Nimitz (CVN 68) - Naval Cruise Book

Text from Pages 1 - 534 of the 1996 volume:

' f - K -- -Y - ' Q-17'-K--QAYLWL--74,15 +4-- 5:5 Vi-if., 1 x f 4-+A--K ' - gg' 7 1, VQn1,,..,,.,,,,,-A I , :Q H.-aqg,,v,,:,:j:,51..,,.1n7egr:1i ,, gg, . 1. zgiiffxh . 1.14: .ff--vw'-rf-W df- A I . , -V , A ,iv f .- I -- - 4 A 'V I H' . . A .- 'V' I 1 M ,A an figural K. x H..- . , g-.,,,, ,Av .. ,xl Y , XA, , . 'S.vV Wm X I I ,fn 4 f ar PW UAQYL - JY E-it L 06 'kdl lr 42 .J-f MAA 46 Wi wa 44 f -.sq-.-5 ,M -,,,. 7 32 29V . I bi .ff V J' .1 M. V, t K, fa' ianu Ugg f 4 , 1 ' l , y 2f? 'wy , l ' y 7 V y V www y Q 2, n V 4 W g,TXn'WM,V hJQJlI,,,rW4,'VV5fs Qyj,A , MX WQ,y I ,1 i gi n,f A .wav ' 5.wqii92Qe'f:V,1xbwWsifff Mel 21 1 'G' if Kvyv lm 7 p2 , nwwfauwrwmw G W V V'mw 20 W1 , g , .W y y' 4,,,W fy lj, .,,, .,.,, Z .oi,w,,.g ,,,, m'.,. ,fl y i E V, e,M,M' .. -ln V f V. '- -p, 1 , - V 7 W 50 ' . ii I , my V Kwan, n V Mnfh fb O i fm Y ts ' as 4V. .,. 4 V' W l 'naajmrunr gg 37 f ' I nomar! war , 5? J m 2 ,af M In g mf 42 Q' .V V Vg .5 . V f 75 24 I 2 V' A 1 92 Q0 , m 1 m .. , 4 'M 9, 3 f ym 'b ,.Hr 2 , Pt Tumor -l l f 37 f 82 42 If , .v,. ..,,,, , ji L gig 4 sl, V. 'MJ -.nv wh ,.x3il5fi' h fgkm aggi I3EPARUTAENTWDFWH4EfVAVY fix. 45 i. use Numrzccvw em wo ne 96697-zazo ,A R :SL Jvn WV,y ,, QW 20 May 96 sri twsulixgffi. -f ' MEMORANDUM FROM THE COMMANDING OFFICER TEAMWORK - A TRADITION Since her commissioning on May 3, 1975, USS NIMITZ CCVN 685 and her embarked air wings have been making history while building a distinguished legacy of service as front line , guardians of our national security. As you review the pages of this book, you will see how the tradition of Nteamworkn continues to be the defining characteristic of NIMITZXNINE as they proudly lead the world's most powerful class of warship and provide the country with the single most capable and flexible force in its arsenal. f Note the pride, 'i the'spirit and the professionalism of the men and women who serve aboard NIMITZXNINE. Although operating our nation's most moderniand sophisticated aircraft and ship Systems, the driving force ofQthe shiplair wing team consists of these proud, talented andgdedicated Sailors and Marines who come from diverse social, aaggamis and ethnic backgrounds, reflecting the VGIY GSSSHCG of 259355553 nstiQ9s9hsY i.l,nn fspisssnpa They bond U09eUheff Work aQQf??5iU7ha?dY7aU57W3kQ5?QQl?S?HSHQrifiCeS in H mos t nob fig e a1'IdV ess ion - count ry and suppcri Oi Peasaeindiggggggmgthroughout the Wdf1dQ' L-f Whether WvrkiaiiihisagbsihsdQ6i?hdST5f5en 5X?e3?iY?'ShiPYafd 'ln' .-iAi mainiinadssfQisfigbfiifiiisssigssiHQQE???Qitbsfslbskffiainihgl duriisssrezsevlOywsnslwsakihssissaikssvsadinslfeftfeubledfersas. in dfaiinnnnssansafthezshinisiaiwiasiaeamispitgmizeS+teamwsrk .a Vlii inf SVGTQEHEUQEEUEY Qs- FisQ55Q????iHQieR9H??s?EQFQQQQASish Plant? C0 CO0rdf55ETh9i?He2WQfiQ3S?mQ5?iQQQ?iiiiiissgiaeiaibmbifiSYSUemS OrsanizatienrabeigeIViD3kQYQEQQ5iQQH?Q?3lgiiiissiybihbfflyins hundreds QfinissibnsfFHEYEEQQHHXQHEKEQQiiiiigiiiiabfalmosu 6,000 Shipmabesfiisamwsrk isQQEEEQQQHEEQQQHQQEQEEQQEQEQHQT599CeSSful mission Hcdsmali5hmeQ?iE5NQKQ5?siiQE?QQ?WQ?lQEi5Q?sSQWQFK Wore neceSSaryssfadsasiiiidsgiiiasdiisE?hs5???Wi6iiaQ5?iFsisigfcaffieI and her SWesikiiisiiiiiagii255332523355??f??iiQE5E?3?E?f .V-' NIMITZWNiNE5iSQ5?Q?s?E?QMiPidifiwinsiigiiiiiwhei makes H shipfairanis?i?5?m?Qi???EiS?i?S?Cf?Wf??PQi?hssQ?QW?bhaUgmanned NIMIT2!NiNBiadsiHsfWEsTsaeacrulaeeiaasesssiswahsffinsst,the .VlV Ship has evefggnownanavTeamworkeagTraditionHgsummarisedftneir every effort'asabhisawssnifiGeese??sQfHUi?sQW?Q?3F5W5fE?H5if'HatiOH'S call and EHKe5sheisieiassIaQ5Bws?iQsisgmesiiimsxhaxitage- '-., -.'.-,. 1.31 ',-.-. U Q 5, ' 1 ' Eli. 1' -fx-,..X1.QJqf,f- , 1Li.a..e:ig' f.3T.-YiTf:1i'ii1T5i,,,,Xf,H-5yffX,'f,Av W. v f --fX,fm.Xff X X X i XM, - X 'XJKAX I ,fxx -X X XFX X XA fd X X X X X X ff X ' XL Wifmv XXX' XJ XXXX XV 1 1 R X -- fg X X X ' X X X X' X 'X 1 WX NX X' j W W X - X X. X X X X ,X X X X X X X X X XX X X XX - I -K xx! X A .v X X X X! X uf' 1 X X X - xxvbf, xx-bf. VX XYX 71 XA XX A ,X Y v , f X M'-X i Xi iii fi X U W X ' X X X-- X X -X LJ L W- -- X ' W X X X ' ' f ' FX 1 XX ' - L H-XX ,X ,X X , X .A Xf X- X ,W-, X X Wi f X 1 X - X X X X X ' . X Q X X E X 1 E W4 X X X J X X H XX X X XXfX1!Xig XX X XXX XW 1 X X X F 1 , I X3 X ' X 1 X X 3 1 Q .X K ' X X X ! LX-if-A-if Q A RVN X 'MX X71 :WX Y' X ' X il M3 Xmmfrn?-X XJ 1, 'X 4, V iw, X ,X ,XX X XX. ,X , , X XX XXXXXX XF XX '5'X?'f yu Xlma X.zXX2XXwuXXXXz .fg? X2 XXXXXH mu lv QXXWX f3f1XXXiXfMl L XXXXXXUXQ 'Q,X1X.X3hf MXMXXQXUX , F U! , ,XX jf -X-ff. fXfXXff'X7 wr 5 ,J A ,J H ,, H V V 1, 1 ,A , ,, X, 15.5135 , , 3, i X. X, lfwivjh il 3 5: .XX 7lLl A .XX Xp zu Q-X,L'r XX .XX XX H1113 XQX P 31,':gX.XwXX:gXJg2' XQXXXXXQ- XQXXXXUQXXXXXXljXgUXg,Q gXXU1X,Qj XX ,my X ' '-XEXXU ff: rms X X1 'Q XXXXXQ-.MAX XXLS XLX0 h2iXr.X'uu 11XWbXwXXi W1 'X 2wHX1Hwf AX MXXSXXGXXXXXX' ' fm 3'3C'5Lxf'3l1,f? Qu??llHJ'X XV1UliX'XUll7l QQQXXLHQXQ '. TXDJXV X, 7XXXil'X l XX. ' X K -3 'X f, .-,X. X' X- X ' pf 5: : VX 7 ,TV X' - 'LY1:,,-1 ' f 14 XgXX-XXXX1, 21. X Ldv- XXX. uw. 2 X.fXX.XzXXxfX. Xe !.oX:a2 u XIXXXXQN QXQJXXXIXXXQXXQ-,H1X 1,553 nn X XX , X . Q 'X ,ax , ,gg I , W A , L , 5, XXY X ' fi' ,viii XX ,.Xg, , CQQQFN mm XpXa2XXLXX.XiXXX.X 3111111 X QXXXXXSX JSXQDMUUE, k?LD'Xl.llliX sew mme D gf w if .3 ,g 1 5, - q, X 35- ,XXX , XX F . . , Hg X .r ,Y Jn- T, . ,, '?'9XiH-QQf?nU!ffi ,ug 'XEAEXXQQX PL 9m,Xr.XXQ 1,1W.lfL1Z3,X.S-Wi, n X?sfwXXXw XDUXQQXXX QXUUQXWX, lv fr-X X ..XX Xl... XXX vw ' Xf:XX,.XrXf'1rXXfX, V L91 Iv -:-v- A ' ,J -n,,?..4,- ,ff Y, ,. , -.1 .- .,,. df. , '1X'.w,..j:, . ,Xfpl ,.X :X XX'I1I!5'f'-X. XXX- X X ,X f . X X ' V14 ir 4 A412 1' 443 ,NQQ jyfi? XI.. , , X 71' Xwfl l r ?'fXL'1'XXW XXX, 1 'MC' X' XX 9 lr' X Xl 'I ' 'fmt XNWJ5' -gfr:N.,,,, , -,,,., j,. ll'lXl.Hl.k.llxg!UX2l N':f A9-H UQLWQJ Q fb X X,X:Xr,, X ,J ' , X fXXX,3XX X mug! W X! . y. 5 Z R V .,,, Af-,mfi,.,,XX X' , M4 J' ,X ,Www V,-: X24 ff ,X 1 4 4, I f V 1, X-A fi gm 1. 3, s E Z 6 X X X ,X , I R , 2- X '-. I ' V .XM VL X ,, Xl-,. 1 k X ? X. , 'Q 'GQKJ 22' X X 0' W P I x HS M 4, .,- w f f, ,, 4 ,, V V ,U 1 , Q lf! ' - Q M., 1 , '-Li -,. N Y Q H Y ' inxqk xi!! ' V x--an X ' if Q9 Ni Vikzriv f' 0.1 Av? U .I I t '11 X I I .VH N' .IQ M th . x f ., , gk ' 4' f 9 Mx J' .nf V I 0 r 1 ' 'r' ' A- N egg! :I h ! 4,3 f -,--'Aff '41 Ax '5-fn-cp: , gg, -1r:,,, k.7:,,,,k W, -2- 5-T,,,l.,,.,F W . Q.. . 4 . ,- 1-X 1 Af-, -7-V .,.,W1sluuu.w-ga ,,,fi,.gnn- Ui.. Y. Ii -vw Vin A -iw S 1 :iv Jil' , C5 134 A X ' ' . M Fixx X 1 , 1' iw: ' iii? in ji Qfai' Mx -:X tt Y ,-Ii.,-1, gg' w 3 I ' Q: T'-'T - HT V4 f f fx X 'wi'K w 7 f' ff f , Af mlffl N l I, vifffj X fN 1 Q Xl Axwff ' x ?11H ,1: ,Q . ff f 'E W UWMWHlf iHHV1 U - L1 U -A VCL U L -QJJ ag W fa- js Md w U M V XM!! U 1 L! ,f ' ,xx X-,A X I gl . .,,Y ,, ,. f, W lf- Y -F ' LY-f I-' 2, U , 3 wew:gguHn us umm Q LmNw:v:f wpliue 19 uaQ 1Q-ww M bffwmsgg Q-x 1i,ufQ1Lfmg4 W.Q3WUlEf'?flH1w 23 i uMmmm , , . 'Q , . , , i Wai qi, . NY !Uhii1D'G1!'I-Qljf. wmmdl my gQ1'um1Qfo,1s1e, LAL uw Q1u 1aH wsfomr 'Hhs Le EieYEMi'7C23 l5JuLwl4uL:1' NMDff1M I 'lg ns filieui mf Wem1gmw Qfir L5 NHMM'lV'.Z AsLmgQfwcQaifl,gl?E1Gr :uu fu4 2 Lum v--gmwi w Qfwwur fw mu m m g QXQJU ,ew-f-a Lfw S' ' U ' E' ' ' ' ' ' 'Q' 'Bei A H -.p, 4 Wwfmnwm 1 nc n ,all 'iiflihwn :iff 4 X r , X 3 Q V144 4 'Y ki 'r mx A I ',1 k f -A J wa A U a Q 1 x n 1 'i A 1' A .iklf -A . 4 L 'fifxifi ' . Q ' 12' If ' '-1-., J QQ, Q -VET, 'fi ,gm we f Y, ' 54: V F.-ii-, .,., wi-fl, , v :V '12, 5514, 5 'TQK Qi? , fi! 91, ' f '5'f,.L L. 3, +1 7 351,134 3 'FA 41.4, f fn 5 , ,V Siyijg 3 ' . 14-'Av- ,Z., 'Q - ' iifsfw A f??E,Q. , . :ff 131' fa A, x 3 ,T 4. ' 4. , fmmn ,f, ,W V .,, fm f - 1 5 4 ifFf ag-4, g 'lwgff ii' J 1: ah: 566 .J ' AZ' ' 1. , , X, , . . Q: I ' K 'GX ' X.. I qifwzf. , X ' fl 'x',, ' 1 . -f7Xv1f .Tags '17 I 'Q fu ,K .1 .W, N x an 25-if ff---iQ' 1' fffffx' fl, ,552 M f., -5 1 a f i ? . , ! 1,3 ax f . i ' 1 t , il 'i xx-P-f , f T E V pg fy' K ,, ' . ,A . Ag 6 . 1 3' 24, . ',' ' t ,J 'rw' S , A ,f , f .j' fQ'b- - af 11 5231, 2, a. ' P ff l' xw.',,f ,n--' 1 W' L Q0 5 Q ?:::: 'ifk Teamwork Through in A .L mnmffrftzfotafff . Tvnwxwtttwf Lfiiaii' ft 11 'uf T. -,I-,M I. -. E If ' I F . , 1. 'tx , ll-A-,Tu f U I - LTB k LTB y LTG LT Korhom LT Prendergast LT Prescott LTR LTJG D LTJG F g LTJG H b ft LTJG N LTJG P 1 CWO3 McMasrerS LTT H P ,l i iiuu-v -ll,l,,'F '-659 -' L--ctw .6 .nf Ml, 1 -H wb llEEl.:.1s,, JKf'il,,L' LCDR Costello LCDR Scott 1!'tti:13f'2?i??'i1e-:ww mwttiwtimi . CDRB mgarten CDR Fischer LCDRH tr LT Buenve d LTP k mix TIITFL M ' ,M j Aff' T l!ggp,1,,.ff f , ', 1 if HQ!!! ffwfc CAPTL d ig LCDRI miya LTB ll ENSE p t -' I ggi- N 61? 1' ' Honor 3. ,, . IQIIIIIIIII I Q ' or LCDR Costello LT Rayner LT Rowan LTJG Chopek LTJG Daily LTJG Gacsa LTJG Lefrak LTJG Nelson ENS Trujillo EMCM Hillis EWC Wilson ATI Jones ATI Santos PRI Trujillo OS2 Ashley AT2 Condict AE2 Holzhuter ABF2 Shea AT2 Woods AMS3 Buno AT3 Garcia AMS3 McCain AD3 Wollesen MACS Cooksey MMC McRae ATI Beers DSI Freeley AKI Moss HM2 Bailey DC2 Sheets E:-721 :II5-:av -lllgwtkk auyy lla E I-1, 4184 1'3- WA RFB EMC Baluyot HTC Brown ABEC Helmuth GMC Hurtt MMC McIntyre ABFC Place SMI Bryant AEI Burke FCI Carson DCI Charlton AEI Garcia EMI Gilbert ATI Landolt ABEI Machaby ACI Matherly OSI Meadows AOI Moore AEI Rhoiney ATI Schrack MMI Sisco ACI Stevens ATI Stewart ATI Strawbridge A01 Strong AEI Van Sickel A01 Vanmeegroot ADI Warner AMS2 Abides AE2 Acevedo SM2 Anspach AT2 Bless AE2 Brown AK2 Capatan AT2 Carlborg AZ2 Carrolan ET2 Christopher ET2 Darfler EW2 Del Sasso BM2 Fracker AC2 Garcia AMS2 Harden PR2 Hazard AE2 Huff AT2 Hutcheson YN2 Ladson AD2 Marte AW2 McCluskey AT2 Peterson AE2 Sterling 0S2 Sushka AZ2 Tackett YN2 Thomas AMS2 Tumey PH2 Walsh AMS2 Ybarra AT3 Ahmed PR3 Amieva PR3 Barkley A03 Bates AMH3 Bellin AE3 Cabrera A03 Carrion ABF3 Cone AT3 Coryell AT3 Creech AZ3 Elliot AT3 Good PH3 Harpell AT3 J org AT3 Kirk ABH3 Lovejoy AT3 Lucy AT3 Mike A03 Purcell YN3 Ryan AMS3 Springman AE3 Wallace PR3 Ward ATAN Gnik ADAN Gutierrez ATAN Thompson 'ir' mlm:-'LfV ' r F ' I' . I ' ,,,'f'--T' . yr' '-- -,, ,I ' . - I I , YNCS Flores HMCS LaRose PNC Bareng MRC Dennis AZC Gilman AOC Hook HMC Mullen YNC Orr RMC Parent ATC Snyder AMSI Aguilar AMSI Balaoing ADI Bonilla MRI Bruce ETI Bundgard CTMI Calebaugh ETI Decker ADI Enriquez LNI Giles DPI Gregoire ADI Henson RMI Kisor EMI Knuth CTRI McKee ADI Nicholson AEI Patterson ADI Potter RMI Reynolds MMI Shaw HMI Shepard IC2 Briggs ET2 Ferguson BM2 Fraker DS2 Hollinger MR2 Jones OS2 Lamarche ET3 Allen 0S3 Michell ET3 Phelps 0S3 Ruxer 'Nm ACC Salter A01 Hawkins SKI Ruskamp PHI Toney PR2 Armstrong AG2 Collin MM2 Hervey AMS2 Saylors A02 Williams AT3 Bierman PR3 Frith PR3 Magnetta PH3 Watson ATC Johnson HMI Barth- PNI Eslao ABEI Melendez AK2 Albright AW2 Roberts I P4 I 'JL ri - . rd' 7 Tl.: 7-: .,f,,-, .,,,,,P,.,,,i1fM,, -gAk,mr. ,, if 'fig if -km'-W--f-'T j:'X' V iw i I ' V 7'p- Q' 1 V W if N 1 i lf' i r' + . lj M if W i Xu f'R,xl + IW l 1 l'I , , 1 'ff-xifx 1 5 L-.5 lffx , W K-fair'-:-'X ' 3 Xxx 5X4Ql?fl W 5- L-, , M512-mg!.QL,fQf dl fum f . .1 flag- , A MLM ., - 1 1 A -4 , w Y' cj I C? 1 Q 1 ff? 1 Lf, ,. M1145 .. f W , W... , Q Mmym- ff I r' J if 4 ' ..f. - v x,. ,wh V Vw , I jf, . , .,. , . f, ?,1'f' A Ve- 'Q .L TE, Az 49 mqit I xx WJ fa- M ffl V 'f 'A 1 mia .Ishi- P 5 . ,5 1, , if ng A Fw , I wil, I Qi' 9 ., ff 'Xi .:f...:J4a..:L'::-:c:.. :ex -f.,: , Q, 1, :: ,f,.i,,-,Nqr , -,,1q.f,,.L::g ' ,:,Q,.,pg.g,,:f 1-1-Llw. ,5.5: ,,g, ,Y ' F , ,,, V., -3.11 :zv'fr:.f13.hp- pf. ,Jvnlvri . ' 'if - f-fu, ,,,- ln. x Vi, ,fx w A A 3 N 4 x w , ' , ' :N rd-- y , . ,V w X x- 4 ,nm F U -r 1 :fly N , 1 , ,F .LM . U ml, Q-I' 'I M. ,W V w . , .r 1 f ' 1 ' 'wx fx ' li-1 - w 1 , 'Ax 41 W w W N w 1 N 1 W , K' 'T W 'iWn'I1I 'lAWVlx ,NX V ef1,.,L.n. x-.- fm 'V' W llV'hi-'OL vw v,.r, x'f V fl-f.l.J,f75E' Aw Y ,M ,, H1 4, 74' we-u'5W'H ii? 1 'mn 1..-A , 1- L x :I ,A H i It A 1. S i 4' is 'W J 1 1 1 11 E-'12-ffx-1-if--112-53101-ff--SHN -..V 1 :ever-Y.iT1: ::':,,:': Y ,.-emi ' Y-'ff :.:1rA'::--Ashe-sQnT.::,.,,1 'Q j ' ' , i,L,',,.-,,,,, '-- ,, g:v 1TZ:,.,'f p,1,.-f,,,f..-LJ, 1' ffsllfy-Y. ' 1 W Y, 1 1 P'-W ff H 1 H- . - - 1-1 K: V K . Rx '11 1 X, ff 1 1 1 H1 'N1 1 1 .1 ,1 1 1 1 ,1 f 1 --- 1 1 1 1 . 1 1 1 1 1 1 1 1 1 1 1 PW1, '51 11 11 ,1 11 111, ff- ff 1 1 1 1 , 1 1 1 1 1 1 1 X 4 'ir 171 1-1 1v1 'i1 1g i1 1,1 NQ 'W 1 1 '1 , 1 1 '1 T l 11 11 1 11 1 Q f, 11 11 11 1131 11 1 11'11111,111111'111 1 1 1f W1 X1 ,,,, XR LQK1 1 ,i1 1-i1 ' 1771 ,W ,, 1---1 1 1 , , 111- 7 1 1 ' 71 ,Q 17771 1 ' fx . I 1 1 1111 7'. 1 1 1 I 1 1 1 1 1 , 1 1 Y 1 1 1 1' 1111111111111111111 1 1 1 K 1 1 1 1 1 1 1 1 1 1 1 jg 1 11 11 1 1111 11 1111311 i1 1Y 4 151 W1 1A, 1? ,V 171 1,1 wg 1 ff' Y 11 11. 11 1i11L 11V 1' 1111 QI 111,119-11-g',f1,.110-11113151 P11 11 1 11-1W?13'11?if1l?e1'i5S3G9lf?iild5QJ10M3QL' ' 1 1 1 ,111-':1im'f1S2 7111111 '1 11 1515161111 1,1 1111131 511 u1!'1U1511 511111511 1CfQK1lmLfl1fLYJlQH1115 1 ,1 , , 11. f111114'1f-- 1 U-.1 1 111 111w1111111i.v.j1:f'111 1111 3, 1f111Qfi1z 13131 111: 111 rf: 111115111 11111g1 g11111111sA,O1Jl1.lG5y1LQg1R1'fQ1Q121Q11, Q' 1 ,111 1 V 1, 1 V- ,Tig ,111 ,Q L I' ,M 11, 1 1 111111 A 211111, 1:1 1 ij1111131.1,11f1,1g'jZ'1..-g Q1:11g1 Q111,g1.11 f1g1,U1c15:gy:1g1yLfQy MfQl.jQfQ1L951i5lQ111L1.- 1 'wijf 1 N ' ' ' if151.L?11'11'111-11'11u1i.ff1'1 ' 1 111 151111111111ui1n'1iMQ1s11Gl5lE1iW7G'i-iEii1i6i1121Q 1 ,,,, 5 g 1 --'- Y , ,, YV , ,W , Y HWY VW .Y ..--MV , .,......,..., ,, .A. ,V A , -YM-WMA . , V V J V Y J, 'Y'-7' Y ' ' -.Q ' .Twin ,1,,.,,m'V,:?-f,'Xi ? '4:: Wie l'?l'5 9 '4-l'5f:'QfV ' -W 44? --Y -T 52- fh f rf.: V-iran?-1 -3 ' ewff Winlqezx... ' Y 1 ,vnu arg, VV T , , U . ., xv f :,',-V.:f , . v .vfiffrf Q JAY rw- . , 1. .-9 1, :wr .m-,- A P2 Af!1Y.--4,-,-..-- ' V . 4 ' M N- : ' f ., V new-, yi VV gg -1I'2g3,,2:rfQ4V5x X44 I' 'b .54 WA N mf, . 3 QQQ . r , 'ii' ' '- 1... Eff? 4- Q f w' 3 fn' 'Y ' . . ,JK 11: . ig' A A p,g5.ig3,,, , 'V . ,. T, . , , , a ,-.Ve QV , 5 mwlwy, 1- P2 -, 5' 2 fa F ,, .--N 11 is 53' f . '31 fx ft ' 4. N f I Q-VAQ. 1? ' liL?i?x'!fi ' f 1 Si: f,2,vSf'7 1. 'Aff . -N XX, W 'gf J 3 ' 3 E ,VN f,,,,qVggggm:, 1 f fx- ,lG?6T?v','. W N.: 035 5,, , . 5 ig A ' 'X 'N f iq'-1 ' fs- '9 9 0 9 7' f ,, 5 9 A ' , V -J 4 A r Q X ' I , .v xg X, is i P -V,V- Q2 N 2 W ff: V 1 1 . ' i V fy' f ,.yf,VH' ' gjmri. V 9 'vii 2 ' ,4zix'f ifff-Wgdfpzfig il 3 2 Z 5 uf-2-F . x ,,gy,5f.,,.,V1 A A . '-V ff: 'ff I f V fi ,qw-A 3 -.Wx 15317 f E 1 gf, - , :,.:z.,: Q .,.,5qg' I I K- 'K ':'1 X , Al K N ,. ,H I ' A ' KZ A L . ' ,I K 1' , , A yr' -7191 L... V 71 ,L l . 'n, , , K , 3 V .V wi L 1'1,ynV V L+ 'I gl 1,1 Fl 1 !,.1!'2if. ' .4 A V :X Z' ' . 0 1 V N , I 5 1 VV f V : , L, - . . , ., 4 '1. I l1V'!. 7. l V V. ,L-' .ix km I' LL' 1'!YQ!. I . II I'-,il !Y1I'l.j1'1 - I , ,. -N H 1 , V A . - , ' z if V Hui V 4:-.L'1,:s.H 1 1 ' ,Q -, 11 j, 12, w g1 afAi 'wr-g1,,f:'I wg ,ravi ff f mfw - ' f, 5- 2 LTV , m m ' if' ' 4 'Z -7 ff5 . ,f?:',, vf1f:'?Yl'f6hLiEB V I' x VfV 5f,7i. -Zf5.4:1Zf'1m:'.,'f Cf? :Qif5:'1,yfV.'7wC cilf-iff? ssf ,- ff x .,.,.gVVs: V ,?-'-ef..:.gi1 ,, ,-,f - - fm-f7,Lfff:v,s'eww-wx-ff ffVf'-wQff:-f.V--.-,f,..:2gf,1: - 'f -. V 4 .f.fEv-wa-W ,fi ' x -vi-27 , . -. f X 2-f-f572fELf'.17196Q. -V 'K V, 4 1 G w .'-QV-Y-.-gv:1z5f,.. :Kg ,HVAV V V3.4 5543, V, -A,4g.,4,V::-yjx2q'hJ 235,-:5g,: . ' ' ' ' - . , - V ' A V V1-V' i 431 'is ff' ' .194 'Y ' azf' ,. g - f , bw fn, -' fy ,sg V 1, +V V -M, -1-V-W if - V sf k zihzig,-:Q-:5VL' ff, l,Vf,:5,gS, c.,,,jffV,fY' 'civwg Wg WW ,ff . b5Me,p,V, f 1,,'f,-'yfm 111625 - 'f,,1g,21f, ,,, 1559? , fzV:v:cV1, ,fi - Q Mr-nv V ,-Q New -1.5 ytmw LV 1 gf, ye, :pm - ' V, hVwam: . - ,. f ,, -1-vM frfV,m K aw 4 .: 1, fm , A, , , ,, V , mm 1-. ,, V ,. 4, ,, Lv M, ,- ff ' -V ,.,,,,. M., .,., ,, , VV JV' . , P139 ,:.',fww4?M' 'v www' 1,-,-,,-my-.. sue -f .Mali f- ., .,,. ' V1-Li? 5' V J? ' '-,251 ? ?4E ' W, N-'YT , .-S? ' N A X mf If J' f , 'fa 1 Zia' 42 , is yu , z N , if -. .fa I.. xi' :FFT-'UQVQVQ'-31fw ff -.Rfb -f-,T V -Y V - W -.T...- 1-X-zfrirr-, -me' , ::.x4:::v.: V.- --4 g 'fi'L1li...-,f 5, ,,Tuf,Q ,T 'I' 1? '..f,,.i Yffggi, rzwff? .,',. ,Lfw.,1xllll1- , ,Y -fl'--nf-'4': :'ff' my -- fmxhg, , w W Af ' ' 1 ' ' , ' V--.K wx 5, K ' 3 1 AJ i llful 1 ' W ' XR 3 V MWA? ' , X-xg U' 1 ' w N N Y j l: L Wulf. 1 1 Y W wg ir , ,dw X114- camer l L ,j.r5,sxKx ff,-4Z',l:iNf3.xN My 1 Nph 7th, 1941 .,,,M-uv.,,q hyuy .L L .1 E T e 5 QWALJ fv.-fr-,.1' 'G I lx W . . 4 'P D N, CZ..T.x,, f' A . ' Q ,S 1 xx , -, pf- W . '41 x 5 X x .' V - k ::gQsg,,,,f , JIMMY Y, V W4 N lm ' ' ,, ,a mf I Y ' x W , X ,.1, X A-1-14.3 H , 1 , Y P X x W 1 1 X I N V4 w , ' ' ' ' w ,, ' , , f 4 .,.,.z 721- , 'x Lg-1. nnV:',Lx'q?Qk Al 1429 , 5' L mirgg ivifff x wuvxg FLEA- .Oi v S i - A li-L3if4liifJD1liV 2 QI x WYE. 5 if 4 ., ll! vXQsL,xQLQ . , , fl, N E931 una ' fm, ,V -X-:wi CD AXE fi' W viii 'Sax L cfbirmx' . fn, ..i- - Auugilwgmlr 1 2 f-A EL-gi, Vixlff? is 'f-., 'ui 4 X .-. K... s, 5, -F' vm 4. :A .xx , Lai f Y --Huw. ,- .noni ggw-u' Aw N 'hw qw w w, ,Q-pw WQEEQQ ww.. av ffwyn f A fdf' Q g...aM v ....llg,, fx nu av .M :wa--I-,+P ,g ff! ,gy vu nam, mmf 4146 nf M xzmrn 1 H . .. f I -fn-hm-1 'Q 1 ' fvl Qld fl Q- V- :ff M -: -'J If ' f W W 4 , I gfhwf' , , 'I , Nui ' - I I 4403, ,. , :pf 5- ey! ll y f ' ., -'WH ,, -.. 'Ve 55 ' f' . ' Z kf'fw HQ' x .' 'fr ' -4- 1 5. 1 ,. V , fm-fwwllnq , -, mug... A ' f- . ' x ' 7 'F'?5f. '- Q' H Wakg2w..,.!..:V.LvM- --Muf.L'..,gW.,.,M. , ' - in X, ' ' Q ,I , . W N,4f.M',v.-M.,-JW .vw M 4' -G u.tf'wn.f'-3,2Q.,'f5 ' .., Agp. A 1 .uw-' n f . 1 , Q 1 V , 6 IUIIIJIIU v 1 T' .,,,,,,ai'4f,.-ua V ws. ,multi -in U 3 , Q 1 W1-N.. 'Q ll Vw.. C ,. fly, P mb rked airc aft C 1'1'1e N X 0 l ' I The E-20+ Hawkeye is an early warning, alleweather delfensive aircraft with a distinctive rotating radar dome. Specialized computers, !'i80l9?S and communications equipment in the Ee2C+ are used to Pfvvlde strike and traffic control, air surveillance, search and rescue guldiellee, NEWER? tional assistance and communications relay. The Ee2C+, Illclillamefl the Hummer, is powered by two 5,100 hp Allison turboprop'engf1DErS, which drive foureblsded, full-feathering, reversible constantespeed pmpellem- The Hawkeye is flown by Carrier Airborne Early Warning Squadron lll2 based at Naval Air Station, Miramar, Calif. The A-6E Intruder is a low-level attack bomber speciiircally designed to deliver a variety of ordnance on targetscompletely obscured by inclem- ent weather or darkness. Flown by a crew of two, and powered by two jet engines, the A-6E is equipped with a sophisticated weapons system and can carry five 2,000-pound general-purpose bombs or a maximum of twenty-eight 500-pound bombs. The A-6E can also be modified for use as an airborne tanker with the capability to carry up to 26,000epounds of jet fuel. The A-6E is flown by Attack Squadron 165 based at Naval Air Station, Whidbey Island, Wash. The EA-6B Prowler is a four-seat all-weather jet designed specifically for use in tactical eletronic warfare. Powered by two Pratt do Whitney J 52- P-408 turbojet engines and having a level flying speed in excess of 500 knots. The Prowler uses sensitive receivers and high-powerjammers and an effective combination to deny the enemy use of much of their radar and radio equipment. The sophisticated and complex electronic systems of the EA-6B makes the Prowler one ofthe most expensive aircraft in the air wing. The EA-6B is flown by Tacticallfllectronic Warfare Squadron 138, based at Naval Air Station, Vlfhidbey Island, Wash. The F-14A Tomcat is the Navy's principal fighter-interceptor. The Tomcat is a two-seat, twin-engine all-weather aircraft capable of flying at almost twice the speed of sound. It also features a variable, swept wing for increased maneuverability and endurance. The Tomcat can carry long- range Phoenix missiles in addition to Sparrow, HARM and Sidewinder missiles. Flying the F-14A are fighter squadrons VF-24 and VF-21 1 based at Naval Air Station, Miramar, Calif. it NN 18 Qs ir Wing N N The S-3B Viking, an anti-submarine warfare aircraft, provides an ideal balance of ASW systems integration and computer technology to enable it to collect, process, interpret and store data. A jet-powered, twin-engine aircraft, the Viking carries surface and sub-surface search equipment including sonobuoys, high-resolution radar, infrared and magnetic anomaly detectors. The Viking is used primarily for search missions in the vicinity of the carrier task force. The Viking is flown by VS-33. An electronic support version, the ES-3A Shadow,', is flown by VQ-5. The FXA-18C is the nation's first strike fighter designed for traditional strike applications without compromising its fighter capabilities. NIMITZ operates with the single-seat F!A-18C night-attack version which has the same capability at night as current aircraft have by day using a thermal image navigation set and a night-vision system. Flying the Hornets are Fighter-Attack Squadrons VFA-146 and VFA-147 based at Naval Air Station, Lemoore, Calif. The pilots and aircrew of Fleet Logistics Support Squadron Three Zero CVRC-305 Det Four fly the C-2A Greyhound Affectionately known as the COD CCarrier Onboard Deliveiyl, the C-2A is the logistics workhorse ofthe fleet. Able to fly over 1 ,000 nautical miles, the COD can carry loads up to 10,000 pounds or 26 passengers. VRC-30 is based out of Naval Air Station, North Island in Coronado, Calif. The SH-60F is designed to operate from carriers and replaces the SH-3H as the carrier battle group inner anti-submarine warfare zone helicopter. It employs a new, long-range active dipping sonar in . addition to sonobuoys to attack submarines. It also incorporates significant im- provements in reliability and maintainability, plus vastly improved tactical capabilities. The Seahawk is flown by Helicopter Anti-Subma- rine Squadron 8, based at Naval Air Station, North Island, Calif. . N mt? ?..,-xfL' ' ' fF-'5'-sw ff 4--iii! eff J 51-- W - -li,-417, - -H, ,YLgq1:f:W..,,::: .iriillwq-lnaeseqfi. ,,:,.., , Ju. I J v - W V.: 4 1,31 . ,. -ww V , , . t 'iq 'i A - -if-W-f'f :f.T3-iiE'.'ff Z'L1ff-V 4-g,E,f :vw ii, fi1iaa,iZ'S2Tf4' 'iifilfiilii -:iTj.T. A' 'P- ',,' i:1f.Qi'f -f.:i22i'i5:f:.,Q W - 2-, g'V' 1 w A 2 :..3' ' TRE- ffff- f 5-J E4.',1,' A , ,W W , is , L ,' '::f:Jz. 'wc-Q-:fQ3.,.' 7 1 K., qw 1, av,-pi rm w n , s gf' w 1 Vf f1:,1 Wy lg.. A 1 A ,, 5 ' T74 4. f. -H ,- ,V ' 'N F, ' N72 w 1 K W 'X 19,1 J, . w Q vs L if V . , C1 l UI w, ,L 1.4 , y ' xy ,1!1,Lljc' Ui ,mf wx 1. '- m , L ,IDWLQ-,'Qi,g 4 W, 'Y V ,. r., fb, ff D A Q, -'-. N-P--f Z' 551 N uv ML 14,51 XX., ----- .14 A ' Y-fiw , af: f LJ 23 V Ailu x A V12 ,. 1 ' L' ' ' Q A ' f Q ' ' 3- WEN!! df f ' A 1 .Q 1, mil aw1j:us f - G0 tim w if '11 'fm-1 YiA 1 -f '., f f : 1: IQ-tiki? , Q ..,.....,.,,,, -.fn - 1.- ,wi ,, ...... , 4 . may 1 I I 2 v Wi 3 B l f I I 1 w W I 4 ! 1 x I Q I I 1 w l Will! teSdi lliletlg a lloyd msSdl brief mrepui will Isis!! lege, 1 Lheli mdllq I mil nlalll u L ' . .1332 mildly 1, is 5 I .iii l Chief of Staff Commander Carrier Group SEVEN CaptainJoseph Enright Captain Joseph E. Enright, a native ofMcLean, Virginia, graduated from the United StatesNav al Academy in June 1 9 7 1 with a Bachelor of Science Degree in Applied Physics. He subsequently attended nuclear power training atBainbridge, Maryland, and West Milton, New York. In October 1972, following completion of submarine school in Groton, Connecticut, he reported to USS RAY CSSN 6535 where he served as Reactor Controls Assistant, Electrical Officer, and Damage Control Assistant. During his tour on RAY, Captain Enright participated in two North Atlantic and two Mediterranean deployments and completed submarine and Engineer Officer qualifica- tions. . ' In April 1976, after attending the Submarine Officer Advanced Course at Submarine School, Captain Enright reported to USS SAM HOUSTON CSSBN 6095 CGold5 where he served as Engineer Officer. for six polaris deterrent patrols. Upon completion of this tour in August 1979, he reported to the Nuclear Propulsion Examining Board on the staff of the Commander-In-Chief, U.S. Pacific Fleet. Following completion of Prospective Executive Officer training in May 1982, Captain Enright reported to USS MARIAN O G. VALLEJ O CSSBN 6585 CGold5 Where he served as Executive Officer. During this tour he completed two Trident deterrent patrols, an eighteen month refueling overhaul at Charleston Naval Shipyard and post-overhaul shakedown operations. In July 1985, Captain Enright reported to the Staff ofthe Director of Naval Nuclear Propulsion, U.S. Department of Energy, Washington, D.C., where he served as the Assistant for Enlisted Personnel and Training. After completion of Prospective Commanding Officer training, Captain Enright took command of USS HONOLULU ISSN 7 185 in May 1988. During his tour, Honolulu completed a Western Pacific deployment, two extended Northern Pacific operations and an Eastern Pacific deployment, and was twice awarded the Battle Efficiency E , From July 1991 to May 1993, Captain Enright served as the Deputy Director of the Submarine and Nuclear Power Division CPERS 425 of the Bureau of Naval Personnel. Captain Enright then served as Commander, Submarine Squadron SEVEN in Pearl Harbor, Hawaii, from June 1993 to June 1995 before reporting in July 1995 as Chief of Staff, Carrier Group SEVEN. Captain Enrightis awards include the Legion of . Merit ftwo awards5, Meritorious Service Medal Cthree awards5, Navy Commendation Medal I three aWards5. and various unit and camnaign awards, V Captain Enright, his wife, Judi, and their two chil- dren, Amanda and Joseph, currently reside in Coronado, California. N . i g . K . ' , h wif D - 23. Commanding Officer USS NIMITZ H Captain A.G. Harms, Jr. Captain Alfred G. Harms, Jr. is a native of central Illinois and graduated from the University of Illinois in 1971. He commissioned through the NROTC Program and was designated a Naval Flight Officer in May 1972. g 4 Captain Harms was first assigned to Attack Squadron ONE TWO EIGHT in Vifhidbey Island, Wa.shiington for fleet in the A-6 Intruder aircraft. He then joined Attack Squadron ONE FOUR FIVE in February 1973 and made two WestPac aboard USS RANGERCCV 615. In June 1975, he transferred to Texas ASLM University, College Station, Texas, Where he served as NROTC instructor and completed a Master of Science Degree in Statistics. In August 1978, Captain Harms reported to Attack Squadron FOUR TWO in Virginia Beach, Virgdnia for A-6 trainin . He then 'oined Attack S uadron ONE SEVEN SIX aboard USS INDEPENDENCECCV 625 and made both Mediterranean Maryland in June 198 1, he subsequently served at the Strike Aircraft Test Directorate ofthe Naval Air Test Center where he directed ordnance separation and advanced technology avionics projects. I 8' J Q V , Sea and Indian Ocean deployments. A distinguished graduate of the United States Naval Test Pilot School at Patuxent Riverill In A ril 1985 Captain Harms joined Attack Squadron SEVEN FIVE as Executive Otlicer He commanded the squadron fro f p , . . . , . c October 1986 to April 1988, and deployed aboard USS JOHN F. KENNEDYCCV 675 to the Mediterraneangea. After Completing Naval Nuclear Power Training, Captain Harms reported to USS ENTERPRISEICVN 655 and served Executive Officer from March 1990 to January 1992. During this time, ENTERPRISE completed a change ofhomeport California to Norfolk, Virginia, and commenced a 4-year nuclear refuelinglcomplex overhaul at the Newport News Shipbuilding Drydock Company, Newport News, Virginia. Captain Harms graduated from the NATO Defense College in Rome, Italy in July 1992. He their commanded SHREVEPORTCLPD 125'from December 1992 to May 1994, and deployed to the Mediterranean Sea and Indian Ocean in of peacekeeping and humanitarian reliefoperations in both Bosnia!Hersegovina and Somalia. He assumed command NIMITZ KCVN 685 on 26 August, 1994. r Captain Harms has accumulated over 3,000 flight hours and flown more than 20 models of tactical military aircraft during career. His personal awards include the Legion of Merit, the Meritorious Service Medal Ctwo awards5 and various other and unit commendations. He and his wife, Gina, reside in Bremerton, Washington. They have four children: KevinCLT, U.S- N BradC2nd LT, USMC5, Andy and Karen. I . 16 1 req: qi. qvfg 2 .. .., ff rg Jxzff? ' A X gtg!!! A , YYYV. ,, V ,,,.,,, i commander Destroyer Squadron TWENTYQTHREE Captain Barry Costello Captain Barry M. Costello is a native of Vermont. He attended Holy Cross College and was eemmissinned as an through the NROTC Program in 1973. His first assignment was as Communica ions .1 t' Off cer, Combat Information Center Officer and Navigateifen cnnsesb. p i' ' 1 P ll h 'he jr-edaJmLsDccterDegree After a tour at Navy Recruiting District, Boston, he attended Albany Law Schoo W ere e earn 1981 and was admitted to the New York State Bar. A He returned to the Surface Line Community in 1981, graduating from SWOS Department Plead Selifonl, and reported to the P Off e sfDestro er USS WHIPPLE CFF 10623 as Weapons Officer. This assignment was followed by additional sea tours as Gperations vie r .li . y Squadron FIVE and Executive Officer of USS HARRY W. HILL CDD 9863. A He then attended the College of Naval Command and Staff where he was selected as hondr Qtraduatre, graduated With Distinction, and earned a Master of Arts Degree in Foreign Affairs. Captain Costello's next assignment was as a Joint Planner in the Operational Plans and Interoperability Directorate CJ-71, the Joint Staff. He returned to sea as Commanding Officer of USS ELLIOT CDD 9675 in 1992, completing a Middle EastFnree deploymen and leading the ship to consecutive Battle Efficiency awards. A follow-on sea tour as the Assistant Chiefef fer Operations, Third Fleet Staff, preceded his current assignment as Commander, Destroyer Squadron TWENTY-THREE. Captain Costel1o's personal decorations include the Joint Meritorious Service Medal, the Meritorious ce Medal with two gold stars, and,-the Navy Commendation Medal with a gold star. ' , . Captain Costello is married to the former LuAnne Golomb-owski of Durango, Colorado. They have tive 80118, Aidan all Brendan. , GQ? , za Executive Officer USS January 96 Q Commander Eric C. Neidlinger Commander Eric Neidlinger, born in San Diego, California, entered the United States Naval Academy in 1972. He received his commission as an Ensign in June 1976, and reported to Fighter Squadron Forty-Three for further assignment to Eight training at NAS Pensacola in November 1976. He was designated a Naval Aviator in December 1977, and M NAS Qwarria, for training in the F-14 Tomcat . In March 1979, he reported to Fighter Squadron Forty-One, embarlted on board USS In January 1982, Commander Neidlinger reported for training at the U.S. Air Force Test Pilot Wheel at Edwards AFB, California. Upon graduation, he was assigned to the Naval Weapons Center, China Lake, California. lWlii.le at C, lie was assigned to the Advanced Common Intercept Missile Demonstration project and performed Weapons and software tests with the F!Af18 Hornet . In November 1985, Commander Neidlinger was assigned to Fighter Squadron Fourteen at Oceana, Virginia. During this tour, he was assigned as Operations Officer and Maintenance Officer, deploying on USS J DY QICV' 575. after temporary duty on the staff of Commander, Fighter Wing One, he was assigned to Air Test and Evaluation Squadmn Four, NAS Point Mugu, California in October 1988. While at VX-4, he performed operational testing of the T-45 'Gtoshawk ,, Fel , and initial evaluation ofthe Navy Advanced Tactical FighterfF-22 Lightning ll. He was eventually assigned as Omcer. ln December 1990, he reported for duty to Fighter Squadron One Hundred Two as Executive Officer, and assumed edmmand of the Diamondbacks in February 1992. During his tour with VF-102, he deployed on board USS America HCV fouredmbat in Operations Desert Shield and Desert Storm. 9 Commander Neidlinger reported to OPNAV .as F-14 Requirements Officer in April 1993. In June 1999, Commander Neidlinger was selected to participate in the Navy's Nuclear Power Program. He reported to the Navy Nu Fewer Training Command, Orlando, Florida, in April 1994, and, upon successful completion of 20 months of training, reportm onboard USS NIMITZ as Executive Officer in January 1996. itti f ' Over the length of his career, Commander Neidlinger has accumulated 3,500 Bight hours and S50 landings in Over 30 types of military aircraft. His awards include the Meritorious Service Medal with old star the Air l Q Combat MVH, two Strike-Flight Air Medals and the Navy Commendation Medal with Combat V and two gold stars. Commander Neidlinger is married to the former Vicky Voigt of Owatonna, Minnesota. They have two children, Ryan and Erik. s . a with N sg . Command Master Chief USS NIMITZ EMCMCSSP Stephen Hillis WSF Master Chief Stephen R. Hillis, son of Mr. and Mrs. Gene W. Hillis, was born in Salt Lake City, Utah on July 5, 1952. He is limi: a graduate ofthe class of 1970 from Judge Memorial Catholic High School in Salt Lake City, and of Southern Illinois University where Lllirfgi he earned his Bachelor of Science Degree in Education. Nllllli Master Chief Hillis enlisted in the Navy in June of 1970 and attended boot camp in San Diego. After attending Interior HM Communication A School, he reported to his first ship, USS TRIPOLI CLPH 105, homeported in San Diego. From there he attended sasigl Nuclear Power School at Mare Island, California, and Nuclear Power Training Unit at Idaho Falls, Idaho. 'hell Following these tours the Master Chief went to the first of five submarines that he served on during his career. These ships ' have been homeported at Bangor, Washington, Groton, Connecticut, and Pearl Harbor, Hawaii. 1. Dm. 67115 Superintendent at Trident Refit Facility Bangor, Washington. YASPY gndljll and his second as the CMC of Submarine Squadron Seventeen homeported at Submarine Base Bangor. Master Chief Hillis has had two shore tours, one a recruiting tour in Minneapolis, Minnesota and one as the Senior Ship The USS NIMITZ is the Master Chiefs third Command Master Chief tour with his first as COB ofthe USS OHIO CSSBN 7265 Dem? Master Chief Hillis' personal decorations and awards include: the Meritorious Service Medal, three Navy Commendation 1d Ufl W ' Expert Rifleman Medal, and the Expert Pistol Shot Medal. mmani Master Chief Hillis maintains a home in Silverdale, Washington and Twin Falls, Idaho. f Trai gllll xgilll at ax' V l 1 XX 1 x l .X l Medals, three Navy Achievement Medals, three Meritorious Unit Citations, two Battle E Awards, six Good Conduct awards, the National Defense Medal, four Sea Service Deployment Ribbons, the Navy Recruiting Ribbon, Coast Guard Special Operations Ribbon . 'X f X I lr- . 7 'zz V w Carrier AirWiniqNINE AVCMCAWISSI 1 ACD Lawrence Cummings Master Chieflhawrence Cununings was born at Fort Bliss, Texas and raised El Paso, Texas. He enlistedinthe US. 1968 and trained as a Submarine Sonar Technicianat the AntisSubmarine Center, San Diego, California and attended at the Submarine Base, New London, Connecticut . Master Chief Cummings served on board USS TECUMSEH CSSBN 6283 Blue Crew and USS VON CSSBN Gold qualifying for his Submarine Dolphins and completing six SSBN deterrent patrols. In May 197 4, as a Second Class Petty Officer, Curnrnings accepted an Honorable Discharge in order to attend college in El Paso, Texas. Master Chief Cummings returned to the Navy, cross rating to a Second Class Aviation Anti!Submarine Warfare Techr 1977 and was assigned as a TAR to VP-94, at NAS New Orleans. In April 1979, he augmented to the regular Navy as an T VP-1 on the P-3B patrol aircraft, completing two WestPac deployments to NAS Cubi Point, RP. In April 1982, he was assigned tothe Test Center, NAS Point Mugu, California as the Special Projects CPO in support of the developmental testing of the Trident, ' keeper, Tomahawk, and Harpoon missile systems and in photographic support ofthe Space Shuttle program. In September of1982, was initiated as a Chief Petty Officer. ' V I Master Chief Cummings then reported to VP-6 as AVXARM Division LCPO in 1985 and then VP-22 as the Operations E in 1988. During this period he completed four WestPac deployments to NAS Cubi Point, RP, NAF Diego Garcia, NAF Misawa, Jsipanj and Adak, Alaska. In 1990, he was selected for Master Chief Petty Officer and was assigned to HSL-37 as the Maintenance Material l Chief and in 1991 transferred to VS-38 as the Command Master Chief, where he completed two WestPac and Arabian depl E on RANGER CCV 615. In March 1993, he became the Command Master Chief ofVX+4 Test and Evaluation Squadron and after disestablishment the following year, became the Command Master Chief of Naval Air Warfare Station, Point Mugu, California, Cummings reported to his current duty station, Carrier Air Wing NINE, in October 1995 as the Command Master Chief Master Chief Cummings received a Bachelor s Degree from the University of La Verne, Magna Cum Laude in 1994, He more the Commendation Medal with gold star, the Navy Achievement Medal and various service awards as well as Submarine Dolphins, Warfare Specialist Wings, Enlisted Aircrew Wings and the SSBN Deterrent Patrol Pin with a gold and silver star. He is to the Sharon Jean Sanderford, and they currently reside in Oxnard, California with their son John and daughter Candice. Their son Natlhm is a Third Class Electronics Technician in the Navy, undergoing training for the Nuclear Power Program in Orlando, Florida. ' , YA J... L, Q ,, ,,,,,., ffiffi? gig? ,fits-Q7 f...4if'1ii- ,..,-Q--ei ff' ffl-ff A ,on N , , ' 04' snzsauwx 4 f. i - M wr YY,, A , M-. ,iw -,. ' Em: 'QP f.'.lie4m1: 9- ,yeh -:amz-v ' ef , , x -Qf' gagefil ffl W ' Ji, NM X, ' .A I I, F f ' ,,xiii5-3? ' 'gf' 'fffgkfg HW' 7' '59 'Shi GP' U fails -K mlif' , 46' ' Q'-lr f. -gf, 'W 'N 111:14 3 'Wi Squadron CC' and X ' CDR M. Roby CDR R. Young CDR J. D1ckman CDR H. Stanley CDR M. Doyle CDR L. Cortellini LCDR R. Nichols LCDR A. Eddowes 'Nm f lC .4 of 33 Reactor CAPT L. Davidson AIMD CDR M. Mellor Engineering CDR W. Escue ff viii-iw' . 'Q' D Weapons . ,gf I I 34 EM LCDR M. Heskett Operations CDR R. Williams Deck LCDR R. Loken Air CDR C. Quinn Supply CDR D. Smoak Department Head Administration i Navigation CDR J. Underwood 4 CDR R. Grahlman Medical Dental LCDR T. Puckett CDR H. Fischer Safety Chaplain CDR S. Lilley CDR R. Burt N CAPT W. Montgomery 3 Marine Detachment I l N 1 l . P I I 3 w E i I Y 1 :I ng 1 1 W m ii I mm nd QE.: .V,...,- ., , ,Ev , Liv. 1 ,, , W ' 1 536- f V. . V . .4 f zif ,gK Wi' . M , S,, f,3.f YNCM V. Johnson EB Mugffaifl w it w H 35 1 ??gg,f I is Master Chiefs YNCM R. Wagoner AVCM W. Mihelik RMCM M. Ellington PN CM A. Vivo EN CM N. Francisco ATC D. Cross Wax' 37 AT1 R. Kelly 031 Freeley AE1 L. Murrell A01 P S-eifried AD1 D. Sutherland the Year AT1 E. Breedlove AMH1 B. Maronde AD1 R. Tallorin AZ1 G. Mozley AD1 A. Rodriguez fy 39 N- 6 1 1 I :H , A - ,-- A 'Q - I 1 M, ..,,-:..-L.,--..W 'A , .S--4.41. H, ,-,,..,g. - ,,.,,g. . Wg-.-L - ,. ., , ,- , ds, A , ., ,.,,, ' , 4, - , , 1 , . , ' ' ' 15 . , f 1 fff f X!!! Overhaul 9 X if 1.4: .f uv,- ...Q ww --T f uf 57 5 , W, 1 1 1, 1 1 - 1 . 1 1 7 L 131' 1111: 11Q ' 1 1 ,, 1 1.21 ' 11 11' '. 1115, ' ,, , .,, , ., 11 1 Iii, i:1I1 11 1115111 11 ,.,,1' '111' 1. 1 1 ,,1 1 1 Q1 if if 15,1 U1' 11,1 pg., gm 11 1Y',:' 1 113- ' Lf 111 11 1 1,. .W 11 WZ In mains ls: P snr:--11 ff ff ' 71 A , fi' N 'av ' 22 pg. .fgf -gm- . fi, D 1 E N 11 1 ,. 3 1 Q 1 -we 'V A 1 xi JW Brt ?za ' n sc:1:g:f.Ekf-gy, , 1 r X 1 WK x V. 1 f y 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 LW I WY4... 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 ,N1 . '21 . '--X 1 1 1 .31 1 ,.,1 1 - A,-1 1 1.11 1 5,4 f fffff' XZXW 1 5f?7f,f!f ffbffgf 997550 f :ff 5, ff! fb df! Vg f vf f ffl ' ,Z ,Ma 1 mga X 1 1 1 1, .--- '1 .lr 1 4 1 1 4 r--, S I 1 ' T 11 1 1 .. 1 . .H-,:. .HQ - L.:!1....,, A ,1.15Ql1.e: ...:::-gf? F Iv-N-vv4b,1f1' v. V 1.g,3:'Q:gLi . X 1 K 1 b Q2 f ,Z MK ff 5, ,A QQ. 3? 'K z 41. M,- as HJ f . ww- 1-MQ JH: 1 W Hn ' df, V Y A -f ...,.,,,w.,........,..?-ffn-,.,...,-,..,..,.N,....,..f..,ff.. - f ikgzvf 1 Q s c 'P , A nam . gf ,' 'ci dp ' '53 if W H21 95 Z' 1 61 ' . 41 1 2 . .'f,g,vf 'b ki Qffyfr, ' z f 'iw i 7 59,2152 I ,V K2L1f , '15 li fi if l 2 1, 1 2 n 3. ,,,,, ,, ,,.,, ,,,,, ,,,, , ,,,,,, si 5 1 i 1 i i 1 1 l :pei 3 V 3 1 1 TM 1 1 y 1 1 vv 41 Slum. X f - L2 , + f ,. ,tl bl 5- 1 . ' N 9 f s 5 2 , ,.-...4......:..,.,-,1.......-,q..............-,1.5... ...-.........,................,............,...,.-.....,................,,........................... ,....-.-. X 5.-.W HWY, 5 3 5 F ! -.. l 3 i Q Y I i 1 Change of Command Augu t26, 1994 1 V-A g K E Wx Q 5 :Q ' QJ 2 li ' L w xg NX Q! 1 331 Xu 4 I n Q f fir 1 1464 I ., I 7 Y , . K ,iv M M I ' mx i 2' 2 2 w-i 'W 17 ' Lk 11 , 7' 9 'f-1 'fi 1-', ef , , ' W Q ' ' I X j':7if':f,x n X -F - 'Y 2 -, w A , , ,Z ,V ,.,. , uwullumu 5 , A , 2, ',', A 'A iif. X if if V ' fall: 15 ' f iii If V h 1 Sglflv WQWWHE 'ff ,QU f .ff ' . Q, , ,,. . mfg, ' 4 rf ws, Ir' ffW?5?wyai vQ,Q 3 1 5 i WHY 1 xx . ,, K N f'.!.f ,V .Q X . 5? - L w f A 'Tip ' , 5543 Q g' 157 ff7 4f:fLfI.,1,, mf ,, , . A A :M-5v,1p::,,,.,,., , , 1 H f f 'ff iff f , , -' ,Q . -V1 .wx ww fi-:CE-i.-i3.A- ij fl, . fa W 1 ,W , 1: ,, ,gg pix., ifzf, 7,3 K :Tx Y W , .q,:f: Y .i.:..g mi. ,:I,.L.5-. ,rv ' V ' ' .-,J -,---Sql: V - , 1, .-YI,-HN' W-lVl !'f'f'?fff-2+ 7--V-K 5-7'1 .-f-Y-5, , f. V I ,4 wa 1 4 - N : 1K ' My 1 f ,249 X 2.. 3,55 . Z, 7Z ,E5 N82 .44 if ' 4 9 X MM.-, is g2Y' Q 1A.,. , H .,,, 1 ,ww i f ny, - 1, f 157' . V y , 21 4 . , ,am f U 4 gf. ' 5 , f, M. f A :yn 3. f , I .gpm 9 ii ,',:g Nz.g,E vxxfz SX , S , 32 4 Q' x xl Q: .- fy K 1 2 JP? fx 1+ -. ' ' 5 . xglfvi R. gli, ,nb xl Q 5 Qi? A .,:,ar XR 1-' f 5' .-1, X 'x mf' F-'f ' Q3 .gg 4 if 16 La N' f 3 5, 'ff S-5 ' 'J' F-k, S E X, 6 3 Qi 5 Q aff? I 3 Vi -' 'WEA 9. , - 'ff 44, ' x H1 f pl' K '1 W , 45 f i ' , 'I 4 Ig, Qifgrz v l y i x ,l f ,M H 1 Q 7 '4. :fr I fdfvyvwuffv ' CQ ,..'fL Y f ' N' ' 1+ . ' A , WTA, f' m 7' W-Xl '5,' :fgf,,gf,sfw 2 JLVIQQ4 it rt I. sb .5 .,. ' fi Vi A Q , ' '-.mi ,x',,unf ::5f.hl:..4 .5 1 x Zffkv-lb' ,...f ,gfwltf WK S hfy, 'fly' if 'av . , hAf+,wfv0v., I, , 9' 1 1' 'AH Q17 Us Y' Q ,. .gzip 4, K if -, ' -4' 'WTR ' t 'Al ' f s., .,.- ,-5-Y '. LW 'A Biff-f' 4 MA nr. 49:- u 2 A gj, Q '52, fi, .1 ne, vw, A 1? 1 I' .7 i . A 4 I fry. , Av 'Y Y.. t Ah ,,.- ifgfgiji f Q.. .. , ilif ,..f.T.5? f'-i 9' .1 , , . ,,. ,i3ij47-ij.,Q,.,V-iQ.':f,. X3-131:16 w . - X . W.. ,. L54 1 X-, , if. f .1 x , ' ff-simfzwef ,..fffff:f.v.1:f.f4-.114-2cswpgfzx K 1 -Q. of -as ' :JV N 1 .- ' K f K f 2g.j:c.m-f'-iaiipfiiid ff 1'-,Q 1 5 Qf3g1'1 ' f J' ' Q f- . k - -' fzfmt, yy., . -5 -1 X -1 , I . ' 1 K . vw-M944-:Gwynvm: pw-Y9:,r5X,z H Vg-.,1p,. , , wgpw 434,-, Q, ,V -f' ' - V , ,. ...ga9'i-2, 1-he ,1-:fag-1fg,. 4:-fi'-il T.:-pig: rflfq- Q-fr:z2fZf 'Q'fifg,v. if ' k - V . .i':'lT-All 124:11 TQ?-1 ','1fe'a'I-: . K , . M ' ' K M: ,-'Y'fK'4i4'..?f-4.''.7A',,74 f3244'R,nf: i, :'l 2wyf3j- 'L -K-,qui J' -14.7 nf fffd I K H., fry-T ' .L ' - - 1 ' ' f6wff'Q,4.fg,w57sfq,w-. ,.,,.-eZ,fn5',, f.f4y.,..f,- H. U pw .2-4 , - -,.f.,,- f. f., ff -V . . . ,fenw-Lg?,.f,f,.-wi,.f,z:,,f1 p,Wyyw,f,:, .,.,,.,, .435 .,k..f:, fy, ,. 4 . 5 , . 1 . QA1-'1ngr4x!L7w!vSfGW3Z-wa4- '.Pi4fffv'j25H We TQ: -?-fb f Us .w-A,,.w wfziffhzf -'V' ,W ,!'f,f.' 'If vw 5 UN-f, f 'Q , ' f. 4 , 15iSw::fffff25 53724221 yu 1f1fQf:fgL7P'-f' f3Z:'2--fgif .51sf:'tw ' ' Y ' K 'L - i ' , V V ' - f ' f - m?:':'z-fe. .Sff::tf1'g5gx-,,. 15113 -'1Tv'Z,fZ.'i' .. ' 'f:ffiVf4,V75.g'g4fv EQgg,ufg?.k:.,g,Q,iv,,27Qg,K Wh ig 5. .V L Q x,!.Lgk,qiQx,k,?fA.71k,V,Q.l,k .. fn 1 -I x ., f V . -, ' Jfmif ,-,, f. .,,, , ..,.,,.,,,, , . ,,. . .. ,. . , , , H X H H A I K '-4. f,'Xi Q ., , WV, A X , ,vv 1 , ,. 51, ,A ' KP' ,Vx f 45.4, V .wif ,, , V,, 1 ' 2' V V VL.f,yZ,,f, ,,f , .ff f., , , , ,,.,,,,,,- V-V.,,1, A f I ,051 l i .5 ' ' Qin! .viii ' V ,fr ' ff , WM ff Vww If ,f V, ,,fX,v' 1,4 VW 27, ' fxffpe W 'f 6. . f 4 f ily, ,, V-V f' ,, . I f V ,515 ,V ,V W x ' V V WV 7 ' V , .3 I 1 I ,W fn fy X' 1 w I Vx ,M r,v1'2QQZ I KA A .n f ,.,f 3' V - V Wm ' 2,1 ,A I, - VZ, VVK effgvy, f 1 is Lg, 41 Vw W JW, V, J .ll-S INK MV XM .ff J V fh L Q W' 'ff V 9441! ,W J Y Nw ,fy-Jf,5K.,f,f Q, , , 5 f, V' VV mf V 15 W 'M f I K 'W up ,Q , , W ,W ,Q 542 .ff 4111, A A We .N , ,wff ,., ff A , N . I I 1 ,, V V, 4' x 4- V ff ' ' , , ,V -JW ff , 'Q V A -' , ,,VVVf- g, - ff 2' , M, ,g!,5V ' V ' 'i' M., ' f f ' - 5- , If .,. ,, 'W-44, V 'V V w.k g 'wg . X V,. fr, ,6,,,V'?f'V, , wfVg:gVf . V, ' 2-,, ., QV fV ffxfm x 'wf-.,..VV. ,nVffv,cc,' H-mf V+' -W' ' 'f f A,-,:,... A, ff., V, , ,mm ,.,V.., 4,4 , I - V ,,,,fV,, NMQMV W K., ,V V,,. VI V A., .3 , A . ,Q QV V.. Rf., - 7.1 :3-V.: V, V.-,',,yVf 7,,Vf',5V,-Q,j,.V .VW V X WN V T V A nl,- Q bf 'ffl , V- fffrzff' if ,Rfk -f 'X15,. ,f, , 4, 4,431.5 .pjw-1 X , -3 ,v my LV Vg, Mg, .w,..,,,x Vi, - yin, ,Q A, , V , - ' V M' ' 'ff ,QV , ,Kai ff. 1' ,, W'-?l fV. ,V - . ' 1 V, ,MV-, wa v ', g' , ' 'V MA V -V. 1 -V -- .. 'ww 0- V ' X' V .V f , , - 5 V,,.,,, V X , A-. - , f- f V--.VJ A -V - ,V , :A . 7,19 U5,:,.5 ww 4 n,fi7Q,, ., 64 I f'VV,,VV,,1,f'V ,AV ff- V, ,K 1 , .V ,f .- V ' W L, ff V , Q.-, In.. vw. V-ff V7 VXA V if -,W 'gm-,. . ., A 4 ' 'lVSV f 'w',i ! 135' N Y 'V f A, V, J A Vf V , , V 'f',i,, I f ,.., w x 'L' , MT I ' x . . 'V L 'vii-.le V -, f AV 1 , r, , , ww V-Vf V, ,V f M,--,ff ,. gf, -V , V' 'V g f , QV V .V Ayffjiw Vw,VV. ,,f:.V'-,-ff - ,Vff'g' , , .,. 'VVi,- -x i,L:'1 Wf7-ff-EQ.-1'1,,Vg,j'f-ff? ' W U, , V, ' ff 1 7 4: ,. , 1? 'ff 'Q V Vt -I - V NNW, v,.w. , Vf ' f ,X dy, ww? ,.5 ' ' , VV fm-, , ' ,INT - L' -- 1. V -' V V' ..fN.,4 ,,-V I L W any - ug f ' sg 4,5 fy., Q f - Y S, 1 Y . V V 1 -4' L 7 I A N 1 I 1 V , if 1 f gf V J 1 , V Av JM' ,ff fi WM jf - V . ,L ..,-lljuxbx V- 1 A f , KM I ,,,. ,JV V3 E: ,M A XM , A .MQ A . V V jr V.tg.2wf,q ' ' ,. f' x , rf, V V gm. JY.. V V JJ. , gy, , ' I P-I:'Xi - f iii? I i, I. I I 'I I QI sg,,g:1,IQ-vf. ,W fx 1.,..:.-1-rf....i n,.,q,,- , -W, , --1 I1. 2 ::.::yfW-'If H M--.--- -ll!!'l 1?5Q?' --if If 9I ' 'QM' ' ,M AI , , I , I I I' ,, ,.-I 1 I HI S J L . I f ,YI fi, 4 I fx ' 1 I 'I I I I V ,N I I' I II I ,f fx X- I I I X f--. I I I II I I - f ,fx ' -1 V' ' f X I II I I I f X I I ' I -- I I I , N - f , ,I I . I .f , I I 'I I ,I I I I I ,I I I, I , I I' , , 5 fx- I ,f I ,Ifxx ' If I I FI I I K 'I I I I I I I I I I 'I I' II. . X I' I I --'- -I-I-I I 'I XX 1 I I I I I - I I , , I X YI ,,I I I I I I , I I ' 1 ' I I II Q I I I I 2 I I I I I 3 I I I , .,.-.I I ' ' I--II--M I .ff I I I I I I I I I I I I I ' I N I.,-' I I IJ I I Ti' fx I I I I I I I I ' 1 I ,Y ,XA I I I I I ,I I I I I I I - 'I I I I' I. I ,I I I j I I I I I I 'i I I I I I. I I-I I I 1 , I I I I I I I I I 'I I I If x mf' f I xf ,I I I- I I I I I I -I ,I I I. -fy' IX VI I LJ -WI' Xxwf -I' IV Ii',M7A ,lil ,,.,,,, QZM,,,,,,,1i,Mb-5 M -I ,Q Xxlf' XJ,-f I- v XXJlfY4 V 74:17-1 . W-.--AI-I!-W 4 -- 'AQ ' Y 4 i f-'91 I 4-I mifif l x T 9 --puppy-W.-... --nr,-g-.,,,-.-,.-.-. ..-1.-.mf m4awp. --i 1 ' , , L, , 3 ,,,r,.,k. P I -, , ffmfzif 'ff Q Wm ., f 2 - i Q iff' r w , P W l N 1 Q 3 F i 1 Mdiddl nmwmmnmnmmmmumHmmm M! , k,,, , ,,,f, ff,1f,,-A, , f w ,f-N, ., , ' HY- : 1 ' ' l , 1 f , V A4f1: , X, f A I 2 1 -, 1 ,,,f' O, 9 : If ly, ., w. 'fb 1 1 . 1 W ,,., . sy , , W Mm .W Wx W .,,.S...-,.-......, W ,.-,...., ' 2-:H - . X, I, , ,W 2 ff f f 7 if V W , Y 4- --f 'W ? A 2 W, X , 'c, . W W- W p A la f ' t . W fl 3 ' W. - . ,W ,VW W W Vp 5 ' 'W if , W - 5 ' 'Q ' ' ' ' ' W 4 1 W WW QW, '5 W W .- .W W -. W X W I W W ' W , Wg, ,bl W 2. W 5 W W A ' WW ,YW-' ww 4 sz, W ' W W W W W W W W W W W W W W W W W W W W W W W . W W W W W W W W W W W W W W W W W W W W W W A W I W 77 ,,AY ,,,,, ,W W W W , , W W W' W in W WW ' W W. W W 3. W W W W 1 W W W W W W W W W W W W W W W W W W, W W L W W W W W W W W W W .W W 1 I W W W ' W i W , W W I WW W W W' W W W W WW W W WW W ' WW WW W W W W W W ' W W W W W W W W W WW W W ' W W W . W W W W 1 W W W W W W A-W - A --Y -H g--gg, - rf MQW, ,W -:'f' -, W' fWrfi'if,ff2afW,wiztfwyfvfi-ffws',ti1f'f, W ,W : Wf f wzf 32,5 ., We ,W WifgGf,WpW?ff W W W W W -W W ,1gzvg,134',5531,W,: W-WW,Mg-Wh54giYIff,,W.,,WW,,:agf5Vm49,f',yW:,WW',W,,: !,a244:Q-.fq,..vgc,,5'i, WWW,WwQWWWQ-WWJWWZ1-1eWzffg.iWyf52WWW W-2.2 ,.WW Www 1,2344WWf:peWg!,.W:.QvW:1f'sg.'f:,W7g2zQWWfWW,:iw4:pf119 Q-ZQ'4QzWW':g21?,W13W Wi'- W ' W, W W W 4f:W:,g5M,',',,, .W , , . W. ,, ', , .W',,W4,:yf,2:,,QWQK-gfj,Wzg1Wlff,g4vf9W,W,f,W, 41W:,'--wW-w,fWfN,f.fpf,W ,Wf2:,', JWWfymf-,.,WWZWWWW-WW-,.-,fx fp,-.,,,-,:w,,,'4 W5Wh,fxWWf,5 WW-,WWWW ff' ,'.y-'MWW.-WW1f,41-mvyg-'.42'7n AX-rs., W swf , Wg - ,ff WwXW,YWy16Wffw1'W-f9W:!fL4fy4s2fSW?W,iW,Miy,424-W111?2'sWW,'Ef,W-W:z,4WfW.iiW,5z-Wvwlfzffyfzf.-W:1,'W L1W'LwIfW Wffw-P-fW1:Wr':fW2iffDf+fWff.wf:51,,fq2f:if-'Q'-,WW:'f,W:WW W i 2 'W xpffsfz Wuxi'fW:zygW,'Wg54w:6ff-,LiW4yf'Wy94ffW,W2WWfm::Ywwf!WgWWg-wf-4f'Ws-4112592.25ry,-1-'lwyfwi'wp,-.Wiyisdyiim-,W11,24V'v'fz.s,f'?::,,W':yf,z- UQ'-WWW.,.4j.':,vfsiff'.fzr-:Wav-Ffa .wi-31+ai!! W W7,ff,W,4,,' ' ' '1 W W, ' W W '- 2-WWWifiwf'-.QIWQZWWL5'gfmymff f 'f ' ,M 55 ' -W f P rv.: YH' W?- 'W' f'ffWf.aW:Qgf xvixziifff :':zsW'WWfC!W5:9f 1:i4m,Zvw2'WW4a' WW'ff,4,.f.dwf, WW. 0,11-',y,'5 W -W , ' - W, , - W ' ,W Vw? . -f WW ,eff W W- ?' -y Wwe -, S -454. 4 v4Wr,fwWW,'i-,lf 2gW,WfX,4:W!W-W4Wf- :Wx W W 1 W' fb.: J W Wa., 'Meier'Www52-'W'WWZKf'?fQx'.z5vz'fzawieizW ,mv W . W 15 4. M ' -f4ffffWr6w:WQ?5QM,:i'i'W'Wmwas W W W, -W-'-'-WWW,,WWWw. , z,f M W g 1-f-1'Wf:WW,1:'f W W W ' 'ff 'WfffmfW,ff'.v4,v?ffe: Wgwf ' .' ,W 'Wav ',W.. .,W. f,g,zW,.,v,,,.1,4f?y ,W,- 1.2-.-W fa- .'rWQ'f,':,gf'sW3 W W W '25 W W 'affix Eff? ', ,Wi W W W f WWW2Wf 'V 1 - ' . ,W W W 71 ff:'v zf,fWXW,t-W -ZW.-W2-1,-'Wi,Wie-,Lff1.WWWyfgW f! 76.202-Whfbw-'YP!22,w2'WmSXw'WfMw-W'-ZWW 2 WW. '.1fwwW,L.W W ,,, W-,WWW ,,,,W,W Wz.-,W-f.W,e5,.W,W,,..,,,vQ,,3A,.,4W,L,WWm-,,WW,fW,y4W7,,5W,W,g,yfW,rWc,g,gfafW-Wf,W,WqwW W ' W f W' -,s,WW4X.Q,,lfy!92f,WW?g5,,5-,Wy9,Wq,,1y5 ff--mf:-,,1'y'W,4,,'.:'W W .W -, W Wf, W' , -W' 'win 1,1113W,WW-'WW'-,1iQWf:'g323gPW-,Wf.yY:' -I' 'Wie' +L 1' W W WW - W, WW W ' W +- W -W W W W W ',.vtf5.g,7'.-,7.':fg,j: W' ., ,QT rW,5Wy -W. fi-gk W W ' ' ' ' W , ,W 1 W ' W, ,ff W W W I 'WW .-X: W W W- ,flil 551 W W W QQ, W W 'W , W,W':,.:4-Q,-,Z-W fw-nm, qw -15,91 gWv'C?WyW-szW,f.fwQ1sW. ,W Ww- W ,. f .53 W f f qfx 'W ,. WWWW,.y,:,, zz:-7 ' 'N-' :vi 'WWW12-W ,W'm,,4WWg.W,WW.yW,,W. , W W, W 'Wi ,tif ,fra ' W-ffW',1,WWpwWa f7:fN'fffZf2fW2?WYii-'i .2fWW-fWfzs2,Cf'f,eHfWff'-'SW,s W W W, WW ,W ff y-,WW-,f-WWW'-W,W Wf , ,WW, W ' y,:T'.WvWWW'f,vf,z q.::pW.wW,WW ,-W.-WA' ,-W.-:e,af,,w' ., W f - Z'W,WW,6wyfzmfw?57W z.,W:f,'cv-,WifWcym' ' W mer 4142 W W W 'Y 'f 'fW!'5WWv 'ff 'Zf' 'WW 'T'-'f fffW?f7W' '- f ' W, W' f' , WWT,'.'T W'iWJ'5Vi?-Mi? NLY16 A :Af ft!!-W shvsif W, W W ,, ,W , W,., f- W ,W.Q4W,q,!, W,Zyx.W,,WN,,-4W.-eg,:K:3..p- LW W 1, im 9- ,2fL'.v'gf,,5f-WN 'ref 1' Wfgkiffj 'W WW W,,,W',4xWW..,W 33553541 W W Vfifqf -SSW pfWQQWEW::Wv:5.f3W,'?y,1iQgWf-W' I WW , ' 7,ejWgWW5,!W5,ip,-W W ,W ,W . II , XVVW , ,V W W, ' W W W W W W W W W W W W 1 W W I W W W W W W W W Q W . W W 1 W W W W W W Y , ----W-W------A--A-W-----1--iv-----W--W----7----- YfAf-aww-Y ,Wm W, ,WWW , , ,Y , , V V Y V V -QI ..--.4. ...... - -QL., - W,, W W - W ...............................- - W ...............4..-............ ......h....................,,...... - ,-...... if -fn' ,Ky V- -Mig Q, f X 'Y . 4. AA K 2 ff f x Q, f ,, , My f 1 .Vt I 1 Y S x s f ,fm fn J W4 1 , ' .5532 ' , .Vx . Sli? , .Q M.. ,. ., J U .fw 'x3ff.., x- ,'- , Af' -Cslfkff ' ., 'L' I '1'vN:?,i' 22 7- -- :fix x '1u 5, Q'1.iff'3 ' 1 :j',:L5.,':3,,,! . , Auf Ma'-'gfbgv I ' pri! 22: ' 1 4?'f?S ., A U ' 1 1 ' '-e4,E..2.K' ff- 2. ri .4 139121 K ' ! .i4f' , Jflff A 1,-ap , i, A 'A 1 1-I1 'Y tl.. l,.i, . 31.48523 ,Qi ,Ffa 4 6.35:-,QQ 73-f 'T .. K ' z.ilf'f71j M 32 iff 1 If 2, 4- w L' ' I , 1- H. ' y 1 + 4 1 M, x ,YQ i EQ? C F . fa ,V ff f 4 it Q Y, . , '.- J f . ,nd Jmf: ,ggi ,F 5 '. f, . n 5 Q 1 If' 1 ' 1 y x' 1 ' , -,1 ., .f's.fg'f 3, ,H ,H 7,.,.,5L226 5 I-f ,h 19 'z gf f J, 5' E' 1 r , . V 1 all ' y Q ?'2Q1,g fQ.j-th,-5237 f 1' pg ' 'lfifz' 12' mafia, ,, 4- .lydgii -, , X94 .fjf,5'I'i',' - '.1i'e ' HH , viii : f T Si'-LEW, : ' i 'xii v V ,w-13.5 ., 1 fi 'bE?,.aiij11n Q? '-i 5 'Z Q f ., ,,,... -Ivswlixlu :Kf- fse W-ff . Q . X LH? is s , Sfjjflfz Wir ' My , fi ff' ' 'fy W f ff, 'Xl LN, ,N , if 'pg' 1 w u 4 , 1 A ,ff wk 4 74' Q f Q f f f qi , I f A I fi if 1: 4 , , XYKW, , 7' fl , 1 ' 1' t at 4 sf , fi 1 M Q , f 1 f, f -. , f fi 1 f ff 1 yf ,,f t 1 ' I 4 1 ' 4 Ja' Q' ,x,, ff f ' 1 f f f 9 ,f f f. f 4 'r 1. vi!! M, 4 If y 6 , F P 4 ., d 1, 4 f f , f f gif X? ff '! X ' Q ' ' ' 4 -Y H o , 1' 4 1 l 1 ,ti 5,41 ,fu tl ,1 4 I, I ,lf I I f, I' . 'J if if 4 4,7 'ff' I ,fix ' ' f 1 gf 1 4 H: . tv 'K L if f 1 ff' sly! W, 7 1 '41 vi Xi 1 '25, fi if ff r f ' If ' I, Vi 1, fy. lf!! I , 1' it rf V 'Y ff ,y ,f ,X 1 ff f f ,f f - f ff ' X 12 M fl 1, r V 1 f,l 2' I WA ff V 1 f if ff V f ,',f , ' 1 'ff r yr tr f fy I 'v IP ,g i H ,f 1 I I It 1, r J I f Y fry Ay , r f lf ' ' if M W yy ff f !, 1 , , C 1? 17 Y l' , 24? ll 14 W1 W f ,I I if I 1 1' W ' ' ,, ' rl X ' , j ICJ 1411, if 1' W f Q' f' 4 5 v ' 3 Z f 1 I i 'Z' ,Q f I ff f ff 6 1 1 v , , Q' rf' f I 1 ' f ff A 1 is Y y H f ,f S I f , l 1 . I lfx r I 'K 1 . , 1' I x fr . 'Y f iff, fr' xrf W . 5 1 ff f' f ,, ,f - fl if c 1 nr, i ln, K ,lf 2 4 iffy ff ! ik . 1 Q f ly ff jiyf X 51 I ,X X 3 M f 1 ,-.i.. mm ..,, . X.,......,,. ., , gli. -,--.WL-4.1, , ,,--nur-nuvpf -' , .,,.4u-ern-M . , , ' I 3 l l i 1 X W 1 X X Y 1 S . 1 1 1 I I 5 1 N . 1 W , 1 I -..T ............ V 'K xx ff Ash , - 1 fs Ti ,li 5 fi s V? 3 2 5 R Z 2 f,.r',f lvgg W I N i I 1 1 X 'N A x , 1 L 1 5 Q 2 1 1 1 W 1 n K , J 1 1 1 1 l z I 3 ! 1 I 1 ! 5 1 I z 1 w X l 5 5 5 A 1 i i f s R v HZ' I f.. LM if 'nn Qi: ' 1 .1 ...Z 'lf 1 v, J 4 ' ' A'fz..fgI'2:f1p, 1' im? ffffiffiisffifff I V Y 11:..:...im1-- 4 I K ' L fffgsnl 1 ff 1 1 HTF! IJ , . f : Q , f xxx-1 ln f .' ' E x W ,.,, Q 4, , ., wg., ,,,,..,,, I 4 2? MWL , X ,. 2 , I , M, f aw x ef .:. I A ,sf 'av I 4 M Q ff. f . - fffiiwf . ,f 'f ' ' , 5 f' . 4 12. ,,,' x M- nfs ..-, W- 'S,,,..,. ,.-.......-....,.w..-.-ny,-.-m'P'-f- N 1 ,-3r,.N,.-1.--,., - . .qg-..- 9-sn w 4 ' 'nl r- X ' 1 1 L x , Q 5 il r 4. swf 'MSF S 5 4 1 Q L! Z . 2 2 x 2 i 4 1 .,, K ' f 5 1 s ,g 3 Y 3 I 1 1 4 1 ,. fs , , ll 4 4 1 J fi A w 1 3 3 L i 3 i 4 1 S V 'Ni 1. 1: if 4, U E Q - W 1 2 r 'Y - hal.. 0 ..-, .lvrgrfvm v X E xx f, I P 1:41. 0 'Y L, M In pg ,ag IQ 1 1 1 1 1 1 1 . 1 X 1 1 ' 1 1 1 1 ' 1 1 I ' 1 1 1 1 1'1 111' 1 11. ' 1 1 1 'K 'I 1 1 1 new Wil!- nf 1 11 , 1 I 9 A 1 1 1 1, . 1 , , ' . , .. 1 Q. 0 g 1 O4 ,Z ' I ' ev, 1 , . - 1, ' .angjljgiyd ' 'I f Q I ' , -, , J 'lj . 'o. A mi . A-' 0 ,, 43,1 Yr I J, , I W-. v Q - 4 ' U 9 ' ,L w wwe, , ., ,-,,-,,,,1 nn-v-nrr-au1vK - ,,, fV,V, V ,, , ,bf K his 99:3 ' i995 h l I i Q v 4 1 I C v D n 4 n W nl ! n'Xi - ' X' E Z, X K.. is XX. X X fc 54, X X f f X X X afz- MX xy ' X MX nw X :X mg ' My E QX X21 Ziff' ' XXX, XX X ,X 4 L- WAX Wu' X 3 X-X in X , 4 37 13' Wim WZ' X' Ky,-4. X 75? .X ' Wx.. X wr Vail pig X 3 YM E Xyxv ' Wil 1 , X my WW X ' wp! 64091. ' W. ,,., X mf W4 J M0 f X vw-4 . X.. M.. . ' WM- -' X' , X as X vX 4 ff l,.,..X....,-....,..,.,X4.+.4.-.,...A,...,A ...,. .A.,.w.......-k.......,.........X.-,..-...- .... ..,... ,,.. .... . vu.. ,M .,.... N.H..,-.. ..A..,., ..... ,..-..,.g ,uk ,gk Q !hX'3A 3. X5 X4 4' -X 1 X 1 X i,....wff , 5' - .171-ff X4--MW X' X,,XXXXX-X IXXXX :L1X1X:XXf? X ,XXXXXXX XXXX ' X5 3g.X:XXXX-X' 4 X Xg ,Q X A X 'X-'XXXX' XXXXX V-XWX X X X ...X XX U , X X- -X,m--,..-...X- 1 X Q X X X X? XXXXXXXX 2, X X XX ' - XXXX-XXXX-XX- NX XX X-XXX XXQXXZZXXXTXXXX' X X X1,xX.XX '- 'XX- XXXXXXX if ,, 1 pf .XXXXXXX XX XXXXXXXX XX XXXXXXXXX X - .XX..XXXXXXXX X ,XXXXXX - XXXXXXXX X fQ.j-XXXXX X XXX' X- X XXXXXX XHXXXXXXX X XJXXXXXX' XX . X X X XXXX XX' XWXX :X 5 Citi? X X X X I XXXX 'A .X X. XTX' XXX XX-li-XXXXXX i , ,XX.mwf'X ' vs ywK,,,.XX,.vm X X X X X X XX I X A XXX X X X X XX X X X XX X X X X XXXXX X X XXX X X XX XX X X X XX X 1 XXXXXX XXXXXXXXX X ' X XXXXXX X X XXX XXX X X X Q X XXXXX X XXX X X X X XX X X XXXMX X XXXX X , XXX XX XX XX XXXXXX X X XXXX? X XX XXXX X XXX XXXXX X XXX, W X X W X XXX X 'X XX X XX X XX X 'XX ' X X X XX X XXNX X X XXX XX X X XXX X X XX X ,XNXX XX XXX X X XX X X X X X X XXX X X X X X X X ,X,.wW ',1 ,, ,H ,N , ,QM 1 1 1 1 1 ,. , ,N I , f, - N 5 , H J V 'g 1 bv, , 4 , 2 3 , , v , k , r f, 5, I , , f ' V W , 5, P L N ' 3 , N, 1 S' w 1,- V , , V ' 1 , 1, 3 ,. , L fi-1f'1i'f ' M' T 'f'.'TWT'ffTTTWifVwvrmvwifwwwvwfafwvfwxwrvwvrrwiemwfw-vmww.vmwfff ,mmm 'www ww ww. N ., V 1 , W V ,wwmw ,mlm ww N V v, HX-M,---M,,-w.f,,YV-.f.-,,,...A..M.w.v,.-,,,N..-. if heznzm ff fw ws H ' 'fx f ..- gm- ,- ,W--4,'.w-,VU Q,ef,-af-.-,.,,,yw-11.Jwzkfy--.QqffnzwmZ-J-am'6fWiEh'1,,.u,pf vz'rA MJm,mV ',w!.2y'wyy.e fwffgzywfhl-rg wihdfcwff---:'n, 15u-'ww-.V-wf':ww, f,-4,1f,wWv,4m-fu, tWwgA',feyvLw:f :.4,g,7Hff V.d'wa.m, -'R ,ry,v1Mw..e:Zw-Hbvw-Jw,w.WwJimwif'---VffE2.v:'f'w1E-.QW-'fri'--- JIk H-'-A.':'w :'u'.',,--2-uf.fw2' ,. W : . 1 , Y V Y pw rw. , . mf-' .f,-,mfw,y,:,m,f'0,'.f,f,'-w7'2f-M-12,4,wz'wm,,-Y-,w7Jg1'Mvar'-wfwwwhf:ww,Wfwzczm----4wf2n-w,,vuM5Zy.lmin-fwmfyvfr.fflw'wfW5-:Lh32w1 -l,Ww--mmmkfvsxM-M--W'.Wf.''l,1fJ'f'MwfnWW',vfCZumM'-fwwws-,'r.w2hf:,m'yW+,ug-.ww--Hf-Wff'-1yr,-.:f-:,'---fw.-u-c'- M- u 1' '-nw w Y - , aff:--N , , , ,, -v -M.,-wr14.u1-N.my+,Lw'.'A-wvg1J:w,Q-r-'ms'mfwg-wwwfvwwu3C+m-Wfpmwfweaw,W4rm.'.Mpizfgdff'-wi,MMandi'wfwwfwwfiw-4MMW9,W,gf.m'fMff4w'v'mQLdfw7MwMJWfwswwwymrwwiwffwwwW-weJf!n:fwmw'fwfwwmffwfrwxhw,m:.'aw,ww'w.',fw.:'f,-,w2'fmsf.-wi. Q - , J - N. N . W fp, . 1-gnu, N w1wfu,'cf,:f.zg-,w,fiww-1m,,f,f+,w'f,f,zM,w,w,w.',www wwwm,,m,fa4suglzmamw wuymfwc:-gyfzMyyy,fw1:my-AgaWwmfz-l,w+,KWALiH,:-ww-mwlwwf,m,W,ww,,ryx5?w,':wg+y,f'wwfW,xWmkwfwwwzwunfwwlwvw-wwd-f-fhwlufWV:-M1-+P-A-4-' -A-wk-M-+4-LQM--A-M:----M Y- 5--MVN -. ., ,,,-..-. vnu' N f H ,A-41, A' Lf,-,'fM,:,f., 3J,w,',,.ff My Wgwwfmwifywwff.-,wifi,fmyxwm-,ggwmfgML, ::,ww.1,w vmfmfw, www,-fm''xvxwfwhwfwiwvgmwyifemwaywfwuvwwrhvwwv1wwwwwmf-.fr'Fw-ww M, .V x f1W.u.1. M44 . Qxqgmwl wL.,L.2gm-Mm -Q M-A-,,M,.mM-M Lg f,yLbm,5!ffmMmLzQ111 uL -ft--J Y MM-w 4 hw 4- 'ww-cw--'MJWv,.,,n.w!fw-m-'fu-M,-,fo-ww H? 1 . M LL J. MAL NUM nw N ,uw 'iw Nfwa-wafvpw, pyfxmmem,rj-M . ,V fe, 5. ,4,,,W, We, L ,-.1 . M., , mmm vwfwfw C'Wu,,,M'yJ1,,.m,y WEP' '. 6 ' yffbwfdwwfw+7162fwQffMnf.,w-M1 Mcwvfy vw ' wWLy,'f,-,rfwmGn,v,',5m,4xDfgw.frw','w um -um I ,rw ,vw vw- rm-4wm..ufw-'id mfwmcaff-ffff 'Wm U45 'H mffLw1:c,sfA'M1:bmw wwff :CfWdz w?'9Nf My f ' 'Vww1Wwwmmsukr'w22'w-CWW-Tw-if ,W .zgpf fm Mwf' 'mmwwmwwgwmwfe-'.-Lg,WN A, My ,., Wmaww,r1gyww','m-,vg,'-mm .pfm ,I W'wwfwm,1fM'+ffg.Qvrfww'Q?wbMI ak, .4 :Nwrwfzgm,'rsgcwgpi 62wyw2g?0WfnyfQ.:fJ3 ff f. , www waz' 'N H w::+wf ww 'fri it , 4 Wigil1M:vN MQW 5pQM?fnfFWfQfi?GJ 'ESM 1 QM Wwfflliehwl'wg?rfsi4Wx:vL+gM Hsrwfi 4 95Ww'4df'1Qf5f7nQ'bA,-.5-ffW.:T-www Qwwf mn., W w www-m,,,fm,-ywsl,,,..f,-,L.m-ml 'ifjl , ' Fs:Ww:Wl4m4,mimxjxffwwgmpu,315,wQu 1 :Wffrf!9w.1,V5xwwifrgzbrwwlvww , Q aw gwwwfw V-wJfnw,3 .pM ge'-'H L F,,ufnfwQn,mw1.3vy-,, ,pw-mwffwf 5f, uw-.wgai 1 -gf .ww nw!W,MQWwwlrf-Xvqwy-,w,5':Hf4 1 1 Pre!fWzwfixlf'MW 1 mv, b fwfwvwWwwmilzxlfflwd-W','v'1 L nw.. 1 MmmaAmwwwfbww-gf'pwnyuw f 1-W , E'1:w'i'Qjy,J1,Jfxwg'vf'G'Jj'U-W-'HL-W-IW'if 1 :W 1 56WQMwflrfufwW-vwmiwfwy.,1 .45 ,fm , ymf:-,'w,-,7'--'v- 'fwznf-.atm'M-W-N.,, F-,gg .. wif , -bw f fwrm,2e 'f-I Wm fhff fm 'M I J rm !'1 '1f','s'w, V ,f:f,f.,w,1,,vN,,f'vf ,, ,5,,yw-- V z fa R mm MW,-a'f. .wwf-fra'-- 'Y uw: J- vw W' J:5 ' 1 il' 5'wMWQfUC0055721'2T:f'5'NY4 f, 'lift M ff' -If aim: 1 'V'H53ffMf1n5fZu':EWG'f'1sT55'2Z1TLl : 11L-'fabyrm 37 ' g,H,,g':m'1-4 ,1fI3m, M'-' 'yf',n,,m'.:4f sig ' 1 HQ Fiffilwyfw,-SifyL2:vd H'.r wh , ww FFA E ' : z jzwslwwf., ,, fy 5, g'gjy'wjJ,,fw, ,,, ,I ww, Q Qu, , rwggwyzf 5 gygw N If ME' f x VFWIQ , ' 47 Y Y Y f ' Fwl'Lw,2J lf. 5 W W, I 1 Nm 1 F '- f ,milf 1' P ff J ,fqfy 5 !,, ' I J L' 9 ' 2 ,j2,c1 -rdf j X .wx ' N , ' ,fp 'V , 3, , , Y g vw v I ff.: ' . ww-,Q H W 1 u,- , my Wy , 1 of ', kdwiw I ?v','w,J ' 1 5- ' ff,',g,g f ips: i wulw 1141- 1 , 0 wh mzf. , fy , 4iLf,wI Y ' 5 1 ? Q' I'W2 ,w , 5 1' Q ??LgEffH Q V N ' Q if jlIj,ji,:'c FJ' QE f mg: g, 'fTWfiX'fv +'-ws---v':wfYvf'1' WY 'Tawf11:ff:wMf': viqvfrq,-qf'fv1 'f 'WT :wr f-U -'rf frffw-1 'ff-w w-My-ff -f---f 5 i4g?,2 ' U , tw' W' , fM'-L1,, . ,, 1-MW.,..,J4.v,,,,,.,g,.,1..',LLg. ,Lg pg.gpg4.L,1,1L:,Q111-Q.1-L'1.jL'b1,11 'mQLf..,g,,'Ll,.Q,,,1'Q,fQ,iQ'L,gi.1,,-,EL,jg NJ ' H - ' ' i ' ' 1 f A 3' ' w 1 5 ' I U ' f 9 L x , 5' W T 1 zu N 1 X .F ' A 5 X .5 - 1 . , ,u ,a Q I - -- - ----- -,--,- f ---- N--v---f---f--V---rf ,'-' V- ----- - ----- --------V--'V-V ------ --ff-'- ' ffff-f Y - ' f UMW' - 5 -UMW My-5--' - -- sw N ' Qjwri. if E , , my N ,, J, 'lx ':i sz Q' Y N N wax, yew, N ' , ,, 1 N - , Y ,. V, , -' , , , , 1 Y -f -,. . sis-,-gw,.wj3Q-,'5 ' , ' ' , , ,- ,- , ,n N ,-- v 'S W' 3 .Q ,ww D,-,mfnzmwzq',v:gf'va4f -,-A 3-W-Lf?-f--1:3324-iff---fffi-'mf:-9:-rv-1---W ---k'J4-A-+W--H--Q f -V Z-as-:.m+au ,, ,m14:424J44e44Mg' '1.c:-FQ- 1 .V ....,.,,--,,-.-,-,..,.,-.- -nmngg-W , . . ' MQ, v- ,-,. 4,-A,,..,.. ,--V... fv- 1 1 1' 5 V 11 1 E sf, L F 1 3 2 5 1 2, V ?'ViV 4 1 1: 1 1 1 5 V 1 V V 1 ENV ' 1 Y 'V 1 3 F 1 5 V V V KV ' 21 1 , zV Vf 1 2 V 12 I VVi Z 2 2' 2 1 1 1 1 V ' i 1 i VV 1 E '1 V V k 5 . 1 2 ' 5 , V V 1 V 2 1 V I 1 ' 1 1V V,V,,,.A.....,h.Q.:,...4,.1,M1VL:4.,1..QV,,.Vg1VV,4pM,,.4.g.44.4.4 V Vf44444.VVQVQQM.,L.1:.1J,.1..1MQ.f.4.444f ,g4.gV4g.L,.:.gV.4Vg,gV,1L:fI'1V I V 1 V 1 1 V ,V,V V ,V il 2 . ' ' 1 V V2 ' 'I f 'E 1 ,' 'if f V17 V VVI, . L?iV:Q'i IV 1 lV'V1V 'V 3 r1VVV V 1 1 in V! zZVVi' ,V V I 1 if VVjV 1 2 2 ,,,, V1 554 KV' ,, ' V V V V -ff-'f--'--''--r-------7-51, VV VV V V---v-v--v---rf--f V V V-v-v--f-fVV V V V Vw,-V.,-w.,VV,W,J'VV'1' QV V' 4 , 1 1 iV V V V'VV gV Viv ,igjVgV, V Vg' 2 V V VV 1 VV VfV'V'VV'V'V fVfV V V 'fVV V 'VfV VV VV 'V V V VV V V11 4--M -1 -V V--V--V--f--------V-VVVVAw---f--A-A-------+++-414-V-VVM--t-V4-+4--++VM.V-:V4VV.-4+V.VV.V.V.4V4VV .VVVV1,4.g4.4..f.+,,g,,,,4,,,,,,,,,,,V,WV g g,Q1!VLVAjMV ML! AH' I V Q V 1 V 3 3 1 2 E' V t V1 4 I 1V VV 4 V VVV4 5 1 V1 V 1 V Vg V 1- V 5 , Vi V e V' 'V '1 1 f 11 VV1 2 1 1 V1 V 2 2' fa 1 . V4 V V V V f 2 1V Q f 3 L V 3 z V 12 2 1 V 'S s , 54 1 1 E 1 , I 1 5 , ! 1 i . i I I f 2 1 i f 7 E 2 x 5 I ? I -2 , , .. wh , . ' 'MM-MLW ,,,.,,,.,,.-,,,.f'---.,. 'xx eaving Bremerton Y W 'fi' ? 7? w , ,f.. X V 4' , . f, .JY .A i .,,, 5 ' A ' QSM .Qgfgk ' 4 ' I ffrwwl ' ' AQ- v ' -' ' , I ' 1' AY - i ,- N M - V1 I' :V Q , ' fig if 'f . Q ,-'f'1.z1: -grey' ,, 'Tv , , ' 1 I 4 A 4. Q ,W M 1...-...lm-.g-1.....n..-.-.....f - L.. if V V- R .1 Y .V --.....+Y ,, ,W , , , , ,7,.,, . ,,.. ,.. , W,-.Lk i....c-- .'X'i . . Y- 1 I 1 I T If 1. ,1. V I '1 4 1 I '1 1, 1 1 4 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 I I 1 I I I I 1 I 1 1 C 1 , fi , , A f 15' , N.,-. -1 1 ---ff -Q:-gf- - 1g--,g -jgjv 11 'f 'f -' f W A' '- W W :vu , --'...,,-,,f4., ,..,Y.,.-,, . :VL f- ,L f N' J w , N Y i I i X X XX XX XXX XX 'x X . f 1 ,N N, X I N ?nzgL,7U ffy-,fax pvmj, x ,fp X Q 'Lx A S.'41,:f1'sf!w,4 1 is 1 'i wHf'umQ mf LM AMLQQ1 L iwMf1l P ,J ., , ,F ww xfylwvx pw fmx 'X f'MNr , X X14 X Xi.1 1 fi ,I X XT x ff Z , , ,N iff--A-Y K .W Lfxx XT x X J 1.1! 7 1 1' f' J f 1 ' 6 : L E .M 7: V i N 1 1 , w 3 ffxx ,Ax 1' Zami N i i . V,,,....,,, X x, ,-1 xx X, V -. ,X X, X, nffwf, H if QM! IES- 'Hi WNW 3 X 5 fwfvjagiy Q H V MMM Lf QE' s 5 ff--,'7-is :wg I: 15 ,Z ,Q111U,w Qmm+vQ'b f M Q-,def ,Lf Mgfsxifwif 1 if WU' 2 A -gfy jf., fl . UE W4 .W--7.',lt,. H . , 1 , V I wfx- avi, W ,BNI W' if 5 2f'If.-f rfvf 'E' f , H1 4 gf,-fV,,,, .., -1'9fff -134 U4 L 'ii i'f: 1:f-WJ-'H GUNS 3' QLLQHEJLE, QM !lihilU7,V I LMIQELVYJLUEE' . ix if ' V, K I C , 'LIT -C - , J. ,M 1,1713 gzip ,-.5 W f- fl 1- - -. .K . .M ilfl +L, 41 4 '31, wBw,aQ'ML11l 919,16 3, '51L0,:1g 'ggi f.xg,jygXgg.1jf pal my gg mmf:wg,w:f f 7 . L. 7 ., , U , f- - r A , -3213953 lf r4 31' JH :fp ffffpwf fwzfg 1.1: .xi qf ',',f'w,7,--. N53 fw,,v-WA Y ,, w ,,,Af, x .fm X W' W Y 1-J 9163 ,Qi!l,Y2A!g'5Wi Qlidllivfylffff-Xffiulfiwbzig,iibquiigglil f1'?f 1 L1 w W ,ZXUUU5 -, .f-'f,5f-aw x-Ii ll, - .- ..Q1s4.fa.f Wu- g .iii yy -311: ' L51 twiki! -'i?Qi5ff'fz' ,l -ii R K -,L ,. f 1 4'rN1-gg. f ,iw .Q-. u 13.-iz: GLW ig: . 1.22: -mv L 1 1 , ..,,i, AQ!! .. Ng, E' .GF 5 Q 1 fd' if Q' Q gf' 2 -, V , -A 4.-1 w , - xff,1li,',,g,3, . i,gg4..,.,:.:.J,, ,ivmx M X. ,V 'Rjgfs Hai' -49: .lfji .EU ,,', 1 an f bf ,,.,., ' . -4 ' 'Ei Q swf 411 bfi 1 13,1 -- . fmmw . f- -' .-mam 'd ' ' 'J V W 11,1 Wi W., . ,xi- .. Y fu z 4 4 mfr Q A hir , V Q , 1- .V ,V ' ,bfi if Q I , 1 3 , 1 ' ,f, Q , . , , , li fra., ' ' 5: ,,, J, V ' , A nap: ' Q' , f ef i . I 'li b, V 9 U13 Q ', , QI f' '.1,','i f, , -' 1 9. 1 H A . . -A 1 0 f Q v gf .,, .-. ' A , 1 v . ' M 1 I 'W fy I ph Q I l Q ' A ' U 4 nag f . . ' 1 I v n ' ' . . . . 59-QQ! WI a lim, A 54 ' 4? , 3 ' , 1 4 ' 5 , Q .. .nu x I kg I 7 W. H, ,O -'lr V 1 Y I I H O I K nr VV , ,,L. , 'E 48' 41 lx IU all I 4 gl mv .r 'i!'?!' as v - ', 'un' av' , as wb Q-.! Y ' 4' A .Wax ' . .f w SMQI15' Q fn V1 USU' ul ' Ae funn I9 , .3 , In C il 4 Q W ' 3 fw- u-fr R353 L' 'max ,, gy! . tl' 'oi UW if if 4 .I 'll' Mm! .U , z ' 4 '11 fr 'I ' .Q p ' Q 'ue . ,,, a i in .. A at I U 1 . 4 3 In M A Q S vf 3 9 gmyf ' 33 ' 1 TQ' Ii. ' v 4, , lun' A 4 nv 1 1 l Q' 0- 1 . :go gil l W' 'z a' oz: f Z f vi' li - , , ie if E . un ' ' ' . ' ' ,W '-oil!!-I' ' iam: ay A 'U' 4 , ', se M f ' L V Wi , I, , 1 1' I A A . sw A . - iv figffh-' :N 'W ,' J'1 ts ,I Ng Q Q W ,X ' an 1 uw F Mxlf, . if mmf 1- ' 1 , If 5,1 , Q -:sue-if-ffm:-f1,L: xr: 1 , . H . ,f W.. gxqvnwgr , wi Y. 'i ji .I 2, 7.4 , .1 .4 -pg, Xi -,ff SN. 1 u 1 2 1 ' H af' f r w .u..X x -JM rGiX ffX 4 x . fd, . 3 x xc-an ,- LTL: 21:-1:5-'11 --2-1-C-azz, :ax :..::11-rf ,.., :,.-:,-,g:.-aa, ':,,::::QfR9.:...QQ:g,,-.-.17q,Y:lg., 1 .14-. -, gig. 1-:?g ..,.: 21-.,:1-,,.-. Q . ,..:,, A .--,q , -1,,Q,4j' , 5 ' , V . ,- fQ.L,f'22ffQ,.Q,-1:-V' 'fiwl ,QQ f,L.-,.-fLf- W- .nf ----SW 'if-fr-'fiffiwfiff' ' : ' 'X' ff 'E 1,7 x I . W 1 . 1 - X 1 w A 'n 4 '37 1 5 1 V 4 1 4 l 1 , f 3 w 1 Q . , , . f w 14 I 1 . Y-V-Wm-...W,x.,.,M...,...Qh:xiii. Lyn mf A XA sssvssx we X :xssxxx X :wx xx X ix fx xx x fa xxx Q -A A . 9 9 , ' K 4 W f 22 id j if f V , . fe ,4,,, E 3322 ' fi? 2 ,, na, 81 Off Dut Hong Kon . 1 .M kg Y KM, W, ., 1 f -S1 Qf.Xw,ygsL. X ,ing .191 W a X57 'taxi f Hz, , Lf wx 9 mr, jgx-i3s'J,,t f 7 .Vu ., . jfs' in X, ,A ' ! . 2 I9 ..,.. ,,,. i vww gyw--Qwqumm.f.,4w-..wm....,...,,f---f-vm,-a..,,.-.....-.... , Mb... , Off Duty Singapore December 30 - January 3 335983 Hwwwma ZWWEWM 23?mwm KEQQMQQ ff U 4 7 fnkwg, . 'Q J , ' :fs3? 4', .fn I , .gf , 2 I - . Q-' E 5 ' f W 'x vs. 5 N, qi TA 011, ,I 9' Qc -- 4- K i. 4' iQ Q53 Ti' 1 V : ff' V f 5:91 'F' I 3: Q15 Q 5 A.-5, AL 'Z Agfa 5,1 wi.fff f 5Q QI Q if , ,S B' w 'fffg'.?3ff Q2 - A sl!! Mai 3 K if A -' Q 5' g f wr as gg 15 , m glee? fs!! XA 5 51 ff X v.Y. f ,. ff - ' ' Y Fl, ,,1 K .,., wp Q,nk,g.1,4,,:,,,,x. 'V A f i-5,1 lp! 1 ui vi L: L2 k,i i :,q'-i, 'f,'iv'3:f T j! ff 'f ,M 1' ' K' fL,, '- 5 V4 . Q l b 3 'T' ,gi ?' I g 9fQ2g1ff'55 Ei: ss 'Q ' 43 255' ,, V .,., - ,, ,, , ,, ,,.-,,-. , , , , . .-, ,, 1:5 ii ,W f- ' ff , '--f- -- ff Hr H' H,---Tv fs' ' .. , ,.., ' f, i:...,:,-i:,1?f 'N' V 7 V .YW-,Y -x1w--v-.W-V,rr7- . Y..YY ,f,,.w-.,,,. .-. -W ,Qu-Z, , Lfqx-11:51- .,...--,- .F-vu- -- - ,i- - K .V , ,?-..-., ' 1 - .-f- -Q fu-.W -.Jlvs--W , , ,--v-T'-,-Y-V----N, V-- - -- ff- 1 -f ' Q! W, 6 I l 1 1 Supa J 5iilW5QFQQDCFC 23 J L . .. 3' PQ , N Nf' ,,.-- iz a f 1 ff. . I 1 Vile 1 2 4 4 'VG L 'Hman 'S -4 'M' K. Lana ,QV v,. . fr , '+,'-,. -7274 ,- It fi ,.. -1+- i' ,V ,,,-- - V-Tvn, W v,-:,vg.,,z,Y.:fF'f-'W' ' ,935 3 in f I I I v x 1 .'l . 'V 5 .- I 5 X il QL 'I J I I L . I va Q ' 1 'iz 12 YI gi. .I LW I ,Q .Q b t : ,l .Q 3 2 ! 2 :R ,N-.1 .I 1 ,x 'z 2 if QOOKW.. xv'-3 AQ!! F YQ mfg fgfrxx in , , wr'-xxx 1? mf? 1'51i Qvx ' M: g, 'j,f M Ijizifgzxgff 1' .lf lxji1L 'M ,iipf '-4 1 f ,f A' hw' R-2 If W -NW! fx ,L-wf'T , X-7 fx Q J f W-Nf'-ff --f ! 4 1 1 E 1 rw 1 .S if S 'WW if . . , ,-- ..-,. m-,H-,.mr'--r-rl 1 ,awww-,qw . , , n4-nn-vrn-'v.f.v:-1q.-,-1.4A,-a,...,f.-fv.-wgum..-yuw, . nn. ' V x 3 Www QA , , V , x ff? X A J I3 if' A , I ' ni? X- ' -xl. 1' W, ' ' . , 1 . ' ,L ' -H -. ', '- J yi 1 5 P QL ff, K 7. 4 f Q' ' L 'V X , Nh a,x v. Emi, F N w 1 N X W- J ,kr x 62,0 4? V F V jk- N .. 4 90 l E , ,w r Q 1 ll . 27 .,. ,gg , 1 sq, ' Vw. ,I-,Q ., V,,V LQMVV Liv., N I- fm--VV . , NLG. Jw VVVV . ,U ,l Vw ' , V, rgifae A V..,. ILSVVX V 3. J A ,,fg'Q' ,l , A .V 4-fir .zu 2.2-rf A -JF V , gV. .. V.. fr 14,xV.w','- - . J ,f -g- A V' J .WA ' sf? ,-VTTVVQ V'?5V2V1VfS 1' iff, , ,Vp Y 1 V .M V.-s? 5-TV 4. 1- 'ff-v.VA 'v1Exf,,':J5Z j V A ,gqari '.-fig..--9 , V Q' V4 - V . A, V15 Aff, 7,V,, ,ff .b lgv A, Inv, ' , -.4--4 xy, 3 .V '-.'ZQ.fV-fgglgf' V t -' ,I 4pVf'?x--f, VV - -' V-V X V -+I., 1-IV '. ' V' ' 'VL , -4-itbr' Vw ' J f'- .' 4' f -V X ':. f .,V4x,vV 'V V.,V.f-1 -., 1 Q .. 9' f' , ff .N - . N-.2 . , V.' - , , Ji 1 ,. - z'L-'jg-f'5J'v-i ri l I - ' , -' 4 --..., , V-f-T Q, Q ',.24',V f - Vx- V ,,V. 1 ,X I V, 9' f N55-,'VV.'4r 1-,.'f WW' ,f V7V,7i'W4f Tf ' 3 ' 'a 'wY'v- 'x., '-:' V V - - . -E' ' K ,' ' 'W , ,Ms - ,-'1g2fzV2'r,a 'Q' ' n, ,wg V'1',, 1, Vflf!2,A X ' V. , ,jiqi Q Wx ff -N Q ,'1 X f.5,V-T' uf 8 ' AW' Q . ' '4a 's'.l ' I ' ,, 1, 't' ,ff f',17' ' WXu'V ' ff- '-A AC' . 5' x 1 , , V ,-A P V ,V A fu ,VV 5' .gn , I . ,,V. ..g v L , , ,- 1 7 A f H H4373 -1,'V,.x -, .nv-' ' ' ff- 4' HV f-' 2, , .V Q, 1 -,-,HW ,, 1 Vwv ,M-V : WV -pw NM.. 'gf 451' wg!! V PM - . -' A faq.: 1 4- V' ' nf' f' 'V' V' V ,kay .Vi T Nxgx V iykgf ' gg., f .P -fax, V-J . .1 'gi ' ,H V I Q' V 1 f., L? ..r.1zbkr. . N, N: ,H . , 1542 . ,A ,V V . , .' V , , .3-Q, ,.,q-p, A 'I-.VN ,VA .2.,,i' ' V' 121574. V ff 2 V- V , -. kfyr- -Qgmrfi-V -'IMI ,iayfn 1 A, ' V , V .L9lV11'f 4-.4 ,ggyyn Q ' Hxnf ' VV .- ,ffffv 2' M . 'V . V. , ' J- .ffl-, ing V f ,cv ' wg, -' -N, A w . , , V .V -'Z V ' f ,Vw ', V' 1 'V V Q f V V ,, V Mn-1 1 f V-, A VER -il I .. ws, V A - , J Vf.Vw,,..,:V ,. MDL, V V , .,,A.V,,,i,,. , , -.V V . V VV f MV V, V fd.-.Qs VV ' ' ' ' I 'f E323 . V . f ' ,' l BV ,A 1 'Aif 1 ' ff' V fic.. ? XRD ,, .gf ' fgtgvvb '-VA, f V 4 ' I Q4 ef V2 , V, ff, :ff 's-,f my V V ,.V,.,,.V, 1 ,WV-V-ff' ' ' V' V A V,V, ' V VV V, f' ' 3 Wy. V W V11 w r V ': 1 , 4, 'Pr 'K' :- QV V 1 , I V 'ri . V , V QQ 54'-W ' V, ' V V A V ,A , , V V -,V V . x, V V , V . K , rx i .s, V,,,,,,,VV. -5+ J, 4' V ' 1 F ' s V2 V fdx fi 'AV V------xg VH f'V 'x-SV Q ll C V Y , -. l L.. A. V' 'V HV JV A V V V V V VL :V V V V V ' V V g V V V 1 V V ' ,V ' ?1 1Vf7fsE:Ex'xx'XV ' 3-.xx fy' E L 2 f V LW! Q V Tl L, ',' Xf V, VM, ,VV V sgsssr 7, .X UV-F ,MV V V 1s 1,V f X :mf ff V,-Wx XV V VVVVV V ' 1 X V--- -- 'Mx ,f V+-V , A-XV VM 'A V fun' K ' 'W V F 9 W Yx f M-XV J, N V V' X1 f V 'x V V ,A--I V ,V ,--, gf fm-V 'V 1 ,V-N. V ,f X. Xi XXV If V V ,V V' X Vi V' V V'V 3 V3 .I ' V 5 V4 V V ff 'V V V V ' W V: 'f V V VV VV -I 5-V V, V EV V, 1 VV X. L! ,f E V i P V X KJ V1 i 5 k,,J V' 'A XJ VXVXJIXV LW-V L-V 1-'WV V .xxwj VW:-,S V-.xV'vf,,.V XXMVVM., X, gf fV 1 Kiwi, V-' Z V V ,fmx V f, X V, X . rwn.. Ldf ' ' 1, x,-mm-Q W 5 ' UV t Em'V 1 , X fv 0 -s Qs n 44 W. bv 4'6- , . M , . jx ',,f1 Env. v-gn , - - 4 W. Q .x A ,Y, ,,,.,,,,wxi ' f .Ax C 3 1. ,A 1. K, 1 w ! 24 1 1 1 .3 M A 4,, I r 'U -....,,.. ...f Y ,f.-,,:-Y ?,,,,,,, , if Q... .hzw V -----vL,,',..,.-1 ,- , ,,,,,- - , --- ,4g,,-,- Y, ,Y b... V -3-,.,...., . W Aw. ----.. Y - . m-..,, 1 V Y Y , ,Y ,,,V .-.....,,.....,.,,,,,-,.s,,,,-,. -,,..., i 4 P v 4 r w Dubai United Arab Emirates Off Duty 41249 :T -VWQ X 'L ' ,lffifm .5 VZ' ' V' M V, - V , Q ., I 1: J' vi 'Aj 2V- . H 1 - ff. , 6 I - .V V V . ff'-.V f' if af. . A ,V . V ,uf V: ff. , VV 4 V , V. V+, tzytgpt. ,, ,, . ,V V, - 'M .' -V:f.VE'3'3--' 1' W W ., ,Vj f V ' A .Vw'1qf'tl5CW1bf V pw' 'E' ff- Mia:-gI'.' -' .' -V Q -. ,Nd af -w V '19, ' ZV?wV1ggfW,y,. VV ,VVQ,,.-gy?-4, VV - ,, V , V wx :ff ,W 'if -11'-ah.. 9 V J' V W - + , viz' -ffm h,.'t:v! V3 V Wy ' X J., J V ,- VV gm:-5 V 'V NV-VV. V VV ,V ,V get 5TVV,'Z'? 2V,.3.4: 1:,V5'A '33, V' .-Witiyfiiw V ,Q t wwff, , ' X-'V V Q:-,'V:,gQyV':.-:S , - ' J ' , ' WW Vf5:.e.a f 3fif'i 5.g.y.VYV X ,V V - In V, .,V,k,,.f t 45 V V 61, :iff 'V Vwff,-,. ,V,,V . V -H? WE ' , , V. ,,,,345wV ,. f . V V ,A jh f:VV':4V ':' p ,,V,V., .Vw .VM I AV , W , Q . V 4 Q 7-1, V, V' . gl' ' 1 V ft GQ 4 1,1 . V gm V s' ' 'f' V - MI' V , ,af 1 J K t 4 2 ., V Q Ar ,J , J :V fx: V Jagzgim V, ,LET V, . ' i' ' ' au V- V , t 4 V .H- . A x r f V . lam V 'WM , N' 5135 ,K -VM WU, , - ,t V VV V V V V 'J?'Y7f7 X ' ,. V' K, , .3 t gait V ' F 1 4-1--L-. WH 4 VAVVV V, -J , A V17 1 ,.,:e, Q . Vrgzf Lani- . K' t ' - ' -A - If QV I . ug, Y ,. J 'AY. 1 i i . ,., 3 ,KL , . ., g.- Vwxv' , wxgpt . 5 ' l V, 53XN,x. .63 f.,bQV?g5CQw. . V Q ' ' It Wi' ffl''x'ifXf'1,,'1fQm.V.t'' -xx N 5 ,A V X 154. tx.. z jxqtigqf.iiX5.:..5,X ,X5Vilif,X,fxxi- Tv :X M A ,V,-Ly k.:?:.?:XVgl. QV . 4 I SX--'ti-NJ V X .Y Wifi 5 tt . - 1 W ' 35? i ' t - xx V ws Vt V1 1 N , . V, t tylsgy -V V X N 'ff X Rxliixlv - V X ' ' 91: ., . L . 1 . V , V V5 V V lard' , , 'Vgy ,u nl s ' Txwif 'Wi-1 .V ' -V 2' ,, ,S V . , V,,.tVf,V-355 , K ,V ,V -- V ' X , ci , V , f ,, f V x ,. -' 1 .VV , ,g - ...Km t A I K- .N ,,,. . VV. fy .-A ,Q-V, 4. 'XY' .K ? A,V! Y, , VM. --V t' . . t N E ' r V. 14V V A' ,ff'iff-V. , t V V , Vw. 21 11 iN' A1 11, il -1 9? ii' ,1 Il 11 J 11 311. bf.-11 MV., iii , 1. 'Y4 '1 1, 1121115 Qlwgvgj 116: :EEK 1: 5451, fi .17 1 .V,,, . 1 11021: Qfffi X315-:gg ,?5?E:'i' l1s5E'fE,1' 312:51 i?51Q5f'j MCSE'- ,:'213,2 111,516 11.11 fl 15?:j! 1E1,fLf,2r ' 1 112-34 . 1: 311121 333:92-f 312125, wx. :Ways 3 1 1 1 lj, 21 1.111 15,1 1 -1 M, 111g11,1:g,g 11121-419:21 if f1:15FQ?ff 11,14- KQGW 1 170,31 1 ' 1913:-1, 1 Ween'- -.f1rr1: ' 2121215 11, 11 11:55-'A l13.,,. , 54410-i' ' WE. ,im 1-1521971735 -?1'i?i:7' , 3 ,g11:J3',g, rf11,5ga5E: 2113 ,,1, 1.1.1. .,-wevghf, +511 gr' '11 111,1.1,:111,1-1 '. , -42, ,11f:x:': 1'-, : Riff'-fi , 11 g1'p.1f:r, W. 1- 5, 1 11 W f l-1: , 1 H -ful: 1 1 ' 1, 11, f, .1 fgfrifa wifi 1111?-f1'1. 17 g1l'3:,3'-4 ' gf,gL2,'fQLt 5511341-1 Miyixfik 14111111-1. 1 1 1, 1, 1 LQ. 11 17+ 1 1311541513 15,221 11 .. . WEN. ' flwflr- x WW'-Ii ??1swe1igi 1911 1 W 11 1111.1 , 5 1.11 11 ,1.,5,,, 11111 ,1 111155.11111 , 11251 1: , 51 1 ,559-.,11a 113, 1 5 iw 1 111,14-2 i 1 ,j11','1p.,v:,':1 M1312 3lF5?F3f.f' 141 ' 11 1v111i1'2111r5ae 3 1W.Q'i ,1- ?i131z2f11f1 lg ' ' rf 1 12 :QM-1 zz-f' 1?11:-,ia 11 15515215 X 252:31 .1 112 , V, Y 3311. za- 1 11.15211 1 1, 1fQ,'4'111d.iT 1 9 11215'- l711 .,1 1 95451: ii! W1 1 .. 1-.1 1:1 1 if fa'-1 15521, 1 111 .11 111. 15:1t.'1'1z1u 19, 15,1 W 1111 1111, -1 M1 ,111 1311911714 ,W ,M , , 5 v,1, nz 1171, .1 1,1 .. 111111.-,1' ,.4,1,. 1??1111l'.1. 1,11 1111.21 A !511 u'L uf, 1111: 1 W -5 J: 151 2 -1 i 5115 W1 11,1 J 1- 2 ,JN . 1.11112 1.1,,..,,1 WH .1 111. ,s E1'u,. 5 ' 51.1- 12.-4 1 12,11 A 1 'W' 5955? -11 M1, 5,111 1 1 1 1,1 2 1 1 -M1 W 1 11,125-ng Lgiziin 11111 KY' ,Wi W 11 1'if1M,:2?f 11 a:2,,1-, 1 11, , 1 11156. ' 357111 f 1, F 16 1, 1 11, 'vin 1 -'11 M' ' 1524 1 1,11 111, 11111 I 7+ 1 3,15 1,111 . 1114 ,111 1 M 31' f 11' lijfff 1 41,1 11 il wi' 131 11-3 32:45, 51-1' QQ? 5111231 3 11'11171i1 . 1 511:43-' 21'-I 1 M11 , 1 ' 11 15- M 31 11,g11',, 11' M., 1 11:1 111' C6415 ' 11 1 11,1111 5' 11: 1 , 11411212111 1 ri11'1ffJi1 1, 13 1,115 111 , X55 11:35, 1135 ggsfq, ,H 1 Of. 1- 171: , 111211 ' ETS4 1 f Y' A .,. ,.,. ,.4.... Y Xi ,1 ,.---2-ff--W--ff-+A1 W' . g.1S2rs1s1fr:Qxf1,...N11q::1:.x1am4+Qy4.f.1.c:pq.M,1:wiyu.M1..141.w..,,5fm.g.i,WV. 3.4.ff1:.,w,'f1Qsv44f'1? M: vwrwlwigwv A I V H 1 M ' 1 1 1 1 1 LI 1, 1, 1 11- 1. , -,111 1 1 iw ,,,--,a,.1.-1-W-W... H 111 :iff-I ff-Y., 1 11.-.fi11s'f'.5l1f'Jf--w, 1 21:1 ' f,1.1A ,V Tg f 1. V ,,14rfL'i'u'1, 1. ' 1 2 : W5.'1:Y2i52' '1 1 .,,,.,, 111 Q 11, 1 X 1 1 f7,75F'1 - 1 1 'gjfq 13, 4211123112131 lr? -11-15 'QQ 5115151 1211?'M11f if: b1'S'fff1P11 r r V X Pi ,W 1, , :a:f1f1.wq :Misha ,, .1,-ww ., 1 11 ilifwf 131,35-P 11913, pf fb. 11-.He f , 1, ,..1111,- ,!!., u,., , - . ,., ,M 4 I 1 1 ,1 1 :Fi Q, i Y 11 S 1 1,4g,21,,, ,, .wwf , , .11--wfv-we-1' 'wvivf - ,- 'M 'x 'i 7 ?fv 11 w:f'fa+ -5-,:i:1f111 12Z?'1::f: 1 11 ,mv ' W W' 5-Eli f5'l::,11 TE: ' fl3l15,j1 1 31.1311 2.92135 V, ,119 , 4 1 11 1 , ., 3,1 x 111 .1.gg11,1 1 , ,111 ,,f3fQx1bZ,i1:.1W'1 1,,f:'m1V,.:11f WH , ,, ,,,, 11511 . , ,,,,1 1 11 1 ,,111'3f37f.1Z'1Q'1 1:21-,f1w1:11' '- 541411 125.5 1 ,zjii-E21 113511 '1fgQZ:1 1 1 1 111, , I, 1 1 A 1, L 1, 1, 5 E, 1 Q E 1 1 1 5 ii L S 5 1 1 1 E X E 1 1 ,W H 959 I -,-,.Y,, , V ,, 1,----.E 1 1111351111 g51j-:1a11,'.g1-1 .gfy ,1, ' 1' 1 13 , 1 1 1 . ,, , , .111, , 1 ,111 . .111 1-11 'L x ' 27?-'T'-A11uw,1 -:www :.:'1i'Zf-Uv,-.1.Q11:1'n' Ui :1:1.:52'Y 1 1. 1'g'f'vs .. 1 11,1 1 T11-.ff N' '1 1 ?1 ffr'1, 1 13:11 f 5- ' ' 11 :W I 1 xxx? '!'!! 2 9 Y Q3 1f'f i73f 1 1 1 5 IX X, 1 xv W '1 51? ff? ' -1 3 Y fQ?:'s,5ffG f' 13:5 3 ,' X 15.1 E 1 K - -E .1 . . : 11 .Ma 1' - 1 'i --1-NX. 1 1 N 5 11 ? 1 1 1 1 ,fl - 1 . 1 1 , 1 1 - 1 1 1 ' Q 1 1 . 1, 1 W V ' 1-X 'I 5 ,Q 121' .' 5 .Q 11 .1 1 111 .5 i X.5S11f:1 1: x iff EW ll gc-11 Q x1g'3-,-1-J'-1 J 1 11 1 , 1, K:-li,'.'13gQR:. 3 12- 1 Q31 '1 Z 1.15111-:ff-je E -a25M11:1x' 1-1 5 iff Z'bX-im 1 5.113,111115.-111y5g1.11.V-1 1 .,. 1351iI:iN1'A WX? 1 1 bv-1 -1.-1,111 15.1111-:, 2 1,11 - X, , wax My .1 wi :qw 11111 . A, X M S L 5.1. 1V'?:'i-1 : 1 1111-.:31,1W5,1,iQ1:e11- , 11'ia:iiQ3NQgSX2f ,1.,,11.wgwp 1 1-wg.11.1g',1q1xV . Q . .11-'s11.1W-11.1 1 1111 1 1 115111- N29 L115:1r:31.91:' YK V,,'q.g ?1S12IA1W 1 M1111 .1,. 11.11511 . 1 Y1 -N i 1-11111111 .111 , 11111 1 X w11u1.'- 'Y 1-N f - 11.',L1-1311111321 wx 1 1:1111.11-111W 2 fi C31 '?1qIx?wk 1f' f- I ..,g'-WW? gs. XJ - ' J1.EfiffiL:1i'Kf 11? 5- ' 'N X f'nA1P 3d1w1 N1 N' M V 1511 ' 111 , Wx 11111, 1, -as-11l1MH M1-1 1 Wa.1vg.1,k11w 'QW 1 1.1 1' .1,,.wS1,1 . AL, 1 , 1 -M M N ' M WN 1 'N 1512 1 1 - -NN' gm 11 .f 11'1-H1 121.31 11 1111! ,. 1 1 ff-1:1:111'1W1' 1 11:1 MQ: 11 1 . ,.1111.. 1 ., -11' . 1 111-g.:-X11 we 'bi -113 -X 5. , 21 f 1,:11'1.-.W 1 1k,.'11Qx F .111,,11, ,v .111 ,11 91 1 4 1 -' 5131 1515 '1kk 1 1111- f-is-1 1 1 2' 11,-1,1 11 I ' -1 ' H ' ' fy V H J 21113 1, 3 11,11 1 13 11111 1, 1, , 1 .1 , 1 . ' 1 1 1. , ,. 1 J 1 D 1-1,1,,,,.1 1,111 w,1,1,1,1,: , 1 11 M11 ,1 1..11 11. 71, 1 1 1, mn? . . ,1 1, Q, K1 . ,J L,,,+xLQ,,., 7174 I V 1 -,LV,,,.kY1W,, .1 ,1.1-M, 1, 1' 1 A , '1 1 1, 1. 111 1 , A , , 1 1 1' 1 1',:jp1' ' 1,, 119' Aff '12 1 1 1 . V ' 9 4-H ...dr ,.! 11 '1 ' 1 N! 1 1 1 ,,,-1 . ,xii ENT 9,, ,J 11, 1. 'E '11 1' 11 'I l' '1 fi 1 1 111 f'sf,2'.',, 1- 'A 4r ' w ' ,hm 1 if--,gr if Q! 11 1+ iz Y 12' I. 141 11 11 il 1 1 if ! i E, ,Y AP' 1 ,.,..,.gA.,...,.. V1 ' ,S 1 - 1 F 1 11 1 11, 3 3 1 11 1 1 X, 1 1 I Q 5 I E 1 1 1 1 21 3 l kj! EQ 1,1 5.6 1 5 1 1 1 1 1 1 , ,1 4 1 11 I . E 1 1 , 1 1 , 1 1 1 S 1 1 1 1 C 1 V F 1 1 1 , A , k U 5 ,,,s--gW ,,.A,.-.,-,x., .-.,g-,-. .M .MVN K. -.,,,..-.Y .V--.-N--v. ....---x.-...A-..--- Y--V.,,..-1 4 :J E 1 1 LVM Ai ' i' an i Y J7c,.,.f:f - ui . 15 x 1' 1 Yi ,VV V 5 V V '- V ' V' YV- , A 5541 If 6 '. - PY' V7 ' 1 V W-T VV' V f new 45 V ' 1-?a3 f f V3Qi: .7 1 'fVj 'VZ-1f5 ,5 T V 5 V .Af-'V ' Ei ' :' :?4 1 'Y A 5 Thi' ' V -' E7lr x'V' 'V VV? ' :' VV ' '-gif.. - ii ff Airy! M126 he ' Q 4 1- ' I ' V ,fig i'Lb,gb , V' It . 2 -'-V fy V V-VV K r:',6V,,' V 514 md if v3,l54,V'V I' Vvpj - ,f,fv.3 1 '4 -1 'V ffl VVV 5 3,2511 V V I .32- H . 'Y 'fa' -Q , .V V'fi'VVg' V V, 4 WV V 25555 IVR' VVVVX5! ,V .1 aa K V VVVW +97 V, ,Vx QV 5 , .,Q7L!5h - VV V f 5 Ri ' f 41? ' ii :WI QQ , .V L , VS , , 14.4 ' kffff Att 5 4 it XY'M' ,f-12: ,x i '7 4 '7 Q1 if .,V 4,152 ffV :. :'. 1VV 7551? VJ3' .. ',' ' V N 1 W V' V' -VV V V, V VT' ' ,' 1?-V: VMVJ - -- 4 V, V14-V VV: af f, 1VfVV3fVnF1'?i3??5'VA':z'?5k-V 153413 m'i 'zVzf' V1 VV VV 'f V VV., .V wa VV f Vxf:.iQ1za4,fr..V ,GM M .V,V4,' - l flY'3'lQv?7gff x' iff' ,f?z'P'Q' .?7 5Vg , mf ' Z m v ': A ' ' 7' T VV: ' WV' ' f,1,Q'.V.zV, wp 2.1-'?.'G,VHQ'S7s,'gVsV'4c'5g'V Q V L.. V V .. .,g,,,.. V. VVV:,V new Ie. 'VV 11 'fwj 4 fpffg ' . - V , ' '. . V V45 f.wf.f'?zV-' - Z:-f 'V '-'X ft-4' V ff ' V ,wif ' 'VQ' .D I V --i V, QWQVI V 'WV' 2 .V fir -' V VVV' x VV ' V - -.1 ' U ,...,,VV 1, Ar.:-Vile 'JV V14-,WW -if ',w'g,.: ,Vf mwxff - 'V 3. .,e'f-13? YA ., 8t,'V.V,,v fj3,,:g, V .ff V ,V 7 ff V VV Vai' 'MV ' in gf V VV-VVVV ' V f V54 V yyegfe :V dxij. Affiiiw ' F ,214 A4 - 'V 3 .' Q15 - 4 V M V, ,- ,. , ,V V ., V V V, V . .V ,. V V., V, .41 ep.-QV V 72 D t Qfiisifl ilkkfzfx V J Jffgr ' 9555? V V 341251 V I V l 22.11 ' V 315' V V 22553 7 V Cffg, V L V V .V TJ T, 5 gkfflr' LRF: 1 VV.-ur-V VW 173-' I gsm VQTRJ wg, K V V V V V 7 V fi V, ?. 3 V lf V ,V ,V ,V V V P Z V V I V V I V ,,mi! f V .V-f iv ' 'V ' V' 112: VZQVVTW , , '41mVVt' V 3251: . , kgagsffqii - V, 'Y H5-f..-. - Vw.. uw n fa Qmil Zygtliffif I I fx ' A ifaV.5f.Vf' ' Fha 21411, V V V 2 I L- f V V ' V 1' f V' i. F! I K . 'fx 2' 4 V ,V N V ' 'V I , VV V V V V , 5 1 V V 5 V V 'X V V 75' A ,V , V V ,Q - V V , V V V V V V! I VVVVVV I VV V' 3 VVVV' if Vg V -wg.. V V V V V V V V V V V A , V ,- f f x - , fV,. -V 5,f.,p4VV,y,V-V V J VV V V, V- , V f,.1 t 'V 1' -V Y V VV 57 N N V ,W ,Y ,,x,,,, , s,,s UH, M, W ,,,,,, ,, ,.,, ,,.,,.,,,, V ,,,V , ,V V, VV VV VV VV V VV V JN.. , .f, 1 ,.4-1 , 2, , I4,,A V V, V . ,, - V. ,. X ,. , . V , V -V W' -VV f V -www Vovk-ff -gf' V m '.-VVVVfo..VV5c-1iV-:- - VVf5'3FV?gV 'VH1.',:'d V 3 f Vifwl zqgig '- ,I ,. -,V-sv 3 V 1 - ,VfwVVVV,V:V V 93553.:V-wl2VrYZ:YEbV1f-aaq.if-ifMILwtrgwbw-V2.,-VVVQJVVQVN,pbfwgiffpi-xf33H:::1gzwzskxwbw-, ge -.5 :Vs ,V:,7,g,,.,, . VV: V V la V V -fl 'Vf 52011:1ifC1Vi?:V'f2'?ffif1?fi?H'???F?f5:if94 WW 'f 1 ' I :V -'2-att.:'V:-fV.fV:V:-.gn-4 'VV: . 5, ,Vpgiglz-fi, . ,',. Vex VJV:-Wemwc-Ki'fVVVP5rf5Vi'f1.i:CVw:1'fV:V'VVWQVV-:9'V5 f'.:'z1V'VV n.Js:'f-:Q - V-in1,-QVzmfwz-,Vfxx:6:Eifs1-:Vw,mmawi:f3Sf?:V9?5ef:'3xV:'w,:qw-:aimVqV1Vf,Vf-:4VVV:f:V,.yV:rtiVfVy:V1VVg -VX ' V-,fr :V my y in ' :fx ,'Vjg igyfffi ' VQ1, ' 2' ' ' ' 5 V155 V, ' ' if ' nv V- .VVQF 'V .aw Y I ,.- e 1 'll' V , ,A .l'n9.V,. ff . '..TTff'.V'V ' ,,V. 5-ff '.. ff '71, .i' . W? ,pg 'Y ,J .V V 5,1 A, . V. 'Nm - r-- V ' -VV 99 , can-nm-r.., A V A -- -f- -- - YW- ---Y WW ,,g,,,,, 7,7 -4.f Y--v-q- - H Y --7.77 W . - - 1 11541.22 zur:-5:12:11 ,,,, Liver: sz fi vmmwegvrnwf-3 www-ef '- s ' 'H A ' Y 'MY V Y l V V :ff V, '11 1+ if W: rf 1551 1 li I 1 i il ? Z 3 x 1 M11- 1H 11 1 1 315: 1 '-wk I-wr E , IN' , 1. In 1151 1154 yi! ,..k,.dE.-.ff .LEEQISQI-I' 1115, af , . H 51 - I P11 , f m f f f 1 :N v r- 12, . 11 1: A HW Q15 1 y 1 1 i A 1 1 :H ' ' ' f 5 ,f 5125 M i'lE23E ' iii: 5 1122 H51 E-15:5 5' 1: QW 11 ii 1,11 rw xi fi. :M 15 1 11221 'M 11 4 21511 W yi r 1 fwf- fli' x 134 ' 1 fri ix 'ff ' , :mid , W ifi 4 v ii? Qi gg 1 11, 1 1215 l 1 1255 1 Q SM M 52 iif kgy Ei 55 vi 1 351523 ,gin : 1 1, 1 H SN 1 11111 W W 139, 1 5 l m 1 11111 1 421 ' Fla N 521 3 1314 E W H 355 W igs: w g-w 1 515223 gi if M3 121513 'F 'f M J M 71 M 352 5 1535 1 1351 1 3 Ng? 1 292 M 5529 E .1fH - 'IW W W M 135 M EM ' 111 Q 1 15152 1 3 111 W ? M W ifi H 52 ' W ' IEW 1 3511321 Q W 3 32226 sl 1 LM 1 5115 53 1232 11 1 wif 1 1:5341 1121 . , Q A fnrlvib, , , ,M funky, ...L-Q..- ,,,,w.x1Q4- pw , Q 2 Q15 g Jim- -vs N?',e:+ 111 11:51 .1 111 1 Y 14 H 3114 111 1317 pi EEE 1 iii 5151 2111 vu 1 ,, -ti 1 ffyseu-en--,-., 1 i....,..q-ww-nv-.nn'v--ff 'N I 3 V V gil 111 41 V 1 712 1 1 fi I 1 1 5 Q11 W 5151 112 I ff 112 I E Q1 7gI 15 12 1 F 1 fi 1 I 1 I 1 1 A1 111 1 1 I 1 4 1 '11 ,N 17 111 11' ,fig :ln ' 1511 9 Eifi f 1 f :Qi ,,- H ,V 111, Q11 1351 Elk: I 157 21111 1111 1 1' wi 1 11 11:11 11111 21121 if 1 17 . if ,112 lf 11' 13 nip, 1 1111 - 1111 11121 1' W 3514 2 352 1513 11 lg Lg 2112 1' X 351 1 9 ,1 52 IE 63141 Q ,1 V: EJ V5 115 , 1151 1 322 Kew , , H 15 1:11 T ' if 1 E: 11211 1125 1115? 3355 1 51 1 if 1151, 1,1 1 51 1 ZH 4. H11 71 ,114 '15 11:1 W y 2 on f?Z!h 1 3173 M- wif! X 1 f f 1 !1l,ff1'.Q'i'fx ik',1 X PL . . Q17 ip-,j'5fg'4'7fK i K 1 k - ki ,,,1.,! X .,,1, x 1 f-,uf f -1 1 NJ Q , I A Pi' x f X ,. , , . N' 4 pu-s-uw uwzd, 'Q-fn' ' '-in z ' if'-?w'F' 4- -A 3 --1-fun-5 s 1 1 3 1x 11 1 1 3 ' 1 Q1 11 11 x 4 1 2 1 1,1 I1 V1 YI, I I1 1 ,1 ,1 111 I 5 3 f is 11, 1, 41 1 1 1 F 1 3 E 1 N X F 1 1 z I 1 s i 1 i 1 1 1 v ,, 9 X K Rx: 'SQQY w ' 2 ', g, 'yu-1. '-.g,!ffLg,.5.- ,Q 4 -H. ,u,,y,.f. - ff ti ,xg fn Thailand Gff Duty v .'7 ' , K if .. , ga A 'ieytg ' Q y ' V y If , 5 If 'f ,--1,-1. . ,Q , . MH- ff ,, , . xv .., X TV? ' wr. ,S ,,,-mm...-f'Q it -01 A 5' QRS?-5-L -:. , 31 ff' H3 1 iw 'Elf '12 Ng! 1.-1 rf 'Q ,A 4 Im .14 if E12 W W nf fu, EV fl 25 1:1 1 M. W 1? 6 f 11 Z' X 1 Q 5 14 11 1 1 3 M1 1 1 14 M 1 5 1 QE 11 11 15? 141 ff Z? E 56 .1 5 5 G 31 4 411:53 11 ,v IFF .vp 111 1 11 11 1,1 f 1? 11 we 1, w. 'Z J' Z if 11 ,gg 4 51 '2 M In 11, 1 E1 3 tr' 11 'I 1 T2 ,, 112 19' 11 1511 1 J. 1154 1 Wi' ' W 111 1 X535 . fliibk 1' 12 4 Q7 1 5 71 '15 W '2 iff 'Q F: r 51 1 ,J .11 iii L2 :Lf 16 11 115 f if E .4. 111 1? 4. A7 J fi Ml F: I 9 r .512 4521? We 11 -1 '11 , 1 M3 11 Z I, 2? 1421 115 2? 11, I I V7 1 J U 'Un ,1 11 11 1, 1 11 1 -fufl V A--- -----' , - ww- L Q , ' A 1 QW f K 1 ' Z 2 , fn' ' 1 ' uf 5, f f 9 - Ecsf, ff: 11, Q? 'A 1 3, 15,5 ,1 A 11 x .gem iffy? ' , 1 - . :If 'V 4 I f ' . ' fu' .sg 'f ' 'if 5 f . -I t ar? 1 WK? I I! , . H, . ,. , L W 5 , 1, , I ,j ?,M'N,,14:::: u I h xmmmv 7:2 lf! fa i 1:21351 I is y Q, 1 :mm-.4Q:1:.g1 ' ffim-,,'u xl 'Z .Q , ' if ' ll 'iffy 34-55 53 v.1x1f,,uf ,1:-:i.lS'Z-ZW f 1--. X J ff fr V rf, , ' , '- ' N ,. , , , ,V '1,:,,4,,,Mvh- ' 1- X2 7 ' 1 V I U' in '5:Df f-- 4' ----W-'L' mllfffff-A ' ' 1, 1 1 M,gQ..N.....,,X. .,..fl,.1'.1M..QQ....Q,gml,,,,-,f,g, 561' 5 - J- A 9' ' n k fwffvvf , A ,, 1 ,, ,K LZ., -'g- -if A-,.,,.., -L, WW- ww-,-W,.-,,,A, fm 1 p .JV- 14 1 M-fm-My-M-QM4--1 -AA- A-A-Nw---1-My--L-Jf-f r,.WMN,,..,-,A1,4,,v,,, Tw- f,,,1fgF',, ?,'f,,,,,,,,,,- -1Qancizxlzzlticz:zxzzziggixg,.,, ,,.1. xfzzwh..- . 1 . I fg ' K ' 1 J' Lwsxfifz-2:fic--zftfzf'ra-:w'v1.-.1-1-1-1-,vm:-'V:asf-.A-, , 1 . -- -- f X' gsm-.-'111,f,1 .,..-.,., , ,,,..... ,EV - Hit' TA 'f ' A ' 11' 1 ' ' f'A 'M 1 Q' ' ' 91' 'QQ-gin-W ' ' V - 1 1x ',3Q4g3 f'm 'g?iQ9 f 5 , , ' 1, 'p .- fs-w . 1 ' 1 .1 - 1515 1 .f': f5 -:5'v4.u' H 1'f 'S ?w -' ifif' ' f f f 0 ' 4 .. . - 1 , , ffiigf -31 ri -Ni? Jw . ' hit ,I ff ' ' H W .az-rf L -1' 1? , 1 'L-.1 ' 2'f'fQ,Z!4y2i,,g TQ- P l f Q 1 A 'if ' W' . ff 1 'f ' 1 - v-., , , ' - . 1 :u - 0, -' ', ,,.L..1,L--..,,1...4L ' A .fy ' L:-L' cw' www..-mf vw- 1.:ea':::::: l' La ' '5 6' .V ,.. 1 . . . .., ... M..-. ' .. -ffifki .- 'H-..ml 5 - '- M '-'-'yf-'uxgjf'-'N-'-'Mil lf' 34 'I - 5 y y- - ff . 311151 .fm-Mxhg A .A+.::-.- :,'.:1,1-:,:2. .S, ' ,gg .4 1 . G M 'HR 1, 5 in ZZ - Q? iQ x 4-' M'M 'd , 5 1 4 ' 1 i a . ff ' , , -f.., -113, 11 ,1 1 4 4, v 1, , A xx - V , ,,. !f-., 1wQf , ' ,:rp :g,,.., ax!! .9-ig 4 ,Z - , mil 5f'1- f' ' 1+ of A .- 114'-gy ' - ..13gc:3:5,-::gt5z??S2?g 1 1-6,4111 .,1, , 4,01-fy, 1' fi ' lj ' , 51--'Gi 0- . fy -' fy ,ff L, 'M ,,,,,p::f-,'g.. if 4,g5,ff4 ' f-f?i1fQ!i?3.: ' , A 1 2 N' ' 1 1? if wjgygfg ff 1 A , .4 'A gifkgwyff 1 1 , '11 1 ,HWQ,.wc. ' - A , ' . QW ,fi '7' if T ' ft, Q41 n'41'43f2 -.' 3.1.1111 C. Q ,A U M . .. ,1. ' I - Al 'f 1 Q'7' X31 : fl 1315-EV ' N 7- 1 -1 .4 ? ' 5: - ' HA' ,V 1 4' 'L ,1 14' -. f - - UM..-f' 1, , gfsyf- V,--JE ,,,1-3 Q ,i:,2,f134 .v : 1, 5 5 f : ..,. W1 '15, 1 ,, EE A ' ff,,2'I5'? 133325 if 2 fly? :xxx--4' VSV? 1'1 . fi -, A 2.4 1.5-2 35 fl 21- 2 A rx f 1.' 144 .2 ra-mrs 1: Ai-1.42.1 6 IM ,J,.E ' ' A - H -' ' A ' :T ,. I ,. , 1 1 4 1 1 1 1 1 . 1 1 f1 1. it .I Q X' , l 3 1 5. N I li f 1 A 1 1 1 1 X I I rx I , - 1 D 14 -5 .:- 1 e - 0 1 1 1 1 1 4 1 . I ' ff M ' O11 ' e -2 1 I , , , A V , I I Y Y 1. 1, ., 3.1 I . -.i in I 'V rs 4 92 13 1 1 --. , 1.K.,,f 1 Y I 1 1 11 1 1, 1 '1 V 'I' - :gnu , , 5 1 It I u s 1 1 ...L if-Q. 4 , X , . .- H' . 1 e.u .0 Q. Q 4' TVQ L, ' 'A' ,Q-I 'xv x , .priar H . 4' il! 'vhlf' f xl.. NJ, v 1 Ll' 1 1 1 K W i L-ml , WIA' g 1 1,1,f fi, ' N .3 .. 'www 'Y e www. ff' 105 I wi 'Q , . r-f f - vw ,-2 vii'-Ai 5:a1 Wf.J'v-A ' 10 'ff' jm- g,-,V 4-.,'. , by rg. 3 :Grin fi-sf Hawall WX May 7-10 Gff Duty .,,.,,............,......-.W u.-1-Q, Q-fp-er Q 2 2 mf-. X ,mn d , 131, , AQ... ' m4,xmq,,..i.q.wwwxs..mislQll0ii1l5F , Wiislirw .'.'f.1fS'q.s ' H11 f ' -- axe: '-H'1-,,.Ng-f- 5 . ap. t . .. .. - . ,, .- S .MK ,WV . .,-A Juv.- k2HFk3,I-Isffg' ' -34:-94? L.:-X 5 A 1. f' Iss,-3 ,f 1. 1- ' ., . .. , nf, K J' a Mfr- -N-.-.f-w-p-mm-x-up-ar -M-..f f-1--.,anv-.,.,,,..,..v...-,v,.,,.J.....,,...... Y .,.,,,A,...,f.v-w..-.-.-- .....-.- .v.............,,-.v --,nm ,.,. N .- n ..,...-...-f-1. .-. .Q 'H I x .6 1. ,..- f I I I I I I I 1 I I I I I I I I I 1 I I I I I I I I I I I I , ,..V-..x..,.-..W..,-.1 I I I I I I by le! fjf ff? w I r f ,f 3 , 5 , X v f iff N1 XR-X ff I xl, 'K!Yf ' ' 1 '- P XF ff V! 2 . 2 IE ,VX-N - -lL- 1 U' V 1 1 Q X , f .nf ., .af -asf. ff yqfivw .,. ,,,., ,., NW ' .. ,1-M1 'X ',,,.-Y,':,,M Q, A Q- .fy -, ,W-f' X,--xxx ..a. fx X -XY ,fur , X'-vjfx rf-9 xxx ifgfzbla-M- viii? FQ pq -J - 1--L1-Lf:-f fm X f, T Mk A ,vi j I ..v.,., 4 , J A X,v.. 1.11. LJ 55X XWMM X i 'f ,- 15 1 - x fy 'I 4 -1, 4 ' K ,. X ,,. 5. ' ,,.,,4,,jr Q AKA- ,, ,, ,lv f , ff' 1 A Hawaii D uty , , , V, f 'A' ' 'X ggfff 154 553 sr, MV 1 c 9 F iw., ' .-.f.,V J YU. ,,.Y H.-1 V 4 1 I I 1 1 I V 1 Y . V V 4 V 1 . 1 I , 1 1 Q, A , 4, ,- fic-?'W7. ,V2V'-PM 1'V':.,'f- 1 j' . Y ' - 6 V9.5-.-fx I, V., yy bg ,, vg,5. 5v'.g ff.,-1, fy, V4 A , ,g:,, -PRX!Vf4'V,,-,,l1+,g x0? f,f,,-Q, CAM- - V WAV.-. ff! , .:'iYp':,z-15'-'fVH':Q, -C' ' ' M' W:-Vx,,,' .AQ f-,,, 'Vvf. . t- . , ,Q 4' V . if lftmw' K-vlvfwfk. . if , A X' Mm- I ,fic fl .A Y'-,v'-4vf.Q': V W .- g,,,,N ', ?,ya4-W' ,f , .,-7, ,,, - V qw fr A. ,f.P'VnWV-f ffm , LX W. 'U,,. - ',g --,,- rf U V V mx. 5, f . My W- U ,n ,V.Q:.-R4 wh Y, V54..Av NM, -.--. -Mm, .' -A ,V 4 .Q ,M ' A. ,, .if - V-V vfw-V ' Vf' f 'f .'..uf' WT' 521' - . V V- - 1 - ,Q I .' - ' L, wVVxN --.-my 'QQ v,,, , vu ,wif-4-9, I Y V ' . . X Y ,V V A: . .. .-. '- . , ,VV .T,,.. ww W-: , f f 'A V A ' .nz ,' V- VMP- - -V -V -,Aww-VH-ff .N .. I , . . V , ,V f V '-JAN..-5 V V- , ,. ..V,.y:,-QV 0,5 K, , df. Q 1+-nr w ,,,,.,.,A5gu-V- .1 ,lbtgv J, , A X. QT. V ., VA ,, .. X. ,,., , ., .I J' , ,,.,, 3.. x I V 1 xun. 4 1, K- 71,21 M- N ' .-M '-W , ,ff-1-M - j V--ff, V-T , ,VV. . -V , L-,,,,... . V .up ,. V' NL I 1, Q ff ' ,fi-ug -1 ' W., K ,.ff?uMNf:ww ' U , H ,.., ' ..Aw,,...,7 V,.n,M.l V, -JAQM, 1 I3 ' ' V M ' N 'V'?2:-.Asn yn-6-4 Qf, ' ,.,-.--.:..VVV.f.- ,, , ' ., V - ,n V ,...,,+ Va-ww---'M U -. .43 -Q'-g9,VQ . fl.-' - W W' A-rv-wv4 ,V ' .-uf NJ! ,,.-V,-wi. .X . , . A A ..,,.,.--.H --4-sod' ,Y A 'V .f ,t ' X ., M V ,.. ' . . J 'f ' -V-aqvvvwwmiiwtvvm . ' X K ' ' -.gym-5 V . ,,,,,,,A.n:4,,g,,,,, QM - 'M M-k.,,,M, - ' 'Y ,,,, ,A,, 4, ,,.-,.,.'.g,g....A .LLQNM Q Wx., .1 N f ? - 1 113 , . -1,491-,y-Ln.. , M4-many-.vb-nk. p-fxw,,,...v.-,f,w.M-qmrmgsavmqgsrv-swan Hawaii Gff Duty r ,. ff .3 11 I 3 Ti, ,xx .MA Q ,rf 11 Ds , .qw 2 I 4 , . We H .55 1 A ' dw W . 'effid' '35 , 'fqi 1 swf fl si- ,.:11-,-5-:.h' . , ,, er can , ,f ,7'A A . ,ff , kg,-. ,J ,W ,.,f ' -1 ' 1 Q ,. -r' F ,d,o, ,. vw, 7 ' 4 5..- X. ff- , . :,?f', - Y . Ili f.- :jg , 1 q AQ.,--,.f-ifhz, -fa, Q ...-, ,., .. A ,. WV , 5 .gr . W ,.,,-- ,,,...-v,,- , M Jgif-.,i.,.. I,f':r .fri .1 ,,lg7f1'.:y,,4 , I W' -., R - ,f'-PQI.. e 'o '!-q31:':-'A7-'F I 'L ., - -' 3',?Yiv-fa 1f.v'ifs-+ ,,f fp'f'r41.As ' A V g:,,.g-,fu up Q, 7 .. ,Z QQu.sm?j,,.,.-' - 5 51 , . ' ' f . I 'we:.,f' - . N K . , , . 5, han., - . A u g 'f' Q-1 Q ' , f'- , ..:ff 3?xf,-aa a-M4 f ff- W., 'lg ,354 , H T.- .,,f'f, 1 5 lf ' Ill 1 , . .L 'I+ .. in M 6: P-. 1,331 L .. ...gf -fq,2,:r, :sap - Q. ,x .N -'ive-A ,hx fiwi ii .f . X efgw- Q f ' -. Q hm-1' - .4.L, . 51,1 - .- -X ,av-H'-' n 9 .fi'i f' E. 1- ,:1HY5i7v,5.xfk q, .-w,,k--7'lfz.4p ' ,ki- :fu- -. 1 X QAM..- -.5 ,r. N ' ,V xy. - 'vu-, v 3. bg., , X 1 -asf. jq.,ml9Q' - - . .1, 13 .- , fx 1 h , Q1-A K , ' S . bp.-, X ., .K L If X X .., .aiswgwh Q. J . X ' E- X S ,Q - - x S. JJ . - - K - X gxrvg, K- '-' X 5 X 1 .5 'k ,. I. x X 'fl -N ,, i - k X x yi- 2 i ' 'L kr: f.,Qf k '- k ' My ,fr A- 1 Xxx ' ,Q Wu. gy 9 X Q X K . QM x ' f 'K Kai-'X , R X x lf -5 , X X, , A A ' .. ggsfgg-if , f k x X if-..x 9. 3' X X --vb X Q X Y X x v X M X -' . + n 'Q uv N 4 situ -1' ' Q -an-1nMQg v4wmm..m.,q:.-fn.-9.1-,QR-ngwkuunnvngnm 15'i Js ,. .. 'E JS ' inc? ' N ,iw -- . fl t .' CAPT B. Poeltler CDR M. Allen CDR D. Bringle CDR G. Deconto CDR D. Fontaine CDR T. Grant CDR D. Meyer LCDR K. Barich LCDR S. Filipowski LCDR K. Fontes LCDR S. Greer LCDR D. Howard LCDR M. Jenkins LCDR J. Mallette LCDR T. Monroe LCDR B. Mullins LCDR M. Napolitano LCDR R. Pierson i . ..,.. . -..fan . LCDR M. Skelly LCDR R. Urbano LCDR B. Wauer LT J. Klein LT S. Oliver LT M. Smith LTJ G M. Itakura CW02 M. Drose DR T. Roberts YNCM H. Friedman MMCM G. Patton RMCM S. Simon SKCM A. Valdez MSCS M. Costales OSCS R. Goodman ETCS R. Taylor RMC M. Cannizzaro CTRC J. Hutson CCG-7 X4 Qs X - 'Qlxx . -A f - :f.-:gf-.. :A Elleif'-L'- ,. 119 -nymgw-,wvfqw+,5vn-mwn..qw:-fWwq,a,nQwvM.-mmgm CCG-7 EWC D. Pilfer ISC D. Rabidou SKC A. Samonte YNC J. Tucker OS1 D. Banks MS1 R. Baun OS1 D. Brown EW1 S. Cushing OS1 M. Freeley OS1 H. Johnson OS1 J. McMiller BM1 J. Perry RMl R. Reynolds LN 1 S. Shamfine QM1 F. Supner OS1 A. Williams s .,,, Y' OS2 S. Cambaliza 1 252 --X osz M. Clark ' 'I ABH2 R. Edwards MS2 A. Felipe HM2 R. Greshel YN2 K. Kepler YN2 T. Mai CTT2 K. Phillips OS2 D. Schneider CTR2 R. Schroder OS2 A. Singleton CTR2 A. Sosa YN2 G. Stalb RM2 C. Williams OS3 G. Boehn OS3 B. Holladay CTT3 M. Jefferson RM3 H. Lee CTO3 A. Vazquez RM3 T. Voorhies RM3 D. Winslow MSSR B. Monzon N4 CCG-7 '2 . S ,121 'H m R' - ' ' rl- 'Y f ' -'H ' --' ,--guy-. . .-v.-ma--v'-m1nf-.w.-1w-..ff-1-yn-,.,..-..,-.-.-f1e.....-M..1..,p,f..-,f.--..,-.,.,.-4- ff,-,fm 1 I 1 1 A 4 1 1 1 1 1 E 11 1 1 1 1 1 Ia 1! R 1 111 1 15 1 1 5 5 If 11 11 11 1 11 11 U 1 1 11 1 11 ,1 11 31 1 1 11 1 1 1 1 1 I1 1 1 5' 1 1 3 1 E 1 1 1 1 1 1 1 1 I 1 1 5 5 -'lf I ,f ': 31?3'lg5W 1 122 LCDR R. Green LCDR W. Haflich LCDR T. Kisiel LCDR M. Long LCDR D. Rodgers LCDR T. Wing . w7', 7Q43i 112221111 1 'YW I'!jJ,. ' ff... v rr., f ,. 662 ,,, , ww , ..-14., wana-suv-u DESRON 23 LT J. White RMCS M. Batz ENC A. Avery FCC T. Baisch OSC I. Carter STGC L. Enyeart 'Na f , ' F. ei'-wt h! H V -' A riff-2:1111 :A ' ,atv- S 'Vw-If if 123 DE RON 23 YN1 F. Rojas MS1 J. Samaras QMl L, Washington OS3 R. Bennett YN3 E. Delgado OS3 P. Hennis f 124 ' DESRGN 23 F OS3 S. Igorospe OS3 C. J unge RM3 M. McGuigan OS3 J. McWaters S A RM3 J. Morris N. ': 1,4 125 Q , - A - ' l 4, I .,,-v 4 1 , I 1 w Q 5 , Q ,a , I ll , V, , , ,, ,, 'R , is M , , I I, ,, ,, , , , I w V, r , , 1 1 ,I 1 , , 1 1 1, ' 1 , , , , N ,' 1 11' , V f, F, ,lf ,,, I., ii H' , U U ,, 1 , ? L K ,- ,, 1 . ' N , ' N 'QP' X ,cw '. ,,f,,,,,, , , A A -A- ' 1 i j Z E L , , l, 2755542 I . yp::5'tfff.:' ' WA T wan? wiv Subway , , W?f5?i,,E???W f ?f?ff63, 999' 3 Y 2 iGQ?7 gikfi fl ww in N45 Qfwemffffil, 402, O X .gs ' ugnlxsixgsxk saw- -Ni N X 'x X X w r 1 Slf8.lIV up the Administrative Department work administrative and support services to the Included among these services are m and transfers, promulgating the and career counseling services, printing admlnlstratlvely provlde for a city of Q1 than 5,000 News,.operating the ship's radio anti television Visitor programg The day-to-day nute significantly to the effective and crew morale. The Administrative' customer service in the fleet 'Whqgq XX X, X-1 Division includes the Captain's Office, Ship's Admin, and the Print Shop. The Captain's Office pro- vides direct administrative support to the Commanding Officer, maintains officer records, controls incoming and outgoing official correspondence and classified material, processes officer receipts, transfers and pay transac- tions. The Ship's Admin Office provides direct adminis- trative support to the Executive Officer, Administrative Officer and Command Master Chief. They publish and distribute the Plan of the Day, administer the awards program, handle internal departmental routing and ensure that administrative policies, procedures, and practices employed in the ship are efficient, effective, functional and in conformance with standardized Navy regulations and directives. The Print Shop produces more than 1 million copies monthly of essential informa- tion consisting of the Plan of the Day, Flight Plans, Green Sheets and the ship's newspaper, as Well as Change of Command programs, ship's directives and operational orders. ENS V. Riveras LICS L. Charles YNCS D. Hemrich YNC G. Orr J LI1 T. Barron L11 E. Mounteros YN1 S. Nolte L12 J. Murray YN3 T. Barrow YN3 C. Ezzelle YN3 M. Garcia LI3 W. Pietrucha LI3 J. Shuler YN3 M. Thomas r YN3 W. Wilson l SN C. Harris LISN G. Miller YNSN J. Moore SA R. Jones AA S. Libby D. f 130 fc ,Y 1 X-2 Division, the Personnel Office and Customer Service Office is responsible for processing all enlisted personnel transfers, receipts and separations along with main- taining all enlisted service records and per- sonnelfpay forms. Processing identifica- tion cards, verifying dependency status and providing statistical manpower re- ports, used in the overall management of personnel, are other responsibilities of the Personnel and Customer Service Offices. Also included in X-2, the Familiarization and Indoctrination Office CFAM8zD which coordinates the indoctrination of newly re- porting personnel. CWO3 J. Cawley SKC M. Dereu PNC N. Kostuck ABH1 P. DeRoy PNl J. Wezell PN2 R. Anderson PN 2 L. Brevig PN2 D. Foster PN2 T. Garrison PN2 J. Lowe PN2 G. Strand PN2 L. Taylor PN3 D. Ames PN3 R. Bywater PN3 S. Coleman PN3 R. Dobbins PN3 J. Flores PN3 M. James PN3 T. Jarrett PN3 M. McDonald 'Nm f f t 131 .-Qmwnv nv-vq-vu-sw.v,-m-rmwvxw- ff., ,, v ,,,,, A ' .9 3 X-2 PN3 D. Stephens PN3 R. Stonesifer PN3 K. Torzillo PNSN E. Berg SN S. Lindschmidt PNSN A. Meehan PNSN E. Mundy PNSN C. Seymour PNSA F. Lujan AA R. Nurse A f 1 ' -1 --gi, . W7- g V' 2 x W ,.k, A 'W' ,.,.,. , ,Mu r 1 X s...l . ' e v Q 'F 4.2 A-ram 1 A - . ,, , X X-3 The Public Affairs Office provides a myriad of information and entertainment services for the crew. Personnel assigned to PAO are responsible for reporting command, Navy-wide and world events to the crew, as well as releasing stories and information about the entire battle group. When deployed, PAO broadcasts three shipboard entertainment and training channels 24 hours a day, in addition to four information chan- nels and two live satellite channels. A shipboard news program is produced three times weekly, as well as port briefs, safety stand downs, and live broadcasts of From the Top with the Command- ing Officer and Big Bucks Bingo. The ship's newspaper,Nimitz News, is pub- lished daily at sea, in addition to producing port guides, welcome aboard pamphlets, the cruise book, and other special publications. PAO also coordinates all special tours of the ship and hosts media and distinguished visitors, stateside and overseas. LT P. Dennison JOC L. Johnson i T JOC D. Youngquist A JO3 L. Bish J O3 C. McClendon J O3 G. Toms SN R. Austin AN M. Duck AR B. Barratt illi :A 133 3 rim .st K X 2 D .XX 1 f, X-4 Division encompasses the Educational Ser- vices Office and the Command Career Counselor. This division provides educational and career information program opportunities for the crew, affects advance- ments, and provides college-level courses when NIMITZ is at sea. The retention program and the Career Information and Counseling course broadens the crew's knowledge of available benefits allowing Sailors to make the right career choices. L., l l NNN 1 ' f 1 I f f , , , , f , , ...nz ,,f!,,!L,, If If X, , A , V i-Q44 if' 121 f 1 j' , , ' Y gf. f'W6fYggZ2ffQf.14f7ffp ' I , 'Y , fi f ' f f -5 ., I . . K f v , 1' -,ff 'f', 2 7 v . ,Q ' - 1. I 'fl f . f f, V -f fy f ugff-',w4'f 'ft .z U f- 'M - -JfYPff:f'AZi2fi '4llXQQQC1 1 ' ' 'IV' ,riffffff - '34 ' I ' 'fb -if-f ff-orn.2,,.f..-.,g41J,:a.L.f,.4,g1- .4z,f-ff.-gi, f' 4-f ' ' ..., -A.'fW-,Qu . 4-5 3 CWO3 V. Arcaira PN1 K. Arnold NC1 M. Campbell PN1 R. Pascual PN 3 V. Badders e PN3 M. Barnes PN3 J. Horsfall k C PN3 C. Pender PNSN M. Scheets SR W. McNeely f ESO I CCC DB l r 'A in' fl .x l RVL ,W N 4- , -. i r 5. ip, .Q-L- 1 if.. :Q nfl -wiv-nfl, f1f--- '---- 'vw-.-w -JH-. 1-. 1.5 :rr 'wg 3,512.9 134 'fl ' .42 l K H lx u lj - 4 Z . Y Xxkifl The Drug and Alcohol Program Advisor is the command representative responsible to the Command- ing Officer for implementing the Navy alcohol and drug abuse program. The DAPA conducts on-board admin- istrative screenings, coordinates and assists in con- ducting command awareness education, monitors af- tercare, prepares required reports and correspondence and serves as the command's self-referral agent. Also included, the Equal Opportunity Assistant is one ofthe special advisors to the command providing a forum for education advice regarding minority pro- grams and counseling. Additionally, EOA provides the means of evaluating the command climate, and provid- ing feedback to the Commanding Officer via command assessments. MACM L. Huddleston MMC J. Brown 1 l L PR1 D. Dover MM3 J. Womack N. 135 gf .f as ' '- f49 in-i -14,.iZS V--.f gr-QW., -lI1!!NQ':.:f,z,g -'r1,,,,,:, .W:g:,.un,,,,1::5.-.,.gnl1 , ,4,f...,..1,,,,.,,,Jl , ,:rf.-,vvvsg--,4,, , ' ,H 1-:vm , e ' sf f I I XV., .A,. T s .,.. , i W f I 'xwrf ?-2 , 4 11 wWTd,wf,:,,.h.w,f.- f.Af-ab If-. ..., ,...,. ., .,:.1,,.,,,..,,,h,,w,vw 2 . ,, ' Us . ,,,. A , M V ,Q 3 1 - ' ' ' ' ' ' - 1 T , -4 I 3 Q ' , 1 4- ' s ,,,V,W, A ..,,..,. 4i ,,,, ,b t' A, d , s. V' it it ' N 'ft' ,,x1Q Q ' V . 'W' pwffm an 'A . 3, I1 H eu t L i ofthe NIMITZININE Team, asmzgni ' pt M2 pljovldes 214051, ttfhere' at thecemefofthebawe P- The? 1 - petty is i s - are resporisibleforperfonninggg -brati ent maintenance andcomponen - as well as providing tee , ,Q i al ce tot activities. The 9 ' ,i sky tmfllty fsurallce and StaifCIM41J,Gene if f -. ,, ff. viqnicyglmmqpgnggm-Qland Sufi! e t2Qln'5f',f31f9'5?b,d1Y1d9d mm 36 work centers, eachf 'th si' alize Q portwfuiictiens. T th sgp etyfwpea ttl1ifi 0f10lvf1lHdS6l1CS ,V 'V . 5.fW.5j z f A ', -wk A, . n f A '5fw5',3'f-'ef -V f .- ' .1 ,Mi I ' ,f f n - , , , 0fCVW.9a5Wel1 as 'L 1 o CECBS rt accompnslunentszabqgtel f -g ! t gthe Battle 'E for superior pe s ti A V maxi - :-, e eww ' f' ' . V '71 if b s t if i fx e ef , esii, tttt I if Q? 'i ttt't 1 ttsi l t se.V - 4, Xkff' X f zxn li 3 ,u .,gV .s is X M X w,g' -'it ww! N fix K- Qfesxgj,-3g4':Z1vV,3Z if,.'W?ff. 525133 V fb ' Ygfff X '., ft ,Q ., ,, L ,g,, mm. ,X , EZQKM. ii' awk' il Zfxf5Mf?h. f ' , wget 'fm,, xxx 'xx t NRS M1 f 5 gf, 1 ' , if A I t I . V,:.ll, N N 136 W ti Zigi M, A yolk ,, r, .Ty ww v B .r y rv r H law Viz ,4- fn . W :X 'X Ai ,w V- 4 ' x ,nfbfwwp ff' fi 'fi-1 xf6f.2:3':-s' Wu 'W ' ' 1 4 1 11 451, hifi 1331? fx vr .ff :a sf' ,xijiisn , -45 ' :N iv.. 4 'fifelf' f .flrj Y Q: f ' H tx, g 1. AM . ' I. Q ,M Q 412, . , . K A f' ,1 '5 f , W Q I , :ze ' V A W 4 f , KE A , anew: 1 fig? , N Qi? 1 M 'fu .m, . Ag? ,q ' ug- 1 , f 1 mn v-amoequwwn-.,fq,,y-mwnv-V.-v.-. ..- , -uv ..,, M., .N X is K! GN X The Staff Division provides key management and administrative functions for AIMD. Production Control oversees the departmentls production effort and efficient movement of components through the Work centers. Material Control coordinates the order- ing, receipt and delivery of parts and supplies. The Administrative Branch provides clerical services and manages a central reporting and record keeping system for all departmental correspondence. Quality Assur- ance CQAD monitors all AIMD Work centers ensuring safety procedures are adhered to and the high standards ofproduct quality are maintained. QA also manages and monitors numerous maintenance related programs as directed by the Naval Aviation Maintenance Program as Well as an Aeronautical Technical Publications li- brary in support of NIMITZ and embarked staffs and squadrons. The Damage Control Branch performs pre- ventive and corrective maintenance on all spaces, ven- tilation systems, and Damage Control equipment as- signed to AIMD. LCDR E. Coyne LCDR F. Quiros ENS B. Cole AZCM V. Human AVCM R. Richardson l -- ATCS G. Green ATCS D. Sears ATC D. Albrecht PRC T. Anderson AZC R. Gilman ASC E. Lane AZC J. Perez ATC R. Ross AT1 J. Ackerman AMS1 C. Aguilar AZ1 J. Hanson AT1 R. Jones AT1 E. Kaal 2 PRI A. Kaasa AT1 T. Lilley p .Y L. QZQ- . N 138 in? - il 6 sf W , l 1 i l l X i l l il , H1 l l l w 1 4.42 WWW IM1 AK1 A. Manley AZ1 J. Misencik AZ1 E. Mora AD1 B. Moritz AT1 R. Oliver A01 D. Ragland AK1 T. Reed AD1 E. Ruiz AT1 J. Sawyer AZ1 S. Seyton AT1 D. Stewart AE1 M. Szuba AE1 M. VanSickel AZ1 K. Wilson AZ2 J. Carlson AZ2 T. Carrolan AZ2 J. Floyd AT2 G. Hill AK2 P. Navin AS2 K. Stamey AZ3 C. Jackson AK3 A. Ramos AZ3 S. Tozzi AKAN R. Cooper ASAN S. Higgs AN J. Leon AZAN J. Manning AN J. Plano AN P. Thomas AN J. VanDyke 'Na f f i 139 . ,,,,,. ,,-w.. X 1 IM-1 , ,. I , , : .. 2 1 , H Wwfmimwnksfi -V-1.1 fwfgzf- ,I inn-. 4 Wm AZAN J. Waters AN M. VVharton AZAA T. Brown AZAA C. Eberhardt AA M. Khouri AZAA B. Wolniewicz AZAR A. Ford AZAR C. Opperman 14 , A l ' '? --,eflm . -..N O Wi! ! X. 1,1 5. X . . ix, . I ' XIM-2 The General Aircraft Maintenance Division is composed of three production branches: Power Plants, Airframes and Aviation Life Support Systems. The jet engine mechanics of the Power Plants Branch test, repair and inspect aircraft engines and associated equipment. The branch's maintenance effort is further sub-divided into three work cen- ters: Engine Shop, Test Cell, and Navy Oil Analysis Program Laboratory. Airframes Branch personnel inspect, repair, manufacture and test air- craft hydraulic system components, hoses, tubes and structural parts of aircraft. This branch is sub-divided into six specialized skill areas: Structures, Composites, Welding, TirefWheel, HydraulicsfPneumatics, and Non-Destructive Inspection. Aviation Life Support Systems Branch personnel are responsible for the maintenance on parachutes, survival kits, life rafts and vests, anti-exposure suits, flight helmets and aviator's breathing oxygen system components. The branch is broken into three work centers: Parachutes Shop, Aviator's Safety Equipment Shop, and Oxygen Component Repair Shop. ENS G. Duffy ENS E. Sirios ADCS S. VVhisonant PRC E. Hill AMSC M. Patenio AMS1 N. Aguzar PR1 B. Berry AD1 R. Diaz PR1 K. Oliver AD1 J. Rawley AD1 W. Reyes AMS1 J. Rodemoyer AMS1 J. Romonsky AMH1 E. Schmidt AMS1 R. Steele 141 it A IM-2 PR1 K. White AMH1 S. Wright AD2 G. Alter PR2 E. Armstrong AD2 W. Gaydos AMS2 W. Goodwin AD2 D. Gray AMH2 D. Harden PR2 C. Hazard AMH2 B. Howell AMS2 M. Kazaoka AD2 R. Lia AD2 R. Liwanag AMS2 J. Malinoski AZ2 L. Medeiros AD2 C. Padilla AMH2 F. Quitugua AMH2 J. Ramirez AMS2 R. Reichle AMS2 R. Shields AMS2 R. Sims AMS2 J. Turney AD2 J. Williams AD3 B. Bell PR3 M. Bogle AD3 G. Brown A -f . , 5...,.,. '-'is a-sms -f- .1334 -- 42 vf IM-2 AMS3 M. Campbell AMS3 D. Fajardo PR3 R. Frith AD3 T. Groves AD3 G. Hall AMS3 R. Hodges AD3 J. Lancaster AMS3 M. Latendresse PR3 T. Magnetta AMS3 K. Neavin AD3 O. Soto AD3 T. Stapp AMS3 B. Steele AMH3 M. Stephenson PR3 J. Valenzuela AD3 T. VanMun AMH3 C. Wandler AD3 D. Wollesen AMS3 J. Woodville PRAN A. Anderson ADAN R. Arnold ADAN J. Bradley ADAN T. Brechbuhler AMSAN R. Chandler AMSAN B. Chipps ADAN D. Cooper X4 f 143 ,1 Y..,,., E NJ . , .. .A V .. A 1a'- -rlnlllfr -in,AI,iH1IIHIi finir II IA..I.i.. ,. An., , ,,,,,,,,, -,,,. -he A A , A 4,,.1gq:i. ,U h ,1 A ,p 51A .,- -if-A 5553-Aw. AAAA ,,,, W 77:11-44 tt:HnnsL444 A - --- -- A U - -- A ai--i-A - A A C-Aj I mu-I-i -.L AMSAN D. Edwards ADAN N. Fiore AMSAN N. Halvorson AMHAN G. Hanblin AMI-IAN T. Jackson AMSAN S. Luoma AMSAN C. McNee ADAN T. Primus ADAN T. Soltermann AMHAN E. Tuller AMSAN M. Whiting AMSAN J. Williams AMHAN G. Winn PRAA D. Dunn ADAA F. Fernandez PRAA Y. Harbin AA G. Perez ADAA I. Shepherd AMHAA C. Thornton AR J. Butler D. -f jg. 44 'ff 1' Aircraft Inter- mediate Mainte- nance Departmentis AvionicsfArmament Division CIM-35 consists of highly trained men and Women who Work on Naval Aviation's most sophisticated electronic test equip- ment. Work continues around the clock for 218 Aviation Electronic Technicians CATH, Aviation Ordnancemen CAOD, and Aviation Electrician's Mates CAEJ who support ll squadrons and nine different type!model!series aircraft, as Well as the calibration requirements for the entire battle group. The division's intricate repair capabilities range from entire avionic assemblies to micro-minia- ture components in radar, communication, naviga- tion, laser, sonar, FLIR and weapons delivery sys- tems. LT D. Buzard CWO2 D. Montour Mr. S. Dang AEC B. Bartow ATC T. Case ATC M. Crawford ATC C. Gray AOC J. Hook ATC W. Lamson ATC K. Olson ATC B. Yeager AT1 D. Beers AT1 J. Biehl AT1 T. Boese A01 A. Dean AT1 P. Decelles AT1 M. Dever AT1 R. Eades lCl J. Fullerton AT1 J. Gagin AEl A. Garcia AT1 R. Gloria AT1 M. Guertin AE1 W. I-Ieckathorn AT1 J. Ingalsbe IM-3 A01 H. Jimenez AT1 D. Johnson AT1 R. Kelly AT1 J. Landolt AT1 M. Leslie A01 F. Liddell AT1 J. Livingston AT1 M. Miller AT1 H. Mooney AT1 T. Nelson AT1 D. Newlander AT1 M. Pastor AT1 E. Reed AT1 R. Rever AE1 M. Rhoimey AE1 L. Sanders AT1 E. Santos AMS1 W. Snowbarger 4 AT1 W. Stewart A01 T. Tiritilli AT1 S. Wasmer AE1 E. Wright AT2 A. Barber AT2 B. Barton AT2 M. Carlborg AT2 T. Cornelius AT2 V. Cruz AT2 T. Cutler AE2 L. Elder AE2 J .sGraham l 1 6 Q I IM-3 AT2 C. Hamilton AE2 R. Hill A02 W. Hromada AT2 J. Hutcheson AT2 K. Jefferson AT2 G. Jenkins AT2 M. Johnson AE2 B. Kader A02 R. Knickelbein AT2 J. Kowaleski AT2 K. Krause AE2 R. Marin AT2 G. Marino AT2 W. Miller AT2 D. Moore AT2 J. N azario AT2 B. Pomaville AT2 R. Rathert AT2 J. Reed AT2 J. Rex AE2 C. Roberts AT2 J. Roberts AT2 J. Sibre AT2 S. Silveira AT2 J. Spotts A02 C. Staats AE2 G. Sterling AT2 P. Strawbridge AT2 H. Westman AE2 R. Wheeler 'N-Q f f t 147 IM-3 AT2 J. White AE2 J. Wilkins AT2 G. Wood AT2 C. Woods AT2 B. Yates AT3 C. Ambrosi AT3 J. Ayers AT3 J. Bacon AT3 A. Badgley AT3 B. Barry AT3 C. Bierman AT3 M. Bowers AT3 T. Briggs AT3 R. Brown AT3 B. Browning 1 14 - - -1. ,--B. 'iffy -f...qi: N... W' 'fs f' IM3 AT3 W. Buchhorn AT3 M. Burnett AT3 C. Calangi AT3 J. Carpenter AT3 D. Channer AT3 P. Cook AT3 S. Coryell AE3 A. Coulson AT3 B. Creech AE3 R. Cunningham AT3 V. Doody AT3 A. Druckenmlller AT3 R. Fernandez AT3 V. Gallo AT3 R. Garcia 'Na 149 1 1 IM-3 56 AO3 R. Gaton AT3 R. Gleason MM3 W. Graham AT3 T. Green AT3 R. Greene AT3 D. Greenway A03 M. Hamilton MM3 R. Hamilton AT3 C. Hassan AE3 D. Hickman AT3 H. Higgins AT3 R. Irvine AT3 S. Jensen AT3 E. Johnson AT3 W. Johnson , .. ' 1 -1:-55 ,. 5- -.-Nl -:- We gl. . ' !T 2 1 N X xx , xx Y-'sw fi - . . Q X A W , -eg 'XX X sw Ai' AT3 J. Keeley AE3 W. Kindler AT3 D. Kirk AT3 G. Kitt AE3 B. Lannen AT3 E. Lowe AT3 J. Lucier AT3 T. Mack AT3 J. Maldonado AT3 C. Marko AT3 B. Mayson AE3 L. McG1in AT3 C. McKinzey AE3 A. McRae AE3 S. Mikulewicz 'Nm ' A --341-4:.?,i,., X- 'r --,.,.TE.f yzfew. .. ,A k:iLA.:i-: ' -if IM-3 gif' 'f51 J.. IM-3 AT3 M. Pennington ET3 J. Nass X AT3 A. Oliphant AT3 D. Oliver AT3 T. Osborn AT3 T. Ott AE3 L. Pelletier AT3 S. Pires ,x AT3 D. Pollock K 152 , z ' -2 . - ,N 'gif ' u0 ,w-U' sf M9'.Xi'wx.ws Y' 11.1 IM-3 AT3 M. Quail AE3 J. Ralston AT3 C. Reyes AT3 R. Ribera AT3 C. Rossner AT3 K. Russell AT3 G. Schneider AT3 R. Smathers AT3 D. Smead ff.,A, A N- lll: :A A .egg-F - If 153 IM-3 154 AT3 M. South AT3 T. Stefanides AT3 C. Teets AT3 S. Tirado AT3 L. Tran AE3 J. Vickroy AT3 A. Villarreal AT3 K. Watson AT3 M. Weber AT3 M. Weins ET3 A. Wheeler AE3 M. Willett AT3 E. Wilson AT3 J. Wilson , - L V-2 --2' ,. Rv- J: - e ' -.,iNV gf: ,gr - 'a ff J - 1 ' ? IM-3 AT3 C. Wyman AT3 M. Zuver AEAN A. Aicardi ATAN B. Becerra ATAN J. Beirley ATAN W. Benavidez ATAN B. Brown ATAN J. Cirizola AEAN R. Cooper ATAN D. Deville ATAN J. Dobric AEAN S. Drew AOAN P. Ely 'Na f 'S A o f 155 IM-3 AEAN L. Fields ATAN J. Gnik ATAN D. Gussler AOAN D. Hittle AN J. Jennings ATAN C. Jones AN A. Karoub ATAN J. Kreider AOAN D. Liming ATAN J. Marquess AEAN C. McCord ATAN D. Moore AN P. Oliven AOAN J. Parker AN K. Scott AZAN D. Sloan ATAN R. Thomas ATAN J. Thompson 152 f ,1 fri -1234. aff IM-3 AN H. Tucker AOAN J. Walton ATAN K. Whitelock AZAN M. Zuchetto ATAA J. Cohen ATAA R. Goald ATAA J. Hiramatsu ATAA G. Hults AEAA D. Jackson ATAA K. Jones ATAA R. Leach AZAA F. LeBlanc ATAA C. Mooney AA D. Richards ATAA D. Thieme ATAA J. Young AZAR M. Bodley AR M. McMi11in N 1 5 7 Support Equipment Division QIlVl-43 is comprised of nearly 800 pieces of equipment Which facilitate support of all embarked aircraft. Fifty-one skilled technicians and administrative personnel are assigned to the division and offer front-line mainte- nance support for all divisional and Battle Group Aviation Support Equipment. IM-4 division is responsible for servic- ing, testing, and performing scheduled and un- scheduled organizational and intermediate level maintenance on support equipment and related components and systems. Included are gasoline and diesel systems, gas turbine compressor systems, hydraulic and electronic power gen- erating systems, air conditioning systems, and cryogenic systems. The Support Equipment Division also performs structural repair and refinishing on various equipment, ad- ministers licensing on 29 pieces of support equip- ment, and provides exten- sive training on equipment operation and service. LT C. Lopez ASCS M. Ashley AZC M. Dorothy ASC P. Ofsthun AK1 W. Bell AS1 D. Black ASI M. Kuhn AS1 A. Pena ASI J. Rubio AK2 T. Albright AS2 R. Betts AS2 M. Bond AZ2 V. Gadbury AS2 J. Garcia AS2 C. Gregory AS2 J. Jones AS2 J. Knight AS2 l. Lyman AS2 S. Mulder AS2 R. Spicer ji N 158 IM-4 AS2 P. Taylor AS2 E. Thomas AS2 D. Tomlin AS2 L. Young AS3 F. Alcala AS3 J Brunson AS3 . Case AS3 B. Deady AS3 R. Dean AS3 E. Bowen M AS3 . Dietrich AS3 . Godfrey AZ3 . Hunter .C AS3 J. Kesler AS3 E. Dickerson R D R AS3A M. McCutcheon AS3 S. Miranda D AS3 . Nix AS3 T. Sisoukraj AS3 B. Smith WVWVFE AS3 M. Stewart AS3 O. VanValkenburg ASAN A. Hooks M ASAN C. Jackson T J l ASAN D. Meridew ASAN S. Schilling ASAN C. Vuong ASAA B. Williams 159 4i, embar e 31 , y e and Shlp From Pr1 Fly on the 0 10 level of the lsland, Wherelall l h hth d ck Where fuel 15 stored and ln many spaces mlsslon IS carrled out nlght and day Malntenance and operatlon of the A1r Department s complex ressure and tlme constralnts The enormous prlde felt 1 .1 A AD In Al + H1 Flin-1,+ lrro wi., W2 .M ,Y 7 :4:.5T,f1f-'L . , Wg, -,Q , JW, A , I , ,556 , . ' - vs' f V-. .'f R!,f. nf, 3 4X K , ,., 93. xv, :-,Deb-:vw . f affix 'W A Za, cz 'L' xi. 'ffgfffafza mf2i: 0f' - mf fb' , y ' l WF , 2 1 fsaf -n., 52, was -A 1:1 351251 mam' vwf- 'few X' 4w:f:.my,g'.g?5. m,f'f ggge. 1 .Ax 1' P' 0 rv ' I., A,-ww 1' ffm , sw ,, 1 ' R, , vi ' Q y 'f 4 1 ,-X , N umm' ' mmf pgik. , M.. 3 R v-. ' ' wb, - fax' fmyw. an , , Day and night, rain or shine, the c'YelloW Shirts CAircraft Directorsb, Blue Shirts CAircraft Han- dlers!Tractor Drivers!Elevator Operatorsb, and '4Red Shirts CCrash and Salvagel of V-1 Division Work extremely long hours ensuring the safe and coordinated movement of aircraft on the flight deck. The owners of four and one-half acres of steel and non-skid, these men and Women keep it pre- served, cleaned, and painted like it was their own. Every launch and recovery sequence is pre-planned and briefed to ensure precise timing is maintained. A missed or Wrong signal could mean lost seconds or minutes, determining the success or failure of a critical mission. The technical expertise and hard Work of each member of the flight deck team is vital in maintaining the operational readiness ofthe ship. LT S. Grabowski LT B. Peck ENS K. Szitta ABHCS L. Mcinnis ABHC D. Jensen ABHC V. Seumalo ABH1 M. Brazil ABH1 K. Daigle ABH1 W. Everton ABI-I1 E. Keevama ABH1 P. Lair ABH1 R. Meade ABH1 T. Sneed ABH2 F. Crouse ABH2 G. Harrison ABH2 L. Head ABH2 J. Holland ABH2 C. Krauch ABH2 T. Lundberg ABH2 M. Shaver Eli: . . .1 .xiii . . -, I2 N 162 V-1 ABH2 S. Vanmeter ABH2 K. Williams ABH2 S. Wills ABH3 R. Ace ABH3 G. Clover ABH3 M. Darbonne ABH3 H. Frey ABH3 W. Glass ABH3 M. Gleason ABH3 C. Harrington ABH3 J. Hinton ABH3 T. Jones ABH3 M. King ABH3 R. Knipp ABH3 M. Kramer ABH3 J. Krecic ABH3 C. Lovejoy ABH3 R. Markley ABH3 A. Melendez N4 se rife' 163 my V-1 ABH3 S. Menear ABH3 R. Nichols ABH3 R. Patterson ABH3 L. Pawson , ABH3 o. Phillips ABH3 C. Shoemaker ABH3 C. White AN R. Alderson AN D. Alexander AN J. Beach AN J. Carter ABHAN G. Chavez AN L. Clint AN E. Combs AN R. Cowan ' .. 16 it 4 nf' A V-1 AN E. DeJesus AN M. Frankenfield ABHAN C. Gazewski AN S. Goodman ABHAN E. Greer ABHAN A. Grettenberg ABHAN R. Gurdyal AN J. Hatton ABHAN J. Hernandez AN C. Holley AN T. Honeycutt AN T. Howard AN D. J aynes AN G. Jordan ABHAN V. Lawrence '-'l :A -' kr - ..X 165 166 V-1 ABHAN A. Lemon AN J. Longino ABHAN H. Martinez AN P. Mendoza AN R. Merrell AN N. Rael ABHAN K. Rednoske ABHAN S. Shawver AN K. Spurrell AN N. Taylor AN G. Trundy AN H. Ubele AA F. Barbeau AA C. Barber ABHAA F. Blacks AA J. Brady AA C. Bushlow AA D. DeLaRosa AA M. DiGiovanni ABHAA J. Dumlao AA M. Epley AA L. Flores AA J. Garcia AA R. Garcia AA J. Gorham AA J. Goss AA C. Hartley AA A. Hothan AA J. Kiemele ABHAA J. Kirby . A 1 egg ,. LRE' -N'-.. ?i! V-1 AA C. Logan AA C. Marchlewski AA P. Maroney AA E. Martinez AA E. Mendoza AA E. Myers ABHAA D. Reierson AA J. Shepherd AA C. Smith AA M. Smith AA T. Smith AA D. Thornley AA N. Verdeja AA R. Walker AR M. Bowen AR J. Browning AR M. Chapman AR B. Greene AR J. Groves AR A. Heard AR N. Herrera AR B. Hinton AR J. J amar AR K. Karre AR S. Livingston AR R. Mesa AR W. Short AR C. Vogel N. - -Izsaz,-:.f 16 7 - ' '- ' W' -'-- - .-f. H V M f The home of 230 Aviation BoatsWain's Mates CEquipmentD, or ABEs, IC- men, EMs, AZs, and YNs, V-2 Division is responsible for all aspects of the safe launch and recovery of aircraft. V-2 personnel operate and maintain four powerful Steam Catapults, five Arresting Gear Engines, The Fresnel Lens Optical Landing System, the Integrated Launch and Recovery Television System CILARTSD, and all flight deck lights. Without V-2, the ship would be an aircraft parking lot. Because of V-2, NIMITZ can launch and recover aircraft day and night, good Weather and bad. There is no harder Working group of people on board the ship. Unaccus- tomed to sleep or hot meals, the men and Women of V-2 routinely perform the impossible. Launching alerts early, unscheduled recoveries, and all-night maintenance to keep the equipment operating is expected of this talented group of Sailors, because they have made it seem so common place. There are no shift changes. The same aggressive, red-eyed, grimy ABES Who man up for pre-ops, flight operations, and post-ops are the ones who also perform the night's maintenance. The next day they turn around and do it again. They must be good, because there is no more dangerous place to Work than around running aircraft, steam catapults, and arresting gear Wires. V-2... they're professionals and they are the best! I 9' ' LT J. Collins LT E. Henriksen LT K. Rietz LT A. Walcher i ENS Cr. Mucke ICCS M. Cansler ABECS C. Thiede ABECS M. VanOort ABEC W. Helmuth ABEC K. Hobson S T T i ABEC R. Mastin ' .. Jif fy. 168 71 f K, --l xx . V2 ABE1 L. Agado EM1 T. Campbell ABE1 W. Duke ABE1 D. Graham ABE1 R. Hansel ABE1 T. Lang IC1 R. Lindsay ABE1 J. Machaby ABE1 A. Melendez ABE1 P. Swanson IC1 M. Walsh 'Fa' 169 V-2 . dLAu' ABE1 G. VVhite ABE2 P. Almanza ABE2 T. Bremmer ABE2 D. Brown ABE2 M. Brown EM2 B. Butler EM2 M. Carter ABE2 S. Chatman ABE2 C. COX ABE2 F. Copon ABE2 J. Davis ABE2 K. Estes ABE2 R. Ferguson IC2 G. Garcia WT? , -E, -4255 ef: .- N- '- r,-z-,-'-H ' 1.15: V- .f l... ABE2 P. Holder ABE2 A. Jones AZ2 R. Jones ABE2 R. Knudsen ABE2 J. Naranjo ABE2 N. Sanford ABE2 C. Saxton IC2 O. Scholl ABE2 T. Smith ABE2 W. Sparks ABE3 S. Arnold EM3 J. Barrera EM3 M. Bennett ABE3 T. Bernklau 'Nm 171 V-2 63.5 , .. ' 1? -722, . - -M W 5 p .- ,' 37 V ABE3 A. Brack ABE3 A. Campbell ABE3 A. Canfield ABE3 A. Corchado ABE3 L. Coward ABE3 R. Crowder ABE3 R. Cuellar ABE3 K. Dodd IC3 B. Eldred ABE3 A. Eshelman IC3 B. Franklin EM3 D. Hobbs IC3 M. Keating AK3 J. Kishpaugh IC3 S. Krabbenhoft ABE3 R. Mangum v 1 1 l I M lx ll ll l l 4 l I l l X l l J sl l I ABE3 C. Massey ABE3 B. Mayhand IC3 J. Mendez ABE3 R. Mendoza ABE3 S. Middleton ABE3 J. Milburn ABE3 J. Miller EM3 M. Moran IC3 S. Myers ABE3 S. Myers ABE3 C. Patton ABE3 B. Perette ABE3 S. Perkins ABE3 R. Reich ABE3 N. Reneau ABE3 G. Reyes V-2 'Nm , , E. -' Hi?- -9 .15 '24 V- ' :r. ' .Hier ff' 173 . -.W-re,--f-me - .....,-...gm-......-...v.1 .1-1, V-2 135 ABE3 J. Robinson ABE3 R. Savage IC3 D. Smith IC3 A. Tellone ABE3 R. Tinsley ABE3 R. Touchette ABE3 A. Welch YN3 T. White AN M. Alamilla ABEAN G. Beggs ICFN S. Bennett ABEAN T. Bliek AN J. Caganer AN G. Callahan ABEAN B. Cervantes ABEAN R. Corbin R- : ef , 'H h L 'E 1 K ff AN R. Crews Vhiaa I, AN A. Curtis AN M. Dunlop AZAN D. Fullmer ABEAN F. Hoffman ABEAN C. Hoover AN A. Johnson ICFN C. Jorgensen ABEAN T. Miller AN L. Nixon ABEAN D. Pelletier SN M. Perry ABEAN C. Rehder ABEAN R. Sanders ABEAN W. Sclafani AN R. Searcy AN M. Tressler AN A. Weese AN J. Weiner N4 ' H., ' 'I'--.p.s.:-.1 -1 .. ..- 145.3- ?: 3... 5 - xgxw. .34 -' ' J r'-1-211: f .. ...,,L:-H., , -'Ze-v V-2 fa' 175 v?1igf V-2 AN A. Williams AA J. Almond AA J. Baker ABEAA A. Boykin ABEAA B. Butler ABEAA A. Castillo ABEAA M. Cooley AA D. Ehrenberg AA F. Fletcher ABEAA S. Garrison ABEAA D. Hanlon AA J. Hetrick AA J. Hoffman AA J. Lopez ABEAA A. Lucena AA L. Marcus ABEAA B. Morgan AA T. Neese AA J. Ponce AA I. Reyes AA C. Rucker ABEAA C. Sims ABEAA R. Smith AA K. Stowell ABEAA C. Strome AA M. Sawyers AA J. Walker AR A. Ballin AR D. Bello 7 AR A. Caffey -. f 6 'v , V-2 AR T. Chapman ABEAR M. Colvin AR C. Cooper AR B. Cotton AR M. Crone AR K. Fuller AR G. Gammon ABEAR E. Harris ABEAR R. Hencke AR D. King AR D. Krentz AR J. Lanier ABEAR D. Leonard AR C. Magnusson AR K. Martin AR L. Martin AR H. McNulty AR J. Menard AR C. Menzi AR A. Mobley AR C. Paulding AR L. Pickett AR V. Pingol ABEAR D. Richardson AR J. Robertson ABEAR D. Robinson ABEAR C. Shearer AR T. Tate AR W. Thompson AR W. Wade fA': ZA .g.p 1 77 --- 4 -- e - -- -f ,.-w-..w,f'-....,-. X, W.. V-3 Division is responsi e or etw the flight and hangar decks, and for the spotting of aircraft on the hangar dec fac ' ' deck's expertise comes from ose c gay Directorsb. In order to support the aircraft and the ship in areas of fire protection, em str 3,00 support of NIMITZ sea and air power. LT D. Carroll LT E. Raney ABHC A. Quillen ABH1 L. Mull v ABH1 T. Ridley ABH1 R. Smiley ABH2 R. Alcoran ABH2 E. Berdiago ABH2 T. Billings ABH2 J. Brace ABH2 E. Duquette ABI-I2 K. Kexel ABI-I2 B. Knox ABH2 E. KO ABH2 R. Stroman ABH3 K. Belcher ABH3 B. Benner ABH3 T. Benson ABI-I3 K. Burden ABH3 A. Chenoweth ship protection, conflagration stations are strategically located in each bay on the han de k 'bl f the safe and expeditious movement of aircraft b ilitate air wing maintenance in support of operational commitments. The han th ommonly referred to as Yellow Shirtsi' CHan s the added responsibility of coordinating and directing fire drills to train air win ' 's company personnel in fire fighting procedures and techniques. ln Suppgyt 0 c bulkheads. They are manned by highly qualified V-3 personnel. In the event 0 ergency, these people activate the systems designed to control potentially C 0 damage-free aircraft moves are completed during an average deploymen X I l L V .. Q: L l K een k to 8 Deck V 3 8 and f fire gar l fan ophic aircraft fires. It is a tribute to the professionalism of the V-3 Division that dlxlgr ll tin . V 3 ABH3 R. Cortez ABH3 D. Digrado ABH3 J. Dufour ABH3 M. Hayes ABH3 S. Keefe ABH3 S. Kempfert ABH3 J. Owens ABH3 M. Perkins ABH3 T. Powanda ABH3 R. Reynolds ABH3 J. Rispoli ABH3 M. Scalise AN D. Adams AN R. Augugliaro AN S. Baker AN D. Ball AN M. Brooks AN P. Cartee AN T. Doody -1 V-3 AN C. Doty AN L. Gallman ABHAN C. Gaschel AN R. Harrner AN A. Johnson YNSN S. LaValley AN A. Leal AN T. Lee AN C. Manning AN J. Morris AN J. Roods AN D. Stoll AN C. Stoneking AN M. Taylor AN R. Urban ABHAN W. Wagner ABHAN A. Wesley AA A. Anat ABHAA C. Callison AA C. Chidress AA C. Franklin AA C. Fulk I nf A 'Q 1 80 75 ik V-3 AA G. Geyer AA A. Lenning AA R. Marin AA L. Martin AA C. Moffitt AA R. Ramos ABHAA R. Rogers AA J. Sabio AA R. Schroeder AA J. Shelton AA B. Skinner ABHAA J. Trenchard AA G. Williams AR M. Boyd AR J. Etheridge AR C. George AR S. Gorman AR D. Harris AR A. Herman AR K. Sparks AR D. Stanley AR K. VVhite N f f l fi x f r' 181 .. ya.. s lL. The Aviation Fuels Division is responsible for the receipt, storage, and issue of Aviation Fuel aboard USS NIMITZ. During a six-month deployment, we will handle well over 20 million gallons of highly volatile aircraft fuel. Along with 7 8 embarked aircraft, virtually every fuel-burning piece of equipment on N IMITZ and her battle group depends on V-4's purple shirts for the delivery of Fuel The Grapes, as they are known, workin two major areas: the flight deck, with its fresh air and sunshine, and below decks, down in the bowels of the ship. The flight deck crews, known as Combat Grapes, deliver fuel directly to the aircraft and equipment through 1.73 miles of 2.5-inch hose, located at 14 flight deck and five hangar deck fueling stations. These highly trained, never tiring crews who haul hose provide an invaluable service in an extremely demanding environment. Also assigned to this branch is the very important Quality Assurance team. They are the crew who test the fuel for cleanliness, free water, flashpoint, specific gravity, and fuel icing inhibitor content. Their constant vigilance in test and evaluation is essential to providing the highest quality of clean fuel possible. aBelow Deckersf' located 10 decks below the flight deck and four decks below the water line, are tasked with the operation and maintenance of the highly complex Aviation Fuels Systems. They are assigned to receive, store, purify, and filter the fuel. Then they pump it through 6.3 miles of piping for delivery to the flight and hangar decks, With 189 tanks, 20 pumps, four purifiers, and four filters, they guarantee a ready supply of clean, clear, bright fuel 182 at all times. LT M. Stone CWO4 J. Mitchell ABFC W. Langdon ABFC R. Munson ABFC W. Place ABF1 J. Hollenbeck ABF1 J. Hutton ABF1 A. Macalma ABF1 J. Profit ABF1 B. Watson EM2 T. Blitch ABF2 M. Columbus ABF2 B. Davis ABF2 C. Downceroux ABF2 E. Harrington ABF2 S. Shea ABF2 J. Woodard ABF3 R. Adamson ABF3 W. Brewer ABF3 J. Campbell F V-4 ABF3 S. Carson ABF3 D. Cash ABF3 J. Cone ABF3 T. Cross ABF3 S. Erdtsieck ABF3 M. Ericksen ABF3 P. Freitas ABF3 F. Garcia ABF3 J. Gombos ABE3 P. Helgerson ABF3 W. Holloway ABF3 R. Jeanpierre ABF3 D. Kangas ABF3 J. Kinsley ABF3 N. Leon ABF3 P. Long ABF3 J. Maclean ABF3 M. McGraw ABF3 T. Meadows ABF3 R. Moore l K V-4 ABF3 G. Neidigh ABF3 S. Roberts ABF3 M. Rothenberger ABF3 S. Sestili ADF3 D. Spickler ABF3 M. Wager ABF3 P. Watkins ABF3 J. Wickham ABF3 M. Wilber ABF3 K. Wilburn ABF3 F. Wilson ABF3 C. Zacharias AN C. Borders ABFAN A. Davis ABFAN A. Filby ABFAN M. Fisher AN D. Foote AN M. Hough ABEAN K. Larson AN T. Lee f 184 tiff V-4 ABFAN M. Mercil ABFAN W. Parker ABFAN R. Perez ABFAN G. Priddy AN G. Salas AN J. Sanders AA J. Sanderson AN T. Seefeldt ABFAN C. Stahl AN W. Stephens ABFAN S. VVhitaker EMFA R. Altis AA J. Bergen AA O. Cantu ABFAA J. Crozier AA S. Dewolfe AA J. Engelking ICFA S. Haase AA D. Hess AA S. Latcham Ya. f F Q 'X A 1 85 V4 AA C. Mallon AA R. Moye AA S. Mullins AA R. Murray AA C. Nassif AA K. O'Leary AA J. O'Neil AA A. Parris AA S. Post ABFAA R. Powell AA J. Ramirez AA G. Ramsey AA A. Reitzloff ICFA C. Robinson AA S. Schlingman 1 .. 'fm I 'X -:bfi-n - ig?-?L?.AQL. NN L-- .jp - 'fi -' V-4 AA M. Williams AA S. Wind ABFAR M. Camel AR J. Dickson AR M. Doughty AR S. Gabbard AR C. Latham ABFAR B. McCoy ABFAR M. Netherly ABFAR J. Pearson AR M. Pyle AR R. Reid AR C. Robinson AR G. Young F25 187 V-5 Division is the leadership and administration of Air Department, yet it is the miscellaneous jobs division that fills the gaps Which are not part of the other divi- sions' scope of operation or responsibility. The Air Boss is the leader of the ship's largest department, and he controls the flight deck, the hangar bays, and the air- space in the close vicinity of the ship. His able assistant is the Mini Boss, Who is fleet- ing up to replace the Air Boss and also acts as the administrative head of the department. The Aircraft Handling Officer CACHOJ, or Handler, is the resident expert for the Air Department workings who controls aircraft movements on the flight deck and in the hangar. Air DC maintains the department's damage control equipment. Air Training manages the training schedule and training requirements. Pri-Fly personnel display and record information to keep the operations of the department in motion, and the Air De- partment office personnel coordinate the ad- ministrative tasks vvhich support and bond the five divisions that form the best depart- ment on the ship...Air Department! We fi,-I g X ,f V., .il . .,.,. .. ... gms- f 2, H J . X 951222, ik 'rw -ff? f 1: ' ' ZZ f K E X z ,f 1 --if-'1: Z-7 'ii an . K 1, AQ ' f Wf 1 f f Q53 Q 1 'mf' V 1, 9 , , ff 'C.i. ,.-.5-1f.f' , C ,,,, Q jf ,,.,, I. . ,Q . I f-.f if ww f A , at 3 4 CDR J. Spurr LCDR R. Southall LT I. Cassidy LT P. Heberer ABCM J. Tullock ABFCS C. Yager ABH1 E. Alfano ABH1 J. Brownell ABH1 W. Mnichowski YN1 W. Thompson YN3 W. Black ABH3 A. Crespo ABE3 P. Gray ABH3 R. Jarvis ABH3 O. McKinney ABH3 J. Obermeyer l 188 r - 1 ' -2 eff? ,. '3.'ffk:?--Mir 3 x N my , x . i Y 2. 1 X 'x L W-ei V-5 ABH3 D. Shipperbottom AN K. Acoff AN S. Gilbert AN J. Harmening ABHAN M. Kirk AN T. McCray YNSN J. Reyes ABEAN B. Rogan AN R. Sanchez AN L. Tortuya ABHAN S. Voges AN J. Wright AA N. Davis ABHAA B. Kusama AA A. Nett AA D. Woods AA C. Clayton AA G. Davis 'rii if 1 89 4 .,,.,,,, . . 4 s VM K J' ' 1- 31153 7Z:.3f:f2'2X-5'fx:.- 'Vgjjlj J. x.,,.X,w,:Af-,M Mfxeg 3250113 .1 , fvw-1,.y,,, i 2 ff ff ff ff f ., .. X , if , M 'fpl'fyi'Q7.'Q'V,'ff'-?T'f5fi, I Hz , ,,...,.,,,, , ,, ,,, 7,-V, 1 ,'V , ,rr f. f,1af-,- Qg'f'L',f' J, if I , ,.,,, 1 .A Y V, ,, L, ' 4 , ,. , ,, . , f f V fy ,v , , '. wif f 1 , x X jf I, A- .fi f- '5'fP5n1'f,s l-'I '59'f'I2x- -X .f f ,-U -V M, , , -fi :QfQzfgf,5f,fY'2LQgQ3f61,49 4,13 '-if1,g,: Z' fp-Q' zifsf, ' .,,f: ,qg1f, , , ,gyyw , ,W 1222,-, .7l'4i 7! fi'1.1f5V,-, I?X'7':- if 'fi W LW! fvf Yfm'x'f H 424-f ,Qf'Z32,'i.,1s4bg4j2Q,4Q? ' ' ' ' ' 41wif-Qfjv 7,'f'f'-Qfgff, , 2 , , ' 'T' -, 'ff cf we f , Vu , 'f'V W' X' f7'??f-Li'WEfP Tiff' f 41' . V V5 HCT 557 14277 bFv,f'l' ZZ- lT',f'l -' f 'f' 1 5-L--I 'nfl S if ' , f 1:24 ' ' ' ' f ,,,, gf , I 4 tifiijtf Zig' ,V,V, t , , ,. ,J , V, f7,,,,,i, ,,.i,-ig,- V 1 ., ,, , ,, A, Q, x Q.. V! VV , ,,7,, ,,G fy, ,,..',37.v.!,N V, 4, ,I f,y',Q,t., 531. g ,:,.1f. M , X k . ,, .,f,q,4,,'f,' ' gg, f, f -.',,:-agp 1 , Vivrff 'Q' . , . Q, V, WX, ,fi ,fp ,f V, ,,V, ,- ,,,. ph ,wif ,, I 2 A ax 2-'fb M, , . ,iff f ' ' ' fx I. .L - ' f ,' , -4 ,.,, ,,.-,, ww. , M- - fn- f ' ,,,'1 ww 'f4,,.,4 Lv 'fyfx' 'X M WU ,Q 5 Q A ,oivfw K H Vnynfw 2' gwx 4 M55 x, f ' V ,Wg 9,2 M x 4 W ., 3,,,y.'4,5, X ,K , ,f ,, ,JWW . k,,v. 5, .- Qb.vumw,.eA -f 'f4w- f .kf,M,5g'r ',::g.,gr.A,j.w,4f fix 3 IZA I I W2 Mfg? Wy, 33-Qf' KW M! 5'.g3'5np,Ai MQ, 1,4 jx q4?w,?,.A hw 'kv ,few Q J 'ww ff' 'N f f fw-zfwm AWA f y .2 f M, A dw ,W 41 ,fx 1,4024 '-A x X W Xfiffsfvxf 'xx VK 4 Q X IIS VV iff! mf wwwfvwwfff f W ,f AA IK w x 1 v f, 4 Hr Y , if 3. 'f 7 -A ff Q X, QMYQEQQ, Qapvg- Aff ' 4 0 'if 1 WDA 'f fV'9 a Af N f.-A wh X- I-ii. f ff 7f:i3L44gi.f:5:i5v-5 W. y ,mx ,70 hi,m.,-I tx, 4 ,. ,,.v.h , , ,a,,,Q-. .-f ,K A., ,W m4,,.', g,.+,g: View-. 5 1. 1 , -' A ,vfff . Q.-,5.,,,5, 4. .35 , A-, 3 f A x , , , f I 1 ff , A . , , Y, ,',,,.,,:,- ,,,,,, 5 -MK 271- 11 QQ.-W ggwzfg',':,,,.Q.-f'V-f,,'f-1-QVQZW.-,41:-.mf fi,1g2:1i2!3.f:Ef2fL' cwff s , ,f wa.-, -2 -rem,2-.gm4.9ywvgzelg'dbfvz-,- ..f5y 4fg.5.v9+ U- 'wg . 'ig :Q-,fA5g.,- ,5,,.4f,w,,,f,g.yfqg,,-M:-gzvf,,-gn. yp.:f4. 'A 'M ' 5144-,436-iyfgg. wq,-42, .123-ixiifvf A ..f'.4a'wfw, '44qs3?:- -5,2 Qffif5i?:.a , ,4Tf4,,f' lf,,,,ai:'Jg W, .V -f ' ,f,,,g,57,,,,, Lffffgy-fl 'gn K 1 , Ky f ,mx vs:-WV3,m,w,qg .QA ,f ,333.xgwi-k4x,,,g,. , , ,, , mv .4,:- I. -. ,fi QQ .V e'1:v,,5?,? ,I,g5gf2fQf:'5':54f:f.f:r:,:psagQ,g,f5.u41.,,Yf:w.'z:.-:- ,mer 'fluff :'4-fx,g1,:qg2f.,m3:az-.2347 Q iukhzwflaffi y ' f L W QCWIEQP?-5Q-i'2-L3'tQ?l-Hiiffif',f'Z22i7?fz31f-3:5475 Q., I '76, .vjfgg-, N1 .- yr.-gpg: .f ' my ,wi .Wy-7 fm-,1 vv:f,,,':.,f 2-5-2.1 ,,g7:,- -f.Q3M3:4-Q1 v,j,g'g.: f f'3-Mzw ws' gn: :f-mg:-2'.'-ff-u'f:4a 292- ,- Ha' '53 fzff:f,11,-Q33 f kPw'f:sf2wff'cy..-Wf'fM-.',:1: QW.w-f.f 5w-ar-'VX , f f : -,,m,f,.y,,,g5g.,,, 3, jP,,ff-gf ,5,f,,,fwL-f,f 5 V , ,pg -5, Vg. gcfhuik' -'11 -5.-,y-5'-,.g.+.',x f'fW'vp?,f-.'-ZHJA ,f'--FN-Kp-f-1-J rw ' f f ' f, - W 2 j i Hji49,gd4'124U2QQ53'?3i94M',?2gs3 ,L ,.,,,5,vy,,.,-,, ff?-ww: X,-.4f:',,5, qjvh, Q-7,25 ,Mfg gg4:g,5,3.1,-3-, V111-'yi f 1 7-1 -K., 5-1,1 ,. ylvif f QM- f 4, J We-v.i,'.g 53,53 11241 -A' 1Q61':+puW:.5g:' 445 45 y, , ' W, 5'2:4gf5i'if N 4g:S521f'9eiff ' WfQ2g:i ,,f1r5?15 1fs12i1'g 1 ' ici.'-p:f:g--v+l':f:- Ii?-1 if? 25171-5' ffvfzbif' f:,2l1Yi:':f 'f2LZf ' 2175? 21511. Lgifffby Yami, .:'Li'LI:ya- wi: .51?f'L-f1'5:l'7433777-1755 J -' fx :QQ 3, 15145,-u .N-f. , f-,-'fxng W- ,.., .L .V . . 4. - , I ,f , ffcf W 9,1 l ,- wg ,WZ Y f 1 4 ff N f -9 f .V A Q , f f 1 8 'vy' X 9 f' XZ , ,n,,. ,J .f-1,7 -v -, plug, f Yu 2' mm, nigh Xa 222, ,f-'K-E: if K f fm 11 -1 X '41-T' - ,, ' 'QT3ES?24f ' cnosiv J Bos'n Division is responsible for the operation, care and maintenance of Deck Department support services, which include the ship's Sail Loft, Bos'n Locker and the preserva- tion and cleanliness of the ship's sides. The division also forms the core of the ship's paint team which provides technical guidance on preservation and painting plus spray painting services for spaces throughout the ship. .ig E91 ch? ill li? E911 mi l . I CWO2 J. Beane LT M. Mankin BMCS R. Santos BM1 R. Perry BM3 C. Herrera BM3 J. Krein SN M. Thompson SA S. Peters SAJ. Webb . il in V l 1 1 x N Y R jLQ:' . ,.,4 ' t 192 7 i 5,49 D First Division's primary responsibility is the operation, care and maintenance of J the Shlp S Wound tackle- Thls lnchldf-ES the two 30-ton anchors and 180 fathoms of anchor D zichain C.l,080 feet of anchor chain per anchorl. The anchors are located on the forecastle C rw which is also used. for divisionfsquadron ceremonies. First Division is also responsible for if if the f01'Wa1' d moofmg 111195, f0U1' underway replenishment stations, and one accommoda- Jilin-Kxmifff Il tion ladder. Maintenance of the ship's 252 twenty-five-man lifeboats is also under First QU Division's cognizance. L -! l i I i i l 9 .. If I f w l E an E 'I I I kd, W., f .m lfffvlh ......... ijihpinnilk LT B. Baker BMC J. Othoudt BM1 J. Davidson BM2 J. Crocker BM2 M. Paridon BM3 R. Edmonds BM3 J. Gonzalez BM3 T. Harrington BM3 W. Henson YN3 J. Martinez BM3 M. Pavey BM3 M. Westwater BM3 J. Wood BMSN C. Bolden SN C. Evans BMSN M. Harris BMSN R. Hood SN K. Lawson SN C. Napolitano SN D. Paano 1ST . f ' ,, 5 , 1 Q ff H. SN A. Williams SN J. Zamora A SA B. Baker SA J. Burkes SA C. Kirkpatrick SA K. Miller SA D. Ray SA E. Robles SA K. Scheuerman f SA R. Simmons he .. l . BMSA A. Smith ' A SA V. Woods - SR M. Doud SR K. Lourwood ' SR E. Newman SR S. Norton SR J. Penn SR B. Perry SR R. Rogers SR G. Veazie jglg- ,N 194 SR P. vvhiiden 'D -x 'f Second Division's area of responsibility encompasses the maintenance and operation of two double-hose refueling stations Cthrough which NIMITZ receives aviation fuelb, one motor whaleboat, four of the ship's mooring lines, one accommodation ladder, one boat boom, one cargo underway replenishment receiving station, one destroyer fueling station Cby which NIMITZ refuels other shipsl, and the ship's two incinerators Cin which trash and classified material are destroyedb. Second Division personnel man Boatswain's Mate of the Watch, lookout, helm, lee helm, incinerator, and aftersteering watches underway. In addition, Second Division is respon- sible for the Officers' Quarterdeck area, including the NIMITZ Room museum where visitors are welcome to view pieces of NIMITZ history. J na? ...WMGK ' ff , ,W A v li 1 z ' '- 3. V X x 'V 1 r - Q '. ZN Xxx X Fyfz LTJ G D. Chatfield BM1 C. Peterson BM2 M. Fracker BM2 R. Tomac BM2 J. Vincent BM3 C. Bender BM3 J. Farias BM3 M. Smith BMSN T. Brown SN R. Davis BMSN R. Flowers SN A. Fowler SN J. Hunter SN T. McAlister SN B. Mercil SN D. Morin SN S. Nelson BMSN J. Roberts SN H. Scott SN W. Smith SN E. Wesley BMSN A. Willbanks SA J. Gallego SA D. Girgis SA J. Stahl SA J. Terry SR K. Blackman AR A. Keller AR M. Krogen FR N. Malone Third Division, the Small Boats Divisionf, oper- ates, maintains and dispatches the Captain's Gig, the Port Motor Whaleboat, and the Utility Boat. With the exception of the Motor Whale Boats, all boats are on and off-loaded using Third Division's boat and aircraft crane. Third Division is also responsible for boat booms three and four, which are used when the ship is at anchor. Third Division also operates a cargo UNREP station and a fueling station. Other divisional duties include the upkeep of the stern liberty ladder, the fantail, the port yard and stay, and towing the spar for aircraft bombing and strafing runs. LTJ G A. Mbuthia BMC A. Bettger BM1 R. Dedeaux BM1 J. Hill BM2 J. Martinez BM2 C. Morris BM2 K. Ray BM3 N. Brown BM3 K. Gagestein BM3 M. McGuire BM3 S. Parker BM3 J. Roberts BM3 R. Silva BM3 D. Simons . .... -' 211 if 1 96 3R13 WC SN D. Caprioglio P SN P. Curl SN J. Fomby BMSN J. Mayfield SN J. Muchmore ' SN E. Nunez A SN D. Oster S V AJJJ P SN R. Tausch J f ' A J A SN R. Valle ' ' 2 Y SA B. Ayers k P l SA E. Feighery ' A f SA Y. Felton SA D. Getz SA D. Long SA K. Parker SA D. Pickens SA W. Westenhoefer 5 A AR C. Gardner AR E. Milligan SR J. Smith rree 197 L l 'P an , ' f f,.,j'1: 'ffm ,J 4 v Dental CDR L. Baumgarten LCDR B. Hunter LT P. Buenvenida LT E. Perkins DTC B. Farinas DT1 K. Ewing DT1 M. Fontanilla DT2 S. Hanners Aj fag :Ali I DT2 M. Rosemond DT3 D. Brown DT3 E. Martinez DT3 V. Myers DT3 C. Sullivan DN S. Allen DN D. Davis DN J. Miller DN J. Price Dental Ya .,..f ,-.. , y - ar:- N f':--'1' . :A if 201 1 Q If ,xfyck .. fp ,W , , ,mg fig yf M, . ,. I . gif iii! f g.,,.,k2,,y?f 1 f,'f,f,:' 4-,w,,,. 4 .L MQ, fp. , A X. ,-Q CW xxx :XZQQFY ,mf rf . ww w f f'3,2QffQ,4 I -1 f f',fL2wf'? , , , ,f , ,,, ,, , , . f 5,5 , , . f fb 'Wm ' ' vim 49 -2. af 'mwgcifz ,. -' 2.1 V 1, : f Z! ' 9? , 4 1 '1LA'ff 'fgyxm , . 2,-ffliziffi ww if-g.,fzQ J ,,.f :gg-fxfz 45.9 P i1Z?A.- ' .J4',,' -'c ,. 4 I Jr. 'fx' H -2 f ,'f'x -Y- f fix lx . X I A, 'x H 'fr fx,- 'w iz 46 , Q 5 z f -, ,Q fm, F . ,dmgz -. ,Y 14' ' , , jf .nuff 4 fi f V we - 2 , 2 ,' -,Z ,ygw , 4 ff -fb ff .ff mi: ff, 41,505 Wm 'W LQGR0 The Logroom serves as the administrative center for Engineering Department. Under the leadership of YNICAWJ Harris, the Logroom Yeomen provide the best administrative support possible. They are responsible for maintaining engi- neering records crucial to the efficient operation of the depart- ment and for processing a staggering amount of naval correspon- dence and required reports. Over 4,000 documents Were accu- rately processed by the Logroom during the deployment. EMCS M. Murry YN1 O. Harris YN3 M. Jordan YNSN C. Wilson grvf A UXILIARIES--. The Auxiliaries Division is led by LCDR Ocampo. The division is manned by Machinistls Mates, Enginemen, and Boiler Technicians. The Auxiliaries Cfficer is assisted by the Auxiliaries Technical Assistant, CWO3 Elliott, and the Auxiliaries Division Officers, LT Cain and ENS Fagan. Auxiliaries Division is one of the most diverse divisions on board. The responsibilities of this division range from the most technically complex in the department, such as the cryogenic plants, to the simple but operationally essential ventilation filter cleaning shop. By the end of the deployment the cryogenic plants produced and dispensed over 38,000 gallons of liquid oxygen! nitrogen and the filter shop cleaned over 7,500 filters. Auxiliaries Division directly supports N IMITZ, primary mission by providing continuous, 100 percent readiness of aircraft elevators and cata- pult steam systems. The catapult and elevator workshops work around the clock to support aircraft operations. The outlying hydraulics workshop is critical to the ship's l 1 . , , safety. This shop maintains the steering units, keeping the ship on a safe and steady course. This shop also maintains the anchor windlass, mooring capstans, replenishment Winches, and the boat and airplane crane. lf there is a special evolution in the making, you can be sure that the outlying hydraulics shop will be involved. Auxiliaries Division's busiest workshops are the air conditioning and the steam and heat shops. These shops are the most important to habitability, and their performance can significantly impact morale of the entire ship. They provide NIMITZ with all of the comforts of home. These shops maintain all hot water heaters, laundry equipment, air conditioning units, refrigeration units, and hundreds of pieces of cornrnissary equipment. The outside repair shop maintains the ship's fire pumps and 12 vertical stores conveyors which are constantly in operation, a most welcome asset to the working party who would otherwise have to strike down stores by hand. Last, but by no means less important than the other shops is the boat shop. This work center maintains all boat engines in top condition including the Admiral's Barge. Although the boats are seldom used while the ship is underway, they can always be counted on to operate in the event of a man overboard or any other emergency that requires the use of boats. LCDR R. Ocampo LT R. Cain CWO3 C. Elliott . MMCS T. Graff I MMC J. Arnot 3 , MMC G. Butler . MMC A. Hoesch MMC J. Lucas MMC R. Youngberg MM1 W. Chong MM1 D. Hroch MM1 R. Ingram BT1 S. Lance EM1 C. Markley MM1 M. McLaughlin MM1 S. Olivas MM1 D. Peters N4 ': 2,4 205 206 A MM1 R. Ritthaler MM1 H. Shaw MM1 L. Sisco MM1 P. Spencer MM1 D. Wisniewski MM2 G. Allstun MM2 K. Argotsinger MM2 R. Arrona MM2 R. Baker MM2 J. Barrickman MM2 J. Bettes MM2 T. Deane MM2 M. Dubrall MM2 B. Dukert MM2 E. Evans , - n 1 ' '2 V-,e.fQ.,,. 'QZ:k?.0mz. MN i?- VI 'I Vw 95 , 65 A MM2 P. Eychaner MM2 M. Futoran MM2 R. J enck MM2 P. Lesassier MM2 T. Lumaban MM2 J. McMillan MM2 S. Mutini EM2 J. Parsons EN2 P. Soucy BT2 J. Trimble MM2 M. Velasquez MM2 J. Williams MM3 T. Agee BT3 S. Angell MM3 B. Ayon 'Na f F Q 207 MM3 P. Bailey MM3 C. Baker MM3 N. Been MM3 K. Botelho MM3 P. Broussard MM3 J. Brown MM3 C. Bustos MM3 W. Clark MM3 D. Davis MM3 S. Deroux MM3 C. Gilbert MM3 D. Gray MM3 C. Haff EN 3 C. Harvey MM3 S. Hicks 2 1 , B 1 ' '2 --,:.f3,,, , 512. q3-5?--'Qi ' 'ij 5 ' ff' EM3 M. Hubbs MM3 K. Jurek MM3 L. Kelly BT3 M. Lapray MM3 M. Lazzara MM3 E. Martin MM3 R. Meneses MM3 T. Morgan MM3 C. Morris BT3 D. Paquin EN3 G. Payne MM3 A. Persaud MM3 H. Ramiro MM3 A. Ramirez N A MM3 M. Salas MM3 P. Scheibmeir EN3 B. Short MM3 J. Stueckle MM3 H. Tiller MM3 D. Webb EN3 A. White MM3 K. Williams MM3 A. Wilson EN3 C. Yepez MM3 R. Zellers EMFN N. Albers MMFN D. Badasow MMFN J. Barnes MMFN B. Batey MMFN A. Carroll FN C. Cornish MMFN D. Hudson FN Z. Milinowicz ENFN M. Phillips MMFN E. Pitt 21 0 MMFN M. Shaw FA P. Adams FA C. Bauch FA C. Braun FA B. Hawkins FA S. Hughes FA A. Largo FA L. Mackin FA R. Martinez FA S. Maurer FA T. Powell FR V. Reidy AA M. Wilson FA D. Zander FR C. Bennett FR C. Bixler FR D. Humbles FR A. Koontz FR J. Kosters FR C. Robertson FR E. Rogers MMFR R. Thompson 21 1 L 212 . -mf. ,pf-K -.-,,..,,..--mam-....-...,.,......,f ..o......,,,,,,,,,,,,,,,,,,,, I Th E1 15 ' 1D' ' ' ' led b LT deWilde and is manned by Electrician's Mates and Interior Communications Technicians e ec rica ivision is y I ' . . . The Electrical Officer is assisted by the Electrical Technical Assistant, CWO3 Goo anilT'gvoFd1v1s1Ion officers, LTJ G Foster and ENS VVhitford. Electrical Division is responsible for the largest part of real estate on NIM I rom I ow o stern, fromthe elghth deck to the top of the mast, the division operates and maintains thousands of pieces of electrical equipment. The division has 11 Work centers. I , , The Aviation and Ordnance work center is responsible for maintaining 40OHZ motor generators, aircraft electrical service stations, aircraft elevators, hangar bay doors and AF FF stations. I I I I I I I The Hotel and Power Shop maintains all underway replenishment Winches, a1rfC0nfl1t10n1ng units, fire pumps, Conveyors, laundry, galley equipment, and degaussing. The Lighting Shop maintains all l15V circuits and responds daily to a staggering number of trouble calls. They constantly work on electrical repairs or habitability upgrades. The Interior Commumcationis Q05 technicians maintain systems which keep the NIMITZ crew informed and ship on'a steady course. The Forward IC Shop is responsible for hundreds of alarms, two ship's gyro compasses, wind birds, and the underwater log. Without them, NIMITZ could not sail a true course, determine true wind for flight operations, or measure the ship's speed through the water. The Aft IC Shop is responsible for the shipis telephone systems and all internal announcing systems CIMC, 3MC and 5MCJ. All announcements Cbgth emergencies and routine! are passed over the communications systems maintained by the men and women of the Aft IC Shop, 2 zlsv -df gui' 'IWW -E T 5 I i 1 LT C. deWilde LT M. Wang LTJ G S. Foster CW03 M. Goo EMCS N. Brown K K EMC E. Baluyot ' ' s ICC G. Barrett . EMC C. Bell ICC M. Wright s EM1 J. Kidd , I L EM1 D. Knuth EM1 J. McClellan 1 IC1 R. Mitchell IC1 C. Neiffer i IC1 J. Rodriguez : , I i E I - o L 1 '? 1:-fin . 'nffi-5..-x61 -.., ' - :ff S' .,. I Ik ,. ifl: .' mg. UQ N L, x 'Q R 1. Tvs 1' 1 l X 'n E EM1 M. Rustad IC1 R. Vargas IC2 T. Boclair EM2 L. Braunesreither IC2 T. Briggs EM2 L. Gonzalez EM2 C. Hardway EM2 B. Smith EM2 G. Urbano EM2 N. Vann EM2 B. Vigil IC3 M. Allen IC3 M. Baker EM3 B. Boudreaux IC3 R. Buchanan IC3 L. Cameron IC3 L. Christensen IC3 J. Clark 213 Y. ig ki ,i Ti I J gf! 1 rf 1 I 3 - 1 EM3 J. Clark 3 103 R. Dean J WI . . -an . fl, lyflliwqg-rnwil' , D 'Wh 'WWA 1 ANDY!!! M mf Vmirx 'GE ' EM3 G. Del-Ioyos EM3 J. Feltz I 5 EM3 R. Foraker IC3 M. Graves EM3 M. Hall IC3 B. Harris X IC3 J. Hoefgen J . J W EM3 P. Housden IC3 L. Jones EM3 J. Kiesel IC3 L. McCall IC3 D. Neu IC3 L. Patrick L V E l A I ' . . . . . . , in A ? r P K EM3 R. Peralta Lf 103 M. Pine Fx f . . is i . lra ? I, 103 J. Robinson f 103 0. Rockett l IC3 B. Simmet IC3 T. Smallwood EM3 B. Thompson IC3 T. Vogel . 1 EM3 K. White I IC3 J. Wojcik EM3 J. Yates . FN J. Harris l 1 EMFN J. Jones FN J. Kinsler FN M. Larsen 'Nm f ' -3T e:4: '- 'H - ki SHAW? 'A ' - s.wl':'+1::1: ' E EMFN C. Larson EMFN K. Matzen ICFN C. Odor EMFN A. Rivers ICFN K. Schmoll FN K. Smith ICFN W. Tovvndrow FA J. Burnett EMFA T. Cvar ICFA C. Delisle EMFA T. Demski EMFA C. Golden ICFA R. Hamilton FA R. Ingram EMFA A. Presley EMFA J. Rybinski FA A. Saldivar FA J. Spellman ICFA J. Stigerwalt FA J. Swartley FR J. Hawley FR J. Husrnan ICFR K. J ameel EMFR S. Matzen ICFR L. Neal FR R. Slavin EMFR B. Smith F R . 3-3a.. .x 216 12 Repair Division is manned by Hull Technicians and Machinery Repairmen. The division is responsible for all production and repairs and is led by the Repair Officer, LT Mills, and the Repair Technicians Assistant, CWO2 Jones. Repair Division's production shops hum with the activity of sheet metal fabrication, pipe fitting, high pressure welding, and complex machining. The Hull Technicians and Machinery Repairmen are constantly on the go, answering trouble calls or completing trouble log requests. Their area of responsibility has no bound- aries, and their contribution to the ship's effectiveness is immea- surable. From unclogging drains to accomplishing complex welding, Repair Division can always be counted on to provide the best and most professional service possible as they answer an average 400 trouble calls each month. LT W. Mills LT G. Korhorn CW02 B. Jones HTCS K. Randolph T HTC R. Chale HTC M. Heath-Cherry MR1 R. Bruce HT1 R. Kern HT1 S. Orange HT1 L. Peiper HT1 S. Rawson MR2 K. Brocksome MR2 J. Jones MR2 S. McMeans HT2 W. Muse HT2 N. Rountree MR2 L. Vannattan HT3 W. Ashley HT3 R. Buczala HT3 W. Buskirk ff? 217 HT3 K. Convissar HT3 S. Davila HT3 W. Foster HT3 N. Frazier HT3 D. Hanson MR3 D. Haugan HT3 D. Hornby HT3 J. Martin HT3 M. McCoskey HT3 J. Rattenborg HT3 J. Rippard HT3 C. Simmons HT3 S. Slaven HT3 N. Smith 1'-25 D 11 L.........- R HT3 R. Standard MR3 J. Summers HT3 R. Westerman MR3 J. Wright HT3 J. Yasurek FN D. Boyd FN B. Daby FN J. Davis FN D. Ellen MRFN D. Ferdinand HTFN R. Flenker FN K. French FN J. Huntsman FN M. Jackson 54 J i IUQ- :Z .5512-11 , ff 219 R 2 FN M. Mathews MRFN E. McDonald AN D. Melancon FN T. Russell FN E. Soria HTFA J. Coleman HTFA M. Giesegh FA J. Loo FA J. Ness FA B. Parks FA L. Pascual FR J. Adolph FR J. Schulz FR J. Willimann l A f 1 f -2 .fygfg . 0' CO TROL-.. KXX J-ff!! The Damage Control Division is led by the Damage Control Assistant, LT Stewart. The Damage Control Division has the awesome responsibility of main- taining all damage control equipment as well as training the entire crew in damage control. From the machinery spaces to the highest level on the island, the damage control organization ensures that fire fighting systems are always ready for use. DC men and women maintain the 10 main repair lockers and 25 unit lockers well stocked and ready for the ship's 800-person damage control organi- Zation to meet any emergency. The Nucleus Fire Party CNIMITZ' Fire Depart- mentD, led by NIMITZ' Fire-Marshal, CWO2 Longmire, responds to all emergen- cies while the ship is underway. It is most comforting to know that well-trained DC professionals are ready, day or night, for any emergency. LT K. Stewart CWO2 P. Longmire DCCS T. Mason DCCS M. Thornton DCC D. Shook DC1 W. Charlton DC1 A. Cox DC1 C. Lindsay DC1 B. Norton DC1 A. Vogel DC2 R. Byrum DC2 J. Crump DC2 K. Flanders DC2 C. Hawkins in 221 DC DC2 J. Koch DC2 J. Martin DC2 D . Sabbe DC2 M. Sheets DC2 F. Tyson DC3 E. Derrnody DC3 D. Driver DC3 D. Fischer DC3 N. Foxley DC3 R. Gardner DC3 J. Hoang DC3 P. McG1ynn DC3 B. McMahon DC3 R. Medal DC3 S. Poradzisz DC3 T. Robbins DC3 H. Severin D f Q'-'ifg-v A 7, - f ...-....,. , ,,,- .. W 4 I I A DC DC2 D. Warner FN B. Bezler DCFN C. Burrows DCFN D. Fields DCFN N. Lake DCFN A. Talley DCFN J. Trosper FA M. Anderson DCFA J. Brower FA V. Harris FA T. Kallenborn FA J. Laney FA M. Manloye DCFA J. Mehling FA E. Potter DCFR J. Downs FR T. Perkins AR E. West Nm f 22 3 The Maintenance Manager, LT Stevens, is responsible for coordinating and managing shipboard maintenance by both ship's force and outside activities. He is also the repair coordinator for the assistance pro- vided to other ships in the battle group. Under his cog-nizance is the Quality Assur- ance Office managed by the QA Officer, CWC2 Longmire. The division is comprised of maintenance experts from a Wide range of technical areas. LT Stevens also manages the Maintenance Support Center. MSC fa- cilitates the shipis maintenance effort by providing a single point of contact for the ship systems support requirements Ctechni- cal manuals, repair parts, etc.D. The division officer is ENS Davis. Additionally, MSC is responsible for updating all ship configura- tion changes. LCDR B. Stevens CW02 P. Longmire MRCS D. Vergara SKC L. Gonzales DSl S. Earles MM1 M. Mcllhattan GMG1 A. Roach MM1 E. Simpson ABFI A. Williams HT1 D. Worley ABF2 M. Coar J ABE2 C. Cox SK2 V. Hoh HT2 D. Pellerin FC2 T. Robak EM2 E. Torres ET2 J. Toups MM3 R. Brooking IC3 S. Loconte HT3 B. Peterson ET3 P. Smallvvood ...A :P-' uw ,,, -M .L krxk j. The shipis 3-M Coordinator, LCDR Koth, is responsible for the management of the shipls 3-M program and the Zone Inspection program. The 3-M Office, under the direct management of MMCMCSW! AWD Benjamin, is responsiblefor the implementation of all facets of the 3-M program. The Intermediate Maintenance Management Systems Database, Maintenance Feed Back Reports, Quarterly Force Revisions, and NIMITZ' Zone Inspection program are all managed by 3-M Office professionals. LCDR H. Koth MMCM A. Benjamin DPC T. Ess YN2 J. DeYonge U3 X 0 '-': X fra' 225 The Legal Department, comprised of the Legal Services 0ffiC0, S9CU1'il5Ya and the? a des a system of Ship,s Brig, headed by the Command Judge . U u military justice, legal assistance to the command 1nd1v1dual servi B corrections, law enforcement and security. While the C rl? personnel are assigned to a six-month TAD billet, headed by the Security Officer provides a prc security and anti-terrorism professionals for the the A judge advocate, licensed attorney, CLNSJ and oversees legal services necessary for notary services, and general legal assistance. At is also responsible for the military justice system investigations, administrative separations, and a and out of CONUS. l x 1 3 1 I X 4 1 1 Q 8 wx J L Wigff ' 1' f LEGAL T . , . SERVICEQ . . . l The rimary legal resource for the battle group, the P NIMITZ Legal Services Office, provides a Wide variety of legai services. The professional staff of JAG Corps officers an Legalmen CLNSD are primarily responsible for maintaining good ' ' ' ' ' ' f the military order and discipline through administration o justice system. The office also provides legal advice to the command on issues ranging from personnel matters to accident l ' tance investigations and international law to claims. Lega assis is provided to embarked personnel in a variety of areas including landlord-tenant, debtor-creditor, and family and civilian court ' ' d t d't'on of matters. NIMITZ Legal Office maintains a prou ra 1 1 professionalism and service to the fleet. gf? l J F H Lt V. Brown Mr. P. Hickson LNC A. Guidry L YN3 D. Steele AN B. Coleman LN1 M. Conley LN1 K. Giles LN2 J. Anderson .X 228 1. W .Tsai L The NIMITZ Security Division is comprised of various ratings and paygrades, in addition to rated Master-At-Arms, trained to protect the crew and Ship' Staying ahead of an ever-changing security environment, the Security Division provides state-of-the-art afloat security programs, includ- ing patrol, crime analysislinvestigation, antifcounter-terrorism teams and physical security supervision. When deployed they serve Beach Guard duty, augment Shore Patrol, and serve as Command Customs Inspectors. p Their motto is, To Serve and Protect? As well as the Security Division, the Security Officer is in charge of the Shipis Brig Staff which provides corrections programs and super- Vjses a confinement facility for up to 17 prisoners. The NIMITZ Correc- tions Program strives to rehabilitate prisoners through a strict regimen of daily routine, counseling and general military training. The ultimate goal is to re-introduce the individual back into Navy life as a productive team player ready to complete their assignment or career with pride. SHIP'S BRIG .SECURITY XXX s l LT P. Treinen MAC C. Cooksey MA1 K. Bellomy MA1 D. Bowman MA1 E. Foss MAI R. Newcomer MA1 M. Sanders-Carter MA2 J. Cesario MA2 C. Hunt MA2 M. Lopez MA2 D. Rutherford MA2 J. Stewart MA3 J. Andrews MA3 A. Jackson YN3 L. Lazo SN A. Buccella X X . Y ffm S a d i 1 I 4 l Sea duty, the continued through afloat. In the Since the family Bell he eoft you B.C., and to duty as ships' the Marine on and from of the Navy one secretary. s expansion of the Marine the number of ships of the Navy carrying tour for the young Marine than in the past. Thus, 'key are not only embarking upon a tour for which embarlg without the benefit of advice from others unless h e most rewarding tours a ffmfm V' can be assigned to. It is an opportunity' continues. The is about one third security, machine gun and ceremonies. The noncombat evacuation Group ships. term United States by allies, and They are guiding bond our Marine, and is maintained by a set of X DET GYSGT E. Sirvent SGT R. Dombroski SGT M. Jones SGT M. Rominski SGT G. Willis CPL I. Barreto 232 .,,. - J. ., .-.hiin W wxff' Lv 1 ., V. f-MTj'j1TIl..w I I r f x 1 I r u 1 r I an--L A 5 5 ,s -. -P 1 f ju an c .',' A2 ' R va ' ag., .f, ,. P , 4 . 9 I 1 I I l Q f, x 7 f 50 MARDET CPL C. Hodge CPL R. Miranda CPL D. Thomas LCPL R. Brockway LCPL D. Castillo LCPL J. Childress N a-ss 233 iq Y MARDET 4 1 LCPL M. Childs LCPL J. Clayton LCPL C. Elliott LCPL G. Fairhurst LCPL M. Farr LCPL B. Greene LCPL J. Horvath 4, .,,, -' 234 7 ! Q 'Q ix . I l 1 1 ,, 1 1 MARDET LCPL P. Jackson LCPL L. Lambert LCPL J. McMil10n LCPL T. Owens LCPL J. Pierce LCPL S. Wischmann LCPL J. Wohlberg N . 235 providing highest levelof WestPac V Medical LCDR C. Izumiya LCDR B. Schulte LCDR D. Weston LT J. Burrell LT M. Quick ENS R. Espino LIQY A.. 238 wg! . V, .,- .,,, ffwafw +2 r Z X, 1 a U N Wye c x 1 I -,A:lf!?fQ...... ev' DOSE Medical HMC M. LaRose HMC B. Mullen HM1 D. Akers HM1 M. Roth HM1 L. Shepard HM1 M. Sweetwood 'Nm s ' . ,g-.,:,A,:-L-.,., V' '-'fE3?'T - ' ' -f .- - ':-..:g-- 'ZA ij'- 'fi-1' if 239 Medical HM1 R. Worster HM2 S. Bailey HM2 M. Barth HM2 Z. Hare HM2 S. Hessong HM2 K. Howell HM2 G. Powell HM2 D. Szabo HM3 R. Beverly HM3 M. Brown HM3 J. Croall HM3 C. Echeverry f 240 Yr? I , a M' X v Medical HM3 J. Gibson HM3 C. Hitchcock HM3 M. Kramer HM3 T. Leonard HM3 A. McCray HN M. Atkins FN J. Crumpton HN M. DuPree HN L. Kuhn HN J. Uridil HA C. Jacobs T5 - 241 'f51'f':PU,,, fx., Y ' ' , ' 57-H, , ' - w,M, wx., fix ,N A f ,4 ,A ,.,- .1 . .,, ,,. f, me ,,,,l., I , .AH fra! :gmw . 'ff ' 1 21, Q ' A' V , , , .4 -H4 ,Q . ,gf wi, , 1 . ali , P KW-' .gf7,2.4A4,,f, ,Q ., ' ' . , . n Ya, '- Y' ,. MM, ffl M g, . -V f I ,. V, E154 9 . ' ,, A f '- -'I M.-,,A,i.,, , xi-541 + Q- vtl fl, ,, 192 ., .14 2351 Q ' as 'iffgffxwgyf 4 fi qi 1 A 2' f ff . f Y ,Af f e,f,,9, V- .. - , msfwwi ' A 5? 3' ,J ff ff Ent' 7 sf ia 12,23 ' ' ' asf A 'f 1 fi? A +1 iq f L 1 fra -'C' 3 f a f 1' ga 1, gf I f S 5, :fn 7:9 'lf 524 2 F4 -1 if 1 f f' ff 1 ' fic, :Age fi ' if- i.':fs1QH0lz4ffi3'554,S3f' 13575 if . f ' 22' 14' ' aw if' X Af .S N 3 Q, 1. pix Ka A gf-Nr 'a+-N., -QW 3125133 '55, 155211. 5 I ff 1 mf Q 5' ' x Y N 'ZH Q is Wx: .5 if LT D. Ten Hoopen QMC B. Wass QM1 D. Galland QM2 R. Harman QM2 E. McClain QM2 P. Racette QM3 N. Bennett YN3 K. Everett QM3 F. Fox QM3 J. Hardy fl. f 3 244 A- ' Z 1 y , F ' TYR Q. Q. 2 ., , 'Q ...n . 51925 '---N jpg 'qgzl x I GV! E' f-,- ,. f . N, pf 1 . . r.f sp LEP, t 'i41 ,. if H ia- 1 '54 the Q 1 h X . 5 , Nav QM3 J. Hinnant QM3 R. Moynihan QM3 K. Penley QM3 E. Tatosky QMSN C. Faulkner QMSN S. Paterson AA T. Davis AA M. Fisher AA J. Woods N 245 E , J N V W1 G w I IND SMCS K. Lyons SM1 E. Bryant SM2 A. Anspach SM3 M. Cross SM3 J. Hage SM3 B. Mercil SM3 N. Noldan ' 4ef X41 E L 1 U HE i X 1 fa V 4 Ji 1' I , 1 L v f 4 1 CD W New NV SM3 J. Scott SMSN S. Shine SMSA C. Alvarado SA J. Fraley SMSA J. Pierce 'Nm SMSR R. MHIOSSIH1 f F Q O eratio ns I The operations Department is responsible forthe planning, Schedul- ilnggaitgtiggzoordinationnof nearly all of NIMITZ' activities ranging fr0m Pefsffn' nel, mail and cargo transfer to the interception and elimination of hostile aircraft. More than 400 personnel and 16 divisions provide NIMITZ and ITS escorts with many special skills and services which include professional photography, meteorology, and expert electronic equipment repairs. ' The Combat Direction Center employs personnel in the OS, AW, EW, and DP ratings to collect, process, display, evaluateand disseminate tactical information. The SUW fSurface Warfarej Module, EW fElectronic Warfarel Module, .USW lUnder-Sea Warfarej Module and the AW lM0dUle manage their respective warfare areas keeping the ACUOI1 Officer informed of the current tactical picture, The T modules, keeping from the various informed and The to provide and alrcrews and embarked techniques and disseminate valuable intelligence national commanders. Producing technical support for CVIC s and ff!! 1- my gl I l 1 I , f X 2 M, V 's3?f11fmf.,?'z' ,f ,, , , ff' 'l,1fa9fAz-Qef,f ' ,gykfiixgzyf f - V55 ' ,f'Ws?f1?'3fH,6Z25f.'yf. f' wx f , r X , if , X Q G . - I' 1 52451. . .N 1' ty I ,.M.z,-131.41 .,.,-,gfsg.f. ' ll 4- f ' g,ar:fci2a.ebt .aff ' ff-N-45f.,.35, - r 1 - -, .N , . .,,,, ,A ' t J 21322-wtf c. egg., , - ' ' ., 3' ' networks, the Information Warfare the numerous combat related information systems dissemination of both intelligence and within NlMlTZ is their vital charge. Scheduling information is distributed to the crew via 'daily Green Sheets, and weekly Pink Sheet which are Strike Operations. When a significant event happens on Operations Department has played a key role in its execution and reporting. ff ,Q , , 1 1 s x X f 4 I, 1 I I V F' 1 5 1 a R, F 1 1 L . ,jg , rl r gn 2' . my M74 H1291 9' I . ., F fvazyxayf u f . Egg, e, A ,Q 15 5 , V914 V , '3':'Xff,5 7,221 ,V 555, fl f 'wwf .A H .. ,, , 1'.:1:.:,p:4,wf':f: X4 . Mg .LN fffgfaffffiggag f if f ' 573 ,nKaQ55Qwi., 51, 35 , .w-fu .Sb .lnvigfy Ng-ff, 5 Agrxxi-Q , ,, ' ' wp Zn. f. 4 J W-V.-wg ,fv,,ffy 5,y:2,jff 51- ' 25:55 f f The Aerographer's Mates of CA Division monitor and forecast environmental conditions 24 hours a day. Precise forecasts, essential for plan- ning safe and effective operations, are provided to all units operating with NIMITZ' Battle Group. ln addition to forecasting the Weather, NIMITZ' AG's provide forecasts for atmospheric and oceano- graphic conditions that affect Anti-Air and Anti- Submarine sensors throughout the Battle Group. The weathermen and Women of NIMITZ collect and analyze oceanographic and meteorological data from satellites, Weather balloons, sub-surface bathythermograph probes and time-tested surface Weather observations. Whether it be at, above, or below the sea, NIMITZ, Weathermen and Women are always looking ahead to help ensure a safe and expeditious journey. LCDR W. Wright AGCS W. Stamper AG1 R. Carlson AGl C. Early AG1 G. Smoot AG2 S. Cano AG2 C. Martin AC2 J. Schorie AG3 K. Collins AG3 J. McLaughlin AG3 K. Thomas AG3 G. Warner AGAN M. Bierle AGAN E. Patrick AGAA E. Lucas AGAR J. Cummings i 1 1 w gl r OC Division is comprised of three major branches. Air Operations CAIR Opsl and Carrier Controller Approach CCCAJ from the Carrier Air Trafficc COntr0l Center CCATCCJ. The third branch is the Air Transfer Office CATOD. Air Ops is the nerve centeri' for all flight operations conducted on board NIMITZ. Flight plans are processed, aircraft data is posted and tracked,.lVIl'EDEVAC data is coordinated and emergency information relayed. Real-time decisions which affect the ship's ability to fulfill its mission' as the cornerstone of American naval power are made on a daily basis. CCA provides precise., timely air traffic control instructions which assist air Wing pilots in landing on NIMITZ' flight deck in any Weather under all conditions. Aircraft are separated and sequenced 24 hours a day using some ofthe Navy's most sophisticated radar systems by the Navy's best CATCC team. ATO is the smallest branch of the division, but it is a hotbed of activity. Through this office, all passengers, mail, and cargo e s arrive and depart , th hip when NIMITZ is deployed from homeport. CDR W. Collier LT D. Gray LT R. Ligon LT E. McConnell ENS G. Sodano ACC C. Cobb ACC T. Salter AC1 J. Crane AC1 D. Gustavel AC1 M. Macierowski AC1 D. Matherly AC1 M. Sparks AC1 M. Stevens AC2 A. Dangler AC2 M. Garcia AC2 B. Harmeling AC2 R. McBrien f AC2 K. Rickman AC2 E. Slota AC3 C. Arrington AC3 C. McClure Q AC3 C. Miller A A i i N ' 5 , , 1 , AC3 G. Neal AC3 A. Smith ACAN K. Goffney AN D. Matthews ' ' ACAN R. Scott A 1 X -. ,A Y ACAN G. Thompson ACAN J. Vincent ACAA B. Cowart L ACAA R. Lewis ACAA D. Lewis i ACAA T. Lott ACAA J. Medeiros ACAA J. Silcott ACAR L. Williams QTQL' --N. 252 i 5. ai, I DDC if f ix z GDC Division's primary responsibility is to provide the ship with rapid, reliable and secure communications facilities 24 hours a day, 355 days a year. 'llhe heart and soull' of ODC Division is the Main Communications space which is manned by personnel in the Radioman CRMD rating. The RMs are skilled communicators capable of properly operating a multitude of communications devices which support nearly all tactical voice and data communications between NIMITZ and members of the battle group, local area Commanders as Well as national command authorities situated around the World. During the 1995-96 deployment, the RMS typically Oversee the proper operation of more than 50 voice communications circuits and handled in excess of 1,500 narrative data messages daily. l . X t il' 1 tl a JW LT D. Mabee LTJ G C. Hallett LTJ G M. Jones ENS J. Hebert RMCM J. Nehus RMC H. Andreasen RMC E. Draper RMC E. Parent RM1 D. Conger N- an i: :fr GDC c T! . 254 u f RM1 S. Corbett RM1 J. Espinoza RM1 C. Finney RM1 C. Hansen RMI T. Mann RM1 G. Perkins RM1 J. Reece RM2 J. Andrews RM2 J. Boyer RM2 W. Cook RM2 D. Dang RM2 A. Duncan RM2 S. Fair RM2 W. Isom RM2 E. Light RM2 J. Quick RM2 B. Rose RM2 N. Rosedahl RM2 D. Sedgwick RM2 D. Villarino RM3 J. Block RM3 B. Crawford RM3 J. Decuir RM3 M. Dragotta Y i 1 1 5. V is Ti 1 w F l y W r i . 'i I1 . 4' 1 1 i n L 1 I i 1 4 1 L i w 4- RM3 K. Draughon RM3 M. Frazier RM3 D. Galloway RM3 R. Hagebusch RM3 C. Hinko RM3 J. Lane YN3 C. McHenry RM3 D. Monroe RM3 R. Moore RM3 R. Nicolai RM3 S. Owens RM3 J. Small RM3 D. Viera RMSN M. Fears RMSN T. Jones RMSN E. McGeachy RMSN J. Miles RMSA C. Boyan RMSA M. Homan RMSA J. King RMSA J. Mount RMSA V. Stoltz RMSR N. Werner 'N4 ' bl. A ' -Il-fel-4.22 'Q-- QS- 'gupm r ., A -X: f'-1-211: - F. .. : .I dvr-- ., I.-2 CDC If 2235 , Communications, Modern warfare requires sophisticated Command and Control U ' . Computers, and Intelligence CC4ID systems to plan, coordinate and execute Joint multi-force operations. These systems depend upon complex computer networks to provide the Planners and decision makers with the necessary tools to perform their mission. The C41 Systems Division provides the necessary support functions to keep the network systems functioning properly. ODJ is responsible for performing the daily administration and hardwarefsoftware support tasks. Supported systems include the Joint Maritime Command Information System, Contingency Theater Automated Planning System, Joint Deployable Intel Support System, Generic Front-end Communications Processor, DOD Intel Info System, Tactical A1I'C1'-aft Mission Planning System, Advanced Tactical Ana- lytical Communications System, Mission Distribu- tion System, Joint Elint Analysis Prototype, Statis- tical Tactical Information Mgmt System, Std-Tacti- cal Replay Elint Display, Tactical Info Broadcast Service, and TOPSCENE mission preview system. ODJ personnel are drawn from the Data Processing Technician CDP? and Data Systems Technician CDSJ ratings. The highly trained and talented members of ODJ ensure USS NIMITZ' C4I systems maintain the capability to support the Combat Direction Center, the various warfare modules and commanders, the Intelligence Center CMulti-Sen- sor Interpretation and Strike Plotl, Ship's Signal Exploitation Space, Tactical Flag Command Cen- ter, and other warfare operations-related spaces i? 7 I gather and process multi-source intelligence data, analyze tactical situations, and conduct airfsea combat. ODJ is responsible for maintaining sys- tems at peak efficiency, network configuration, operator access and security management, trouble- shooting hardwarefsoftware errors, and working with ODC to maintain connectivity with C4I sites worldwide. LT J- Mihm LT D. Sergent LT G. Vincent LTJ G P. Frederick 1 DSC R. Fajardo DP1 R. Chastain DP1 M. Gregoire DP1 G. Phelan DP2 R. Desormeaux DS2 D. Glover DP2 M. Labbee DP2 D. Mayle DS3 W. Ferguson DS3 D. Kubica DS3 M. Wall A in f jig- j.?':.vS -N 4 I I WI I I I P Il I 1 ii I ll 1-Eperations Electronics KOED Function is responsible for the maintenance repair and ca 1 ration of extremely complex and sophisticated combat systems. It includes highly-trained llmsgrlilliciains ripresenting five of the N avy's ratings. The function consists of 19 work centers, dl l ' g our istinct divisions, all under the purview of the Electronics Material Officer. The 1v1s1ons are Communications and Navigation Systems COECJ, Data Systems COEDJ, Radar and Television Repair COERD and Fire Control Systems COEMD. LT J . Falkner ETCS M. Rasmussen ET1 P. Moore Operations Elec- tronics Communications KOECJ is respon- sible for all maintenance and repair to the NIMITZ communications and navigation equipment. Our division's motto is you can talk about us-but you can't talk without us! OE02 - Shop 1. These hard-working technicians maintain all high-frequency radios, SAS secure red phone communications and all weather equipment. OE06 - Copier!Typewriter Repair. These IMS and ETs keep our office equipment up and running. With over 70 copiers to maintain, they often keep a hectic pace to guarantee timely customer service. OE08 - Mouse Shop. These ETS maintain a vast amount of communications equipment. This includes our flight deck mouse ears, satellite equipment, ship- to-ship, ship-to-air, and all wireless internal shipboard communications. Last but definitely not least, they maintain our Sprint telephone system, allowing the crew to talk to loved ones back home. OE 10 - CRFINAVMACSITACAN. This shop is responsible for the maintenance of all cryptologic, secure communication, message traffic, and TACAN equipment. OE14 - SINS. The Ship's Inertial Navigation System repair shop keeps NIMITZ' navigational equipment operating. They ensure we know our speed and location anywhere in the world. Additionally, the SINS shop performs the electrical safety checks on all personally owned equipment brought on board. g - LTJ G W. Johnson ETCS M. Jorewicz ETC M. Morgan ETC R. Muckley ET1 T. Bundgard ET1 S. Chapman IMI C. Vance ET2 T. Christopher ET2 M. Darfler ET2 S. Ferguson N f f'f: X tfr 257 OEC IM2 J. Grneallas IM2 K. Parker ET2 P. Perdue ET3 J. Allen ET3 R. Combs ET3 M. Cummings ET3 A. Diemunsch ET3 B. Griffin ET3 J. Groinus ET3 D. Kuzak IM3 J. Martin ET3 J. Merritt ET3 Y. Rael ET3 D. Ressue ET3 R. Rich ET3 M. Schiltz ET3 J. Smallwood ET3 W. Steach iii' --.. 258 7 ' 1 ig 1 M ! F if A as l s f ,. 50 .1 3 i ., G. , Ri V ., , . ' 1 '1 5 1 n 1 W is U I l 1 1 W 5 I i With skill and dedication the Data System Technicians maintain the Advanced Combat Data Systems CACDSD, Carrier Anti-Subma- rine Warfare Module CCV-ASWMD, the ever expanding J System - Joint Maritime Command Information System CJMCISJ, and a myriad of stand-alone intelligence gathering, collection and dis- semination systems. These are the hub ofNIMITZ, Combat Systems environment. Also under the umbrella of DSS expertise are the areas of Micro Computer Repair, one of the busiest shops on the ship, and the Battle Force Intermediate Maintenance Activity CBFIMAD Micro!Miniature 2M Repair capabilities for NIMITZ and her battle group. CED makes professional cost-saving repairs to electronic circuit cards and assemblies. LT M. Schleis DSC J. Carter DS1 J. Camper DS1 J. Jordan DS1 E. McFadden DS1 D. Vossbrink DS2 J. Brown DS2 T. Burnett DS2 M. Hollinger DS2 D. Miller DS2 C. Mills DS2 K. Rainer DS2 C. Rouse DS3 J. McKillop DS3 J. West N Q I The mission of the Fire Controlmen on board NIMITZ is to provide the last line of defense against airborne threats. Fire Contolmen are respon- sible for the repair, maintenance and operation ofthe AN XSPS-48-E 3-D air search radar, MK-23 Target Acquisition System, NATO Seasparrow Mis- sile System and MK-15 Close-ln Weapons System. The ANISPS-48-E radar, the longest-range radar on board NIMITZ, and the MK-23 Target Acquisition System are used to provide targeting information to the NATO Seasparrow Missile System. The NATO Seasparrow Missile System engages and destroys inbound air targets using the RIM-7 missile. Should the air target survive and continue inbound the MK-15 Close-In Weapon System would engage and destroy it using the 20mm Gatling gun. FCCM J. Miller FCC B. Miller p . FCC W. Quill i FC1 T. Carson - l -- FC1 M.. Collins w A l R. l J FC1 A. Crocitto g v l FC1 J. Foster i FC1 D. Will T FC2 K. Anderson A FC2 D. Bell . Fcz J. oorkhiii . ' FC2 R. Harris l FC2 E. McLaughlin FC2 J. Meeker i F D f 260 ff. OEM FC2 M. Miller FC2 T. Robak FC3 J. Bailey FC3 A. Fraser FC3 E. Jones FC3 J. King FC3 C. Lundgren FC3 M. Orn FC3 J. Rafferty AN B. Bright FCSN C. Robinson AR R. Eich AR R. Hanning FCSR J. Palmer 'Ng f 261 Opera- t i o n s Electron- ics Radar COERD Di- vision con- sists of three work centers that perform preventive and corrective maintenance on a variety of NIMITZ' complex and highly technical electronic systems. OEO5 is responsible for the navigationfairlsurface search radars, Identification Friend or Foe CIFFD, and the Radar Analog to Digital Distribution System CRADDSD. This Work center provides the ship with Keyes to safely navigate, identify long-range air threats, and provide a picture of the areal timev surface contact environment. OE10 is known as the eyes and ears of air traffic control The marshal radar CANISPN 435 is used to bring aircraft into a stack pat Cn final approach, course correction information is provided via bulls eye CANXSPN 413 and 1'16GdleS CANXSPN 463 Optlona automatic, hands-off landing capability is available The CATCC DAIR CTPX 42D provides air controllers with a myrlad Ofv information. The system includes a mission data recorder for replay of communications and aircraft approaches OE13, TV Repair, is the heart and soul ofthe ship's audiofvisual network for tactical and I entertainment systems. Manned by five Inte- rior Communications Technicians vvho pro- vide maintenance and repair to the Shipboard Information, Training and Entertainment CSITED system, Pilot Briefing C9TVD system, Satellite TV, Tactical Interior Communica- tions, and over 800 televisions. LTJ G D. Tinker ETC G. Bush V g ETC S. Moriguchi ET1 M. Decker ET1 S. Green ET1 E. J anuska ICI B. Lee ET1 G. Ormston ET1 W. Sanders ET1 R. Venem Denham ET 5g.. ,N 262 f i 'Q-' X i SX X M l K Y A N X R V .. J , 4 GER ET2 T. Hamilton ET2 J. Mateikat IC2 M. Zamora IC3 C. Dubocq ET3 D. Fox ET3 M. Phelps ET3 S. Pickett ET3 W. Sanderson ET3 D. Schauer IC3 J. Sullivan ICFA C. Servidio f f 263 OI Division is synonymous with the Combat Direction Center CCDCD, the tactical cornerstone of the NIMITZ Battle Group. Com- bat is manned by personnel in the Operations Specialist COSJ rating. The mission of CDC revolves wholly around gathering, processing, evaluating, displaying and disseminating tacti- cal information to vital command and control stations throughout the entire battle group. To accomplish their mission, OI personnel are re- sponsible for operating a myriad of detection, identification, and prosecution equipment asso- ciated with the Advanced Combat Direction Sys- tem CACDSD. Combat is divided into five mod- ules, each managing a specific area of warfare, Tactical Operations Plot CTOPD, Detection and Tracking CDSLTD, Anti-Surface Warfare CASUWD, Anti-Submarine Warfare CASWD and Air War. Each of these modules is responsible to the Tac- tical Action Officer CTAOJ for creating a clear and concise tactical picture of events surrounding NIMITZ. This enables the TAO to advise the Commanding Officer ofthe current situation and make decisions on how to effectively fight and defend the battle group. In addition, CDC is tasked with conducting Radar Navigation CRADNAVJ. Personnel assigned to RADNAV stations are responsible to the Navigator for the safe navigation of NIMITZ during periods of reduced visibility, negotiating narrow channels and when entering and exiting port. It is safe to say, being what many consider the heart of the battle group, OI Division is instrumental in nearly every evolution in which NIMITZ is involved, day or night. OS1 K. Luckett OS1 B. Meadows OS1 R. Navarro l CDR S. Ewell LCDR D. Swedensky LT M. Buttrey LT E. Stoffregen ENS M. Paul OSCS C. Pochard OSC S. Clevenger OS1 R. Butcher OS1 E. Carpenter OS1 M. Hvall OS1 L. Spink OS1 B. Swanson OS1 G. White OS2 A. Ashley OS2 R. Cavanaugh OS2 D. Conrad OS2 P. Jordan ? i i il L. '1 I I in i i X :',i,:. .,N- 264 q f OS2 A. Lamarche OS2 D. Landrum OS2 M. Shires OS2 T. Sunde OS2 L. Sushka OS2 C. Versteeg OS3 M. Adams OS3 T. Anderson OS3 R. Baird CI OS3 B. OS3 G. OS3 R. OS3 D. OS3 D. OS3 F. OS3 E. OS3 C. OS3 J. OS3 S. 4131 Bowman Carlson Dawkins Dawson Feil Forbes Foster Galdino Gallagher Gonzalez-Lago 'xt F CI OS3 A. Horn OS3 C. June OS3 R. Lee OS3 B. Lohman OS3 P. Martinez OS3 K. McBride OS3 R. McClelland OS3 K. Mitchell OS3 P. Murchison OS3 B. Nance OS3 W. Park OS3 T. Ruxer CS3 C. Schmidt OS3 A. Shure OS3 C. Watkins OS3 J. Wilson OSSN K. Black OSSN D. Brooks OSSN S. Bynum OSSN J. Casler 'ill 'Q 266 - E- l 3 I v r l l l 1 Qi. .. 1 lk , wr Q,...jE,,j, 5, -W ,M .Max 1... , .fn 1 13 . ta 2 f 2 f 'f fw f mfffy ,Q a t M 4 1 r CI OSSN J. Clark OSSN J. Cline OSSN T. Edwards OSSN A. Gaines OSSN A. Garrett OSSN D. Gibson OSSN G. Good OSSN J. Halfhill OSSN C. Minaberry OSSN A. Pecot OSSN K. Pisano OSSN E. Simms OSSN L. Skinner OSSN K. Stocker OSSN K. Thomas OSSA D. Archer OSSA T. Trickler OSSA D. Woodman OSSR K. Gonzales OSSR M. Tripp 'Nm f ': 2 ff' 267 The MFIVE STAR PHOTOGRAPHIC LAB is com- prised of 26 Photographer's Mates and four Illustrator Draftsman who support a multitude of assigned tasks for the ship, air wing and battle group. Operating two photo labs, the men and women of OP Division record the ability of NIMITZ and its air wing to project power. The main photo lab captures the action on the flight deck and the several hundred people required to ready the ship and aircraft for launch and recovery. .They alS0 document the everyday motions of people on NIMITZ, whether it's aircraft maintenance, cooking meals, washing clothes, preventive maintenance, dropping anchor, fepalfmg gear, re-enlistments, awards, promotions or public affairs photographs. The second photo lab is located in the Intelligence Center, providing support to the tactical air reconnaissance and surface surveillance missions provided by Air Wing NINE's potent team. t During this Western Pacific, Indian Ocean and Persian Gulf Deployment the photog- raphers of OP Division produced over half a million photographs in support of this mission, and the men and women of iii r I NIMITZININE. of The Photographers of OP Division truly maintain a amake it happenv attitude and are proud to be part of The Finest Photographic Laboratory Afloat. LTJG S. Norr PHOS D. Sevigny e . PH1 J. DeLoach DMI L. Pineda l x l i 1 I r x l I I l I 4 . I PHI B. Toney PH2 H. Coleman PH2 A. Isenhart PH2 W. Kipp L PH2 K. McDonald PH2 R. Norwood PH2 A. Pugliani PH2 H. Walsh DMZ H. Washington PH3 K. Brown p .... 268 I OP PH3 C. Conklin PH3 N. Guimon PI-I3 D. Harpell t DM3 M. Johnson PH3 C. McGuirk PH3 D. Menard PH3 C. Perkins PH3 C. Ware PH3 J. Watson DMSN S. Branch PHAN J. Fults PHAN B. Hylan PHAA N. Tower 'Nm S ': 14 ' iw - 269 Q Q Q CQ Division is composed of Electronic War- fare Technicians CEWSD Who both operate and main- tain sensitive electronic detection and countermea- sures equipment. The EW module, an integral part of the combat team, provides detection of threats to the ship and coordinates localization of threat emit- ters for the entire battle group as the Electronic Warfare Control Center. The Electronic Warfare module plays a key role in defending the ship by locating and countering inbound anti-ship missiles and other Weapons. LT D. Thompson EWC K. Wilson EW1 R. Cole EW1 G. Collier EW1 K. Kranech EW1 D. Potter EW2 T. Conklin EW2 G. Delsasso EW2 R. Hager EW2 A. Kitchen EW2 T. Pounders EN3 S. Bidwell - EW3 B. Grout FIW3 H. Wilterding EWSN J. Klippert EWSN T. Patterson rf ! . -f 270 if? . ,QV V l Q 1 w ie l l l l ' 1 l X l H OS Division, hidden behind the blue door, a small but vitally important element of the Operations Department. Hard-Working Oryptologic Technicians COTSD provide tactical indications and Warning to the Commanding Officer and embarked flag and air wing. Other duties include signals security, special communications and special security assis- tance in support of the ship and battle group, when deployed from homeport. LT S. Graham OTOC R. Faubion CTO1 J. Edison CTR1 L. Harris CTR1 R. McKee CTM1 K. Mitchell CTR1 J. Yates CTA2 J. Barnhart CTM2 G. Calebaugh CTO3 J. Hanscom CTR3 P. Rice CTR3 K. Schneider CTOSN J. Benson CTMSN B. Brown CTOSA S. Empson ': .4 271 i QT X Operations Training Division arranges, coordinates and administers the training of all NIMITZ personnel. They are tasked with the implementation of the formal school training pro- gram required to maintain readiness and profes- sional aptitude for the entire crew While homeported. Closely related to this is the neces- sary funding of temporary duty orders to accom- plisxh this training. The task of preparing these orders for everything from fire Hghting school to 3-M courses falls Within their realm of responsibility. LT T. Lindberg FCCS J. McLeod EW2 G. Figueroa T YN3 J. Furlong PHAN D. Wells X 272 if 5 I . ..f. A - - ....- ..,.....---.,.-.., -w-an---qv--.f 1 ...Z -. The Undefsea Warfare CUSWD Moduleis mission is to provide Antisubmarine Warfare CASWJ intelligence, tactics and Oceanographic environmental support to VS and HS aircrews, enabling them to detect, localize, track and if necessary, eliminate any Subsurface threat to our battle group. The professionals of the USW module are comprised of Aviation Warfare Systems Operators CAWSD and Data Processing T chnicians CDPSJ. AWs re d ' ' ' ' ' 9 i p pare an conduct preflight mission briefs, and perform real-time and postflight acoustic analysis and mission reconstruction. They assist on-station aircrevvs with tactical d t d ' J' A I I. 'x Q lil T Fi in i 1 i 11 4 ff!! QA . y t'r ' . .g. , 1 . If ' I ,ai fi :fi 4299 - ' ff- - V . .355 . 'I Z. V. V- . A J f' 'f 1' X' 4' I M x X p w ' : ui ,wg 'X ,aw ' ,fi 1 S' 1 1 Z' W In I! up a es an recommendations. To keep the USW Module fit to fight, DPs provide essential mission support by maintaining vital equipment on-line and linked to the Combat Direction Center. DPs also program and build mission data onto portable tape cartridge units for the S-3B aircraft's on-board computer. Additionally they are responsible for post-mission data extraction which aides in the recon- struction and analysis of each air ASW event. These professionals are keeping the tip ofthe spear sharp by remaining ready and able to detect and defeat any submarine that threatens USS NIMITZ or accompanying ships under her protective umbrella. 1 LT R. Bornemann ENS S. Gobar AWCS G. Kamberger AW1 B. Emerson AW1 D. Hubner AW1 R. Martin A AW1 M. Mullen AW2 J. Gill DP2 M. Kolberg AW2 C. Kuntz AW2 L. Leeman AW2 A. McCluskey AW2 R. Roberts AW3 A. Mathias DP3 R. Stencel AWAN J. Gomez AWAA T. David NT I 1 L lk .- l X .fi ff X f ox I .X X W nt I Ops Admin is the administrative nerve center of the Operations DGP-aftme . and team NIMITZ. The personnel assigned to Ops Admin produce a variety of reportS and material designed to ensure that the ship is always ready to fulfill its operational : commitments. The division is unique in that it is composed of a variety of ratings. The Q Yeomen of Ops Admin process all operational reports, maintenance casualties and hundreds of messages each day. They type all correspondence in supports of 16 i divisions and monitor all budget funding requirements and expenditures for the if department. Additionally, they process the personnel performance evaluations and officer fitness reports for more than 400 personnel assigned to the department. 4 i + I la f F 1 CDR C. Weber I LT J. Barnet LT D. Cutter LT B. Whitten L i 3 1 i OSCM S. Herron OSC F. Been I YN1 P. Duchesne OS2 N. Berryman 5. - X04 YN2 S. Olavere OS3 C. Flanders . Q . , OS3 C. Liesegang 1,p DP3 J. lVIcGillivray S 4 YNSN C. Ashley 1 , The overall intelligence mission is to collect, analyze, and disseminate intelligence information and products which serve to support ship, air wing, and battle group decision makers. Six distinct work centers G x comprise OZ Division: StrikePlot is an all-source intelligence fusion and analysis center maintaining intelligence data- bases, accurate enemy order-of-battle plots, and situational awareness to support organic battle ou fl et and 'oint ower projection operations. gr p' e J p Multi-Sensor Interpretation CMSIJ exploits intelligence collected from organic and national sensors and disseminates it in supp01'i of fleet, theater and national collection objectives. Mission Briefing and Debriefing CMBSLDD u d th d' ction of the air Wings Intelligence Officer, conducts aircrew mission briefings and debriefings, maintains maps and clrfaiil aid Hsovides any additional . 2 P . igaport related to air wing mission planning. Supplementary Plot CSUPPLOTD provides tactical indications and Wammg q13zWJ tstglgi e group including long-range detection and tracking of specific cont t h' h d ' 'str is the focal point for classified correspondence distribution via variousaliiiIigalcmaxijrifeinlaciiseaoihreatjfo die bqi131IigTr?1?eIIi?e1'i2e1iibrari6S, physical security controls and other intelligence support functions. , Specl lc C assl le 1 The Special Activities Office CSAOD is where the Joint Deployable Intelligence Su ort S t CJDISSJ resides The JDISS, - - . . I pp ys em - . I computeg sygtemllirovidies the carrier arid battle group with computer connectivity to other intelligence resources and agencies around Egfpifgicibanigf T353 15 3 Comp GX USIHGSS Which demands extreme dedication to duty and exceptional professionalism ffomi Intelligence Team is a strong, proven corps of just such dedi- cated professionals. CDR T. Dennis LCDR D. Cross l I I LCDR J. Hardy LT R. Clements J ENS J. Weatherwax OZ CW03 T. McMaster ISC C. Beitinger IS1 G. Fisher IS2 R. Ashburn IS2 J. Leslie IS2 S. Reilly IS2 K. Robbins IS2 K. Schmitt IS2 K. VVhitehead IS2 J. Widick IS3 J. Armenta IS3 S. Dykes IS3 J. Kean IS3 D. Kroft IS3 M. Lamar IS3 M. Medina IS3 J. Mullinax IS3 J. Phillips IS3 R. Pruitt IS3 L. Vasquez ISSN K. Bair ISSN J. Collinswo ISSN D. Kent ISSN J. Meyer ISSA T. Aubrey 'N4 rth f f i 275 8 x 'tau'- gf. 4 f ,A 5 , 'P ,L 4 2 'I vfzff l ' 'V L lf,-fflff-2 , .,,,,,4, , ,my ,,.,,ff,V,, V f 'W J 'Y f ' 6 , f. A iw , lf an efizfmi xfffwfzgm J, 1' 7 ff J , M, , MW., , , .L 21 N ' fic?-vWfl4?? 4n , ' -hiyffff' W1 - ,A , wfifwrlf 32 5-mfHx:z9mwffMs:,4i-,1'M 4' I zcwfw ga ' .4411-pf-24fWi,wM:'ff'7 2. 1 MU ,W ww flwfkvzm-QQQMMMV' , , Mg,,,,,yf4f.Q4 ,f.W,f,w,4.,,,,,f,f.,.xM1 fw-W,.ff- n,suf-fW,.,- wrww,,w.yf,fym : my--,f:i'p1'1,Q,'ffw,f2f.'K?yz12?'af v f' ' V, 'JM w141z.f2f2iiwL ,, ,wg yi wk w.:-z2' ,,,, Q .v 11:14 1f1z':':.e:f nn.. , If , Z ,V ,w'3i4wawfeA,:wf wg-ffz . yung ,M Wzfafw,-ff-frvgggpx : . 6:1413 w.,J'f9'.'4x-,I in 1, M Wizimii-7' f iyggmf, . 2 ,-f,a,g.ffgf, 7 '2W?wW 4 f M722 fu'4-'f +1f,h4,, , Y., . v' J 9 ., ff if, 1 f'fzi'?vzr,b7:,f' fic in ,fffv wwf ' NM ,Z-.M-7.-,Q-1vA,4'mfA'fJ J' Q, WSJ' wi ' 2 4 wyifm 1 Qgyyzifffiaz :F QfyzefL3 'vifhff fd 1' 1 Z,C.y9x4g iff? :hgh f'LM:,:' , 4McwM,'f'-'fx w..mff:fy ff ,,, , 3,4 my Q f,,f,,-,QM ,. 4,-, , .mf 1 f ,,f,,,,-fm., - M f wg, 4, -. ff-Q. vfff,,,,.f A M wwe- 'ww -,swf 1 Mafvvvi' 1. nf-2.-an fx 1' ' Q Ewrmgyf' gs .r, AL, ,X v-, 9361 A. . fgfs - fvzfj - T374 kr f wg., A I fi QQ A5195 1- ,, , :QL-nv ,, 'arf 3542- w ' '1-,gg Q. 4 MW a iqmvj ,f., ,.,,, ,, 7 ,A , pry uf: wf2f,f,,m,f,4-f :,fff:wW1f.y,.f ,W ,, , ,, , f , , f I 1 Q., , A jaw Ha s or and most of all a vital role in ensur- commitments and battle spaces are located deep within be felt throughout the ship. of the energy requirements for and domestlcq needs. The 400+ the department are highly around the clock maintaining the Navy's They serve Reactor Controls Division is responsible for the maintenance ration of reactor instrumentation and controls necessary to and ope maintain both reactors in a 100 percent operating condition 100 percent ofthe time. No time can be Wasted if RC equipment goes down. Itimust be fixed promptly and correctly the first time. The Sailors of RC Division are up to this challenge. Daily training and bi-weekly testing of personnel ensure that maintenance crucial to the operation of the reactor plant is accomplished flawlessly, regardless of the time of day. This rigorous schedule of training by day, maintenance by night often results in extremely long work days, but its personnel maintain high work ethics and get the job done expediently. LT R. Chen LTJ G G. Wieland CW02 T. Graham ETCS M. Fischer ETC P. Kinn ET1 C. Barber ET1 S. Castillo ET1 L. Ewell ET1 P. Holdorf' ET1 G. Howard . ' K 1 yg lf ll: lf? Q! H l R , l x L .Pi r ij V l l 1 i Y ET1 J. Lowe ET2 S. Bunz ET2 T. Castro ET2 P. Cook ET2 s. Daneli l 1 l 2 I l l 5 . ET2 B. Delp ET2 D. Donelson ET2 B. Evans ET2 O. Ferrari . f 278 q f R I i 6 1 wmv-'f f v -... 7 . 5 . i ' . , l L. , y ' E . A, . '-ff fm' f Nab ,-,..-7-r wjfv' 'HM' , , , . . f 3 I L f J L . ei? 1. w 1 J K . , .Q 1 ...L ffms Y i A ,Q . y . -,f . ,Y K RN,-'J l . l 1 , L hx .- . -v- RC EM2 G. Galbraith ET2 T. Guillen ET2 G. Hendricks ET2 P. Huizinga ET2 B. Jensen MM2 J. Kahn ET2 J. Ledda ET2 R. Long ET2 J. Marsh ET2 J. Martinez ET2 Z. Modrell ET2 J. Moller ET2 M. Powell ET2 M. Prescott ET2 J. Rasmussen ET2 D. Schwerman ET2 D. Stofan ET2 J. Stout ET2 A. Taggart ET2 A. Tuttle ET2 C. Van Daam N f r' 279 RC ET2 R. Winters ET2 C. Zvvierlein ET3 K. Alexander ET3 D. Barnes ET3 S. Bathke MM3 G. Boullester ET3 T. Decant ET3 A. Dunseith ET3 M. Fleming ET3 C. Jones ET3 S. Ledlin ET3 R. Nichols ET3 S. O'Melia ET3 J. Palacios ET3 D. Quimby ET3 D. Roe ET3 J. Slaughter ET3 L. Ventimiglia YNSN T. Campbell 1613 280' 7 4 ,si Reactor Electrical CREP Division is the team that provides the high voltage electrical power for NIMITZ. An integral component pf NIMITZ' combatbsystems suite, RE Division maintains, operates and provides the ultimate source of power for T communica lons, weapons, com at systems support, and engineering systems as well as the propulsion plants With the capability of generating enough high voltage electrical power to easily support our homeport of Bremerton and its surrounding areas, RE Division rides the crest of professionalism and enthusiasm 24 hours a day, 365 days a year. From routine daily upkeep to crucial corrective maintenance, R Division provides the power to get the job do , ' t ' ' NIMITZ th t h' h ' t d We are the POWER in NIMITZ POWER AND LIGHT! ne mam ammg e giiea Wars lp S e IS O ay. CW02 M. Wilcox EMC G. Baird EMC W. Bertwell EMC R. Gawer EMC C. Jones I EMC R. McKay EMC M. Nadon EM1 T. Beavan EM1 T. Brooks EMI R. Burggraf EM1 J. Coffey EM1 J. Lathouris EM1 B. Murphy EM1 D. Rhine EM1 P. White EM2 G. Ball EM2 L. Bash EM2 M. Bowers EM2 M. Brundeen EM2 D. Cialone EM2 S. Cornell EM2 J. DeForest EM2 A. Dickens EM2 M. Galles EM2 E. Grebel ta' 281 I I I 5 YI: IJI ,w Ig 1, .I I.. , I . ... II I II .. I . I I I . RE EM2 J. Grigsby EM2 M. Hotopp EM2 J. Hulsizer EM2 D. Lee EM2 S. Loret EM2 B. Lovell EM2 D. Meyer EM2 C. Michel EM2 D. Mihalik EM2 T. Naatus EM2 S. Nollette EM2 W. Novak EM2 C. Price EM2 A. Rauch EM2 M. Righi EM2 B. Rushing EM2 C. Ryals EM2 C. Smith EM2 T. Sterbis EM3 P. Bushong EM3 D. Cavanaugh EM3 T. Colbert EM3 S. Courtney EM3 J. Dreher . f 282 'V .WW A ' L RE EM3 R. Garcia EM3 J. Gardner EM3 P. Hartley EM3 E. Holcomb . .wA AvbVA4h EM3 M. Kehs ..-W i ..,. . A ,. ,. 'V,j4.,,..1,,f.w V , x ,I ,4,,.4,4 , ,.7.3g?3M5'k,Lr..,VV.A ,. , :V 1,51 i 1 - gy 414 'Q 5- L .1 , I , if ,J . M. , V, . ,-..- -1 .e , . ., 1, f f. W J , EM3 B. Kiley x E W . 5 ' . EM3 J. Knutson s I 1 1 . 3 L j EM3 J. Lin l l ' . EM3 M. Lopez . ,r.r 1 . .. f EM3 Y. Martin EM3 A. Oda EM3 M. Peralta EM3 D. Pettigrew EM3 C. Pick EM3 M. Piras EM3 W. Reulet EM3 B. Rice EM3 M. Sanchez EM3 J. Schmitz EM3 M. Shin EM3 T. Solos EM3 K. Walsworth EM3 D. Whitby EM3 W. Yarnell X- f . ...- 3 2 83 Reactor Laboratories CRLJ Division is responsible for maintaining the chemistry and radiological controls for the nuclear propulsion plants. These highly qualified indi- viduals perform their duties not only as Engineering Labo- ratory Technicians, but maintain Reactor Mechanical Watch stations as Well. MMC J. Fulton MMC C. McRae MM1 J. Havner MM1 D. Hodges MM1 T. Narr MM1 J. Roethig MM2 J. Austin MM2 P. Byron MM2 C. Chaffin MM2 B. Evitts MM2 S. Slabaugh MM2 C. Uher . MM3 B. Bafus i l MM3 T. Bradford MM3 L. Converse MM3 J. Costa MM3 C. Eddleman MM3 S. Egner MM3 G. Gallant MM3 M. Gratzer MM3 C. Hamel MM3 B. Moore MM3 J. Spencer T l 284 ff? Q' Elf 4 LT S. Barry Reactor Mechanical CRMD Division operates, maintains and tests the mechani cal systems of NIMITZ' two nuclear reactors. The men of RM Division Work, train and drill around the clock providing safe operation of NIMITZ' reactors, the largest of the Navy's nuclear plants. The motto of the mechanics of RM Division: Without RM the ship would be a cold, dark and quiet place. 'Q ,. ?:?...1n.. .N . ,. '- LT T. Shoemaker LTJ G D. Kiick MMCS C. Graham MMC D. Bentley MMC R. Campbell MMC A. Szumiesz MM1 J. Evans MM1 B. Golden MM1 D. Goodrich MM1 H. Grimes MM1 T. Hansen MM1 R. Hunt MM1 K. Kosier MM2 W. Bettilyon MM2 T. Bruce MM2 W. Chastain MM2 J. Clawson MM2 S. Corean MM2 T. Gehlin MM2 S. Harris MM2 T. Hersman MM2 S. Hill MM2 T. Jackson MM2 R. Johnson MM2 M. Lawrence 'Ng f 235 RM MM2 C. Martinsen MM2 R. Merema MM2 B. Midgarden MM2 G. Mullen MM2 R. Petty MM2 K. Privett MM2 S. Quick MM2 R. Reinhart MM2 D. Ruskamp MM2 D. Scheppman MM2 J. Sink MM2 E. Smith MM2 J. Styka MM3 P. Bardnowski MM3 M. Berberich MM3 G. Bias MM3 T. Bohnert MM3 B. Casperson MM3 R. Castens MM3 B. Conger MM3 G. Corbet 1225 , wif. -V N 6' 'Wi ft J 'Q .-.-15 'Z -E Ji' f T3 -g f 21' sv N 'Q .f ,.': . A L ff RM MM3 C. DuPont MM3 B. Giles MM3 T. Hansen MM3 J. Head MM3 M. Howell MM3 F. Kibler MM3 B. Lamont MM3 K. Maraffio MM3 G. McElmurry MM3 D. Montano MM3 J. Neumeyer MM3 R. Neuner MM3 M. Nikirk MM3 A. Ortiz MM3 C. Powell MM3 D. Reigle MM3 R. Rinas MM3 S. Stanley MM3 R. Tatuaca MM3 J. VanOoVen MM3 M. Williams X- f-': X 287 On this ship of ma.rvels, with its high-tech computer systems, roaring fighter aircraft, and complex weapons sys- tems, it's often easy to forget the basics. Whoever thinks twice when they drink the water? ls a second thought ever given when a person flicks a light switch? When a plane lands, do you know who keeps the ship at the right speed? Far beneath the flight deck, in the heart of the ship, Reactor Propulsion is the division that knows. These Sailors provide the horsepower and the electricity that NIMITZ needs continuously to iiilill her mission. In addition, these unsung heroes provide 400,000 gallons of fresh water per day and maintain the propulsion plants in such a high state of readi- ness, that the ship is able to meet any situation, be it tactical operations or routine transits. After a long day on y the flight deck or in the scul- lery and completing the mis- sion of the day, say dwell done to a Sailor wearing the NIMIIZ Power and Light ooveialls. LT H. Brady LT R. Ginn LT G. Prendergast LTJ G J. Markiewicz LTJ G S. St.Germain MMCS D. Frazier MMC W. Bentley MMC P. Bonkowski MMC S. Lowe MMC W. Pherson MMC J. Pyle MMC S. Ruelo MM1 R. Anders MM1 J. Colescott ia .fl MM1 J. COX g MM1 W. Dixon MM1 C. Ingham MM1 D. Lewis EN1 D. Munro MM1 K. Olson MM1 M. Simonelli EN 1 K. Spencer MM1 S. Thilmony MM1 L. Urwin MM2 P. Bailey . 1 288 1 .. r - 'Cx .-.Q- N., -I v ' ' '.-L' . ' v .3 RP MM2 K. Clark MM2 L. Claycamp MM2 S. Eddy MM2 L. Ellringer MM2 J. Hampton MM2 D. Hervey MM2 E. Hrubienski MM2 M. McAdam l MM2 T. McCoy . MM2 J. McEwen I . MM2 J. N eierich MM2 D. Opp .MM2 D. Pactol MM2 R. Rukes MM2 D. Schmillen MM2 R. Scott MM3 L. Archuleta MM3 J. Bacon MM3 A. Burch EN 3 D. Burk MM3 R. Burnham MM3 J. Coyle MM3 C. Cunningham MM3 A. Dodd EN3 K. Duncan MM3 G. Eldringhoff MM3 J. Erosky N fra' 289 l Z' A? MM3 K. Godwin MM3 D. Gosch MM3 J. Haiflich MM3 G. Hardrick MM3 C. Hiatt MM3 B. Hicks EN3 D. Hill MM3 T. Hoops MM3 J. Johnson MM3 G. Kahlke MM3 L. Kantorowski MM3 T. Kast MM3 T. LaBauve MM3 B. Lindmark MM3 M. Losey MM3 C. Norman MM3 G. Ocakanza MM3 R. Parker MM3 S. Richardson MM3 J. Rogers MM3 M. Rutland MM3 J. Spears MM3 E. Swanson MM3 A. Thompson MM3 T. Tuetken EN3 A. Villarreal MM3 E. Viuhkola MM3 J. Watkins MM3 C. Weiss MM3 B. Whitmer MM3 J. Wilson MM3 D. Zimmerma MMFN J. Flores MMFN P. Hoebing ENFN M. N unley ENFN D. Stamps FN D. Stasienko FA C. Archer FA J. Bartin FA J. Bean I1 N f f-Q - -I -fr. --1---1 , ,feqigjrv - -- If ' -f:rL-..-- A-'Tw RP fi' 291 K ,a A Qi y M 25,4 N it 1' , J 1, :V 1, ,Q ii '1. Q, 1 . 1 . W, sw, 1 Tffill rim ,g,, ,J-.y 'Vi Wil, 1 1 1 X , Hifi 11131 i , V, 11, IT iii 1 if ,w ,!,,I, VL' ,MJ ,. I wilt: sw! 1: 1 , mg! HV A -wa RP FA W. Bromiield FA T. Coleman FA D. Firewick FA P. Fisher FA J. Hamilton FA M. Heredia FA A. Hurst FA A. Jones FA M. Kerznar FA E. Klingensmith FA S. Kroohn FA B. Loop FA J. Mayorga FA S. Newey FA A. Pisciotta FA A. Switzer FA H. Wiggins FA K. VVhite FR I. Desrochers MMFR F. Telles A A TQ . 292 L A gif' l All nuclear operators must have specific training on NIMITZ Propulsions Plants. Reactor Training Division conducts the initial phase of this training. Additionally, the RT staff personnel form the core of the Propulsion Plant Drill Team, Which trains the plant Watchstanders on both operation and casualty procedures. 's 1 q , I 1 F l LCDR E. Izdepski ETCS H. Juneau ETC A. Osborne EMC N. Powell MMC E. Wildblood MM1 T. Cureton MM1 R. Florence MM1 P. Harvey ET1 C. Lorenz EM1 K. McQueen MM1 J. O'Rourke EM1 B. Tarleton EM1 K. Warren MM1 M. Whitten ET2 J. Charette MM2 D. Heuer ET2 R. Jimenez MM2 B. Krejca ET2 J. Larsen ET2 G. MacDonald EM2 M. Nelson EM2 S. Riga Nm f 293 RT MM2 R. Vidal ET3 J. Alcombrace EM3 B. Bergeron ET3 C. Brothers ET3 T. Coulter EM3 R. Dillow EM3 J. Fallon MM3 J. Forlow MM3 S. Goldsmith EM3 D. Holman EM3 G. Jacobs ET3 A. Kachirus ET3 B. McReynolds EM3 M. Raffke ET3 M. Sanguinet MM3 N. Scavone MM3 M. Sharpe ET3 R. Skimmyhorn ET3 D. Stevens ET3 R. Visness EM3 J. Watts EM3 G. Zwick 4 E1 ' Q -' -I4 2 :? . N ' Qi E 4 ,ig i '7 I . J w Y I I 4 l The Reactor Administrative Office provides administrative support for the 400+ enlisted and officers of the Reactor Department. They prepare and route large volumes of correspondence, evaluations and all other essential reports in support of the Reactor Department. The Reactor Administrative Office also serves as the nerve center for the department, where each of the Principal Assistants hang their hats. The Reactor Depart- ment Administrative Assistant and Reactor Department Yeoman accomplish their jobs as true N IMITZIN INE professionals living the ship's motto MNIMITZ: Teamwork A Traditionf, Also falling under RX is the Nuclear Quality Assurance Division which overseas all aspects of repairs affecting the two nuclear propulsion plants. Exacting attention to detail, professionalism and ability to provide and conduct hands-on training to the 400+ person Reactor Department are requisites to assignment to this division. Additionally, we skillfully manage the ship alteration program ensuring NIMITZ maintains the same modern stan- dards as our newest carrier platforms. The division includes RX09, who performs preventive and corrective maintenance to all damage control and life support equipment within Reactor Department. CDR C. Raney LCDR J. Creed i LT M. Boyd LT C. Engdahl LT L. Fransson LT W. Pedersen A LT M. Rice ETCM R. Walters EMC R. Kilian ETC M. Lindemann MMC T. Mclntyre , MMC J. Vanvliet MM1 M. Cook MM1 J. Meier YN1 S. Whitman MM2 R. Isgriggs YN2 D. Magee MM2 C. N ewbanks MM2 R. Rash MM2 T. Rudolph EM2 J. Wanner EM2 G. Wilds MM3 K. Dunlap ET3 M. Kite ET3 K. Randa EM3 B. Woods SN K. Mounts rfsr 295 H f,,,,,f , ,N f , WW, fjfpmf ,V ,f,f I ff ff 1 ,ZZ y :GW wdafiif f 4 f ff' ,,y,fy,fvrff,1!f any 0 f vyfffff MM , f f 3525 WWW 4: ,, M32 in ff ffflff wif, f, Mff fvffff ffA,yf,f, f , ffi 2 2f29gA44, ,ff 6' ff J' ff f M1 1 , fy 4, f fp f f6.fffi ff, ' f .1 Jiffy? fwffiffffw, Wf fy' ffm F7 4 egffwfi f . f, ,n,,,f,f,, A ., ,.,,, X, , , W 25,151 74Z1?W 3-.75 2f4QFf7ffQf,?LL153' 5 J 7 ' 5 QW' if , N' 'Q5fCf,gfWi:f LfQf7?7'13fT7fIj'5i'?EFlf,, M .. ff , - fi- 1-'rg iff Fit 4- JA M 1: ww::f'aa ? .g+ , ' Ai ' V -,LQ j 'Li . '11f'1wHM-1 ..,w.g,.,. ' A W ff' fdmgff 1 A 1 new-rr 2ffs.-nffzff :. 1- f Q 9x Religious lnlstries The goal of the Command Religious Program CCRPJ on board USS NIMITZ is to morally and spiritually the relationships of all Sailors and Marines to God and to another by: D energizing people with hope, 23 mobilizing the institution with moral 33 strengthening people through pastoral care, and 41 building community. The IS accomplished through the provision of quality Divine Services, offering of P . . . . fellowship opportunities, Religious Education studies work space vlslta ersonal growth groups, stress management seminars, values-based training, community projects and shipboard adjustment classes. 1 Other duties of the Religious Ministries Department include delivering approxl- 3,000 American Red Cross messages annually. Beyond the counseling support in of grief and anxiety, the department also assists personnel in the Emergency Leave This ranges from making flight reservations to providing a Navy Relief loan by shipboard Navy-Marine Corps Relief Society office to pay for the ticket. Religious is also responsible for the manning and operation of the finest shipboard i . An ' tor of over 9 000 hardback volumes, a Learning Resource n the fleet lnven y , Center and four Pace Two videofcomputer study stations attracts 15,000 visits from the NIMITZININE crew. The Library!LRC!Reading Room spaces are a hub for enhancement. At sea, the Chaplains and RP staff serve the entire NIMITZ Battle Holy Helo Religious services and counseling for 3 39, Religious Ministries LT P. Kanicki LT J. Thomas RPC J. Walker RP3 T. Dm-:wig RP3 J. Johnson RP3 M. Jones 525 --.. 298 7. ff. if 53.5 I r r ? V Religious Ministries RP3 R. Rodriguez SN M. McCarthy RPSN M. Mercado SN J. Salazar SN E. Shaw SA R. Craig N f riff' 299 rua m'f2f'2 v ,f V , 5,,M ,,j,,f ,V f . , fffzf xfzfH'3 ,f ,ffm f X f ,ffIf'-fxf,.f ' f, f H, mf A pf, ff ,M ,,, , fwgyfj, y , ff, wfuqif , ,, .mp ,,,,, fn , ,,,., ,, fyfff , 4 ff ,V,,f.Vf ,fy N, ,, , 5 , ,n , J, f f- , .fy fy f ! f W ,,f,,,g,f 29.5 , , wwf .,fff,., v,,, V ,, f,,..f,, , ,. ,,,,,,,, ,,,. fff, , , fr , f ,,'ff,f, H gf ,:,yf.vxi,f,w5 if ff an ,fx- xv fW,7Q? f,Lf1lZZ2f. Q22 fY,7 Lfff, ' , 7 f 042.02 ff V v,'f,f',y yy! f,2'ff'fwyff, fi, fi' ' ,f-,mn ny x- My X yn, -Q:-,-f,7,,p 0 , , ,, ,4,,,,Af.,,4- , I , ,4:w,fa,,wf 5 K H fc-'MW' ,J 'g2i4'.2v'zm'.y-,Zf,, , , w L . ,-ff: wafer, mfr' fcf, fn, 1 ,p,L.14f,'7,Wg, ,g',,,-fgffgw. f V f, ' f.,-Mp: f, I f, f ' 1162?-iffi, f V f m1,.1,, , ff f,54'5'f ww, 'wgivfvf W ff, ,J ,, nfffw, ' ,f 4 ,, 12 I ff'ff'? 2f'v7! ' ,,ff.,,L ,,', ff, ,',' ww. ff, ,., ,lf 437: ff,f-VV QW, 7 ,, , f t and run the C011- X V xx Q x , mn QM, 4. www- X ,. .- Nix zm.-Qxiigfxg. X K -S. -562' N - x ch . ' Nxiiix , ,. ,X.L,,, , X , , ,, 15: 5. X 1 , 5- T x. ,kr s a t Q--I lv., sw, ,. K Q .lfffwpvijfxb ,awww .- mar , n, 2151: . ,-ii, ., ,- ufwilr 'f pn- , .fa r 1 ,ffgg , V 'trim ' ,nfx,f,, ,, c'-IU.. . ,, -1544 x I fx qe,:a 5,:j, i'q gf ,4 -513, ,L A 1 ' TV' 'f i4 ,f'f ,im ,,L,,3, 'rf 3 , ' ' 745, WURJ. -:D ' ,. 1 '1 'l ,.,.- 1.-,ll . -2 V f fi'-f .'vi' 'H 'fI.:.1 V . 31, 5.,x x'4 ',. , f. Z -,I V A , 7, ,'j,g,:!Q ,I V nfl ' , -, W 1 54 J -, , , QW, , L3 ' 'gb '1 W ,IV -R xigyyiggff I ,-Q-: 1..,. frfisi ,Q Safety LT C. Kreager ABHCS M. Bemisdorfer 1613 302 DCI B. Barnes A01 T. Feck am. A -W' -gli Yifikrx K a ff H , Safety I I ,vii 'H , Af .W .,f,1 fl. 2 X-Wx f - fi 2 'Q ag -, Zaye-.14-,L x f 4.---P' 3 my. .r V ETI M. Madden BM2 P. Vasquez YNSR E. Frost 'Nm . f FQ ,PEQSE5-1 V. -' -'J 1'--all P4 fh- if 303 'ji I , , f 1 ff 3 Q' Y h I s A f I J 'T 1 xa .gx V, Q I ,ww 4. ' M2472 X 7 25251 4 1 ,915 in V V1 bz- 6 , , ' 66, .,, , A, .A , . ,fs 44 '. . f. uf wr. 1, W4 mf V ,f yg,f,f,f:,q,7y ,. fyzvff. uf v +4--4 ,f T 'viwfufz 'V 4-pq v n wg! '. I- . Q-. ZH a. 4 . ,-In ' Vp, Ml? -f T 4451 4, Q 'Q-, S. ,..,- N4 S I 9,- 4 Nh 'MX ...,..,,..e' -' '4 , . U fi 'uf - . , , ' x W Q. ,. 4 Q 'Y-,. 'fr-Putin, V - QV sv ff J ' z.,.w-L4 iw .Lv if , .,.. .. 0' A 5 .e- ,.. N 970 ...A .Na- 9 '- ' f 'Bl Lt' fzgf, Xrw vu w 'ilk 4 N-'q:.p.- l..,,. Z I Lu: hiifff. 132' . X, .X , .. f35X6'Sf-1 'TOR ' X X .Nix xQFXff.XX XXX ' . - K .XXXX-rw,-XX.h Q QN X..-PX. Wx -ff..- X .XXX :iff -L mc. wg . Xi: - , :XXQX XX. X X XFXXXXX-.X, XX: E 3. Y qi lf' .X -' , ll. - . f .X..Q. '+Xc-wwmxg X... . I X- . - - X .Ar . , . . . X-3'., ., i.f-Xsi. ' X X'-'XX' :X X NX , XI X X X - -:asf as f. w H ' XQXQ V X X - i5'?'4.HEfa- X X 0 X X X , X Q N' X X xx 4 XX X E X X N X. X. , ml.,f Y- . t .X 5 X xXXXXX.-- -1 . 'X .1 NX '-SX - X X -F L ...IQ 11 ' 'P .sf 2: ,gig , XX.Xj5g.?g,., f fi 5-sg-.ESA -' f x 4' ' S!! ..! X , v n .M4 '?fAi: Q ' 14 y rm 1 'f5'v, , A Eng 3-we-v .Y .A-,,7f'e1fl1e?l f 0 v. , F .ff . f , afar 49 .V 4 A Nix , .,,, ,ggi - ' u Q wh' u-nqgpqpqqp-...,..,,.,,,,..,,,,.,. M-0-M Stock Control Division CS-15 is the financial hub for readi- ness operations on board NIMITZ. S-1 maintains the accounting and reporting for the shipls 345 million operating budget and S250 million worth of ship's stocks. In addition, S-1 personnel perform a wide array of inventory management functions to ensure 87,000 line items of consumable, repair parts and aircraft components are kept in stock for maximum support of the ship's mission while underway or in port. - At sea, S-1 is a 24-hour-a-day operation. The storekeepers participate in underway replenishment, assist squadron AKs and issue Medical!Dental and Reactor Plant material from one of the seven storerooms in their care. S-1 ensures NIMITZ maintains maximum readiness! LT W. Baker SKC C. Harmon SKC P. Torrella SK1 J. Berg SK1 M. Mills SK1 J. Stuart SK2 K. Garrison SK2 E. Gloria SK2 V. Hoh SK2 J. Lewis SK2 D. Wieberg SK3 S. Huchins SK3 T. Kearns SK3 A. Ringaman SK3 C. Weil SN E. Fuentes AKAR C. Campbell SKSR R. Reed D -f --.:2fll.,, . fl?- :' 'A N 2' i K, N W bn I ff 1. 'V N Comprised of nearly 100 Mess Management Specialists and 200 Food Service Attendants, the Food Service Divisionis primary task is to provide superior feeding and quality customer service in support of more than 5,500 NIMITZ and embarked' Carrier Air Wing NINE personnel. They proudly support such facilities as the Forward Galley's Bistro, which features a popular Make Your Own Sandwich and Taco Bar. The Aft Galley serves up a variety of nutritious and wholesome meals with an emphasis on healthy choice alternatives and features a '4Build Your Cwn Pasta and Salad Bar. Ofparticular note is the monthly Special Birthday Meal and Ice Cream Socialsw which have proven to be quite popular with the crew. CW03 J. Lowden MSCM H. Bituin MSC D. Coursey MSl D. Abbott MS1 J. Candelaria MS1 E. Denison MS1 R. King MS1 J. Motz MSl G. Myers . .a .,,,,. . ..... .......,... , M51 W-NiCh01S011 f Y 5 x 1 T MS1 N. Salenga MS2 J. Gaither MS2 R. Hernandez MS2 J. Heywood L MS2 K. Hudson MS2 T. Kettelkamp MS2 A. Lopes MS2 J. McCarville MS2 L. Pierce . MS2 M. Randolph MS2 K. Shannon MS2 M. Smith MS2 M. Thompson 'f 307 308 S-2 MS2 Thorneycroft MS2 D. Wolcott MS3 A. Avila MS3 M. Bassett MS3 D. Bilderback MS3 J. Colton MS3 K. Curtis MS3 W. Freeman MS3 W. Gary MS3 L. Godwin MS3 M. Hanford MS3 M. Hardy MS3 K. James MS3 K. Kliesch MS3 P. McCon1ogue MS3 J. Nardinger MS3 J. Price MS3 J. Sulich MS3 A. Sykes MS8 G. Wagner MS3 D. White MS3 M. Woodman MSSN J. Aaron . - 1 ' .iii , - l'3?4' s---.. 4 .te ' V' H, s ll J Vx AL H V 1 H 1 N K S-2 MSSN G. Baker MSSN C. Barta MSSN D. Brown MSSN A. Burgos MSSN C. Daney MSSN T. Drabick MSSN M. Emrnert MSSN E. Hawkins MSSN B. Jenkins MSSN P. Kaplin MSSN M. O'Brien MSSN W. Pearson MSSN J. Pena MSSN M. Powell MSSN T. Rawie MSSN A. Tanner MSSN D. Winston MSSN B. Yoch MSSA M. Drohan MSSA T. Plumlee MSSR J. Chapman N 309 -pwugnq-nag-.,...,,....,g..... iallIIIIIIIIIIIEEEEHHEE!!!!!l!E!EI!!El!!!!!!!llllllI ' S-3 Division is the Total Service Division. It is the crew's main source of low cost, high quality merchandise during at-sea periods. It also generates considerable revenue for the ship's MWR fund. Ship's Servicemen, strikers and TAD air wing personnel operate the Ship's Stores, Vending Machines, Uniform Shop, Barbershops, Laundry and the Dry Cleaning Plant. Health and comfort items, SPRINT pre-paid phone cards, gedunk, and sodas are always stocked and available in all the retail outlets. Laundry is done daily with each division and squadron on board assigned specific days when laundry will 'be done for them. The division strives to provide the highest standards of service to the crew, directly impacting crew morale. ENS A. Trujillo SKCS J. Esteves SHC C. Castro SH1 B. Brink SH1 G. Embry SH1 J. Garber SH1 P. Lazarus SH1 J. Ong SH1 R. Ramsey SH2 W. Jackman SH2 S. Miller SH2 R. Musfelt SH2 J. Riche SH2 G. Sheppard SH2 F. Stratman SH3 M. Comly SH3 S. Crawford SH3 J. Espinoza SH3 W. Hill SH3 T. Kaufman SH3 A. Kimble SH3 G. Ryner SH3 T. Snider 310 ii? SH3 D. Stuart SI-I3 L. Wilson SH3 C. Yablonski SHSN E. Banks SHSN D. Carter SHSN J. Clark SHSN T. Crawford SHSN J. Dartt SHSN C. Hartman SHSN B. Hempstead SHSN M. Johnson SHSN B. Kelvington SHSN K. Lopez SHSN G. Melanson SHSN S. Parker SHSN J. Touchton SHSA M. Harding AA J. Heil SHSA J. Prince SHSA T. Woods .. Q3 S-3 -Pd llvv-vw-rl-Q---vw-Q--v . . as-fepv--vpn-4.-...v-.1 a,r..f.u-rp-.1 -..-... -,,,,.,,....,......-.yvs .,,.....-n....,,...,..,..,..,..,..,....,.,..,.- , While deployed the Disbursing Office maintains more than 5,500 military pay records, of Which 2,500 belong to the air Wing. The Disbursing Officer and 25 Disbursing Clerks, 10 of Whom are from the embarked squadrons, Work day and night shifts to provide 24-hour, seven-days-a-Week service to our customers. This service includes check cashing, changes to allotments, Direct Deposit processing, Split Pay Option, pay record TGVIGW, and individual financial planning. Disbursing also provides a 24-hour Automated Teller Machine service, allowing NIMITZ Sailors to access their money at any time, day or night. XX A., x ,fi gaF'mr iii if E3 il ENS P. Daily DKC F. Suie ' DK1 M. Hacker DK2 R. Bantug DK2 K. Church DK2 S. Dorse DK2 R. Edralin DK2 D. Manglicmol DK2 J. Matous DK2 Q. Moore DK2 J. Mulder DK2 M. Reagan f v- nf 312 15? X S-4 DK2 B. Vinluan SH3 J. Armstrong DK3 H. Auz DK3 A. Herron DK3 W. Prlce DK3 C. Szynal DK3 J. Valenzuela DKSN D. Lemmon 2 , .,, .4 DKSN E. Thurman SA S. Cador SA J. Darling DKSA P. Moorman Xa. f f-Q ' ' xi' - -51:1-L W4 -1- 2 4- fu' 313 ....,...,,.,..,, The Wardroom Division acts as a hotel and restaurant for the officers aboard NIMITZ. The two galleys provide over 1,500 meals each day, and the Wardrooms are a place to meet for both business and social purposes. The Mess Specialists create gourmet meals for distinguished visitors, departments, and squadrons. The stateroom crew cleans and maintains over 250 staterooms and provides full-service laundry and dry cleaning. The more than 100 Mess Specialists and assigned Food Service Attendants are dedicated to providing the highest quality meals and services possible to the officers of NIMITZ. MSCS D. Benoit MSC A. Brooks MS1 J. Creasey MS1 M. Flynn MS1 R. Ochoa MS1 K. Waddell e S 1 MS2 T. Hoffman MS2 P. Hopkins MS2 F. Hopwood MS2 D. Millard MS2 R. Miller . MS2 M. Rich l MS3 S. Benson MS3 E. Berry MS3 R. Clark -' 314 H 1.-www L S-5 MS3 K. Coleman MS3 B. Draper MS3 K. Gutter MS3 M. Jones MS3 R. King 3,5 MS3 J. Stanle S4 MSSN R. Alhson MS3 T. Horton MS3 M. Kosler MS3 J. Lewandowski MS3 J. Medina MS3 K. Pavledakes MS3 M. Roberts Y MS3 R. Taylor MS3 C. VanA.rnarn J 5 xnNwwpyW,m S5 1-G25 , l -' ' -2 A-,:.J1iQ,, , ff MSSN R. Bailey MSSN M. Cantwell MSSN V. Chaney MSSN J. Dawson MSSN R. Ebeling MSSN J. Hektor MSSN J. Letendre MSSN A. Morin MSSN A. Murphy AKAN D. Smith MSSN J. Tate MSSN M. Thompson MSSN R. Ulmer MSSN R. Wood MSSR T. Howard The mission of the Aviation Sto D' ' ' res 1v1s1on CS-65 is to maximize aircraft readiness, ensuring the NIMITZXNINE Team meets all operational commitments by providing the necessary parts and service to facilitate maximum air wing readiness. S-6 Division offers Aviation Storekeepers an opportunity to gain f . pro essional knowledge and experience in the entire breadth of their rating. S-6 is dedicated to increasing growth and professionalism through formal schools and on-the-Job training. During the cruise, S-6 Division processed over 40 000 requisitions and inducted over 10,000 components in the AIMD repair cycle. LT W. Rowan LTJ G D. Lefrak ENS F. Gasca AKCS S. Courtney AKCS A. Witherell AKC J. Bolduc AKC T. Ryan AKC D. Samuelson AK1 R. Ahuna AK1 A. Harris AK1 K. Morrissette AK1 R. Pagarigan SK1 K. Spoerle AK1 L. Strong AK1 J. Utley AK2 R. Brady AK2 K. Holloman AK3 A. Davis S f 317 6 Q3 , - ' -E ,7,:.fL,., . - , .5...m1 -.,, ' fi -2 AK3 J. Davis AK3 T. Evans AK3 S. Harris AK8 T. Smithson AK3 P. Taylor AK3 S. Williamson AKAN J. Chadkewicz AKAN R. Garner AKAN W. Richardson AKAN R. Walker AKAA C. Staples AKAR C. Bruno The Supply Department's Automated Data Process- ing Division CS-75 is responsible for the management, opera- tion, and maintenance ofthe SNAP III computer system. S-7 also manages the N IMITZ Shipboard Local Area Network, and all information security on board. The SNAP III system maintains the accountability of operating funds, supplies, repair parts, and repairs of the ship and embarked air wing. The division is manned by 16 Data Processing Technicians and three Data Systems Technicians 24 hours a day, seven- days-a-week to ensure maximum support to the NIMITZ! NINE Team. CW03 W. Hurt DPC C. Ross DP1 D. Bauer DP2 N. Downey DP2 L. Fletcher DP2 N. Jones DP2 J. Jones DP2 A. Keller DS2 S. Leeper DP2 J. Salazar DS2 J. Smith DP3 B. Schletty DP3 M. Turner DS3 P. Turner DPSN W. Aldrich DPSN R. Mawhinney DPSA A. Bicanovsky DPSA A. DeBouse DPSA C. Lariviere 'i'n 319 -.....,.....,.,....,.,...,,,,,,,.,,,,,,, Q- ..,.-........... .-..,.,.... - ' Material Division is responsible for the receipt, stow- age, issue and shipment of all material aboard NIMITZ. The Material Division team receives approximately 50,000 pounds of cargo each month via aircraft in addition to processing the shipment of over 25,000 pounds of outgoing cargo. Material Division is also responsible for inspecting and stowing approxi- mately 600 pallets of material a month that comes aboard via underway replenishment and in-port crane operations. S-8 makes more than 10,000 storeroom issues a month of general consumables and repair parts in support of air wing and ship operations. Material Division's dedication to these tasks has provided the supplies and equipment necessary to help main- tain NIMITZ in the highest state of readiness. LT M. Rayner LTJ G C. Nelson SKCM E. Rivera . AKC D. Beard AKC G. Esquela AKC M. Morse AKC C. Norcross SKC L. Tawiah SK1 M. Conley AK1 M. Emanuelson SK1 R. Hastings AK1 A. Jaime SK1 R. Nunez SK1 C. Nunez . SK1 N. Samonte AK2 H. Capatan . l SK2 D. Edwards AK2 R. Genschorck SK2 R. Jones AK2 A. Kahler SK2 S. Kiss 320 9-7 S-8 1. AK3 T. Kern SK3 K. Knight YN3 B. Nakagawa SK3 D. Schlag SK3 E. Williams SKSN K. Browne AKAN L. Dunn AKAN M. McCook AKAN B. Mehlick AKAN J. Ristvet SKSN S. Veile AA M. Roberts AA E. Shaw AA D. Tolbert AR J. Carey AR T. Cavazos SKSR D. Holt AR S. Short AR E. Smith AR J. Stinchcomb AR F. Thorne N if 321 ' - '- 'w- -f-v--vv- -.-.-v,4v-wnr-..- ....,.--,,,.,.-..,.-.. ,..,.4...,,, , , Z LTJ G A. Chopek AKC K. Schofield AKC L. Welch SK1 W. Ruskamp SK1 G. Skerstad SK2 C. Ballman SK3 V. Cain Our mission is to provide our customers with the right material, iT1f0f'If1f1'CiQH, and services inthe right place at the right time. S-9 is responsible for the procurement, requ1S1l910Tl1I1g and expeditihg of N all Sin ,S CASREP NIMITZ Hot Parts List, Open PufChHSefN0H-Stock Numbered Items, and Direct Turn i P f . ' tg, All contracts and service requirements including port services cboth 5 S 9 5 Over to customer requiremen . , . U d th th bhu - ff' 'i foreign and domestic? are S-9 Division's responsiblllty '50 Pfofllre ang 9 en gay Gi 1 .NIMITZ has an assigned Repair Parts Petty Officer from each of the divisions. - con ucts a ul training, qualification . . P tt Officer. The ships controlled equipage inventory is also 1 and testing for each Repair Parts e y maintained by S-9. l AKCM G. Giron AK1 J. Baker AK2 J. Emerson SK3 D. Riha AKAN K. Norton p m f 322 f f 1.,,,.,,.-J K z f Supply Quality Assurance Division personnel have a major role in the Supply Department. They provide the Supply Officer with an independent review and analysis of performance indicators and assist 111 determining the causes of below standard performance. The division monitors various Supply Department funC1Ii0I1f, ensuring proper procedures are followed and data 15 processed within required time frames. 33 incl. Ulu Tu. 3181 L I ill lm, im? Ill , Through rain or sleet or snow or the sands ofthe UAE, the mail must get through. The crew of the post office handled a half million pounds of N IMITZIN IN E incoming and outgoing mail, sold a million dollars in money orders and a quarter of a million dollars in stamps during the Arabian Gulf and WestPac cruise of 1995-96. Seven days a week the Postal Clerks exemplify Readiness Through Service. PCC L. Burk PC1 D. Keillor PC2 W. McDowell PC2 J. Palmer PC2 R. Shirley PC2 B. Tommerdahl PC3 L. Alvarez PC3 K. Ingram PCSN A. Bailey PCSN D. Beam PCSN M. Burks SN R. Canty V 1 3 I X 4 , 1 i A l I, N v f i 'A 14 V .-,. 323 , LTJ G W. Adams SKC K. Allred SK1 L. Gist MM2 R. Barrett SK2 J. Brown SK2 S. Murray AK3 C. Dotson SN S. Dudley PCSN T. Lovette SN D. Schuerch AA G. Pennini AA J. Winscott FR T. Henry AR J. Pepau , .. v f L V 'E -ii-fi . . 2335 --Y-N. 11,52 -- V fl ,-1 . 4 Program. This program is designed to prevent injurje ersonnel and the environment. The material consists 01 . Hammables, combustibles, corrosives, acids, toxins, oxidizers. The division stovvs the ship's Hazardous Ma in 10 storerooms, issues Hazardous Material from the . P The Hazardous Materials Division consists of rsonnel responsible for managing the Hazardous Mate ardous Material Minimization Center trailer in Hangar 3, and tracks all containers in the various Work centers. T or disposal. I' . fu X 23 rlal s to and teria Haz Bay he division is also responsible for the proper collection and segregation of excess Hazardous Material for reutilization The MWR Division supervises two aerobic and two weight lifting gyms with over 100 pieces of as well as other exercise equipment throughout the ship It is directly involved with the organization of tours hotel reservations activities and thl t' b th ' ' . ' 3 th t , Then Involvement In other Ships proglams includ tra Ce ics on o e in ramural and varsity level e e aptain's Cup Competition, the Cruise Book, Family Day Cruises, BINGO, all-hands holiday parties and Steel Beach picnics. Mr. R. F roelicher RM1 J. Espinoza GMGI G. Gonzalez EMl S. Hawk EM1 D. Rhine IC3 M. Baker AT3 C. Geschwell MM3 S. Reinhart SH3 R. Wood AN J. Bronson S-14 Division provides five-star service for the Chief Petty Officers aboard NIMITZ. The galley serves approximately 1,200 meals each day at sea. Special meals and cakes were presented for the observance of various holidays and special occasions such as Christmas, New Year's, Martin Luther King's birthday, and a special visit by the Assistant Secretary of the Navy. The twelve berthing areas assigned to 348 Chief Petty Officers are cleaned daily and laundry is picked up twice a week. The nine Mess Specialists and 33 Food Service Attendants are proud to serve and contribute to the finest Chief Petty Officers' Mess in the fleet. AOC D. McCloskey MS1 S. Buenaventura MS2 A. Gomez . MS2 C. Hodge MS2 R. Johnson MS2 M. Landry MS3 E. Miller MSSN R. Lunetta MSSN J. Santana MSSA R. Afalla xg 'i :A 'tr' 325 I-1 ,x, w cw ,V-V N 1 V l I , fx i wi Vi , ,N l 11 l 'i i 1 ,ff y Z! ii' 32' l ,Isl , m1 H? Q! ,ag li 1 , x , ii W My '1 5, k, , 1 53 1:1 NZ , mi S Q l , r , 'IN , 5 . if Wg, fl? ails N ,n ww 1, If 4! 1' k if yi i I, I 1 4 I Wx? M4 ,, fl' 15 f ' , All , V rl ww 4.1 I 'I L, W J ' ,,,,f M 1, ,, , ,, , 1, IA! 'I X, 1 ,, i I ' ip? L EI E, 1 1 ' 2 1 Eggs ' fl! 'w M , :H xl' N1 my A W if wx-1. Wm W H1 ?fi3iE !i2gg2 na we KSU' QW- mss i HSV Miki mxsx armz,I,if2N The men and women of Weapons Department provide the NIMITZXNINE Team with the munitions that put the bite in the team's bark. Composed of six divisions plus the EOD Detachment, they requisition receive stovv inventory breakout bl t ort d ' y 7 a 3 7 assem e, ransp , an issue all ammunition for the ship's company and air wing personnel. That includes all bombs, mines, Cartridges, bullets, missiles, grenades, special munitions, and demolition charges. They initially stand and coordinate mine t t h s and th F ll lookou wa c e man e u bore Stations, they dive,' the magazines and elevator pits. They are on the flight deck for all air operations and maintain the transporters and bomb skids. VVhether Yeoman or Gunner's Mate Aviation Ordnanceman or T0rpedoman's Mate, Machinistis Mate or Electrician's Mate, this 260-person department takes pride in its motto, WE ARE THE ARM OF THE FLEET? Weapons 'rw ' x, l 3' X 2? ,fl is ,7 , ,,,, N I EI sa- ' G-1 is divided into two crews. The Hangar Bay Crew is responsible for maintaining all electric forklifts and pallet jacks. The high quality of their maintenance ensures the safe transportation of ammunition throughout the ship. Additionally, they are tasked with the safe and efficient transportation of bombs, missiles and other types of ord- nance items to, from and about the hangar bays. The Flight Deck Crew is responsible for the safe movement, issue and receipt of ordnance on the flight deck. They remain con- stantly aware of which aircraft are loaded and the quantity and types of ordnance they are carrying. CW02 J. Barlow AOC D. Ketchum AOC J. Williamson A01 T. Gaskey A01 L. Johnson l A l A01 M. Kihlstadios A01 G. Koupas A01 P. Woods WT2 M. Bell A02 A. Houck A02 N. Mitchell A02 T. Prunick A03 T. Farley A03 R. French Aos R. Hill Aos J. Holly A03 J. Maudlin A03 W. Menendez A03 B. Piro A03 K. Wenbourne AOAN M. Baleto AOAN R. Castetter AOAN R. Davis AOAN E. Heckert AoAN D. Lowdermiik L c Q . l?i'S' ' 328 3 G-1 AOAN B. Lunsford AN C. Meyer AN C. Steward AA B. Dekker AOAA D. Erickson AA J. Hussion AA B. Jacobsen AOAA W. Knight AA R. Lucy AA L. Mack AA J. Millar AA D. Sheriff AA H. Smith AA T. Watkins AR W. Baker AOAR S. Detwiler AR D. Dickerson AR M. Escoto AR L. Evans AR D. Lakeman AR A. Massey AR T. Monfett AOAR T. Vinson X, 5 ' . in-4 329 ....,..........,,,,,..,,. . W... CWO4 L. Ginn GMC M. Hurtt GMG1 A. Roach GMG1 R. Salazar AO1 D. Strong AO1 D. Vanmeegroot A02 B. Bunch GMG2 C. Erickson GMG2 S. Nichols GMG3 D. Boltz TM3 A. Chamberlain GMG3 B. Daugherty GMG3 C. Hoefling GMG3 J. Jackson TM3 C. John GMG3 J. Kross GMG3 C. Loar . -' 532.5- ,Xu 330 7 i Home of the 'cReal Gunners, G-2 Division consists of the Ship's Gunner, MG TM AO LCPO and 34 ofthe best darn gunner - men and women G s, s, s, SN and AN in the United States Navy! Primary responsibilities of G-2 include manning the Ship's Armory, maintaining all small arms, and repair and maintenance of 40 magazine sprinkler systems. G-2 also familiarizes and qualifies naval aviators and NIMITZ' crew in the use of small arms. Controlling access to magazines, responding to breaches in security, and providing line gunnersv for underway replenishment are but a few ofthe many responsibilities that G-2 upholds. From their stand and deliver .50-caliber philosophy to their can-do spirit, their's is a commit- ment to excellence. it 9-7 ? G-2 TM3 J. Moore TM3 T. Moore GMG3 L. Taylor AN J. Brown AN J. Hinton AN S. Kerr ADAN J. Lockridge AN K. McClain GMGSN C. Muse AN R. Oliver AOAA L. Bellamy AOAA G. Leverton AA J. Maricle AA C. Poland AOAA I. Smalley AA S. Szych AR R. VanMeter AR R. Velazquez N rrnn 'fr' 331 4 G-3 Q Excellence in performance! The true measure of material readiness and operational performance... responsible for the upkeep of the ship's Weapons magazines, receipt, stowage, handling, assembly, and disassembly of conventional ordnance, G-3 established the standard for the Pacific Fleet. The combat capability ofthe NIlVIITZ!Carrier Air Wing NINE Team is truly recognized with G-3's ability to flawlessly build-up and deliver conventional Weapons to the embarked squadrons to carry out the mission. Are our standards high? You bet they are. AOCS S. Shand 1 r AOC D. Bass 1 AOC T. Lane 1 A01 D. Brandenburg A01 T. Brook A01 R. Harris . A01 J. Hauer A01 D. Johnson A01 P. Kerrigan 1 A01 V. Koenig A01 S. McClelland A01 E. Moore A01 A. Rafanan A02 M. Cooper A02 P. Ferrante li . . -' 5:bg' N.. 332 7' G-3 A02 D. Graham A02 S. Manderbach A02 K. Quary A02 R. Richardson A02 R. Strittar A03 V. Avery A03 J. Brooks A03 B. Doten A03 G. Hickman A03 A. Horton A03 W. Krock A03 T. Martinez A03 G. Martinez A03 C. Ranallo A03 J. Raney A03 B. Rundlett A03 S. Sanders A03 E. Sauceda A03 J. Staffard A03 J. Way AOAN J. Boberg AOAN J. Bussell 'xl , ' A 3 333 G-3 i AOAN M. Cantu AZAN R. Cristo AOAN C. Davis AOAN C. Davis AOAN M. Gaynor AOAN R. Gonzalez AOAN J. Haley AOAN R. Hintz AOAN M. Ingham AOAN J. Jones AOAN E. Kness AN R. McKissiok AOAN A. Quick AOAN R. Ritchey AN R. Shaw AOAN T. Shepard AOAN S. Vasaturo AOAN K. Woodel AA R. Degracia AA E. Finke AOAA G. Ford AA G. Hartwig -g I 334 .5 of 1 . 1... ,,1,, .,..g,ff5?,,.f.f.z-u,M,.,,.,.,.,,,,,,, L.. I f ' A ,, I f Mi .....Mvf,,ia 'Q:,jx, yy! V V' V frnfff. . df X N , , .A A M, A, Z , yfgfmjr I 1 ,I H . ..-. .,.,,, I- fr .. ,-.L ff, .,.,.., A .fi ' If J 'SN if tty? I I A, fm Q 1-.i E . 5 G-3 i ,....,. l Q JP ' .J SQ!-1-,Yxf AA B. Ivory AOAA E. J antz AA W. Jasper AA J. Linskey AA D. Nelson AA S. Reed AA M. Sareny AA J. Wainwright AOAA R. Wall AA M. Tempier 4 AA A. Woodall AOAA J. Word AOAR S. Barnes AR M. Bowes AOAR G. Dehart AR D. Fabian AR R. Gosselin AOAR J. Handy AOAR B. Hargrave AR W. Manning AOAR W. McGaWan E AOAR P. Ross N xr., ': .A 'fa' 335 l . ,...--.,,u,,n.l,-,-,.W--- I ,..,..........,,., G-4 Division is solely responsible for the safe and efficient operation of 10 weapons elevators on board USS NIMITZ. The division is comprised of specially trained Aviation Ordnancemen, Machinist's Mates, and Electrician's Mates. Their duties include preventive and corrective maintenance on the elevators and their associated hydrau- lic power units. Additionally, G-4 Division personnel provide training and licensing for all departmental operators and maintenance person- nel. CW02 R. Sullivan MMC R. Argillander MM1 A. Baker AO1 M. Hawkins EM1 D. Keller AO1 N. Stewart EM2 T. Averitt MM2 K. Delikat MM2 J. Gray EM2 L. McKinnon l w 1 t , Y A 3 r , MM2 V. Mitchell AO2 W. Morrison MM2 T. Thomas A03 K. Haywood AO3 R. Kurnp AO3 D. Miller AO3 A. Robinson A03 M. Wiederstein AOAN R. English AOAN J. Hunter AOAN M. Stilwell AA R. Bradford AA S. Choisser AA T. Fitzgerald -AA D. Johnson 336 , i f 1 ' -2 -wyyig. '-'Qgl-?,msl -.N G-4 SA R. Norris AA J. Parker AA R. Sherrod AA S. Simon AA J. Vanalstine AA A. Wunderlich AR B. Adams AR E. Carson AR M. Dunklin AR J. Frede AR W. Ga1e11a AoAR C. Ray 'NA 3 .- 3 :-.-::-4 'DC AR B. Temple ff m A -...p,...,..-....,...,,.......,..,,. H ff' .X X G-5 Division consists of three Work centers of highly experienced men and Women combined to form the nucleus of Weapons Department. Ordnance Control is the nerve centerf, They direct and coordinate the breakout, assembly and delivery of all Weapons required to support the embarked air Wing, ship'S COIDPHUY and Marine Detachment. Strict accountability must be maintained at all times for all ordnance, Whether it be 20MM ammunition, 500-pound bombs, or the most sophisticated missiles. This task is achieved by the Ammunition Accounting Work Center. It is a demanding job with no room for error. The Quality Assurance Work Center guarantees ordnance material of the highest quality is provided as Well as ensuring consistent, quality repairs and maintenance of our equipment. They accomplish these goals by providing technical guidance and quality assurance direction through internal audits and in-process inspections. The sailors of G-5 stand ready to respond to any task 24 hours a day. 1 ctw LT M. Price AOCS H. Marion AOC G. Ramsaur in 1 A01 T. Gast A01 T. Hosler A01 E. Larson A01 S. 0'Leary A01 T. Pritchett A01 P. Raymond TM1 J. Tomko A02 J. Bauer A02 S. Pautler A02 E. Ponce A03 M. 0liver fllf- ,XY 338 ff? -' L aww- T G-EOD l Explosive Ordnance Disposal Mobile Unit ELEVEN Detachment THREE ONE is f NAS Wh'd rom 1 bey Island, composed of an Officer-in-Charge and five technicians. The detachment is under the operational control of COMCARGRU SEVEN to provide EOD NIMITZ B t 1 G Services to the a t e roup. For EOD support to N IMITZ, the detachment Works under tactical control of Commandin 8 Officer, USS NIMITZ. The detachment's primary mission is the location identification renderin safe r c d d' 1 f , , g , e overy, an isposa 0 .p explosive ordnance which has been fired, dropped, or placed in such a manner that it constitutes a hazard to personnel operations At th d t h l or material, sea, e e ac ment is ready to respond to potential ordnance problems associated with flight deck operations. The detachment further provides diving and demolition services to the battle group when needed. . k A R L LT A. Guziewicz AOC R. Burrington BMC K. Morgan GMG1 P. Grubb BM1 R. McCormack EN 2 R. J anneman N A viva-12' 'rQg3i' s .XA - - Jr'--.--.1: - ,. .EA ---'cf ff 339 g i . .. ...,,.,.,..i,,..,........, ,..,..n....,. ..... U l ,1 il ii ll i 1 : 12 li If w 5 F E i r 3 w 5 V ,. is I! ! i s L ii I2 ,T 11 ll 5 1 in l Z r i 1 l 4 .- WD Q Q Weapons Department Damage Control Division is unique in that NIMITZ is the only aircraft carrier Where all departments have a separate division to address damage control issues 24 hours a day. The division responsibilities include preventive and corrective main- tenance of damage control equipment in 231 spaces Within the department. ENS P. Davis A01 A. Pesavento to D iill 4 A02 K. Higingboth.-am A03 F. Coats t ip r l l 1 l i E l I AO3 D. Hughey ' TM3 D. McNulty F AOAN M. f Tvrdik AN B. I Alberts l AN M. ' Spinola AA D. Ballard AN C. Tillman AA D. Barral l v 340 1'- ' X f' WX Division or Weapons Admin is charged With carrying out the administra- tive functions ofthe department. Included in this division is the Departmental LCPO, Admin Officer, Career Counselor, 3-M As- sistant and the Yeoman. Maintaining the administrative load for such a large de- partment is a 24 hour-a-day job. AOCM R. Miller YN2 B. Dean LV A03 S. Graham 341 saw actlon ln the Paclfic until 5 SS PHILIPPINE I ln July 1953 the World ' r deploymen ,t e deployments on bpardluss CQNSTELLA- Kwhat cont1nues to bel the pest Shiplgir wing Storm operatlons ffom Marek thrbughfAug'uSt 1 An' Wmg NINE Completed 27 deployments on 9 IS homeijoqrted at Ngi31ale'Air'Station .all n of the state. Q ' - ' 53' a 7 , lv rj' lf? HE lt J I proud z meet the 9 311' 1952. 1 was the redeslgnatlon of then -wp ,lr 341 and 5 1 ii? QD, Y L of all air of seven t K 65l on I conducted then' most rticetit depleynientito 5 ln Operatlon Southerd Watchg X, gilt' A . J f I I 4 ' 37 P . , J ,ri . , .1'-L5-S' ' i ,. K K. ,YJ .- -- 1 l L s 4 Aff: Ev x.9': 5 f J- Q lil -,Jill I X f pf I I at -W I I MW - e 1 l ' A wxix1.ifw- wx W J. m F , , 5 5 ' s N z l y 1 H -: I I Fa N' If 'E 3 lc if V li fgifi X1 I N R N! Wk .-4 112' X, JW! L , .132 LMP! fl ,, . f ,, ? A ' fm fziifff yu Lv- ' 1, Y, gf' 3', f in +'+i,1afkf X .452 1 .. X Q 3:21 flu' V245 f -w 521 1-y1,,,,q'j' Y,-3' 1- ,, . ' ww, 'Q 43.7 551, 1:55 22-:Ev 53225, ' 'f 'G-airy, Jjfflaf' - .ff 4 h :.f.- V 91, mwx.-xi. i,-1M1.f-1 'Q' - ,ww-5,4 11: 2 4, 32: 455' ..f' . 1 7 -, .- 47 S21 ,165f'72:,z f ,Q fgfh , f 'G Q3- jwz , fr rg fr. , ,gg , if 11235 -ff' ' 1 f 1 , 'M .wx .1-5 f . f 1 ggi 41 x if f - X -f P' 5, A -1:2330 ' -'--X :fi-12 avi. 39135 f am? . 11 W Z ,, lm.. Q ,. V 1, 1. 'uri ,ff M Q gpg ... Q , f .. YV 52 , GC? if f 2 A ff' T f g2 Z',,1w,9 inf! J ff ' A Mfr A, , W9 f V V 'Vwn f.f , Wu ffm , ,fy 7, ' ' 'fa if ,, V. 2 ,535 41. , fa fy , W 3 KM ,,,,.N,wk Carrier ir Wing Nllilgf CDR J. Maitner LCDR C. Dodd LCDR K. Freeman LCDR C. Holmes LCDR K. Kenney LCDR D. Kleinberg T LCDR G. Moore K LCDR S. Whitaker in LT R. Dewalt W LT T. Frieder K -A LT R. Griffith LT G. Hodder LT D. Hulten R FK 1. s.. LT N. Kazerooni We if R LT R. Stober . ' LTJ G J. Stubblefield ENS R. Behrens tn . f 3 4 4 lf f CVW-9 AVCM L. Cummings AVCM G. Fruit AOCS E. Coles YNCS P. Flores AMCS J. Rollison AECS B. Taylor MRC V. Dennis AKC C. Potter NCC P. Wiseman AE1 N. Arango A01 G. Guenther OS1 G. Parker YN1 C. Roberts AME1 J. Smith YN2 J. Nejedlo AMSAN T. Kotecki AN W. York X4 f f i i n '1- e f ' 345 1 4 2 ii A squadrons to Carrier1Air Wing NINE deployed 'in USS A V. NIMITZ CCYN,68Dl.jlflSd-Slhas 24 and 523,aircrewmenas well as over 125 maintenanceiandf sup.piortjp,ersoiinel .vVliOdlCIlS1.lI'C the -readiness and flexibility to support the variety of missions' that is. called upon to p91ffOrm.- HS-8,S',.C11TTQHtc inventory includes five Sikorsky lSH460F helicopters' and two- CSAR aircraft, and is currently home ported at Naval 'Air Station North Island, San, Diego California. The squadron's primary missions include Anti-Submarine -Warfare, Combat ndl'Search'iand Rescue. . Secondary missions include logistics, medical evacuations, and Rescue Naval Special Warfare Supportwa Q , , d I d i W A d D pg earch and control and anti ship missile defense 'ofjthedcar1jiep1,battlses.group,For ASW missions, the SH-60F, can be armed with machine gun and up to three MK-46 or'MK-d50lASWtorp,edoes.Q Itilearries a crewof four, two pilots and two aircrewmen, SAR ' n .the.HH-6,0H is armed with two M160 ,or M5240 machine guns as well as a qualified rescue swimmer For C A 1 'II11SSlO S, y d , g A I, A d Q p I A g 1:0 be used for self defense A crew of iive.is'used-for missions, two pilots,.tWo door gunners and a crew chief. All are uahfied to use Night lVision'Gogglesf CNVGSJ which greatly 'enhance vision in low light conditions. Opeyatlens 111 the ArabianfGulf in support of Cperation Southern Watch included over-land Combat Search air wing personnel lovv anddfcoordinated training' exercises with Navy SEALS, Air Force and the 26th KuWa1t1 A1-moiiedi .In additionxto its operations in Kuwait, HS-8 assigned personnel to the A A h I V A t th J ' t Services Rescue Center. HS-8 also Force South West Asia headquartef'Sw p.'SHUdif,-AfiabialfO,SL1PP0I' 1 ,I 96, 0111 p in several coordinated Undersea ,4'., 6?ivQIC'1Sc9Sl'4W1thN. other airwmg .andbattle group assets. ,These exercises the Elghtballers for possible real world USWfmissions 1131.11l16'S.13I'Q11ZS4dQf'T8.lVSf31f1L The SHAGOF is equippedhwith a sonar transducer lowered into the Water by a 1500 foot cablei, ':This5system is yirtually unbeatable when it comes to tracking and attacking enemy HS 8 also performed numerous logistics-missions, moving personnel and cargoaround the battle group. and to various HS 3 Was able to put its valuable Searchlanud Rescue trainingtofuse when it performed the timely andsuccessful rescue of two 14 aviators .'c', , A V, u A, ' 9 9 , 1 I ii 5 Th 1995 15 k the 21st cruise for HSE8 in 15 years and over 50,000 hours of mishap-free flying. HS-8's safety 9 1996 deploymen mar s p , p p nd Warfare prowess were recognized recently Withthe Safety S award for 1994 and the Battle ME? award for1995. -The HS-8 d th 1 st to land, continue to provide versatile mission capability to the USS NIMITZ Battle Group. HS-8 LCDR D. Bean LCDR J. Kruse LCDR D. Lausman LCDR R. McVVhorter LCDR M. Murphy LT D. Atkins LT E. Balaton LT R. Cheairs LT L. Cockrell LT S. Cooper LT J. Gutierrez LT J. Hagar LT J. Hatridge LT K. Lenox LT D. Persky LT T. Sanchez LT M. Sandberg LT B. Smith LT W. Stewart LTJ G S. Dalton LTJ G K. Fine LTJ G J. Wilmes T L .' -2 -qzfglm , '-'qi-??,AQL. -.N .r-ag 348 4 HS-8 CW02 D. Shotwell AFCM M. McLellan PNCM A. Vivo AOCS A. Ammon AF CS K. Haun ATCS T. Koscak ADCS J. Marshall ADCS E. Ritarita AOC B. Bennett AWC J. Burke AWC J. Caswell ADC E. English AMSC F. Garcia PRC B. Geikie ATC S. Law AEC L. Pennington PRC B. Salazar AMHC E. Tayag AZ1 R. Austin AD1 E. Benjamin AMH1 S. Casciotta 'Na ' 1 350 i3,1,p,,, HS-8 AMS1 J. Congjuico AW1 J. Cox YN1 R. Garner AMS1 L. Gonzalez A01 D. Handshoe AW1 M. Larson AW1 K. McNease AZ1 G. Mozley AD1 D. 0'Nei11 AD1 K. Perry A01 J. Rivas A01 N. Schramm AMS1 T. Stotelmyre AMI-I1 A. Talampas , - A 1 ' -2 fsigm. 'QfT?:?,.xmz. -.N HS-8 AE1 M. West AK1 W. Woodley AT1 J. Woody AMH2 M. Aid DK2 R. Bantug AW2 R. Binczak AZ2 T. Carlson AE2 R. Collins AW2 L. Dengler AZ2 J. Dunn AD2 D. Edwards AE2 J. Ellis AMH2 D. Fernandez AT2 A. Harris f- :A HS-8 AMS2 C. Kampitak AW2 C. Littlefield MS2 W. Lockhart AT2 M. McDermott AMH2 B. McKenzie AW2 D. McNamara AD2 B. Miller AW2 S. Milligan AZ2 E. Moran AW2 B. Munot A02 M. Nagar PR2 P. Ortiz AE2 S. Parker AE2 R. Patterson AT2 B. Pierce AE2 R. Sabio E 352 . P .1 ' '- -ry!-G. 3225 ? HS-8 AW2 D. Stoughton YN2 J. Surles AMS2 C. Tenchavez A02 J. Urena AW2 C. Vliet A02 L. Williams AMS3 D. Abram AMS3 L. Aquitania A03 G. Carrillo AMS3 C. Colbert YN3 J. Cutlip AT3 D. Denewett AE3 M. Gleason PN3 R. Guarin AW3 D. Hazelton AMH3 T. Heck N f Ai if HS8 AT3 K. Heilman AS3 S. Hutzenbiler AK3 N. Irvin HM3 J. Jones AE3 H. Kaupp AK3 R. Landa AW3 M. Mills AW3 J. Nomis AD3 W. Ortiz AW3 J. Penix AT3 D. Pfeifer AW3 W. Pope AE3 N. Quintana AW3 K. Redmond AD3 S. Rojas AK3 P. Samuelson AK3 J. Sobotka AW3 M. Stretz AD3 R. Tantorres W1 , --Zin. - .M .yr AW3 B. Toman PN3 D. Tranberg AZ3 R. Tucker AE3 B. Turner AW3 D. Vanderbeack AW3 A. Wallace AT3 C. Weier AT2 D. Williams AOAN D. Anderson AN T. Ankney AN H. Butaud AN D. Davis ADAN J. Dioso AOAN J. Galindo W AMHAN D. Hollings AOAN R. Holmes AMSAN B. Johnson AN C. Lagle AN S. Lecount 'Nm 'IAZ :A 355 HS-8 HS-8 AOAN G. Luster AMSAN F. Melendez AN M. Miggets ADAN E. Morris AN J. Redahan AN C. Scarlett AN J. Shumway AN D. Summers AOAN M. Terrell MSSN Thomas ADAN B. Thompson AKAN S. Yankee AA J. Bertulfo AA J. Blakley AA C. Edwards 121' A f -N 356 if f AA K. Elger MSSA R. Hughes AA E. McIntosh AA C. Monte AA G. Montemayor ATAA M. Quiroga AA K. Sotelo AA F. Warren AR L. Domyanich AR R. Harvey YNSR J. Lopez YNSR S. Miller AR L. Morrison AR C. Polander AR J. Walgren Xa A nnr of 357 r HS-8 --www-ga I I H A I F H I F I HE IN I HUDEH ' ,f,' I September 1960 - September 1996 I II sffizii J! I IfIII ll Q2 I f ,I,f ,7 12-. I V 7 '41 III' fffpfc I , C ,fry Wi I f '2Q,3,QiZfjiif'?Z?f ,I 7 fvff,w4iy,Ig rf I5 V, f H2'f'f?',t,l ,LI ' ' ffl III 63 Hex I 1 I f ' 1 Jff I X ' 'Q' X73 42 iff ,I,,, I ,,,, , , f ,Izf-,fffcfuaif nf, ' I f wI,,MiI,?fWf 584,24 !II,f?.z,a,Ls1fv,f -- ,Za - 'swam ff Aww' I 31,253 545 44 '77 Em f vII: ,ff ,f . I gf,fyi6f:,ii4 g: I 1 I I . ,I I ,I II ' I II , f I I I II 'f I I I I I I - I I I I I I I III II : I I III III I I I I I I I I I I I III IIII II I I II ' I I II II II II II II II I I I I I I I I I I I I I I I I I I I I II I I I I Z , I I III I III I I II I I II I II 'I I I' I I I I . I I I. I I I I I I I I I I I II I I I ' I I I I I I I I I I I . I I I I I I I I ,I L xg -15 xv K+-: 1 .Q u , ,- J. Q ' ' .V f ,Q , ' , ,, : i,..Mfff1,1-ASM:-f1-ff vf, ' ' ' ,p ,, ,, ,fMJw4,gWw1fwwwwf. f X of the fifth in July of 1996, markingnotlonly the Aend of one of histor-y's finest attack squadrons, but Intruder era, 3,'timc WhennA.theSg robust ,two-seats attack aircraft led longfrange strikes day deliveringheavy ordnance, 0n Ta1'QcfQjV0n'oTime5 Every Time! o an a- n Boomers, you have madeamlsareapartof historylc W V 1 c s - ' o a VA-165 LCDR R. George LCDR D. Horton LCDR S. Mclnerney LCDR R. McLaughlin LCDR G. Smith LCDR E. Vincze LT T. Best LT M. Briddell LT A. Brosnan LT M. Bruington LT D. Czarapata LT D. Dargan LT B. Davis LT M. Green LT C. Hartman LT T. Hibbetts LT K. Hollenbeck LT J. Hoskins LT M. Lucas LT D. Maclnnis LT E. Martin LT B. Meekin - 360 ' -.-...,.,.-,-,...-..-f-'.--n-.,,..,.,,,...:r-h-Q---,...ff.v,..--..,.-.-wave--,,,-., , g.-,Qkw,4. v.4y-yvxn-m-+-my-mnwmf-qw-wr VA-165 LT C. O'Nei1 LT C. Rankin LT M. Roman LT T. Smeeton LT E. Spitzer LT L. Steinbaugh LT E. Wetzel LT R. Wiley LT T. Yambrick LT E. Young LTJ G R. Brown LTJG C. Johnson CW04 P. Coombe CW04 W. Powell AFCM M. Clevette AVCM W. Mihelich AMCS W. Gass AECS M. Hernandez ATCS R. Hubbard AZC C. Baughn AEC R. Farmer PRC S. Hyder N 361 2 , . ................. VA-165 YNC M. Keliikupakako AMSC J. Lee AMSC G. McC1ary AMEC M. Merwin AOC F. Monthey ADC J. Sanchez AMSC R. Unger ATC R. Walosin AT1 J. Anderson AMS1 A. Baleros AZ1 K. Burdette AMS1 A. Carter AD1 J. Deperalta , A 1 ' -2 -:.:.fLT,n. gg... ,N 362 i fs- --.--1-qv.-vmbvwwmnwx ...yu-ax,--.h-,..-Q-:...vu4p VA-165 YN1 S. Eassa PN1 G. Fischer AD1 J. Flores AE1 D. Glesener AMH1 M. Grocia AME1 M. Harris ADI G. Holland AT1 W. Herwick AMS1 H. Howard AE1 B. Hubbard AMH1 G. Johnson AME1 P. Jung AT1 P. Kronholm N f r'or VA-165 A01 C. Kutzke AT1 K. Mitchell AT1 R. Peterson AK1 A. Reonal AE1 E. Serrano AMS1 R. Shepard AME1 A. Smith MS1 P. Smith AMH1 S. Stockert AD1 D. Sutherland AD1 E. Talford A01 E. Thompson AD1 R. Toms AE1 M. Wanless A01 R. Wuensche A01 J. Wojtowicz AE1 K. Yergen AT2 F. Antenucci AMH2 K. Arnold AE2 C. Astorga A02 S. Bates WL . L ' -2 .--fin, ' . N-,. 364 VA-165 A02 S. Beaty AD2 R. Beebe AD2 R. Burke AT2 J. Cambia AT2 C. Clark AE2 P. Clark AE2 S. Coon AMS2 E. Deluna PN2 J. Dickinson AT2 P. Dunn A02 R. Edwards AMS2 F. Ferdin AMH2 J. Fitzgerald A02 K. Freeman AMS2 R. George AT2 E. Gravois A02 P. Gustin AMS2 J. Hornbaker AT2 R. Johnson AMS2 J. Keller AMS2 M. Kottke 'Nm A'2 I 365 VA-165 AD2 D. Kwapiszewski AD2 J. Lamouria AMS2 0. Lawson AME2 D. Maier AT2 B. Medeiros PR2 R. Miller AZ2 G. Mooney AT2 P. Ogle A02 B. 0psal A02 D. Provaznik AME2 B. Pruitt AT2 J. Rogers AK2 R. Ruefa IS2 M. Rusinko AMS2 G. Gabri A02 G. Salazar A02 J. Shearer AZ2 J. Stonebraker MS2 H. Taylor YN2 R. Vandyke A02 T. Vangrimbergen DK2 D. Villar p m f 366 L l VA-165 '21- A02 R. Walker AMH2 K. Welch AT2 B. White V DP2 J. White V . AMS3 C. Andersen HM3 A. Ashton 1 1 l IS3 S. Austin PN3 M. Bannon f' AT3 P. Basile AT3 T. Blumel YN3 D. Bobbitt I 1 V l n AMH3 R. Bray ' AME3 R. Brockman AME3 R. Carey AT3 C. Colburn AD3 H. Colson AMS3 F. Craft AT3 J. Craft AMH3 M. Errand AT3 C. Even AT3 D. Freeze N '1 X , .. . . - .l ln W 1 - -p. VA-165 AD3 G. Gibsonserrette PR3 R. Girard AE3 P. Gomez A03 K. Greca AE3 L. Guadron A03 R. Gunderson AZ3 R. Havens AD3 A. Hernandez AE3 L. Iwanski AK3 D. Kabukuru AK3 A. Landry AT3 D. Lathrum AD3 0. Lee AD3 S. Lewis AE3 N. Matthews AE3 K. Mendes AMS3 K. Miyashita A03 J. Mulholland AT3 G. Nipp AME3 W. 0al1nann PR3 T. Osebold AD3 A. Pecson AT3 C. Pederson AMS3 J. Pitts AME3 M. Price A03 J. Ringenberg AE3 N. Schoof l 368 R 1 I 'E -iiifgl-n . -A-W.. ?i VA-165 AO3 A. Silvas AT3 C. Simmons AMS3 M. Smith AE3 W. Smith AE3 T. Snyder A03 D. Summers AZ3 R. Sweet AMS3 W. Tibbetts YN3 J. Tollison AT3 J. Walsh YN3 T. Wheeler AME3 R. White AT3 J. Wilcox AMS3 P. Williams AO3 T. Winston AZAN K. Adams AOAN C. Alexander ADAN S. Armstrong AMSAN W. Bales AMEAN M. Benson AN S. Castillo AMSAN M. Clover AN K. Dixon ADAN K. Douglass AKAN A. Estep AN H. Flippenpinzon AN E. Fuentes N- f--2 M 369 i 1 i V M i ily, iii 'Eff i Q l W VA- 165 W A AMSAN T. Gager ADAN S. George N N i AKAN A. Garcia AMHAN R. Gregg 51 mi i 5 ii ISSN N. Greven A AEAN R. Harris E A YNSN C. Key 1 AKAN R. Logan A AN C. McDonald .ii 1 NA, .!. . if .f i ADAN D. McMurtrey 1 l e AN O. Medina 'AA AN D. Morton AN B. Pickett lf AMSAN M. Ramirez ! W 'li fi U 1. ,. 3, VH' i i v H ,M v V52 .wil ,. i. AOAN L. Rodriguez AMSAN R. Romero fi Ii Z i ESV if AN J. Ruiz if AN J. Ryan . H , W i. ' ' W 37O' . ,V A ,,,, , ,,,,, A., ,nun W, , , ,.- ---.-v,-,,4.......-..-.,..,.......-4f.,-w,.fu:. 'rv-v Q-,N-.Q--wa., -9-f ,--Q-....-.-.- .....-i ' 0- VA-165 ADAN J. Scheunert AN R. Scott AOAN F. Sii AKAN J. Simmons ASAN K. Simmons YNSN L. Villalpando ATAN F. Villanueva AN R. Walsh ATAN J. Warner AN G. Whitney PRAN D. Willyard AOAN C. Wood AN M. Wood AA C. Aschoff AA J. Bovard AA J. Butler AA D. Carter ATAA A. Colson X- 371 VA-165 AA A. Cyr AA D. Downey AEAA D. Eck AA S. Eitel PNSA W. Guyton AZAA S. Hacking AOAA V. Hardy AA T. Harris AA R. Hayslip AA W. Hernandez AEAA L. Hoover AOAA C. Jones AA D. Keller AMEAA A. Koch AOAA J. Mackie AMSAA R. Manning 37.2 AKAA T. Martin AA C. Mendoza , 1 ' -.2-fig . gg. -N - VA-165 AA A. Nichols AA W. Pierce AOAA J. Raynack AMSAA W. Reiss AA L. Robertson AA M. Rosalez ATAA D. Scoggins AA T. Sin AMSAA M. Trosper AA G. Vela AR J. Alega AOAR N. Barnett ADAR G. Ingoglia ADAR I. Luna AR M. Marsh AMEAR W. Skaggs AMHAR J. Vanderpool ADAR R. Verdezas ADAR L. Winfrey SR W. Worley Xa f F D '5 4 s ...... - ff' 373 Igill'IIIIIIIIIllllllIlllllllllI!!!!!!!!!!!!llIlllllllllllllIIII----- of the Prowler is to suppress the he radabhoming High Speed EA 6B Prowlers which are the the modernhlgh tech battl eidd Officers CECMOSD. The Yea four r and made then' itself d three more 19769 Cotioplete made SIX Valuable in 1995 for Prowler 1993 Battle E Q ' 'N 1 -W-f-ff--f-'--v-f--N-me----fx-fm-f--.w-.,1,K,,.-,-,Q-..N, , , . ,-3-Q-.,-uyp.-x.,,-...1-,.-. -- J.-.-....,,,w,.r, v F4bwvy3y VAQ-138 LCDR S. Beckvonpeccoz LCDR M. Ciardello LCDR C. McDonough LCDR S. Pollpeter LCDR R. Portnoy LCDR J. Sterling LT H. Berge LT C. Bush LT K. Coleman LT P. Coleman LT D. Ensminger LT B. Gray LT W. Harder 376 m f VAQ-138 LT P. Jennings LT C. Mackin l LT C. Mueller LT R. Ring LT T. Robertson LT B. Schildknecht LT A. Skalicky LT J. Stoneman LT D. Sullins LT M. Vandersluis LT A. Vozza LTJ G C. Nolte ENS D. Berry N- '2 .A if 377 VAQ-138 AFCM H. Mathis YNCM R. Wagoner AMCS C. McGreW ADCS R. Protsman AECS F. Sessions AMHC M. Abercrombie ATC B. Beck AZC C. Burnett AMEC R. Fowler PRC C. Hall AMSC D. Melchor ADC S. Skolarikis YNC W. Stenstrom ATI R. Baker ' jgkg ... 378 VAQ-1:-as AT1 A. Cerny AT1 C. Clifton AMS1 P. Colby AE1 P. Dietrich AME1 D. Downs AT1 T. Flora AO1 B. Freiermuth AD1 K. Fruik AMI-I1 R. Gaffney AO1 T. Harrison AE1 R. Hewitt AZ1 D. Ladouceur AMEl M. Olmstead PNl T. Ramsey 4: 14 379 VAQ-138 AD1 E. Roblyes V AMS1 P. Rock L AMS1 W. Sargeant . AK1 P. Singletary PR1 M. Wessel AME1 J. York AC2 A. Aguilar AZ2 M. Barrington YN2 R. Bougher AT2 L. Bowen IS2 A. Campbell AT2 K. Carson . YN2 A. Chavez AT2 T. Dillehay A02 D. Drone j.2i' o --. 380 ....-.-,....,...-.....,..., . ,....--.,...v-...-.. ,...,....... -,4,.,., vw, .. , , . . ,-1. r ..f. --.-..-...-..v.--. Q-vis-x..q.--Qs,-..n.--r -nm 1:- VAQ-138 CT2 S. Evans AMH2 C. Foy AE2 J. Frohlich PN2 L. Hawman MS2 I. Hernandez AMS2 R. Hudson AD2 J. Lyons AZ2 J. Maletto AE2 F. Mariner AZ2 A. Martin AME2 C. McDaniel PR2 P. Randall A02 J. Rodriguez AMS2 J. Rosenfelt AE2 R. Rotello X- R-oo 381 VAQ-138 AT2 J. Scanorol PR2 J. Taylor DK2 B. Vinlvan MS2 D. Waite AD2 R. Wandel AT2 T. Wasson AZ2 K. White AW2 W. Zabelka AK3 A. Andah AE3 M. Beliveau AD3 M. Brancazio AZ3 A. Bryant YN3 J. Burca AME3 D. Campbell l nf 3821. 3 VAQ-138 f 7 , AT3 V. Cipriani . , AT3 B.Dale 2 AT3 C. Daniels L R . , . H , ,. A AT3 K. Davis e .... ...... .... A K 3 B. Finn AT3 R. Fisher AME3 C. Jones AE3 J. Krueger IS3 L. Lampton AD3 M. McConnell fi AT3 C. Mitchell AMS3 C. Morey AE3 V. Myers N- 383 VAQ-138 AD3 K. Plump AE3 R. Porter AT3 R. Rhodes AMS3 D. Rich MS3 W. Rose AE3 D. Ruef AZ3 D. Shirley AK3 C. Solis A03 C. Stark AMS3 J. Stroh MS3 M. Sullivan HMB K. Wright AMSAN L. Anthony i... . -,, AMSAN R. Barrera 3 38 3 ' 4 '91 ll' IJ VAQ-138 AN T. Bauer AN T. Bibbs AMSAN P. Burke AMHAN s. Campbell AN C. Chalmers AOAN B. Helm AMSAN C. Hudson AOAN R. Jones PNSN C. Jones AN S. Lewis AMSAN M. Lomeli AN J. Lunders ADAN D. McDonald AN R. Miller 'Ne ,b-1 :A 'NNN VAQ-138 ADAN J. Parlin AMEAN J. Pitzen AMSAN M. Rutledge AZAN P. Salgado YNSN C. Sanders ADAN J. Sbalbi ADAN A. Swope AMSAN T. Teneyck AEAN J. Toles AMHAN C. Trujillo ADAN P. Walters AOAA V. Barber AA D. Deguzman AA T. Gray AA K. Hampton A R . -' 386 A, E K NAM? 1 ,,,,,,,',,, Y ,,A --Q-pn-va-sunny-v . . ....-...-,..Q,,.-...,..,,,,...v.v.-,. ,. -'v ':'-'v-'-1 1 VAQ-138 ATAA W. Hein ATAA J. Marren AMSAA D. Petersen AEAA P. Smith AA L. Waters PN SA T. Wenner AR V. Charles AR D. Damron AR T. Edmiston AWAR S. Hegarty AR R. Inocencio ADAR J. Murrill AR R. Tezeno AR M. Zappia N- 1 ff' 387 .,w...........,....- .......,.....,.,..,,,, ..............,......,,,.,. M - 2 1 1 g llustrious history which dates back 50 years to when The Fighting Checkmates of Fighter Squadron 2 1 1 have an i . d B b S uadrgn 74 Although the squadron started flying the SB2C Helldiver, it the squadron was commissione as om er q . . . wasn't long before it began its tenure as a fighter squadron in 1949 flying the F4U Corsair. The squadron was redesignated as VF-211 on March 9, 1959. Since that time, the Checkmates have flown many aircraft types 1ncludinggF. - t 9F Cougars, FJ Furys, F-3H Demons, F-11F Tigers, F-SJ Crusaders, and F 14 Tomca s. . ' ' t h ve been among the first to rally 1n support of our nation's Throughout 1ts 50 year history, the Checkma es a . foreign policy. During the Vietnam War, VF-211 pilots distinguished themselves by being the flrst F-8 Crusader pilots, to engage and down North Vietnamese MIG aircraft. They finished the war wlth SIX confirmed MIG kills, more than any other Navy F-8 fighter squadron. 0 The primary role of the Checkmates and the F-14A Tomcat is to provide air defense to the entire battle group from d f th ts The Tomcat gives long-range, self escort strike capability to Air Wing NINE unlike enemy airborne an sur ace rea . any other platform. Its lethal abilities are focused around the powerful AWG-9 weapons control system in conjunction ' ' ' t 20mm Gatling gun with fire rates from with the Phoenix, Sparrow, and Sidewinder missiles. The aircraft also boas s a d ' te In its multi mission role, the Tomcat also carries various air to ground fweapons, 4,000 to 6,000 roun s per mlnu . A - p including cluster bombs and precision guided munitions. Tactical Airborne Reconnaissance is an additional capability of the squadron's TARPS Tomcat, which gives battle group commanders real-time imagery with multiple optic and infrared sensors. The Checkmates, o Team. The squadron is relocate to NAS Oceana, 1996. p ver 250 dedicated professionals, are proud to serve as part of the NIMITZININE at Naval Air Station Miramar, San Diego, California. They are scheduled to k I i i I i ! 1 i i v 5 Y r F 9 v P Z I Z 5 2 Z i VF-211 LCDR K. Angel LCDR C. Craig LCDR W. Daly LCDR W. Davis LCDR C. Ferguson LCDR D. McGoWen LCDR W. Shivel LT J. Bartelloni LT B. Bartosh LT R. Bello LT D. Dick LT G. Friedman LT C. Gordon LT R. Gruenhagen LT R. Hennessy 32.1- ' 'G .--...-....,.a-A-.....-..q-,.....1 -.m.q..,.,,,,q ,.,,,,,, ,,.,.,,.,,4-B--Q-.,..-1 -Imran-m..,-.g,-p--.vp-1.-vp:...n-up-A VF-2l 1 652323 0 , . ff 4'lfJ'9' 6.4 .,.-... f lf- 5 LT S. Ind LT J. Lay LT W. MacDonald LT D. Martis LT T. Osteboe LT K. Reynard LT L. Schager LT D. Tri LT P. Vedra LT D. Woodworth LT G. Yates LTJG K. Lewis ENS J. Hedberg ENS J. Pate CW03 I. Sharpe N J D. f : Z4 391 -. ,.. V VF-211 l 392 - CW02 J. Bethke CW02 H. Brenner YNCM V. Johnston AZCS P. Cook AECS D. Cowart ADCS H. Matkin ATCS D. Moeller AMCS C. Stenglein ADCS R. Sulit AEC D. Adams AMSC W. Dallas AOC D. Ellis AMEC M. Ernst ATC P. Hay ATC D. Hilton sv' 4 1 -W... -.J 'A----4----sv-ef--v .5-J.. -ww-avg,-xg-nf ,--,-NM-......n AMSC M. Medina YNC G. Moore AE1 R. Armstrong AT1 J. Arriola AEI R. Arterburn AMS1 J. Balaoing AMH1 C. Bouse A01 R. Burry AMS1 J. Caalarnan AZ1 C. Carpenter AT1 J. Cassell AZ1 A. Davison AD1 V. Enriquez AMH1 J. Fischer AD1 V. Godinez VF-21 1 'Nm ,au .-.-. I A , AJ:-5.....a:,.-.. .Qs-K - f 'Q fe? N74 393 .......,,....,...,,,,,...,...................., VF-211 AME1 D. Goins A01 R. Green A01 G. Howorka AT1 E. Isenbergh PR1 M. Kennedy AME1 C. Lawson AMH1 R. Mantes AT1 M. McKinney AE1 L. Murrell AD1 H. Nicholson AME1 R. Rund AD1 V. Sahagun AK1 P. Suarez AMS1 J. Vaughan R R . f flEL' ... R ff'-'E ' 1 ' - ff: - X 1 . J! f K If . -..-4.-..q-.-1,i-..,-'wvuvunqvn-an...,.--.zz1-1Qv-v--1-a.mu- VF-21 1 PN1 C. White AMH2 S. Abare AE2 C. Beauchamp MS2 C. Bloom AD2 M. Bradley AT2 J. Brown AME2 R. Brown AD2 R. Burt AT2 J. Cain AK2 L. Carr PN2 J. Case IS2 F. Cassello AE2 P. Cheadle N. '1 :A J ro e J 'if 395 -q.,-.qp..,,,,-.-..........,.,...,.,,,. 'M'-'f YU? -211 AMS2 I. Concepcion AT2 R. Coore AMS2 J. Cortez AMS2 I. Coxsom AMH2 J. Damwyk MS2 A. Davis AZ2 D. Gil AE2 A. Gill IS2 B. Helbig MS2 G. Jaminal DK2 J. Jones AMI-I2 L. Joseph AT2 M. Lemons AE2 G. Lumaya AE2 M. McCullough AZ2 A. Milca PH2 J. Moore AT2 M. North , A - 1 :xg ,. jlkj r-A-N. fl: 396 VF-21 1 AE2 M. Ocreto AME2 B. Ordway AD2 S. Ourand AMS2 C. Paschall YN2 S. Rodriguez AT2 M. Rondeau PH2 A. Rutigliano AD2 C. Schuman AMS2 I. Snyder AK2 B. Spicher A02 J. Tucker AT2 G. Vanderwell AME2 E. Villena AO2 S. Walker AMH2 D. Wallace AT2 J. Wilkinson AZ3 B. Acklen AK3 M. Albin it e f' - - QI 1-'-1-111: ' 397 .......,......., VF-211 AD3 A. Anaya MS3 S. Bacon A03 M. Beauchamp AE3 D. Bussabarger AT3 R. Campbell AT3 T. Chase PI-I3 R. Chavez AMI-I3 J. Collado PR3 M. Cyrek AE3 K. Davies AE3 C. Davis AT3 M. Dawson AMH3 C. Dicks AE3 R. Edwards AD3 J. Eicher 398 VF-21 1 A03 S. Fisher AMS3 C. Forrest PN3 R. Garcia AT3 C. Geschwell AK3 J. Glushien AK3 R. Golden AMH3 T. Guerrerolira AE3 J. Hawn AE3 M. Huffaker YN3 D. Hunt YN3 A. Jenkins AMH3 D. Leighton PH3 J. Logrande A03 K. McDougall PH3 J. McNitt 'fr' 399 'wrnnnaovs-w-Q -.-...-.-...,. up-p-1.-.Q-.-..f an-.-mv-.-.,.. . .. v -.-f..,.....,...... -M NM, . ...Q ...F .,, , ,, ,, VF-211 l p , . -' l 400 AD3 F. Mitchell AME3 E. Moffitt AT3 E. Morgan AO3 E. Nakamura AE3 G. Oden AMS3 S. Padilla AME3 M. Patrick AT3 M. Pena AMH3 R. Phillips PH3 C. Pierce AME3 S. Puranda AT3 D. Quick MS3 P. Ramlal AT3 H. Roach AT3 R. Robinson AT3 J. Rondash AT3 A. Roof uv' K L 1 5 S LA 1 ..-.-,.,....-.,....,,.,..Q. --...-.,.,w-..,..-.-..-F......1 Vu,-mkfvq 'gym AMS3 M. Rought AD3 O. Sangster AME3 C. Schroeder AD3 C.Si1va AMH3 R. Slavey AO3 R. Steinborn AMS3 G. Stowe YN3 S. Thompson AT3 K. Whikte PH3 D. Williams AT3 W. Wilson AMS3 S. Young PH3 J. Zlab MSSN A. Aquino AOAN K. Briard PHAN S. Burge AMEAN S. Charboneau AMSAN M. Cummings ! VF -2 1 1 sa . 1 xix X Xxx iq. 1 1 6 I' s 974' GEM in E' VF-21 1 ADAN C. Rutherford AN S. Rye ADAN S. Sartori AN R. Sulit AMSAN D. Taylor AN D. Vo AMHAN J. Watts AOAN H. Westberry AA V. Bevel AKAA C. Bruno AA G. Davis AZAA M. Elston AA L. Evans AA A. Gutierrez AOAA B. Hampton AA T. Jenkins AA E. Labinpuno AA E. Mamasig AOAA D. McCarn AA S. Moore AA D. Simpson N '-': M 403 ,., .............. VF-211 HA V. Streeter AKAA J. Turner AA J. Warren AR M. Ball PHAR A. Custer jL2g A-.. ' 404 p f VF-21 1 AR B. Ellis AR B. Federspiel AMEAR C. Hudson AR D. Middleton AMEAR K. Raum N 405 Li I I I I i F 1 I ii U E I Ll , . , . .. .. .. ,....... V ...., ,4,,.,...,,..,,...-s-.f-w...- ...Q-awww.-.9'.g.-rr- 1'-'I-f'-'f '--' -' ,- .,....-.-.-..,,-.....-.,.-...- ..., .J V. .. ..,., '-f.-- - . - - -- f - - - ....-.-...-.....-.-..,..f-1wn.f,.--.-..-,....,.ev+--,-f , V x 22321 In October 1986, the Flghtlng Renegades, backed by a superb maintenance effort, surpassed the three-year mark, an accomplishment that is un arallel d ' h p e ln t e F-14 community. In 1988, VF-24 deployed for the first on board the USS NIMITZ CCVN 68? to the Western Pacificllndian Ocean. A In 1991, VF-24 deployed to the Arabian Gulf in su t f O . ' ppor o peration Desert Storm. This deployment lfiarked he gquadron's flrst deployment wlth the ff more powerful F-14B Super Tomcat. 1992 was a year of change for the Fighting Renegades The s uadr 1 , . . . Q - q on comp eted an arduous transition to the F-14A Tgmcat w1th.character1st1c expedlency and professionalism. The Renegades also embarked on an aggressive aiI.,t0.g-round trainlng program to maximize th l '- ' ' ' ' ' e mu tl role capabllltles of the F-14 VF 24 utlllzed this strike fighter h 't d l d 'th NI ability W en 1 ep oye W1 MITZ in February 1993, to the Arabian Gulf i . rt f ' the n a n suppo o Operatlon Sou Upon returning, VF 24 kept up the fast pace with Coronet ' 1 ' ' ' Sentry 94, two carrler quallficatlon I' W 9 board USS KITTY HAWK CCV 635, and winning the 19 4 provide support for Red Flag and e S 8 1995 was a busy year for the NIMITZ in December to Key West, readied itself have thUAF to GE CDN School, as well as Roving Derby. The squadron also visited Nellis for yet massive ,,,, ' ' ' ' WFP--' ----f.w.vN,.......-..,....,... .,.......-0.-. VF-24 Q 4 0 3 - 1' LCDR R. Ariza LCDR B. Kocher LCDR D. Masterson LCDR R. Pyle LCDR J. Sheehan LCDR M. Singletary LCDR M. Watson LT D. Bull LT M. Burgess LT T. Carlsen LT J. Cummings LT T. Eberhard LT R. Erie LT G. Johnson LT B. Jones LT W. Kronen LT M. Lane i ...-..,..,..-xf-.,........,f.....-1 V-Aung,-4,11 ,-gffx LT I. Larson LT C. McNeW LT S. McShea LT J. Muse LT A. Petit LT H. Provitola LT C. Tinio LT S. Trafton LTJ G B. Burns LTJG L. Sidbury ENS J. Hanly ENS E. Twining ENS W. Winters CW02 J. Seiberling AMCS E. Gause ATCS M. Kern AECS T. Walsh AOC J. Ausman VF-24 AZC J. Baquero YNC M. Fortier ADC A. Hilliard AKC L. Kelso ATC A. Marshall AMSC D. Molina AMEC R. Selga ATC K. Smith AEC G. Stiehl AK1 M. Bolosan AE1 A. Burke PNI E. Cacanindin AMS1 D. Calimquim AZ1 M. Champion ATl O. Chavarria AMF1 D. Chavez AMH1 T. Cornutt AO1 E. Espanol AMI-I1 J. Evans AMH1 D. Frye Q f RT N---.. ' 41 u 1 ww u1 ' KG . ' -2 ---F 3 . A 'D 1 '-Qq n,,...isi' - .25 1. X .- K Y E VF-24 AMS1 T. Haman AD1 E. Hamilton AO1 C. Haug AD1 A. Henson ATl G. Johnson AD1 C. Lantaya AMS1 M. Liggins AE1 H. Morrison AD1 V. Relos ATl W. Schrack AO1 P. Seifried PR1 R. Trujillo AO1 K. Wall AD1 M. Warner ATl R. Wright AMS2 P. Abides AE2 R. Acevedo AMS2 S. Alli YN2 A. Bennett AT2 R. Bless N '-Q . . . -l':'1i,i:2::.:,,-.. 'i':g:fewf --A ' E.-:f3f3'i' 411 VF-24 AE2 M. Brown AT2 W. Condict AD2 E. Cruz AME2 A.Escami11a AMH2 T. Farmer AME2 C. Fauria AMH2 I. Hernandez AT2 E. Hildebrand AE2 R. Holzhuter AE2 E. Huff AME2 C. Jones AT2 N. Kim YN2 G. Ladson AT2 J. Loper AK2 R. Lorenzo AMH2 F. Malagan DK2 A. Manglicmot AE2 P. Marsden D Qi ,-A7 .. .. ' 4 'I ' D ' fv 'EP' -9-f vvlmwuvv---an.-w--.0--.,..,. f.-1, H., -N. J f. ..,...-.1-,mg--.,...,.. --p-ngygfx,,2--.-wr,--v..v..v..24,-,J. VF-24 AD2 A. Marte AT2 M. McKinney A02 W. McNeil AT2 M. Micenec , MS2 J. Mikulsky AT2 L. Peterson AE2 G. Porter AMH2 B. Reingardt AMH2 M. Richardson MS2 A. Sarmiento AMS2 C. Saylors 'xt ug. 4 Lg AME2 S. Schierholz ' I i AT2 J. Strickland AME2 P. Suwczinsky AZ2 D. Tackett YN2 L. Thomas AD2 D. Villalobos A02 G. Williams N ggi i: Z, 413 -.., , .,,.,.....,.......,........., - M... VF-24 AMS2 P. Ybarra AT3 A. Ahmed PR3 A. Amieva A03 K. Arnoult PR3 C. Barkley A03 J. Bates AE3 K. Behler AMH3 E. Bellin AD3 K. Brownlee AMS3 A. Buno AE3 M. Cabrera 1 M iw, 213 W 71 .5413 Him . HY lu. aw 'I l iq. . ' gil' '15 , , R15 A03 A. Carrion AD3 R. Carter A03 S. Combs QI U , W 3 flnlfaj W .vim .MWN ,W ,,!?V,'4 34131.51 www nf . It 1 , , r?lM' A , ' .EU W1 41 4 '73 YM . 1 Q' I - - - . V .f,,,..-.,.,..,....,..,,,,,,,....,,....,....,.-. ...,....., ,W V. ,..,,,,,,,,q...Q ....f.+,-q-v.-..7,.,,,,,1-9-.wf,.-.........,..- VF-24 AMS3 B. Cooper PN 3 B. DeLaCruz MS3 T. Echols AZ3 K. Elliott I AE3 T. Featherston A03 M. Ford AK3 A. Gastelum AK3 K. Giambertone AT3 J. Good AE3 R. Gorman AE3 L. Graddic AZ3 B. Myracle AT3 D. Ischy N 415 VF-24 AT3 D. Jones AT3 K. Jorg A03 J. Lasiter AZ3 J. Lightfield AD3 G. Limas AT3 S. Lucy AT3 J. Lundy AT3 R. Martinez A03 T. Maximovich AMS3 P. McCann AT3 D. Mike AE3 M. Munroe AMH3 D. Poirier YN3 F. Ryan AT3 M. Sisson I ,V,. I + 416 N 'J VF-24 AO3 S. Sloan AE3 J. Spencer AMS3 J. Springman AK3 D. Torres MS3 W. Vigie AE3 G. Wallace PR3 R. Ward AD3 D. Yarbrough AN J. Arriaga AN G. Balthazar ADAN J. Boatner AN R. Boyer AMHAN S. Branch AN M. Brown AOAN T. Council X- 417 VF-24 AN A. Davis AN M. Devonshire AOAN A. Dodson AMEAN D. Fankhauser AN R. Fields ADAN R. Fife AMHAN K. Goodman AN A. Griffith ADAN R. Gutierrez AMEAN M. Hammar AN J. Horton ADAN K. James AN C. Keele AMSAN E. Knezevich AN G. Leith ADAN R. Lopez AN S. Parker ADAN J. Parsons AN B. Rademacher AMHAN D. Reeves . ,,,,..... , .-.-.ev-.., V ,.,,i..-1,-c- ,...m-.-up-4-lv AOAN D. Richardson AN G. Roberson AKAN D. Rohraff AN R. Sagel AN A. Sanchez AMEAN E. Shank AMHAN D. Smith AN L. Thompson AZAN B. Wattson AN J. West AKAN R. Williams AMSAN S. Wilson ADAN B. Wootten AA G. Yurkovich AA M. Alfaro AMSAA D. Arenas AA S. Balog AA B. Boucher AMEAA L. Cain AA Y. Carrillo VF-24 YNSA J. Carstensen AMEAA M. Francois ADAA J. Guillermo AA S. Hewett HA K. Hill AA D. Irish FA B. McCormick ADAA B. Mulanix Q3 AA N. Reid AA J. Salazar E S 4 I 1 i L, N , i , 4 ' w P VF-24 AA D. Sheres AMEAA S. Taylor AA G. Weeks AA G. Yurkovich AR R. Blair AMSAR M. Kreisher AR A. Magpoc AR W. Murdock AR R. Rafael AR D. Short N f F 1 'S A 421 an ' fqw V V ,-fff'f , 424 f---'-'---Y VFA-146 LCDR V. Bussmann LCDR T. Downing LCDR R. Horton LCDR K. Miller LCDR J. Williams LT D. Antonelli LT D. Arteta LT L. Bray LT J. Creed LT B. Dixon LT B. Kilty LT M. Pritchard LT C. Schnabel LT C. Skoda LT S. Thompson LT S. Tingle LT C. Zimmerman LTJ G K. McLaughlin LTJ G J. Taylor LTJ G G. VanErt T L .' -2 . .1-Zig I :af 'Qi f f . .,. ,V,,495ay-2 '1 A V A V .4 , L mm 1 mf. f J ::::2: . ff . ' ' mfg ,. ., 'U J M ,. H., M V . T , 'J lggplkncen STATUS , WE ' PM S'I'EPiViASH Asn Msssnues Twp ZACKV , , f,, o3fa5 f . ,, ,....,-.W 7149 03'o96'J'L,, , , , ,, mm nonropl W ,,.,, 7 7'T' ., . iikiiilillkimhun 02 0443 T T mm os-asv-o-1 'Tf,R oi-asf-o-1' -M --MMTWMQ 'ifbil o.1.os7Q6-1 N -M -Mu-TTT os-1:5-2-i W WWW-Nm oa-no-2-1 Aiillv ' Am MDW WIHMII -..L mm aa HARVEY! 03.gg4,4,l l' 'i ' N ' 'fri oz-on-5-1 4-Mi-' um W 'A Wd 01034.44 M-YD AQ' l ' 'hi' :su ogboamil ...- .,,,, 2519044-1 s'n'ia 'fa+4 'W Iva-oolfll fr '-'- - nu l0J,0,2.M ' V W---.-,.o..,N5 7544 ,Munn ff-Q39-3.1 QD 5' nas o,,, MN'-W I 67-04 io, 44 T W v-U nf' lg --. X 53 X 'X fi 'sf VFA-146 X CWO2 M. Parks wg ETCM K. Johnston l AFCM B. Morris .r PN CS J. Ambrose Q YNos K. Barnett 7 AMCS J. Holsinger ADCS J. Moore AMHC J. Edwards AEC V. Espitia AOC G. Guilfoyle in Q 1 N Q ATC K. Holt . ATC R. Snyder ADC M. Thompson ATC J. Turner AMSC J. Wolstenholme 1 i AD1 B. Antonio AMH1 C. Barnett ATl E. Breedlove AD1 R. Briones AT1 D. Casillas 4 1 I .- - J T J or A rrrr ri A A ' A.... gg'-3,'i, :bf.5',l'H, I vi-1. yi., , V f ,,, 2 ..., f ef is V' ' fi' 1' ' ' -3: -,.:2i- ,. ' 1 , i. 1 ' 5 Q ,rf r L 4 i i r ! .F 1 1 E f i? rrrr'. . to J Eeif? ' 1 J: ' w E 5 .C 'Nm f f i 5 4 . ..,..., -'ft' 425 ,Q VFA- 1 46 AME1 C. Choate AZl W. Comstock AMS1 C. Dean AT1 M. Grice AD1 J. Gullion PR1 C. Kitts PN1 G. Lugod AME1 T. McClain AO1 K. McDonald AO1 D. McKnight A01 R. Minke A01 J. Morrison AK1 R. Pineda AT1 B. Pippin AK1 A. Rogado AMH1 B. Thiede PN1 J. Thorp AZl M. VanWormer f . .... 6 'ff , v ,E VFA-146 AMS1 G. Ward AE1 H. Yates AZ2 O. Brown AT2 R. Burnam AK2 R. Butler MS2 B. Carino A02 S. Chandler A02 G. Clark AT2 J. Clark z A AD2 J. Dodt AMSQ. R. Dyboahl YN2 T. Estelle A AMS2 B. Eubanl Q, . V V . ai-.. A AT2 R. Grant l . HM2 S. Hessong AE2 J. Hill J A AD2 A. Holbrook J' AME2 T. Hurn 1 X 2 I E L W 'T ' it' 427 VFA-146 45 AMS2 G. Jones AD2 I. Justo AZ2 M. Kelley AT2 R. Kellogg AT2 S. Maser PR2 M. Mason AK2 T. Meidlinger AMH2 W. Morgan AE2 R. Nunez AE2 K. Pomykala AMS2 J. Remington YN2 J. Shuler AMS2 M. Sledge AT2 B. Smith AE2 C. Stone N Z sf I l as VFA-146 YN2 J. Testa IS2 G. Torres AMH2 V. Tucker AZ2 R. Valencia AD2 T. Vinereanu A02 T. Wild AMS2 J. Williams AD2 P. Woodworth A02 D. Wright AE2 A. Wright A03 N. Adams AZ3 A. Archuletta AMS3 D. Blea A03 J. Campbell AK3 R. Cole 'Nm , . '-Q FJ: -.4 32 '24 . ..:,.Lh,.. 1:24 f' 429 ,.,,,.,,,.,, V. - v....f-ucv...-r......... -Nq......,................-.,. .. VFA-146 A03 J. Collinsvvorth A03 J. Davis AMS3 S. Deepchandani AD3 A. Ealer AD3 J. Fulleros AME3 P. Granados AT3 T. Gray AMH3 A. Green YN3 H. Greenwood AMH3 D. Guidry AK3 R. Hanet AT3 S. Harvey A03 R. Higgins AE3 A. Huls A03 T. Jenkins AZ3 R. Jones AT3 D. Judge AMH3 R. Keehn A03 F. Kennedy A03 L. Lee , - A 1 V 'T -T,E-ff., . '1q'g?r-?.Q.m1 -...NV flux ,I , , 4 3 O 'ff - ' J I: 2 Q .nf ' I S rf ie I VFA-146 YN3 E. Ortiz AK3 J. Ramirez PR3 R. Read PN3 J. Sanchez A03 S. Scavish AO3 T. Smith AO3 J. Spruill AE3 C. Stell AK3 R. Stellpflug AMS3 J. Thompson l AMH3 J. Tiner AMS3 M. Trask AD3 B. Vannattan AD3 M. Watkins AMSAN F. Aguilar AN M. Akers AKAN M. Alcaraz AOAN G. Alvarez AOAN S. Arnold AZAN D. Bailey inlz :A VFA-146 ADAN E. Bender AZAN S. Blackwell AMSAN C. Bolin ADAN A. Bruns AEAN S. Case AKAN J. Davis AN E. Falter AN J. Graves AN A. Harris AMSAN J. Helt ATAN R. Hoover AMSAN P. Hughes PRAN L. Lonemaw AMSAN M. McCammer AN C. Morales AN C. Mullins ATAN C. Naish ADAN S. Nelson AMEAN R. Nires AN A. Pauldine AMSAN G. Preibe AMHAN J. Ragland AOAN B. Richard AMSAN P. Rivera ATAN J. Robinson 4321? VFA-146 AMEAN J. Russell AN R. Smith ADAN N. Timko AN A. Tobin AMEAN T. Turcotte ADAN R. Winston AN T. Winters AN D. Wisner AA R. Bailey AEAA M. Brown AA A. Byrd AA H. Clarke ADAA J. Gaudy AA B. Hall AA C. Jones AA P. Lang AA T. Palafox AA J. Rummeriield AA A. Sharma AMSAA C. Taylor AEAA J. Tinsley AMSAR P. Sowden AR B. Asbell AR I. Brantrochez AR D. Farley AR T. Ferguson AZAR T. Head 433 , ,H 1 My 31-Y G12-Z me-7 In xv.-1 was ,: , Ji Qxfififfi fw fgifgf ii gs',1a iQ.f,i A r v rlzxffi I 0 344 v f. . 1 3, ff., ng . N1 'gig I I. V f ,f I V 'R . X' ,fgrfyl ww . ffl , 's.,AqmNvmr w 7 - .. N P - A 5 T SQ 5 f 'affkiflff . S- '11 I X F5 ' A x 1.3 k Q ' k X ., Q X VFA- 1 4 7 :iz ' 436 ' 7. - ' LCDR B. Imerman LCDR B. Makridis LCDR M. Mercado LCDR W. Nielsen LCDR C. Sonderman LT J. Baumgarten LT J. Burpee LT W. Dahl LT E. Holmberg LT J. Jacobson LT D. Lyon LT R. Molina LT T. O,Brian LT G. Petersen LT J. Turecek LT C. VanAsten LTJ G C. Caler ENS L. Arkins ENS W. Chaney ENS M. McCurdy K ,, .., . . .Y .....Y .-lv... Sv' ENS M. Warren ASCM W. Anderson AVCM J. Mckinzie AECS M. Denis ATCS R. Gorski AMCS P. Graham AMHC K. Curtis ADC G. Dille ADC R. Hayes ADC J. Hennessy AZC K. Japzon AMEC L. Raleigh AMSC D. Sadowski PNC D. Suratos ATC K. Vlfhitmore ATC D. Zylla AT1 F. Alumbaugh AMS1 D. Cline AT1 C. Dahl AMS1 K. Denison VFA-147 X 437 VFA-147 AO1 T. Donahue YN1 P. Dooner AO1 T. Espinoza AEl R. Flores A01 R. Green AME1 M. Kemp AD1 J. Lopez AO1 M. Lucky AMH1 B. Maronde AMH1 D. Seaman PR1 D. Smith AT1 R. Smith AZ1 N. Spratt AMS1 S. Westhof p 438 'ff ' 51 if VFA-147 AMS1 D. Willis AD2 M. Abalos AMS2 A. Albertson A02 W. Beaver AD2 G. Berger A02 D. Bond AE2 J. Ciganovich AMS2 S. Darnell AK2 B. DelaCruz AME2 J. English AMS2 R. Hall AMH2 L. Hernandez AD2 A. Hughes N f f i 439 VFA-147 44 PR2 J. Jones AE2 D. Larson AMS2 K. Lesmeister AT2 D. Maloy AE2 S. Martinez A02 R. Maslen A02 M. McAdory A02 W. McDowell AMS2 T. McGovern AZ2 R. Moffitt AE2 T. Morff AE2 S. Morrow AE2 K. Muegerl A02 B. Presas IS2 J. Rezendes AME2 L. Rinehart AME2 S. Roberts AMS2 A. Saldana A02 M. Smith AE2 R. Stryker AE2 W. Tomeck 15'-J O 29? VFA-147 AK2 R. Vinas MS2 M. Wagner AMH2 C. Winecke AD2 P. Wolentarski AD2 J. Woodard AT2 A. Young AMH2 J. Yu AO3 C. Adams AT3 J. Arkadie AMI-I3 T. Brown AT3 K. Cabbage AD3 W. Callaway AMS3 M. Calvillo AK3 K. Connor YN3 J. Curtis AT3 B. Davis AT3 D. Dennis PN3 C. Ewell AZ3 L. Farmer AK3 J. Flowers AE3 A. Gebre '-'El i-:sw 441 .xx ! 32-41- ,, my T :MMM 1. iw 1 . .,,. ., ,- l i l T 1 , l I . l 1 . li I l l I I . . l N N 1 I in, ,,, .Imp VFA-147 YN3 D. Gonzales AE3 S. Graham A03 A. Hale A03 E. Harrison YN3 M. Hildebrandt A03 D. Hoxie AT3 J. Hurd AK3 F. Johnson AE3 K. Jones AMS3 R. Kamai HM3 T. Leonard AT3 D. Loveland A03 E. Martinez PN3 J. Matro AT3 J. Mayer A03 M. Mothersead A03 J. Noack A03 J. Rodriguez PR3 M. Stellpflug AE3 D. Thurman AT3 R. Tilton AT3 W. Weaver AMH3 S. Whisnant AN M. Agar 3. f 442 V' VFA-147 AMSAN R. Allain AMSAN R. Allen AN J. Barrick AN S. Coulombe AN H. Couzin MSSN W. Craft ADAN A. Cronk ADAN S. Dallemand ADAN D. Feyerabend AOAN R. Fleitz ADAN G. Gonzalez AN J. Guerrier YNSN N. Gulley AZAN D. Kaas ADAN J. Lowery AN J. Lubo AN R. Mathes AKAN W. Mathis AN R. Middleton ADAN S. Mieszkowski AN J. Montelongo 'xg -5 ' -.. 443 VFA-147 ,X X, . 4 Y if . af, AMEAN R. Neumann AMSAN P. Phinney AMEAN L. Porter AOAN S. Robertson AMSAN A. Santos AMSAN K. Taylor AOAN A. Thurman AMEAN J. Turcotte PRAN W. Wofford AN G. Zezini AMSAA F. Chudziak AA S. Greany ADAN J. Guyton AA R. Guzman ADAA J. Hall 444 , A ,Aj 4 '?- . f' N, .17 N, ' 'T ' A Q ff N. f 1 I sl l l i l I I l VFA-147 AA E. Hatfield AA J. Logan AA J. Manssour AA R. Paris AA R. Reyes AMHAA D. Rosales AA A. Ruffin AA H. Tran ASAA C. Vonessen AA T. Williams AR J. Blaine AMSAR R. Bradford AR H. Gomez AR K. Jones 'xt 5 ' Y -,.- , 'QA I 445 L . ,gg-nv.-1 VS-33 'aff , s an nternationally Traveled Screwbirds of Sea Control Squadron 33 Q tvs-33jf1y the S-3B Viking, the most advanced carrier-based Under Sea Warfare CUSWJ and Surface Warfare CSUWD aircraft inthe World. Using 3 vast array of advanced avionics, acoustic and non-acoustic sensors, the Viking is capable of detecting, tracking, ocalizing, and destroying enemy submarines and surface units. The Viking has evolved into a true multi-mission force multiplier, critical to the successful operations of the carrier battle group. Since commissioning in 1960, the Screwbirds have earned the title World Famous and Internationally Traveled by Econducting operations around the world. During 16 major forward deployments, VS-33 has operated in the Pacific Ocean, Indian Ocean, Mediterranean Sea, Atlantic Ocean, Arabian Gulf, and off the coasts of China, Vietnam, and Central America. VS,-33,s awards include six Battle Efficiency awards, five Meritorious Unit Commendations, five Arnold J. Isbell trophies for A ,USW excellence, six Chief of Naval Operations Aviation Safety Awards, seven Golden Wrench Awards for maintenance excellence, ,land the CINCPACFLT Golden Anchor Award for Retention Excellence. The Screwbirds enjoyed great success on their deployment aboard USS NIMITZ CCVN 685 a d d t b f ll n areprou o eaparto t e :NIMlTZfNINE team. The Screwbirds were instrumental in providing strike support, electronic support, surface search and I '11 nce armed surface reconn ' g 5 Commissioned April 1, 1960, the 'fWorld Famou d I 3 1 isuwel 3 , aissance, under sea warfare, and in-flight refueling in support of operations in the Arabian Gulf land off the Taiwan Coast. P '7UD VS-33 LCDR W. Henderson LCDR P. Hennes LCDR S. Kelly LCDR A. St Clair LCDR G. Sullivan LT W. Agee LT S. Augustine LT G. Bowie LT J. Choi LT J. Cotter LT G. Dennis LT J. Dickenson LT F. Facyson LT C. Finch LT R. Fryer LT J. Jones LT M. Keimig LT M. Kingston LT T. Knight LT M. Leeney 448 ff. VS-33 LT T. Lown LT S. Martens LT T. Moore LT S. Morrissey LT M. O'Connor LT C. Sarnello LT R. Shuck LTJ G W. Franklin ENS M. Hopson CWO3 G. Brosnan CWO2 C. Maler CW02 W. Rios RMCM M. Ellington AMCS T. Martin AECS N. Pierce ADCS D. Valle AMSC S. Dolski ATC T. Johnson AEC D. Jones AMHC B. Karrick AMSC D. Layton . ADC J. Martin ATC D. O'Melia N ': 449 VS-33 .f , , . 1:2- - ' le vfpgfg. :Q ,N AMEC K. O'Nea1 AOC M. Thompson AWC C. Webb AKC R. Wright AZ1 S. Baer AD1 O. Balangcod AD1 N. Corpuz ATl D. Deaton PN1 W. Eslao AE1 D. Ford AME1 R. Francis AZ1 P. Fulgham AT1 P. Fuller AMS1 S. Goins PR1 R. Hafner AE1 S. Horan AMSl R. Kerr AME1 J. Leonguerrero YN1 M. McGinnis AW1 T. Meyer I x X Y we-Y W. f V , f AE1 D. Miller AO1 T. Pitts ADl L. Seeram A01 N. Stafford AD1 R. Tallorin AT1 T. Toles AT1 A. Turcic AD2 M. Anderson AZ2 S. Cochran AE2 D. Daniels AMH2 R. Duquez DK2 R. Edralin AK2 F. Feliciano AT2 J. Francis AT2 K. Garrison HM2 R. Geshel AZ2 C. Glass AD2 J. Guiang AE2 M. Hite AZ2 G. Jeffery VS-33 'Ng f F? 451 --4-.4....w.,..,,. ...-1-.... 0- - V - - - ' -- -0 ' ' ' '- VS-33 4 , l E , i 1. F Q, L 115 tl H 'l il 1. . I I , W I f AZ2 M. Kaesberg AE2 J. Katzenstein PN2 D. Kohn AW2 B. Kunz AE2 D. Manassa AT2 R. Matheny AMS2 D. Mclnnis AME2 S. Moore AD2 J. Oliver AW2 D. Penfold MS2 P. Rojas AZ2 T. Ryan AME2 C. Smith MS2 D. Vasquez A02 M. Williams AK3 E. Agcaoili A03 C. Applegate MS3 K. Beck YN3 M. Benton A .- if VS-33 AE3 G. Boddie AT3 J. Brandt AK3 D. Bratcher AT3 E. Burgess AMS3 G. Burgin A03 P. Burns AME8 C. Cain AMS3 S. Cale AT3 W. Chambers AW3 C. Compian AD3 J. Contreras AD3 D. DeSim0ne AE3 N. Eckhaus YN3 S. Etcheverry AW3 T. Forsell AW3 M. Foster AO3 J. Graham AT3 T. Graham AT3 F. Hardee AME3 S. Hensley AK3 R. Keeler xl 5 ' '4i11? q - , . Q: 453 --A-Aran-h.An-..n...-,k -. - Y V H -11.11-ian-2 l VS-33 fzbi u., 454 YN3 S. Lawrence MS3 J. Leyba AT3 F. Linskey AO3 K. Malachi AMS3 M. Manicke A PR3 C. Marrese AMH3 R. McBratney AD3 D. McComas AME3 W. Morris AS3 J. Nall AO3 K. Payne MS3 E. Porter AMS3 D. Rivera AT3 A. Salas A03 R. Santos AE3 M. Staab VS-33 'Ill -QPSN A , ' M Q1 'iw PN3 C. Stattel AT3 C. Stevenson AW3 R. Tellez AD3 E. Torres AME3 S. Turner AW3 N. Wilson AN A. Bataan AMHAN J. CotoSandoval AMSAN W. Daniel AN T. Griffis ADAN A. Hernandez ASAN W. Jones AMSAN M. Lifsey AMHAN C. Mateu AMSAN J. McCloud '1 'Wg' 455 --. VS 33 1 1121 qw, f C f I , I 1 . f 4, i fgf, ff ! If 1 , Q ' -Q 6, 4: gf L i AKAN H. Miller AMSAN D. Moore ' AKAN J. Morales AN D. Motley f A , A ADAN M. Muldoon ADAN M. Parker A AMSAN E. Parsons PRAN D. Rias ' ADAN E. Ruiz-Cales . PRAN E. Sarracino AOAN S. Stoddard i K L u ' n ADAN M. Tariq AMSAN V. Wawrzyniak AN M. Wills AMSAN T. Yarnell AA M. Alfini l AA S. Goodine AMSAA J. Karther AMSAA J. Kowalla AA M. Landry - . AA C. McCraW Xi A x 456 VS-33 AA C. Montgomery ADAA K. Nguy AMSAA B. Rickett AMSAA D. Rockot AA J. Shulley AA D. Spark AA J. Tomaszewski ATAA K. Walters PN SR B. Bielatowicz AR J. Fowler AMEAR B. Hubbell AR R. Pearson AR B. Wheeler .- N . Q., , 4 fx. 11, 1 lk, A A I AMHAR J. Wurster N ff ! 'fr' 457 A B 1 32:1 Qbiiv' K ,f av-1. 1 , , 'ixliifl 52, as .- X- f ,,, NX -n X vb? , K fr , Xyzz -- fri' ,A , - Wai: Q 2 3:8 ,X A f . A-,,.E,g .-g M . -3-'Q X 1, if i -5 , kia: X 'PX 'sv N-X -il X-.Xfw 'X W :,. fig' 1 ' -. fi.r.XX3a:Z:i.a2 --: 1, VXI- X5-gsfizv , .- -- XXX.:- T 1 mi- E.-1. Q fs--aim wwf: X X, 'iii 54 'b ' Q: 11,9 ifx' N- .. N ,,X,-ff? , 5129. 2 'Q-'T-X WRT- FSI- E E4 -, X . 15.-1-f 311, XXX-X .K X X-.tw 1, .5 X- X t Ag- XA X-51-A ,gmt ,ffiqf X-.rf . -'egg ITF.-ii- Qflg. ,QNX L xr, -,X af 2- -Xena ---1 X. -X 1--:Ag 1341: I- .f4',11' X fm., 1 '. -X:uXX -XX -X- - :ug X X -fm X 5 X533 K .15 X X X -gf,-gg gf, X '-N-1fQ-- xii- XT 4'-X-533. Q r Xl X -1:53 -Q:-2 : X. X S- '- ,- X5-2-X 9- - '11 5155?-Zim - .: wa'S4m - ' 11---1 X515 Q -. - XRSSX ss.. .- - .--xiii. :X - X.EfiiJ-EX-X 2 :. X X - ffisx X X X iv, E ,XTX-. . .Win X--X K 'bl P S 1 of up to fours different carriers at currently embarked in North at this new site on October 1, 1994. This move allowed the squadron to coordinate and west coast air wings and battle ou s. T d V gr p 0 ay, Q-5 is at full operational strength and often time. 1 first deployed as a detachment in USS KITTY HAWK CCV 635 in June 1994 the detachment had a mere three month stand-down before VQ-5 detachment to participate in the full set of air Wing Det Charlie again deployed on a six-month WestPac and Grou p- 9 ne maintenance, one intelligence officer, and This compact and efficient unit has have supported several VQ-5 LCDR S. Bergesen LCDR B. Eilertsen LT D. Lucka LT J. Prickett LT M. Utley ENS M. Wells ATC D. Cross ADC D. Morton AE1 C. Davis AT1 D. LaJoie AME1 J. McNally AZ1 M. McNeail AT1 C. Mills AT1 S. Nichols AMH1 M. Robinson WJ 0 f VQ-5 AD1 O. Scott CTT1 A. Stout AD2 J. Amenhauser AME2 J. Brazil AMS2 P. Leonard PR2 T. Sanders AK2 C. Williams AME2 J. Winter AT3 P. Boes MS3 M. Brown AT3 K. Curtis IS3 B. Fields A03 R. Gilmore AD3 D. Harkin YN3 T. Jackson X4 461 Q- HM3 M. Kennedy AMS3 J. Larson AE3 D. Latimer AMS3 S. Minatre AMH3 J. Ramirez AT3 J. Ruisi AMS3 R. Smith AT3 M. Weber AMSAN E. Brunson ADAN C. Criado , FD ..f1g,Wn. .K NN W , 212 ff 113 W I , ymwihasjgpyf 1, -f , , 1 M. X y' ln . ,vi .fa -' ,'i 'Wa f If F.. UL. x., Y ' I PM-Vif 'W'lifW if V 1 151 l I 1 A VQ-5 ATAN M. Delzell AEAN J. Haley AOAN L. Holland ATAN C. Hussey AOAN R. Randolph PNSN C. Rouse ATAN M. VanSchaemelhovt AEAN S. Young AA L. Dittbrenner AKAA J. Trevino N 'Lil lllz :A 'f f 463 Win be in su th Early Warning Squadrons based at Naval Air Station aircraft, the primary mission of VAW-112 is to provide g and battle group. The E-2C Group II active and forces critical time to react. The Hawkeye's extensive tween Warfare commanders and their assets. The as part of the battle group. The five-person all levels of operation in which the battle group may 311 deployment and the Golden Hawks' 25th year ch. locations as Cold Lake, Canada, Honduras, as JADOIJ EZ, Red Flag, Roving Sands, and e E-zo Group II is a key part of all battleplans d - ' 33 officers of VAWp 112 Work as a team to is truly the eyes and ears ofthe battle that have confrontedthem and have been the 1995-96 WestPac deployment. pi 1 ,WN T ll- VAW-112 4 LCDR S. Baldree LCDR R. Hajek LCDR J. O'Brien LCDR J. Stocks LT A. Boswell LT L. Bozzelli LT R. Cinco LT T. Dobbert LT C. Griffin LT F. Heyward LT K. Hobmann LT W. Holcomb LT C. Kenefick LT S. Koenig LT P. Learned LT A. Limberg LT N. Marusich LT E. Michaelson LT M. Miller LT D. Peacott LT M. Roberts LT J. Schmidt LT C. Schneider LT F. Trayers LT J. Vannice 'Q jsit' - .... ?7 ff X, .fl kr X f J I VAW-1 12 LT E. Webster LT J. White LT R. Williams LTJ G W. Latchford CW02 F. Icona AFCM M. Dublin ENCM N. Francisco AMCS L. Butler ATCS D. Clark AMCS J. May AZCS J. Phillips YNCS P. Smith ADC R. Abadesco 'xi 5 ' 1. .,. 4 I I II ,I I I II Il I I I I I I I I I I I I , . I I I I I I I I I I I II I 'I , VAW-112 ATC K. Clark AEC R. Marsh ATC D. Spurlock AMHC E. White AZ1 F. Bogar AD1 G. Bonilla PR1 D. Cerillo AMH1 L. Charvet PN1 J. Clarkson AE1 R. Dooly AD1 S. Drenning AZ1 D. Ferrell AT1 J. Fritz AME1 F. Garnab AT1 G. Huber AE1 J. Johnson MS1 L. Manrique AMEl T. Martin AMS1 N. Morris AK1 A. Moss AMS1 N. Nolen YN1 L. Parker IT RELEASI I , , f A VAW-1 12 AMS2 T. Nichols AT2 T. Ongtawco AZ2 E. Pruitt AZ2 C. Roysden AMS2 S. Sabatino AE2 D. Smith AK2 R. Springer AT2 T. Stephenson MS2 N. Villanueva AD3 C. Ball AK3 E. Bloomer YN3 C. Brown AT3 B. Bullock AMH3 W. Campbell AK3 E. Dailey PN3 E. Dascher AE3 M. Davis AMS3 N. DeJesus AMH3 A. Dingemanse AMS3 B. Evins AT3 J. Forbes AZ3 S. Gardipee l l , l l 'D '4' , M VAW-1 12 AE3 C. Gilpin AK3 R. Godre MS3 J. Haka AZ3 J. Hance HM3 M. Hendricks AT3 A. Hernandez AD3 J. Hix AK3 T. Howard AMS3 J. Jablonski AD3 J. Lababit AMS3 K. Nichols AME3 T. Nolen YN3 J. Oates AMH3 R. Pickett AE3 M. Ream PN3 G. Robertson MS3 M. Rodriguez AT3 H. Slaughter AD3 A. Southwell ADAN G. Asher AMEAN N. Beltranmeza MSSN W. Booker N- g. ': .A 471 ' D f 472 VAW-1 12 AN C. Boutilier AMSAN D. Dvorak AN E. Fields AMSAN A. Fortin AMHAN J. Hartley AMSAN K. Henry AMSAN S. Hinze PRAN L. Ibarra AKAN R. Lawless AMSAN T. Lee PRAN M. Lucas ADAN M. McCauley ADAN R. Nickel AMHAN B. Reeves ADAN J. Scott AMSAN S. Smith AN J. Staples EXIT RELEASE L S s l sf' VAW-1 12 AMEAN J. Stout T A AA K. Cebulski AA J. Clark L KV X AA S. Dixon A A' A S ' A n AA P. Hernandez A AA J. Lavin AA T. Lebeau AA M. Lucht AA E. Simpson AMSAA J. Taylor AA T. Walker AA M. Wear AR H.. Buezo AR J. Delgado AR D. Frye AR K. Kilkenny AR C. Mosher AR W. Samson l N , - 473 A .41 J, VRC-30 LT J. Alves LT R. Baron LT C. Grant LT B. Wysocki LTJ G R. Budge CW04 D. Garcia AEC C. Hines ADC R. Vergara AMS1 L. Darvin AMS1 A. Erasquin AMH1 G. Hadley AD1 G. Lorenzo AKl A. Marquez -1- -V-W - .. . '-N. .1 AMEI E. Moran D L, VRC-30 YN1 R. Schultze AT1 M. Smith AE1 S. Stay AMS1 T. Tan AE1 C. Tinsley AD2 E. Abella AMI-I2 C. Acosta AD2 D. Aguilera AD2 C. Alexander AT2 N. Baker AD2 M. Burke AD2 E. Canto PR2 D. Clark xl 5 ' 1.5 ' 477 VRC-30 AE2 M. Dicamillo AD2 G. Greterman AZ2 W. MacDone11 PR2 J. Stone AMS2 R. Vincent AMS2 W. Woods AMH3 R. Bernheimer AT3 W. Heath AZ3 S. Trout AD3 R. Valdez AMS2, R. Vaughn Q , .f 3 if 47 a 1? ?f n-J' RN. VRC AE3 B. Yarwick AN C. Dawson -30 AMHAN N. Figueroa AKAN H. Harbin AMHAN J. Johnston AN A. Lara AMSAN M. Micale AMEAN G. Nicholson AN J. Stork AA G. Abernathy AA G. Collier '54 K-- ' 14 . ,, 479 +15 , 4 V V X, fy ff 'f, f,A f , , f 1 l A ViN........... .7, r F fl 432 r Late Arrivals CAPT F. Ludwig CAPT T. Vaughn LCDR M. Monaghan LCDR B. Pearson LCDR T. Sweet LT G. Collazo LT T. Elliott LT A. Gardinal LT C. McCarthy LT G. Mensah LT M. Valadez ENS E. Brown CWO2 W. Charboneau ATCS B. Beck MMCS S. Morales SKC B. Bentley HTC J. Brown ABHC D. Charles ABHC R. Curran ABFC J. Edwards DCC H. Leal ETC P. Monasky ABEC R. Oliver MMC L. Rogers AKC K. Schofield HMl H. Acuna ADl T. Bass ATI R. Bullins ADl J. Caruso MMI T. Cureton Late Arrivals BMI J. Fryer DK1 W. Gaines EM I R. Gilbert ATI K. Hale TMI R. Mebert ATI J. Ouzts HMI J. Pate MAI B. Peterson RMI J. Pozzi ABFI R. Pruden ACI Y. Sanchez MMI S. Thilmony MM I R. Wallace MMI A. Woods BM2 O. Abernathy DK2 R. Arana AT2 R. Burnam SK2 G. Clifton AK2 S. Collins AK2 B. Dela C1112 AT2 P. Gray ABE2 J. Hudson ET2 K. Kennedy ABF2 D. Koon AE2 C. Labat AMS2 P. Leonard EM2 R. Messier EM2 C. Michel ABF2 R. Miller Sgt R. Miranda 'gl j. 'PET ' ir' 483 Late Arrivals AK2 D. Pedretti AME2 C. Prochot AZ2 L. Rogers EM2 J . Rosen ABH2 H. Schmidt MM2 B. Sparby SK2 M. White AD2 E. Wolfelt BM2 J. Yoakum AT3 J. Albright AG3 M. Anderson SK3 J. Cook AG3 S. Fowler RM3 D. Galloway MM3 B. Gholson EN3 B. Grout ET3 B. Gump DK3 M. Hamill MM3 M. Henderson FC3 F. Huebel IC3 L. Jones PH3 M. Magee IS3 M. Medina MA3 C. Montrose DC3 P. Nelson FC3 D. Newsome EW3 J. Pfingsten ABF3 A. Pomales DP3 D. Schyvincht OS3 C. Shaw I fig , .n9 a. xx 555 ' za' 1 l L gl K l l l Late Arrivals IC3 D. Shephard EM3 T. Solos DC3 T. Stuart MA3 D. Webster EM3 T. Zachry AN R. Cintron YNSN E. Conaway AN A. Flores ABEAN J. Foster EWFN T. Kutz ABHAN T. Lee AN L. Mercado SN D. Morin HN G. Olson AB FAN E. Peretto EMFN R. Sexton SHSN J. Smith SN J. Walker DKSN R. Weems DN M. Young SA B. Adams ABHAA S. Alphonso SAM. Bell AKAA G. Besong AAB. Collins St, Q had 485 r Late Arrivals 4 PHAA G. Cook AZAA L. Erickson AA C. Fox S A L. Gantt AMEAA P. Gor AA D. Graves ABEAA T. Jenkins EMFA L. Kemer YNSA D. Penzo ATAA E. Stallnian FA D. Wooden AR J . Barksdale AR W. Bradley AR S. Brown YNSRK. Carroll AR J. Duncan SR M. Estes SRB. Fiene AR J. Flores AR A. Garcia AR C. Gardner AR K. Harris AR S. Hawkey AR R. Hays SR B. Jackson SR C. Johnson AR J. Johnson MSSR J. Keele AR M. Krogen AB HAR D. Kukasky 5:21- --L. 86 ' 1 i V N J n nf Q QFTKSLS 'K fi ' Late Arrivals MRFR T. Luu AR Q. Minor ABFAR J. Nanez AR T. Nishida ABFAR J. Page SR D. Payne AR R. Perez AR C. Pratt AR M. Sadus FR J. Schmaljohn SR C. Scott AR R. Scott AR S. Shepherdson ARR. Simpkins ABFARL. Slaughter AR A. Standfeld SR W. Sterling AR J. Vogel AR D. Washington QMSR C. Weekes AR J. Wise SR A. Wood ABHAR S. Woods AR B. Wynn N 487 ligg Tiger Cruise W M f w . ,IVI Q ,1- x 488 5 1 ':? .. . ,- . ,gcgfigj ' V s. ' fy f ,sa I- .11 w lx .lnxp 'ai 1 'T SQ I r I Q, xx. , QCA , X - 4 Sw V Q 1? 3 Q f,,.,f' O54 A w4,,,X krr, ,.3,,i.,.fV5 , , r f +,'fn.,- - 1 f N31 'Y N ,, X. ., X , x 3 'f,f,3fIZ'fS' W f , ,i fg.i4'qhi,7a!f I , X , A, , ,, , f X 1 x f f f 1 , Q dw ,,..,,-V. v 'Q' ' Y x X .fm Tiger Cruise , . W 4 1 f X , ' Q? Blur llinxnomi 'Nm ' vEf? ' . --- an :ww -' - QI-'A-f f. .- A 4, 4. V . 1 AT1 Mark Smith, VRC-30 TE M IMITZ J V. 'r A 2 ,, -.mil 'I N- 531 . V SK3 Ringman, S-1 Div. H Place BD. lace SMCS Kurt Lyons, Navigation Dept. Place PHOT0 CGNTE T LCPLM Mi11on,MARDET Honorable Mention Ss, -'6is3'? ' - - ' f JI--:Q--- :4 -if 493 Shelby Bender Kyle Callahan Claire Jennings Kaitlyn Kenney Gabrielle Manglicrnot Joseph Edralin Meagan Melendez Tyler Wayne Mariah Mesa Caleb Robertson Pedro Canales Jr. Nicholas Wauer Tristan Arnold Juliette Hoxie David Lakeman Nichole Montour Isaiah Jean Pierre Eric Moye Neil Patton Micah Nance W, 1 K 'Qin '---N. 494 1 TZIN N New Addition , J if Wf 1, Qi , Q may H, J Wffr, .ff cf ,uf X- 74 yin wyfff'-f ' - :Q-iff ' fffsf H f- f'2-'fz-51- , f ,1-' 1' 1 M4 M, ., A , V, ,V ,s,,y P f .- U 4 'P f . 1:5-'if' , 9 .,f,f,. iv, 1 ,f f, an if ,ff , , fn , dm. , - , Q! t f A M Jill X Ma. ..f..f xx f 3f,. V ' 4 Q, , 1 Q , 55 P5 ' N EQ f . . -. L1 1 Eur 'gi fi. sw . XJGQQ, , , . , I , ,,.,,v 'w-1 I ini 1 lm' 1 f f 'F Xl l ff s. N 74 : we x- V,-' f . ,vff ' it H I M, . P K a gy W, ff f if Aww , , 3 . ' l Z 3 Xljfw- 1, y . ,451 w i ,ff ' 1 K5 7 Milf!! 7 R F, ' if f' ,. 7 1 . l i L ' , ,lf fl 'B I 4 s, iw, X' lx fmggss Q V 35' 5 I -5 MCH' 1 .xx I nf. X A -' 1 F if I, ' s -.xl fp 9' VO., iff' im' aff. gl , 2 X A . wi hi., fl 'R +- .,ga 1: .. 1 , , as y - ,.,u A . , K - 11 - , P . 'ff ,Q v. Zllllf' Row lux Htl i f 15-ff! flgx ilfllll, l'l'I5, 1' I.. 15. l- -I ,H ,i, 4' ' , B I i f t hi 1 ' J-qt ff ' w . -.-1 - . fir s., ' ,ix , 52322 1 A . W, Q F: V , - ' fx 25: 0 l A 52 ,, 1 ' . , fy fl . 11,57 ' 7 'P' -sf 5 x f 5, . ,gg 4 F , I, ,, .. .lv Q, F , wr' ,, , rfb R A my 'W . f ' yn, ff 'Nm Carter Peccoz Jonathan Koch Samuel Zachary Wesley Hawkins Anjali Sukhdeo Kristin Wilson Ricky Francis Jr. Jonathan Fullerton Callie Turner Kristen White Shane Jordan Josseline Figueroa Nathan Jones Eric Savage Alex and Ryan Wildblood Christian McCann Ian Ferguson Raven Marrese Alanna Mason Christine Farinas Christy Tripp Destiny Post Cassidy Williams Stephen Rowan 495 if 4 , ,, . 'fa, ,' ' , F ,, . . . M4 I ,J fi , 1 - 'f x' 1 Q 1 my . g -,.,1,,4. K. ,,,,.,. . ,f,f', JA' 4' , ' V , 'L,'AQ',.' ' ?, ,A . , , , ., , ,I . .K J, , N x A, V . ,f ' ' . V, I .91 ., , , V, , I , M M . ', , - 1, . Q f .' J. ' , ' '.'., ' ', 1251 .J ,.,,- ' 1. .J ,'..1' I-A ' ' f. fav ,' - ' 4' '- f 1 r ' ' ,. ,,.' Q.. V rx ,,,- , , ,J N . r .fj,. W- , .v ' V, ,, ' . -m ' ' ' , 1. ,' 'D . ,. V, 'f 7 .. , , .f. , 4 ' f 4 1 , , .1 - .nw Na+ . -- 'fr '- A . .L ., , ' 'We . V' 'w. ,,V , 3:-. ,,, , f e 'nf ' 1, .V-Q.. 4 .r.' I . ,1'. ,,. - ,. .f : JI 4 ,,, V. 1 7 it pf- 1 A L, N- , .f f .V ,, ,A - H' :, ' f o,' ,' fy. mf' . ,, ff 0 Q f ,Hr .ff V7 f .. If 4 . Q , . . 1 v A Q., . 41- . rv. J Q, s , 'Q ' 5. nd' .. V - VS , L F 'fx .. + .':.- .. 'u fl hge- N, W ,. f , U, , I-.f , v l,v K K- , mv fw nr .H-F, 11 .w. '.'.' Y . r' ' r I . , ,',q.. 5 'iz 6.46. 0 ,. 4. 'o ri K: nf u--if . I Q .gf-, - s.. , Ax. .. -.fry , :,. .1 fm f , f ,S '.'- 'H' . -- , .1 1 f 1 .,,. ' , 5'-ff A' ,., L . . . . , , ' - ' .si- , ' . - I - v wi.,- ,.' ,.a- +1 .b , ' . f . ,,'P, -1 - X X f , s ', I ' -s ,l, L,-Q ,fv-i , l L .Zb- 4' . ,,+f,-ff' - -,gfjgg 5-9. y.. .4 . 'TQ' af! I -pi -V ? ,V A, vs In ' I -' . - -if fra - '.-- 3.2. , , ..f --l 1- Q- -ff!f'i-Q-'ah ' ..:?' , . f gp:1f1..f-I -fu-:v'F.' ,.. 9 V L 7' '3 ? 'iff-. Jg 1 Dfw' V' ' Y 401' il.--vw A, .Q .Q k , 4 A. MA. as ,- , V rp 8. Q . 4 . x- ,. , f ' , -1 ' , ' -' iv. Fm., aw: 'NV J. , 'via' . - X .gif 'XA 1 ,3 X :Q -QI' g,,ii.,5'iQ:fyf I Z.. , . fl, I- 1 -' sqm . .1 .-'J Q - f ,Qfblj .'-.4.'f.4. 'W wg .gf 'Qi . jg-iw.. .+ gg.. ,. . Q., A 59 -v,- -' Qu - ,,.'5- '1 -- i5-X-Q-' ,AQ 'UF' f N Y' K 1 K- I , 4 ' k - . ',- ff.. ' . - gt '51, ,..-.+ F-iv . Lf.. - -X 4 ff .eff , . 1 ' , . a -- 'K k , v ,gf fs' . 0 . f, J. , . , st f.kt:,:1u'qt Q 3 . . -. u .:.4?5,.V kv, . argl 1 Q-. , 5 K iw? QL!! j.P5f' .- 1 ' fx- ' 4' Qian-,.?f' '-'el -?..f 3 - '. ' ' -- ' . . . 'Mf. 'J P' ' 1 '-,' . ' x L .H A .a-Q -' - QM' -' , .., 13 I H- , -,go ..f . ' ,. ' xx rj .I kv ,Q D -1 ...X .. , 1. QL- ' I .s, f 'L mf'-.JS A'-.f as ' 7 .- , , ' , .K 'Hn r . S Yr, k.Y..q.,, .. WS.. .dxf Q . Qi, 1 Si., K in .4351 . . ,YH .. Xw' A ' - . , - , '3 'FX was X ' ' . ' V' L f M , .. 'fhfe' N ,-yi' K'-1'w?t'4qj-I fl. -., Q 91 ,..AQf,.-i- -' .L L . '-Q ,N . 35? , .asf-, Z 1 J' . A V ..-f . F - X ' ' -- -4'-- . p -'AW' ' .X ' 3 ' -x f g' . .Arif K - 0 ,, ,f ,rf ' H fa'-, .k :Q ,. f f-A.1'-'M ...N T-X... .. .31-+ f., , ' - .- ' -' M 1' . . cw f f,w'v .-fi' M -. . -vm . .S1 na' - ' ' ,vw 1- X '- .1 . L ...A . K -w' -- ,-QKJI. hx .,k -12 ' ' .51-fy' ' . . A X ,gh QQ.-.1i'? :why .4 4 fx, , 3- .- Aww -4, 'Af N. ---, A.k,g'g.kQ fgv - A f - .. Y I x. S X v . 4. 4-Q'-ve' s ... ,,n!' s - J - X . . .3 . . .v .,f.g.g .,: ,,.:?gi.,lA, -,. . -Jfqffi., ' ,hs hyggz, , .Q-hog -3:4 --jx 5kiL,i. - 4 , , 4 .K nj-4 '- , 4 f nn ' . . 1.33 f--.A .Q 'pf .1 ' I A V 1' n ' '-,r',..b . '.. in ' I , 1 , ,fi X., .gQ.N'f'fg.-.nge-s 'I'-f 15, -- v lf. ,. xv... . N R90-. . , rx, x .X J... . -' .34 . .' A . '... P - Y 'Q' .' 4,6 ...-,ff - r S 'WA !'X,.yL ny - -43,-Q' 1., 6?-1'--1 1'b..Ql -I ' 'X vf ' - .-- . -5 .-b .Q is ff , -. ' Q .- ' - nf-.v -' .. .A .xr n 5 , a '.3a, 'Y ' ',.' 5.51.36 f,5n-52, 5 f'5f ?,'Q-1' rf: . ff .' -,f .1 ' .Y , , hr' .- yi ' .2 -'.' . . Q-YA A V-4 - , - - ' K','og.. 4'-Q v , ' ' Q J Q b df .' u 5 1, . U' inf 9' .9 -' ' nib --' '.L. 3. 'f'Tf iv 4K full . f --Y wg . A, V - ,X .. . x xv, Y- -L - -. . Q . v 1 , fy is - X: .X fa HV . ' 4 . f - 'Q' . . ffl, 'hp 1 I . ' ,..E., N 5,31 - Al, . - - k .L s . Sf' ' , K .f . '-ifvyil -1 - as 2 - ' ' ' f ' ,ev . f K, . .Q .' 1 i.. ,, Q . 1 W . - s ' f' , . K . ,,,. if 4 31 . Q' TQ' '-. ..,v.:, V. J nn I n a I ' ,,. I, ,v ' 47' Q .,,,, 'Y :Xa 'H gy 41 ,ki -'Y U V Ii' x AWA 6 . . 4 .f .Jiix :jets . 1 ,-gfvh f 'iz' 4. xii? X 3 -'aff' ' ' 3 '-'S .II S If :Gs fx A' I ' ,W I X fl, 4 ef' as A . Q g n 5 0 1 q, I M ., ' ' N 5 fa '--1. , is u', '-yn, ,Tri 5 , f. 75 . Sw 'N I ,G 4 f. 4 .D .4 sm Y .A , 1 -s Y 'N - fl' A ,, K Vs n 'i ' -ar, ,y W -.. -S.. tm:-I I fffga K , iii ,af Ln, 'W' QY . ' l ' ' : , 'K' Q S w 4, gh 4 x ff' 1 'Vs 1.0 ,N f-ss. 4 I Ab. .. . ,,,, 'AN L, ,yyni :S VT ' ' tm x nf N- rm 2 - 'wi , , ' :xg . , 1 .,-h 1, Q .mx f L. . , . r ML V TW ifU.f:, .,',?, X Wkggrifigfi , ,5,5.,3'f,I,75g:'1,1..5f,g, :J x Q If 1 gf' KO, f ,I I 1 .--1 gn Q I 1 ,,,..,, as nu Y 3-,,W..! I -.2 A:4,,,,:,,,,, ..,,..,, ' f ,,,-,.:' ' ' ' 1 1 f. a, ,C-.mx L X wx Q Xa-,sp 4 N M TZ Memories During a six-month deployment, Sailors encounter many different people and cultures. These experiences develop into memories which will last a lifetime. Memories are not only found ashore, but many memories that will stick with NIMITZININE Sailors are experienced on board as Well. 92? ' v sf , .JA A. VYQK M5 ,W za as Kiwis 0 we K ,,, . ,I ,V , 1 g-341. 1 a vi f,,.,-i ,rw ,.,,........... , V VM., . .vtv.,- - 1-1 Q amil Crui e July 29 1995 th 1v , 'D 2 -wqlgt-?..xm1 .N ' 7 ' lt ! X. , l 5 NA X, :X A ,iff TEEL BEACH ff P CNIC ,ff 1.0, . E ! l 5 ff 7 fl ' . I In ,f' 222' --., l 502 7 F x I Eg iw A l4', 7 'K 1' VK A-X . . 7 , ,gkgf IL fff-JVY, , 5.13 A U P 5fJ1Y.XV XAX XX Q' 'B' ,PX NJPXJN gc f-., figff- X 2 ,R rx 4 541 ,wil mi, f'.f,.u'f : A 2, ff- X .vtggr 'if-, -Q , Fi w :I 201.1 My 1 5'qv ?,.,'- ,SX K ig. ,N gy, -A ,Af xxx fi? ' 5 HT-'ji' 2 I X Rf f ' ,L.,, , Q, -1' in Vvfgxxfx. lu -1 xff,5M'H' -A-'.' XX 13 XX , 'ufh-4.1.-.1 ' , W vi I 1 A , A G'-f-an . shag, gm, s , ...W M f 1 'g BURN N CALORIE Q N ., x N -Q , wfxps:-X - - - ' 1 f1..gk.gg x '12:: ggrg1L X w,x,VN-W. .-, --we 1 ., sw x x Mx: XM. ., . -N x gg, J -: f Q11 ' 'l,1'3ww-u'fv: N ygg: - 4 s, I V ,,,-vm., DAY SERVICE ...L- I X I 2 lil jx Q. 2 1 1. ' :Q .D api Af -'L Q., '22 il :Q n lil lLl , , 1. 4.12- -df' A,,:1f A., , , az- xg 3 V Q J' ff' xig . 4 , . . .Nw xy. 'x'f f V' N c ? was , ,. x ...ff A, A ' ff s21wvf'zv.-Q-:sv ,, . A '73 V ' -1. HW: ..- 4 Y 5 ilffl' -. K , .vyyg J, X' K SML.. ,Q , M' , X - f 4 1- . .- LW ' -1-,N-N x WN .. .,,,. . ,Rl Team AQWEWV .X W5 ., v::ff?3Givi? g:f3-1,'irll 1 v 'f' ,f I. ,,,, , , I i 74'-ri' ' 4 ,f-'f',l'T'Fffm-wff V - - 'Ju ,jgjqezggg 'gg Wing '- -. -1U:w1.f,fggJ,zqf1-gg 2 ' f X 2,5 Y . , if , , 11 f 4 vt. iw, ' 1 .1 ! , lux, - , f , n,, 7 f 4 1 9 - 9 I Sf, Y' A 1995-1995 , ,,yi V 1 1::c7J.Q.f1' A f, . fmeqg' F' fqffg, Z Y X ,,., 1 xr, f.-f- , , . ,, . X 1 fiifkf, ,ww P391 .,,x , J iw yy 3.-wp. ,- ..Q.. Q n l V I QU -magnum! Homecoming 3 San Diego ' E Ni! le 3? l 1 2 FE +L v 2 ,r ii ?, 4 'L J I ' 1 g IE I' ti V 1, i E1 Ai H 4:5 o . L , i Q os ,, -ef fi 5 3 J-Eg ssv ,IQ i ,il 1: if 2-A af' 235 H ,! Q 5 v .x.N.-R214 L . 5 Y 4 'Y v I X XKNX 1 2 , ' 1 ,,,,..i,,,nnmr1rlll1. I , SW wi, Lrg A dll fl'- San Diego N t .. .MN ' -:- l'.fiy,',-. s x , Q 14 f V65 FDU 1 .'w. . 1 HN 'V I vwz-4 ., f 3 fl il x 1 lg' I ..-- f k'x 1 1 J 1' 1 ' , xi, J I, 15 , Li! : -J x ', ,j lY' 5 gli x -Sf.-.5 4 'N-. 4 'FN -'swf Q v, , ,W ,,.,.,g.,,,,,Q,,i,,,, 'vw' J' . wfmxwmyw ww 7 ffW,4N ef q xiff F xsf ' 9 MD2C g1Esi MDMJ wmv wus sump mmwmrv enum i Home Again Bremerton if , ,, Qi 1 ' 27. a ' L ,w?f,f5 ? '4WX, I1 . V f 6 Vey, f 'QWK ' W - ' 1954323 I 4 ,V 'll -'fy .,,A H M sw xxwxx v -1 ' - f 7 f v . g,,1p,'1 1 1-,ff ' Miki wHt,i?2'a,f,1 .'A 1 1 1 I I 1 I I u 1 K W 1 5 1 Y 11 Z 1 J fr, 1' gi if Wai -Etisfbj 1 X W V 1 1 1 I Q 1 1 1 I 13 'N -1- 1 17 'fi WH .CQ nw 1 I 1 1 1 1 1 1 1 1 1 1 ,f N. . yfv W, ' ,V V, 1,14 ,A IW, w,14H,1 ffwlvc W ,V ,ay Yf, , 41,7 f X, X! X 1 A H ' ! I I X4 I E 5 I ' I 3 w M 5 ! S 1 w I 5 W, X Wu... 4 1 aw' If TX' I 4 Q ' A f if N-.5 1 w ,Fx-FN S S A X X x N x N f- ws -lbw f ug- b.'f 1 34 qg WA X533 Swv T' HV, Mudd! f ix. N L 'Ky ...Q-ff' 143 ,,. HA , -3 I1 ,A 2 Nr' W9 f w1..., s N 'mu ,fi l , 1 . ' . 1 ' 'Q YI G r'L X 4 f I' 4 ,M Q n , Y U Q K 94 3 , i I P wx 1 Q Q '13 I 95511, J P 5 Ari? W A3115 .1 ' ' rf ',.ul,I ,, , .,, 'Mi Y. ,fs ff' vial 1 .,',l,,,3: v ' Wm' '.i 9' U 4 , NI . 3 . ,. flL'j,'4 5 - w. P x -. A n.. S. AJ 'X ' ' ,, 4 u M, fi. , N Q . 5. I ' , W vi .4 - I F' ,fi S O 1 4 1 , 1 4 M in- 4, if pf xx 5 1 I1 -, fp mal W. fxxglg ffiiai .- ' X in Y Xkhrrilfi-1 gggisfi'E5f sf X--.L ips Q kST!5i,5,A . - X. wax. xx .NM .mf t le t 0 u 1' rts be tF01lb19d- g trust also in me- In h0HSQ are T0 not So, I wld YOU- H111 g0i11g Y GPHYG H fOr 37011- I will come bi liggl ' takeyou with me that you may be Where I am. CJohn 14:1-35 S , ' ff 52 7 ,. Cruise NIMI 1994-96 Nimitz, twenty years of teamwork