ,.. v-11003. Q,,g..D ml4ggQm Effbmfbcn CD 'Eli OOOo Q'fDwo.m4D- 5'+'5.Ei -' CD f-v- fQP:D5,ag35'g5o'SQsEdgsEg5zaS E Fhcn UQ 5 4-1- SQEQEAQQOSUgig'2fE5'eS,E-Eeiife '-' ' C CD5+-'E' D-' OJ gJ 5i--Cn CD pm 99 DJ O HP-'I-r O ' r-'- mawammaaemws emgogsseaee Cnsftiidoid-ffDO'if's'2+fUimf2S :HSS Dm U3 5.235-'::1+SE-,E'mE-,:1g0U ' 5 TfD.-.O5 O,':f -'H mo.-Q4 'Df-f D f5'fD2'4:v Q53 CD Cfcri Us eofmmfb 'D ra' mmizw-P, ogaifg Em ?f,'3FD'QdS5?E'vgH,'D2EEEO gg C5 Fm Gofb'-'CDm'EH,Bg 9 EQ-Cg 'O'-'P- 4 p-4. lin:-sg,1..,':1cbD-E.. D,,.UO2,.,,,,CDg ,,,cng E25-52.5-'s F5-S2.2UfDfvf-QQQVDQEEMEE O ' f-v-I-gOQ.Cn2Q-,m'-rD f'+ CDm f-v-r-In-n.CDlD-152. H I--OD' DDD-mg.-P f?s'55smiS-saS'02fa.r'25,DQ.smfsr2W fn 'a,'r,ss..,:fE'1vUCgJ'yda5fDE'1Q.,fD3fD g,11 P- DQS-UO Hmm 'QPQJHHQC-I W I-Ioa,.1 :S er-' an Prob' mcncn,., I-I'-1c,,CD+-L., -+.9.,.,s4:uw5+fDr::OCE'wo.Q. iFsDQ.:rg:p91 2513?---eggs so-QSES 2 eg owgrf.-.ggf3,52'F5'4m..,9,'9h5'E'is-14 Oc-JGD IT..-. O Q 0Q fp-'Qi +-s 1 4cn cn'- cnQ 'f,,G,-, f-sD 0Jm 'rm Oi-1 'WEP rsa:'fD5?E Sagem 52-Wim 1 p... img 5 3-14 Pchgutg-E eg53,:-I '-' mo :DE '- ' s'-ei as-fam: 3.3525 5-Piss-'fr cncn. CDD-FP:-v'l'1:1 :.O..cnco .Emmy IDE PRIDE PRIDE PRIDE Seniors f 153 From the very beginning the class of '82 showed promise. Something about this class made everyone on the North High campus aware of them. Attending double sessions during 1978-79 with students from Cape Cor- al, Pine Island, and ,Fort Myers, they shared the woes of afternoon classes. While still on split sessions the next year, they had to experience the divi- sion of schools: North attending in the morning, while Cape High took over the campus in the afternoon. That year, as sophomores, the Class of '82 discovered what high school was really like. After dodging the jeers of upperclassmen the previous year, they snickered over the expres- sions of bewilderment on the faces of new freshmen. Settling into a whirl of activity, they finally felt at home. Burning with anticipation for their senior year, the Class of '82 outdid themselves and everyone else as juniors! The eyes of the school turned upon them and saw leadership in this class that put spark in their activities. When at last the 1981-82 school year began, the Class of '82 was struck with a severe case of . . . SENIORITIS! The class, sponsored by Mrs. Rachel Murray and Mr. and Mrs. Fred Gebhard, had a hard time getting things organized due to the multi-faceted interests of the members. The class needed strong leadership and turned to their Class President Rick Bacon and Vice- President Kristy Frazier. To keep things moving, Rick and Kristy called on fellow officers, Secretary Lisa Finley, Treasurer Parrish Hill, and Class Coordinator Christine Gartner. These class leaders worked hard to carry on the traditional role of leaders of the school, though it was difficult at times due to the lack of participation by seniors. However, spirits and enthusiasm were finally aroused for the events ahead. Throughout the year seniors deposited sums of money at given in- tervals as payment .for their final reward, the Senior Cruise. The sole school in Lee County granted another year of fun in the sun in the Bahamas, North's Senior Knights worked hard to meet this great ex- pense, as well as striving to be worthy of this privilege bestowed upon them by the Lee County School Board. The final months of school were u-pon the seniors before they knew it. With the arrival of the Prom and the hurried search for that special dress or hectic arrangements for the rental of a tuxedo, seniors found themselves in a flurried haze. Dancing the night away, their thoughts turned to their past years as students at North and the years that lay ahead. On their evening at Grad-Nite, seniors felt it was their last chance to act as children and made the most of this opportunity, enjoying the Disney fairyland until dawn. Then time accelerated to record speed as plans were finalized for graduation. Announcements were sent to relatives and friends pro- claiming the news of their forthcom- ing commencement. Given final blessings at their Baccalaureate, seniors felt tensions grow. On Wednesday evening, May 26, approximately 320 North Ft. Myers High School seniors crossed the stage at the Lee Civic Center to become graduates, North High alumnae. No longer high school students, the Class of '82 were proud individuals tomorrow's leaders. fr. .zf - ' Q ' Senior Executive Council: Front Row: Phil Baker, Tammy Lawrence, Manley Iaquiss, Tara Maxey, Ianet Collins, Kim Bitter, Louise Adams, Becky Barley, Kathy Bllomfield, Kristy Frazier, and Christine Gartner. Middle Row: Mrs, Shirley Gebhard, Sponsor, Mr. Fred Gebhard, Sponsor, Robyn Bouch, Belinda Takach, Kim McCook, Mrs. Rachel Murray, Sponsor, Kim Kirby, Lisa Finley, Ed Garner, Rick Bacon, Pam Clouse, Wanda Newman. Back Row: Rick Morales, Darryl Ellis, Bill Collins, Tom Montefinese. 154 X Seniors f .Q ti- 5 I 1 High Cost of Being a Senior if' iifizimaifiw W Z 5. ,109 1 hee,.,., 1 J The cost of being a senior was astronomical. Before the school year of- ficially began, seniors received appoint- ment cards to have their senior portraits taken at Bryn-Alan Studio, with a sitting fee of 33.50. When the proofs arrived the photo packages were ordered for prices between 39.95 and 3131.00. As soon as school started the twelfth graders lined up to purchase the sym- bols of their elevated status : derby hats for 33.00 and T-shirts for 38.00. Supporting their senior class prolect of selling spirit buttons and ribbons meant an expenditure of 31 00 for the button and 3 25 weekly for the ribbons In October it was time to be fitted and then pay for the commencement caps and gowns price 312 00 and order that extra tassel to hang from the car mirror for 33 00 Then came the ordering of an nouncements calling cards memory albums and senior jewelry with prices varying according to each senior s needs If this wasn t enough yearbooks needed to be ordered with a pre delivery payment of 315 00 Students planning to attend college had to take either the SAT for 310 50 or the ACT for 38 50 College Level En trance Program Examinations ICLEPSI L 'af mix' ff 1 - Preparing for fun and excitement in the Bahamas, Mr. and Mrs, Cebhard, Darryl Ellis, Wanda Brown, and Ron Beecroft, have their bags packed. 2 - 1982 Senior Class Officers: Secretary Lisa Finley, Vice-President Kristy Frazier, President Rick Bacon, Class Coordinator Christine Gartner, and Treasurer Parrish Hill. '9 31 Ib fd Q V QQ 1-, E X , '---. were available in various fields at an extra cost of 322.00 a test. All North students dream of the day they will be seniors and eligible for the senior cruise to the Bahamas. This year's trip aboard the Dolphin from April 16 to 19, cost each senior 3350.00. The ticket for the Senior Prom on April 8 was free for seniors, but not for their dates, unless he or she was also a member of the senior class. Expenses of formal wear flowers and the tradi- tional dinner out before or after the dance boosted the expense of this memorable evening Seniors and their dates were eligible to buy tickets for an all night visit to the magical kingdom of Walt Disney on May 8 for the yearly celebration of Grad Nite Ticket price was 325 00 per person which included all expenses ex cept food and souvenirs Seniors are looked up to and respected by the underclassmen at North High School Although it certain ly is not cheap to be a senior each freshman sophomore and yunior dreams of the day they will be at the top to enj oy all the activities and privileges offered x -.xt Y 7 . . . . . ,, . ,, o ' ! . . ! ' ! ! ' ll ' !l ' ' I u n v . . l 3 ' 7 K I n a o y . . , . . . - , . ' 1- . v 1. ' if . . . sz? f V - - y v US.: 44 . ' ' lt - H - - - - -i1'?,.Qi', . t, H.e+?3:?i32, . . Seniors! 155 Seniors Rise While Float Sinks This year the Class with Class, the Seniors, finally met their Waterloo. During Homecoming Week one of their biggest projects, the Senior Class float, couldn't get off the drawing board. With so many seniors involved with after school jobs, numerous periods off campus, andfor holding leader- ship positions in other school organizations, they couldn't get a group together to work on the float. After numerous construction meetings which seniors failed to attend, Senior Class President Rick Bacon had an idea. Quickly a few loyals helped Rick whip together a shopping cart pgaily decorated with crepe paper and sporting the banner Senior Apathy. It was pushed along behind the band in the Homecom- ing Parade for all to see. Though the Senior Class had difficulty with their float, they didn't have any trouble getting workers for their refreshment booth on Field Day. Their thick, juicy hamburgers were dispersed amid smoke and laughter, and dollars poured into the class treasury .,,. X' 4 f. , f' , we my f ' WAN-f ' -.-H7 L......,M.WM.fq5 , I faffffgii. jf i' T , ,M 2. 33, ...,.... Y ,c If 2 1 - The infamous float Senior Apathy, 2 - The Senior Homecoming window competition entry heralds a message of spirit and pride. 3 - Manley Iaquiss, Prince of Punk, holds court among four f'raving punkettes, Chris Siegle, Ianet Collins, Michelle Markovits, and Shawn Lingle. 156 X Seniors 3 V t -. 4 ..: Ext, , . 9 . 1 .. -X N24 1 - Really smokin' now, Darryl Ellis grills ham- burgers for the Senior Executive Council with his assistant, Ianet Collins. 2 - Nostalgia Day par- ticipants, Denise Morgan and Christine Gartner, go pre-historic. 3 - Robin Ferrell interviews Nicole Vracar who portrays a member of the opposition from across the river. 4 - Four of the Senior Homecoming Representatives ride in style into the stadium during the '81 Parade. E ,,,- ' 3 Seniors f 157 f i r K Q E A X E I fffki - . 1 Ei Ii li I w Lu lu U 6: i 115 X 1 , , gi A 14 W: ,E :Q H Q ii ii 4 az 3 Q E S3 I 4 2 1 K 5. F 'V ' - WWW! KmS7??'BEU?NfQZS1E72sEJPZ5Si7l915Z5fka'0WZ?347iW!1F.5'hNZ'4iPP!I5?WV-fYlL7AG7'MfR472fiM7f1l9.'V!75577'6W41iiW?'AZ'l IN. m . I' -1' f ' ' 1 '- I f '- ' ' ' ' I 1 u ' , 1 ' -. ' - - ' 1 1 1' ' 1 ' ' ' ' ' ,efmxi fizf,W 'l',s, 1 1a 'Lff,'-'s FT33'lik-2H71,'f31f'1?Ny? M5131?-kJu?'lik ZFi4I+.iJQ71'f.'7:i A9L95'Ti1k'i'YYMSlBBSilf!sif.z1?E' ' ', . . ' .1 gH W1WWWP,HW1I1hW'M4H49'i2fWvZ902Z231WHwlBfBl.W'MW9WmI9WW3WR'K4i293ZfIf'1 WKMM COMMENCEMENT 1982 The long awaited day, May 26, 1982, arrived. As seniors donned their red caps and gowns and prepared to march into the Lee County Arena to receive their diplomas, their festive mood was marred by the realiza- tion that a part of their lives was drawing to a close. No longer would a major portion of each day revolve around the classrooms on Orange Grove Boulevard. No longer would they be beckoned to their studies by hour- ly bells. Friends and aquaintances would pass from view, some never to be seen again, others only intermittently. This evening marked the real beginning of their lives as independent adultsg it was the first day of their future. As they reached out to meet the challenges of tomorrow, they would remember with pride their days at North Fort Myers High School. l . Iulie A. Aberle - F.H.A., 11, 12. Colleen G. Adams - Volleyball, 9-115 D.E.C.A.. 115 Executive Council, 12. Debra L. Adams - Band, 9-125 Executive Council, 10-125 Student Government, Secretary, 125 Special Nine Honors Program, 9: Spanish Club, 10-125 Spanish Club, Sgt.-at-Arms, 115 Spanish Club, Secretary, 125 P.E. Leadership, 12. Kimberly L. Allen - Executive Council, 12. ,, ,WT-t,. a.. I Iulie A. Aberle Colleen C. Adams Debra L. Adams Kimberly L. Allen Connie E. Amerson Christine M. Anderson Frank A. Arciszewski Dawn M. Armstrong Tony C. Armstrong Rick Bacon Connie E. Amerson - Spirit Club, 105 Votech, 11. Christine M. Anderson Frank A. Arciszewski - Swim Team, 9, 11, 125 Baseball, 105 French Club, 11. Dawn M. Armstrong - Papillion-LaVista High, 10, 11. Tony C, Armstrong - Chorus, 105 Football, 105 Basketball, 11. Rick Bacon - Class President, 11, 125 Executive Council, 11, 125 Student Government Association, 10-125 Basketball Cameraman, 105 Football, 11' Golf Team, 10, 115 HN Club, 10, 115 Forensics, 11 125 National Forensics League, 125 Drama, 10-125 International Thespian Society, 11, 125 Yearbook Photographer, 125 Florida American Legion Boys' State, 115 Who's Who Among American High School Students. 1 1 Seniors f 161 Rebecca H. Barley Leroy Mason Baskin Anthony G. Battle Tracy Lee Becker Connie L. Bedford Ronald A. Beecroft Kimberly Ann Bitter Kathy Io Bloomfield William G. Bogart Richard Botelho, Ir. William C. Brewer Philip W. Baker Brian K. Barnard Mary I. Barnes Iames D. Beckos Diana L. Bishop Robyn R. Bouch Robbin Bowman Daniel Boyd Natalie I. Breyer Philip W. Baker - Wrestling, 9-1ZQ Tennis, 11, 123 Spanish Club, 11, 123 Student Government Association, 113 National Honor Society, 11, 123 Special Nine Honors Program, 93 Executive Coun- cil,123ECC, 11. Rebecca H. Barley - Executive Council, 9, 103 Spanish Club, 93 Track, 103 Powderpuff Football, 10. Brian K. Barnard - D.C.T. Mary I. Barnes - Cheerleader, 101 Povvderpuff Football, 103 D.E.C.A., Fashion Club, 11, 12. Leroy Mason Baskin - Track, 101 Who's Who Among American High School Students. Anthony G. Battle - P.E. Leadership, 12. Tracy Lee Becker - Powderpuff Football, 11, 123 P.E. Leadership, 123 Executive Council, 123 F.B.L.A., 123 C.B.E., Point Chairman, 12. Iames D. Beckos - Votech, 11. 162 X Seniors Connie L. Bedford - French Club, 9, 103 French Club, President, 103 Executive Council, 11, 123 Band, 11, 123 Excalibur, 123 Drama, 121 P.E. Leadership, 123 Student Government Association, 11, 12. Ronald A. Beecroft - D.C.T., 11. Diana L. Bishop - Excalibur, 11, 123 Iournalism, 12. Kimberly Ann Bitter - Band, 9-123 Majorette, 10-123 Executive Council, 11, 123 Special Nine Honors Program, 93 Band Council, Iunior Representative, 111 Band Council Librarian, 123 Student Government, Vice-President, 12. Kathy Io Bloomfield William G. Bogart Richard Botelho, Ir. - Photography, 103 D.C.T., 12. Robyn R. Bouch - French Club, 10-123 French Club Treasurer, 11, Vice-President, 123 Student Government, 10-12, Treasurer, 123 Executive Councils, 11, 12, Special Nine Hours Program, 93 Elementary School French Teacher, 11, 123 Science Fair, 93 Hostage Welcome Back Commit- tee, 113 Who's Who Among American High School Students. Robbin Bowman - Track, 11. Daniel Boyd - Baseball, 10-12Q Cross Country, 123 Knight Life Staff, 9-121 Knight Life Editor3 Florida American Legion Boys' StHt6Q Excalibur, 123 Ex- ecutive Council, 10Q State Iournalism Competition, 10-123 Who's Who Among American High School Students. William C. Brewer - Charlotte High School, 99 Lakeland High School, 103 Votech, 11. Natalie I. Breyer - Canterbury High School, 9, 10 f l Fannie L. Brown - Basketball, 9-125 Volleyball, 10-125 Softball, 105 Track, 9, 10, 125 Cheerleading, 125 Spirit Club, 95 Powderpuff Football, 10, 125 Sophomore Class Secretary5 Executive Council, 10, 115 Y,A.C., 115 P.E. Leadership, 10-12. Wanda I. Brown - D.E.C.A., 12. Sandra L. Burford - Orchestra, 95 Cape Coral High, 10. Karen M. Butsch - Spirit Club, 9: Swim Team, 9, 105 Track Team, 105 French Club, 115 Gymnastics, 105 Powderpuff Football, 11, 125 O.E.C.,115 C.B.E., 125 F.B.L.A., 125 P.E. Leadership, 115 Who's Who Among American High School Students. Steven P. Callahan - Terry Parker High School, Iacksonville, 9-11. Roberto Carrillo, Ir. - Band, 9-125 Symphonic Band, 10-125 Baseball, 10-125 P.E. Leadership, 11, 12 Kimberly A. Carter - Medical Explorers, 12. Della I. Carver - Basketball, 95 Votech, 12. Russell D. Carver - Band, 9-115 Key Club, 11, 125 Key Club President 125 Executive Council, 11, 125 National Honor Society, 11,12. Terri T, Chaney - D.E.C.A., 115 Powderpuff Football, 95 Track, 12. Paul K. Chaplow, Ir. - Baseball, 10. Ioseph D. Charney Pamela E. Clouse - Special Nine Honors Pro- gram5 German Club, 95 Basketball, 10, 115 Spanish Club, 10-125 Cross Country, 115 Executive Council, 11, 125 Yearbook Business Editor, 12. Dayna I. Cobb - Special Nine Honors Programg Band, 9, 105 Concert Band, 9, 10, 125 Flag Corps, 125 German Club, 105 Executive Council, 9, 10,12. Terrie Y. Cochran - Drama, 10-125 Drama Fannie L. Brown Wanda I. Brown Sandra L. Burlord Karen M. Butsch Steven P. Callahan il ,l Roberto Carrillo, Ir. Kimberly A. Carter Della I. Carver Russell D. Carver Terri T. Chaney Paul K. Chaplow, I Ioseph D. Charney Pamela E. Clouse Dayna I. Cobb Terrie Y. Cochran Terrence B. Cody Shelly L. Cole Tommie I. Cole Ianet M. Collins William P. Collins Secretary, 125 Thespians, 11, 125 Thespians Treasurer, 125 Excalibur, 11, 125 Excalibur Assis- tant Editor, 125 Student Government'Association, 125 Executive Council, 125 ECC, 125 Forensics, 125 Medical Explorers Program, 12. Terrence B. Cody - Wrestling, 115 Football, 10- 125 Track, 11. Shelly L. Cole - F.F.A.,11,125F.H.A.,12. Tommie I. Cole - R.O.T.C.,10-12. Ianet M. Collins - Band, 9-125 Symphonic Band, 10-125 Executive Councils, 10-125 Powderpuff Football, 105 Student Government Association, 10, 125 National Honor Society, 11, 125 Treasurer, 125 Math Team, 105 Special Nine Honors Program' Spanish Club, 125 ECC Summer Scholarship, 11. William P. Collins - Baseball, 105 Spanish Club 125 Executive Council, 11,12. v y Seniors X 163 Ianice M. Cooley Iames F. Cooper Timothy I. Corkhill Scott A. Cornett Iohn Cosby Tyler A. Cox Kelleen S. Crager Rebecca A. Crawford Danielle C. Curry Ella M. Davenport Alex DiGiacomo Yvonne C. Dill Iackquline R. Dixon Lori I. Douglas Linda Io Drew Eva Louann Driskell Teri L. DuBrule IUrsinI Idella Mae Dunson Ioseph H. Dziewik Angelia M. Eblin Ianice M. Cooley - Bibb County High School, Centreville, Alabama, 9-11. Iames F. Cooper - Football, 9-123 Track, 11, 123 Y.A.C.,9,10. Timothy I. Corkhill - Football, 103 F.F.A., 11, 12. Scott A. Cornett - Football, 9-121 Co-Captain, Varsity Football, 123 Track, 11. Iohn Cosby - Basketball, 9-113 Football, 10. Tyler A. Cox Kelleen S. Crager - IV Cheerleader, Co-Captain, 103 Spanish Club, 10-12, Officer, 11Q Powderpuff Football, 113 P.E. Leadership, 113 Band, 93 D.E.C.A.,12. Rebecca A. Crawford - Special Nine Honors Program3 Bradon Adult Center, Tampa, 103 C.B.E., 12 164 X Seniors Danielle C. Curry - Gymnastics, 9-113 Class Secretary, 103N-Club,103 F.F.A., 11, 12. Ella M. Davenport - Will C. Wood High, Vacaville, California, 93 Powderpuff Football, 11, 12. Alex DiGiacomo Yvonne C. Dill - Spanish Club, 102 P.E. Leader- ship, 123 Powderpuff Football, 9, 10, 12. Iackquline R. Dixon - Baseball, 9-111 Football, 10-12. Lori I. Douglas - R.O.T.C., 10, 113 Spanish Club, 12. Linda Io Drew - IV Cheerleader, 101 Homecom- ing Court, 9,11. Eva Louann Driskell - Powderpuff Football, 9- 122 P.E. Leadership, 12Q F.H.A., 11, 12Q Executive Council, 123 Softball, 123 Keyettes, 103 D.E.C.A.,113 Child Care Service, 11, 12. Teri L. DuBrule fUrsinI - Student Government Association, 9-12, Secretary, 113 Executive Coun- cil, 9, 10, 123 Chorus, 9, 10, 123 Spanish Club, 9, 10, 123 Forensics, 11, 123 Drama, 11, 12, Grease , 113 P.E. Leadership, 12, Special Nine Honors Pro- gramg Yearbook, 11, 12, Secretary, 123 German Ex- change Student, 113 Who's Who in Music. Idella Mae Dunson - Spirit Club, 103 Votech, 10, 11. Ioseph H. Dziewik - Marching Band, 9-123 Con- cert Band, 93 Symphonic Band, 10-12. Angelia M. Eblin - Gymnastics, 9. ,. Scarlett R. Edge - Spanish Club, 101 Keyettes, 112 P.E. Leadership, 111 Forensics, 11, 12, Treasurer 123 Powderpuff Football, 12. Iohn C. Eichner - Diving Team, 93 Spanish Club 123 Executive Council, 12. Darryl W. Ellis - Executive Council, 10, 11, 12 Spanish Club, 123 Baseball, 10. George I. Ellsworth - Baseball, 9, 103 Basketball, 10. Serdarryel D. English - Basketball, 10, 111 Foot- ball, 10, 112 Track, 9, 11, 12. Alonzo Everett, Ir. - Football, 103 P.E. Leadership. Robin L. Ferrell -- Cheerleader, 101 Drama Club, 10-12, President, 123 International Thespians, 11, 121 Executive Council, 123 Excalibur, 12. Lisa M. Ferrara - Riverdale High, 9, 10. Christine R. Filkill - F.B.L.A., 12. Lisa M. Finley -- Marching Band, 9-123 Sym- phonic Band, 9-123 Spanish Club, 10-12, Sgt.-at- Arms, 123 Class Secretary, 11, 123 Executive Coun- cil, 11, 123 Student Government Association, 10-123 National Honor Society, 11, 12, Sgt.-at-Arms, 123 Forensics, 123 Special Nine Honors Program3 Powderpuff Football, 10. Richard L. Forehand - Votech, 10, 11. Katherine M. Fortini - Gymnastics, 9, 101 Cheerleader, 11. Richard S. Frank - Diving Team, 93 Cross Coun- try, 11, 123 Spanish Club, 11, 123 Executive Coun- cil, 11, 123 National Honor Society, 11, 123 Special Nine Honors Programg Alternate, Boys' State. Kristy L. Frazier - Cheerleader, 10-12, Captain, 123 Homecoming Court, 113 Class Vice-President, 123 Executive Council, 10-12. Ruben M. Garces - Wrestling, 93 Marching Band, 9-123 Symphonic Band, 93 Stage Band, 10, 11, Baseball, 102 Homecoming Court, 103 ECC, 12. Scarlett R. Edge john C. Eichner Darryl W. Ellis Robin L. Ferrell Lisa M. Ferrara Lisa M. Finley Kristy L. Frazier Nora D. Garrett Christine E. Gart Cherie L. Gerald Nanette F. Gill Edgar W. Garner - National Honor Society, 11, 12, President, 123 Brain Brawl, 113 A vs. C Debating Team, 113 Edison Scholastic Programs, 113 Edison Math Contest, 10-123 Special Nine Honors Pro- gram, Spanish Club, 11, 122 Student Government Association, 123 Executive Council, 10-12. Nora D. Garrett - Band, 11, 12. Christine E. Gartner - Special Nine Honors Pro- gram3 Student Government Association, 10, 113 Spanish Club, 10, 111 Marching Band, 9-121 Secretary of Band Council, 123 Majorette, 11, 12, Captain, 123 Executive Council, 10-123 Class Coor- dinator, 11, 123 Basketball Statistician, 10. Cherie L. Gerald - Executive Council, 10-123 French Club, 101 Iournalism, 93 Chorus, 10' Spanish Club, 93 Student Government Association 12. Nanette F. Gill - F.H.A., 11, 12, President, 12. - George I. Ellsworth Serdarryel D. English Alonzo Everett, Ir. Christine R. Filkill Richard L. Forehand Katherine M. Fortini Richard S. Frank Ruben M. Garces Edgar W. Garner HSI' Seniors 1' Antonette D. Gilmore Richard N. Gilyard Trudy A. Gittleman George A. Gottfried Doreen A. Graff Tammy L. Green Irvin Greenlaw Michael L. Greenwell Thomas A. Grice Nicholas D. Guerra R. Ioseph Haggard Donita A. Hall Nicole R. Harmon Phillip S. Harper Vickie L. Harrell Brouth Harris Timothy H. Hay Ieffrey A. Hayworth Patrick Healey Bryan I. Heggemeier Antonette D. Gilmore - Spirit Club, 9, 103 Y.A.C., 111 D.E.C.A..113Soltball,9,102F.H.A.,1Z. Richard N. Gilyard Football, 10-12. Trudy A. Gittleman George A. Gottfried Doreen A. Graff f Track, 93 Basketball, 10, 113 R.O.T.C.,11,12. Executive Council, 10-123 Powderpuff Football, 12: C.B.E.fF.B.L.A., 11, 12, Vice-President, 123 Who's Who Among High School Students. Tammy L. Green - Keyettes, 10, 11. Irvin Greenlaw A Wrestling, 10-12. Michael L. Greenwell - Baseball, 9-12: Football, 10-123 Homecoming Court. ll, Thomas A. Grice - Swim Team, 10. Nicholas D. Guerra - Votech, 9, 112 Football, 11. R. Ioseph Haggard - Executive Council, 11, 123 Tennis, 12. Donita A. Hall - Cheerleader, 103 Volleyball, 11, 12. Nicole R. Harmon - Executive Council, 10-123 Band, 9-123 Majorette, 123 Band Senior Represen- tativeg Student Government Association, 9-123 P.E, Leadership, 122 Basketball Statistician, 10, 11Q Special Nine Honors Program3 Who's Who Among High School Students. Phillip S. Harper - Key Club, 93 Evangelical Christian School, 9, 10. Vickie L. Harrell - Concert Band, 9, 10: Mar- ching Band, 101 Student Government Association, 103 P.E. Leadership, 12. Brouth Harris - Ft. Myers High, 93 Football, 12. Timothy H. Hay - Willoughby South High, Ohio, 9, 103 Forensics, 12, Drama, 123 Executive Council, 12. Ieffrey A. Hayworth - Band, 9-12, Drum Major, 123 All-Star Marching Band, 112 Lee County Honor Band, 112 Student Government Association, 10: Special Nine Honors Program3 Boys' State, 111 Who's Who Among High School Students. Patrick Healey - Bound Brook High, Bound Brook, New Iersey, 9, 103 Votech, 11. Bryan I. Heggemeier lb. ln-ag-. Kimberly G. Henderson - Executive Council, 103 Student Government Association, 103 C.B.E.!F.B.L.A.,11,12. Zona M. Henry - Powderpuff Football, 9-113 F.H.A., 113 I.V. Cheerleader, 103 Varsity Cheerleader, 123 S.A.C,, 111 Homemaker of the Year Award, 113 P.E. Leadership, 11. Robin L. Hess - Stage Band, 10, 113 Marching Band, 12. Albert Hill, Ir. Parrish L. Hill - Forensics, 11, 121 Forensics, 1st Place District, 11: Executive Council, 12, Class Treasurer, 122 P.E. Leadership, 113 Y.A.C., 123 F.C.A., 12, Deborah A. Hills - Volleyball, 113 Science Club, 9. Knight Life, 11, 121 F.B.L.A., 12. Donna L. Howard - Spirit Club, 103 F.H.A., 11, 12, Officer, 123 S.A.C., 11. Tina M. Hribar - Y.A.C.,11. Kimberly L. Hughes - Bishop Verot High, 93 O.E.C., 113 C.B.E., 11, 123 Cheerleader, 123 P.E. Leadership, 123 Gymnastics, 11. Laongtip Nok Hunter - S.A.C.,11,12. Emory M. Iles - Chorus, 113 Riverdale High, 9, 10. Tracy M. Iverson - Basketball, 93 Softball, 113 F.H.A., 11, 12, Vice-President, 123 Powderpuff Football, 11. Gloria A. Iackson - Cypress Lake High, 93 In- teract, 10. Kimberly C. Henderson Zona M. Henry Robin L. Hess Albert Hill, Ir. Parrish L. Hill Deborah A. Hills Donna L. Howard Tina M. Hribar Kimberly L. Hughes Laongtip Nok Hunter Emory M. Iles Tracy M. Iverson Gloria A. Iackson Polly A. Iackson Laura B. Iames Manley E. Iaquiss Edward S. Ieleniewski Franklin F. Ienkins Mark E. Ieter Carletha Q. Iewett Polly A. Iackson Laura B. Iames - Spirit Club, 102 F.H.A., 11. Manley E. Iaquiss f Cross Country, 10, 113 Na- tional Honor Society, 11, 123 Executive Council, 11, 123 Lance Yearbook, 10-12, Sports Editor, 11, Editor, 123 Student Government Association, 12, Lance Representative, 123 Spanish Club, 12. Edward S. Ieleniewski - Key Club, 93 Knight l..ife,10-12. Franklin F. Ienkins S S.A.C., 123 Basketball, 10-12. Mark E. Ieter- R.O.T.C., 11, 12. Carletha Q. Iewett - Spirit Club, 9, 101 Powder- pufl Football, 103 Executive Council, 103 Cheerleader 10. Seniors X167 Frances L. Iohnson Iessie M. Iohnson Loretta R. Iohnson Albert R. Iohnston, Ir. Kimberly A. Ioyner Stephanie V. Iuba Wendy K. Kelleher Kimberly G. Kelly Kimberly A. Kirby Teresa E. Landress I I I Cynthia L. Iiles I Paul H. Kelley Mark E. Kinder Brad L. Koehler William L. Kurz Robert W. Lanier Ianet L, Lannen Iudy M. Lannen Kelly Lansberry Linda D. Larson Cynthia L. Iiles - Chorus, 9-113 Y.A.C.,10. Frances L. Iohnson Iessie M. Iohnson - Spirit Club, 9. Loretta R. Iohnson Albert R. Iohnson, Ir. F West High, Anchorage, Alaska, 9. Kimberly A. Ioyner - D.C.T., 11. Stephanie V. Iuba - Suwavvnee High, Live Oak, Fla., 93 Spanish Club, 9, 10: Spirit Club, 10: Keyet- tes, 11: Drama, 11, 12, Grease , 11, It Happens Every Summer , 113 International Thespian Socie- ty, 11, 123 Forensics, 11, 12, Vice-President, 123 Yearbook Secretary, 12: Student Government Association, 123 Executive Council, 12. 168 X Seniors Wendy K. Kelleher - Spanish Club, 12. Paul H. Kelley - Track, 9, Marching Band, 9-123 Concert Band, 9, 103 Symphonic Band, 113 Key Club, 11, 12: Executive Council, 11,12. Kimberly G. Kelly - Special Nine Honors Pro- gramg Executive Council, 10, 12, S.A.C., 11, 12. Mark E. Kinder - Riverdale High, 95 Knight Life, Editor, 123 Excalibur, 11, 12: French Club, 12. Kimberly A. Kirby - Marching Band, 9, 103 Con- cert Band, 9: Class Vice-President, 105 Executive Council, 10, 11, 12: Cheerleader, 103 Special Nine Honors Program, Spanish Club, 105 National Honor Society, 11, 123 Student Government Association, 10, 123 Skip Bafalis Intern Program, '11. Brad L. Koehler - Basketball, 11, 12, Haworth High, Kokomo, Indiana, 93 French Club, 10. William L. Kurz - F.F.A., 10-12, Reporter, 11, Vice-President,1Z. Teresa E. Landress - F.F.A., 10-123 German Club, 10. Robert W. Lanier - F.F.A., 11. janet L. Lannen Iudy M. Lannen - R.O.T.C., 10-12. Kelly Lansberry Linda D. Larson - F.F.A., 10-12, Treasurer, 11. President, 12. Tammy R. Lawrence - Student Government Association, 10-123 Executive Council, 10-123 Medical Explorers, 11, 12, President, 123 ECC, 123 Special Nine Honors Programg National Honor Society, 123 Who's Who Among High School Students. Philip D. Leite - Stafford High, Fredericksburg, Virginia, 93 R.O.T.C., 10-121 Golf Team, 11, 12. Robert I. Lemieux - Riverdale High, 93 Votech, '11. Lisa Lesh - Votech, 12. Ricky Lewsader - P.E. Leadership, 12. Shawn L. Lingle - Marching Band, 10-123 Sym- phonic Band, 10-122 Powderpuff Football, 9-12, Softball, 10-122 P.E. Leadership, 11, 123 Executive Council, 103 Student Government Association, 93 Special Nine Honors Program, 93 National Honor Society, 11, 123 Knight Life Staff, 11, 12. Troy W. Lister - Band, 9-12Q Student Govern- ment Association, 9-123 Special Nine Honors Pro- gram3 Florida American Legion Boys' State, 11 Who's Who Among High School Students. Dawn Melissa Lovett - F.H.A., 11, 12, Secretary, 123 Powderpuff Football, 11, 12. R. Todd MacDonald - Baseball, 103 Cross Coun- try, 113 Track, 12. Tammy I. Maclntyre - Revere High, Richfield Ohio, 9, 103 P.E. Leadership, 11, 123 ECC, 12. Debra I. Maffei - Spirit Club, 103 C.B.E., 12. Steven R. Maitland - Iournalism, 11, 12. Clarence Major - Football, 93 Basketball, 9, 10 123 P.E. Leadership, 12. Doreen Makar - Spirit Club, 103 Volleyball, 11 123 Excalibur, 123 Executive Council, 12. l Tammy R. Lawrence Philip D. Leite Robert I. Lemieux Lisa Lesh Ricky Lewsader Shawn L. Lingle Troy W. Lister Dawn Melissa Lovett R. Todd MacDonald Tammy I. Maclntyre Debra I. Maffei Steven R. Maitland Clarence Major Doreen Makar Dan W. Mallow Gregory A. Marinell Michele Markovits Garry A. Martin Rufus Martin Michele Martindale Dan W. Mallow - Football, 10-123 Track, 11. Gregory A. Marinell - D.C.T., 11, 123 F.F.A., 11, Rodeo, 11. Michele Markovits - Marching Band, 9-123 Sym- phonic Band, 9-123 Spanish Club, 10-12, Secretary, 121 Executive Council, 9-123 Excalibur, 11, 12, Asst. Editor, 11, 123 Drama, 123 National Thespian Society, 123 Forensics, 123 Student Government Association, 10-123 Powderpuff Football, 123 P.E. Leadership, 123 Special Nine Honors Program, National Honor Society, 11, 12. Garry A. Martin - D.E.C.A.,11,12. Rufus Martin - Basketball, 9-121 Football, 9, 103 Track, 43 P.E. Leadership, 11,12. Michele Martindale - Cheerleader, 93 P.E. Leadership, 113 F.H.A. 11, 12, North Child Care Center, 11, 12. Seniors f 169 ship, 12. Brenda M. Massoth Iennifer L. Maxey Tara I. Maxey Daniel P. McCarthy Amy G. McClurg Kimbra P. McCook Susan M. McDermott Timothy L. McGill Maureen McHugh Gary P. McIntosh Lucinda M. Means Robert D. Mellema Sonya G. Merritt Christopher Meyers Heather A. Mikels Nancy L. Moffler Patricia L. Moffler Thomas S. Montefinese Stacie L. Moon Levi D. Mooney Brenda M. Massoth - C.B.E., 11, 123 P.E. Leader- jennifer L. Maxey - P.E. Leadership, 123 Track, 9, 10, 122 Executive Council, 9, 123 Marching Band, 9, 10, 123 Symphonic Band, 10, 123 Majorette, 10, 123 Student Government Association, 123 R.O.T.C., 93 Y.A.C.,9, Tara I. Maxey - Student Government Associa- tion, 9-12, President, 123 Class President, 103 Ex- ecutive Council, 11, 12: Track, 9-12, Captain, 101 Cross Country, 113 Powderpuff Football, 10, 11g R.O.T.C., 10-12, Platoon Sgt., 10, Company Com- mander, 11, Battalion Executive Officer, 123 Na- tional Honor Society, 11, 12, District Brain Bawl Team, 11, District Secretary, 12, Advanced Math Team, 113 Flag Corps, 12, Captain, 123 Spanish Club, 10, 113 Spirit Club, 93 Special Nine Honors Program: Concert Band, 9. Daniel P. McCarthy Amy G.McClurg 4 Softball, 9-113 Executive 170 X Seniors Council, 113 Track, 10. A Kimbra P. McCook - Bonanza High, LasVegas, Nevada, 93 Baker County High, MacClenny, Florida, 103 Spanish Club, 11, 123 German Club, 11, 123 Marching Band, 11, 123 Symphonic Band, 123 German District Contest, 11, 123 German State Contest, 11, 123 German Exchange Student Pro- gram, 112 Drama Club, 12. Susan M. McDermott- German Club, 9-12. Timothy L. McGill - Marching Band, 9, 101 Sym- phonic Band,9,10. Maureen McHugh - C.B.E., 123 P.E. Leadership, 12. Gary P. McIntosh - Football, 123 Baseball, 12. Lucinda M. Means - Student Government Association, 103 Executive Council, 11, 122 Class Treasurer, 111 Powderpuff Football, 9-12. Robert D. Mellema - Temple Christian High, 9, 10ZD.C.T.,11ZVotech,11. Sonya G. Merritt - Pep Squad, 93 Gymnastic Team, 10, 111 Drama, 11, 123 Forensics, 123 Ft. Myers Beach Shrine Queen, 12. Christopher Meyers - R.O.T.C., 10-121 Forensics, 11, 123 President, 123 Executive Council, 123 Track, 12. Heather A. Mikels - Minoa High, 9, 103 Liverpool High, 11. Nancy L. Muffler - Votech, 12. Patricia L. Moffler - Votech, 12. Thomas S. Montefinese - Tennis Team, 11, 12: Spanish Club, 111 Executive Council, 9-121 Lance Staff, 121 Knight Life Staff, 10, 112 R.O.T.C., 10-12. Platoon Leader, 11, Company Commander, 121 Forensics, 12. Stacie L. Moon - Y.A.C., 113 R.O.T.C., 93 Wrestl- ing Cheerleader, 10, 113 Yearbook, 113 D.E.C.A., 113Votech, 12. Levi D. Mooney - Football, 10-123 Wrestling, 10- 123 Track, 10-12: French Club, 11, 121 P.E. Leader- ship, 11, 12. Richard I. Morales - Executive Council, 9-123 Class Sgt.-at-Arms, 10, Student Government Association, 9-121 Spanish Club, 10-12, President, 11, 121. Special Nine Honors Programg Spirit Club, 12, President, 123 Lance Staff, 12, Copy Editor, 123 Math Contest, 103 National Honor Society, 123 Basketball, 9-122 Tennis, 11, 12, ECC, 11, 12. Shevawn Denise Morgan - Student Government Association, 103 French Club, 11, 123 Band, 9-121 State and District Contest, 10-123 Band Treasurer, 123 Majorette, 10-12, Executive Council, 11, 123 National Honor Society, 11, 123 P.E. Leadership, 113 Special Nine Honors Program. Andrea R. Morris Gary S. Moser - Wrestling, 10, 11. Faye D. Moten - P.E. Leadership, 113 F.H.A., 11, 123 Basketball, 9-123 Volleyball, 10-123 Softball, 103 Powderpuff Football, 9. Margie Nahalewski - Basketball, 9-123 Softball, 123 Spanish Club, 123 Lance Staff, 123 Track, 123 Executive Council, 12. Cassandra Neidlinger Wanda L. Newman - Diving Team, 93 Special Nine Honors Program3 French Club, 11, 123 Lance Staff, 10-12, Business Manager, 10, Asst. Editor, 11, Editor-in-Chief, 123 Executive Council, 11, 12. Robert T. Noble - Marching Band, 93 Wrestling, 93 Baseball, 103 Football Manager, 103 F.F.A., 11, 12. Laura L. Novatney Harold L. Olmstead - Football, 11. Deborah K. Oropallo Robbie M. Ower - D.E.C.A. Iohn I. Panio, Ir. - Special Nine Honors Program3 Richard I. Morale: S. Denise Morgan Andrea R. Morris Gary S. Moser Faye D. Moten Margie Nahalewski Cassandra Neidlingel Wanda L. Newman Robert T. Noble Laura L. Novatney Harold L. Olmstead Deborah K. Oropallo Robbie M. Ower Iohn I. Panio, Ir. Laurie L. Parish Queen E. Parson Larre Todd Pate Robert W. Peckham Lynn A. Pepkowski Paul Q. Petersdorff Football, 10, 111 Executive Council, 10, 113 Homecoming Court, 113 Drama, 121 Spanish Club, 123 Forensics, 12, Secretary, 12. Laurie L. Parish - Orchestra, 9, 103 Keyettes, 10, 11, French Club, 9-123 Elementary French Teacher, 123 Executive Council, 12. Queen E. Parson - F.H.A., 113 Band, 93 P.E. Leadership, 113 Powderpuff Football, 9, 11. Larre Todd Pate - Marching Band, 10, 113 Stage Band, 11, 12. Robert W. Peckham - German Club, 9-123 Ger- man Exchange Program, 113 Key Club, 11, 12. Lynn A. Pepkowski - Student Government Association, 103 Powderpuff Football, 10Q Ex- ecutive Council, 11, 123 National Honor Society, 11, 12. Paul Q. Petersdorff Douglas C. Pfeiffer Robert A. Pohle Toni L. Reist Teresa A. Rhodes Christopher A. Rice Tonya L. Rice Keith E. Richmond Ira L. Riggins Cathy D. Roberts Ann M. Robinson Robert A. Rock Beatrice Rosario Raymond Rowland Walter A. Ruth Tony I. Rutherford Dave G. Ryals Tina Ann Sain Geneva M. Salvatore Frederick VV. Salvatore Theresa Sands Douglas C. Pfeiffer - Band, 9. Robert A. Pohle - F.F.A., 11, 123 Florida High School Rodeo, 11, 12. Toni L. Reist - F.H.A.,10,11. Teresa A. Rhodes - Drama Club, 12. Christopher A. Rice - Executive Council, 11, 123 Student Government Association, 12. Tonya L. Rice - Cheerleader, 113 Powderpuff Football,10, 11. Keith E. Richmond - Spanish Club, 12. Ira L. Riggins - Football, 9-121 Basketball, 10, 113 Track, 10. 172 X Seniors Cathy D. Roberts - Powderpuff Football, 93 Volleyball, 113 Basketball, 9-123 P.E. Leadership, 113 Student Advisory Council, 113 F.H.A.,11Q Child Care, 113 Softball, 10, 12. Ann M. Robinson - German Club, 10-123 Swim Team, 12. Robert A. Rock - F.F.A.,11. Beatrice Rosario - Spanish Club, 103 Powderpuff Football, 113 Interact, 113 Drama, 113 Grease , 113 D.C.T., 112 Thespians, 11, 12. Raymond Rowland - South Plantation High, 9, 10 t t l Walter A. Ruth - F.F.A., 11, 12. Tony I. Rutherford - Baseball, 10-12, Executive Council, 11, 121 Student Government Association, 12. Dave G. Ryals - D.C.T.,113D.E..C.A.,12. Tina A. Sain - German Club, 103 D.E.C.A.,12. Geneva M. Salvatore - French Club, 9: Spirit Club, 101 Executive Council, 12. Frederick W. Salvatore - R.O.T.C., 9, 10, 12: Ex- plorers, 9,10, 12. Theresa Sands l Darlene E. Sapp - D.C.T., 10, 11, President, 113 F.l-l.A., 10,11. Colette I. Saumier - F.H.A., 11, 123 Executive Council, 121 Powderpuff Football, 11, 121 Drama, 10. David Linwood Schultz - National Honor Socie- ty, 11, 123 Key Club, 10, 11, 12, President, 11, Lt. Governor, 123 R.O.T.C., 10-12, Platoon Leader, 10, Company Commander, 11, Battalion Commander, 12, Special Forces, 10, Color Guard, 10, 112 Ger- man Club, 10, 113 Forensics, 113 Band, 93 Golf, 103 German Exchange Program, 11. Tina M. Scott - Swim Team, 93 Diving Team, 103 Medical Explorers, 113 Executive Council, 12. Iacqueline E. Scurry - Powderpuff Football, 9, 11, 123 Basketball, 9-123 Interact, 11, 123 P.E. Leadership, 123 Volleyball, 123 Y.A.C., 12. Lonnie L. Seal Eric W. Sellers Michelle I. Selvage - Band, 9, 103 Gymnastics, 10, 113 Tennis, 11, 121 P.E. Leadership, 11, 123 N 'K Volleyball, 123 Powderpuff Football, 11, 123 Basketball, 12. Christine A. Siegel - Basketball, 93 Executive Council, 11, 12, Prom Committee, 111 Lance Staff, 123 Spanish Club, 12. Craig A. Skipper - Senior Executive Council. William Wade Smallwood - German Club, 11, 123 Football Team, 10, 123 Baseball Team, 10-12, Night Life Staff, 11,12, Sports Editor, 12. Gail D. Smith - Powderpuff Football, 11. Marilyn D. Smith - Powderpuff Football, 93 Ex- ecutive Council,123Y.A.C.12. Richard Todd Spurlin - Special Nine Honors Program3 Spanish Club, 103 Computer Club, 101 Key Club, 10-12, Treasurer, 10, President, Lt. Governor State of Floridag National Honor Socie- ty, 11, 12, Project Ghairman3 Hugh O'Brian Youth Foundation Representative, 103 Participant, Southwest Florida Mathematics Competition, 11, 123 Congressional Intern, 113 R.O.T.C., 10-12, Pla- Darlene E. Sapp Colette I. Saumier David Linwood Schultz Tina M. Scott Iacqueline E. Scurry Lonnie L. Seal Eric W. Sellers Michelle I. Selvage Christine A. Siegel Craig A. Skipper W. Wade Smallwood Gail D. Smith Marilyn D. Smith Richard T. Spurlin Lynda C. Stauffer Larry E. Stenli Beverly L. Stevens Debra L. Stokes Brenda L. Stresing Iay Charles Strong toon Leader, 10, Battalion Commander, 11, Bat- talion Advisor, 123 American Legion Boys' State, 113 Who's Who Among American High School Students3 Forensics, 123 ECC, 123 Executive Coun- cil, 12. Lynda C. Stauffer - Palmetto High, 9, 101 German Club, 11, 12, Treasurer, 11, Secretary, 121 National Honor Society, 11, 123 Executive Council, 11, 12. Larry E. Stenli - Tower High, Warren, Michigan, 9, 10. Beverly L. Stevens - Special Nine Honors Pro- gram, Football Manager, 101 C.B.E.!F.B.L.A., 12. Debra L. Stokes - F.F.A., 113 C.B.E.fF.B.L.A., 11, 12. Brenda L. Stresing - Spanish Club, 9-121 C.B.E., 11, 123 F.B.L.A., 11, 123 Executive Council, 123 Stu- dent Government Association, 10, Special Nine Honors Programg Who's Who Among American High School Students. lay Charles Strong - Track, 11. Seniors! 113 Matthew L. Sturm Leane M. Suominen Ken I. Sushil Gregory W. Sweeney Belinda R. Takach Donald E. Tatum Glenn E. Taylor Sandra D. Thayer Curtis A. Thomas Loretta L. Thomas Karen M. Tillie George M. Tisell Charlton F. Tooke Christopher Townsend Neal R. Trombley Bryan L. Tydings Larry O. Tyre William G. Underwood Marshall N. Upshaw Denise VanValen Matthew L. Sturm - Grafton High, Grafton, West Virginia, 93 Chorus, 103 Drama, 10, 11, Executive Council, 11, 123 Forensics, 123 D.C.T., 12. Leane M. Suominen Ken I. Sushil Gregory W. Sweeney - Football, 9-113 Wrestling, '10, 11. Belinda R. Takach - Plantation High, Ft. Lauder- dale, 93 Band, 10-123 National Honor Society, 11, 12, Vice President, 123 All-Star Band, 121 Honors Band, 113 Solo and Ensemble Contest, 9-123 Band Council: President, 12, Secretary, 113 Math Com- 174 X Seniors petition, 10, 11. Donald E. Tatum - Votech, 12. Glenn E. Taylor - Band, 9-12. Sandra D. Thayer - Band, 9, 103 Student Govern- ment Association, 93 Spanish Club, 113 Executive Council, 123 Flag Corps, 12. Curtis A. Thomas - Marching Band, 10-122 Stage Band, 113 Concert Band, 10, 11. Loretta L. Thomas - R.O.T.C., 11. Karen M. Tillie - Special Nine Honors Programg French Club, 9-113 National Honor Society, 11, 121 Executive Council, 121 C.B.E.fF.B.L.A., 12. George M. Tisell - Cross Country, 12, Charlton F. Tooke Christopher Townsend - Marlboro High Marlboro, New Iersey, 9. Neal R. Trombley - P.E. Leadership, 11, 12 D.C.T., 12. Bryan L. Tydings - Football, 10. Larry O. Tyre - Football, 11. William G. Underwood - Football, 103 D.C.T., 11. Marshall N. Upshaw - Basketball. Denise VanValen - F.H.A., 111 Votech, 12. Artemio Velez, Ir. - Votech, 103 R.O.T.C., 12. Nicole E. Vracar - Special Nine Honors Pro- gram: French Club, 93 Drama, 10: Chorus, 105 D.E.C.A., 115 Executive Council, 12. Robin L. Wade Sandra K. Wallace - Spanish Club, 10-123 Ex- ecutive Council, 12. Kathy K. Wallin - Spirit Club, 9, 103 Powderpuff Football, 113 F.H.A., 11, 123 Swim Team, 10. Kevin S. Wambolt - Stage Band, 10-12, Marching Band, 11, 123 Baseball, 10. Lyle C. Warner - Votech, 11. Tammy Io Watson - Gymnastics, 10, 115 Ft Myers High, 9. Todd M. Watson - Lutheran Northwest High, 9-11. Robin L. Waugh Natasha Y. Webster - Powderpuff Football, 95 Y.A.C. President, 113 D.E.C.A. Historian, 11 D.E.C.A., 123 Student Government Association, 11 Forensics, 12. Ianelle M. Whetton - German Club, 9-12, Vice- President, 10, 113 Powderpuff Football, 11: Cer- man Exchange Student Program, 11. Artemio Velez, Ir. Nicole E. Vracar Robin L. Wade Sandra K. Wallace Kathy K. Wallin Kevin S. Wambolt Lyle C. Warner Tammy Io Watson Todd M. Watson Robin L. Waugh Natasha Y. Webster Ianelle M. Whetton Cynthia A. White Wendell Scott White Laschawn R. Whittye Nina M. Wild Michael E. Wilhite Barbara A. Williams Barbara I. Williams Thomas I. Williams Cynthia A. White - Fort Myers High, 93 Drama, 11, 12. Wendell Scott White - F.F.A., 10-12, Florida High School Rodeo Association, 11, 12. Laschawn R. Whittye Nina M. Wild - Special Nine Honors Programg Chorus, 9-12, Voice, 10, 123 Student Government Association, 10, 113 Spanish Club, 11, 12. Michael E. Wilhite - Wrestling, 10. Barbara A. Williams Barbara I. Williams - P.E. Leadership, 12. Thomas I. Williams Seniors X175 Pamela K. Wilmot Robin L. Wilson Shari R. Wilson Montgomery W. Winslow Chalida S. Wolf Kimberly L. Wood Samuel E. Wood Richard E. Woodall Mark Christopher Woods Madeline M. Wyatt Yolanda Yslas Pamela K. Wilmot - Special Nine Honors Pro- gram3 Class Coordinator, 103 Executive Council 10, Homecoming Court, 10, C.B.E., 113 F.B.L.A., 11 Lance Staff, 11, 121 Drama, 12Q Forensics, 12. Robin L. Wilson - Spirit Club, 113 Tennis, 12. Shari R. Wilson - H. H. Arnold High, Wiesbaden, Germany, 93 Romulus High, Romulus, New York, 10, 11. 176 X Seniors Montgomery W. Winslow - F.F.A., 113 D.C.T., 11. Chalida S. Wolf - Cahokia Senior High, Cahokia, Illinois, 93 Chorus, 10. Kimberly L. Wood - Basketball, 113 P.E. Leader- ship, 11Q Powderpuff Football, 10, 113 Knight Life Staff, 113 Softball, 115 Excalibur Staff, 11. Samuel E. Wood - Marching Band, 9-125 Sym- phonic Band, 9-122 Stage Band, 9-123 Executive ALMA MATER Our North Fort Myers we honor thee, For memories we hold so dear, Council, 10, 11, 12. Richard E. Woodall - F.F.A., 9-12. Mark Christopher Woods - Fort Myers High, 9 Football, 10, Aquinas High, Augusta, Georgia, 11' Wrestling, 12. Madeline M. Wyatt - Powderpuff Football, 10 11, 12. Yolanda Yslas - Interact, 113 S.A.C., 11. Ideals we've learned and friends we've made, Oh may they guide us on our way. So ever forward be our aim, Our Alma Mater hail to thee. I-11 f ffff ff ' 1 fy , ,,,,A,,W, .,.., ff Vw if ff! 4,7214- f fffzwf ff.2Wfi:f'ifff-M f f , fjfyifjfz-fgfffffzff ff f Ig, ,fx ff ' f , Q., fn. 1 X f T 'Uv '75 ' ff' 2 ffffngy If m, ff LC ff, ' f 1 ' X 1 ':ff'fz4.f,:.fj,17W' 'I' Q f f f ,fa aff M id Z! f ab! ,Q w,.w,f:,qg ff Y 1 if sf' ff f :...ZQ1.xmX f: xxx s. few ,. . w'.Y24vLXXX www-'W-wzwf 5 f F-4 ff- j 'K-, 1 Wa -, em Y, ,Wm-2-1Qxygwcwa,Aan-NmffwL.,X..W,Q-.gQmfw..Q4s,:.-.-X Yf'cif9f3-5Q'3fWZvG 5? Q, ffl .-v Tx5S2fi3ii4'fg,E'4-:7'5f5'251yff,Z'j:?Q'.y-.71--'f2q3.?jff2jjf,f 2'Q-gg-2334 f f 1 6 y Viv-1 Q2 syf 1 f.40M.s , ,, xy 1 wwlamwv.wf..Wfw,. -f-, , mf. ay 12 X? ,, , , A , V' - ,ow 4 5 lf Qwfw xl? J 5'7'-fzffk'-vL'i'k2'1?' J Q J W 4 Q3 sg '-1. ':f:v1vfffi1'.:- fl ,. lf: lax, ,,,, ig 5-0 'Aff fy ,MM ,fffy Qfyff, V1 fgfi? f ? - M 12,2 .fi 4 -f-'f '. 2 mf 'Ma-' 2, f f' Af W 'ZA ja Q yv 32529 iw'-1 f Q5 :im f ,-.25 A 21 f if f fkf' 3 . 4 f vff Aww ff 'J ' ,, l f , . ,. gy as 1 yiwfwffyf ,fffbyfW,,? 2Q2Z2?Q22222??g2?E? i ?252i5???i y Aff V M ' ' 4 f7 A-mr.f-W..-X42-1 .-?492W3i.,-, fo ,ff 2 f X ZWA . Us M, 4 0 ffAm!0,.12l.., f,-J -m,.m.A wel fl ., , .,,.,, fx K 2,45 ',f'f Yi'f'fff7f3??'..Y- ?f2fQ'?il 1- LZ ya M91 4 44,-,f . w - f ff ffxff A fp . ffif X994 . 1'.x- .,., J '.',.- , 17... , ffiwfaga Q fi. ' WVzf0?ffW?23zf?f2Q2i??axf :QQKZ ' , L, f ,,., ,, If .- x.., .gf Eff -f 7 ., ' f -,. f ffkd23 W zQ4422f2ZzZZZQQZZZQZQZZZZZZQQQQ w ggaff' g, ,Q f 7 XXV ff ,fyff may 1'f'2f5f6 Q'Z V 7775i ,. ,, ,, ,Q-Q -gf yffgf, ,Wx i. F ff X 5 M7 M ',,f. M.ffffif,yf1 f 0 f fyy - V, ,cfQw,fwi4f,wf My f, , f 'f'7f'Z' 2:5 ,gg ff,y,fff ff ' ' f V ,z 'Q uf,MNOfLffVf'Aff xfpy' My f, K ffi27f ?5zw 1 ff ' ,. V2QQyfPWfifi fgayiggwf fyw f f l,yf1f2zLf,yQX 7, efvfgfffj C '-HZ fw 'Q 1,37'!:f4ff,f,',,f W Qs' fx 9 ff3jzl,4jff-1f,7f, ff' . --wg W-13-L305,:f:,,f:gffkzfef, wvki' 7 ffffff 47 Z2 4 y., ,wx-4 f f V ,ry , 4 an ,fr f ' ji ap nf ii6Zf4EfvI,'4 ' ' Z: Qi 2? 5 Q, Eg Q 1: la 5 Q if ? f 2 2 5? f 4 wwMc.vmwAw,Nw.m , Z f 2 y 9 wvwmmmqwm 5 5 mmwwmwwmmw umm Z 5 5 , 5 5 ., ,X..m.wy- 1. E ? 's X: X PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRII PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE mn .U C CD .E 4- 0 .CLI V1 U I ll .C 4- I I O cn .LJ 4- GJ orhlefics ofhlefics orhlerics orhlefics orhleric L0 LJ I I J I I . I- 'W:'4- 'I ,P .4 IA, TQ' ur. I Vf4V' - 1 4' ' I 3 ,Q I I 4- if .C 4- I IIII O I ofhlerics orhlerics athletics orhlerics orhlefics PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIE 180 Athlet f . E PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE othletics othletics othletics othletics othletics .U I: GJ , IE 4- U if .C 4- O athletics othletics PRIDE PRIDE PRIDE ,,-E, ,aww-4 tm- , lf! .E 4.- il .C 4- U C-fl .E 4- 2 .C 4- C cn U UC Q --r 3' othletics othletics othletics PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE Athletics During 1981-82 many sporting events were held around Lee County. No matter where you looked, the bold name of RED KNIGHTSH was seen on the backs of many of the participants. Though the Knights did not alwa s emerge 431, they were always in the midst of the competition, striving and struggling for team or individual victory. North High offered all sorts of op ortunities for participation to the athletically inclined student. Outstanding coaches worked countless hours help- ing young women and men develo their potential and realize the satisfaction derived? from develop- ing their athletic ca abilities. Even for those wqio chose not to lay, sports still provided a way to become involvedjin high school ife. Sitting in the stands, cheerin for the home team brought unity to the student body and school. Gften a seemingly lost effort on the court or field was turned into a victory by the enthusiastic sup- ort offered b the t t . p y spec a ors Athletics is a part of life in the United States of America. We have given the athlete a place of honor in our lives and spend countless time and money watching himfher perform at'all levels of com etition. Here at North we take great PRIDE in the dledicated young people who take to the arenas of loonipetition on behalf of North Fort Myers High Sc oo. EICIIEICI EIGIEICI Ildcl EIG Ildd 2 EZ 5 ao Muscle raced a s rippling, Dusty Boyd and Mark Westra, gainst the clock and all the other runners. My Q.. E I away-1 . , .ww . ,M , ,. 11 l'1Ii ,l, 1,1 .. 1. , i. ., . 11 11: 11 Z? N l 11 1 11, .111 3 ,1 111 J -P 212111, 1.1 -1 tn iam- fi -S2111 11 1-- -11111-me gf: Z1 g i f 1 21111 ,S na 11 111 5 ,151 .f1,.11- ,11,.11,,11 ..-.:,..11,,- ,.,, 1.1.1. 171 ' -'3,f i2J 11111 '1'.1 11, '1111i11 11:--1 1 1' 111111151 w 11 11 . '11 11 ,151 112211 1151 21111111111 1 11 152111 QWQ111111 51111111 41 1 S 1 1251111 2 1 i s -1911 1 1 11 11 11 5111151 15351121 .1111 1 1112111 511111 2111 11 1211531 I 11 1sw:1w1fq114f4 , 111l11111,1f'511 Il 1115 . 11 1 11 111 1111511111111 111 , 5115: gl 1 1aL11 1gi1?111,g11 2- 1 if f 1 1111., 1 111,'11'1111'1:111 ,t '11'11:1E11 1: U11 .1 ,191 553411 1 1 512 111111111 11?i:11l111111111 15-121111l1111111sz551l31l 11 1 11 'Lf-:121sx,1::1:1-we -. 1:1112 1, 1511.111 41 1,111 l-1. 51 111 1911 111-1-1 E1 1 11 1 1 111 -11 :1 i1 '1f1'1g511 51 11 211 1111 1 '5'1't1?11il .1-111 1111 1.1 21 'G+ NH 11 5 1,15 11 1 1,1 1 -1 13A W1 1 1 1511 11 1 1111511.11 , - ,QA X-1 1 1 311 1 111115 1 1 11 1 1 151 131 gi15g 111gf1i11 ,f -11111113 1f1f11Z3ii 11l1,1 1 Q1z11111fi11111111 1 N 41 3 If fqwr 2gwf5i4g412 :1 11' 11g 11111,-.'1,:11Z,'511,g 311,111 1 111 13 1i11111111.311 11'1 e rik . 'HE -1 fi 1 '11111f1t1'1l'fz1111-.1 11111111 1511111 1-12111 41 ,91.1I1111?1'11' fl 2111 1g1i1111l1111i1fi1115112211111:1 g111ii111111 11l11 111l 1315i 1151! 1 1, ei M '1t11111111f5'21l 111,,1111111 1111111'f 1'11:2 z:c U 1111- 111111151 11 11 41151 535 11:1 11141 Q11 11 1 1 ' The 1981 Boys Cross Country l Team: Kneeling IL to Rl: Steve Muri, Wa Richard Richard Standing lter Ratliff, Bob Frank, Ratliff, Mike Dukes, M ' ' . uri, Kenny Davidson IL to RJ: Mark Westra, Curtis Gully, Dusty Boyd, Tom Tisell, Ms. Terry Wieland, Coach, George Tisell, Richard Iencks, Ri 182 f Athletics Chard Frank. Running on Borrowed Time Self-discipline was an essential part of training for North's cross country run- ners. Despite sweat and pain, in fair or foul weather, both girls and boys ran at least five miles daily to build up their endurance. Every Monday was spent on the stadium track concentrating on their speed. North's Cross Country Teams had a rebuilding season under the coaching of two experienced runners, Ms. Melody Mitchitell and Ms. Terry Wieland. These coaches just didn't sit on the sidelines yelling instructions and en- couragements, but worked out daily with their runners. Both the girls' and boys' teams were largely composed of young, inex- perienced runners. Only a few had ever competed in any type of distance running before the first meet. After a season of eleven meets against teams from Venice to Naples, North's runners had improved so much that some of them were finishing in the top five places. Dusty Boyd, one of the two seniors on the boys' squad and perhaps the most experienced runner, was injured mid- way through the season. However, this did not eliminate him from being named Most Valuable Runner along with Tom Tisell. The Most Improved Runner Awards went to Walter Ratliff, Curtis Gully, and Mark Westra, who had each cut their time on the 3-mile course by at least two minutes. Richard and Steve Muri captained the ' 1981 Boys' Cross Country Team. The 1981 Girls' Team was led by freshman Cindy Weber and sophomore Ianice Cottrill. Cindy was winner of the coveted Most Valuable Runner award, while Ramona Harris, who had improved her time on the girls' 2-mile course by more than ten minutes, was selected Most Improved. Distance running is a sport that can be enjoyed throughout one's life. It instills in each participant a feeling of ac- complishmentg knowing you are doing something good for your health as well as for the enjoyment derived from those moments of inner peace. 2 1 - Maxine Soler pushes to cross the finish line ahead of the other runners. 2 - The 1981 Varsity Girls Cross Country Team: Front Row IL to Rj: Maxine Soler, Doris Soler, Maria Castaldo, Teresa Roof. Back Row: Ms. Melody Mitchitell, Coach, Ramona Harris, Cindy Weber, Lil Topchy, Ianis Cottrill. Sports X 183 Spiking the Season Under the coaching of Mr. Lynn Hinkle, North's Varsity Volleyball team completed a season filled with frustra- tions and disappointments. Their prac- tices, lasting two hours daily, consisted of warming up exercises, serving and spiking drills, as well as determining team strategies and learning plays. North's season began with two wins, one against Port Charlotte and the other against Ft. Myers. Strong serving by Doreen Makar, precise sets by Dana Cooke, hard spiking and accurate bumping by Fannie Brown and Ber- nicene Coleman, seem to demonstrate that North might be a tough competitor in conference matches. Although the Red Knights dominated at the beginning of the first game of their third match, Cape Coral soon took control of the tempo and North's win- ning streak. This seemed to touch off a losing streak for the North girls and despite occasional brilliant playing by individuals, they lost their next three games. Seeking revenge for being eliminated from district competition the previous year by Barron Collier, North awakened from her slump. This awakening didn't last long as inconsistencies in playing cost them the next two games against Riverdale and Charlotte. Beginning the second half of the season, Port Charlotte thought they had won the first game of the match. An er- ror by the official gave North a reprieve and they went on to win that game and the match. Doreen Makar served nine straight points in the third game. In North's second game against Fort Myers, Lady Luck deserted them again. After ten badserves, they lost a hard fought 3-game match. Fannie Brown's sudden illness during the Cape Coral game, after she had dominated the ac- tion both offensively and defensively, allowed Cape to come alive and ended North's chance for an upset. Offense was strong but defense fell apart during the next two games, and North lost to Cypress and Naples. North ended its four game losing streak with a convincing win over Lely, but then turned around and lost a close one to Collier. In front of a Parent's Night crowd, North showed Riverdale how volleyball should be playedg the outcome was never in doubt. Playing two nights in a row proved to be too much and North lost their last game of the season to Charlotte. In district competition North found themselves facing Fort Myers. The Greenies twice had match point, but both times Diane Cosby led rallies that ended in North's victory. In the second round, Naples continued its three year mastery to end North's 1981 Volleyball season. ' t Y I y ...., , . 1 - Doreen Makar returns M M the serve. 2 - The entire North team attacks the op- position. 3 - Most Improved Player Diane Cosby and Most Valuable Player Fannie Brown show off their trophies. 4 - Michelle Selvage com- bines her ballet ability with her volleyball skills. 184 X Athletics 1 - Dana Cooke gets in the position to set up the ball for a spike. 2 - 1981 Varsity Volleyball Team: Kneeling - Debbie Hill, Michelle Selvage, Fannie Brown, Dana Cooke, Donita Hall. Standing - Coach Lynn Hinkle, Patty Haley, Doreen Makar, Bernicene Col- ,, W, eman, Diane Cosby, Brenda Crosby. og: '? '7ff7 11 PM raaacm ifwiwi fc x i'Q? t 1 .uf ,fi Q I ., IQ ' v .ikwi .1 -8 W f I , l4l-4 l ' fin xusmgh Seasons Record 7-13 Athletics X 185 1 - In the midst of a serve, Angie shows her com lete concentration. 2 p 1 Volleyball Team: Kneeling - Angie Ina Marie Cooke, Wendy Tillert, Brown. Standing - Coach Leroy Kathy Yoder, Diane Lytle, Lori Dill. 186 f Athletics Caudill 1931 IV Caudill, Marian Dewey, ll-113 IV's Set the The purpose in any junior-varsity sport is to train the players while they are young in the specific skills of a sport, so they will be able to develop profi- ciencies and thus draw additional en- joyment from the game as members of the varsity. Under the experienced coaching of Mr. Leroy Dewey, this pur- pose was rapidly realized in the IV Volleyball program. The entire team concentrated on the basic fundamental skills of serving, bumping, setting, spik- ing, and digging. Victory was never as important as the continual improvement of individual members and the team as a whole. The team's record of 5 wins and 13 losses in no way reflected the effort and determination of the underclassmen who made up the squad. Two of them, Diane Lytle and Wendy Tillery, showed so much promise they were moved up to Season the varsity squad in time for the district. North's IV Volleyball team began its season with a loss to Port Charlotte and then one to Ft. Myers. Bouncing back due to spectacular efforts of all players, North registered her first victory with a win over Cape Coral. In the next three matches, the squad fought diligently, but lost all three by only a few points. Outstanding players against Cypress Lake, Naples, and Lely, were I. I. Anderson, Angie Caudill, Diane Lyttle, and Wendy Tillery. North's second win was against Col- lier. Diane Lyttle had 19 good serves and caused 14 points to be scored. Then came two heartbreakers, a quick loss to Riverdale and a 3-game battle with Charlotte. After being defeated by Port Charlotte and Ft. Myers earlier in the 3 season, North worked hard to improve their style and overcame the Tarpons and Greenies. Consistent serves, perfect sets, and spectacular spiking showed they had learned their lessons well. Then misfortune struck. No matter how hard the IV Volleyballers played, victory became an elusive thing. Outstanding individual effort and noticeably improved teamwork were not enough, the young netters lost all but one of their remaining matches. At the annual Volleyball banquet, special attention went to Wendy Tillery, the Most Valuable Player and Angie Caudill, the Most Improved Player. All the girls were congratulated for the amount of time, determination, and ef- fort they had expended . . . they proved to be winners even when suffering defeat. QMLEV 75555- ',.:. 1m.,fX ., 1 'Q I, . 1 - Spiking the ball for North High is Diane Lytle. 2 - Wendy Tillery sets the ball while her teammates anxious- ly wait to assist. 3 - The IV team plan their strategy for a successful game. Athletics X 187 1981 Varsity Football Team: IL to R1 Bottom Row - Richard Whitney, lim Cooper, Levi Mooney, Scott Cor- nett, Warren Williams, Wade Smallwood. Row 2 - Chris Harnett, Brian Makar, Steve Dahlberg, Stuart Moriconi, Dale Heinkle, Gary McIn- tosh, Edgar Pugh, Row 3 - Ray Cobb, Iohn Cummings, Tim Sushil, Iackie Dixon, Danny Mallow, Fred Satchel, Bob Nein, Ken Walker, Iames Holland. Row 4 - Billy Clif- ford, Rusty Wenrich, Malcolm Mc- Collum, Eddie Lopez, David Cooke, Tony Myrick, Eugene Majors. Top Row - Coach Ted Ferreira, Coach Bob Curry, Trainer Don Plunkett, ,ij Acee Couch, Louis Tillman, Head Coach Ron Hoover, Coach Wade Hummel, Coach Roger Pritchard. pig. 0 up-1. --2.-1251: xv-se' -ff 1' ww X? 'fl5'7f7Ql,' iifgfff' fifiki L.-ivzf K' iff fg 3 ii 1 ff? -' I qs . ' , 1-,gf21,ffi1g,2f i,1E ,i,fii'f14gg'fLf5'2vg ' I ' . V aei' , ' .,,mJy, ,y ,Q 4141, ', ,,,,v,,:, ,.g ,m.,.,:,,, tr 3 4' -f 4f 1:4 r5 .:.':-2,5514 4 I f, K ,,. ,,A:, , , 1 H Y S U ,. ,..,. ., ..,., M' 53' fy A- M Q 5, -rf ar ,841 lk 4 MQ ,4 6 Q 'N i x gf ,K , ff ta -Q fi if tw 1 was 1. ing: zz, gg , as 9g A 2 3 sf 5 ff wif 5 4 4,51 I fa 1 A ' A ' z 5' P 11 , af .4 Z., as-,212 TW 1 2 1 - Tony Myrick sets up for a deep pass. 2 - Senior front line: Kneeling - lim Cooper, Iackie Dixon, Wade Smallwood. Standing - Dan Mallow, Scott Cornett, Levi Mooney, Gary McIn- tosh. 3 - Varsity Football Coaches: IL to R1 Ted Ferreira, Tom Cook, Wade Hummel, Ron Hoover, Roger Pritchard, Don Plunkett, and Bob Curry. 188 X Athletics M 'lfi irfs Knights on the Line North Fort Myers High School has been synonymous with winning football over the past 13 years in Lee County. For that reason it has been difficult for the student body and some fans to understand the past two losing seasons. Many believed that with the return of former head coach Ron Hoover to the helm, things might change in 1981, but lady luck seemed to have turned against the mighty Red Knights for the second year in a row. ' Sportswriters, during pre-season coverage, likened the return of Mr. Hoover to the head coaching position this year, to his arrival at North High in 1968. There was one big difference though, in 1968 he found a large number of young men, ready and willing to take on the challenges of rigorous practice and discipline in order to prove themselves on the gridiron. This was certainly not the casein 1981. Starting with only 24 players in August, their number peaked at 35 players at mid-season, and had dropped to 21 before 7 IV players moved up for the last game. The season was marked with injuries to key players and deser- tion by those without the inner-stamina to continue. The players who made it to the final buzzer of the last game were certainly not the inexperienced boys who had begun the season. They had become seasoned veterans, men who had been called upon time after time, to go both offensively and defensively, against teams with larger rosters and thus greater depth. The Sarasota Sailors ruined the Red Knight opener by out-scoring them, 33- 20. North held their own into the third quarter, leading 13-7, but then the defense tired and Sarasota scored 21 points in 51!2 minutes. North's first home and conference game resulted in a 20-13 victory over the Barron Collier Cougars. The Knights took over the lead early in the second half and held the Cougars to only 34 yards in the second half, while rushing for 143 yards themselves. After flying down to Key West, North's attack stalled both on the ground and in the air. The Knights were defeated 21-8, as the Conchs scored two fourth quarter touchdowns. North dropped their next game to Le- ly whose powerful offense out-rushed the Knights 310 yards to 191, and out- passed them 98 yards to 58. Final score, 34-14. It was a defensive battle during the 1 ' . v 4 . . v . . A 1 - Knights' defense prepares to leash the Cougars. I . , I . ' .. ,,.. .,v. .. .,.... .... -..J .....,.A-...,,.,,...-., ,,.,.,., .,s,. ,. ..,....g .,.A...,,.. ,........,.v . l,L.J........Q,,l..,.,..ll.f.f.,,v-..,..-1i,i2.. Athletics X 189 Knights . . . Line first and second quarters of the Cypress Lake game and both teams went to the locker rooms at half-time, tied, 0-0. With 7 minutes remaining in the third quarter a Red Knight fumble led to a Panther field goal. The Cypress Lake defense kept North shut down, while their of- fense managed to score late in the fourth quarter, making the scoreboard read 10-0 at the final buzzer. On their second trip into Collier County, North Fort Myers' defense again played one quarter of perfect foot- ball and held Naples to a 0-0 standoff. Then the Eagles took control and scored 22 points in the second quarter and 28 points in the third quarter, overwhelm- ing the Knights 57-8. North's only score occurred in the fourth quarter. For a clash between teacher and pupil, the Knights traveled to Punta Gorda to meet Coach Keith Goodwin's Charlotte Tarpons. Goodwin, a former Red Knight player of Hoover's, coached his team to a 14-6 victory over his Alma Wwwwxs. 1 T :1 , WE 1 e 5 1 ,. .. ,.,,, 1.1 11111 111 51 31 11 11, ' 1.1.1l1'1 11 .111:f1,11i 1 1 1 1 1 1 B 1 I, 11111 J w, X X 11 22 1 f 1 , f 5 if ff!! , X 5 I I 1 111 1 1 111 1 1 H if f 5 51 11 1111 111 11:1 1 . g1.11t' + 111t1 151 1 11, 1 111. 1 , -1- I1 11: 111111 1111 211 . . E i f 11 1 15 ee.gm-.ffzmiff 1 1 :.' ,1111 31111 1 ,2 11 1,11 1511 121 11,3111 '- Q1 1',I21I111'l1 111 11-1 5, ,411 ,H13 L, 14111339.11 113 1 1 11 11' V53 111111111 11111111111 111 111: . 1 . 3 1. 1 1 1 3 .111 1 1 2 '1 111 1 i111 111 1!l11'l' 9 '11111 5 11? 11 -2 11111111313 112.11 . , 1 111,.1Iz1,1 1 51 1 1 1115151 1 lg . 1. 111 1111 131 111 .,, 11 1 11 1, , gif t, f 115 1 1.1 ku .4-1- ,g 11 , 1.f. 5,q,1...,..1,,M ,,.,, ,, 5, ,... 1. ,....., , f S 1 Y 1 , , f f 1 X f I .1 1 1 , 111111 112 4' 111111 111111111 1 ' 222 .11 s1 13111 2,511 .1 '1 swf 1 111111111511 1 .1 1,. 1. 121411 1 -1 1151 111111 111l11 :1111 1311 313 A 41 ww w 111121.11 5 , . l l , lfr 1 1 51. . 15 1111 11 111 11 11 1 -A 1 , . 1 1,--52 122 1-1 11'1'1111- 11 11 1111111111111 1 111'1 11 3111 111 5 . 1 .11 .1 ,pw 1 11 1 fy. . 11 - lv. 1,6 . 1111.11 sf 1111 4.-we .., . M11 p1 . 11.,.w ., 1,11 1, W, ,., .:, fl, 4 1.5 11 11 1113 .1 5 I ,,, 3g f l 1,4 2 ff 3 3 , 5 1111 1, 1 1'1 5 in ,- ini il 1 5 A S 1 .. .3 31,1 11 1- . i:3'311:11131.11111,11, 1 . 1 ,... . 3,1 111 . ,..4 W ' '1 ',.w':1-311' 5. 1,1 -.su-J 1+ -wi 9 I 'ZVEZ1 -3' I 41711.-.W-1, 1- 11.4 .1 .,-Q f. 11-1-1 W., ,,- . . . 1 1 1. 01.41131 1 . i .. 1' EWQBFQZ 11' 11 1 '1 :11 111 l111'1 111131 1 11:13.-1 -12-we l1i 1 1 11 111 1 1 11:2-wa 1' ' 11111124 ws ' .M ce- 1. .. ' ' ' ' 5111 -m y 1 146.1 1-?'511v4 1fwW 41-af 1-1-1 ,. .,.,.,. 1 ....,.... , 1 1, , .,.. V? ,,,., 3. 1 ji. .. 1v.,.,..,.. . 4,3514 111 . '11, ...1 .... 11 ., ,..,,., , 1 .aff s .-11s11.::v 1. -W.. 11 as ...,z11t.L, 3 11. .1 A -W - 1 11.,e1w1 1-21226411 3 ' 1 190 X Athletics 1 . .. ,.,,,, ,.,. 1 M 22:10 il. 1 - Trainer Don Plunkett puts his knowledge and training to good use on Lewis Tillman's ankle. 2 - The young Knights overcome the Lely line. 3 - North's IV takes down their opponents with Pride. 1 Knights on the Line Mater. On November 6, crowds packed the Red Knight stadium for North's an- nual Homecoming Celebration and their contest with arch rival, Fort Myers. Although the scoreboard showed the Greenies victorious 30-6, Fort Myers was later ordered by the Florida High School Activities Association to forfeit its game because of the use of an ineligi- ble player. The Cape Coral Seahawks dealt North their seventh defeat of the season, 14-0, at the new Cape High School stadium. The Big Red threatened once in the second quarter, but were shut down by a determined Seahawk defense. In their last game of the season against Riverdale, an inspired North 192 f Athletics 3 effort almost came up with a victory. North held the lead, 21-20, with 4:18 re- maining, when a fumble deep in North's territory allowed the Raiders to take control of the ball, and subsequently score the winning touchdown. North High's 2 win, 8 loss record was deceiving. Anyone who had witnessed the determination, dedication, and courage demonstrated throughout the 1981 season by the varsity squad had to be proud of these young men. They were few in number, but like knights-of- old, willing to bravely do battle for themselves and for those of us in Big Red Country. The Knights in Waiting This season the North Fort Myers' IV Football Team changed the tide of their scoring game. After losing 3 straight, the young Knights began to heed the lessons of their head coach Lavon Simms and his assistant Iames Davis, and won their final 5 games. The team, composed of freshmen and sophomores, worked hard to perfect their plays and learn the basics during daily practices. When game time arrived they concentrated on their assignments and played as a unit, putting team effort ahead of individual glory. Even when faced with the loss of a few key players due to injuries, the IV squad regrouped, adjusted, and went on winning . . . living up to the motto Red Knights ii1. fn. ,,.,.,. 1981 Iunior-Varsity Football Team: IL to Rl Row 1 - Troy Simons, Kevin Williams, David Bechtol, Ralph Black, Robert Stancil, Carl Smith, Kane Richmond, Iohn Knight, Gerald Liebhard. Row 2 - Ricky Rumph, Tony Bouie, Billy Clifford, Reginald Perkins, Anthony Chapman, Dwayne McLaughlin, Victor Florence, Dale Heinkel, Tim Sushil, Ierry Iohnson, Louis Tillman. Row 3 - Coach Lavon Simms, Manager Anthony Battle, Nathaniel Brand, Ron Morgan, Iames Delaine, Ray Cobb, Forrest Norton, Edward Williams, Ieff Norton, Ed Lopez, Fred Moore, Coach Ioe Clark, Coach Iames Davis. 31' , , ,, f ..,,,.,.,,,,.. I,,,,,,,,,,w?, t ff 71:2 5, . . wg 1 - North's IV pounces on a Trojan fumble. 2 - Red Knights pass the defensive line of their foes for a sizeable gain. 2 t it 4 1, 1 wg. X: 3211 'uit ig W3 M451 -yn? if W2 t t S ' wwf: iw it T ag? ggigt Eigilyi j iilg' fwmlziir ,1fi'g1:s:1- de arly' ,4 fef4r723fff.ifffiw.-Qikffw ,f 01.7 13512212155 at :rag felt fra i1,g1 i1E'gyg f E ,, Z, . . 11 wb- ' 11-'H us- , A. :hir 1 V. - .?4??7t ?a1yfia5D ' . f -'-9-9-.f y'Qff?3f liz twist ,rin ! V 's1l? ,zf:12i2 ie nf tra ar 11ig:w2 1 ,Quia 'axzzssv 'iE4!: , 11fiivfE. e wil 'nfl' - -2 ,1:': Lv .',,4 -' H 4 - , f 'S V ' wal,-:gi -gqgtgt 2,g,gt 'f,l,,52ts' f ,,f-A ct Aififrf w' i-X-i iwft if 1 sf .4 it uit, f a 'if?.',,t: . V, 'fwfff w e t' ' -vit:-4' 1 4 wr' ,vi ,'ff44:'4 Mer: ',,.,,g -fl! 1.6: ? traw l . '12 - if mt P ,1?2 vw-s.,12',i,fi-'f f'.-ww-v' -lv' ' Wa ,, 1 2 ,J . v ' fd,-H-, w x sm ? 3: -g i 12111496 ,zfwmwfcfife-f 4 'g r ad ' g'jfei'+5'+miv fa-I is rss: ,v ' iW,.5 ' M wg . -f 2 .4 3,5 ffm, Q4 . wf q wqy 1 ,W ta, fr- tv we v .ff ,-4 f , jaw 1 ue? Jw ,Q .- 2' I . f . Qfiyxyiaf M QW A -. ' f. fa? ' ,fx f , f 1' ,f Wg, 5 - ,ff W 221 : iiatra: -' . , ' f' M ' wzf iff- E ff ,ff M glm gl 35 ff as fi A E ll w , .. 'V pei' fn. f f 214, 11 - : . 'w , f,fw -N. '- ., ff, to ff fe- 'f , ia 1 Athletics f 193 bf'g1'.' f , ., 4 . 4 wwf J aaaw. L,.,, , 5. QQ 3 4' 1 'V b 5 2 Y ' 'Q 4 , f i M, i , 2 194 X Athletes 1 - Margie Nahalewski grabs the rebound as her teammate Diane Cosby 1251 moves up to take another shot. 2 - North's April Brown controls the jump and Margie Nahalewski and Diane Lytle await the ball so play can get underway. 3 - Head Coach johnny Pate doubles as athletic trainer as he tapes Margie Nahalewski's ankle. 4 - 1981-82 Girls' Varsity Basketball Team: IL to R1 Row 1 - Coach Marsha Bishop, Fannie Brown, Margie Nahalewski, Coach Iohnny Pate. Row 2 - Dana Cooke, Sheila Harris, April Brown, Pam Clouse, Diane Cosby, Diane Lytle. fn..- tt. -.,-. Shooting to in It isn't always easy to be a female jock in today's teenage society. Although women ask for equal rights and oppor- tunities, it seems that very few are will- ing to sweat and strain, practice and train, in order to learn to place the round ball through the netted hoop. We've come a long way, baby, in a lot of ways, but not far enough it seems when it calls for donning the red, black, and white uniforms of North's varsity girls' basketball team and giving up hours and hours of personal time to become a run- ning, shooting, rebounding athlete. It was an unstable year for the Lady Knights coached by four year mentor Iohnny Pate and his assistant coach Marsha Bishop. The team was young, inexperienced, and troubled throughout the year by a fluctuating number of players. Seniors Fannie Brown, Margie Nahalewski, and Cathy Roberts were the only returning lettermen. Two former IV players, Pam Clouse, senior, and Diane Lytle, junior, rounded out those who had experience and real hardwood time. The girls worked hard during practice to perfect their skills. Running, shooting, rebounding, practicing offensive and defensive patterns occupied a large block of their time three days a week. They worked equally hard the other two days as they took on teams from neighboring schools throughout Southwest Florida, proving how tough these ladies could be. At season's end the fans knew they had witnessed some great games and some good games and were never disap- pointed in the effort put forth or the ex- citement generated by these dedicated Knights. Team Captain Fannie Brown was awarded the Most Valuable Player trophy at the end of the season for her tremendous basketball ability and outstanding sportsmanship and leader- ship. She exemplified the qualities of her teammates and all athletes in Big Red Country loyalty, dedication, determination, and pride. North High's outstanding. player and leading scorer, Fannie Brown, drives towards the basket. l l Athletics X 195 1 - Chris Trammell dribbles through the Riverdale defense to score. 2 - 1981-82 Girls' IV Basket- ball Team: IL to R1 Row 1 - Lori Hayworth, Sharon Harris, Coach Sylvester Issac, Row 2 - Shauna LaPbsta, Arlicia Garrett, Marian Brown, Lori Dill, Sheryl Miller, Shelia Ervin, Lena Chance, Kyna Lister, Chris Trammell. f f -5 WOW 1 ff a 4: ff 1 I ,Z Z r 4 f fgfff ' ff! f, ff , J 4 ff ff, ,QM 14 , ', f a ' fu! ft ff' .M W ee wma nw ., , f ,mv fx' ,f fffwy iff Mfygwfff 5 fm, ff, f 1, 4g,j,wz w , ff mfjfwyiyf X I , , f, f, f ,f..,f' ff ?ff fW!fW f,ffff ffC , ,i .f ,W?, Qfjf 139324622 Zigi. ,, f5fMyJf f, 1 55,5 ,f Q gfg4 f,,f 'ff ff- R ' V ' Z 1 1 ff!.'f,4g,fO'z,a'!f' ,1- y,f, K ff-,ff-I ff ff f, ., I tl, ' A :Q ,3 .gf f gjff: A3 X5 ,f ? W ' ,f 4 I jf' W6 af aff I W f 1 ff! Af f, fnf .' 1 I ,W ffmggfy ff,ggffg,g,,Q, ff ,gf ffi .j wffy ww fy -fu eff , fw ffffd :ff f ,wwf V , S fy'-941111141 ,ejffwf fm' OO J ' X ff 1, ' nw My fg gn? , ff, ,gf ,ww ffm ,ff fff ,f 1 ff , ,f Hfgmf ff fff -ff-nf f y V ,ff , f if ff fa . ,fy ffff,fyzwf.,f 4 1 wwf f yfff of fi KAW? Wffw fffffwffjh , www' 0 f!ff '1Mf flew' . ff ,f'MMfWfr,fQAf . f f ff ' 4 f WM M :wa z ,bffffff ,MM wif? Wgfgfwfffm new -f f W W' Q . .f f ifff fl ' ff f , f. 'U ,4Aim,w,4ffWfffff5fffM f,,' . . f ff S ff mffw xwzefyfzffwwzfw , w e W 'W ww W WmjyawyfffififfmkgyzWWWfwzxfzgfnffbwmmiwyvfw'Mafiaswfffwfwreffmzxtffeff-14-fix Wfmfwwyffffgf fmzfmffiyeff-zf'ff-ffff wfwffwagwafvfwwfwfra.fwffwfffwwfzwif-wr-ffs f 196 X Athletics ,. .j f .Jawa 'cw' 1 1441? ff 1 Q 16 ww? f gif I K4 if , f if illing To Learn North's IV Girls' Basketball Team might not have posted an outstanding season during the 1981-82 school year, but they learned a lot about the game. Most of the girls had never played on a team before showing up at the first practice in November. Coach Sylvester Issac started them on conditioning exercises to develop the muscles and stamina they would need for four quarters of basketball and then drills in the basics of shooting, dribbling, passing, and defense. The team started with eleven recruits and throughout the season served as a feeder system to the varsity squad when the need arose for ad- ditional players. Lori Dill, Chris Trammel, and Lori Hayworth all saw action with the varsity Lady Knights after receiving their initial training under Coach Issac's watchful and demanding eye. The experience these young ladies gained during this training year will indeed serve them well as they move up and take their places on the varsity club. Good training in the basics, game experience, and dedication can result in a future championship. 1 Lori Hayworth gets her shot blocked as teammate Kyna Lister prepares to rebound. 2 -- Bringing the ball down court to set up a play is Shauna LaPosta. 3 Going up for two points is Lori Hayworth. Athletics X 197 Fantastic Few Basketball at North seemed promising at the beginning of the season, but the thrill of victory soon turned to the agony of defeat. Losing games and players, North's Head Coach Steve Conley and Assistant Coach Steve Frank had to rebuild the team around one senior and two juniors and the continual addition of sophomores and freshmen, until the entire IV squad had been absorbed three quarters of the way through the season. Although the revised squad worked hard at developing strategies and improving team play, they were young and inexperienced and certainly not up to the tough competition provid- ed by powerhouses like Cape Coral, Cypress Lake, and Lely. Down to six players before the IV squad moved up for the Lely game, the Knights started their new season against the Charlotte Tarpons on 1 - Rick Morales and Ed Iackson battle their Pahokee op- ponents for the rebound. 2 - Tall Knight Acee Couch sinks 2 with his famous jump shot. 198 X Athletics Ianuary 19. North fought hard until the fourth quarter when foul trouble and fatigue served to defeat them as much as the Tarpon five. The Collier Cougars were the young team's second challenge. This proved to be one of North's outstanding games, as the Knights only lost by one point after an exciting overtime period. Traveling to Venice, the Knights dedicated themselves to team work and precision shooting. Battling a physically superior team North stayed with them to the end, succumbing by only four points. The Riverdale Raiders wanted to blow the knights away, but Coach Con- ley and his team wouldn't give up. The contest see-sawed back and forth until fatigue hit the tiny squad in the fourth quarter and North lost, 79-62. .Tn The contest between the Red Knights and the Seahawks was close through the half. In the fourth quarter the Knights experienced foul trouble and ended up with four players on the floor and two on the bench. Cape took advantage of this dilemma and went on a scoring spree. Adding some spice to the dirty V2 dozen, the IV team was added to the varsity. They traveled to Lely High to take on the Trojans and the young Knights experienced their first taste of the running, shooting, rebounding game Lely is so well known for playing. With five games left in their season, North High hopes their young squad can continue to gain floor experience and pull a few upsets . . . but look out in 1982-83, Red Knight basketball will be ready. f fr, V . y , , I s G 9' few P' 'O ' J .?, ff' fo-IX 1 Viiy V Pvt, 2 1 i Q ffli,05 3 550 f f , Gfgmyyl A .3 N43 ffl, ,, ff, ,yu-diy .f4-, 4 'fmffyfff W f.--1-WM? 7 ,'.- win W RV' Q f if ff! V: Future Glor Working on layups, dribbling, free throws, passes, and defense . . . defense . . . defense kept the IV basketball squad busy from November to February, five days a week, excluding game days. Coach Levon Simms stressed the impor- tance of team play and working the ball into the player with the best shot. They knew that when a ball left a player's hands, Coach Simms wanted one thing, two points. Hard work during practice and in games against each other and the varsity paid off for the young Knights. After fif- teen games they stood at nine wins and six losses. Then a decision was made to disband the IV squad and move its members up to the varsity to complete the season. Disbanding the team and forfeiting 'N-41 DeLaine, Coach Levon Simms. the rest of the games was a difficult decision for the coaches to make and an equally hard one for the players to understand. The varsity was plagued by personnel problems, but the North IV stood very high in conference competi- tion. Of their six losses, only four were to conference teams, so they had a real chance to rank at or near the top at season's end. Being loyal Red Knights, the team ac- cepted their fate and began to work equally hard to become contributing, useful members of the varsity squad, gaining tremendous experience as they watched and played against the tough South Florida competition. Watch out for North in the futureg with these young players maybe we can recapture our Basketball Glory Days. 1 - Iohn Cummings dribbles his way to stardom. 2 - Soaring to score is Iames DeLaine. 3 - Bruce Whitaker attempts to put the ball over the outstret- ched arms of the Riverdale Raiders. Teammate Ed Williams is set to rebound if he misses. 4 - Basket Bound Ioe Williams gets an assist from teammate Bruce Whitaker who boxes out his opponent. 5 - Ed Williams shoots to score another victory for North. 6 - 1981-82 IV Boys' Basketball Team: IL to RI Kneeling - Paul Davis, Tyrone Davis, Ioe Williams, Iohn Cummings, Ray Cobb, Brian MacDougall. Standing - Manager Anthony Battle, Ed Williams, Ray Brown, Todd Ienkins, Tony Myrick, Scott Ower, Gerald Christian, Iames Athletics X 201 Hand-to-Hand Combat Most of us obtain our limited knowledge of wrestling from watching the grunt and groanerst' on the video tube. Professional wrestling involves 98070 showmanship and certainly is not an accurate portrayal of the highly com- petitive team and individual high school sport of wrestling. High school wrestlers have to adhere to strict training to keep their bodies in top physical condition, and must watch their calorie intake if they are to weigh in before each meet at the correct weight. If a wrestler gains or loses too much during the week and doesn't qualify in his weight class, the team suf- fers as it must forfeit that match and the opposing team gains an automatic 6 points. Keeping wrestlers healthy and on-their-weight for all thirteen weight classes is no small undertaking. Wrestlers can qualify and compete in the following weight classes: 101 lbs., 108 lbs., 115 lbs., 122 lbs., 129 lbs., 135 lbs., 141 lbs., 148 lbs., 158 lbs., 170 lbs., 188 lbs., 223 lbs., and unlimited. Although wrestlers are required to wear headgear to protect their ears and tights to protect their legs from mat burns, injuries can occur. Cauliflower ears fears swollen from being banged against the mat or fallen onj, pulled muscles and tendons, and raw skinned arms and faces are common complaints of the athletes who engage in this hand- to-hand combat. The individuals who composed the 1981-82 Red Knight Wrestling Team qualified for this demanding sport by being strong, agile, quick, determined, and dedicated. Coaches Frank Drake and Roger Pritchard and Team Captain Phil Baker organized each daily two- and-a-half hour practice session to in- clude calisthenics and running drills to increase endurance, agility, and strength, and practice matches to sharpen moves and the ability to think while engaged in competition. One thing that hurt North's team this season was the limited number of par- ticipants. In some meets as many as 6 matches were forfeited due to a lack of qualified North wrestlers in certain weight classesg thus North was down 36 to O before the first opponents stepped on the mat. Although the team's record was not outstanding, two wrestlers had excep- tional individual seasons, Levi Mooney and Ieff Kader. Both had identical win- loss records until Ieff was injured and had to cease competing. Levi, at 223 lbs., ended the season with a 13-1 record and the South Florida Conference Cham- pionship in his weight class. 1 1 - Once again North's Frank Putnal gets the ad- vantage over his opponent. 2 - 1981-82 Wrestling Team: IL to Rl Coach Frank Drake, Iacob Hemed, Frank Putnal, Kenny Richmond, Ierry Cohen, Phil Baker, Shawn Smitter, Rusty Wenrich, Brian Makar, Levi Mooney, Coach Roger Pritchard. 202 X Athletics 2 1 I ig 1 - Conference Champion Levi Mooney displays his wrestling ability and determination. 2 - It's not a new dance step, it's serious business to North's wrestler Brian Makar. 3 - Ieff Kader sizes up his Riverdale opponent. 4 - Going for the . pin is Red Knight Phil Baker. 'iiaw 3 4 Athletics X 203 orth's atators Starting off with a splash is what the North High Swim Team is doing this year. Mr. lim Repp has been coaching the Red Knight swimmers for eleven years and has successfully taught his team members throughout these years to strive to be 111. Preparing for the season, the members of the 1982 team must maintain a strenuous routine. Each day they swim 3000 yards, which is about two miles, lift weights, and run two hundred yards. These practices usually last approximately two hours. As the time for scheduled meets approaches their practices intensify until they feel more at home in the water, than out of it. Debbie Siltzer, presently a junior, is the number one swimmer at North. She has gone to State both her freshman and sophomore years. In 1981 she set school records in the 100-yard butterfly in 59.20 seconds and in the 100-yard free style in 56.02 seconds. North looks to Debbie dur- ing their '82 season for leadership and experience. Although the boys and girls participate in dual meets, they are separate teams, each recording their own points through the eleven events. North looks for a hard, competitive season in 1982. One in which school and conference records will fall and new names will appear on the Red Knight swim plaque in the front office, AE' 1 - 1982 Boys Swim Tgam: IL to R1 Sitting - Russ Graettinger, Gary Brown, George Gottfried, Scott Brown, Ben Houser, Al Lopez. Standing - Ken Foskey, Iames Thompson, Neil Fowler, Shawn Smitter, Frank Arciszewski, Scott Sutton, Coach lim Repp. 2 - 1982 Girls Swim Team: IL to RJ Sitting - Wendy Tillery, Betsy coffin, Debbie Siltzer, Lori Hayward, Raedene Turco, Tracy Iordan. Standing - Delisa Carter, Barb Mueller, Iulie Britton, Carrie Sproul, Dawn Minick, Coach Sandy Mc- Cready. 3 - Ben Houser surfaces for air during the breaststroke competition. 204 X Athletics Mm lv www ,Q , L.., ...N ... - , -4 .. , W e,'! al 3,'lZ? i,f V ns' ,ww-,, --iw ,um-Y -'-'Y' V, 1 4,3 I K g G by L ,ska I A 4-Twain... M 'if ww, , t sf f -f W ffl tw-H t s t 5 M 'tfyffwsh 55? :Ji Rl--'ff my 45' i f: t .t , -,K t 5' , if ltty it v A1 v.-y::?Qf' Q .. . 144 1 5,17 ff 1 , My r ,all-fzf ,gf we , an ., f.,::73- .W ,fr-.Q ii' .,,, 1 fr' fi 'L ,' . I u , ,L- F ,, ,, . Ja .lb ,, .. , , ff1.4:ww,v MWY ,P Q ,4 fer, . , may Y ,cf . ,- ' QL-.i 7 ui, 2 I-, t,-fgaw 5 ,K -0. 1, Q ' A '. ff. 4 .bfi -mqfgfgiitr 2 .t , ' rl' . TW W3 1 - Backstroking to a North victory, Team Cap- tain Debbie Siltzer shows her style, 2 - Frank Arcizewski strives to win his event as he races down the lane. 3 - Showing strength and coor- dination, Shawn Smitter, Swim Team Captian, demonstrate the butterfly. Athletics X 205 1 - Diving Team Captain Scott Brovsm shows perfect form in a reverse dive in pike position. 2 - Coach Sandra Mc- Cready demonstrates without entering the water during the chilly weather. 3 - Practicing his reverse dive in layout position is diver Iames Pearce. 4 - Wendy Tillery enters the pool with a forward dive. Muay A ,,,, f. Mega am,.4,t,.,fw V . sf ' s t fr v W ..:' rvrw ' . -11f ': 2 5 - A few team hopefuls line up during preseason practice. KL to R1 Gary Brown, Betsy Coffin, George Gottfried, Wendy Tillery, Scott Brovim, Dawn Minick. 6 - It's a bird . . . it's a plane . . . no, just Scott Brown showing how a swan dive should be done. ,,,,,n1 ., .. 206 X Athletics 5 fb- -l S o arin g High Being a member of North's diving team wasn't easy dur- ing pre-season as North High's pool was without a diving board until the second week in February. That meant the entire team plus Coach Sandy McCready had to travel across the river to the Wes Nott Pool on Cleveland Avenue for their daily practice session. The eight member squad is an important part of the Red Knight Swim Team, competing in each scheduled meet during the 1982 season. Three boys and three girls are eligi- ble to compete each week making practices doubly impor- tant as the divers must qualify as members of each meet's team through intrasquad competition and their attendance record. Divers must perform six dives at each meet with a dif- ficulty rating of 1.0 to 3.0. These dives are evaluated by three or five judges who look for excellence in the ap- proach, the departure off the board, the entry into the water, the precision and form of movements, and the dive's difficulty rating. A score of 0 to a perfect 10 may be award- ed by each judge. Then the judges' scores are averaged and recorded and finally totaled for each diver's performance during the meet. As anyone who uses the pools of Southwest Florida knows, diving off a board or from the side of a pool can be dangerous or embarrassing lespecially if one ends up belly-flopping in front of one's friendsj. Well-trained, agile, well-coordinated, graceful divers like those on North High's Diving Team are a pleasure to watch. They leave the board soaring for the clouds, execute their dives with precision and accuracy, and enter the water crisply and cleanly . . . perfect 10's in the eyes of their fans. 3 4 W' -4 - 6 . 4 iff-,.,.f HX . gr Athletics X 207 W 1 ana-anna 1 - Head Coach Ted Ferreira and Asst. Coach Steve Wise lay down the team rules before baseball practice begins. 2 - The 1982 Varsity Team depends on the hot bat of Mike Greenwell, who batted .544 last year. Iason Cash catches for his teammate during practice. 208 X Athletics f, f 9 f ,, f , 5 f My I 'f if I pf 'v X n, ' f , ,wh iWz,'ff,f?j' jim , QM ,, W , ff v it f'fffz.,,,5 'p ,.- . ' ,rig '. 2 - ,...,w,,,f,,,, .,,i .wi-,f,,,,.M,,4,. ..,,,,,f,.,.. new W!! nu-9... 4?iW ty... fn. ,,.,,, A , , f .V J f ,, ',w ' 'f cf W ,n,fi,:f:ww 3 5 T if we , , f' N .0 hi f , , ,,, Maw I , ' A wwf-Wffwwl 1' ' . .,, 9 Nfl Willllilw Q ,,,,, , ,Q V My , ,7 Q. ., ,- ww. W , , f ,ef fb' gf' .,.., i ,f mf.. .Mr , at ff nw 4 , 0 It s A Hit! The 1981 Varsity Baseball Team, coach- ed by Ted Ferreira and Steve Wise, emerged at season's end with a feeling of pride and accomplishment. The team, composed of all juniors and seniors, had proven they could work as a united group in all areas: hitting, throwing, batting, and fielding. As proof was their record of 19 wins, 7 losses, and 1 tie. They captured the South Florida Conference Title and became District 12 Champions. This made it two consecutive years that North's varsi- ty baseball team had won these two championships. Practice started early in january for the 1982 season with the hope of achieving a third appearance in the conference and district playoffs. The team, rich in talent and experience with eleven returning let- termen, practiced daily after school. Seven starters from last year's successful nine, returned to the diamond and battled with hopeful and talented juniors and seniors for 1982 starting positions. Many of the team's hopes in 1982 centered on Senior third baseman Mike Greenwell, three year letterman and 1 - Dusty Boyd hauls one in for an out. 2 - Scooping up a grounder is outfielder Wade Smallwood. 3 - Varsity Pitching Ace Bobby Carrillo winds up to deliver the ball across the plate. 4 - After forcing Stuart Moriconi out at second during an intrasquad game, Scott Sushil fires the ball to first base on a dou- ble play. It's A Hit! leading hitter during 1981, pitcherffirst baseman Bobbie Carrillo and outfielder Dusty Boyd, both two year lettermen. These three formed a forceful leadership core. Drills in base running, fielding, stealing, batting, and defense occupied each player's and the team's training time in preparation for the season opener against Sarasota on February 19. Coaches Ferreira and Wise continually stressed the impor- tance of a proper mental attitude, top physical conditioning, and clear thinking, so each player would be ready for any game situation that might develop. 1 Fi., A N, ., 1 f'-V . ,im 1 2 lil' iw? 3 1 - Ken Sushil snags another fly to left field for an easy out. 2 - Last year's IV Pitcher David Ierz moved up to the varsity mound for the 1982 season, 3 - 1982 Varsity Baseball Team: IL to RJ Kneeling - Bobby Carrillo, Ieff Prince, Ioey Cross, Iames Giles, Dusty Boyd, Kenny Miller, Tim Sushil, Dale Hinkle, Scott Sushil, Iason Cash, Wade Smallwood. Standing - Coach Ted Ferreira, Glen Nesta, Tony Rutherford, Stuart Moriconi, Ken Sushil, David Ierz, Mike Greenwell, Paul Chaplow, Steve Dahlberg, Paul Drew, Coach Steve Wise. 210 X Athletics The inors The 1982 Iunior-Varsity Baseball Team, coached by Mr. Wayne Iensen, was eager to begin their season. Fifty freshmen and sophomores signed up in- itially to try-out for positions on the team. Many of the prospective team members brought with them training and experience gained from years of participating on the area Little League and Babe Ruth teams. The only returning I.V. veterans were Ioe Flinn, Richard Ratliff, Tim Sushil, and Dale Hinkle. They led the eager recruits in pre-season conditioning. Before any cuts were made each player attended daily practices, participating in scrimmage games so Coach Iensen could judge their ability, sincere in- terest, and team effort. Gnce the player selections were made, daily exercises in numerous baseball skills sharpened the team's play, making them ready for the umpire's call of Play Ball on March 2 against Bishop Verot. 1 - During a I.V. intrasquad game, Richard Ratliff slides in vain as Ioe Flinn readies his throw to first for the double play. Ioe Williams rushes to back- up teammate Flinn. 2 - Ioe Barley takes a mighty swing at the ball. 3 - Getting ready to deliver his pitch is I.V. player Dave Markovits. 4 - 1982 I.V. Baseball Team: IL to Rl Kneeling - Ioe Barley, Gary Brown, Robert Ratliff, Gary Dickey, Robert Onson, Russell Cushing, Duane nash, Ioe Williams. Standing - Ken Tolbert, David Mavkovits, Ray Butler, Louis Tillman, Ioe Flinn, Franklin Driskell, Ierry Whitaker, Greg Williams. Athletics X 211 Rise of Determination In 1981 it was one, two, three strikes and the entire softball season was out. Halfway through North's 1981 schedule of games, Coach Carolyn Whitehurst felt it necessary to cancel the rest of the season due to lack of interest and participation. 1982 took on an entirely new look for Red Knight softball. Head Coach Tom Pacl and Assistant Coach Fred Gebhard took over the task of rebuilding, training, and inspiring the Lady Knights. The renewed interest shown by North female students was encouraging. Hour after hour of hard practice on the diamond at Waterway Park that produced sore muscles only increas- ed the determination of the team to band together and enter each game with a winning attitude. The energy level was incredibly high as each player learned and perfected the rudiments of individual and team play. Specialized drills in throwing, base running, fielding, bat- ting, stealing, and conditioning kept the girls sweaty, dusty, and exhausted by the end of each practice. Composed of mainly freshmen and sophomores, with only a sprinkling of seasoned veterans, the Lady Soft- ballers knew it would be a challeng- ing season, but were determined to make a name for themselves in con- ference competition. 1 - Shortstop Susan Brady grabs a pop fly for a perfect out for the Lady Knights. 2 - Kim Simons reaches for the ball from her first base position. 7 Z'f7F3 i3 f-f7'1f M9 2' iwi af , 4' 'WWW 'T ' V . fm mr . . ' +V: '- 2 'f I ,, ' .. . , 1 , f 1 . 4, . 7 7' , 5 Mn. . . i l 1 i E I 1 5 I E 1 , , . 212 X Athletics 2 ,W Or I, f A ,,,,., 1 vw. ,V 4 , 4 , 1- A 'www ff' W- ,. 0 ,, f . , f KC.- ag, 4,-:, 4194 1 - Senior Missy Lovett gets ready to bring a runner home. 2 - Determination and concentration assure that Lisa Garrett will make this catch. 3 - 1982 Softball Team: IL to Rl Kneeling - Susan Brady, Missy Lovett, Regina Belongia, Cindy Davis, Carolyn Winegarden, Shawn Lingle. Standing - Loretta Marinell, Coach Tom pacl, Kim Culver, Lisa Gar- rett, Kim Simons, Lori Dill, Shannon McIntosh, Sheryl Miller, Coach Fred Gebhard, Tonya Becker. v.....,, Athletics X 213 1 - Shot putting takes strength, quickness, and coordination as Levi Mooney demonstrates. 2 - Showing good form as she clears the hurdle is senior jennifer Maxey. H m AY, f f fy ,1 f f 4 f x jf 13 W ,, 4' .Q M f , ,f g gg X U f 42, '5 hum x 9 V , W , wg , .f . .1 o o i if ef? 1 1413571 V I Q V. ,f,L,..M . S., ff ' - 1, . ,fm get 'Uv .V 1 f . I ' ,.,,,,.VV ,X , VVV., ,. . V' f '. If , , - ' ' wffifr. i f. . fy f . f iw, .0 ff-fjj . V ' J f 4 , 'ff f I P' ,ft . . I 2 CII the Right Track The ancient Greeks believed in the perfection and beauty of the human body. To keep their citizens interested in maintaining their physical well- being, the leaders conceived a series of athletic contests which have transcend- ed the years and now, slightly altered and modernized, constitute the events of an up-to-date track and field meet. Members of the 1982 Boys' and Girls' North High Track Teams carefully chose the events in which they wished to participate and felt that could com- plete with success. These included sprinting, long distance running, hurdl- ing, jumping, discus throwing, pole vaulting, and shot putting. The boys, under the direction of 214 X Athletes Coaches Wade Hummel and Roger Prit- chard, and the girls headed by Coaches Melody Mitchitell and Steve Frank, began early to condition their bodies for the strenuous competition ahead. Being in excellent physical condition and warming up before any physical exert- ion is extremely important for track and field participants. Pre-season practice lasted approx- imately two hours a day, five days a week. Warm-up drills stressing stretch- ing and bending, weight lifting, and run- ning were a requirement for all track team members before they proceeded to specific areas to perfect their skills and techniques in their individual events. Injury is a constant hazard during practice and at all meets, since track and field events place participants in often precarious positions. Miscalculating a height while pole vaulting, high jump- ing, or hurdling, or pulling muscles or tendons while running, jumping, or throwing, happen frequently as the athletes push themselves to achieve faster times and great heights and distances. As the 1982 track team members honed their skills, a spirit Of determination and pride permeated the air around the Red Knight track and football field. The coaches and student athletes felt this track season would be H successful one at North Ft. Myers High School. ms? -as . bbw 1 - Leaving the blocks during practice are sprinters Greg Iones, Iames Holland, and Warren Williams. 2 - Cindy Weber smiles since she knows it will be a successful pass to teammate Ianis Cottrill. 3 - Springing to life off the blocks is junior Dandria Henry. 4 - 1982 Girls' Track Team: IL to RJ Sitting - Carla Doerre, Linda Yslas, Maria Castaldo, Sharon Harris, Dandria Henry, Ianis Cottrill, Ramona Harris, Tara Maxey, Dawn French, Cindy Clark. Kneeling - Chris Trammell lManagerJ, Cindy Weber, Melody Addison, Kim Tomlinson, Sylvia Cavasoz, Olivia Topchy, Kim Moody, Iennifer Maxey, Karen Putmon, Melissa Roof. Standing: Coach Steven Frank, Teresa Roof, Evelyn Sherod, Iennifer Nicks, Candy Boring, Michelle Manuel, Patty Trealout, Cathy Roberts, Kim Bitter, Diane Cosby, Cathy Boring, Faye Moten, Coach Melody Mitchitell. 5 - 1982 Boys' Track Team: IL to RJ Kneeling - Rusty Wenrich, Greg Iones, David Markovits, Robert Nein, Steve Muri, Richard Muri, Kenny Davidson, Curtis Gully, Carl Smith. Standing - Coach Roger Pritchard, Warren Williams, Richard Whitney, Tom Cornett, Ieff Kader, Levi Mooney, Iames Holland, George Tissel, Tom Tissel, Coach Wade Hummel. Athletics f 215 1 1-v. fini,-5. f wif, f- x -I M , 96, , ztffa. . ,.,,' f ,ww ,05- ,pw 4 , Mg5v4nv1n0AilQt ai If-www f gg W f I ,v-aw' z f ' ff? XY ,fa f Zak Z ge? ff . ' M - 5 'ff H , I' ' .ii . ' V A,A,,, .N 1 - Balfour Representative lim Leach traveled to Lee County, com- plete with earphones, to compete in the Red Knight Classic. 2 - Coach Wade Hummell strides ahead of overall female winner, 10 year old Michelle Iennigan. 3 - North's A.D, Ron Hoover starts the runners off on the 10 kilometer course. 4 - Thir- teen tired but happy Red Knights line up with their awards. 5 - Allen Saunders is awarded a second place trophy by fellow runner, North Prin- cipal Ed Stickles. 6 - Having receiv- ed his third place award, North senior Dusty Boyd pauses to read its inscription. 7 - Asst. Principal Steve DeShazo sweats out his run in the Classic. 216 X Athletics 5 2 ' W' ,. A I Vky, . I 1 3 , , 7 Run for That Pepsi Spirit! 142 runners competed in the Third Annual Knight Classic 10 kilometer run held on Ianuary 23 at North Fort Myers High School. The day was a beautiful one for spectators, but the hot Florida sun beat down unmercifully on the con- testants, whose ages ranged from 7 to 67 years. Sponsored by Pepsi, directed by North Principal Ed Stickles, and run by members of the North High faculty and staff, this event has become a popular one with Southwest Florida distance runners. Proceeds from the Classic go to North High and are used to furnish awards for North High athletes. The Pepsi Company provides each runner with complimentary T-shirts, trophies and ribbons for the winners, and free Pepsis for contestants and spectators. This year eighteen members of the North High family entered the race, North's faculty team, composed of Alan Saunders, Steve DeShazo, Wade Hum- mell, and Melody Mitchitell, garnished the first place trophy. Other first place winners in their age groups were North students Tom Tisell and Teresa Roof and faculty member Mrs. Betty Kayusa. Mike Webster was the overall male 'J 13' 2 winner of the '82 Classic with a time of 32:53, while 10 year old Michelle Ier- nigan ran off with the overall female award with a time of 41:58. The best time for a North runner was recorded by North teacher Alan Saunders. The 34:47 earned him a fourth place overall and a second place in his age group. Dedication, determination, en- durance, and training are essential for anyone interested in competing in distance running. These qualities were found in abundance in the entries in this year's Red Knight Run they caught the Pepsi spirit and ran, ran, ran! Athletics X 217 Seasoned Screamers Echoes of the cheering crowds remain perpetually locked in North's stadium. The spirit of the fans for the 1981 foot- ball season was greatly enhanced by eight vivacious young ladies, the North High Varsity Cheerleaders. This squad was chosen during the spring of '81, after participating in a strenuous cheerleading clinic. Once selected, they began the tremendous task of creating, revising, and learning the cheers and class calls that would be used at the pep rallies and football games. tainly not an easy nor inexpensive undertaking. Hours were spent practic- ing and perfecting all movements and stunts so they could be executed with ease and in unison. The girls were also responsible for scheduling and planning all the pep rallies and designing their original skits and dance routines. Artistic talent seemed to be a prere- quisite for cheerleading as members of the squad were called upon to paint spirit signs and create the decorations for the football banquet. Cheerleaders financed their own par- Being a Varsity Cheerleader was cer- ticipation on the squad. Pep rally uniforms, shoes, pompoms, and the summer trip to cheerleaders' camp were but a small part of the financial obliga- tion that came, with this spotlighted distinction. The squad was captained this year by Kristy Frazier and co-captained by Cathy Kubesh. Ms. Melody Mitchitell acted as adviser, chauffeur, trainer, friend, critic, and confidante to these talented extroverts who served as catalysts for North High's spirit and pride. w-fff, ,,,, X 4 4 V X . 961' , 'f.,,4, ,f f , W, , 1. ,. aww, ,.,,, 'v 1 2 3 1 - Varsity Cheerleaders: In front - Ellen Ayres. Row 1 - Fannie Brown, Kim Richards, Cathy Kubesh, Kristy Frazier. Row 2 - Dee Henry, Zona Henry. On Top - Kim Hughes. 2 - Kim Richards, Fannie Brown, Zona Henry, and Dee Henry perform a snappy dance routine during a North pep rally. 3 - Riding the hamburger and fries , Zona Henry and Kristy Frazier enjoy themselves at the McDonald's playground. 4 - Varsity cheerleaders have it their way at McDonalds. 218 X Athletics 1 Fannie Brown surveys the Red Knight Express down the slide Z Like reflections in a mirror, the Varsity Cheerleaders Co captains, Cathy Kubesh and Kristy Frazier work closely together. Hoop Hoora The Varsity Basketball Cheerleading Squad was com posed of five members of the original 1981 82 Varsity Cheerleaders After losing three of the girls at the con clusion of football season it was decided to seek one replacement before basketball season began Referring to the alternate list from auditions held last spring the replacement was named, Doris Soler. The squad cheers at home and away games for both the Varsity Boys' and Girls' Basketball Teams. They also organized the Winter Sport Pep Rally, sold poinsettias at Christmas for the boys' team, and painted spirit signs for each home game. The energy generated by these exuberant young ladies encouraged the performance of the players and added to the enjoyment of the fans. 1981-82 Basketball Cheerleaders Dee Henry Doris Soler Kim Richards - Ellen Ayres - Cathy Kubesh Kristy Frazier Athletics X 219 Exclamator Experts The Iunior Varsity Cheerleading Squad was originally formed in the spr- ing of 1981 after strenuous weeks of practice and tryouts. The six member squad accompanied the varsity cheerleaders to the Tampa campus of the University of South Florida during the summer, where they participated in a training clinic. As the new school year rolled around, one member was forced to drop out and the top alternate from spring tryouts moved up to complete the roster. Then . . 1 . -. . , A .1 ,L -V - , ' ,mfg-131' A , 1, if ' ,, ,.S?i'4f 5 4 ...ri - as in early fall two more vacancies occur- red, so tryouts were held for freshmen so ninth grade representatives could fill the newly vacated positions, With the departure of two more of the original six members, another replacement was picked based on the spring tryouts' alternate list. It seemed to sponsor Miss Sandy McCready, she was supervising a revolving door instead of a cheerleading squad. Only one member of the six girls on 1 - The effervescent vitality of North's cheerleaders packed an incredible wallop. 2 - The sparking attitude of Kim Simons was evident when she performed during pep rallies. 3 - Leading Red Knight fans, Connie Burke, Dana Cooke, and Tiffany Touchstone, chanted their favorite cheer. 220 X Athletics the original squad survived through football season and into basketball season, this was Amanda Smith. She and the four others who composed the new squad, Connie Burke, Kim Simons, Tiffany Touchstone, and Tracy Greer, proved to have finally found a winning combination. The spirit and enthusiasm these young ladies demonstrated in leading the cheers at the girls and boys IV basketball games proved them a cohesive unit and one in which North could have great pride. 2 ff 'Q -,? , 'fl nn i 1 - 1981-82 IV Cheerleaders: Top to Bottom - Connie Burke, Tiffany Touchstone., Kim Simons, Mandy Smith, Marie Smith, Dana Cooke. 2 - North's cheerleaders get the spirit rolling in the 1981 Homecoming Parade. XX 'xxx ' ., ,XXA This past year a new seven member cheerleadlng squad appeared on the North High campus The group was formed by students who were willing to volunteer their time and energy to up lift the spirit and enthuslasm of the wrestling team and the spec tators who viewed their matches Deciding not to elect an official captain the girls rotated this honor at every appearance The squad consisted of seniors Karen Butsch and Beverly Stevens juniors Ieri Cunningham Brenda Horn Kim Kibler and Debbie Roberts and sophomore Dawn Salomone Mrs Ella Butsch served as squad sponsor Their zeal and eagerness showed as they performed in schools across Lee County The members of the squad traveled with the team, sharlng the Joys of vlctory or offering encouragement when confronted with defeat 1981 82 Wrestling Cheerleaders Beverly Stevens, Ieri Cunnmgham Brenda Horn, Kim Kibler, Dawn Salomone, Debbie Roberts, Karen Butsch 1 ' lm r . . N8WSp1F1lGFS 1 1 ' ' l A ' . Athletics I 221 Pride Cuiders We've got spirit, yes we do was the theme that Spirit Club members expressed throughout all the sport seasons at North High dur- ing 1981-82. Continually pushing spirit and pride, members kept their enthusiasm in high gear. Having Mrs. Lynne McDill as sponsor, Rick Morales as president, Cindy Clark as vice-president, Robyn Maker as secretary, and Lynn Truskey as treasurer, the club possessed a core of strongly spirited leaders. The Spirit Club continually adorn- ed the campus with red, black, and white banners heralding the virtues of the various athletic teams. To raise capital for this continuous outlay of funds for paper and paint, the club conducted bake sales and sold pop- corn and sponsored a water balloon toss during Homecoming Field Day. lust before basketball season, a unique item was offered for sale by members to the North student body, spirit bells. These clangers were in- tended to keep the school ringing with spirit through the active winter and spring sports season. f 2 Knight Crusaders The FCA lFellowsh1p of Christian Athletesl was reac tlvated at North H1 h during 1981 82 Students who felt they needed and wante a little time to share their faith and ex tend the hand of love and friendship began to meet twice weekly before school for short prayer meetings At each atherin Coach Wade Hummell the group s adviser asked or a vo unteer to prepare the prayer and bible reading for their next gathering Being an athlete was not a prerequisite for membership in this increasingly popular organization A concern for one s fellowman and belief in the tenets of Christian love and brotherhood created a strong bond between these Knights They started few in number but large in love and faith they will continue to grow in the future as more students discover the inner peace and friendships this sharing in fellowship created The beginning core of F C A IL to Rl Sitting Bonnie Bouch Becky Barley Robyn Bouch Standing Angela Morrison Lynn Stauffer Wade Smallwood Heidi Williams r 1 - Spirit Club members talk over their participation in Homecoming events. 2 - A line of Spirit and Pride is demonstrated by North's Spirit Club. 3 - Spirit Club: IL to R1 Kneeling - Teresa Roof, Paula Branch, Marie Kapcin. Sitting - Delisa Carter, Cathy Boring, Chris Roberts, Can- dace Boring, Patricia Luster, Beth Gurnham. Front of Knight - Cindy Clark, Mrs. Lynne McDill, Rick Morales. Standing by Knight - Lynn Truskey, Robyn Maker. 3 . . . . . . . . . . , . 1 1 r ' . . . . . . . . . . . . . . , . . . . g Q i . . . n C 1 1 f. ' . . . V I B, . . . . . . . . . . I . . . . . . . 1 , , I . . - 1 1 1 , . , 222 f Athletics u-u-i- l World of Sports This year was a year of great controversies in pro- fessional sports. The 1981 baseball players' strike over free agent compensation lasted for seven weeks and closed down the national pastime halfway through the season. When play resumed, new controversy arose as to the method of naming league champions. It was finally decided that the winner of the first half of the season would play the winner of the second half for the right to compete in the World Series. After six grueling games, the Los Angeles Dodgers were victorious over the New York Yankees and crowned World Champions. The year's professional football season was ac- cented with upsets and surprises. New faces ap- peared in Detroit for Super Bowl XVI, the San Fran- cisco Forty-Niners and the Cincinnati Bengals. This great contest on Ianuary 23 saw the Forty-Niners take control early and successfully fight off a comeback by the Bengals, defeating them 26-21. This year's most bizarre happening took place at the Indianapolis 500. Bobby Unser had apparently won the race, when charges were filed by fellow driver Mario Andretti, stating Unser had illegally passed 7 cars under the yellow flag. Andretti was then named winner, only to have this decision reversed by the courts after four months of legal proceedings. 1981-82 saw professional athletes achieve great suc- cesses and go down in humiliating defeats. It was -V ...C above all, a year not soon forgotten by sport fans. Simi bnsffvaff My Lift us , Web! Found F PIHCC Tv dWEU ,lb We tl dfmsmfr vw 33 sfzser . 5,4 35,1 the awzvfns HELL I- ' H Wm bm sv lonely Gzfbhu 15 f ..,.,,,. Neve been S0 Lonlfly Uris been S0 Q We Could C . f , .71 . . ' .. f ,rf M... . ki 3 1 - 1981 World Champions, the Los Angeles Dodgers, had reason to be proud of their pitching ace Fernando Valenzuela who was acclaimed Rookie of the Year. 2 - Sugar Ray Leonard holds his hands high after stopping Thomas Hearns with a fourteenth round TKO on September 16 and gaining the undisputed world Welterweight championship title. 3 - Fans protest the 1981 baseball players' strike that halted play from mid-Iune until August. Athletics X 223 4 PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PR E H Q-dverrisements odverrisements odverriseme 'ff 2 Q' D I.I.I D Q. if 'ff 92 I-'J LTO Q IQEIX cr t Q- P 5 B D. nn E P ff H A LL, E INVESTMENT Q A an CU SPECIALISTS Q. LIJ ' IIf- g ' 2 Q 9 I Q: Q. 'Q E g C3 I2 P E ai ,JJ E Q .2 Q: 1: 0- cv E' 'D I if O . . . Q. odverrlsements odverrlsemenrs odvernseme PR IDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PI DE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE nts odverrisements odvertisements odverrise 'P P- Z OU Q-I'l'I is ee gm IDE 20 V'I'l'I odverrisemenrs odverrisem 5 ff PRIDE PRIDE PRIDE PRIDE 2 IE Q. 2 '5 Advertisements I-T4 2 EEN 'D Rs' SPP 'J 5-2 cn C CD25-g .S to mn-4 U :DJ-O D QQ ,df-m U' 'men ggi mm 5' CR: Ui: QE ,... CD QD' UE 5. cn EE: S' or anizations a urc ase a verisin s ace in 1982 Lance a no lncrease 1n our cos . The following pages are perhaps the most important yt often most overlooked, part of any yearbook ithout the su ort of the people, businesses, and h d d t g p th n t d pp t ll d t b g y th t y t I We now ask glfou to join us in expressing our gratitud Q- to these, our a vertisers, by letting your fingers do th vizlalkilng through our yellow pages and by patronizing I t eir usinesses. I mn Ll.I 4- c: Q E Q. CD LLI o o. 4 92 g. 3 rn 2 M odverns PRIDE PRID IDE PRIDE PRIDE PRIDE QXPQ O C S Xb Gp S G C3 294 Q, vertlsements - , 6ATSBY'S In the Market Ploce 2282 First Street, Fort Myers, FL 332.3174 ,r was Pat Romano Congratulates hrs grrlfrrend, Margie Nahalevvskr on her graduation S ff W Mbmw Mil' WW X ff f wwW mmm Axim! xxx X X .gk N 'xx 41 12955, 7231. Z as inf' Advertisements f 227 ' ' 1 C ., ourmmww ourC0nvmWmQ KDQUU v,,.f , .4 Y'5sa1-- llfllll -lllllll 5 1 U a i Q g ph0f09fdPhy STYLES FOR MEN 81 WOMEN Debble Dukes - Owner 995-4393 FANFARE SHOES Edison IVIalI Ellen Ayers and John Panio x 6 0 0 N . Xl o , 710 Pondella Road, Suite 5 LEE COUNTY OPTICAL 4 PIB hBld EtgtShppgCt K- a Vernon Strlckland J'-6044 , Dlspenslng Opt1c1an Prescriptlons Filled Fsfggwffggsgfiggo Frames Repalred and Replaced WWC E W ENSCHEN K8 33 332 3 Ph. 694 3341 a Lenses Duphcated ' 1 Ad X 230 f Ad pealadqa 2 fgwammewwzaagejws 41720414 wwwmeemq X2 ,-fame Sacee4az'4e?ca'cne77Zaq7faZd DUNCAN FLOWERS Flowers for All Occasions Mrs. Billie Dice nr e Chris Earheart 2250 First street Fort Myers, FL 33901 Sunshine Card Shop Party Goods - Gift Wrap - Stationery RESTAU RANT Thanks for Shopping WEST FIRST STREET DOWNTOWN Downtown Fort Myers Tel 332-1801 Russell Stover Candies t THEJXQSSQRPSE 3579 Fowler St 334 i900 M Mile North of Bill Branch Chevrolet F' - , 'Lex ' Family Hair E Fashions in a L 4 Family Atmosphere 80F Pondella Rd Mary Grant' Hair Fashions 995 1314 U f FoRT MYERS IEWELERS 2263 FIRST STREET FORT MYERS, FLORIDA JOHN MCCLISH 332 1391 UW N X Young Love, First Love Young love is perpetuall in full bloom, like a magical blossom, here at North High. The days of young romance always run their stardust course from the moment boy meets girl. EV6I'y young lady engages in a meticulous beauty routine before each meeting with the Man in her life, but for that extra-special date, a trip to one of the many hair salons of our advertisers for an exciting new haircut or a special stylization, is a must. The wise youn male who wishes to make a fantastic impression on hisdady, may thoughtfully purchase a floral gift from one of our advertising florists or a sentimental card, to help him ex ress his inner thoughts. A romantic candlelight dinner for two is certain to be included at some time during this romantic relationship. Memories from such an evening alwa s take on that extra glow if the couple dines at a specialyrestaurant such as Peabody's or Smitty's. Older North students often cap their special dates by rocking the night away at the Warehouse Lounge. Many high school romances blossom into true love and lasting commitments. When this happlens it is time to stop at Fort Myers lewelers to purchase t at very special ring. From its spark ing de ths come the wonderfu memories of moonlight, fresh ljlowers, your first date, and that magical first kiss. Advertising X 231 MORTON A. GOLDEERO 534 1346 JAMES ALAN J. RUBENSTEIN A J STEPHEN W. EUCKLEY J RAY GOLDSTEIN HARVEY B. GOLDBERG JOHN B. CECHMAN ALAN M. PARVEY A A . E Ad JIIWSIVIOBIL SERVICE Located on the Corner of: Orange Grove Blvd. and Pondella Rd. . . 995-9812 'V 'gongrafufaffonfi .vofjlze Senior . f l'0l'l'l ,. , ' Jaw Om... A Goldberg, Rubinstein 81 B A PA CORNER OF MAIN AND. BROADWAY A 1 A A A P.O. BOX 2366 . A FORT MYERS, FLORIDA -5.5902 DUDLEY BURTON of counsel A 1. 4 f fy f 6' ff , , , .. . . ..,,,. ,, Xzgwfwf .,,.,,,.,4 ,Q . . ,, N. , .,,,. ,.,. -, FAST Mobil EW l T FRIENDLY TIRES BRAKES BATTERIES ,, , , ,,,,,., - The Trovel Specialists P AQFH ,mod Telephone - Xl gm gras X38 Coxiiesvulww 4 nd.56L5lj29l,?,g9 ll ll 6 ll fl. oo cslmcl nsra TRAVEL AGENCY H 0 ' 1524 Broadway Downfownxft. Myers George E. Adams Realtor 2621 Cleveland Ave Ft Myers, FL 33901 334 3334 O Adv dK Cl NGRTHSIDE VARIETY NURTHSHURE SHGPPING CENTER NhCl1 A WOMAN S BOUTIQUE EDGE 2287 Flrst St Ft Myers FL 337 2041 Handsome and Well Tailored Tuxedos Our pnces are competitive Our service excellent Manley Jaqulss Rick Morales and Tom Monteflnese Sidney Davis Buffs Mews SHOP M211 S 511012 1866 N. Tamiami Trail 2265 Flrst Street Downtown Fort Myers 7 . For the Prom O 0 I From Muddy Swamps to Fashion Floors The gator has raised its head from the murklyi swamps of Southwest Florida and be un a trek whic has covered most high school and coliage campuses in the country. Being so close to its natural home, North High students have indeed fallen under the gator's beguiling trance and thus, around eve corner is another preppie sporting his banner of allegiance. High fashion and high school students have always seemed naturall drawn to each other. Daily the latest trends and fads seem to jump from pages of magazines and newspapers and appear in the halls of North High. If you want to convert to the fashionable prep ie look or are in search of any of the other fasffion phenomenons, the merchants advertising in this an- nual will be happy to aid you in selecting your in- dividual look. Go down today and gaze into the bewitching eye of the gator. Scott Brown, Kathy Prickett, Manley Iaquiss Advertisements X 235 and Clndy Weber Mona s Mark Il Umstyle Salon 997 5200 505 Pondella Road Overnight Rooms Apartments and Trailers 1547 N Tamiami Trail 995 4105 MQTELBCHICAGD Wholesale Distributor U NURTH FURT MYERS Chevron Oil- Atlas T.B.A. REALTY, INC. N 108 Pondella Rd. m ' li . Ft. Myers, Fla. 33903 ' Residential Commercial Acreage .mm C co- Investments , 2612 Edison Ave., P.0. Box 279 995.3821 Ft. Myers, Fla. 33902 A yt- Telephone 18131332-1535 L ' T. Uh l Gene Tho L' d R IE t t Sales Man g A-P- QA., Crouch B k Realtor A . 3 !Ad ' Go Ask Al1ce November 18 and 19 1981 DRAMA Thesp1an D1str1ct Conference Ianuary 23 1982 Apr1l 1 2 and3 1982 Cluustmas Plays at the Edlson Mall and Elementary Schools Muslcal March 25 26 and 27 1982 M1me Workshops under the d1rect1on of Troy Van Horn K Grease March 26 27 and 28 1981 I is 9 . lm ' ll, Thespian State Conference Advertisements X 237 Wanda L Newman NEWMHN MOTOR 1 it-iii.. REPAIR P N,l,lllwr 1087 N0l'fh TBUIIBMI TFBII fl' 997 6I27 .r X H Lal E 3 ,Jw 4 ' Y 1 L WOM NOI'fh Fort Myers, Fl0l'id3 aw CO to M .f - W' ' . . Al ki KN I , M lf your mower lsn t becoming to you It should be coming to us' V P Q00 x 0 sf: of Q.. 0 O0 1' O0 Qc. 0 Q. 3 '--' 0 Q ' ' 9 3 WADA PooLs, :Nc , .9 3:29 Q Cape Corral? .2 4? b gllowens Scpllants iii' P 5 4 l d ' v Q 1341 Del Prado Boulevard by WGS Ash -f Cape Coral, Florida 33904 '-'R President :gg PHONE Mmm 0 Zag? Nl'4K:'l Drill: 995-47oo Q, fDtaneQ.Cong N 'tiF' Haze Fl L. N 9 3 A d J, P 4, Q 4 Q 50 l Flzliaa ggsoayersl cvzolflsag u 'a so Q t, -149 X .fe Q s -af J Our Prlces and Products Prove Beautiful Draperies Do Not Have to be expensive' IDDHIETZ DRAFERHES 708-1 Pondella Rd No Ft Myers Florida 33903 Wllhams Uffloe Supply mayweirz Ph0ne4812-9997-S015 38 X Advertlsements Q ' gl 9 ,Ln CVM V11 w SEIKO WATCHES - UP to 5072 ofi 1 ' 'ABR Df R I' ORYH 997 7716 Y Q LILIJL13 TFIJLE 'UW 1I3EU'ULJ B 2235 Fowler Street Fort Myers Florida 33901 337 1178 North Side Baptist Mission Pastor: HAL WYNN That Forf Myers Moy Know Christ 4300 LITTLETON RD N FT MYERS, FL 33903 1813199775440 75? ff .1 MMM? f WVMWMAWAOW may 5'-1-u-1.-v.4..... ILDINQ SY5'ffZ?ai:'3 Advertisements X 239 2401 Danley Drive Fort Myers, Florida ee ran 939 1303 939-1312 LAND DEVELOPMENT CONTRACTING DEWATERING EQUIPMENT CONSU LTANTS RENTALS lea6lnnes.X1xc. . .B 312 .F.M Fl.33903 LEON J. PHILIBERT SR. L S1 - SEWER f WATER f ROADS Phone 995-4676-o 2140 Hancock Bridge Parkway P0 ox 80N t yers, a PRES: Auro PARTS 1105 N Tam1am1 Tr N0 Ft Myers Flonda 33903 Mon.-Sat. 8 a.m.-7 p.m. Sun. 8 a.m.-6 p.m. 240 X Advertisements coMPLlMEN'rs OF: R.L.' McSHI-IEHY. Z OFFICE 'EQUIPMENT I - s-A DEL PRADO BLVD. R , commas: HANcocK.PKwy, , M CAPE CORAL. FL 33904 I I BOB McSHEEHY' Office' Furniture sz 'Equipment 813-549-4777 5 Oqngzfczak gszamic cgfuplio . WHOLESALE ' RETAIL E lp GFIEENVYAFIE AND SUPPLIES Dnstnbutors for Fash-en-Hue Stains 549-4055 Hfgffi-I Fifa? 2 5 I YOUR MANUFAC- TURING COMPANY OF SOUTHWEST FLORIDA for yOU? cei ng fan 7108615 1015 S.E. 12th Ave. Cape Coral Florida 33904 8 13! 542- 1 171 HAIR AFFAIR Four years ago a teacher here at North High real- ized that he would not get rich in the teaching profes- sion. This teacher was a man who had always set high goals for himself. Instead of leaving teaching to try to ind a more lucrative position, he sought to learn a second occupation that could be pursued along with his teaching responsibilities. He decided to study cosmetology, thus enablin him to go into the hair styling business with his fatlier. The teacher, Mr. Iohn Yeomans, now feels that anyone who oes through life and doesn't try goin into business for himself, really misses out. No world is more wonderful than the world of free enterprise, says Mr. Yeomans. Mr. Yeomans is a man who ossesses two very special talents. As a professionalpeducator he leads his students through experiences that help them master knowledge in law, Civics, and historyg As a professional hair stylist he gives his customers a new ook for that big night on t e town with a shamlpoo, set, or stylization at Blakes on First Street. He fee s he has discovered the best of two worlds, satisfying his and his family's needs. The two lives of Mr. Yeomans BLAKE S 2216 Ftrst Street 334-4416 Keith Richmond ond Missy Lovette Advertisements X 241 Sharon Hads d I 102 Pondella Road North Ft. Myers, Florida 995-6037 I jg Lochrnoor 3911 Orange Grove Blvd North Ft Myers 995-0501 EL RIO GOLF CLUB 1801 Skyline Drive North Fort Myers 995-2204 O CD 0 3608 I' Realty, Inc 4, 'W lg - I Office: 813-997-4000 - .M. Cl I . N. . N .Ft. My FL 33903 Badcock HOME FURNISHINGS CENTER FURNITURE APPLIANCES FLOOR COVERING HOME ENTERTAINMENT FOWLER ST. PHONE 939- 1314 o -T CIP? K ol I R I . i KN' 3, B 1 11 J ea tor -QISSQ 5 ' V V 4522, ,jf f fig? I E cdcgf r C9 tx 6 u UO Q' If. Open 10 - 5 P.M. Monday thru Saturday i W MP- in wnenwzxv esnues 1 5 P Sundays O N 6613 eve and Ave, W o ers, ' Adjacent to Robert E Lee Motor Inn . 0 0 0 Signs for Every Need THE SIGN SHOP Specializing in Magnetic Signs Plastic Letters and Plex Signs f-envy 1 -t -V ,,.--.4 f ' ' - 4. 'u '. f f J- -F.-v .. ,a N 1 '11 K '- -- -.-Q I- Lvl- -I- .,-.-..- ., i '-H1 V . f-1 rf,-:H z .- -7 - ,A Fw- ig.. 'Bw array .G , Personalized Car Tags T. L. Klingensmith Owner 995-2522 960 Pondella Rd N. Ft Myers Fla 33903 Phone 332 1612 Prescr1pt1on Shoppe nc Dehvery 1n the P111 Wagon 2200 Anderson Ave Myers Fla OPXl Advertlsemen tSf243 CEIOQQQS BOM' DOCKS 995 2153 1179 PONDELLA ROAD 'I6 YEARS OF SERVICE CALL FOR FREE ESTIMATES O Y f 1 . I1 I ' f. 1 , 1 p ..-.-...---1 PROVISION CO AND ITALIAN IMPORTERS PHONE 3346485 X Manufacturers of Quality Food Y, IMPORTERS OF fs C - T - IL - AT ES PSAHEESIENEXEAAIAN WEE 0 6431.0 MANUFACTURERS C a W of SERVICE AND ACCESSORIES - ALL MAKES 59 SPINAQH PAKSTA - STUC-SPED PEPPERS ASK FOR CARL, IERRY OR ANDY FE TUC INE - TA LIATELLE wg-A RAv1oL1 - LASAGNE - MANICOTTI CANELLONI - GNOCCHI 2707 IEFFCOTT STREET 813 549-0701 I I 916 s.E. 14th Ave. -INDUSTRIAL PARK FT- MYERS, FLORIDA 33901 CAPE coRAL FLORIDA 33904 CiQJ1Eu9jEaEu.lLa.i'iQIm.,S Bos LINCOLN INC. 2807 Fowler St. Fort Myemeauty College Fort Myers, Florida 33901 2155 Anderson Avenue Fort Myers, Florida 33901 Telephone: 334-6981 244 X Advertisements lean VanVleck Owner Bob Tanchuck Manager 9 Flowers by lean FTD ' fvwezd Kg eau 413 CAPE CORAL PARKWAY AT PALM TREE BLVD. me CAPE CORAL FLORIDA 33904 Natural and APt1f1C18l Floral Decoratlons PHONE. 18131542-3107 Representatlves W I VanVleCk and Iohn W Drady Deslgners Four Han' Styllng 6837 Cleveland Ave. N. Fort Myers, FL 33903 997-2523 1tx,i5PAp,' 7 y H 0 s 2 9 9 1 1 QQ ' 1 1 MNA 'gtg O I X Q IIFFIORA . . . , f ' . . . 0 0 0 ready,mi m E ,E ' 1. sANo . GRAVEL I 9 WIRE MESH o REINEORCING STEEL E o MAN HOLES l A 9 CULVERT8-PIPE I 99512721 ' A M 995-5445 P3151 . - W If READY-MIX INC 1179 PONDELLA gpm - - - NORTH rom MYERS Advertisements X 245 WORKING KNIGHTS The proverbial putting your nose to the grind- stone is a challenge to the industrious Kni ht. The exhilarating feeling of independence, brought about by employment at one of our local business establis ments, is a pleasure enjoyed by many North students. Working at Publix as bag boys or cashiers are jobs which employ many of our teenage peers. Tellers at Fla ship Bank develop accurate counting abilities at lightning s eed and can enjoy their 'obs long after their high sclfiool yearsg some, even mafce it their careers. Some students interested in expanding their horizons check out the Armed Forces. With multiple career opportunities available, this alternative is a viable choice for anyone interested in a guaranteed future. Creating delectable sundaes or mouth watering sandwiches at McDonald's has been found to be fun and satisfying as many members of North High col- lect their aychecks from their favorite eaterie. Yet no matter wflere or how our valiant Knights earn their paychecks, they ply their trade as no others can, with sty e and finesse. START COLLEGE IN TWO YEARS WITH MORE THAN 515 000. I How many employers today can guarantee you work for two years, let alone offer you a bonus for colle e? Today's Army will do both. ln ict, if you join the Army for two years, you could accumulate more than 515,000 for school. Here's how: if you participate in the Veterans' Educational Assistance Program CVEAPD, the ovemment will match the eamings you save two- for-one for a maximum of 57,200. Then, if you qualify the Army will add on an 58,000 educational bonus. That's 515,200 in just two years. For more about how to serve your country while it helps you finance school, visit your local Army Recruiter Or call Army Opportunities, ARM! BE ALLYOU CAN BE. Call: SSG Hathaway 813-997-3132 Army Recruiting Station 3323 N. Key Dr., Annex 4 N. Fort Myers, FL 33903 RED KNIGHTS - WE DO IT ALL FOR YOU! IYlCDONlALD'S OF NORTH FORT MYERS 246 X Advertisements 'I nl !.. 2 Mx, 1 'gj.l g. X -' 1:3 Q , 1 ,,,. .emi A-f-,M -,-,,,,,,,.,,. ,M x l .. Y i 1 E u ' r . -w.,.-.! M l , 1 ,, I, si A f1'1 -1.7. , Qisf ws- u any egg: -' -Am' ' 4? 1 5 , V 7 :,4'.r.1 ,M bw, V? ,1 j, TQ. W , 'J g ,,,, ,.Yig..,,,,i,,,,. ,if A ii., -L MM' .Q ,-.., ,ff ,V ,. yy, -wnmzww ' 1 :iv 5 1 , 1 , ., f 6,4 rf, ' 4' ' nf A, . 6 , ,Www Q i , f j fy :vw-'fwffqmfW.M,,,,. W.,--.,,.. wo? , 1. 4' 44 ', amy? A, get 'Z ,M -we 9 1 as 1 f ?w'1 f?541'v f ,ew 4, VW , , fn I jf, f ', , 'fr' M X' f , 'QW , 4 flff' U6-M4 ,mf 4J ,W S f,, ay, wifi f U, , f ,,, ,r H ml ' W :gf ff, -W1 WM, Mmm, fmmg-1 fffffff, , 4' 1' Q45 f we f f 4 4 4 41 , M, f X, 24 'HQ CADASTRAL ENGINEERING AND SURVEYING INC 1430 S E 16th Place , o Cape Coral, Florida 33904 U T U R E USINESS EADERS MERICA C E VALENTINE? STUDIO UNE 1776 001011131 l30lIlBVi:ll'd Fort MYBFSQ florida 33901 Q36 1511 Q I 23 4 Q ' ' :T Q.,-an Awnings ' Carport and Patio Roofs 78, -Ask ',,l 1 E ' , 5 7 F . I y I v, 7 J. 'lllllllll T, 1 Rooms i AL. if fs Pool Enclosures Screen Rooms ' Vlny I , f ART S ALUMINUM INC . ll' I The Poo' Connectlon 906 S.E. 13th PLACE ART MATTSON 1516 S.E. 46th LN PATIO AND POOL SUPPLIES CAPE CORAL FL 53904 PHONE 549-2101 CAPE CORAL FL 33904 542-3410 I Qct. 1. v.v.e.v.v. gens gg gn gg - Q 574-2123 By Appointment uf 1 , .,,.---- -. W5 I LEVI S 1 N-'fm , PRICE 'f x Ns fp ' ' A 'jQ4i'S ,ug CLEARANCE RACK SALE I ,,, ,ITM F 1 3 'WESTERN SHIRTS IIOHG SlEEVEI'SPORTS SHIRTS' -4 fx ' Q '-,OIIQ1 I H up Q 0 PRE-WASHED IEVI JACKETS 0 DRESS SHIRTS 0 ! 'xy'yf 5 S ' TERRY CLOTH PUl.l0VER SHIRTS 1 T-SHIRTS ' Q Q ,pt 'S'8IJ'ZT2E'Z 2525 11215 2 55 Zf'X? ' k I gg H IPI U SIGN ' MWSAND X' 4' PHHQQSM6, BOYS' WEAR Q 'fix 9t9fl:e1ng,eIIa nd. ,..f,?.!1fE'l:.., ,11f,'1',2:':,Z3g, COraI, .Sas-,A-3 ,V - YZ 33:5 a'q,0f?9':,L'3':3:A':5b:53,':5-:?Z'23,l':z2gZt:3 3.54 I I 250 X Advertisements ' , ,,,,f,,f,,.,e,f, for hmm L i i . . . . 1 3 tc Alr Condlllomng Ru u d Sales an d Servlce s Central Installatlons Repalr Any Brand 995 0950 I if ,,4, 'I - RDW 8270 Sevlgny Drlve N Fort Myers FL 33903 1 1 18 PONDELLA ROAD ARMSTRONG BISCAYNE SHEET VINYL GAF VINYL ZZ' CABIN CRAFT CARPETS BURLINGTON HOUSE CARPETS CARPET .X THE CARPET MAN INC 1926 Del Prado Boulevard 86, Cope Corol Flondo 33904 I I Phone f813J 542 0335 CAPE CORAL S ONLY TRUE CARPET STORE WITH INVENTORY WE STOCK 60 ROLLS OF CARPET AND 60 ROLLS OF SHEET VINYL PATRICK COSTELLO III ROBERT S COSTELLO Sales and Mechanic 6 years In carpet lndustry Carpet and Rug Institute Product Tralnmg School Armstrong profes sional selling skulls Armstrong sheet vlnyl school Mechanic and Sales 1 year In Carpet lndustry Armstrong Sheet and Vlnyl School Carpet and Rug Institute Product Tralnlng School Master Mechanlc In carpet tlle and sheet vlnyl Ak M4 ,X K at W, Q ' I r X 1 Q 5 T 5 LQ Q A5 4 if ' I I 4, or-W fmmwswf Q , IK -. 4 Q ,sy It I f 1 fM.,.,,,gf Mum Yi I Y ' as 3 5 Y ' 9' I 4 L-41.-va...-L...al.. PW5 - SLAND LU X i Q I I J ' I I 5 l x A : 4' X ' , V V if I .X X - ,aiu , f I VV 9 1 v, ,,- f 1 io gk 1' , ,, ' ,V I ,AZ , XO xf 'H , I Q f X ., f , f f ' ' ffl 1 ff , f 072 I g . 1 . . , V l Advertisemen tsf251 fill .A xxxxxxx SUPER HIR NS Bayshore Congratulations from: Bakery 114 Bayshore Road 4240 Cleveland Avenue b NOI'th F011 Myers Fla 33903 Fort Myers Florida 33901 995-2806 995 6277 C8133 939-4724 Linda J. Seeley Robert L. Seeley Anne and Beecher Allen lust North of ALLEN s RESTAURANT sz nm me an a 0 PIZZA 542 6562 FAMILY DINING EXCELLENT PIZZA 304 DEL PRADO BLVD CAPE CORAL FL 1571 N. TAMIAMI TRAIL FORT MYERS FLORIDA Gnngratulations Glass oi 1982 0 , I I 1 h 1 9 ' 00 PM Bars sin an 7 L t- -- GENERAL MENU TAKE-OUT SERVICE Pett Cash The simile, spare change burns a hole through a leans pocket li e lightning goes through a cloud, olds true for almost every North student. With sipiraling inflation, it is difficult to make it from pay ay to pay day or to the weekly allowance dole. What spare pennies do manage to jingle in teen's pockets seem earmarked for many momentary satisfactions. Who can resist a juicy sub at I-recks or a tantalizing sweet from the Bayshore Bakery If pressed for time, a quick stop at Shop and Go or a Pepsi or a refreshing pint of Hart's milk, hits the spot. When time permits and the hunger pangs de- mand a more complete satisfaction, mpney goes for a chewy pizza at Allen's or Armando's Restaurants, a scrumptious BBQ at Fat Boys, or a famous Big Mac from McDonald's. T-shirts, the mainstay of a teenager's wardrobe, always take a large chunk of our extra-money . Super T-Shirts have hundreds of standard press- ons, or are more than willing to personalize a shirt to mark an im ortant event or fee ing in your life. No matter lfxow Red Knights spend their sipare change, they seem to be prime examtples 0 the economic fact, that teenagers are one o the largest and most important consumer blocks in the United States. 252 X Advertisements Frank Ienkins Qmawiwwmmomsyvmnaamnm COMPLIMENTS OF: 1 PEESI 1 ,a1 ' 3, - M 't , Q h 5 UPQKQU 33933 fm-my Congratulations 9 Class of 82 2330 Anderson Ave fm IA JA fli , lk, MSL D HO F ESHER ' A ,ff ' , 1' if f Fort Myers, Florida ' Advertlsement Q I 1169 Oronge Grove Blvd Vi North Forr Myers Florrdo In . P' 1 adv ,Q A d , . f I , Q sl s it Wx ' X - Q x -r X Serving the Entire Community ' m ' v n cf Star Pharmacy for Better Health 1240 Tamia iTrail N Fort Myers Florida 995-2136 Hollister Ostomy 8 Con alesce t Aids may 995-6005 No Ans.: l813l 334-0111 wma W shi'-7391 ELLSWORTH'S HEATING 8z COGLING, INC. Mobile Home Specialists George Ellsworth 1905 N. Tamiami Trail Wildlllaffs Trophy Wgfld President N. Fort Myers, FL 33903 505 Pondella Road Adv 'sem Durhng and Assocrates Realtors 8 Del Prado Boulevard Cape Coral Flor1da 33904 Excluswe Sales Agents Marv1n I-Iomes Models Hancock Br1dge Parkway 1 Block East of Del Prado Boulevard Phone 549-4122 . 542-1222 7: LO do Q ' 2 T Q 5 O 00901 1 ' 'fvcf :,zq'2Z'z: yf3 ' n fl, VM X 4 ' A f f fr , . . X fy , R4 , '7W? , , 'f 'Yffffy ffnf , , f I I 4 f f X ya X X 1 fff y 4 Z ,, , ,,f, QQ44 f. Wm4f7ji0f ' mmf' H ' ' -.4 , ' 1 , W ,W 6 , ,K 4' 7 'W ' Kim Moody and Darlene Sapp 256 X Advertisements Wkdte Wvu-., H., ga ,,,, 4 7wWlw4 J, e 22252 3 551, A' W da. 2 4 ' fjaw,,'3 g f . 3 ','k I ff, , 'I I, if 44 'V V 'W , 1 , !7,fifzf,J, 'Lk , ' A e. wb, 4 If fy a A if V4 Cla Q' QNATN0 D98 BUD Sl-IDD 1910 I'I0l1di:l Dvirld Q36 1784 Contemporary Automatic Car Wash Complete Exterior and Interior Service Tibe Larson Atlas ACCGSSOFIGS Spec1al1z1ng ln REGENCY Tune-up Brake Work Auf Condltlomng W 2333 Fowler Street The Gentle Teueh Fort Myers Fla. 33901 337-9792 Mltch and Donna Wllllamson 995-5450 6737 U.S. 41 N. N Ft Myers FL LHFSOIYS Chevron Darlene Wllllams Robert Chllders Rlchard Ratllff 258 X Advertisements M8zM AUTO Modern Day Chariots Carolyn Dickerson, Tara Maxey, and Lori Pastirik Our valiant modern day Chariots are the mainstay of many people's lives and one of the main means by which we stay in contact with the world around us. Like the horse drawn carriages of olden times, they occasionally need to be repaired, fed, and cleaned. When your modern day steed is hun ry stop by Lar- son's Chevron or Iim's Mobil and fill it up with a tankful of high-octane. If your transportation is show- ing signs of illness or bucking at the starting gate, it may be time for a visit to M8zM Auto for a complete mechanical check-up. Dama e repair, a new face-lift or paint job can be providedgby Mr. D's Body Shop to give that old set of wheels a brand new look. However, if new in the literal sense, is what's really on your mind, we suggest you sho for your new vehicle at Southgate Datsun, Bob Lincoln Oldsmobile, or Gulf Coast Dodgle, our advertisers. They would be glad to put you in t e driver's seat of the car of your c oice. New or old, keep your set of wheels clean and shiney with a regular stop at the Regency Car Wash. Knights are proud of their vehicles, as they are of everything, and their caravans of classy chassis prove this to be true. Advertisements X 259 GERITIHN CLUB MW 260 X Advertisements M1405 Us l is my m Q k UJPLIXNQE. SIQRNILY: My , When You Sleep on Water Sleep on . Ebb Tide Debbie Wyatt ,A 15 P Design Consultant - ' Ima? 1 V' ame gjlflane l303 Del Prado Blvd. hair designs 549-884i Cape Coral Fl. 33904 Family Styling Looklng Good Makes You Feel Great! Betty s Contmental Un' e uty Salo Spec' l' 'ng' Styl C tsandNat IP m I 'rms ' zu Q- Q 1 ' . '71.,73.. . ai nf . ' ,fs R Sw gwiv f Qs f X iz sein N 5+ l ' 56 0 r 5 -F5 M5 10 ,, ,A Waterbeds Compare Our Price Mattresses ' Custom Liners Made to Order Heaters Vibrators Drain and Fill Pedestals 2075 Cleveland Ave. Covering Southwest Florida Fort Myers - Naples 332-4467 Rodger T'D l 7055 P dell 997-1781 Advertisements X 261 NDRTH FDRT M x.-'E 5 is ..Ql' ,ff 60 a n 'f .- W , O ,Q gk . mm' Laarning +0 do Doing io learn Earning + live Livin io . ..-6:3-9:30 . f7'.EfS'1.1o..-0 ,, RUTH 3366 Cla oland Ave. Mya -Lu Square 0Cl5Lll'65 I1 Clflflfned 936-2131 481-2421 wp My Q J Qualify and Service Gun anlood W' jf' my jf ' 33903 Your Exla Touch Florist I : lm X f 'QI lf Member r.r.o. 5' W' . . 9 . 3 I9 - ' fl , 995-0872 Messmer LIJ KAY L. HOAGLAND ii Realtorw HOAGLAND REALTY INC 1526-A S.E.16th Place Cape Coral Florida 33904 Office: 813-542-5155 Home: 813-936-4054 L P9 VI If C 'I 3 fb Won 74141-.1 I0 a m 5 F m 0 ,W f rl 1 H a m 5,1 m ZX 'i -Q 1. I9 r P If-4 V f an e zz aa I e ef-J, a U H Cerumiw o em ef e az f gfauea 9 u :ea glfm . Qin-5 jean erry gnslruclzon p one U! - , . n - N 1 597-3740 334-8261 Dr' Bruce Senlor Foarlilsllyers, Florida 334-6605 and His Optometric Staff Wish to Congratulate , THE ELI WITT CG. the Class of 82 3140 Kutak Lane, Fort Myers, Florida 33901 BI'adfOI'd Block Fort Myers, Fla. 33902 Nawaz, fdifaeiifaal giamii GALAXY LIQUORS- BEER-wines 1 LOUNGE H OFF MA N i ASSOCIATES if HAHLQRQGN I 990 PONDELLA ROAD 941 E. Country club Blvd. N' FT' MYERS' FLA 33903 WCB llii-0TfeFl5Ql.ll-lxiliclion Ceramic Boiflihlinjoslzhljls5932226096 Complete Design Service Residential and Commercial Advertisements I 263 North Tamiami Trail When you are thinking about your future we suggest that you consider a career in telephony. Rewarding opportunities with long range potential are available in a wide variety of fields. Whether you are ready now or in the future why not talk to United Telephone soon? UNITED TELEPHONE OF FLORIDA UNITED TELEPHONE SYSTEM An Equal Opport 'lily Employe What Next? 995 2141 WORLDS LAR MPH' 'D- 264 X Advertisements ARCOAL 59 the Clock Those few precious hours, away from school or work, that are allotted to leisure activities have special significance for busy Knights. They devise many ways to relax and revitalize their energy supply. A rigorous work out at the Robin Dawn Dance Studio can release mounds of pent-up ener . Spending the weekend out in the woods or downl-fy the shore with equi ment from Robbie Sporting Goods is an enjoyablle outlet for our nature loving students. Strolling leisurely through the fascinating Shell Factory or curling up or a few hours with an in- triguing novel from the Book Trader has its restful qualities. Time spent at the Edison Mall browsing the unique shops and boutiques or dining with good Eieqiis can e a pleasurab e experience to be savored a . yPerhaps the most popular leisure time activity en- joyed by North students is using the equipment sulp- plied by UTS, United Telephone System. T e telephone, often referred to as a natural extension of a teenager's ear, keeps us in touch with friends near and far. However free time is spent, in sweet solitude or the throng of humani , its cost is priceless, and its recrea- tional fringe bene its inexhaustible. Robin Dawn Dance COMPLETE DANCE TRAINING FROM BEGINNER TO PROFESSIONAL Offering. . . MODERN IAZZ Member - Dance Masters of America and TAP - BALLET - POINTE Professional'Dance Teachers Assoc. Faculty Member - Dance Educators of BATON - DANCERCISE America EXCELLENT WITH CHILDREN SPECIALIZING IN ' , y 3 YRS' T0 ADULT CHOREOGRAPHY FOR PRIVATE OR MUSICAL NUMBERS sTUDIO HOURS - MON.-sAT. BY APPOINTMENT ONLY I ' 549-0827 X ,, 4426 DEL PRADO IUPSTAIRSI CAPE CORAL, FLA. 'MBOOKTRADER 'BOOKS FOR ALL THE FAMILY WEAVER S CORNER Mon Sat 9 30 5 30 .Y Q. . 2 ' '1 f . 1 v 1 ww-I rw.- l 5 . ' . 5 , 'fe- QSX ? Xoglgzed NN gi yet OLP ei GP O LSSEQQIRQ C' O Nggvgfxvgf , sects f Mam ie. fOr VOUI Ooefsiop SOOOOIOO Oleosore Nick Cooley and Vicki Cooley Iohn Ammons 266 X Advertiseme . , mm f ,V'1-Vf , ' . f Star W u'ro ' Creat1ve Rattan, Inc Congratulations and good luck handcrafted rattan furniture Local Manufacturers of fine to the Class of 82 8485 Tannami Trail N E N Fort Myers FL 33903 C8131 997-2636 t of Fort Myers, N.A. Main Office South Trail Office 3210 Cleveland Ave. South Trail Shopping Center . Fowler Street Office Cypress Lake Office 8 3357 Fowler Street Express Lk. Dr. at Winkler Cape Coral Office Downtown Office 926 E. Cape Coral Pkwy. 2075 Bay Street Member FDIC IHS Q BQ .,'3.E.QE!!!!3Qk5 BIG RED OUARTERBACK CLUB Jlm Bouch Presldent POST OFFICE BOX 823 Cliff's Cor Core, Inc. Quolify Honesty Personol Service 1910 Hondo Rood Fort Myers, FL 33907 FORT MYERS FLORIDA 33902 939-1007 PHONE: 332-1440 IEIIIEIIT IIIIIIISIIIIELIIIII. 1' , in . , Q . 1 ., M ,, , . ,gh u. f 4.9355 it fn .V - I K -if I eww 2 995 9903 GULF COAST DODGE INC , . 4300 S. Cleveland Ave. E FT. MYERS, FLA. 33901 PETE FFIAZEE Sales Manager 1260 N Tam1am1 Tra11 N Ft Myers FL 33903 Owner Ral h lane Anderson Congratulations to the Class of '82 Star Plaza Coin Laundry - Hfldp 268 X Advertisements Dealership: 936-4118 f 5 M m ' 18131995-2981 ugmj' 18133 995-3587 we Qdflgtslitlw' 7a Wlqma ?e4Z'6aha6 7nc, Residential 8t Commercial Pest Control Lawn Spraying f Fertilization ' Termite Control 58 Bayshore Road North Fort Myers, FL 33903 TROPIGIAS Import and Truck Service A Transway Company AAA 24 Hr. Road and Wrecker Service Complete Services SGTVICG ArOUI'1d the Clock Tune-Ups Transmissions Air Conditioning rlgrakes Radiators 1reS Generators Restaurant Equipment Div Body Shop Starters Sales and Service CALL: 997-3233 337-2234 Complete line of N. FOTI Myers Fort Myers Ice Makers and 334-2849 218 Pondella Rd. 2138 Cleveland Ave. Refrigeration Equip. American Transmission Around the World :Batteries 1 Illfmfv HESlDEHT!AL F, THE IVILJNTEFZS CORPORATION PO BOX 5425 FT IVIYEFIS Fl. BBQCVI PHONE fB'l3J 9135 1555 Speczalzzzng zrz cooling lower CON ST fill and related heat and moisture transfer surfaces - TE LEX 5-2755 Advertisements X 269 '7 ..f. ? 4 ,.g:::g:f,.g:QE2:3:Q:,, 5 1555, 3 555253355EgEfZ2?fffffI:'?2??Ef1SIT? if f1 ' j'Q',', fg f fff 2'f?f??8 f '- --..,Q .-+ .,2' 21 x.1-A-251122 1a21iH 2e2ff 2fr5, -. .. 'v szssix fisie I . fs, 'E5 :' filiffilfz 1181. 2-' 5,592-61,4 '--.kia . -5 :1 :i- - 1:55 :gi 1, 332 fs Frey a' 1 fi 2552 1 1 22 2: 2-1 :xi .f'!.: ff . 5 . ,,sig1,:31253i,i gg 5 1 -fi ' ' g1:3,,:gr 135312-' 211'111:g.j-rgggzgzrzgzgzgzjzi:Iv' :Ere .I ff yn:-' 143231, 323:31,g:3:3j5:::gt5:3', . ,W 11:2li...g51' 2522535533514-Qs5s5fE4i2i2i'1:5E ,1i2ii'3f ' . ST fi' iffgsf1fiziigiiiiissg,,.:.,., .-7 'V AQ, tx, 1'5'Z'M'i'i'f 5.1:-. 12- 41:-11:1:-:1:1:-24:-:-:-:-15523. 1y::5:5:g:g7g'57:':f nl S 2222525 11521. V. s, lgiiifl ' ff 2Esf3ifii52?2?2 e fiiiiiiifitiiisks. iiiiiisfsfsisis25522252525fff9i51f:11z2E?i:Z2tEEF' --1:12225 .-59255333235555E5E5E5EQI3E5E5EgEWME5E5E3i??E5If?iEEEEZEEEEEZEEEFSEEEELQ3 gE3Eg25E5E355E5E. 553: SESEEEEEE -:Zzz:ggf:3:::,:::5:::5:g::f::51:grzufiziizfziflzizf,-:'-':g:.1.,.:.g:g:::::1 . -:gzzzggzzgzgzg 'rg :-:-:- 52535f5i5i515E:E5E5:5i5i31 .2sSsSsizEs:st.. F32 '-:-:-:-:-:-:f:f:-:-:-:-::-:':-9:g:g:::::g:g'g:g:g15:g:g1g.-1g1- :-:-:-:fx-1':-F:g:g:g:g:g:::g:5:1.5.. .' 12:23. '-:-:-:-:4:-: V ,. f - 'fizfesiziz 2, 'SEI'15SEIEIE131SfE1:1:2E1S1Si1i'EIE2E2f.5252551 -E2i2E2EE51.2:E?Z'?i153:E:3:ErE1E2?fE'EfffIfI1I51 ff3f2f7fff2fQfg 5255525235 155 .... 2'I2Egiligiririgigigigiggigig2525:55533E.. ...,:E:ErE1E15fE1ErZE,E2E5E5fgEg2,1gZg55:5E3E3E5.21 1E5:EiE:E:5:5:E2 f2i55fffff,H'Q:5 umrsn ' ST . .,.. ...... , ,xt 1:7 5:5:5:5:3:5:2:f: FEDERAL K ' sAvsNGs AND LOAN AS o IATI ?S:3:2:5gE5Eg3g5EgEgE1E5 - 1111:1:::V. ff' ' 1'l-T'-'i1E-Q12E- 2122- -,fifisisfff2232221522222 NORTH FORT MYERS: 909 Pondella Telephone 995-1900 ,sz5:,. are 2s252s2z2s2s2s22:. 15E5E5E5E- . A -A isizfsiisiaieisi'15:52:s2:ae:s:s:s:z:a:s:s:1-5-sw . was it fff-11-2-2. :s:zSs1s2zEs4ia: z:ws:s:s:s:5:5:s:s:s -1'2-1-1:5:z:z:- .iiiiiiiiii- :g, .5. e:z:s:s:e:s:zs:s:z:s:s:s:s:sns:s:s:s:s:e:s:z21:52 A: ,1e3:z:1,sa:.. a:z:s:1:s:s:a:z:a ':s:s:rasfefe- f-'M 270 X Advertisements Your bridge to the future Enter Lee Countyncross the Caloosahatchee... , to Lee County Bank...and full service banking. Save time and money by doing all your banking under one roof. Lee County Bank. Like a department store of banking services. Your bridge to the future. 4, Z Www Member FIRST FLORIDA BANKS! FDIC Over S2 Billion in Assets Compliments of QSI Fl-0R10 SCH 46, I5 FIRST NATIONAL BANK 2400 First Street 6231 Pine Island Road 5044 S Cleveland Ave 2925 Anderson Ave Edison Mall Member FDIC an Federal Reserve System if v 'ul 'ZA 45 Y d Money Makes the World Go Round Money, money, and more money . . . it seems to be the center of our ever changing world. If you haven't got it, you want it. If you've got it, you want more of it. Not only is money getting more and more difficult to obtain, it's becoming even harder to retain. North High students begin early in their quest for a regular income. It's common to see Red Kni hts work- ing hard in various local establishments, ogen labor- ing after school, evenings, and weekends. If younfg Eeople are smart they will entrust a large portion o t eir aychecks to the professionals at one of our local banks. Even young people quickly learn that a rainy day is often right around the corner and a savings account is a very hand umbrella. When money matters really become difficult, Bea's Pawn Shop will hel you turn that old typewriter or radio into ready casfi. If you are a graduating senior and thinking about moving out on your own, ou may want to stop by the offices of one of our advertising real estate com- panies. Their rental experts will be glad to help you 1nd that apartment you've dreamed of, at a price to fit your wallet. Whether expanding our horizons, movin up, or moving on, the money that you've worked so hard for will help pave the way if you have learned to manage it while you are young. MORROW INSURANCE AGENCY INC Robert G Morrow 390 -'I Pondella Rd. NLE! Mye S Fl 33903 18133995 - 2867 V W Exchange Bank because a good bank can be your best asset 995-0130 1535 N. Tamiami Tr. N. Fort Myers FL 33903 Bea s Pawn Shop Congratulatlons to the Class of 82 Money Loaned Buy and Trade Sell u I o ?L r I Mernbev FDIC 4 n n n . I' Realty, Inc Office 813 997 4000 Cl 1 N N Ft My FL33903 I f Realtor B , Zi? fi Q43 ' ' : - - IIB a n cv UO S' I Open 10 - 5 P.M. Monday thru Saturday l - 5 P.M. Sundays 6613 ' eve and Ave., .W. o. . ers, - Adjacent to Robert E Lee Motor Inn Advertisements I 271 APPLE PIB REA INC. PAR REAR The 1981 Varsity Cheerleaders Apple Pie Realty 2140 McGregor Blvd. Fort Myers, FL 33901 337-1399 A 7 V Sound On Wheels Rt. 15 Box 1189 N. Fort Myers, Fla. Alladin Pools Inc. Rt. 13 Box 806 P S. Fort Myers, Fla. B8zB Bookkeeping 791 Pondella Rd N Fort Myers, Fla. Best Wishes From Mr and Mrs Roger D. Boring Caman Power Systems 3100 Evans Ave Fort Myers Fla Cape Coral Togs 1432 Viscaya Pkwy Cape Coral Fla Dr Berwun Clifton 8450 Fowler St Fort Myers Fla D8zM Shed Distributors 17 N Business 41 N Fort Myers Fla First Federal Savings and Loan Association Of Fort Myers Florida Rock Industries Inc P O Box 6984 Allco Rd Fort Myers Fla Patrons Franzese Plumbing Inc. 907 Country Club Blvd. Cape Coral, Fla. Ph. 542-2354 Hines Realty Inc. 1519 Hendry St. Fort Myers, Fla. Knight Life The Student Voice Of North High Moser's Tire Store Service 1069 N. Tamiami Trail N Fort Myers, Fla ' N F M Memorial Chapel Phone 995 1113 Congratulationsll North Shore Animal Hospital 1230 N Tam1am1Tra1l N Fort Myers Fla Congratulations Lance Staff 82 From Robert Rathff III George Schupka Studio 3435 Fowler St Best Wishes From Mr and Mrs Emery A Smith U Save 1208 N Cleveland Ave Congratulations Class of 82 Volkswagen Repair Center Fort Myers Fla Ph 334 2420 tSf273 Fort Myers, Fla. 2857 E. Hanson St. A E 1 ver isernen aAa A.P. English 78 AXV Sound on Wheels 273 Aalto, Brian 55, 94 Aberele, Iulie 161, 289 Acitelli, Anthony 133 Adamcik, Ronald 133 Adams, Alicia 54 Adams, Colleen 161 Adams, Debra 161 Adams, Kimberly 54, 94, 95 Adams, Lisa 24, 56, 63, 94, 95, 103 Adams, Louise 6, 56, 83, 78, 154 Adams, Nina 68, 94 Adams Realty 233 Addison, Beverly 94 Addison, Marsh 94 Addison, Melody 60, 133, 215 Adult and Community Education 38, 39 Ahlefeld, Kelly 133 Alfano, Richard 66, 133, 281 Alfred, Denay 94 Al's Auto Parts 240 Alladin Pools Inc. 273 Allan's Rest. and Pizza 252 Allen, Kimberly 161 Altvater, Heidi 133 Alvarez, Iody 114 Ambrosia, Anthony 79 American Transmission 269 Amerson, Connie 161 Amerson, Iackson 94 Ammons Auto 266 Ammons, Iohn 73, 133 Andersen, Christine 161 Anderson, Dennis 50, 64, 69, 114 Anderson, Glenda 53 Anderson, Iennett 114 Andrew, Terry 79 Apple Pie Realty 272 Archer, Rhonda 94 Arciszewski, Carrie 94 Arciszewski, Frank 161, 204, 205 Arlington, Mark 48, 49, 56, 62 63, 100, 133, 145 Armstrong, Tony 161 Arndt, Candice 79 Arnett, Kevin 133 Art's Aluminum Inc. 250 Ashcraft, Michael 99 Asher, Barbara 99 Ashton, Amy 56, 94 Asselin, Michael 133 Asselin, Steven 94 Atkins, William 56, 99 Auldridge, Zana 62, 70, 133 Austin, Amy 69, 114, 281 Ayres, Ellen 63, 133, 134, 139, 218, 229 Ayers, Phillip 60, 133 bBb B8zB Bookkeeping 273 Bacon, Richard 49, 62, 154, 274 f Closing 1 General Index 155,158, 161,281 Bacon, Richelle 284 Bahrs, Laura 73, 134 Baier, Howard 79 Baker, Philip 46, 63, 149, 154, 162, 202, 203 Baker, Susan 114 Ball, Sherwood 94 Band 56, 57 Banta, Lisanne 46, 63, 66, 134 Barber, Iulia 32, 94 Barksdale, Linda 94 Barley, Ioseph 55,114,211 Barley, Rebecca 154, 162, 154 Barnard, Brian 162 Barnes, Donald 94 Barnes, Mary 4, 72, 162 Barnes, William 134 Barnett Bank 266 Barnhill, Michelle 95 Baseball 208-211 Basketball 194-201 Baskin, Leroy 162 Battle, Anthony 162, 193 Battle, Bernice 76, 79, 133 Battles, Lori 114 Bauchert, Cheryl 68, 95 Baudino, Michael 95 Baudino, Sheri 134 Bauman, Bill 23, 79 Baumer, Ellis 50, 55, 60, 69, 114 Baumgardt, Iulie 95 Bayliss, james 68, 95 Bayshore Bakery 252 Bayshore Fire Dept. 16 Baxter, Laura 134 Bazzle, Ianet134, 275 Bea's Pawn Shop 271 Beatson, Michael 134 Beattie, Mark 55, 114 Bechtol, David 62, 114, 193 Bechtol, Herbert 95 Becker, Tonya 62, 114, 213 Becker, Tracy 71, 162 Beckos, Christine 95 Beckos, Iames 73, 162 Bedford, Connie 49, 53, 56, 62, 162 Beebe, Kathleen 56, 65, 114 Beecroft, Ronald 155, 162 Beigh, Mark 114 Beller, Darrell 73, 134 Beller, Lisa 48, 134 Belongia, Regina 213 Bembry, Iimmy 56, 95 Benkatar, Kathryn 64, 79 Benneit, Howard 79 Bennett, Donna 63, 69, 114, 141 Bergen, Gary 294 1 Bergman, Veronica 114 Betty's Continental Unisex 261 Billings, David 95 Bishop, Diana 66, 67, 162 Bishop, Georgia 115 Bishop, Marsha 79, 194 Bishop, Vicky 95 Bitter, Glenn 56, 95, 110 Bitter, Kim 30,56,58,111,154, 159, 162, 215, 233 Bitter, Marie 79,110 Bitter, Mark 56,111,114, 115 Bjurstrom, Robert 79 Black, lamie 86, 95 Black, Ralph 95,193 Blake's 241 Bloomfield, Kathy 4, 162, 154 Blue, Latrice 72 Blum, David 134 Bob Lincoln Inc, 244 Bogart, William 162 Bogey's 235 Bohannon, Harriet 31, 77 Bohannon, Iarnes 31, 73,79 Book Trader 265 Boring, Candace 63, 95, 215, 222 Boring, Cathy 63, 114, 115, 215, 222 Boring, Christy 56, 59, 63, 69, 133, 134, 135 Boring, Mr, and Mrs. Roger 273 Bostic, Annie 95 Botelho, Richard 19, 162 Bouch, Bonnie 46, 54, 64, 133, 135, 143, 222, 289 Bouch, Robyn 78, 154, 160, 162, 222 Bouie, Tony 95, 193 Bovee, lack 26, 79, 89 Bowers, Trent 114, 115, 116, 259 Bowker, Robyn 32, 68, 95 Bowman, Robbin 162 Boyd, Daniel 47, 51, 66, 162, 182, 209, 210, 216 Boyden, Eugene 115, 141 Boyden, Marc 95 Boyette, Pamela 27, 34, 49, 62, 133, 135 Brad's Renaissance 256 Bradley, Debra 27, 49, 62, 133, 135, 137 Brady, Susan 55, 115, 212, 213 Bragg, Tamara 66, 95 Branch, Paula 115, 222 Brand, Nathaniel 95, 193 Branson, Brad 291 Branson, Virginia 47, 79, 281 Brazill, Diane 56, 69, 114, 115 Brewer, William 162 Brewster, Cindy 135 Breyer, Natalie 162 Bridges, Kelly 95 Bright, Kelly 60, 115 Brightbill, Donna 115 Brightbill, Regina 115, 132 Britton, Iulie 56, 59,133, 135, 143, 204 Brodeur, Molly 48, 49, 62, 65, 69, 114,115, 281 Bronson, Reginald 96 Brooks, Lisa 135, 254 Brooks, Tina 96 ' Broskowski, Amy 81 Brown Air Conditioning 251 Brown, April 55, 115, 141, 194 Brown, Edwin 14 Brown, Fannie 159, 163,179, 184, 185, 194, 218, 219 Brown, Gary 96, 204, 206, 211 Brown, IoAnn 96 Brown, Larry 55, 96 Brown, Luvenia 115 Brown, Marian 96, 186, 196 Brown, Michael 135, 235, 206 Brown, Ray 115, 199 Brown, Robert 96 Brown, Tarsha 96 Brown, Wanda 72, 155, 163 Brown, William 116 Browning, Buddy 292 Bryant, Ieff 96 Bryn-Alan 228 Bud's Men Shop 235 Burchfield, Denese 116 Burdick, Lester 116 Burford, Sandra 163 Burford, Susan 96 Burge, Arthur 116 Burger, Iohnnie 79 Burke, Constance 66, 68, 96, 97, 102 Burkes, Ioyce 96 Burkett, Karen 116 Burkett, Marilyn 47, 135 Burnett, Tab 116 Burnup 8: Sims 266 Burton, Tari 73, 135 Busbee, Carolyn 135 Bussey, Karen 64, 67, 95, 96 Butler, Ray 116, 211 Butsch, Ella 79, 110 Butsch, Karen 8, 71, 111, 163 Byrd, Raymond 116 c Cc C.B.E.fF.B.L.A. 71, 248 C8zW Cycleworks 244 Cadastral Engineering 249 Callahan, Steven 163 Callari, Stephen 135 Caloosa Middle 286, 287 Caman Power System 273 Campbell, David 116 Campbell, Thomas 135 Cannon, Tracy 33,114,115, 116 Canova, Robert 134 Canova, William 96 Cape Coral Flowers 238 Cape Coral Togs 273 Caputo, Lorry 96 Caraway, Allen 66, 79 Carpenter, Christopher 135 Carpet Man 251 Carrillo, Roberto 5, 56, 123, 160, 163, 209, 210 Carter, Delisa 68, 116, 204, 222 Carter, Kimberly A. 163 Carter, Kimberly D. 96 Carter, Regina 135 Carver, Della 163 Carver, Rodger 96 Carver, Russell 50, 163, 257 Carver, Tracy 116 Cash Air Conditioning 260 Cash, Iason 60, 135, 208, 210, 260 Cassell, Virginia 77, 122 Castaldo, Maria 96, 183, 215 Catania, Marie 96 Caudill, Angeleia 116,186 Cavazos, Sylvia 72, 215 Cement Industries Inc. 268 Ceslok, Gidget 97 Chance, Lena 97, 196 Chandler's Hair Design 250 Chandler, Shelly 97 Chaney, Terri 163 Chaplow, Denise 133, 135 Chaplow, Paul 163, 210 Chapman, Anthony 97, 193 Charney, Ioseph 163 Cheerleaders: Basketball 219 1.V. 220, 221 Varsity 218, 219, 272 Wrestling 221 Chester, Mark 97 Chestnut, Ierry 79 Child Care 110 Childers, Robert 56, 135, 258 Chirco, Amy 116 Chorus 60, 61 Christianson, Carl 116 Christiansen, Eric 97 Christy, Iennifer 97 Cira, Debora 117 Clark, Cynthia 63, 114, 117, 215, 222 Clark, Felicia 97 Clark, Ioe 193 Clark, Lisa 72, 136 Clevenger, Michael 97 Cliff's Car Care 268 Clifford, William 117, 188, 193 Clifton, Dr. Berwin 273 Clore, Ioseph 97 Clouse, Kimberly 15, 30, 63, 69, 114, 117, 234 Clouse, Pamela 15, 24, 47, 154, 163, 194, 281 Clouse, Susan 15, 30, 63, 69, 114, 117, 234 Cobb, Darrell 117, 188, 193 Cobb, Dayna 50, 56, 59, 151, 163 Coblentz, Timothy 97 Cochran, Terri 47, 48, 49, 54, 62, 163 Cody, Terrence 163 Coe, Mark 117 Coffin, Elizabeth 56, 114,117, 129, 204, 206 Cohen, Ierry 117, 202 Cole, Shelly 163 Cole, Terri 117 Cole, Tina 136 Cole, Tommie 55,163 Cole, Toni 117 Coleman, Bernicine 146,185 Collins, Ianet 46, 56, 63, 154, 156, 157, 163 Collins, Kenneth 62, 136 Collins, Kelvin 117 Collins, William 17, 154,163 Color-Tyme TV Rental 239 Conley, Brenda 97 Conley, Steve 79, 129, 199 Connors, Carl 97 Connors, Larry 117 Connors, Shirley 60 41- Gala Greetings Amid Colorful balloons have always been a festive addition to a party parade or circus Now they are even used rn large quantities to send special greetings to a friend, busmess associate or loved one In Lee County a small business located along side the Caloosahatchee Bridge turnoff is responsible for this epidemic of balloon greetings Balloons Over Ft Myers They will dehver 12 large colorful balloons anywhere in Southwest Florida with a personallzed greeting from the sender One day during her thxrd period class Ianet Bazzle was the proud recipient of a large bundle of balloons Suddenly at North High we had Balloons Over Reading for Pleasure D.C.T. 73 DECA 72 D8zM Shed Distributors 273 Dahlberg, Iames 118 Dahlberg, Steven 136, 188, 210 Dantley, Travis 98 Davidson, Kenneth 98, 182, 215 Davis Davis Davis Davis Davis Dean, Dean, Carla 98 Cynthia 118, 213 Davis, Davis, , Darrell 56, 98 Davis, , Iames 80, 193 , Laura 27, 56, 59, 63, 137 Davis, ,Traci 63, 118 , Tyrone 98 Debra 137 Paul118, 199 Phaladya 46 Shad 98, 168 Deaver, Ioyce 68, 98 Defaira, Iames 55, 98 Deitz Draperies 238 Deitz, Lori 62, 118 Delaine, Iames 118, 193, 199 Delong, Eric 98 Delyser, Ellen 98 Demoss, Iames 98 Dennis, Ieffrey 118 Deno, Timothy 118 DeRosia, Michael 137 Desfosses, Michael 137 DeShazo, Nancy 80, 149 DeShazo, Steve 77, 127, 216 Designers Four 245 Devito, Toni 56, 59, 119 . l A. . 9 V 1 1, ,Q,r,i:i,'. I . . . . . 7 ! ' . . . . , . . , . . U I 7 1 . . . , . . . . . . . . . . . . i . . ' K6 ' D . Conrad, Ieffrey 97 Conway, Debra 97 Cook, Tom 97, 188 Cook, Willie 117 Cooke, Dana 65, 68,114, 117, 127, 131, 185, 194 Cooke, David 65, 97, 101, 188 Cooke, Ina 18, 30, 65, 116, 186 Cooley, Ianice 164 Cooley, Nick 15, 49, 62, 133, 135, 265 Cooley, Vicki 54, 97, 265 Cooper, Iames 4, 110, 164, 188 Cooper, Iulie 97, 110 Cooper, Peggy 79, 110 Corbett, Margaret 97 Corbin, Ioel 54, 68, 118, 131 Corbitt, Elizabeth 53, 66, 136 Core, Michelle 98 Corkhill, Iohn 68, 164 Cornele, Michael 136 Cornelison, Tanya 136 Cornett, Scott 164, 188, 215 Crgsgy, Diana 73, 184, 185, 194 Cosby, Iohn 8, 164 Cottrill, larlis 56, 118, 183, 215 Cfgtrill, Scott 56, 60, 136, 145, 15 Couch, ACee 118, 129, 188, 199 Counts, Sherrie 98 Cox, Manuel 50, 55, 118 Cox, Mitzi 118 Cox, Tyler 164 Crager, Kelleen 72, 164 Crager, Richard 98, 111 Crain, Tracy 69, 118 Crawford, Iohn 50, 69, 118 Crawford, Rebecca 71, 164, 179 Creative Rattan 266 Crews, Lisa 53, 136 Crocker, Catherine 136 Crocker, Iulie 56, 69, 118 Crosby, Brenda 133, 136, 185 Cross Country 182, 183 Cross, Ioseph 51,136, 210 Crouch Oil Company 236 Crummell, Zetha 118 Cuevas, Mapi 79 Culleton, Liz 53, 79 Culver, Kimberly 98, 213 Cummings, Iohn 118, 188, 191 Cunningham, Dana 136 Cunningham, Ieri 46, 51, 63, 68, 133, 136, 143, 254 Curls, james 55 Curry, Danielle 68, 164 Curry, Robert 79, 188 Curry, Shairon 98 Cushing, Russell 211 Cusic, Deborah 98 Cusic, Kerrie 136 dDd Dewey, Bobbie 41, 52, 80 Dewey, LeRoy 41, 80 Dials, Darlene 63, 114, 119 Dials, Ieanette 63, 98 Dickerson, Carolyn 52, 56, 59, 259 Dickerson, Valerie 146 Dickey, Gary 119, 211 Diggs, Patrick 73, 137 Digiacomo, Alex 164 Digiacomo, Denise 119 Dill, Lori 119, 130, 186, 196, 197, 213 Dill, Yvonne 164 Dillon, Ieffrey 72 Dillon, Robert 119 Diving 206-207 Dixon, Cynthia 53, 60, 119 Dixon, Iackquline 5, 164, 188 Dockstader, Dee 98 Dodd, Stephanie 56, 58, 69, 114, 119, 129, 233 Dodson, Richard 55,98 Doerre, Carla 215 Dominiak, Melissa 137 Doss, Millard 80 Douglas, Calvin 99 Douglas, Lori 63, 164 Downing, Regina 132 Drake, Frank 202 Drama 62, 237 Drawdy, Iohn 137 Drawdy, Tammy 137 Drew, Linda 164, 177 Drew, Paul 137, 210 Driggers, April 119 Driskell, Eva 164 Driskell, Franklin 119, 211 DuBrule, Tamara 68, 137 DuBrule, Teri 54, 60, 164, 261 Dudley, Carla 64, 99 Dugan, Ieannine 69,119 Dukes, Michael 119, 182 Duncan Flowers 230 Duncan, lack 292 Dunn, Laura 62, 119 Dunson, ldella 164 Dziewik, loseph 56, 164 eEe Earle, Enid 5 Eash, Rick 68 East, Rick 137, 146 East, Susie 80 Eastman, Brian 9 Ebb Tide Waterbeds 261 Ebert, Clifford 55,119 Eblin, Angelica 164 Edge, Keith 55, 99 Edge, Scarlett 48, 165 Edison Mall Merchants 265 Edgign Prescription Shoppe Edwards, Catherine 68, 119 Edwards, Michael 119 Edlund, Douglas 35 Eichner, Iohn 63, 165 Eli Witt CO. 263 Ellis, Darryl 154, 155, 157,165 Ellis, Matthew 119 Ellsworth, George 165 Ellsworth Heat. 8: Cooling 254 Enfinger, Robin 72, 137 Engelhart, Paul 137 England, Robert 72, 80 English, Serdarryl137, 165 Ennis, Lawrence 50, 55, 69, 119 Ennis, Michael 50, 55, 65, 119 Ervin, Beverly 120 Ervin, Sharon 60, 99 Erwin, Gina 137 Erwin, Shelia 99, 196 Erwin, Valerie 56, 137 Esquivel, Cynthia 64, 67, 99 Evans, Dorothy 80 Everett, Alonzo 165 Excalibur 67 Exchange Bank 271 fFf F.C.A. 222 F.F.A. 32, 33, 68,262 F.H.A. 70 Facella, Donna 99 Fahrner, Roger 138 Fame Mane 261 Fan Fare Shoes 229 Fargnoli, Kelly 133, 138 Fargnoli, Patricia 99 Farrell, Iames 80, 89 Fat Boy's BBQ 252 Ferrara, Lisa 165 Ferreira, Ted 81, 188, 208, 210 Ferrell, Robin 49, 54, 62, 157, 165 Ferris, Iames 120 Field, Henry 138 Filkill, Christine 71, 165 Finch, Kimberly 70 Fine, Annete 120 Finley, Lisa 46, 49, 54, 56, 63, 78, 154, 155, 179 First Federal Savings 8: Loan 273 First National Bank 270 Fischer, Charleen 81, 88 Flag Corps 56,59 Flagship Bank 247 Flaherty, Margaret 41, 81 Fleming, Laura 66, 120 Flener, Brenda 99 Flinn, joseph 116,119, 120, 211 Flint, Lana 32, 68, 99 Florence, Victor 193 Florida Rock Industries Inc. 273 Flossie's Inc. 229 Flowers by lean 245 Floyd, William 138 Fluker, Wilma 138 Flynn, Mark 99 Football 188-193 Forehand, Richard 165 Forensics 48 Foriest, Iames 99 Forster, Bruce 81 Fort Myers Beauty College 244 Fort Myers Iewelers 231 Fortini, Kathy 165 Fortini, Ioseph 48, 49, 53, 62, 67, 69, 114, 120, 130 Foskey, Kenneth 99 Fowler, Linda 27, 81 Fowler, Neil 138, 204 Frank Hoffman Assoc. 263 Frank, Richard 46, 63, 165, 182 Frank, Robert 120, 182 Frank, Stephan 81, 99, 199, 215 Franzese Plumbing Inc. 273 Frazier, Kristy 28, 30, 31, 154, 155, 158,165, 179,218,219 Frazzini, Elizabeth 99 Freeman, Sylvia 27, 51, 138 French Club 64 French, Dawn 27, 133, 137, 138 French, Iohn 50, 56, 99, 215 Freshman Exec. Council 95 Frey, Barry 50, 120 Frey, Yvonne 56, 99 Fricke, Charlene 120 Fuentes, Iohn 99 Fussell, William 65 Fussnecker, Scott 68 Futral, Linda 81 sGs Gadson, Richard 138 Gage, Lorie 138, 281 Cainer, Angela 99 Gallagher, Denise 99 Gannon, An-ette 138 Garces, Rueben 16, 56, 165, 178 Garcia, Sandra 99 Gardner, Amy 120 Garner, Ed 12, 46, 48, 54, 59, 120, 154, 165, 170 Garner, Iames 73, 138 Garner, Raymond 48, 63, 69, 114, 115, 281 Garrett, Alicia 95, 100, 196, 213 Garrett, Nora 165 Garrett, Troy 120 Garringer, Shelli 139 Garrison, Norma 81 Closing X 275 Hills, lohn 55,121 Gartner, Christine 11, 56, 58, 154, 155, 157, 165, 233 Garrow, Christopher 114, 120 Gary, Debra 72 Gatsby's 227 Gaudelli, Beverly 81, 95 Gay, lames 68,139 Gebhard, Fred 82, 154, 155 Gilglgard, Shirley 41, 82, 154, Genesky, lennifer 64, 95, 100 George Schupka Studio 273 George Smith Exterminator 268 Geraci Travel Agency 233 Gerald, Cherie 165 German Club 65, 268 Getzlaff, Andrea 41, 82, 110 Gibbons, Angela 120 Gibbons, lohn 73 Gibson, Douglas 55, 100 Gibson, Pamela 100 Giddens, lohn 55, 139 Giffin, Toni 95, 100 Gilbert, Anthony 120 Gilbert, Charles 55, 73, 120 Gilbert, Susan 100 Giles, lames 52,199, 210 Gill, Nanette 70, 165 Gilmore, Antonette 166 Gilyard, Richard 166 Gilyard, Roderick 100 Giompalo, David 54, B2 Giovannelli, Craig 68, 139 Gist, Melissa 120 Gittleman, Benjamin 139 Gittleman, Trudy 166 Giunta, leff 100, 112 Glendinning, Candace 139 Glenn, Tomas 100 Goff, Melody 139 Goglin, lodi 139 Goldburg, Rubinstein 81 Buckley 232 Golden, Desiree 71 Golden, Shavon 120 Goldwien, David 100 Goodwin, lon 73 Goodwin, Rachel 139 Gordon, Douglas 73 Gordon, Scott 100 Gottfried, George 139, 166, 284, 206 Grabowske, Edmund 55, 139 Graves, Dennis 100 Green, Carmen 100 Green, Gennie 139 Green, Charlotte 120 Green, Nora 139 Greenpeace 69 Green, Susan 114,121 Green, Tami 85 Green, Willie 140 Greene, Thomas 100 Greenlaw, Irvin 106, 177 Greenwell, Mike 166, 177, 208, 210, 276 Greenwood, Gloria 101 Greer, Dawn 101 Greer, Tracy 121 Grice, Thomas 166 Griffin, lessie 140 Griffin, Toni 56 Griffith, Beverly 121 Grime, Reggy 82 Grise, Randy 121 Gulf Coast Dodge 268 Gully, Curtis 101, 182, 215 Gurham, Shawn 114, 121 Gurley, Sandra 73 Gurham, Beth 51, 95, 99, 101, 222 Gutierree, Norma 101 hHh Haddaway, Robin 140 Hadsock, Sharon 56, 69, 114, 121, 242 Haggard, Monica 62, 63, 114 121 Haggard, Ronald 166 Hagie, Pamela 46, 69, 140 Hair Affair 241 Hair Shoppe 229 Hale, Sarah 101 Haley, Patricia 63, 133, 140, 185 Half Moon Liquors 263 Hall, lames 101 Hall, DOIIIIB 8, 166, 178, 185 Hall, Scottie 101 Haller, Rebecca 121 Hames, Beverly 121 Hammesfahr, Robert 68, 121 Hammond, Patricia 101 Hand, David 55, 121 Hanley, Pamela 55, 138, 141 Hansen Manufacturing 240 Hanson, Teresa 68, 121 Hardy, Thomas 55, 65, 121 Harmon, Kallyn 56, 95,101 Graettinger, Russell 55, 139, 204 Graff, Doreen 71, 166 Graham, Lury 139 Graham, Richard 199 A Touch of Class All teenagers dream of owning a sharp-looking, fast car. Senior Mike Greenwell has made that dream come true. Mike's car has won many trophies. After taking a second place last year, Mike reentered his newly painted Mustang in the Ft. Myers World of Wheels this year, and walked away with the first place award. In the Tampa and Miami shows Mike did equally well. In Tampa, an additional Best Interior Overall was an exciting triumph. One thing about Mike is he doesn't leave his car parked at home. Each day it is his transportation to and from school and baseball practice. He spends spare time clean- ing, improving, and working on the engine, interior, and exterior. Hard work, talent, and cleverness have made another Red Knight 411 . . . in a very special way. 276 X Closing Harmon, Nicole 56, 58, 166, 233 Harper, Lori 101 Harper, Phillip 166 Harper, Tina 101 Harrell, Bobby 68, 101 Harrell, Vickie 166 Harris, Brouth 11, 166 Harris, Paul 55, 101 Harris, Ramona 141, 183, 215 Harris, Sharoyn 56, 196, 215 Harris, Sheila 101, 194 Harris, Tinita 101 Hart, Marlene 56, 101 Hart's Milk 253 Hartnett, Christopher 51, 140, 188 Hartwig, Scott 121 Harwood, Debra 140 Hassenzahl, Sandra 56, 69, 114, 121 Hauger, Casey 48, 63, 140 Hay, Timothy 48, 49, sz, 166 Haynes, lames 101 Hayworth, leffrey 46, 56, 57, 58, 166, 242 Hayworth, Lori 56, 101, 196, 197, 204 Heally, Patrick 166 Heggemeier, Bryan 166 Heinkel, Dale 121, 188, 193 Heinkel, Dianna 56, 95, 101 Helms, Patricia 121 Helms, Vickie 68, 101 Hemed, Hezy 64, 140 Hemed, lacob 101,202 Henderson, Kimberly 71, 167 Henry, Dandria 52, 76, 133, 138,140,Z15, 218 Henry, Zona 52, 138, 167, 218 Hepp, Dawn 64, 70, 140 Hepp, lames 68, 101 Hernandez, Annette 55, 133, 140 Hernandez, lose 101 Hernandez, Lisa 101 Herrell, lune 23, 82, 146 Hess, Robin 56, 167 Hickman, Brenda 121 Hill, Ablert167 Hill, Parrish 48, 155, 167 Hills, Deborah 47, 66, 71, 167, 185 Hines Realty 273 Hinkle, Lynn 82, 146 Hirshals, Erik 121 Hissam, Linda 82, 105 Hitzing, Lynette 82 Hoagland Realty 263 Hochstetler, Beth 140 Holland, lames 68, 101, 188, 215 Holley, Harold 122 Holloway, Charles 122 Holmes, Michael 101 Holt, Sandra 69, 122 ' Hopper, Franklin 122 Hoover, Ron 82, 188, 216 Horn, Brenda 140,221 Hornberger, Richard 65, 102 Horne, Susie 55, 102 Horne, Wayne 122 Horner, Katherine 102 Horstman, Nancy 122 Horton, Brigette 102 Hottensen, Tamara 72, 114 Houser, Ben 141, 204 Howard, Andrew 122 Howard, Carla 52, 70, 133 Howard, Donna 123, 167 Howard, Tryee 102 Howze, Karen 66, 102 Hribar, Mary 141 Hribar, Tina 167 Hudson, Steven 122 Huffmaster, Velvet 65, 141 Hughes, Charles 62, 122 Hughes, Cheryl 122 Hughes, Kimberly 71, 167, 218 Hughes, Mende 68, 102 Hughes, Wednesday 62, 68, 122 Hughett, Miranda 122 Hummel, Wade 82, 188, 215, 216 Hunt, Tammy 102 Hunter, Laontip 52, 167 Hunter, Songsak 56, 69, 122 Hupp, Kathleen 65, 122 Hurley, Dora 122 Hutchins, Kimberley 55 Hutchinson, Pauline 82 111 Idlette, Melvin 122 Iles, Milton 167 Interact 51 Interval Ownership 36, 37 Irazarry, Agnes 122 Isaac, Sylvester 82, 196 Iverson, Tracy 70, 167 Ivy, Reggie 102 ili lackson, Carolyn 102 lackson, Darrell 52, 141 lackson, Dawn 64,122 lackson, Polly 167 lackson, Felicia 102 lackson, Gloria 167 lackson, loseph 122 lackson, Ed 198, 199, 290 lackson, Subrina 122 lackson, Wesley 102 lacobson, Linda 47 lager, Charles 82, 110 lager, Heidi 80, 110 lager, Suzanne 48, 82,110 lames, Laura 167 laquiss, Manley, 46, 47, 54, 154, 156,167, 235, 281 larvis, Pauline 82 laschob, leannine 122 leffcoat, loni54,133, 134,14 leleniewski, Edward 66, 167 leleniewski, lohn 102 lencks, Regina 122 lenkins, Alphonzo 122, 199 lenkins, Franklin 52,167,25. lenkins, Mark 102, 105,107 lenkins, Richard 141,182 lenson, Wayne 82,211 lerry's Men and Boys' Wear 250 l6I'Z, David 141, 210, 281 lerz, Keith 122 leter, Mark 18, 55, 167 lewett, Carletha 70, 167 liles, Cynthia 53, 60, 168 liles, Stephanie 102 lim's Mobil Service 232 locke, Connie 24, 294 lohn, Amanda 68, 102 lohns, Andrew 15, 64, 122 lohnson, Audrey 122 lohnson, Brett 55, 65,141,143 146 lohnson, Danny 123 lohnson, Edward 123 lohnson, Frances 168 lohnson, lerry 102 lohnson, lessie 168 lohnson, lodi 83, 102 lohnson, Kenneth 123 lohnson, Karen 102 lohnson, Kerry 102 lohnson, Laura 141 lohnston, Leah 114,123 lohnson, Leon 193 lohnson, Loretta 168 lohnson, Manuel 55 lohnson, Merlinda 123 L johnson, Michelle 60, 123 johnson, Raymond 123 johnson, Thomas 103 johnson, Yolanda 34, 141 johnston, Albert 19, 168 jones, Allyson, 63, 114, 123 jones, Anna 103 jones, Bobbi 141 jones, Delretta 103 jones, Greg 215 jones, Lisa 56, 114, 123 jones, Paula 55,60,61,133, 141 jordan, Tracy 102, 103,204 joslin, Melanie 114, 123 joyner, Kimberly 168 joyner, Lisa 123 j-recks 253 juba, Stephanie 48, 49, 62, 168, 281 juliano, Amy 56, 95, 100, 103 junior Exec. Council 134 kKk Kadar, jeff 203, 215 Kanell, john 50, 55, 56, 63, 69, 114, 123, 257 Kapcin, Marie 67, 103, 222 Kappel, Theresa 103 Karcher, Christine 103 Karn, Mary 68, 114, 123 Kaufman, Mark 103 Kayusa, Betty 69, 82 Kayusa, Michael 82 Kayusa, Robert 82 Keister, jackie 103 Kelleher, Wendy 27, 63, 168 Kelley, Charles 73 Kelley, Donna 65, 103 Kelley, Paul 50, 168 Kelly, Angela 123 Kelly, Charles 127, 142 Kelly, Kimberly 52, 168 Kelly, Kevin 68, 103 Kelly, Michael 103 Kelly, Sonja 68, 103 Kenyon, Tina 142 Kerik, Craig 103 Key Club 40, 50, 257 Kibler, Karen 123 Kibler, Kimberly 52, 54, 71, 133,134,135,142,143,145, 221 Kimpland, Wayles 82, 148, 149 Kinchen, Margie 123 Kinder, Edward 142 Kinder, Mark 168 King, Hector 103 King, Karan 123 King, Lisa 123 Kirby, Deborah 65, 133, 142 Kirby, Gregory 123 Kirby, Kimberly 46, 154, 168 Kirby, Todd 56, 103 Kingsbury, Mark 55 Kittle, Michele 30 Klapper, Edward 73, 142 Kleitz, jack 76 Kline, Susan 103 Kniestedt, jennifer 117, 123 Knight, john 193 Knight Life 66, 273 Knighter, Albert 103 Koehler, Brad 168 Kohn, Pamela 103 Kosarich, Christopher 104 Koshko, Kathleen 142 Kozlowski, Ramona 124 Kubesh, Catherine 46, 53, 63, 133,134,135,142,143,145 218,219,254 Kuhs, Katherine 63, 103, 104 Kurz, William 68, 168 lLl LaFiantz, Simonne 95, 104 Lamm, joyce 82 Lampert, Donna 104 Lance Staff 280, 281 Land, Tony 73,142 Landress, Teresa 68, 168 Lanier, Robert 168 Lannon, janet 168 Lannen, Robert 55, 142 Lannen, judy 168 Lannon, john 142 LaPosta, Shauna 104, 196 Larson, Linda 68, 83, 168 Larson's Chevron 258 Lawrence, Lori 60, 142 Lawrence, Robert 73, 142 Lawrence, Tammy 60, 154, 169 Lawton, Kimberly 104 Lawton, Lisa 124 Leach, jim 216 Leaphart, Gerald 104, 193 Ledford, Ethan 56, 114, 124 Lee County Bank 270 Lee County Optical 229 Lee County Transit 240 Lee, Dallas 124 Lee, james 46, 143 Lee, janet 143 Lee, Shannon 46, 104 Leite, Philip 55, 169 Lemieux, David 104 Lemieux, Robert 169 Lennon, Robert 142 Lentz, Tammy 56, 63, 114, 124 Leone's Provisions Co. 244 Lindenmuth, Charles 124 Lesh, janine 143 Lesh, Lisa 169 Lesh, Stephen 104 Lester, Terry 104 Lewsader, Richy 169 Lias, Sharon 104 Liberty, julia 143 Lindhout, Carol 60, 104 Lingle, Shawn 46, 47, 52, 56, 66,78,156,169,213 Linnon, Delores 104 Lister, Kyna 56, 104, 196 Lister, Troy 56, 169 Lochmoor Country Club 243 Loggins, Harry 124 Lohness, Theresa 143 Long, Lisa 124 Long, Richard 104 Longbrake, Steven 124 Longfellow, janice 82 Lopez, Albert 143, 204 Lopez, Eddie 188, 193 Loraine Building Systems 239 Loughren, Daniel 55, 104 Lovett, Claudia 133, 143 Lovett, Dawn 70, 169, 213, 241 Luders, Michael 143 LUd8FS,SCOfi16,49,60,62 Ludt, james 124 Ludwig, Staci 68, 95, 104 Lukitsch, Loren 114 Luna, Manuel 143 Lust, Tanya 56, 59, 143 Luster, Patricia 104,222 Lytle, Diane 124,186, 187, 194 mMm M8rM Auto 259 Macdonald, Coury 53, 64,124, 281 MacDonald, Michael 143, 281 Macdonald, Todd 169 MacDougall, Brian 104 Mach, George 105 Maclntyre, Tammy 169 Maffei, Debra 169, 294 Maitland, Steven 66, 169 Maitland, Thomas 124 Major, Clarence 169 Major, Eugene 124, 188 Major, Theresa 124 Majorettes 58 Makar, Brain 51, 143, 191, 202, 203,218 Makar, Doreen 67, 169, 184, 185 Maker, Robyn 56, 105, 112, 222 Mallow, Danny 169, 188, 218 Malone, joyce 56, 69, 114, 124 Malone, Timothy 56, 105 Maloy, Michael 124 Mann, Michael 105 Mann, Tracy 32, 68, 143 Mansfield, Dayna 143 Manson, Alice 143 Manuel, Michelle 215 Manuel, Mike 73, 143 Marcel, Denise 124 Marengo, Frederick 105 Marinell, Amanda 105 Marinell, Gregory 68, 73, 126, 169 Marinell, Loretta 105, 213 Market Street 289 Markovits, David 124, 211, 215 Markovits, Michele 47, 48, 49, 56,62,63,67,156,169 Marks, Susan 51, 56, 58, 143, 233 Marquiss, Charles 105 Marsh, Laura 105 Martin, Cheryl 64, 70, 124 Martin, Dennis 56, 105 Martin, Garry 72, 169 Martin, Kent 105 Martin, Rufus 169 Martin, Steve 50, 65, 69, 114, 115,125,257 Martin, Stuart 55, 105 Martin, Tommy 105 Martindale, Michele 169 Marvin Homes 255 Mary Grant's Hair Styling 231 Mason, Rhonda 69, 125 Massoth, Brenda 71, 170 Massoth, Mary 19, 63, 71, 133, 143 Matheny, Willie 125 Mathewson, Dale 55, 125 Matson, Dawn 68, 105 Matson, joanne 82, 133 Mattox, Tammy 105 Maxey, jennifer 56, 58, 170, 214,215,233,254 Maxey, Tara 5, 46, 49, 54, 55, 59,76,154,160,170,178 204,215,259 Maxwell, Donald 73 May, Andrew 56,105 Maynard, Homer 55,105 Mayo, George 41, 82 McAbee, Lisa 70,125 McCaffery, Eleanor 105 McCarthy, Daniel 170 McCarthy, Michael 125 McCartney, Eugene 125 McCartney, Sheryl 144 McClanahan,Sunee105 McClure, Charles 55, 105 McClure, Shawn 144 McClurg, Amy 170 McCollum, Malcolm 125, 188 McComb, Rick 72 McConnell, Kelly 133,144 McConville, june 82 McCook, Kimbra 56, 62, 63, 154,170,294 McCrea, Andrea 61 McCready, Sandra 82, 204, 206 McDaniel, Donna 144 McDaniel, Sonya 82,90 McDaniel, William 144 McDermott, Gerald 125 McDermott, Susan 65, 170 McDill, Lynne 82, 222 McDonalds 19, 218, 246 McDonald, Paul 55,125 McFarland, Lisa 144 McGill, Timothy 170 McGriff, Komona 70, 133,144 McHugh, Maureen 71, 170 McIntosh, Gary 170, 188 McIntosh, Shannon 125, 213 McKibbins, Wayne 68, 106 McLain, Todd 106 McLaughlin, Dwayne 193 McLeod, Anita 56, 64, 69, 114, 125 McMann, john 68, 144 McMullen, Paul 125 McNally, Crystal 125 McQuinn, Fred 65,67,106a McSheehy Office Equip. 240 Means, Lucinda 170, 178 Mease, Michelle 66, 125 Mellema, Anthony 55, 125 Mellema, Robert 170 Melock, Robert 125 Melvin, Gary 55, 106 Mendez, Diana 82 Mendez, Nancy 144 Mendez, Peggy 125 Merritt, Ronald 46, 50, 55, 144, 259 Merritt, Sonya 48, 62, 170 Messmer Florist 263 Meyer, Milton 84 Meyers, Christopher 55, 78, 170 Meyers, Sean 55, 144 Mikels, Heather 170 Mikkelson, Todd 67, 106 Miller, Glen 106 Miller, Kenneth 114, 125, 129, 210 Miller, Sheryl 62, 68, 125, 196, 213 Miller, Tamara 106 Milliron, David 106 Milner, Frank 73, 84 Mims, Pleshette 106 Minatree, Serlene 106 Minick, Tamara 62,144,204, 206 Minnick, Rodney 144 Minnick, Scott 106 Mr. D's Body Shop 258 Mitchell, Vincent 144, 146 Mitchitell, Melody 23, 84,215 Mitzel, Sarah 126 Modern Metal Buildings Corp. 269 Moffler, Nancy 85,170 Moffler, Patricia 170 Moll, jennifer 106 Moll, Steven 144 Mona's Mark H 236 Monroe, Billie 73 Montefinese, Thomas 54, 55, 170,178,235,281 Moody, james 144 Moody, Kim 64, 68, 114, 115, 126,215,256 Moody, Todd 106 Moon, Stacey 170 Mooney, Levi 8, 170, 188, 202, 203,214,215 Moore, Colleen 126 Moore, Fred 126, 193 Moore, Elmarie 84 Moore, William 126 Morales, Richard 27, 54, 63, 154,159,171,179,198,199 222,235,281 Morales, Rufina 145 Moreaux, Wendy 126 Morgan, Denise 46, 56, 58, 64, 157,171,233 Morgan, Ronald 106, 193 Moriconi, Stuart 145, 188, 209, 210 Morris, Andrea 171 Morris, Gregory 55, 106 Morris, Nancy 126 Morrisey, Leslie 106 Morrison, Angela 56, 106, 222 Morrison, Dawn 106 Morrison, Lisa 106 Morrow Insurance Agency 271 Moser, Gary 171 Moser Tire Store 273 Motel Chicago 236 Moten, Faye 171, 215, 294 Mueller, Barbara 47, 56, 59, 145,204,281 Mulford, Stan 38, 50,84 Munter's 269 Muri, Richard 65, 145, 182, 215 Muri, Steven 51, 55, 65, 145, 182,215 Murphy, jacqueline 63, 126 Murphy, Paul 145 Murray, Rachel 41, 84, 154 Myrick, Tony 55, 126, 129, 141 188 nNn N.H.S. 46 Nahalewski, Margie 171, 194, 227,281 Nash, Robert 56, 107, 211 Neel, Mary 107 Neidlinger, Cassandra 171 Nein, Robert 61, 126, 188, 215 Nein, Susan 61,126 Nelson, james 107 Nelson, Stephanie 145 NeSmith, Brian 68,126 NeSmith, Eric 107,126 Nesta, Glenn 133, 145, 210, 281 Newman Motor Repair 238 Newman, Wanda 47,154,171 238,281 Nicks, jennifer 55,64,67,114, 126,215,281 Closing X 277 Niver, Pruella 84 Noble, Robert 68, 171 Nolan, Denise 64, 107 Noland, Iames 56, 126 Normandin, Caroline 64, 95, 107, 264 Normadin, Peter 126 N.F.M. Memorial Chapel 248, 273 N. Ft. Myers Realty lnc. 236 North Shore Animal Hospital 273 Northside Baptist Mission 239 Northside Variety 234 Norton, Forrest 107, 193 Norton, Ieffrey 126, 193 Nottingham, Valerie 64, 67, 95, 107 Novatney, Laura 171 Novatney, Raymond 126 Null, Eric 138 Nyberg, Russell 126 oOo Oakes, Pamela 56, 145 O'Grady, Emilia 84 Oliver, Todd 72, 126 Olmstead, Harold 73, 171 Olson, Michele 56, 95, 107 Onson, Robert 211 - Orchestra 61 Oropallo, Deborah 171 Oropallo, Robin 27, 126 Orstrom, Aleen 65, 127 Osborne, Terri 54, 65, 69, 133, 135, 145, 281 Owens, Diana 145 Ower, Robbie 72, 171 Ower, Scott 56, 127 PPP Pacl, Becky 84, 90 Pacl, Thomas 38, 71, 85, 90 Palmer, Carla 107 Panio, Iohn 48, 63, 139, 171, 229 Panrell, Susan 69, 119, 127 Parish, Laurie 47, 171 Park, Catherine 127 Parker, Marion 127 Parker, Paul 107 Parker, Tami 66, 67 Parker, Tim 146 Parr, Marshall 145 Parrish, Elizabeth 13, 63, 145 Parson, Queen 171 Parson, Richard 145 Parze, George 50, 56, 69, 127, 145 Pass, Sandy 127 Pasterik, Lorilyn 49, 56, 59, 62, 100, 107,111,259 Pate, Larre 171 Pate, Iohnny 85, 110, 194 Pate, Stephen 50, 55, 107, 111 Paz, Maria 127 Peabody's Restaurant 230 Peacock, Tracey 127 Pearce, Iames 107, 207 Pearce, Wayne 55,68 Pearce, William 56 Peckham, Robert 13, 65, 171 Peckham, Suzanne 65, 127 Peisch, Brian 107 Pelton, Randall 145 Pennington, Paul 145 278 f Closing Pepkowski, Lynn 46, 63, 158, 171 Pepsi 253 Pepsi Run 216, 217 Perkins, Mildred 85 Perkins, Reginald 193 Perry, Phillip 55, 69, 114, 127 Peter, Monica 127 Petersdorff, Paul 73, 171 Petrey, Betsy 107 Petry, Carol 68, 107 Petty, Cindy 70, 145 Pfeiffer, Douglas 172 Pfeiffer, Douglas 172 Pierce, Anthony 107 Pierce, William 107 Pike, Gregory 56, 146 Pim, Carol 41, 46, 85,90 Pine Island Lumber 251 Plunkett, Don 85, 188, 192 Poel, Iennifer 107 Pohle, Robert 32, 68, 172 Poirier, Paul 146 Poling, David 127 Ponte, Toni 56, 59, 127 Pool Connection 250 Porter, Tami 145 Pottorf, Ray 5 Powell, Arlisa 107 Precision Refection 254 Presnell, Christopher 65, 146 Preuss, Iohn 48, 146 Previty, Iulie 85 Price, Vivian 107 Prickett, Carol 63, 127, 235 Prickett, Iohn 48, 49, 50, 62, 63, 133, 146 Prince, Ieffrey 146, 210 Pritchard, Matthew 108 Pritchard, Roger 85, 107, 188, 202, 215 Proffitt, Connie 110 Publix 247 Pugh, Edgar 146, 188 Pulsifer 108 Putmon, Karen 56, 59, 72, 143, 146, 215 Putman, Shezell 60 Putnal, Harry 127, 202 QQQ Quarterback Club 267 Quetel, Marie 55, 108 Quill and Scroll 47 rRr R.O.T.C. 55 Raby, Fredrick 108 Radomski, Pat 85 Ragland, Anne 85 Ramage, Sherry 108 Ramsey, Benny 108 Rasbeck, Susan 127 Ratliff, Richard 56, 127, 182, 211, 258 Ratliff, Robert 273 Ratliff, Walter 134, 146, 182, 281 Rattan Fantasy 261 Raulerson, Deborah 62, 70, 146 Ray, Iocelyn 146 Reed, Robin 70, 146 Regency Car Wash 258 Reid, ROSe 56, 59, 72, 133, 138, 145 V Reid, Tangela 108 Reigle, Iodi 56, 59, 133, 147 Reist, Tami 70, 108 Reist, Toni 70, 172 Renfroe, Ronald 147 Rensch, Suzette 70, 147 Repp, Iames 87, 102, 204 Rewis, Kimberly 133, 147 Rex, Kellie 80, 127 Rhodes, Lee 108 Rhodes, Teresa 49, 62, 172 Rice, Christopher 172 Rice, Kristin 127 Rice, Tanya 172 Richardson, Gary 55, 68, 125 Richardson, Martha 47, 67, 87 Richards, Kimberly 133, 147, 218 Richmond, Kane 103, 108, 193, 202 Richmond, Keith 172, 241 Riggins, Ira 172, 179 Ripple, Debra 63, 147 Rise, David 125 Ritter, Pamela 147 Ritter, Patrick 108 Robby's Sporting Goods 265 Robin Dawn Dance 265 Robinson, Ann 172 Robinson, Beverly 65, 108 Robinson, Debra 147 Roberts, Cathy 172, 215 Roberts, Chris 108, 222 Roberts, Deborah 71, 147, 221 Roberts, Dorothy 68, 125 Roberts, Ralph 55, 125 Roberts, Rhonda 108 Roberts, Suzanne 125 Robertson, Debbie 147 Rock, Robert 172 Rodgers, Iohn 147 Roe, Michael 68, 108 Rogers, Louise 87 Rogers, Robert 73 Romans, Pat 227 Roof, Melissa 63, 103, 108 Roof, Teresa 63, 147, 183, 215, 222 Rosario, Beatrice 49, 62, 172 Rosario, David 73, 147 Rose, Cheri 125 Rose, Iames 125 Ross, Carey 55, 108 Ross, George 108 Ross, Iada 125 Ross, Melissa 108 Ross, Randy 73, 125,133 Rowan, Iames 68, 108 Rowland, Bryant 125 Rowland, Raymond 73, 172 Rubinstein, Francine 48, 49, 62, 63, 69, 125 Rudd, Renee 289 Rudd, Sherry 72 Rudnik, Kimberly 68, 109 Rumph, Ricky 193 Ruth, Walter 172 Rutherford, Kim 63, 125 Rutherford, Tony 172, 210 Ryals, Amanda 148 Ryals, Dave 72, 172 SSS S.A,C. 52 S.G.A. 54 Sain, Tina 172 Salomone, Dawn 125,221 Salvatore, Frederick 155, 172 Sammons, Christopher 109 Sands, Theresa 172 Sands, Timothy 125 Santos, Blanca 125 Sapp, Elizabeth 48, 70, 173, 256 Sapp, Kenneth 55,125 Satchel, Frederick 129, 188, 191 Saucier, Iody 129 Saucier, Tammy 48, 54, 63, 133, 135, 148 Saumier, Colette 173 Saunders, Alan 87, 26 Sawyer, Lloyd 55, 73, 148 Sawyer, Tammy 126, 133 Schoneman, Donna 63, 67, 114, 129 Schooner Bay Realty 243 Schooner Realty 271 Schoonover, Linda 109 Schoonover, Marie 60, 148 Schulte, Elaine 148 Schultz, Linwood 46, 50, 158, 173, 257 Scofield, Iames 87, 110 Scott, Appie 87, 110 Scott, lack Brady 68, 109 Scott, Rita 17, 52, 54, 111, 133 134, 135, 148 Scott, Tina 47, 173 Scritchfield, Terri 109 Scudder, Febra 109 Scurry, Angela 53, 55 Seal, Lonnie 173 Selby, Michelle 109 Selvage, Michele 173, 184,185 Senior, Dr. Bruce 263 Senior Executive Council 154 Sepggr Hall of Fame 158, 159, Senior Superlatives 177, 178, 179 Sessions, Russell 129 Seymore, Andrella 109 Sheehan, Clifford 129, 259 Sheets, Laurie 129 Sheffield, Betty 41, 87 Shell Factory 10, 264 Sherod, Evelyn 215 Shop 81 Go 253 Shorten, Donald 129 Shoultz, Donna 109 Shreffler, Robert 73, 148 Sickler, Tina 148 Siegel, Christine 49, 63, 65, 156, 173, 281 Sidney Davis Men's Shop 235 Sign Shop 243 Siltzer, Debra 11, 148, 204, 205 Silvester, Beverly 87 Simons, Kimberly 129, 212, 213 Simons, Troy 30, 66, 109, 193 Simms, Levon 87, 193, 199, 201 Singletary, Alicia 109 Singletary, Margaret 109 Singleton, Michael 109 Skiff, Walter 87 Scurry, Elease 60, 61, 133 Scurry, Iacqueline 61, 173 Skinner, Monica 109 Skinner, Ted 109 9, , f 4, Old Iack Frost Arrlves Did you say ICICIBS? Icicles at North'-' Yes, beheve it or not icxcles appeared on campus this past December When the weather forecast was for damagmg frost Ms Nancy Ward North High Agriculture teacher, knew she had to act quickly to save their plants While the temperatures dropped Ms Ward watered the crops, creatmg a fantastic lcy wonderland as screening This process insulated the plants agamst the cold The water had to be kept runnmg until the air became warm enough to begin to melt the already formed ice What a delight for the southern born Knight who had never seen ice except from a refrigerator It was as if old Kung Winter had taken a small vacation ln Southwest Florida I , . , . P droplets froze on the leaves, stems, and greenhouse I ' Cl H ' Thumm, Skipper, Craig 173 Sliman, Alan 148 Sliman, Derek 129 Smallwood, William 65, 66, 173, 188, 209, 210, 222 Smith, Amanda 27, 129 Smith, Billy 68, 130 Smith, Bob 148 Smith, Carl 193, 215 Smith, Catherine 56, 63, 130 Smith, Charlie 294 Smith, Daniel 12, 55 Smith, David 109 Smith, Denise 148 Smith, Mr. and Mrs. Emery A. 273 Smith, Gail 173 Smith, Hugo 56 Smith, Iolena 109 Smith, Kimberly 114, 130 Smith, Larry 109 Smith, Leigh 148 Smith, Linda 68, 108, 109 Smith, Lizzie 130 Smith, Marie 55, 60, 114, 130 Smith, Marilyn 53, 173 Smith, Robert 12 Smith, Susan 56, 57, 100, 109 Smith, Tammy 60, 61, 130 Smith, Theresa 72, 148 Smith, Tina 148 Smith, Tracey 110, 130, 146, 281 Smith, Wayne 110 Smitter, Shawn 133, 148, 202, 204, 205 Smitty's 230 Snodgrass, Karen 63, 69, 133, 149 Snyder, Kevin 68, 110 Snyder, Scott 149 Soelberg, Nancy 87 Softball 212, 213 Soler, Doris 56, 63, 133, 149, 183 Soler, Maxine 56, 63, 69, 130, 183 Sophomore Executive Council 114, 115 South Gate Datsun 258 Spanish Club 63, 255 Spencer, Debra 110 Spicer, Paul 85 Spikes, Valeria 70, 130 Spillman, Christopher 85, 149 Spirit Club 222 Sproul, Carrie 110, 204 Spurlin, Richard 46, 48, 50, 160, 173, 178 Stancil, Robert 110, 193 Standford, Skeeter 130 Stanford, Celina 149 Stark, Keith 54, 87 Starnes, Terry 110 Star Pharmacy 254 Star Plaza Laundry 268 Stauffer, Lynda 46, 78, 95, 173, 225 Stearns, Eloise 87 Steiner, Stephen 130 Stehli, Larry 173 Stephens, Chiquita 70 Stevens, Barbara 87 Stevens, Bertha 53, 87 Stevens, Beverly 66, 71, 173 Stevens, Richard 87 Stevenson, Debra 110 Stewart, Shirley 32, 68, 130 Stickles, Edmund 27, 28, 51, 76, 77, 216 Stokes, Debra 71 Stoops, Kris 130 Stotz, Deborah 70, 87 Strecker, Ieffrey 110 Stresing, Brenda 71, 173 Strong, Iay 173 Stumpp, Clayton 48, 63, 149 Sturm, Matthew 72, 174 Sullivan, Sherrie 71, 149 Summerall, Cindra 56, 59, 110 Sunshine Card Shop 230 Suominen, Leane 174 Super T-Shirt 252 Sushil, Kenneth 174, 210 Sushil, Scott 35, 51, 52, 149, 209, 210 Sushil, Timothy 65, 130, 188, 193, 210 Sutton, Scott 110, 204 Sweeney, Gregory 28, 30, 60, 174, 179 Swimming 204, 205 Swindle, Danny 110 Sykes, Ann 56, 130 Sykes, Robert 130 Sylvester, Robin 72, 133, 149 Szulczewski, Iulie 65, 95, 103, 106, 110 tTt Takach, Belinda 46, 55, 154, 174 Takach, Brenda 54, 59, 130 Talley, Patti 56, 62, 65, 133, 149 Tam, Michael 66, 149 Tanner, David 9 Tamner, Matthew 110 Tarver, Michael 55 Tatum, Bryan 110 Taylor, Elgron 110 Taylor, Connie 87 Taylor, Glenn 56, 174 Teter, Eileen 149 Thayer, Sandra 56, 59, 174 Thespians 49 Thoman Thomas, Thomas, Thomas, Thomas, Thomas, Thomas, Thomas, Thomas, , Kimberly 65, 110 Curtis 56, 174 Ianet 87 Iavanda 53, 146, 149 Iennifer 63, 114, 130 Loretta 55, 174 Marie 52 Michael 130 Steven 130 Thompson, Glenn 73, 110 Thompson, Greg 68, 149 Thompson, Iames, 66,149, 204 Thompson, Pamela 110 Thompson, Vanessa 110 Ioseph 150 Thumm, Michael 131 Tietj en, Heidi 27, 48, 51, 63, 69, 114, 115, 131 Tillie, Christine 114, 281 Tillie, Karen 46, 71, 174, 177 T illery, Wendy 65, 114, 186, 187, 204, 206 Tillman, Louis 111, 188, 192, 193, 211 Tisell, George 127, 174, 182, 215 Tisell, Thomas 111, 182, 215 Toggvveiler, Bob 293 Tolbert, Kenneth 211 Tolles Concrete 245 Tolles Seawalls 244 Tomlinson, Kimberly 54, 131, 215 Tooke, Charlton 174 Topchy, Olivia 65, 146, 150, 183, 215 Toro, Kathryn 52,131 Torvinen, Susan 131 Touchstone, Mallory 68, 73 Touchstone, Tiffany 68, 102, 105, 107, 111 Townsend, Christopher 174 Track 214-215 Trammell, Christine 131, 196, 197, 215 Trammell, lack 73, 150 Trealout, Patty 27, 51, 56, 150, 215 Trombetti, Robert 77 Trombley, Neal 14, 174 Tropic Isles Elem. 284, 285, 290 Tropigas 269 Truskey, Lynn 64, 95, 111, 222 Tryon, Wendy 111 Tucker, Donald 131 Turco, Raedene 56, 63, 114, 129, 131, 204 Twardokus, Donna 111 Tydings, Bryan 174 Tyler, Tammy 111 Tyler, Thersa 65, 150 Tyndall, Michael 111 Tyre, Diane 111 Tyre, Larry 174 uUu Ulino, Rose 62, 63, 114 Underwood, William 174 United First Federal Bank 270 U,S. Air Force 146 U.S. Army 246 United Telephone 264 Upshaw, Leola 111 Upshaw, Marshall 66, 174 U-Save 273 vVv Vagle, Barbara 25, 87 Valentino's 250 Van Buskirk, Christopher 131 Van Dyken, Eric 111 Van Horn, Troy 13 Van Ryckeghem, Raymond 49, 62, 150 Van Valen, Lisa 111 Varn, Regina 56, 65, 111 Varner, Angela 62, 150, 281 Vathis, Ioyce 60, 131 Vaughn, Sally 60, 131 Velez, Artemio 55, 175 Velez, Leticia 111 Verde, Mario 38, 87 Village Cleaners 242 Volkswagen Repair Center 273 Volovlek, Betty 150 Volk, Pamela 49, 60, 62, 114, 131 Volleyball 184, 185, 186, 187 Vracar, Nicole 49, 62, 67, 157, 175 Vracar, Richard 131 WWW Wada Pools 238 Wagner, Ioy 56, 114, 131 Wagner, Philip 50,69 Waldron, Zoe 131 Walker, Kenneth 150, 188 Walker, Linda 55,131 Wallace, Iill 65, 69, 133, 150, 281 Wallace, Sandra 63, 175 Wallin, Danny 150 Wallin, Kathy 175 Wallin, Renda 111 Walsh, Paul 111 Walter, Traci 63, 131 Walters, Andreina 87 Waltman, Darla 131 Wambolt, Kevin 16, 56, 175 Ward, Forshunder 61 Ward, Michelle 60, 131 Ward, Nancy 87, 88 Warehouse 231 Warner, Lyle 73, 175 Washington, Rickey 111 Waser, Lisa 56, 111 Waser, Michelle 56, 66, 133, 150 Washington, Yvonne 150 Watson, Tammy 175 Watson, Todd 175 Waugh, Robin 175 Weber, Cynthia 51, 95, 111, 183, 215 Weber, Rhonda 69, 132 Webster, April 111 Webster, Natasha 72, 175 Welch, Mercedes 65, 68, 112, 259 Wendlend, Beth 112 Wenrich, Russell 101, 112, 202, 215 Wenrich, Sulyn 56, 132, 188 Westra, Mark 69, 114, 132, 182 Westra, Michael 112 Wheeler, Carlis 150 Whelan, Mary 112 Whelan, Sarah 132 Whetton,1anelle 65, 175 Whidden, Sharlene 68, 83, 112 Whitaker, Bruce 132 Whitaker, Ierry 132,211 Whitaker, Timothy 55 White, Cynthia 175 White Furniture Co. 256 White, Iacquelyn 112 White, Wendell 175, 291 White, Willie 52, 68, 150 Whitehurst, Carolyn 87 Whiteford, Lori 132 Whitmore, Brian 103, 112 Whitney, Kimberlie 132 Whitney, Richard 65, 151, 188, 215 Whitten, Donald 112 Whitten, Michele 151 Whitten, Paul 112 Whittye, Casandra 60 Whittye, Laschawn 175 Whyte, Liana 151 Wieland, Terry 23, 87, 146, 182 Wierengo, Iennae 62, 132 Wild, Iohn 56, 112 Wild, Nina 60,61,175 Wildman's Trophy World 254 Wilhite, Michael 175 Williams, Barbara 175 Williams, Charles 55 Williams, Daniel 151 Williams, Darlene 56, 57, 69, 114, 132, 258 Williams, Deborah 56, 151, 138 Williams, Edward 132, 193 Williams Williams , Eugene 112 , Greg 112,211 Williams, Heidi 56, 112, 222 Williams Williams Williams 211 , Ierry 55 , IoAnne 87 ,Ioe 56, 131, 132, 199, Williams, Kevin 112, 193 Williams, Lisa 132 Williams Williams Williams Williams Williams 215 Williams Williams Office Supply 238 , Shelly 132 , Stacy 66,95,113 , Thomas 175 ,Warren 34,151,188, , Wendy 113 on, Keith 113 Willie, Angela 150 Willis, Dean 113 Willis, Michelle 48, 49, 62, 151 Wilmont, Pamela 48, 49, 62, 176 Wilson, Donna 56, 113 Wilson, Dr. Iames 292 Wilson, Kathy 113 Wilson, Linda 70, 87 Wilson, Lisa 56, 100 Wilson, Melisa 95, 113 Wilson, Paula 132 Wilson, Robin 176 Wilson, Shari 176 Winegardner, Carolyn 132, 213 Winn Dixie 243 Winslow, Montgomery 176 Wise, Charlie 73, 151 Wise, Craig 151 Wise, Steve 87, 208, 210 Wittaker, Bruce 199 Witte, Iesse 113 Witte, Lisa 48, 151 Wolf, Chalida 176 Wolff, Robert 113 Wood, Iulian 56, 113 Wood, Kimberly 176 Wood, Samuel 56, 176 Woodall, Richard 33, 68, 176 Woodard, Phil 87 Woods, Charles 132 Woods, Cheryl 113 Woods, Mark 5, 176 Worthington, Carole 55, 60, 151 Wrestling 202, 203 Wright, LaDonna 132 Wright, Michael 113 Wyatt, Madeline 176 Wyatt, Randolph 95, 97, 106, 113 Y.A.C. 53 Yeater, Greg 132 Yeomans, Iohn 87 Yirkes, Ioseph 113 Yoder, Katherine 64, 132, 186 Young, Allen 56, 113 Young, Iohnny 113 Yslas, Linda 215 Yslas, Yolanda 52, 176 zZz Zabinofsky, Deborah 72, 113 Zolno, Michael 55, 113 Zurcher, Angela 151 Zyderveld, Michael 113 Closing X 279 ,S ,. ., 07- VQ, . , Y, 26 f get , ff J , ,lg ,iff if ,Q Publishers of Pride As you enjoy the 1982 Lance, stop for a moment and try to imagine the time and effort that has gone into its produc- tion. It's impossible to comprehend all the agony, frustration, anxiety, dedica- tion, love, enjoyment, and pride unless you have placed a bit of yourself into each word, picture, page, and section. This year's Lance staff got to work during summer school as they attended for all six weeks to organize and pro- mote their advertisement campaign and perfect the skills of layout picture crop- ping copy fitting photography and headline writing. Then it was off to Tampa for a 4-day seminar in yearbook production and the enjoyment of meeting and comparing notes with staff from all over the state. As soon as school began members of North staff faced the reality that Room 143 would soon become a second home to them. Countless hours of classtime vacation time nights and week-ends were spent planning each page, scheduling and taking pictures, writing and rewriting copy and captions, draw- ing up the final quad-packs to satisfy the high standards of the new yearbook sponsor, Mrs. Virginia Branson. An endless series of deadlines seem- ed impossible at times to meet with all the other responsibilities heaped upon the staff. These included vending balloons at pep rallies organizing the Homecoming parade pushing ice cream during field day collecting monies for class pictures producing the spring musical Godspell and most impor- tantly selling copies of the yearbook. Even though hard work is synonymous with yearbook there 1S still time for fun and friendship. Who would ever forget the party at the Pizza Hut the deadline slumber party or our end, of the year banquet at the Smitty s. Good friends good fun and an excellent year- book. . .spell LANCE 82 LANCE STAFF '82 Editor-in-Chief: Wanda Newman Editor: Manley Iaquiss Business Editor: Pamela Clouse Layout Editor: Clayton Stumpp Copy Editor: Richard Morales Photographer: Rick Bacon, Ray Garner, David Ierz Staff: Richard Alfano Amy Austin Molly Brodeur Marilyn Burkett Teri DuBrule Lorie Ga e Ste hanie Iuba Coury Macdona d Mi e MacDonald Tom Montefinese Barbara Mueller Marge Nahalewski jennifer Nicks Glenn Nesta Terri Osborne Christine Sie el Tracey Smith Christine T1 16 Angela Varner jill Wallace Pam Wilmot Advisor: Mrs. Virginia Branson -me fr 1 ' . ,wwf ,ff-1111 4' 7 - f H -21.33 i'f'?f I ' X f' -uw we-.1 . :gif , 7 iffy? QV' ' N5 4 , 1 P' 4 J f 4 'Y P J 29 5 te-X, Y I K, ' J f 43.4 3,1 f. ..s.:'a.m . :1-1 - I- -ww ,, WEE . . ., . , 5 f are K gti iiii F war g? wt sf' wi f ,,......, mtl its , T - A . A 2 - M ' 1 Q H il, 'rf . 1 , . .Q . A Y. s ff --.' ' V. -1 l, 8 ' , QW I i in I I . N ,-.. . . I A I if -' . h ,A el . g , ,.,,, , ,.,. Q , . ,,.,, j Ein, 1 2 ' 0 . - -2 j V , g,ff.' .. N t . . +R' f . . .. .. ' t ' i sl Av f U Q -.L-V-.W A H ,, .X . If ' 3 '-, 25: 'J gsm., , , 1. V ! V V - V. ' L, 'k., ,,,' ' . , ' X ,. :'5. by . X A . ,V ,273 k..,V I A ., V I 5 l j V , A . GN 280 f Lance M - 8' s T A T Cir . 5 4: 4 'fi an aw ? I A Yvj Xi N f .ii 6 1 - Lance Editor-in-Chief Wanda Newman and Editor Manley Iaquiss really had to work closely to see all deadlines were met. 2 - Dressing up to sell yearbooks are Manley Iaquiss, Stephanie Iuba, Richard Alfano, Rick Morales, and Tom Montefinese. 3 - Lance staff members Tracey Smith, Terri Osborne, Richard Alfano, Mike MacDonald, and Glen Nesta led the NFM Homecoming Parade. 4 - LANCE STAFF 'B2: IClockwisel Mrs. Virginia Branson, Mike MacDonald, Ienny Nicks, David Ierz, Richard Alfano, Christine Tillie, Rick Bacon, Walter Ratliff, Amy Austin, Molly Brodeur, Angie Varner, Chris Siegel, Margie Nahalewski, Ray Garner, Iill Wallace, Coury Macdonald, Barbara Mueller, Terri Osborne, Rick Morales, Tom Montefinese, Manley Iaquiss, Wanda Newman, and Pam Clouse. 5 - When a deadline nears everybody stays around the clock and worksl?l until it's met. 6 - The creative mind always works bet- ter on a full stomach. Lance ! 281 , V ,,,, ,Li PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE I I W O ATI ' 0 LL' FI Im IDI Q IEJQ1p1DJ-,,.4.kqg, ID5.DDyE,fQQE.CD VJEQIM Q55 ELEM IEQQQ DQ.,VIu44.u.L1i ww gf, -' IEIMQ ll zzfiiwcf igi PR DE PRI QI jf 3 PRIDE DE IDE PRI PR PRIDE PRIDE DE PRI DE PRI II 'flfj ,,,, ,4,fy, O FI 'Q .xx J I H ru I EI D 3- W1 QMAM A1 AMFCQHAIM F hgsf V TKWOKAAXUM ,wIq qmsff LmDSmDg ZLDSJLE CLDSJEQ CJQQML5 LQQQMI PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE F 282 X Closing RIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE PRIDE closing closing closing closing closing IID .e Lu CD 2 Q CC w U Q. I 1 , -f-ff C3 ' ii' US E 4 I 5 -+ D- il I A U I E E ,fi m I M Q, t LJ I-I-I , , ci closing closing 0- DE PRIDE PRIDE PRIDE oro IS Bu olo IS Su closing closing closing DD PRIDE PRIDE PRIDE PRIDE Closing As the 1981-82 school year ends, North says farewell to her seniors and reflects back on the events and people that have occupied her rooms and hallways. Everything that occurred was founded in the past and certainly will affect the future. North is her eople. The students, who enroll in classes, join clubs, partici ate on her athletic teams, form friendships, share Ifaughter and sorrow, ex- perience success and disappointment, and hopefully grow in wisdom, assurance, self-respect, determina- tion, and pride. The faculty, who have received slpecialized education and training so they can help t eir students develop the ability to thin critically and act independently, to teach and hopefully inspire their pupils to learn. The administrators, who assume the responsibility to lead, organize, challen e, discipline, regulate, and guide the various parts of Sie Red Knight machine so it runs smoothly and efficient- ly. The office, cafeteria, maintenance, and grounds staffs, who maintain records, answer hones, cook, serve, clean, repair, and generally tendj to the needs of this multi-faceted educational unit. As we leave this year behind, let us pause for a mo- ment and reflect on all the years that complose our pasts. Enjoy this followingb section, whet er you elieve or not . . . these have een and are some of the BEST YEARS OF YOUR LIFE! EICIIlcId 3CIIlcId I'cId EIG Itdd EIG O ,.. o LD ,... :1 on x lx? oo w 1 - Richelle Bacon gets a fond kiss from Mom as she leaves for first grade. 2 - U40 Winks is cer- tainly needed by kindergarten students during their strenuous day of learning. 3 - Fourth graders know they will get recognition if they work diligently on their daily assignments. awww ,., 1 I 1111 unix: sinus nxt! 113 3118! ' vi V4 5 gg li , 'n'Ja,429g. l MA' I A fr 44' I Qi y no ff 1 - .fll fi W' 284 X Closing 4 Enter: Education The moment we are born, we begin to develop and learn, but our formal education starts when we enter kindergarten. Little children, suddenly find themselves in a world without Mommy, surrounded by strangers. They must learn to share, to take their turn, to memorize the alphabet, numbers, and color words. An endless flow of worksheets and art projects, games and play activities, prepare these tiny tots for the difficult educational tasks ahead. First grade marks the beginning of the primary grades. For the next three years elementary pupils are drilled on the basics of reading, writing, and arithmetic. Then it's on to the in- termediate grades where the program of studies becomes a bit-more diversified and complex. A special program. M.W.A. fMajor Work Areaj is introduced at the grade school level. Students, upon recommen- l equipment. dation of their teacher, are tested to determine if they could benefit from an enriched, accelerated curriculum. These special students are removed from the regular classroom once a week and exposed to a variety of cultural and academic experiences that are intended to broaden their horizons and viewpoints. During this long period of public education, children are still able to identify with one special teacher each school year. This helps to promote and maintain their emotional stability and academic advancement. Looking back to this period of our lives, the workload and experiences seem incredibly easy and carefree. We often think how nice it might be to return to these childhood days when life was uncomplicated. At the same time, every North Fort Myers elementary stu- dent dreams of the day they will move on up and be identified as a Red Knight. 1 - Things are a bit quieter dining lunch time at Tropic Isles. 2 - Mr. Fig's Magic comes alive in a first grade class. 3 - Tropic Isles' students can see the BIG SCHOOL across Orange Grove Boulevard from their playground Closing X 285 'SAK 1 - Mr. Charles introduces Industrial Art skills to eager middle schoolers. 2 - Discussion can get lively in Mr. Bell's Language Arts class at Caloosa. 3 - Two young Caloosa 8th graders evaluate their classmate's projects at the Science Fair. .Q sf, 2 in 286 X Closing Middle of the With the end of grade school a new public education adventure begins, middle school. During these sometime painful, turbulent, adolescent years, students are introduced to many new social and academic ideas. For the first time, the pre-teen has to assume the responsibility of getting to six different classes on time each day, and complete class and homework assignments for as many as six different teachers. Exploratory classes in foreign languages, home economics, business education, industrial arts, band, and or- chestra, supplement the basic cur- riculum, adding further dimensions to the pupil's educational experience. The emphasis in middle school is on the student. Teachers attempt to adapt their program of studies to aid the students' discovery of their own per- , M i 1 ? Course sonal worth and to understand and cope with the influences and pressures ex- erted upon them by their family, friends, and society. The pre-teen begins to experiment with new social activities and interests. School dances, roller skating parties, group dates, and hanging out at the Edison Mall occupy more and more of their time. However, in order to enjoy these new socially orientated activities, transportation must be obtained. When Mom or an older brother or sister can- not be depended on for getting around, the good old reliable Lee County Tran is often the only answer. For a fare of 7511: one can travel from one end of Lee County to the other. The lack of conventional transportation causes middle schoolers to begin to dream of 2 W.. 3 one day owning their own car. Some in- dustrious boys and girls begin to mow lawns, baby sit, or look for other ways to earn money, so they get a head start sav- ing for their future set of wheels. During these three short years in mid- dle school a lot of growing up occurs. Team sports and hobbies become im- portant, special interests inside and out- side of school develop, and friendships and boy-girl relationships begin t0 blossom. It is not as easy a time as it sounds or as most high school students remember. In fact, as middle schoolers bid farewell to part of their childhood and ready themselves for high school, they experience a potpourri of feelings and emotions sending them alter- nating from the depths of despair t0 joyous heights in mere seconds. ,- .Ph 3 1 - Hallway congestion in enclosed areas contrasts greatly with North's openness. 2 - Bicycles are a middle schooler's main source of transportation. 3 - It seems everyone at every school must rely on those yellow monsters. 2 287 1 1 - Home EC students beat the cafeteria rush by cooking up their ovxm lunches. 2 - Typists wading through Mrs. Scott's heavy assignments in Typing I. 3 - Raggedy Ann Bonnie Bouch does an humorous speech for Mrs. Getzlaff's Class. 288 X Closing ?L,L'5 ii' 1' ii Q :..f?f.f I Ziff 42 M' .fl 3 ,,,.,,,,..,,.w 2 1 2 Z Next Stop . . . Adulthood The high school years hurl a multitude of different questions and emotions at a teenager. Many wonder if they will fit in, if they will be able to keep up their grades, if they will be able to adjust to the social and monetary demands placed upon them. Others are consumed with the desire to exert a newly discovered feeling of in- dependence, to resist the authority and morality of the adult world that has ex- ercised such a tight control over them so far in their lives. Still others are emerg- ing from the cocoon of childhood, eager to learn, experiment, live, and enjoy. North High welcomes all of them, hop- ing they will remain all four years - learning, growing, and developing - turning into mature, responsible adults. All classes, organizations, activities, and aspects of North High life are geared to provide experiences that will allow the student to grow academically, socially, and emotionally. Teenagers want to know the reason for everything and how it will affect them and their present and future pattern of existence. Peer relationships have their greatest influence during the high school years. Although family is still important, periodic exertion of the newly discovered self and group cause oc- casional parent-offspring conflict. It is sometimes difficult for the parent to let go, to direct without demanding, to understand without smothering, just as it is hard for the teen to admit they need rules: the guidance, experience, and ad- vice of someone who cares deeply for and about them. High school students want to belong, to dress like their friends, go where they go, and do what they do. As they mature, they begin to look longingly for someone special to share private moments with, to get to 1 - Renee Rudd and julie Aberle work on clay during art - . , . :fa-:hge . in '35 f 1 class. Z - When a North teacher speaks Everyone listens! 4.53 . jf .. wi Us. Lv 3, . , it , Z, , xf, .. . . 5 15 I . 3 -23 1 Q -Q , , t E I I l know more deeply. Teachers are still important to North High students but more as Hsharers of information, guiders of inquiry than as substitute parental figures. Getting to really know a teacher is hard unless both student and educators take a few moments from the hectic, bell orien- tated schedule to really communicate. The biggest thing in a teenager's life seems to be a job which will supply the money for the next most important thing, a set of wheels. Living in a mobile, fast moving society, a car has almost become a necessity instead of a luxury. Four years of high school pass quickly for most students, although others insist they drag. Many believe the more a stu- dent tries to learn, the more he becomes involved, and the more he cares . . . can make the difference. Closing X 289 Training for the Top While education of the mind is of great importance in a person's life, there is also a need for physical activity so the body will develop in a normal and healthy fashion. Not only do athletic and recreational pursuits enhance our physical fitness, but they also provide much needed emotional and social experiences. Before formal schooling begins, young children get physical on playground equipment in their backyards or neighborhood parks. They build their coordination by learning to manipulate their tricycles and eventually, bicycles. When school begins, physical educa- tion proceeds hand-in-hand with men- tal education. Actively engaging in games which supply instruction in agili- ty, coordination, and muscle building, the child also develops fundamental skills in running, kicking, throwing, and hitting. The community joins the school in providing athletic activities for the developing youth. Classes in dance, gymnastics, swimming, fundamentals of team sports, tennis, and judo are offered by the Y.M.C.A. or city and county recreational departments. Highly organized groups such as Little League, Pop Warner Football Association, AAU Swimming Association, Softball League, and Youth Basketball League, offer the youngster the chance to learn the rudiments of team sports and to build their own athletic potential while engag- ing in active competition. For the athletically inclined or in. terested teen, North High School offers a multitude of opportunities for physical involvement. Varsity and junior-varsity teams in all major sport areas eagerly invite the participation of all students. Engaging in high school activities has provided many North students with ad- ditional educational and vocational avenues. Athletic scholarships have taken Red Knights to universities and colleges throughout our country. Some have returned to coach the young, others have continued their athletic careers as professionals, while still others use their talents in volunteer community recreational programs and for their own personal satisfaction. 1 - Little ones enjoy the slide at Tropic Isles Elementary School while fourth and fifth graders play volleyball on the court. 2 - Learning coordination and dexterity is fun on a playground obstacle course. 3 - Reaching for the stars and two points is easy for North's Ed jackson. r 290 X Closing ittijlw Q W 2 I 'ifiafa 3 1 R .1 'E . ' ,V ,,,VV my 1 - Riding the bull in championship form is senior Scotty White. 2 - Professional basketball player Brad Branson, North High Class of '76, returned to campus during the spring to visit fellow Red Knights and pose for the Lance in front of his retired jersey. 3 - Volleyball is a sport that can be enjoyed in P.E. class, on the beach, or in high school, college, or professional competition. ti 'Sas 41 new V' f V vry 1:1 5 2 i NJ 3 .2 OQXX Closing X 291 1 - Cattlemen lack Duncan and Buddy Browning wait for the ac- tion to begin at the FFA Rodeo. Z - Dr. james S. Wilson and his assistant use kindness and love to examine a small patient. 3 - ECC students spend quiet moments together in their student lounge. 1 2 Finding Your Future The biggest question that needs to be answered by high school students is what to do when their school days end. A new and very different life awaits the graduate. With the end of public educa- tion an endless variety of choices loom on the horizon for consideration. A few choose to just float on the tide, enjoying the good life of travel or being a Hbeach bum while still living under parental care and protection. This soon can become boring and more expensive than a part-time job can support. Many get their lives rolling im- mediately' utilizing skills obtained at North High or the Lee Tech Vocational School. Now the classroom training pays off as they gain fulltime employ- ment as mechanics, beauticians, draft- smen, secretaries, technicians, sales clerks, truck drivers, masons, book- keepers, ranch hands, or .construction workers. Those who desire additional educa- tion look to various agencies and scholarship funds for monies to assist them in their further quest for know- 292 f Closing ledge. With or without monetary aid from their families, they realize that the ensuing academic struggle will be ex- pensive, difficult, and all-consuming, but worth it as they emerge four to six to eight years later, ready to enter the pro- fessional or administrative worlds. More and more high school graduates, both male and female, look to the military for the answers to the post-commencement decisions. A two to four year stint in the Army, Navy, Marines, Air Force, or Coast Guard can supply the young adult with advanced technical training in a variety of fields while granting them the opportunity to get away and see the world. Whatever choice the North High stu- dent makes for his or her personal future and wherever that choice leads, it is hoped the knowledge gained and foundations built during 13 years of public education will serve them well. For they are America's future and all of us are justifiably proud of each and every one of them. M .... N., ,- ,fffc-.f5'W f'tf'f 772 L z 3 1 - Hard workers are always in demand on local construc- tion jobs. 2 - A friendly honk and a wave . of the hand are evident characteristics of the constantly busy truck driver. 3 - Exchange Bank Vice-President Bob Toggweiler oversees the operations of the North Ft. Myers branch. Closing X 293 The Curtain Closes As the 1981-82 school year draws to a close, it is a time of conflicting emotions. Some students rejoice as the academic year winds down and summer vacation looms invitingly around the corner. For others, it is a time of sadness, a time of leaving, of saying good-bye to classmates, friends, and a chapter in their life they can never regain, their childhood. Seniors remember looking forward to their graduation day from the moment they arrived on campus as bewildered, nervous freshmen. Now it seems those four years have disappeared in a mere blinking of an eye. As they nervously don the traditional red cap and gown for an official com- mencement portrait, seniors begin to understand the mixture of happiness and sadness that will accompany them as they walk across the arena stage to receive their diplomas. They will know the pride of successfully completing this academic careerg the contentment of knowing that knowledge has been gain- ed, that challenges have been met, and that growth has been achieved. They will experience the uncertainty of the future, the misgivings that accompany the leaving of familiar faces and sur- roundings to strike out on one's own. Wherever they go and whatever they do, North High students and staff wish the Class of 1982 happiness and success. This was an exciting year at North Fort Myers High School because we were all here together, sharing a segment of time filled with Red Knight Pride. 1 - It's important that Debbie Maffei's cap fits perfectly, so Photographer Gary Bergen makes the necessary adjustment before taking her picture. 2 - Bryn Alan Photographer Connie Iocke works hard posing Faye Moten so her cap and gown portrait will be perfect. 3 - Look straight ahead, into the camera, and smile, are the instructions Charlie Smith gives to Kim McCook at the Bryn Alan Studio. 4 - The Senior Class emits a cheer . . . Graduation's almost here! 294 X Closing .L 'I f f f f 9 f f , A, AI 5 , ,,,7,,,7,, W, ,,,Q, 7 f 4 f 2 a ,'-1'3 'i','93i.'?fi:4'i31 ,W ?'FL,f?iT: 0-M2242iff:f:sf'i1-fm'ww fri:-i2n',:4-rl:z1c2-isefz I 1 ff:.1-ze-1.11-1'nfs--11,7,,1.,,1.,.1,1m.,.If.,a -, ,.Qf.f ,1 W ,- 71313: f.-pf:-A ,L f f mm V.gA.g.gfjwgfi-g. ggggg-Q fu,,Qrng-54v34g,gg,:3,3535 ,, , ' 1f'qf11Jzlf4,'fl1j,,'f3-f'1:'W5flflE1 g,f,gi' 4 f, - 'f-' 1 '-f- , , .. 7 ' ' ,,,, ' ' , ff , .rsiefe1sfs,f:,'tf-., igf,3,f::gi,g1g'g',:z,ra: , ffff:-ff-,:-,.?11f,.1-,-,Qrf'f,:1'AUQ, , ' f k3zegzfz.gz:fam.,4'wfCi.f5f. 4:-':e- iaf,1z:f:gf,f,, :f :Q.gy,f,fl1gf:,f-:gm,,ff:w:,f.:'fs,z,:+sw:f,ig4ygfy: +I.: in32324251c2f.iaif5f2p2fgfi':f:f.,f,zf,17.,,X . ,rf41s2f1-al,gf'gf,tg5,g:ffzysyzg ' ,f Z,41915z:v5zgz1f,z:zefggfl'fi,3z.'-,aa4,2-454:ifsf,1ff.s.-:W-,Q,.:C ,,,f 'ifz2,z:f:.f:1fsfifg4g,:.,.,fefs1-2yz,:g W.-.fkg,gfg.,g4 :gwggyggqgff,g,,gg,i,',3:,3.g,4,,'f.5 grg, , f, 9215-1,51:ua-ze24-2-5-lm:51-13'-12:z,7:'afi'41fzafsviswig, 1121.1-ffffi-iwsziz..'75,i'gWMi1i',,.,if5-gig-,EQEZEYf.1-P5f.e'z,s'vlaJ:'2ffwi,f4'14a61f2 i.5fyz,,i,gfi'gg'ggfg1'2-25 , , ' X , f f f f 4 4122 f f no nn' oo ne no na oo ofa f f X X ff f f f f ,, , f ff f ':i1fv.if.i'fw-Wz?fff f,2fi fw,.f,',. 5, , N ,c,,4. ,V,., ,,f,, .,,V , . X .,fgiw,::1: , f f f f , f f f f fx f f f f f f f , , f f 3' ,, I j 1 ' f m7nfCl,'IE,E11iaQ: 1r ICegQ c3piQigfqmlimijgtQ f 1 ' f f 4 f ,L.,, ,L,.V'... 6 i VME!-m l13 1' ' ' H? i ' 'Q' V g,, ,m'OifQ2 3:5155:2154112-2iE'l17': '.,' , Z-if v I K , ff-ivifiei , - , gn , , , : 'iZyf',yigi1f1ig :,' zgiyli 5221-,g ffEjLlIf-yl': 'GQ ','n',1,',' 5 fi'.Qjf2j,PZ ' ,f V f f X ' ' ' ' f f i f V l l Qf 1 f l A ' ' i l , Q , Al., l. ' MDM ' 1 ' +1 1 5 1 Q 1 ' l A f 1 1 W g 5-f 31i ' 'l,L ' , Q'Ql f Q l l l 1 4 '1 ! . f f ? Llmda J Y' ? i5 P fiJ: . 1 + 47 f , l yyyzl, VV,z,'-, 1 i !,,' ','V' z ,, f,'1' ,' ,I ,,' ,',' QL ,zz ww if g .yfi Q , f-,, 1 f , 1, , y-51 .,k'- lf, f, , ,,, 1, I I , , 4, , w-Q, , 1 , .,,. ,.,,. 7 , ',,f f,f,, i .V . ,..,, V. 3 I , I I 1 I f f f f f f f wiv ,L Wg, T112 fav'-1:2g'z?.i'fc,gf, 5 '3:'51,':5'fn.f7'f'j1 ,f'4y,, 'f :':fV57y5,,:fjg', fjlff, ,422 X 'fvwefiygl ', f':1:9f'24'?-WTS?IE! f V.1Z?Ek77lIf?Q f,3f f5-i'f'Qf5'W M6 . 'fI':i:wf 5:l'5L5w ,,,.k ,,., ,. ,,,, M X -f Z.,f55i:m2i7:igifkfwf ' ' y x lyfip, 'Q .715-ilrwffb ,f,fCjg..gg,g, V5 f ' jggh ,V f , 717 X f , , 1 :i'f:W'X Lfffe, :fm -f ,4!,,W,V ,, f X f., H ,, , f , 1 f X , , , s f w6?:,'f'51 , 1 ,ly 1, ,-wi ' .9 f 4:3-: ff - 296 X Clcsizif f f - K f 1 , ,M ,, X 4f , ,C ,,,,,f ,H ,fy 4 IT SHO DE T PRI 'VE GO OU HEN Y IT SHOWS W DE T PRI 'VE GO OU WHEN Y 'SWHEN YOU'VE GOT PRIDE IT SHOWS WHEN YOU'VE! pride pr' eggpride pride pride pride pride pride p 'de I X3 Q3 jk iSiIvi,ifyQr0wv9yrrVg3 YC? WI my .- f VSV X V -E-S353 NQXQQOI MN 0565 3 QQSVNIIQWWI QWOUWCPIU 'o Q-XQUQIXA5 IV CP QQXQYQ SL IJ 'E JXISBINGKTP' WWW Xxoxwxx ex'xfAxB5X0,,QWi9I' 8' jjigysimxir MHWIWUIWWW 'O I ,X M 'ai I NIM WM WWI III? I TQ E. cv TQ Q. cv TQ 5. cv TQ E. cv TQ Q. cv TQ M1 I0 Mow qi I 4 ggjpiw in IW qi? WL 'I' viii Wwijrw My Aionppj DUB U60 WIT bb. XIC PM QIW IOM II I I O IOQOVLI UPL IBJINGYQWGS SW ,C WJ W Sride pride pride pride pride pride pride pride pride pi WHEN YOU' VE GOT PRIDE IT SHOWS WHEN YOU'VE GOT BOT PRIDE IT SHOWS WHEN YOU'VE GCDT PRIDE IT SHOWS 2 . ........ I pride pride pride pride Fylde pride pride pride pride pm? E T7 ' cw N ,f ,I X ff? I f . , I ,r N J Vdgfbp 753 'I KW f yew fmcftjmae algffdwd 3, .4 4 ' QM Q 0 QAM-Qwwam 013 'QJIXAQBMJ R wi, SIMS duew FD C CG I jim loeaiwmlww MQJLAQLCQ, , 'Q 4 A at SQHQMSIQJB QQQDIQQMX QQ 618010 2- 2 iw 'Q Q I 5 -I um, W5 fb 11 me 33 'Q E -1 EQ m 'D 1 -I 9 E iD ,gpride pride pride pride pride pride 5 YOU'VE GOT PRIDE IT SHCDWS WHEN Z . g L., coLoPHoN ': I Volume 21 of the Lance was printed by Taylor Publishing Q' 3 Company in Dallas, Texas, represented by Mr. Ron Binns. -8 U1 The cover is a special embossed design, using 160 point ': 3 binders board, red base material, mission grain with a black 3 0 overtone. :Q EE The majority of pages are printed on 80-pound double E- C coated glassy enamel. Pages 225 through 272 are printed on G, Lu a special order 80-pound yellow Vivi-Text stock. Endsheets are :Q Q printed in two colors on a white 65 pound cover weight stock. E- E Body copy on the opening, closing, and division pages is set Q, D' in 12 point Melior type. The remainder of the body copy is set TQ 5 ,in 10 point Melior. All captions, folios, and page numbers are L.. Q- G set in 8 point Melior. GJ Lu All portraits were made by Bryn-Alan Studio represented by . TQ P Mr. Conrad Jocke. Candid and group photography by Bryn- . . . . L- s D Alan and staff photographers. 0 Press run for the 1982 Lance was 800 copies using 296 PIP E P- pages. Approximate production cost was S20,000.00. i ' YW? ' W fmwwqwwmfyafwiwwwmwmwmwmwffwkfxwwwwfwwWHWnPMNTi f jf?gn. ,. Q, 57' 'FQQV VFK :e?i -l fff '4I: T: 'w'7Ti'El , '-83595 'tg V, E,-'S'- i'3.FQi'f1.1 -'J5'-.iid-5.4. 11' L X . I - 'H H f' 4'5 ' PL-'Rf-ii' ' I 5 1f'::f,'+?'Y .fav-54+ 1 53' f Mg vqflf'-4 174- I Huff'-'-rf: PW if gfi.gg,?f Q Eggs ,a5 .,f1wi5i,5x jg -1-:- ' 4. f 5 ' ,, ' r ff ', . ,. , .15-,-gg 'ff A 65 lgm 5' 'Eff ff if vff Vi.,-y.'-r f. n M . . ,sw-F lf' If .qw A .' 1 lv.. wa' GC- i?3'3l i'Iff'-ff11iff-4 f-7'faZ': if Q 1-wr. -. He--.-tilfxcuf . -'-fa? Y Q ' ary-gil fain Sa.: I -1 ma.-Y? S.. la'-,IPQRQ fer--Z I 'gunna UTI: I I Y, fl-,,' 1: 54: Y? I. ,a N i U .Hr ,E-T. fjiffb- ,,t,'i,aK,g'li'-'rg xii if if XC 5 J gf,g'5xgl'If:Ti?f,1 -.-g' , ,S 'Q if H54 V 45 'vfI .Ms A fj1.'EEb,.g:Z:!:Q:'f.-2 X, 2,3555 Qgig-1 y' 'rg ,LIN flu ' sf? U5 ..f3l'g, 'M'h,,.:Ng-Q., 'jp . Q ty p Q 1 N :L Q1-fQ :wi-fr-Q, -cw.. Q: ww f '1M.1i-'ffm' f 1 4-,ai A f. ir S, Q .,. fi., I' ' J. i4'Q:u '25, Ex M I ji' M gf k M '41 K. .if kV , ,,Q ,n- lutvx ' Q- ' 4, .L , ,b-' ' .' r 14. . L Q 42. Q W f,..-1'-,W fri. 1 J MM H J ff, -,gf . .-- X' -f- Q , ', WJIJ- , ' '..f fs , A. QH,'.-,UA-Hx. -f ' ,' - ,.,5xff3Ft1x3I7QKf,5:Z,f ifgg- ET-gg. 'F-13.3-2' if .ggi ,Q if A 3-h I ' '3 , 6 ,' '?.'-j :EL,,. Nqjii, . :S-4a+,., g1m' 'lixngigff-f-g?Jiwh f,gg,f4ff JT ,ff , ff' L fl' 1'iff 'g.'i.m -M'f:'?'ffg53gq.,ii,:fgs,,i -,BQ- ' 12 -v f 33 SV , ..1.., Q-f'?'SQ?5 5LQsi f7i1.7Fk'5':5'f a51?,'.Q, Ls-t'fg'-'fr' WL. w' , ,J f5f '1YfI5f?f k 13 Hg ff'fFL ., 'S+-lg?-wagdaii ,x,,:fN-'lffifwsA1,T..fx..g fitQfkx,w,f . mp, . , . - -I ' ' IPA . at-' ,314 xv' ' 'M' D 4' .Q-. 'nv 'Ll' 4' ' 'V v ' ' - Q L 1 fl I .3-1 VK' ' v ' I' I ij,- Qsskw'-1,4,,,y ' 1 ' BLg,f1 kk3'.v1f4,fQ25 QQ, if -mggf-gfff f gg-,4:'s' 'irgflav-f 'f , . JT Wi-5? - ,t ffsid' ' . V ' 3, Na' ,9'! E-' L -o 4:, f ' M' g, H- W wh Q: :fi -K ' 1- , 4 '. Q l :- W 2i'fQNi1ff?i -'s .V Prfflvgl. Nxfgmj-gyim 'f ' ,1....,,,.. ff',':i',5Hf:.f '1'J,,f , h 3? 3' 'V' sl f 'I 'J -I i 'Z- ' 'fg':t'. 'U' '- ! I' ' 'hw-',',.l-.EJ ma, Q - J5h R E3 A ' I 'X 2 15- A ' glkN: ':A5 :i'D:' K' its-S. 'J NVQ? Nsdxlr :Th 'Q--,ali -Ry, 'g! 'lf.::,-, 1,51 ' I I, fn - .oz IJ '- ' Y I. .I I I 1 . 'i9g, 7fi., Q- . 5-,.x-413:-f A, 'W-F?,gQ:a.5.3,. A an ' .LQ 'v 3 V+ A fx 'gn' . ' - 'J 'IEJT v7 A' , 9,4 - 1' I8 v ',gB!Fg l+iq, kph x ,f ' T5 4. .. A 'N 11 ' 1 ,,, 4-' ir' ' -11':,:a..' QA I -El' ' N- 'v ' C Vrnh, . X? 'Y J, .1 ' 5 -,Q iv' K 'Em , I V ,I A 'I ' I Yr, ,N .l:ejfQ'k'u q ff! I w,e'l4i,i.cI?xcqL.'? iw.. 1.-I a u Ssggalv ,A Jael- V JH !'v'- ,- I r :Vik AL 'iaith'-,I .W in M.-Nil? n 'ra 45 I I ,..f3T.l: Xa? Q4 v.:- -,-1 .ET , ,Q-.L H 4 f, - ax Nw- .-.f.f.fff'f'-tw-M--...' -uf. v- - . ah ' P 'N ff- -. ' f.-lf f'3'f?f'Q:' ,- .?,4,3 Xfigxg 5' l '-'4T'5'i ff14::g'1fjti5 f-'qfff:4'?1i1,'Pf 5 1ff'TT'3ggf., gm, 'EP' ,'f'1'?f??gk..,fif ' T. , +25- '. i 'f'4'3 1.1 ff. -1 .5 2'-'lf -7, '1.J'?2K'lf .4 -'A'1.V.'.V-f Q ' ' .1s'f1:'. .Iv 1 iff'h'2?'1-iff SSH 'ai A, T .'-' fl' ,- In ' ,. I fi Tv- H+, , V4 -I 5 -wrw+f2fgf' A W ..1 ' :ia- f' 'P' ,, , K, n, - .-. .T - -0 ..x Jn . lr..-'I F '1 4 K' 4 13 K5 Q' 1. fe I. Q! t Wls -ig NI. ', - . I - - r ' J',4n A A v i .- - N. t', .L . E 'Y I . l Q, Ya- 5 h4 A 1, I- fl tx- ' ' J.. K. ul Q V . A V '. 'A I . . .ri ' J .itpblyi 5 Ffifgmf -xvli- l'WfKx55'f'Y :wf.wx fa.. ' .?P.3Y 'WL 'Y' 'il .'.'- ?'f'ik'.i'g1vJxf-It 'W ' fff' 1- N J 'A AM s m 1-1-J' 'FXS' ll, pr- 4 f 'ajs'-1',fs'?Q: ' fix M fv 3:,S X -'ff A I ww if GS . M'm z J If S fi It I I? 313143 ,FA 'I M J tsnxiw lit' Kun 4 1 y W .Air XiRr '4i41'l:: .511 Iwefiv -Ax Q wut :GNN 'H't, 'gtg' 1 1 Q ' 4 y ' ' -.J 'rfb 1 WWW 'BT' 'I' Amr- xg? .gk 1 gf 116 ' o :Fl ' fi' v Jn L 5s t 'nk HIL ' I 'GH -'ww -Q ,Fl 1 X11 Ml JL-+ sw gf' --f-1 Q! JN , F5 ip A ,152 fwxlv 'QQ N 1 xi. 'Y xh 7 '- W F M h 7 wx 'Ii 5 R 4 uk'- 'ff' J 2' is P X1 r Lmflfvf-9' sk A A tx MEX 5!':-'xi lJ-ILT' ax .- -AJ' it . 1 . 19 . fr '.L Y ,I-'J ' 1 '. 1 'u'. - '. it -.. . 'Xx, - ., ' 'sh-'V -fl' ,'. C .f,Qi ,Qx .31 ,f ,-.Q , ' .' if 1 V' fi- .:.', X,fis '1J--.Jr,,'.,- - f4 1'4 - six . uf' f -i'7ff1'.,fi fa'2!f' g-'Aff -.v.1, 'tbl -'T gf? 54. !g .-F'-1.1 - fait! r 1 -'.- 5 ': J U , .' - . - H- 1' -Fi' . ' rf .H.-f ' 0 . -'x ':-.' L K . .1-. 'M . f I. I Q :vp , r' J L ', NN- - - - H.,-Q, . , gl .V af , ,L w- 12-Y .146 ,-1 1 4,m. ,Uv JT I- ... Y ... Q, . if mf- Q -an 33.1 f+,f..- QA ft ii 2---wx . -1 . -.11 'f'w-'-- fs fm ' ' 'f.:f vm -. Y , - fi F ,'.'-. , I Ln -fi-f'.,f'2-I. V' 1 U,-.' -' .- . ' -' 41 , ,, QL.- 1- ' w.' ..' -,:.,f', if 4- 'gmt,:.A--2135. BA.: .. 1. .,l xl lf! ill-.,g'f: ': T i:' Tf.:.X.Esfg' nl ati? ll. Eli f '.' .H ft J Ax- M A , Qtr E JP' 5 ' ff. '1f':1ey-- 'W' fi, v 2 x Q if - 13 . Vx. 2 .ff ri E , I .V .an I :,: uv - .n --'IJ It 'Ai ,A .i:g yL,l ': , 'nag .k.',.' n 5 , L . V I t v yt' ,: qx 'K E :xl i-.H I' - . ,bt J K jhf ' s ', fkll. -auzgzlg 'tl .N vzisffllira -xv! 1,11w'2i'-Q ' .tc r '?QCE?3.'l . 1 It : ,.:!N. 'li ,K V Kiv.:flg.'M.V Q-:bf ilk? ' rl.-.Q H if I 14. mf! f' !fL,'r '- , -. ..34S,2Qi'y-V3.4: r,,, 'Yu Ml 1-f3f1lfI3'i3i+ -X - K ,,- in-,-. - n . 1 , W 1 . . 3, xg H Uh- f , 3 ' , f f vy -5, - ,, ,.- f , rg .fu 'f -gif- na Z! 'nz iy,.,,q.'- li 9 -:iz -. 1 A ' 'JN ':n'r5 'QT-1 f MJ'-qg.Rg' Th' 'J' . ' ,u .lux it fern -' Jain' T 13 :?th, ,-lhi. Lftgxl' li.: JQYI. '.f-.jh:f'xK4'- , L . fy , - 2,g'g5.l5i,5Q2'f:j Q.. f XJR' . , L-,' .If'5L HP 59 1 Anil' '.5 7,1 Q E'-Q P 5' KT i -5-ffl -ff.. lg. ,rx ' -4- '.1.,f-'- - 7.1 v ,.X,, 5 ..f- 'H .1 rf -.-3, 'X '54-3' , f X . x ...- U - . -.T't- . '-'11 1 Q1 1' ' if-1:-.if--A-2,-.fIfi x-v v' 2'-' I+ ,-gc'- 1l'f f ffl- 'ff Jw-wr '-'...- L . 1 .wf.'1f1,-' -. 'P-5 . ,. ' ,' f ' ,',.e 'Q1 -F'-iff .ff '1 ' -,-f ',T-'ff 'Q , '4 -'haf - ,,L'Q'. ' . . .', VC.. .' ' . ' , , gf- - nt'1-'fu'.'-'!X'z Q'hf:amy-FY? -as ':,-f:'m- 'Q 4 'Lv' nd 4947 I ' 5 age 4 3 l' fwtfug 2 'x.- I x if 1'5 li- .Ulf Y hr' in 'I fb- hi: f E L . .,1 ' 1 '-' Y, . ' ' 3 ! v, f'.,i r iq: ,- ' 18:9 I-'fy rf' '-in' 'W-'J ,L'.A - fl ' Q' A .5 ' 'X i. ' I1 sys-L- '. ,1.H.g,j.4I-.4 ., 112' , ..- il? .J ,..,-,-,,'7 'if!-, H f- . . L. 'T -. I'-rv? '55 '-'-.1 1 . v 1 , V -'v , V-..-M - - , H' 1 -.H '- .ab ' f '1 '- - '. -. - IJ . .' -. I . ' I' -. - .- '. .. . . -, , A. -1 Q -.-- .-, U- A A .- If 1-aft PM ' -- U.-' -,A -gl . ,- AI, - . +., 75Pfl5?- 0 I 'AM - ,. . 5 't 1f 'f4'-f 'E' .7f5,715 5-N , 'Q El-fd -E '- '. rjs,.H3'- g' VY? 1 ' . 343' mwfwx iii wi f- -H ,JW M. ' 'L' ' WHS MYNWME J 5' ,- al -' ' a A L., . -yisibrl . , . . . NJ 'fly -1 A .. ,hw n ., s .fi - '.,, f A. ,UA 43, .2 mf A 3 . -55 , . - 'ff 'ffxkpb r '. ' - . 'Us ff. e -'p A 'X 'f' .. iff' i5.':1a3lk-l '1'f .Ji :H , Qi 'IIA ' M Q-:::i jA'1':'.f'v. I ,Q kj LII. .-E1 ,'l'Y.iTL-Ni' .I E R5 :NL :Qfghni 3' J u: ,3J::.?,:hh G , . F V. E 5 . ,F,'2ZhRQofi gt,.- 'T J1.'.fI'?'-If . 13-Qi yn!!-. -' :A fu .fy 'aS,.u'2-iw' ,71Q-' 6'wlgqu.l9'!:i'.- 2 h,x.,.. 'lv. - 41 W!.? 'Vw' I- 4.14.9 Q' 4 L - f . - ' - 1 - W- ' . 0. ,. I - 1 - L h ' vi S 1 ini EJ-I - I U ' -',r ' . 6 V31 K? i xl . I .H .f'.', JJ 1 ' 'Yf.r,'p?v -I, nh 5 iff- mtg: J i 50 F, ','-, .451 Lat, , ,?u1 ' .j u. Xb, J. .Q .I f :my A 2 ,V hx R I.-.df B bl. '51, :vm Ki ,fy ,-g ihP1bf'.Yi.H' .-ini? J:-,: ni K hsqi! gh-t .4 gs 'fjkxgtg -Nigga Kfil- ,Y-'WHQI' .Mc AH .' 2- ji- . ... .. .. .. Q . 4.' ' . . ' .', - iv. ..' 1 i L- ji-5,3 -,-- , v, 5 c V' .J P fy! ,iddi ,V .,. -,Q .Y 1. . 'pls z. .k 1 .. 1 .n fl ,115- 4' 'I I K I jrfj . ,ff 3' 1 1 f f fj,. ,MAI Y, va 5.92 Q Jr. P . II! uf, sr, s -4- .f..,' .L -.,. . J., . . - f - - . ,.- -. - . .M-, , 5' . : A M Ii -', 'dj I -'. .4 xi' . .J ' . Lil J 'ii- ' .J -,.' 'I' h 1-.wx Qgv. 'N' 1-YQ - - . N. A Ja-, If ', .I - ' .QM ' A I, A . , '.. H U prix I' .Z--,-E If - . JJ! I I Y -xi 1 I - ..::L,,,,o91::lj sigfifiq ,N Q ll.:-3 , E- lkfuxvfl f.-it fl, ,: L ,X H I .-.Mx Q. .:.,l -V r,.k:'4,- Mn. 4 .', V -. s -I ff 4 ' - ah ' 1 f ' Al 'Y V 3 ' - - '- i , - I xy .-- AQ, v - '2i?'f T fi yi? 1i711:f,,1a9,gEff? '-Jfff? f5?fff4-vfr-Q ff9Ifs1'f'f.,,f-1'-2 V In ia- . I V if FX, I - H - uJ IP.. 5' T E. lg -gflk - Q ,ff .ht 0, x in uf- 1 - . 1 sg Nwtlux -l5::.:.,: vli:.Js:.3 3 V 5 L aww I ' 1- , p IW -' f'3 ' lv I F , f I, 'f 'Qu ,al ' I , .s lv ' , .' , ' , ',l, 1 -wr l Y: -0 A. Y, , 1,655 ,V V A ,V Quai 3. iw- ,. , 1 U I N. r l x LA' k S s i' ' E., is -Viv J, . 'bf . .ns .l Q --by kg. . ry- . V ' f.j1,5,,.' ff-f j ' .-,Q 1q'4,..-v'Q,, 5kif f'f.givts5-J' fy ' J ,--'Q'f.12Q-f'.- .',:,5,1'!,1.' -u.V55'f5',-:..?!-ua- 'f'-x'f1.i,.--'A-.x,.-,f,ff,aM'- A ,V I .wig Z,.. ,, I,-F t I. ph ,..- .4 I 'i-plug..-N . y - l .M Y. JK: h i, lag.. , ,.lK.x .:', -I W W rf? ,-ff' ff gf 64 shi 'Z' ini' 5' J WMTWYZ- ,f.ff'f . f ff + Wv+--Q. ,F J 5 I 1 f ' . , F, .,- '52 . -'Y V r ' , ' P '- ' I 4-a ,',. , , . . e . L , x- . .- V I '- Q ' 5fJ ef 'f' A .3 - , .A . f'f,-.f.f .- 'f7f :.. M-ti 12,1 ,gd-MZ:--H A - ' ' A - A f e'vf2' sf . KM'-.f . f, . , i 1 , ',- ,- Q , , V .V - lf,-. X' '. I' , -,v . ,Q-' N ,fy . . - H'-, . - , . 1 . .K ,wif f1.' ,, ug h , 11,51 Q 3. u ing' ff 4 . TFTAE-!'L ,Ts Q.:.,.:' 1 Lili'-.' Ke . f 5'f 4iA 1 -,.'-gs f... ie'L ' ' !1 ff , , . .. f':.,F'x j '7.'i,'f1 -3-.J-fz..',fxi,+.'-f f ' Eg, 'AX vg, ' 'aff--Y' '- . 119, 5 - ' ' 'F J Wg- .1 Q. 11-V. . M X RW 3 if I X 1 ax 'i5'4v.s PW!! 31 ,E HW Jgglk J j l eff :Z 'Aix i.r:!.g'::r-A-',...:7.1 -W, '5 ff ff- 3? ' :,1.- ' 'I' f 'f' -5'-.. 'K -' '-L 'Ma-,-M 'S - ' f' , I'-fe' 9 n 4 .'A- J 'i'.r',, 45115, I 3 , f I fi -',ijlQ V .1 , - ,- ff L 1' w PM -.v ?'f , V' - vs' -1.-1' .4 ' I - XX ' ' an , -5-. n. 4, --Mi, Q, 7 ,, , --- , H.:..j:V,,Rrs,A,-:4.gi v A. X - n .-pq. , , A ,,c 1 bg fe:-' . 1' 'fi , ,W 7 WZ si , - .. - 1 ,iv fuk. L ' 'fiff- Q1-,. Rug. 1-aims.-.14vo'tx'4I0 51 JJ e.l.'-6-.Mtn '51, ' ' V., is ' f :ui 5 8' N 4.2 if Y, g , I, I P 'Q s rl I Nw ' J. f - lx xx-t ,' x 4 '- .W ' : uf Q V . 311-1 ' 1' I J' ' S ,. 'J .f? f',. 'bf .1 .r -' f-2 17' fs eu ' i . V K . -f ,4--'V .- . -- I - V z 'Cl Af' ., , ',.v3o:f ' h 1 554 1 Q X U -gm. W Mtg- .1 +1 5- x.. It ,V N J ,- U, Fai 5,2 gy: f 45, A' wg I, fi. . !,,w? .,g.T4 gf Qi' JL '., .. A- '-M3-'bfiekf-1'I -J A Q - ' .' ' A' . I. - , ' . , I. i 9 xx' Aj . . -3., .. :mf - l:?,,g,,1,,--- -V Qf 'l.'v,n .A at swf ,W 11- + 'a ff ' .-iff. X -' , ami jlf' 'Sk 2.44, ' :WL ll?-. -- 'fhcilki At- if 5 5 .Y t 'K' 4 i 'M 'E sf K . 1' . -1 - V - - I .fir F K- -, Ji, Q.. . A- f , tim, 'Q W My 54 f Ei1W''fimjwfait-si'::fX534li1'+:'1'-Tfqfwff' ff'3'w ff? - .K , . . ff' yer. -'.'ef j'-gil, - ,L -I .pw,,1 -' - no ', r . -R bf . f- -1' -I :QM- ff psigg.1f:A5.at,L'ff?e4p-.'F 'arf,::.,J1:'liN:.'2ga?g, 5'f.g -xff f', mi Y Eff R ff '- 1 nfgli gif xiii: wifi -Q R14 We 23? ti I' ,EP I .S rk ,M 195:-f gy X - X We Q gif -'22 A .-1 .J :. ' ., 'f-1,5 I X- . -. -QT . ii- ,Q ., P x-, g xg -0.11, K, r,p'.1g '- , j- , ' 1' W ' ' ' ' L ' 'fi ff? -' ' 4 tain. ?' '+P -QU-1' A1'M'l5 . ' F5 9 4 . ,if ' . ,' J. U' I ' .2 . J x ' 1 'ip' 1-'j.ju. ' ig ff--,a,L. '-f' 'f f kg V. ,Q 'Eu 55' if ' 4 ..' -,L-J L W A - + . f fig 5 1' f ' vii ' '?S ' - A . -va 5il .v'R 1 1i1f'4Ai 5'.: lfawff- Ji L-.iENt'm U-A ' If ,Q-. ' . ' ' ., ,a '.'L ' , -',h ', 4' 1 -lv. ' ' ,. t in f, ' 'E U H -fQ.w.g..J- Lf - .,i '.'.'. -5 . - . ,iwftalf ' 'W' , K Q ,5 f'T!',4'+' fl K- f V' 1, F - '-H ,1 mfvrf' ff 'L 'C , iv? fre ' e lv Q 'il ' LW 1'f-.inf b -swerf . , TW V W,-f'e: v 1+ H '..g,afwv ' fwfil-wk.'f-if .-ffs'f.1f' ,fwfv-5,2 W' N, , ',-15.4 ,1.s--- - V 'f 1 .,- x - . 'Mt 1 , .- . ..,. 5-sr. if Yi A 5 -Q -'f n,. 'ii 'MQ' A M . .5QY:w, -f Q f.- 1.-'fill' 1-MLYT'- ' , '. i 5 'arf' ' ' ' 3' 'V uQ2.-.,'- .- 'f . ' Wagga' ' H , a Fr 'W u - 1 K3-1 35, ik .eff - 1 , 'X Mfkvlp-H 7h -:'1'--fi--' 4 s - 5... -. -f'-a t -V V, .V 'Eg 31 .. eL.u.m.2' s. .xi . .v1. ' J.-' bww... 4 A-if :A 4 'lx 4- '. n.. Q ,fu-rJ,AM7v ,xi XQX ,HIM f af- 1, 3 'Al Mig tg fn M if 'MH U Jr- w E4 'gwagx' 1 'S 1 I 55 L V' R :.f'f5 Wmixik ' A LL 1. v , mx-L ' 1 ',.x 1 . ,'. N ' . Jn 'w .' - ' IX 'fs ya- 2 - nv ,. 'F .. . . Qu F' ' QLW rx ,rm 'N I V 1? '11, ,,'g.',1a.,,'.,.t'n 23,11 nn. sg ,I 7? IN. R F.. A Yi ' ' V. . Fil 75' - . ' ef A , ff 3 1.-'