Moline High School - M Yearbook (Moline, IL)

Text from Pages 1 - 310 of the 1971 volume:

EMKWMM volume 59 moline, illinois mhs--vvorld within a community lx. M Ewa: Hmmm: yy. ,, M, - ' entertainment, a desire for knowledge, a life of spirit, exchanging ideas, the world receives us. Xxx X .1 'el gk' if I1 XL I V, A--M. fr' J ,', :Jima A V.. L'A 1' 1' K x -xv , f 'N , 7 LI' , I A I xf haiuafiugzl C8 w bl' r . ' ffieffg Q Vi has 9 Egg : QE WW 262599. v' J ,V . -f . 1 ,L s . x Q ,xx Q1 A H U, . JV, .-xg t ,Nl I, X I N ui' h 'A . swan., if-ac I .A Q - 't ill ' ' X 'f V ii 1 -' t - A A', ff '-?w.'.v , U- . X !I fl . ,X xy x, 'ry 1 . - yum V Q4 at ,-at . . L ' ' 47 X BEN . 4 ' -. ' ' in P X4 I ff '47 ',,' F5-QS' -,if Fifi V TQR ' '. ., W . x 5 , XXX - , 1 5 I . , F 'av .. J'-we - - .., .' V .9 ' NL 2 xg fix v .1 - If X IQ: I lv All I -,s 4 gzwxfk :if .T 'P 'Liga-1 ,.:gf?4 ' ff- :tm , ! 'XY 'W' fr . ' 'X ' fy 'if F f - 21.1--if in a ikizslfi Y Q X ' '- f i 'Qs A ,A f, - A ' vi :rf--'.. sy 1-4, '- 'i' 1 ?i',if'ff' W A 'P' -an.. X , N 4 , ,, . . , i - I . 4 f 14. 'E 5 . ' X I x ' 1' 'a -f- X A' x!p 'N 29 wi .Q X :mu-14.1 7'-Q - Q-3V ?--fl I A ' If 'J '- ' A ' fi? f Af . TW' '15 312' -. f 'F '., L . , ,gg f 'J 1' Q . X - 1 , .. 1 'fs M ip., 'wi , f 'f- . 'W' f -' f '. 5' I A' 5' 7 fl 'Q- .1 ., f'-5 .- 1 7 ' ,f.1 'Q , .1,.,.' . , ,A , ' X f' ' 'V . A n I R' , M' -K - '51 - To -A IJ-Q Q 1 , ' y. TLL,,,, 4 ffm, Xu' ' , 1 , -bm 9 - ' L ' f' A E I . , 'xt' -f .u g .' - ae'- ' 4 -K, If -'H' I ' 4 -F nl. A Q ' I 4 I u lx X I If A N 'Wk A x r .I I 15.2 151,75 ll . N , Hx Lili -' .-E , - I' w I R1 E I 1' fl' ' ' 4 5. L I 5,31 A bl' Y X A- iQ K 3 1-:F- -.9 ..-I-p 3 .- xx competition, a pensive moment. making new friends the wisdom of teamwork, we learn of our world. is '1- Qii ..:.- i Q Q i if wi K ka 1 if ik. 'jg i 5' if! ' t, A 2 1 ,FQ 1 , hx K f UL .. 311689 an 'F 5b,,Bii gtg, y,,w EQ? ' 22,515 - X l 5 If x A. X E4'i4l4fa'2f- xx QQ '- l',- A4 ,4 1 I ' .W 'IA , -1. A, f ,f- ' , , 1, , , 1 4- . g,1:' ' .v A'-k ,-wx 7 f 1 , -f , ,- '-V. -A , ' . v ,., AV! - - N ' . Ly'-,, yi,--' x 7 'flflff' fl? K ' 3-+I! X .,v yi' ky X 1 !,f. Aff w, lj -gi? Lf? 5 SX gf iq? U f N551 X' fd. E SE E . 5 , g , 5 . , 5 A E f .5 5 K is 4 of V ffaivdefliilffe .1iif . . l 919.8 facadehiiics , . if 4 . 4 ' ' it . S6l liOf .... - . organizations ........ athletics ..... 4. .... . advertising .... .... 4 ..., .. . 22 46 110 144 164 208 240 .. .3 , 4 s f' tw, . ,... S Q A at 6 'F i iii. A , 4 N HF . ww? -,iw J, + . 1. nf Y '5 fnNkm.4e ' .ar if BM xw :ks i Wit mug,- to, Q iv lo ? we o me ' i it li he f Q .5 li 91 I is lx t is n s l it .,,, i' x L M 2 l' o l r S w e o f f sg it 'i l , Y 5 , ri mLA'Q1 L t. l 0' itil i O! 5? O gr igkizl tl get Ot If Q if, l l it fi 55512 I Am Egg a friendly smile, a helping hand, muffled laughter, echoing footsteps slamming lockers a quiet moment, welivetogether. student life homecoming royalty preside over Z their court at coronation ceremony The ceremony had already begun and anticipation filled the air as the twenty-four honorable mentions were named. Captivating the audi- ence were the editors of the Line O'Type and HM as they proceeded to announce the sophomore, junior and senior attendants. Then, the mo- ment each person had been waiting for finally arrived. The king and queen were named, Marcia Lewis became the new 1970 M Queen and Bill Stevens the 1970 Line O'Type King. Following all of the pictures and con- gratulations, the court jumped into their cars and prepared for the pa- rade which was held forthe first time on 23rd avenue. Cars, floats, and tandem bicycles were all part of the activity. ln the float competition, first place in the class division was awarded to the juniors with Shear Delight Tonight. Science Club was proud of their float, Maroon the Rams, especially after it won the award for the club category, and Signal Success, entered by Elec- tronics Club, stole the sweepstakes award. Before the victory game with Peoria Manual, the winning floats were pre- sented. The following evening, MHS students enjoyed the GAA sponsored homecoming dance which was held, for the first time, at the YWCA ball- room. The music, provided by the Islanders, set the mood and further enhanced the theme, Insights into the Zodiac. Chosen by their classmates, the 1970 Home- coming Court consists of fourteen outstand- ing students. They are: Bill Stevens, King: Marcia Lewis, queen: Rick Nelson, Wendy IO Henss, first attendants: Eric Nelson, Cindy Marianne Karstens, junior attendants: Bob Atkins second attendants: Ron Hanavan, Mari Stevens, Mindy Grafton, sophomore attend- Harris, third attendants: Dave Harsha, Lynn ants. Humphrey, fourth attendants: Steve Keller, N3 if figs Anxiously awaiting their introductions are members of the Homecoming Court. Some senior boys discuss the upcoming parade and dance. Using the idea of a telegraph, Electronics Club won the Sweep- stakes award in the float competition with one entitled Signal Success. ll l I Walking oh' with first place in the club divi- and third lace winners D sion the Science Club Float 'Maroon the GAAand KeyCIub. Rams displays its winning design. Second , ,J-9, V , 0 QE-2? 1 if raw. were sponsored by A, ' i W C P ' ' 4 . 7, X X' H l W l L -B V .i v V ' H 1 ,sJ'I.535'7'N ' f -' . ,, A A - - M .M-. rs In K K A K x m5v x l Q '73 ,L 1QMf2'm.,? , ., . . .. , .. . . , V4',.,v,.vit V i .5 vi' 2 5 K at 3 '35 . xj li if ps ' , A I U x Y s ,.. t 5 If Mari Harris congratulates LO'T King, Bill Stevens and encourages him for the big Homecoming game with Peoria Manual. i2 l Performing in Tan 'Dem' Rams, Glendeen Gidel and Deanna Goetz enjoy their part in theparade. iiii ge 1 A Z' P .32 N sam rL:.f. W- ., ftwx -tq:eg.2,i -M. -W Mi ,, M ,, Q W Sf ? -1....1 mum Q The junior class outdid the sophomores and seniors in the homecoming festivities this year. With Shear Delight Tonight, the jun- N Receiving honorable mention are FRONT ROW: man, Gayle Whitebook, Dawn Hoyt, Barb George Hansen, Jon Tunberg, and Ron Dave Hisler, Pam Bowling, Sance Beck, Nance Thomas, Eva Morgan, Laurie Hallquist, Mitch Bernard. VonLangen, Deb Olson, Nancy Goegel, Bill Carlson, BACK ROW: Dave Lester, Gary Dono- Burrusg SECOND ROW: Jim Vana, Amy Meers- hue, Greg Anderson, Scott Acord, Mark Lewis, 'Pv'L iors grabbed WST mace in the Class division Attendants Mari Harris, Mary Ann Karstens, their happiness with a pretty smile for the of float competition. Mindy Grafton, Cindy Atkins, Lynn Humphrey, camera. Wendy Henss and Queen Marcia Lewis reflect I3 i W Driving her antique car makes Deb Skromme appreciate modem cars with automatic trans- mission, power steering, and disc brakes. ---i i,,,,,' 44 in A 14' Throngs of people cover the Wharton Field House basketball court at the 1970 Fall Festival sponsored by Student Congress. The Hippo became a rallying point for the senior class even while it was still in the making duringthe week before the parade. Arm a-kimbo, pom poms in motion, the Con- temporaires march down 23rd Avenue bound for Wharton Field House. I5 During an exciting play, all eyes are on the basketball court and IVIoline's athletes. K, If -5 5 ': l'k-' Q QMS wx i f 2 WW Ewa, Q 9 ' M ea ,Q Q F , f li - I -X' 1-gihgc ,J -fl, .,:s,'...'z '.:.':,',.7.,,g,-,.,,f1fg.'gr -3 -1-:5,.E,, , ew 'V 2 K K ' ,925-7 ,QL ' Rf , 2 . 55 ga mes draw students as spectators work and play, hand in hand for '71 x1 I've never seen anything like that before, says Sue Vonderhaar, as she views Sue Sum- ner's latest creation in tie-dyed T-shirts. Senior, John Segura, plays to win a prize the ring toss booth sponsored by FTA. M V- ma.. , ..,.,.. I8 The senior girls drain every ounce of strength in order to come out on top, the winner. ou Nancy VonLangen thinks fall weather a little too crisp to go without a coat Cor sweatshirtj fs, A Q' ws- ,gf If you play one more wrong note, says Nlarc Sale, l'lI wrap this trombone around your neck. 'E L. ,V , we-w. Struggling with the chicken wire they plan to use for the Thespian float, the boys know that all their hard work will be worth it in the end. I9 snovvfight, music, and sports activities of moline high students PTH!!! ah. All 4 - Throughout Wharton Field House on Friday High School pep band can be heard before and and Saturday night, the music of the Moline duringthe basketballgames. 20 After a strenuous tennis workout, Sarah Carl- son relishes the thought of being allowed to go home. wwf' 3 3 Foreign exchange student Maureen Plitt ap- pears to be helpless against the devious plans of Dirk Schroeder and Steini Bjornssen. Football, a favorite pastime of MHS students, is enjoyed not only by boys but also by girls, if 21 4544 num, 1 fa X X N pi lg N Qu . 25 2 if 11 we 1 0, - , - ww ' Q11 - it ,- N-WW the thrill of discovery, the pride of knowledge insights for the future, the help ofa teacher, the pain of failure, the joys of success, we learn. academics dr. rockafellow stresses curriculum improvement and efficiency study Through the efforts of Dr. Theodore F. Rockafellow, Superintendent of Schools there has been a greater emphasis dealing with the curriculum improvement. Last summer depart- mental committees met to revise their Curriculums in order to keep up with academic growth and new teaching methods. Dr. Rockafellow also directed administrative realign- ment of teachers and principle co- ordinators to help direct and guide their departments achieve a se- quence of curriculum. Evaluation of new projects or courses this year, such as the efficiency of Moline High School's math research center, con- igg. . sisted of only a part of the coordi- nators duties. Aside from working with Dr. Rockafellow, the coordina- tors also worked through either Mr. Hollis S. Nelson, Director of Secon- dary Education, or Mr. Marlin Baxter, Director of Elementary Education, who filled these new positions this year. Under Mr. Nelson a steering com- mittee was formed for the study of a vocational education program. This program would give boys an oppor- tunity to build homes thus enabling them to apply the carpentry skills they have acquired. if xt FN DR. THEODORE F. ROCKAFELLOW Superintendent of Schools I .ai The administrative coordinators are SEATED: Mrs. Ardeth Scott, Elementary Social Studies: Mrs. Frances O'Neill, Reading: Miss Marie Ringquist, Art: Mrs. Mary Hood, Elementary Language-Arts: Mrs. Roberta Wollerman, ln- structional Services: Mrs. E. Jane Keim, Home- making: and Mrs. Lorraine Nichols, Assistant Vocal Music. SECOND ROW: Mr. Steve Rado- vich, Secondary Social Studies: Mr. Darrell Goar, Secondary Science: Mr. Robert Swed- berg, Secondary English: Mr. Louis Dilulio, ln- strumental Music: Mr. Orville Harkey, Secon- dary Mathematics: Mr. Ray Brasmer, Vocational and Industrial Education: and Mr. Harry Franck, Elementary Mathematics. BACK ROW: Dr. Frederick Swanson, Vocal Music: Mr, Karl Haytcher, Assistant Art: Mr. Don Hartley, As- sistant Elementary and Physical Education: Mr. Joe Wasson, Coordinator of Counseling: Mr. Ray Smith, Health, Physical Education, Safety, and Transportation: and Mr, Laverne Zeigler, Elementary Science. Administrators of the school system are: Mr. sistant to the Superintendent, Dr. Theodore tor of Elementary Education: and Mr. Arthur Robert G. Saelens, Director of Personnel: Mr. F. Rockafellow, Superintendent of Schools: S.Jenkins, Director of Business Services. Hollis Nelson, Director of Secondary Educa- Mr. Melvin L. Reynolds, Assistant Superin- tiong Mr. Lamont Hultgren, Administrative As- tendent of Schools: Mr. Marlin Baxter, Direc- Serving the Moline Public School system's G. Seeds, President: and Mr. Robert Carlson. pro tempore: Mr. Donald Almquist: and Mr. Board of Education are SEATED: Mr. Melvin STANDING: Mr. Paul Edstromg Mr. William Milton Ericson. L. Reynolds, Secretary-Treasurer, Mr. Robert Millman: Mrs. Roberta Pearson, President 25 administration uses team method ross promotes public relations An administrative team was formed through the addition of three assis- tants this year. Nlr. John A. Adam ob- tained the position of Administrative Assistant for Curriculum and Instruc- tion while Mr. Stanley Woods ac- quired the duties of Administrative Assistant for Student Affairs. lVlr. Robert Brooks was also appointed as Administrative Assistant for Student Affairs. The revision for a team meth- od made school operation more ef- ficient. To improve public relations. Mr. Ross helped formulate parent study groups. Parents, chosen at random, were invited to attend the various de- partmental programs presented throughout the year. Assisting with the presentations were selected stu- dents who gave their own points of view and explanations. lVlr. Ross hoped the parents had become bet- ter informed about Moline High and the courses their children were tak- ing. lVIr. Ross expanded the seniors' re- sponsibilities through the issuance of privilege passes and the optional at- tendance their first or sixth period study halls. The passes allowed sen- iors a greater freedom of movement from classes to authorized areas in the school. The success of this experi- ment will have some affect on the study of flexible scheduling for the future at Moline High. Victor J. Ross, Jr. Principal John A. Adam Stanley L. Woods Jack H. Brown Roger Potter Administrative Assistant for Administrative Assistant for Student Administrative Assistant for Student Athletic Director Curriculum and Instruction Affairs Activities counseling staff 26 Helen Andersen Jack Coder Harold P. Griffith Ralph McMinn Jay Schaff Albert Stevens Robert C. Brooks Assistant Pfimlipal for BUSUWGSS and Plant Assistant Principal for Student Altairs Administrative Assistant for Student Affairs Management The MHS secretaries are: Evelyn Engstrom, Lucille Tompkins, Helen Geddling, Dorothy Verna Smarsty, Olive Haydon, Lucille Kendall, Blarstrom Betty Olson, Phyllis Myers, Margurite Ross, Frieda Schnowske Emily Stotlar Joe K. Wasson Janet Woods 27 Many students find that math becomes easier and more fun by using the computer terminal, bell tape machine, and electronic calcu- . Iators. 28 i 1 1 -Y E Q v ft E f 2 5 P ,Q ' E if : :iii f- ? , V , 5 W, wt:- 1 5: i Q , I ilk 5 C' it t 2 we Q 40 Fritz Boom Mathematics Don Fentem Science Delores Hulse Science fxh 1?- ,435 pk, Gary Bushman Science Gene W. Flesner Mathematics Phyllis Johnson Mathematics 1 - -'-1 Science F. Darrell Goar Science Wesley Johnson Science fifth ik' 'B Dennis D. Davis vScience I Science Milton Hagberg Orville Harkey Mathematics Mathematics John L. Julius Dick Lewis Science Mathematics ff A Careful examination of a clam shell during the summer ecology course helps Penny Pow- ell to develop an appreciation of nature. t.h.i.s., a new insight into science math lab promotes new technology Changing the appearance of the Mathematics department was the addition of the Math Research Center, a laboratory with electronic calculators and a computer. With its installation the department has set a goal to place a stronger emphasis on lab. work. Two proposed math courses for the future, a two year program of algebra I and a two se- mester sequence for basic math classes, would combine the use of this research center with the text. By combining biology, chemistry, i l Nancy McManus John Reakes Mathematics Science Earl Wear Science and physics with a humanities supplement , the Science depart- ment created a three year course called T.H.l.S., Towards Humanization and lndividualization of Science. Modules outlining the objectives of the course enable the student to progress at his own speed. Mr. Goar, head of the department, hopes this project will develop within the stu- dent an appreciation for and an un- derstanding of the place of science in man's history and future. The 1971 yearbook regrets to record the death of Mr. Dennis Davis. On be- half of the Moline Senior High School student body and faculty we express our deepest sympathy to his family and friends. T.H.l.S. students, Steve Van Speybroeck and Barry Nelson observe as Mr. Davis uses a smoke chamber and telescope to observe evi- dence of molecular movement. 29 lnnovations in teaching methods American and modern literature, Miss Helping students use the library reference material is but one of Miss Rosebe-rg's many activitiesasateamteacher. as head of the english department and courses were created this year and for the future in the English de- partment. As a result of the recom- mendations from the Advanced Placement committee, a new senior English course, the Honor Sequence, was proposed. This study would deal with major British authors the first semester and have an independent seminar approach of world literature during the second semester. Team teaching had proven to be successful with last year's sophomore English classes, and this year it was also tried with the junior Communica- tions classes. Through the team teaching method Mr. Bradley taught Librarian aids, B. Streeter and M. Johnson, explain the use of the newly acquired Xerox machine to an MHS student. Neumann taught free reading, gram- mar usage, and composition, and Miss Roseberg instructed the other class on a brief research paper, li- brary work and oral expression. Ro- tating every twelve weeks, the classes had all three teachers throughout the year. Further innovations in the de- partment were established. A Re- demptive English class, with Mr. Bradley as instructor, was designed to help students overcome weak- nesses in English studies. In the future the English department hopes to achieve their goal of de- veloping a more elective system. X Mawr- L K '- .. , . if 1 'fr-Q ,K 'ht . ,- was s str t gt To itit is ir--- it it ia f --V t A--.gs Delores Beckmann English 30 Patricia Bernardi James S. Bradley English English fix Opal Carson English Elinor Case Davio CO0Dman Kathleen Curry Thomas Derouin Jennie Ellison Librarian ENSIISTW Librarian English English Virginia Moffitt Barbara Newmanh JoAnne Nusbaum Joanne O'Brien June O'Connell English English English English English . i. J vi My greatest speech and Miss Beckmann for- got to turn on the tape recorder! laughs Steve Hugaert. Julie Anne Phillips Betty Roseberg DeWayne Roush Lucy Shawgo English English English English Phylita Shinneman Juanita Timson Barbara Wheelock Mary M. Youngdahl English English English English 31 Anne B. Bell Languages Carol Conelly Languages wesiwwmflfxisfllw-1- 1 f- fi: w3,,,i551gi5M1- . 7 -f,- f,.,,.,. V , 1,, QQEQES QQQQZQE fl . il- -mate .. ..,, , 2, 2253 fwm., . M Q 2 if af, i i :.. ,WMM or ,,... we ,, as.:::,.:-:iii --. -l. ,, - ,I S rr f 'r' Diann Bloome Social Studies Phillip M. Doherty Languages D ,E-:lw2A-ffisi,- U- V is as . ., ,Q . isa - e-:ui. -,.. 5 ,:,: ,, ..-Q-.15-fs-15-.,Y..i iss. ,,g.--g,, M., .,.. ., , .--,--,-,- -f-' f:-' Q - sf X - iifimfagfxfsermwue,f--l--l-.1 . . -55-is ..,L. VN ,..e L, L.., wt .,., L.,L. .,...,. u J f,:b,.. w,.: L.,, sw . -1, ,, L .. .. .. , lftff .fi-'L l5fLSi11f-f ,fi 52.11,'fi.1f??f5Sf !Wf,lfilliiviiit QE?lSi5??hfE1iifiilfi?PE5W Come now Mr. Lee: Are you really that upset to see your first period Spanish class Ieave?? 32 if 'L ' V I ef, 2 it as 2 5-l M Ea, N XM K 8 as 9' i r gms? ie Y lr ww El m 3 E S2 as L 2 S at ., .. ,iili 2, , L, -V 12 xx is . Q i 2, ,im 4 H W f ,, w as xg f 22 1 ia sq swag? 2. ig is is Mary Foster Billie Gene Lee Sara Mclnerny Karen Meier Social Studies Languages Social Studies Social Studies Reminiscing over their travels Mrs. Piehl and tional folk dance fish net Fillet le Bleu in the Mrs. Bell display souvenirs such as the tradi- background fortheir classes -1:5 ' .ki Reading and interpreting some actual cases are a part of Mr. MilIer's Liberty and the Law class. ,A+ tres f wit? 1 at eiwfgiaf an ta Q., t ax m if X S' R. fills B language teachers stress culture social studies aims for electives Touring through France and various French speaking countries last sum- mer Mrs. Piehl visited Tunisia, Africa while Mrs. Bell did extensive travel- ing in rural areas of France. With slides and experiences to relate, both teachers hoped to bring more culture into their classes and help students further their understanding of the French people and language. The departments future plan is to individualize all language study through the remodeling of the lab with emphasis -on performance and behavioral objectives. Norma L. Mendoza Languages Jack L. Miller Social Studies Helen Piehl Languages Ralph Peterson Social Studies Gene Shipley Social Studies Willard A. Starkey Social Studies M Donald Morton Social Studies Robert Moore Social Studies Barbara Shah Social Studies Harley Rollinger Social Studies Esther Steffen Languages Carl Sundberg Social Studies In the near future the Social Studies department would like to initiate all one semester electives into the re- quired curriculum, thus enabling a wider range of selection for the stu- dents. The inquiry method, which deals with several basic concepts that the student utilizes for analyza- tion, is an approach that the depart- ment would like to extend into more of the social studies classes. Experi- menting with the approach this year were several World and American History classes. Sue Nelson Social Studies Kathleen Schultz Social Studies Herbert C. Thompson Social Studies 33- new practice driving course gives trainee valuable solo experience With the completion of the driving range this year the Driver Education department enabled students to de- velop their skills more fully. Ten cars driven simultaneously under the supervision of an instructor are maintained through radio contact. ln this way students build up their driving responsibilities without hav- ing an instructor in the car. This produces a natural driving situation and yet the students are under ob- servation. Future additions to the range will be some curbs and an embankment for up and down hill parking. ln the girls' Physical Education de- partment a new twelve week syn- chronized swimming class was added. Learning such stunts as the ballet leg, the dolphin, and the barracuda, forty juniors and forty seniors cho- sen from tryouts participated in the program. The weight control class was continued this year for those girls wishing to lose weight through exercise and body conditioning. The boys' P.E. department stressed the use of the weight room for the development and toning of muscles. Instructor, Mr. Lester coaches wrestlers on how to pin an opponent to win a match. William Baltzell Driver Education Jean Carlson Physical Education Harry P. Lester Physical Education 34 4,-Fx Bill Bishop Driver Education Geneva Henss Nurse Jean Lundholm Physical Education 251 Ken Bunte Physical Education Herb Klier Driver Education Mark Marsell Driver Education Judith M. Carls Physical Education William M. Klier Physical Education Richard Matter Driver Education Larry lVl. Carls Physical Education Edward Lemon Athletic Department Donna Pettavino Physical Education The new girls synchronized swimming class which meets first period gives swimmers a chance to learn basic positions such as double balletlegs. The driving range has proven to be a good warm up course for students before motoring on city streets. 'rgifqgmaQ4f1?ig2ieviw-wif: 1 f V . ' f -'fs1,12, ff . fi '- ' 5 'HIL QQ? '--:VJRA . E ' - 2: if it fv. ,M ft? as im 3 Art Mercer Herman J. Miskowicz Sharon Pirkl Pat Shannon Joseph A. Vavrus Debby Wheeler Physical Education Physical Education Physical Education Physical Education Physical Education Physical Education 35 Mrs. Nahrgang reminds Nancy Chinn that it is important to keep her fingers on the home row keys. William S. Adams G. Raymond Brasmer W. R. Crouch Robert A. Edwards Industrial Arts Industrial Arts Industrial Arts industrial Arts Sam Etzel Helen E. Gehring A Margaret Griffin Alan Hinkle Industrial Arts Business Education Business Education Industrial Arts 3- .,1' , Mm-M - 1mw..,,,, Dorothea Hyink Business Education Joseph Mortier Industrial Arts 36 Alrna Kotez Business Education Kay Nahrgang Business Education Righard Marlin L. L. Mayes Edward Mitchell Lois E. Mitchell Industrial Arts Industrial Arts Business Education Business Education Dorothy E. Nessel Joseph Ru berg Cedric Salisbury Beverly Sevick Business Education Business Education Industrial Arts Business Education l was 9- The photographic enlarger in the graphic arts classes enables Steve Williams to accurately proportion a picture for his project. 'Wt 1 gisggri . fiilufsn'Nazi''S3?i?i'5Tf. :SGl'53i.I -W'P3WA G:M 3lffAqlki fgjid' 1 52333 fis?i,QE1sa3-fmg?xHiiErgQif:siiwris 'T '?WtF,5?5iWi5f Rf eigsiiizisiigsgtgei -w eg,e?zf.gei2xsaf'fa1img rmefswx wc: 12 -. 'R tfQgg3y.:c1 5,2:E:u2E4'T ?i5gQgi,ggfi5gef,gi We ,L In .. 1 ,. .gtg-qu.: 2-'af -V if Q ' -' ' ' S -f11t,fs,f,1i1i2sfi f A ' , f -' :T A -3 ef -rs' ,- r ,. 1..5:r.,.f- 34.55 xg, -I fs21,,.i4:g 71 4:37 -'fi lil 57521 711357-SEQZQS sm- 52221.55 - ' -f if fzf.sf'Liiizis J 25 , t ,N T M.. 1, if A i bumnesseducahoniMansfornew course boys engineer new driving range The Business Education department purchased this year electric calcula- tors for the lab. Plans for next year involve a course called Consumer Education, which will include the Home Economics department. This class will be team taught by Mrs. Beverly Sevick from the Business Ed- ucation staff and by Mrs. Nancy Par- nell from the Home Economics staff. The program will be aimed toward consumer buying through individual projects, field trips, and class involve- ment as a whole. This course may be taken for math credit. Revision of short hand instruction is also being studied for the future. Graphic arts was an innovation in the Industrial Arts department. This pro- gram was a study of the process of reproduction which included letter press operations, oft-set operations, and processes of photography as related to off-set printing. The department helped in the con- struction ot Moline High's new driving range and control tower. From this experimental project the department would like to branch out into other similar programs. A building trades program is being studied which will allow boys to become involved with the actual construction of homes for next fall. John Small Clyde Storbeck Industrial Arts Business Education Frank Willits Kermit Wilt Industrial Arts Industrial Arts Sandra Swafford Business Education 1 Machining parts for a large circular table saw, Mr. Mayes expertly aids students in operatingthe vertical milling machine. 37 Linda Snider knows she can stay ahead of her L... gig, Samoan 1 budget by designing her own clothes. ii '1'A h E ' hue., -U wiki 23? Karen Anderson Home Economics Joel Erickson Art Stan Leach Art 38 Loren K. Carey Art Deborah Forseth Home Economics Iva D. Owen Special Education Allen Dalhaus Music Calvin B. Hedegaard Music Nancy Parnell Home Economics fu!- ,, ,,... 7 L. H. Dilulio Music Frances B. Johnson Special Education Marjorie Partridge Art Dorothea Duncan Home Economics E. Jane Keim Home Economics Merle Wegener Music Art student, Tim Krambeck, discovers that there are no creative limitations in metal sculpturing. A W7 .x LV 25 ,ki 533 ,Si 53'- -Q. , 4. ,gk if vs '25 1- .yi 'eg -, S Q ma, ii-M - .ff 5 'ig-, ?iz . . X boys to enroll in home ec. classes music dept. offers theory classes Expanding their curriculum this year the Home Economics Department in- cluded a course called H.E.R.O., Home Economics Related Occupa- tions, for senior girls interested in training in such varied fields as food and nutrition and family relationship and Child development. Next year H.E.R.O. will be open to boys. For the first time this year boys could take Family Relationships and Child De- velopment or Housing and Home Fur- nishings. The Music Department continued to offer music theory and survey classes which were started last year. The theory class dealt with composition and arrangement of music through the study and analysis of chords and harmony with the ultimate goal be- ing an original work. Research on Bach to modern composers plus studying and listening to their works composed the survey class. In the future the Art Department plans to stress specialization of classes with the possible addition of photography and print making. They plan to further encourage indivi- dualized study. Displaying the art students' creations the department held an annual patio art show for the enjoyment of the student body. Rl Putting in extra hours at the easel Ruth Gor- don finishes up her abstract oil by using com- bine brush techniques for her advanced art class. Experimenting with student instructors, sen- iors Mark Ohlsen and Mike Barber conduct the band sectionals for trumpeters Brian Olson, Pam Carlson, and Dave Klann. 39 custodians, cafe help, hall monitors help keep things in working order As he looks back down the long, empty hall- way, the custodian knows he will just have to do the same sweeping job againtomorrow. Serving as custodians through the day are don, M. Weine, N. Wykert, H. Huntley. BACK wards,J. Beldon,B. Pendleton. FRONT ROW: E. Robinson, P. Morgan, L. Gor- ROWI E- WYKGVTY A- Hammafi- O' 3 liCki R- Ed- 40 Yi X 3 2 'T r Q ii '-W tj E QTL 3 gf j E95 'Ex fax A The hall supervisors are FRONT ROW: V. Smith, P. Shicks, l. Engstrom: BACK ROW: N Rogenski, B. Shipley, G. Koker, C. Aitken. MHS' cafeteria help are FRONT ROW: J. Lar son, L. Dyvejonck, D. Baker, M. Hanson, M Morris, M. Hicks, M. Dunlap, F. Larson, R. Ed wards: BACK ROW: M. Lash, C. Todd, E. Ough M. Dye, B. Brunstron, M. Richardson, M Snyder, Z. Praught, K. Johnson, N. Seirratt O.Logsdon. Moline's night custodians are FRONT ROW: F Dopler, P. Ripley, E. Lesley, BACK ROW: P. Swanson, D. DeVolder, C. Marshall, D. Carson, L. Breeden. l 4 I honor students praised for their leadership, service, and scholarship Julie E. Gettemy Julie E. Gettemy Athletic Scholarship Jeff Murdock Excellence in creative writing Scott Harris Excellence in creative Writing Deb Skromme Merit Shield Service, Leadership, Character scholastic honors group Lorraine Anderson John Barrowclough Christine DePoorter Deanna Goetz 42 Jana Bender Cindi Carlson Lisa Carison Ruthann Gordon Caroline Hagberg George Hansen Scott Harris Wendy Henss Jean Hufford American Legion Auxiliary Award American Legion Award Popularity Cup Wendy Henss Leadership, Service, Scholarship Mari Harris Leadership, Service, Scholarship Ron Ha navan Voted most popular senior girl Popularity Cup Voted most popular senior boy scholastic honors group David J0hV1Sf0l'I Doreen Koresko Michele Kruse Pamela Morling Debbie Olson Linda Oppenheimer Susan Sumner Barb Thomas Ralph Tornes Jacqueline Mathias Jim Miller Jane Powell Marta Schatteman W fy V ..w,?. . Vzz. .fi Vzj W, T gpg I AmVA if V , . 1 L .i Senior National Honor Society members are SECOND ROW: S. Sumner, K. O'Donnell, D. Guy, C. Hicks, D. Johnston, J. Barrowclough, FRONT ROW: J. Powell, N. Williams, M. Hudson, Brandt, L. Hallquist, S. Hufford, D. Hoyt, L. K. McKee, D. Skromme, D. Koresko. C. DePoorter, K. Olberts, L. Messmer, S. Wood. Carlson, C. Compton. BACK ROW: J. Ackley, J. FRONT ROW: D. Hanmer, B. Thomas, M. Schat- Swales, M. Plitt, D. Olson, G. Gidel, D. Goetz, Hagberg, B. Kirchoefer, M. Steele, K. Zuhn, R. teman, A. Pettit, J. Mathias, S. Milroy, L. Ander- W, Henss, S. Taylor, M. Kruse, BACK ROWQ J, Tornes. son, F. Lester. SECOND ROW: P. Morling, J. Miller, R. Biorn, L. Thompson, S. Dismer, C. 44 Diagraming is half the fun, says Debbie Ol- son as she begins another calculus problem. results of hard work evaluated, national honor society announced After the completion of industrious seniors and juniors, the National Honor Society work by 1970-71 members were selected. These stu- dents were commended on their scholastic abilities during an evening ceremony in the school auditorium. Giving a traditional banquet, the High Twelve Club also honored these students. Members who qualified for the Na- tional Honor Society had a grade average of 3.5 or better. Seniors had completed their constant studying for this year, but the juniors must continue to strive to qualify for next year's National Honor Society. Junior National Honor Society members are FRONT ROW: R. Hellebuyck, M. Hoffman, J. Simpson, H.' Gates, S. Edlund, K. Aldene, S. Surila, R. Vasquez, M. Harper, M. Cooley, S. Dee, J. Carlson. SECOND ROW: L. Serres, D. Burns, N. Schiess, M. Pearson, J. Welnetraut, L. Verhelst, V. Matter, C. Hallene, A. Anderson, M. Chilberg, R. Walden, K. Newton, M. Crane, T. McMinn. THIRD ROW: R. Schumacher, S. Lund- gren, J. Schourek, K. Starr, B. Shipe, J. Pfelff, D. Duncan, G. Lynn, G. Schatteman, R. Schae- fer, J. Flatley, M. Boom, B. Kirchoefer, J. Grif- fith, L. Carlson, B. Healy, J. Corkery. BACK ROW: S. Hammerberg, K. Schaeffer, J. lngelson, L. Collison, J. Clauson, N. Elhoffer, J. Robbins, N. Hintz, M. White, M. Possin, P. Norlen, S. Camferdam, R. Hammer, J. Schuett, S. Oleson, M. Robinson, T. Kusnierczyk. 45 ,- R, V' ,.'-,,5. '- R. is ,QE gf x 5375? - ff My 4 1 xi' Q ,Q 8 Q . 3 L I M31 7 . 'Wfs' iy.. N ag-?if. E --Snlfffi ,...f S355 1 L y. - ff' , 1 7 1 'fin' ffm . .1-Qw'ff'3ig ii L f i. K X f - 1 3 Hs. W? ' ,gin-'vlaakfxiii - . 71'f -'KY3 5 Y Qfwfffg L14 '- ' 2 - L YZ?-iff ' '+L Y '.,,:,-H45 1275 J .i mfr. 3- i :P mi. ,Z Wf.w.g . . . . 4, srl:-. ' 19.4 Q, 5 i ,W Q 1 ya' 4 'S our best year, joy of accomplishment, treasury of memories, the end and beginning, the envy of sophomores, the hope ofthe faculty, we graduate. seniors senior class officers plan ahead under guidance of faculty sponsor After a summer filled with both re- laxation and hard work, last year's juniors returned to MHS with a new outlook and a new status-seniors. In recognition of this status, special privileges were granted to the senior class. The exclusive use of the east patio, the permission to leave school first or sixth period instead of re- maining in study halls, the issuing of privilege passes and finally, the abolishment of the dress code all greatly increased the freedom of the senior class. With only one year of high school before them, seniors busied themselves deciding their fu- ture plans. Some worked part of the school day, planning to continue the occupation after graduation, while others set to the task of choos- ing a college, aided by the senior class sponsors. The year drew to a close with the elegance of the Senior Ball and finally graduation, climax- ing three wonderful and unforgetta- ble years at MHS. 48 Competing in the battle of the bands at the Festival is the well-known group .Next-to- None during their three hour evening con- cert. Mari and Ron, Homecoming royalty, make their entrance to the coronation ceremony. , Senior class president Ron Hanavan enthusiastically explains his ideas for the Hippo Homecoming float to officers Pam Bowling, secretary, Lynn Humphrey, treasurer, and Mari Harris, vice-president. I i J 'ihrkf 'msf ?5 .igl it iw rrrrrr H I Life, t i Helping a senior choose a college wisely is Coder, Stan Woods, Fritz Boom, and Jack only one of the many tasks undertaken by the Brown. X senior class sponsors Helen Anderson, Jack , listless summer days, measureless hours of peace and contentment Well-known guitarists Gary Donohue and Bob Bradley, while strumming along with the John Ackley Folk Society, do a little serious improvising during their summer vacation. Scott Acord Carol Adams Jeff Adamson Pamela Aitken Alan Akers LIOYC' Albertson Debbie Allardyce .Lorri Allen Sherry Allen Dale Allensworth Danny Allison 50 David Allison Britta Anderson Dean Anderson Greg Anderson .larrin Anderson Julie Anderson Karl Anderson Lorraine Anderson Marilyn Anderson Nar1Cy Al'1d9l'S0f1 K ? 'Wilw s .mf , U ' 4 .A 1 Hot, long and lazy summer afternoons- pro- furnish much time for just plain fun as shown vide a carefree and relaxing atmosphere and by Kathy Decker and Sue Sumner. 51 deb spends time restoring ford find her olovvning on the job Deb Skromme pops out of the rumble seat of her 1928 Model A Ford. Many Satur- days of her summer were spent in restoring the aged vehicle, which she actually drives' 52 s Sherry Anderson Susan Anderson Terry Anderson Jon Armel so Lucy Armes Carol Arrington Diane Asplund Cynthia Atkins Gary Baker Gary Baker Lynn Baker Steven Ballard Danny Banks Carlos Barajas Jeff Barber Mike Barber John Barrowclough Cynthia Barth Gregory Bauer Sally Bealer lVlarc Beauchamp Monte Beauchamp Kathleen Bechel Pamela Beck Sancy Beck Sandi Beldin Jeff Bell John Bell chris scrubs car, expects rain adds final touch to the shine .is w ' What can be a more perfect pastime on a hot summer afternoon than washing and Frank Bellson Jana Bender Timothy Benson Susan Berggren repairing one's car? Chris Bauman will have his car looking good as new in no time, 54 Ron Bernard Nancy Bernot Alan Berrier Frank Berrier Patricia Bey Randi Biorn Bradford Bisbey Thorsteinn Bjornsson Gregory Blackburn Gregory Blaser Betty Bloemsma Cindy Blomquist Catherine Bolkcom Debbie Boone Chefyl B0Cluist Maribeth Bowen Rafldll Boyle Paul Braatelien Pam Bowling Nanette Bowring Becky Boyd Dan Bradley Robert Bradley Nancy Bra ndeberry 55 seniors earn additional credits in summer school to prepare for fall Deborah Brandt Robert Brathall- Bonnie Brenstrom Jackie Briggs Mark Broderick Mike Broderick Patti Brown Rick Brown Peggy Brownfield Stacie Brownfield R B on ruce Timothy Bruce Kathleen Buchanan Annette Buell Mark Burgett Kathy Burklund 56 Marsha Burrows William Burrus William Busen Nadine Buser Beverly Byrd Jane Cahalan Steven Calvert Garth Canning ,sieivfrlei -f 239558 , ,ZA -lfvvfe. . , 1 l :Se - . l' N Dick Nelson perfects his typing skills by taking a timed writing test during summer school and thus proves to the female world that boys can type, too! l 57 after summer in europe, chris gains more than just souvenirs Reflecting on her summer experiences in Germany as an AFS student is senior Chris Moore. Chris spent two months in Ketten- kamp and has already begun planning for her next trip to Ger- many. 58 Teresa Cappaert Cindi Carlson Cynthia Carlson Janet Carlson Larry Carlson Lisa Carlson Mitchell Carlson Patti Carlson Jackie Carlstrom Sheila Carothers John Carpenter Dave Carsen Michael Carson Marcella Carter Carmine Cerra Mike Cervantes James Champion Kathleen Chandler Kevin Chapman Mary Cheek Suzy Chelstrom Sandra Christopher Jamie Cirivello Greg Claeys Howard Clark Mike Clary Richard Clauson DOH Clemens 59 ,, 1. various college representatives talk over seniors' future plans Gary Colburn Steven Collins Carla Compton Joann Conway Gay Cook Daniel Coons Tnomas Copeland Tom Cordes Lewis Corelis John Corkery Meeting with Sue Berggren to discuss her col- lege plans is the Lawrence University repre- sentative, fin' V 60 1' Larry Cornell Cheryl Cox Julie Cox Kathy Coyne John Cross Kathy Crowe Linda Culbertson Colleen Cumberworth James Curtis Joe Daebelliehn Cindy Davis Nancy Davis Cynthia Dean David DeBaene Kathy Decker Keith Decker Kathleen DeFauw Thomas DeGraeve 61 ,, 1 seniors participate not only in parade but also on sidelines rw-.Sf Watching the annual Homecoming parade was a new experience this year because of the new parade route. Among the spectators were senior Craig Sommers and his girl- friend. 62 Jim DeJonghe Karen DeLathower Mark Dembosky Harry Dempsey Linda Dempsey Mary Denato Chris DePoorter Michael DeVolder John Diamond Dee Dee Dietsch Sandra Dismer Greg Doherty Gary Donohue Gary Dooley Rita Dooley Craig Dove Richard Dow Diane Driscoll Jennifer DuBurg Bonnie Dopler Connie Dopler Greg Dorr In anxious anticipation ofthe long trek ahead of them, band members line up and tensely await the signal to march, marking the beginning of another winning per- formance. senlor spectators appear to nave varled impressions of tne parade Brenda Duke Linda Duke Beverly Dunlap Brian Dunn Tim Dyer Fred Ealy Allen Eastman Douglas Ecker Karen Edstrom Steve Edwards Robin Egert Raymond Eggers Elise Eihl Jeffrey Ekstam Patty Elder Cole Elliott ,MX -H-ww,-f-ff , This is only a sampling of the various types of rade, which leads one to think that half the onlookers one may see while awaiting the pa- fun ofany parade is watching the spectators. S. . James Elliott Susan Enderton Dave Engstrom Patricia Engwall Julie EViCkS0n Sotero Escarza Terry Eslinger Monica Esterdahl Carol Estes Cynthia Exbom 65 l . imprisoned onlookers watch festival fun in hopes of being bailed out Mark Fahlberg Linda Farris James Fecht Rex Felsman Kent Ferris Richard Filer Debra File Bonnie Finch Terry Fischer Cynthia Fisher Wendy Henss, the senior who originated the idea of the Festival, tries her hand at the coin toss. 66 f-.,.,, One could put his friends for enemiesj in the Senior Class jail for a small fee. Jailbirds Cathy Henninger and Sandy Dismer await their release. Diane Fisher Chris Flake Debbie Flynn Rodney Forest ' Shelli Forshee Jerry Fosbinder Jeffrey Foss James Foster Jim Francis Sarah Francis Darryl Franklin Steven Franks Dennis Pretty Ann Friesth warm puppy ca ptu res attention of doting senior girl and others Debra Frohreich Kathy Fuller F Andrew unk Cheryl Gaghagen Rodney Gann Christopher Gantz Richard Garner Irene Garza Laurie Gates Kathy Gatz William Gerard Glendeen Gidel David Gierlus Jane Gisel Sandy Glaus Debbie Gleize Festival-goers had a chance to win man's best friend by guessing the number of beans in a jar. But the real trick must have been getting Jean Hill to part with the cuddly prize. ,..n.. 555 5 Johnnie Glenn SherriGIimpse NanCy Goebel Deanna Goetz .:.' ..,. f,::.,,.,::..,,..,,.,,, is, ml: x V- H Q L. ..,,.ge:,:,g -it f G A JA ee W Q 3 3 i 1 Y is .',. i , Sig, W g ' l we :M , - V' mis .:..,,. '-:,., Laura Gold Ed Goodale Bruce Goode Shelie Goodman Richard Gordon Ruthann Gordon David Gorge Debra Gorge Jean Goswick Marcia Gouverneur 69 after-school time and energy are not only spent on homework During the intramural championship game, Mike Newell runs for a touchdown while Bill Ruud Barb Gramkow blocks for him. The Budmen went on to win the game over Lester's Boys. Don Green ,mr i KriStif1a Gfeen Debbie Griffin Rebecca Grimes Bill Grzanich Valerie Guinn Jeff Gustafson James Guy Joe Hack Dan Haddock Caroline Hagberg 70 l , . - 1 i at Dan Hakeman Laura Hallquist Lee Hambright Tom Hamilton Mike Hammitt Ron Hanavan Mike Hancks Kathryn Hank Jim Hanne Cynthia Hansen Pulling to another victory are the famed Ama- straight years under the leadership of Lynn zons, who have been undefeatable for two Humphreyinthetug-team championships. l f 'lt government classes gain insights into national elections Ls, SEN W SM IT fi M yy , fa. ...ef i - v- i No Prior to Election Day, November 3, Laurie Gates, playing the role of her favorite Sena- torial candidate, gives her campaign speech which is sure to win her public favor. 72 George Hansen Evelyn Hanson Pat Hardi Timothy l-lardi Susan Harrah Emily Harris June Harris Mari Harris Scott Harris David Harsha Debera Hart Don Hartman Greg Hartson Steve Hartzell Rickey Harvey Jan Harwood Mr. Jack Dye's second period Government class ership characteristics in both the United States ponders one of his questions concerning lead- and the Soviet Union. icelandic student learns american customs but keeps favorite pastime Bev Hasty Rodney Hawk Sandra Hawkins Robert Haywood Pat Healy Hadley Heater P I H t au ea er Roxie Heaton Kristi Hendershot Janice Henderson John Henderson Pam Henderson Debbie Hendricks Ricky Hendrix Gretel Hengst Cathy Henninger 74 Gayle Hensley Wendy Henss Karen Hepner Audrey Hesser l Charles Hicks Jean Hill Dave Hisler Debbie Hodgson 'x Playing soccer in his spare time is foreign exchange student Steini Bjornsson from Reykjavik, Iceland. Steini came to Moline through the International Christian Youth Ex- change, and is staying with the Harsha family, Dave being his American brother. 75 south african exchange student brings moline her many talents Gearaldine Holland Bob Holliday Bruce Holmes Tom Honsa Tim Hoogheem Toni Horton Barbara Howard Bill Hoyt Dawn Hoyt Martha Hudson Maureen Plitt, AFS student from South Africa, has been active in dramatics. Here she assists N Scott Joseph with his make-up for the musical. 1 Rita Huff Jean Hufford Janilee Hugaert Steven Hugaert Jeanette Hull Patricia Hull Lynn Humphrey Rickey Hunt e it 1 William HUUUGY Jeftrey Impens Deborah Ingram Cindy Irwin Marvin Jackson Laurie Jamieson Susan Jauhola Sharon Jennisch Becky Jensen Brian Johnson 77 german exchange student fills dennharclt home with musical talent Brian Johnson Charles Johnson Craig Johnson Dwylan Johnson Mark Johnson Mike Johnson Mike Johnson Terri Johnson Vanessa Johnson David Johnston Patti Jones Patricia Kable Judy Kachevas Ann Kalomas Dale Keeler Vicky Keenan Taking a break from his homework is multi-talented Dirk Schroeder from Kologne, Germany, sponsored by the Youth For Understanding. Dirk also plays drums, electric guitar, clarinet, flute, and little saxo- phone. 'iy fry , t wgqg, .- J' A , - ' LV' . - , , 'Vi If . 2. Q1 I f K , .k of f- . I wk f , wi 45' 3' ' 'Q W f , ir g - . ef --: -,i S , W ,Q i if ' ' A 1 W .gs-, X fi '2 ,. .J , , 7' V .,f' 'fit I . J J J, f 5 K fs: V, , r ,L W f 9' F- V 'I 1 l -fi-f :- .,.t , 2' c,. e ,A ' 5 J ,Iy,:g5: ,. JS 3? f ' ' RM ,fl Randy Kelly Lee Kendall ' John Kennedy Judy Kennedy V A -g c V .-.., ., v,J 5 Kyle Kephart James Kerckhove Mike Kettering Debbie Kiehr Linda King Glenn Kinkead David Kinsey John Kipping Barbara Kirdhoefer DOD Kistrler seniors earn extra money with after-scnool, week-end jobs ,f'STo'i'7 1 3 si 5 ,cg- Rex Kitt Dave Kizer Dave Klann Steve Klugger Sneaking a squeeze but getting caught in the act is Ed Goodale, who works part-time at a local grocery store. But who can resist? he seems to say. 80 Nancy Knittle Sue Knock Cindy Knudson Doreen Koresko Harold Kostka Lynda Krebs David Krouth Bob Krueger Michael Krulik Cindy Kruse Kristine Kruse Michele Kruse Carol Kuberski Kris Kuehl Thomas Kuffler Roy Lackey Dennis Lambert Lois Landuit Gary Larson Larinda Larson Dennis Larvenz Gail Latham research papers keep seniors busy at school and public libraries Packie Lawrence Bob Leaf Margo LeComte Bill Lee Sally Leech Mike Leffler Jill LeMaster Nancy LeMaster Donna Lerschen Bob Lester L Dave ester Frances Lester Marcia Lewis Mark Lewis Barbara Libey Sally Liljeberg 82 Spending several Saturday afternoons at the Public Library is senior Jill LeMaster, who is finishing taking notes for her upcoming termpaper. ...rw I.- 5 ' ,L Mary Lindquist Treva Lindsey A G. , Mark Long Bob Longmire Y! ' -Qi zufwre-f X941 MN' 1 A ,Jvff Benedict Lopez Rosa Lopez Gayle Lorenz Len Lovell Roger Lundahl Dan Lundeen Rick Lynch Mary Mack Kathy Malmstead Gene Manning 83 national rnerit scholarfinalists selected in yearly competition If Larry Markin Marcilene Maroon Mary Martens Brenda Martin Lawrence Martinez James Mason Mike Massey Debbie Matalik Jackie Mathias Kath!! MGTYGV Lorraine Anderson, Lisa Carlson, and Carla Compton are this year's National Merit Scholars. -3 IV X - N x,H..:,..::'2 Eafbif' . A :Ere -L. fx - ::.'.ff':E xr: EI .5 : 84 5. B, I i Mets? N 1 1 ' fr i Lffww C r t A Susan Matters Gary McCain Kathy McCarthy George McCIean Karen McCIean Patti McClelland Don McCIung Robert McCoy Rick McDanel Michael McDaniel Donna McDonald Steven McDonnell Kevin McFarland Cathy McGill Dwight McGrew Barbara McHenry Chris Mclntire Danny Mclntire Patti McKean Kevin McKee national merit commendation letters received by twelve mhs seniors Paul McKinley Diana McNeely Greg McNeill Amy Meersman Richard Meredith Lori Messmer Sarah Metz Linda Meyers Mark Michl Dale Milefchik Stanley Miljush Doreen Miller Jim Miller Kathy Miller Martin Miller Michael Miller 86 National Merit letters of commendation went Sumner, Kathy Decker, Ruthann Gordon, Jean to seniors Bill Busen, Chris DePoorter, Marta Hufford, Barb Thomas, and Mark Dembosky. Schatteman, Marc Sale, Wendy Henss, Sue Pam Morlingwas notpresentforthe picture. Mike Miller Susan Milroy Jim Misfeldt Sandra Mitchell Allen Monroe Bill Montague Rick Montegomery Thomas Mooney Christine Moore Janet Moran college brochures and catalogs overflow state schoIar's desk ' ff!!! Glen Morford Eva Morgan Pamela Morling Steve Moross Sue Morehouse Laura Mountain Sue Muldoon Jim Mullarkey Valerie Mullarkey Jeffrey Murdock Illinois State Scholars such as Ken Zuhn often find their mailboxes brimming with mail from eager colleges and universities. 88 'Pte ,f- ' ,J-f ' ,- 'WMv,-MP gf- Jim-Nagel Theresa Navarro Dave Neighbour Cheryl Nelson Chris Nelson Dick Nelson Eric Nelson Randy Nelson 5 Rick Nelson Terry Newberry Becky Newburg Mike Newell Richard Norlin Pam Norris Kathie O'DonneIl Jill Ogden Mark Ohlsen Kathleen Olberts seniors begin preparing for future many fill out college applications Carolyn Olson Cind Ol y son Debra Olson Rebecca Olson Steve O'Neill Mike Ontiveros Linda Oppenheimer James Orendorff f' Y. ff Pamela Orey Donald Ostrand Cindy Otts Russane Owen Merritt Owens Mark Padesky Patricia Page Sheila Palmer 90 John Parish Connie Parker Ena Parker Lynn Parker Pam Parker Mike Parmentier Pat Parsons Dianne Passini ' A t e r gg-,351 be I 23512 'fa ,K Q E ,M Filling out a college application with hopes of being accepted is senior Marla Steele who seems to be an old hand at the project. 91 ice skating, popular pastime during brisk winter weather -nr Sue Jauhola finds time during Christmas vacation to contemplate the newly-frozen surface of the pond along with her new pair of ice skates. 92 Dave Pearce Charles Pearson Debra Pearson Doug Person Debi Peterson Diane Peterson Mark Peterson Ted Peterson Ann Pettit Robert Phillips William Phillips Alan Pilichowski Maureen Plitt Randy Pobanz Gary Poppy Debbie Porter Kathy Porter Lori Posateri Bruce Powell Jane Powell Penny Powell Susan Powers Joy Preston George Prosser Kay Pulfrey Ron Pyland Carmen Quinones Jodee Radosevich 93 preparations for christmas day bring happiness to those who share Jeff Raes Dan Raney Theresa Ransdell Hojly Rasche Carolyn Rea Steven Rea Cherie Reed Jane Reese Jacqueline Reid Jon Rettig Jeffrey Retz Judi Reynolds Michael Riddle George Rita John Rives Thomas Rizzolo 94 Sue Roberts Bernard Robertson Randall Robinson Debra Roche Greg Rodell Michael Roelens Pat Roelens Rick Rogers Shirley Rogers Phil Rosales wav' l ,aww -A . 'N' 14 t '-23595 ff' f , 455 5, 2 'l'4?1-f Wrapping Christmas presents with a friend is And especially when the friend is a cuddly little definitely more fun than doing it by yourself. PUPIDYHKB he S- students enjoy freedom of dissent in classroom debates Expressing her viewpoint in a class discussion of a controversial topic is Jenny Walsh, whose classmates seem to have their own thoughts on the subject, 96 Leith Rosenthal Joseph Roush Ross Rudsell Mark Ruhs Martha Ruhs David Rumlel' Bill Ruud Patrick Ryan Regina Ryder Richard Ryser Marc Sale Robb Salmon Sue Salzmann Deloris Sanderson Darlene Sands Rebecca Sansale Netris Sappington Susan Saunders Ronald Schafer Marta Schatteman Mike Schnoebelen Linda Schold Jill Schorpp Nancy Schrempf Dirk Schroeder Deborah Schwartz Bruce Schwenneker Vicky Scobey pep of mighty maroons boosts mhs spirit at basketball games John Searle Cynthia Searls Tom Sears John Segu ra Bob Seibert Connie Sell Dean Sellers Darlene Selman Richard Serre Billie Jo Shannon Diane Shaw Sandra Sheesley Don Sheets Debra Shlaes Barb Shoemaker Dennis Shoernate 98 A brawl at MHS? No, simply a Mighty Maroon after-school practice session, in which four boomirfg voices try out some of their spirit- boosting. Ted Short Patsy Siebenmann Kathy Sims Weldon Sippel Cindy Skoglund Debbie Skromme Ron Smartsty Craig Smart Carol Smith Catherine Smith Charles Smith Connie Smith Larry Smith Michael Smith diligent student fill evenings of final mhs year with studies i R. . gg 'EIN is. Liu Being a good student often means spending many hours a night over homework. Linda Snider Gina Schatteman does her assignments in preparation for the next day's classes. Joseph Soethe Stuart Soliz Craig Sommers Reed Sommers Steve Soper Richard Southwick Marilee Spahn Curtis Spillum John Spitznas Debbie Spore Dale Spriet 100 Judy Sprouse Diana Spurgeon Debra Stanley Marla Steele Bill Stevens Tex Stohl Roger Stolting Mike Stone Randy Strom Susan Sumner Nancy Sunderlund Julie Swales Robert Swanson Susan Swanson Steve Sward Karen Swedberg Victoria Sweet Johnny Tacker new experience gained in various field through part-time jobs Brenda Taylor John Taylor Karla Taylor Sheila Taylor Anne Tedell Michael Teel Jim Temple Steve Terronez Robert Thennis Roberta Thennis Barb Thomas Christopher Thomas Don Thompson Linnea Thompson Marion Tietz Pat Tingley 102 l F fr I Y l A.A1 Qgliifm ib'iW ' W Jf We This part-time job offers Kris Kuehl a glimpse tinue after graduation, having gained valuable of the veterinary field in which she may con- experience by working for Dr. Alex Stone. l l as ,,......,... Jill Tippel Rob Tolmie Janet Tonn Ralph Tornes Colleen Tracy Jon Tunberg Brad Twentyman Sandra Twing Carol Ulmer Eliseo Valdes , - 7--H --- ' small children, on-the-go parents create ever popular job for girls i -we l-, i - kiss ,Achim Babysitting in her spare time, Deb Kiehr not only earns money, Jim Vana but also makes many new friends. Mike VandeCasteele Carol Var1deMOOI'fel Dotti VanderHeyden David Vanerdstvelde Cindy Versluis Mary Versluis Susan Vonderhaar Nancy vonLangen Charles Von Motz Denise Vorhies Sue Vrombaut 104 l Mark Walker Jennifer Walsh Karen Walters BOD Warfield Mike Warner Patti Warren Donald Wassenhove Brad Watson Debbie Watson Gary Weller Mike Wenthe Linda Whitcomb Michael White Mark White Gayle Whitebook Susan Whitehead Craig Whiting Randy Whitmire 105 study hall fun brings unending laughter to staff room members Bonnita Wiborg Steven Wicks Richard Wiemer Frances Wiese Glenn Wilkerson John Wilkinson Nancy Wilkinson Pam Willett Becki Williams Nancy Williams Randy Williams Mike Willis Diane Wilson Sandra Wilson Steve Wilson Robert Windisch 106 Tressa Wolfe Colleen Wood Fal Wood Sharon Wood Michael Woods Jackie Woodward Carol Woolley Nancy Yaudas Bill Zelnio Kenneth Zu hn o :,. g.o, a Did you the hear the one about the . . . begins Marta Schatteman, relating another hilarious joke. after one last backward glance, seniors focus eyes on future iii? for sys 15 YS gina iffK'fJSf3 !.'fif7 Gfaiiff' ifiiiil -7? 'Zi nfiffs - i weiiwe r,ro Rica aauesh A iriZfA?i5E srssriiiiifiiiii iris? i C5212 as Tux? vvah nw uaviva xascais s3gz,:'Y aft? H in Zffiiiri, s , , 108 The notorious GBU exhibits another one of its many talents on a snowy Sunday afternoon, Jane Albrecht Renee Barritt Charles Baskett Chris Bauman Terry Beckman Don Brant Steve Brems Dawn Bromley Edmundo Cavazos Kenna Clifton Janet Cobert Kathy Cochuyt Janette Dalton Yvonne Davis Roy Davison Frank DeWitte Patricia Dietsch Kathleen Dunn Vicki Dzinkunska Bruce Elvidge Gregory Ervin Donald Ewing seniors not pictured Terry Garrison Pamela Goard Jack Griffin Bruce Gross Craig Guldenfennig Michael Hanson Lynda Houck Guy Keeley Mike Krack Larry Kyles Stephen Lavin ,JM M 4a.isiw24'fi Steven Lopez Steve Martinez Connie Miller Vickie Natsis Julia Noce Steve Nordquist Susan Olson Joe Quinn Gary Randall Trent Rigg Michael Rodts Terrence Rodriguez Cindy Roman Henry Ruiz Deborah Schenk Mike Shinn Craig Slater Roy Stearns Rob Uecker Tim Walker David Wates Bruce Watts 109 1 A 1 l S s sparkling faces old and new, excitement and plans, some pensive moments, demanding studies, unveiled opportunities, striving for a goal.- c students react. underclassmen junior float wins first place prom is met with smiles by all Active could be one term easily ap- plied to this year's junior class. Carrying on the tradition and setting precedents for future years kept the eleventh graders busy. Supporting the Maroons in their Homecoming victory, the junior float, entitled Shear Delight To- night, captured first place and fifty dollars during this annual event. In the newly-initiated Student Congress festival the juniors amassed the greatest number of points, entertain- ing the guests with a dunking ma- chine and cork gun shoot. These points furthered their bid for the class spirit trophy presented by Stu- dent Congress. Following in the footsteps of their predecessors, the juniors purchased class rings according to their per- sonal preferences. The usual ring dis- cussions ensued after these under- classmen received their orders shortly before Christmas. Displays of muscle power were prevalent as the junior girls competed in the yearly tug team event. Succumbing to their senior rivals, the girls decided to change their images by an appear- ance at the Junior Prom. The girls were dressed in their formals, while the boys were uncomfortably attired in either suits or sport jackets. With the school year drawing to a close, the juniors watched the seniors to see how they were to behave in their last year of high school. For all itwas an enjoyablejunioryear. WM W Vjjw ,,.c.,. . . i.2sffe,f .. .- I L, . gd, V 9 as ref? I V ' Preparing for the Junior Prom, Louise Lefler and Faith Seeds choose their formals. 1- ' Reviewing their plans for their second year at dent: Carol Hallene, Secretaryg Bob Freeman, their plans for the year were the festival and Moline High are Junior class officers Sally Treasurerg and Steve Keller, President. Among Junior Prom. Lundgren, Lit Board: Dan Carlson, Vice Presi- ll2 l JZ wp : A 1 P A-Q F? X 4 4 ' P rseww f . 4 ,M Ugh! Umph! Ohhh . . groan the girls on a running, many juniors enjoyed the fun and junior tug team as they strain to overpower excitement of participatingin the games. their opponents. Even though they lost in the wel ? ,.,,,. - ig . . M V H'. :-..L,:-, ra '..' Mg-:. .. . Counting the money the Junior class made at the festival are class sponsors Mrs. Parnell, Nlr. Carey, and Miss Schultz. Mr. Krouch is not pic- tured. H3 MR. COOPMAN PERIOD 1 FRONT ROW: C. Dorothy, B. Hilligoss, T. Berndt, M. Thomas, ROW 2: P. Manley, R. Biscontine, R. Shinn, T. Koberstein, R. Masias. BACK ROW: J. Hartman, L. Parker, T. Lopez, D. Starkey. MISS BECKMANN PERIOD 2 FRONT ROW: D. Lenc, S. Berstrom, J. Hoeltz- ner, B. Criswell, T. Ridnour, C. Dye. ROW 2: J. Fletcher, V. Woods, G. Carlson, P. Tro- baugh, R. Shipp, T. Vanert. ROW 3: R. Sparks, B. Clark, K. Baker, K, Kinsey, J. Ruchotzke. BACK ROW: J. Ward, J. Paul, G. McCIean, M. Hendershot, M. Ptak, G. Clauson. After long hours of hard labor and several late nights, this years Junior class assembled their prize winning float, Shear Delight To- night . II4 junior class float reigns victorious over 1970 homecoming parade P on il' .tr Saw I Q fi B' .s I . A ,,-qs ya? MISS BECKMANN PERIOD 4 FRONT ROW: M. Klansek, L. Johnson, L. Mulli- kin, J. Dahlbert, S. Giacomelli. ROW 2: K. Rahn, S. Long, J. Spiegel, L. Franks, J. John- son, K. Behnken, M. Teager. BACK ROW: M. DeWaele, S. Schilb, M. Barajas, R. Noble, C. Everett, B. Hasty, D. Marriott. MISS BECKMANN PERIOD 6 FRONT ROW: C. Taylor, M. Owen, M. Rey- nolds, ROW 2: R. Silversrnent, L. McKinley, R. Barr, C. Scritchfield. BACK ROW: N. Grimstad, K. Fox, M. Wisdom, L, Waterman, J. DeVrieze, K. Henry, D. Hansen. MR. BRADLEY PERIOD 3 FRONT ROW: R. Gilmore, C. Carleton, L. Floming, K. Anderson, D. Birdsell. ROW 2: J. Williams, C. Gadaire, L. Hubbard, T. Spal- ding, S. Mills, D. Henderson, S. Van Echaute, D. Morrison. ROW 3: C. Minear, C. Barham, R. Nipper, H. Torres, J. Smith, D. Larson. BACK ROW: J. Crippen, R. Angel, D. Cope, D. Pikuza, K. Maeglin, J. Wassenhove. MR. BRADLEY PERIOD 6 FRONT ROW: C. Kauzlarich, S. Pearsall, K. Armstrong, M. Ryder, L. Foutch. ROW 2: S. Spenler, B. Strother, C. Mellgren, K. Chum- bley, A. Pedesky, K. Harwood. BACK ROW: S. Masengarg, G. Minear, J. Ross, S. Evans, G. Vize, M. Tscopp, T. Krambeck. H5 MR. BRADLEY PERIOD 5 MRS. ELLISON PERIOD 5 FRONT ROW: C. Ruiz, P. Ullrick, E. Cervantes, L. Mier, L. Felgar. ROW 2: C. Lane, W. Johnson R. Wisely, D. Berhenke, R. Janecek, S. Hotch kiss, M. Deushane. BACK ROW: D. Hartman D. Sthoehr, C. Lane, M. White, M. Catlet, M. Heater, S. Rasmussen, P. Buckholz, F. Reyes. MRS. ELLISON PERIOD 1 FRONT ROW: C. Woodward, D. Wendell, T Clark, D. Berhenke, R. Allen, M. Gustafson C. Miller, S. Karlix. ROW 2: K. Dooley, P Surber, M. Freeman, D. Woods, K. Sletten, D Letfler, M. Quinn. ROW 3: D. Kondora, G. Mat- techeck, T. Moeller, H. Hoops, S. Blaser, J Drefchinski, S. Carter, M. Dailing. BACK ROW R. Ridnour, J. Van Norman, R. Egert, T. Garri- son, B. Korch, G. Anselmi, D. Hulting, J. Eddy, M. Hoffman. MRS. ELLISON PERIOD 3 FRONT ROW: D. Stokes, J. Simpson, J. We lander, D. Marion, K. Hamer, D. Banfield ROW 2: D. Allison, L. Nuss, N. Kron, J. Brady J. Galassi, J. Clausen, E. Harvey, ROW 3: A Peterson J. Robbins K. Bertelsen C. Coo er I . I D , D. Hull, P. Smith. BACK ROW: G. Schwabe, T. Lewis, T. Dopler, K. McLain, M. McDermand C. Siegfried, S. Joseph. II6 v festival provides entertainment fun for crowds of mhs students ff: r A victim of the dunking machine, junior Dave Henderson keeps his fingers crossed and hopes that no one is lucky enought to hit the lever. MRS. ELLISON PERIOD 4 FRONT ROW: S. Edlund, C. LaBotte, E. Blecker L. Urbain, C. Dobbells, ROW 2: C. Breckle, K Johnson, J. Oleson, G. Lynn, S. Gustafson, S Bender. ROW 3: D. Shaw, J. Tunberg, P, Ter rell, P. Patch, R. Schaefer, T. Hicks, D. Duke BACK ROW: M. Newell, W. Fitzpatrick, B. Rob erts, J. Corkery, M. White, B. Bauwens. MRS. ELLISON PERIOD 6 FRONT ROW: K. Ball, L. Wilson, D. Murphy, D Esterdahl, T. Scherer, ROW 2: P. Gaghagen, J Breshears, P. Schrempf, C. Piercy, K. Hart Zell, S. Cunningham. ROW 3: T. VanDamme W. Marzolph, M. Hoffman, J. lngelson, M Smith, D. Weaver, R. Rempe. BACK ROW: M Johnson, J. Griffith, M. Bottman, T. Law rence, S. Craig, P. Sherwin, P. Ockern, Junior, Tim Krambeck, painstakingly adds the finishing touches on the painted rocks sold by ArtClub at the MHS Fall Festival. H7 MR. COOPMAN 11B PERIOD 3 FRONT ROW: S. Kachevas, P. Scott, D. Wendt: ROW 2: B. Machado, S. Lemaster, C. Garcia: BACK ROW: A. Surdez, T. Goswick, T. Ferry, D. Hendricks, P. Johnson. MR. COOPMAN 11B PERIOD 4 FRONT ROW: T. Hodgson, J. Finkle, M. Stablein: ROW 2: G. Garland, D. McKay, L. Cook, J. Hart- man: BACK ROW: R. Poppy, S. Crews, D. Na- varro, D. Sandholm, B. Watson. H8 Students find that the small calculators can come in very handy when working with difficult math computations. As Debbie Burns studies the answer from the calculator, she realizes what a great help it is. students obtain knowledge of modern techniques in math lab MISS PHILLIPS 11B PERIOD 2 1 FRONT ROW: S. Barham, D. Green, D. McVey, W Easter: ROW 2: K. Frey, D. Suess, M. Osterand D. Crandall, R. Sage: BACK ROW: E. Johnson, B Warhourse, J. Britz, R. Phillips, R. Morrill. MISS PHILLIPS 11B PERIOD 3 FRONT ROW: P. Cooney, G. Villarreal, J. Dono- hue, K. Klingborg, C. Roberts, P. Sereg: ROW 2' E. Hallstrom, N. Hintz, D. Mahoney, L. Dilworth L. Barritt, M. Smith, G. Akers: ROW 3: R. Nel- son, S. Jamison, D. Erickson, M. Raney, M Lemon, M. Pearson, C. Jones, T. Hammar BACK ROW: G. Misfeldt, D. Hull, P. McKay, P Smith, A. Warner, J. Campagna, S. Oleson, D Clinard, R. Smith. MISS PHILLIPS 11B PERIOD 4 FRONT ROW: E. Hernandez, H. Perez, M. Buck, D. Newberry: ROW 2: J. Farrall, K. Taylor, A. Shattuck, R. Garza, K. Crane: BACK ROW: B. Sweet, T. Stanely, R. Sage, D. Denato, R. Law- FENCE. II9 MISS PHILLIPS 11B PERIOD 5 FRONT ROW: K. Ballou, V. Matter, J. Lemon, N. Schiess, L. Lefler, D. Powell: ROW 2: J. Witzee, S. Morrison, D. Blow, T. Anderson, P. Jackson, L. Collison, J. Weintraut: ROW 3: T. McMinn, S. Sherry, S. Holgersson, C. Dunn, T. Thorngren, M. Sullivan, R. Hellberg: BACK ROW: D. Joseph D. Peak, M. Smith, T. Kirschbaum, S. Friesth, DI Dunn, T. Bjornsson, A. Sherwin. MISS PHILLIPS 11B PERIOD 6 FRONT ROW: J. Smith, V. Maxwell, D. Albertson, C. Ver Straete, S. Keeton: ROW 2: P. Duhm, C. Furgie, L. Greer, C. Gasperovich, K. Baughn, S. Liberty, K. Kruse: ROW 3: P. Davis, S. Seibert, D Nolen, D. Conrad, D. Tolmie, L. Manchester: BACK ROW: F. Overton, S. White, B. Humphrey, J. Mayfield, J. Allen. MISS NEUMANN 11B PERIOD 1 FRONT ROW: L. Schinckel, P. Hellberg, N. Col- lins: ROW 2: N. Willey, C. Johnson, C. Decker: BACK ROW: T. Jared, M. Strandlund, M. Torres, S. Maston. 120 puppy polypeptide wins love as mascot of biology department 'Lf..lT73 Like many other Biology students, Lissa Collison has fallen in love with their cute mascot. MISS NEUMANN 11B PERIOD 2 FRONT ROW: C. Tracy, K. Kastelic, G. Fronreich M. Rizor, R. Sloan, M. Harding: ROW 2: C Bridges, R. Cross, R. Vaszuez, S. Bigham, N Buster, L. Serres: ROW 3: M. Anderson, E. Peter son, S. Folmar, A, Moody, C. VanAcker, R Cleek, S. Dudzik: BACK ROW: J. Bell, R. Kramer S. Monson, S. Thompson, D. Holroyd, S. Schna bel. MISS NEUMANN 11B PERIOD 3 FRONT ROW: B. Watts, M. Hodgkin, P. Cause- maker, A. Karlirg ROW 2: M. Noce, B. Schu- macher, M. Danner, B. Mudd, P. Madison, B Block: BACK ROW: K. Drummond, J. Aitken, T Purse, R. Cochuyt. I2I MISS NEUMANN 11B PERIOD 5 FRONT ROW: V. Johnson, T. Romo, J. Campbell, K. Wyers, J. Landry: ROW 2: J. Short, R. Sprung, G. Lopez, J. DeVrieze: BACK ROW: M. VanErst- velde, J. Aultman, S. Izer, F. Ortiz. MISS NEUMANN 11B PERIOD 6 FRONT ROW: J. Johnson, M. Axnix, M. Harper: ROW 2: K. Schaeffer, D. Burns, L. Wambeke, D. Green: BACK ROW: M. Crane, G. Stoewer, R. Walden, J. Schuett, D. Carlson, M. Chilberg. MISS ROSEBERG 11B PERIOD 1 FRONT ROW: D. Moburg, C. Klann, K. Sylvester, J. Whitmire, T. Rockwell: ROW 2: B. Hughes, D. Frame, K. Peterson, K. Halloran, B. Sturgis, S. Bishop: ROW 3: L. Thomas, M. Stevens, P. Ar- nold, A. Compton, C. Woodard, D. Beckett, J. DeVolder: BACK ROW: M. Robinson, J. Jauhola, S. Caldwell, D. Laughead, R. McGill. MISS ROSEBERG 11B PERIOD 3 FRONT ROW: J. Rodriguez, K. VanHoutte, N Bealer, M. Burnett: ROW 2: D. Wright, V. Fruti ger, D. Clayton, D. Webb, J. Jamieson: ROW 3 R. Fischer, D. Allison, P. Marckese, L. Smitty, P Hingtgen, B. Baird: BACK ROW: B, Kettler, J Landuit, M. Cheek, K. Mundell. 122 rain-drenched students watch as ma roons slide to victory These patriotic students have come prepared to endure the rain at our last football game. MISS ROSEBERG 11B PERIOD 5 FRONT ROW: S. Rose, P. Atkins, C. Weissmann B. Edwards, K. Biggs: ROW 2: S. Burrows, C Day, S. Schweitzer, B. Shipe, S. Hammerberg B. Thornburg: ROW 3: B. Hansen, P. Vander Vennet, M. Palmer, M. Yaudas, W. Lange, V Linzer, D. Adams: BACK ROW: M. Possin, T Kusnierczyk, D. Fortin, G. Johnson, G. Souza R. Lorenz. MISS ROSEBERG 11B PERIOD 6 FRONT ROW: S. Dee, R. Hellebuyck, E. Bennett, E. Gibson, J. Riddle: BACK ROW: G. Benejam, RI S. Teckenbrock: ROW 2: J. Stange, J. Holmgren Van Oteghem, B. Healy, P. Norien, L. Carlson I23 MR. ROUSH 11B PERIOD 2 FRONT ROW: B. Swan, M. Goddnight, S. Sosbee, L. Attwood: ROW 2: D. Rhodes, W. Henrichs, N. Craxton, E. Baker: BACK ROW: C. Meredith, K. Dreifurst, R. Salsman, V,VanDamme. MR. ROUSH 11B PERIOD 5 FRONT ROW: B. Van Eckhoutte, B. Crow, B. Carlson, S. Morgan, D. Russell, S. Streit: BACK ROW: B. Schaeffer, A. Fredrickson, K. Wojcinski, S. Dhaenens, D. Pauley, B. Behrends. WW 124 student imprisoned in senior class jail during the festival MISS SHAWGO 11B PERlOD 1 FRONT ROW: A. Lucas, J. Pfeitf, C. Duke, D. Stevenson: ROW 2: L. Jacobs, E. Clow, J. Schou- Why me? Deb Stokes wonders while she serves her time in the festival jail. rek, T. Gapinski. D. Knight: ROW 3: K. Koeppel, J. Swales, J. Gulley, C. DeVolder, J. Michael: BACK ROW: J. Beckman, E. Slininger, B. Bald- win, G. Huntoon, D. Olson. MISS SHAWGO 11B PERIOD 2 FRONT ROW: J. Carlson, H. Gates, F. Seeds, L Smith, D. Mercer: ROW 2: B. Witherspoon, C DeBo, M. Johns, S. Lundgren, S, Aitken, P. Van Vooren: ROW 3: G. Panicucci, M. Shlaes, C. Pal mer, S, Edwards, L. Janoski, G. Johnson, J Lasley: BACK ROW: G. Ballard, S. Boyd, K Meyer, S. Rose, R. Hammer, D. Benson, T Trevor. MISS SHAWGO 11B PERIOD 4 FRONT ROW: K. Johnson, K. Aldene, M. Nas- Iund, M, Wilson, M. Cooley: ROW 2: K. Raney, L Rigg, C. Merrick, N. Sears, R, Kilby, N. Elhoffu BACK ROW: M. Hanz, M. Boom, K. Newton, A Kouris, S. Fornes, D. Roelens, C. Schroeder. MISS SHINNEMAN 11B PERIOD 1 FRONT ROW: J. VandeMoortel, C. Van Landuyt D. Kremer, P. Snyder, S. Samuelson: ROW 2 D. Findley, M. Tenorio, V. Hallquist, D. Cap- paert, W. DeLong, N. Anderson: ROW 3: D. Matz A. Forest, N. Wright, L. Aitken, M. Karstens, J Conway, B. Weeks: BACK ROW: G. Reinhart, B McMillin, A. Leech, J. Mortier, R. Inskeep, D Perkins, A. Piasecki, D. Freisinger, M. Alvarado S. Van De Gejuchte. MISS SHINNEMAN 11B PERIOD 4 FRONT ROW: B. Willits, A. Smith, M. Almanza V. Van Daele, K. Hendrix: ROW 2: R. Renner, A Johnson, S. Cornmesser, P. St Dennis, O. Black- man, R. Miller: ROW 3: J. Young, R. Jump, D Henderson, D. Whaw, D. Franks, K. Osborn BACK ROW: J. Haun, P. Winter, P. Terrell, D Dailing, M. Berry, K. Breecher, M. Gabbert. 125 MRS. WHEELOCK 11B PERIOD 2 FRONT ROW: M. Beard, L. Harper, V. Long, P. Dorr: ROW 2: G. Johnson, M. Youngvorst, B. Cowdery, S. Byrne, B. Moon: BACK ROW: G. Elliott, R. Peterson, D. Scott, B. Westerdahl, R. Escaieba, D. D'Lev MRS. WHEELOCK 11B PERIOD 4 FRONT ROW: J. Steenbock, K. Mallek, C. Bar- tels, E. Howdeshellg ROW 2: M. Quinlin, B. Rey- nolds, A. Soethe, B. Leuntjens, V. Hernandez: ROW 3: G. Strayhall, C. Swanson, S. Harder, D. Hayes, M. Marsoun, D. Cox: BACK ROW: S. Bun- ten, R. Johnson, K. Adams, M. DeMay, R. Millman. MRS. WHEELOCK 11B PERIOD 5 FRONT ROW: J. Strambaugh, N. Cervantes, B. Greene, K. Shipley, J. Denkhoft, S. Goodwin: ROW 2: D. Vatt, R. Wilson, D. Kissell, L. Mc- Clarrinon, M. Owen, V. Brown, J. Wolverton: ROW 3: T. Pappas, D. Exner, M. Bergren, D. Redman, J. McKarty, J. Lynnon, R. Moeller: BACK ROW: P. Smith, J. Farrell, R. Willaert, M. Gipson, C. Duyvejonck, D. Van Der Linden, B. McMillin, T. Lopez. Delighted that their long-awaited classrings have finally arrived, Sue Hammerberg and Becky Kakavas compare the two different styles. 126 '71 classrings brighten mhs halls as christmas approaches Absentees are: Juniors, Jim Maitland and Alyin Barnes: Sophomores, Wilma Young and Ray Talley. eg if 69. - fig. 5 R fel? .X Z' A MRS. YOUNGDAHL 11B PERIOD 2 FRONT ROW: J. Godwin, A. Bedford, L. Verhelst A. Albrecht: ROW 2: P. Bristol, J. Flatley, S DeVrieze, L. Trapkus, S. Siirila: ROW 3: C Treanor, S. Keller, M. Lukens, K. Starr, J. Wil- liams, S. Tillberg: BACK ROW: K. Harris, E Lillybeck, K. White, B. Kirchoefer, J. Hanky, D McCarthy. MRS. YOUNGDAHL 11B PERIOD 4 FRONT ROW: N. Dietsch, P. Wells, P. Evelans, K Lehman, M. Knoles: ROW 2: D. Bisdorf, P Mitchell, M. Cherrington, B. Mitchell, S. Ras- mussen, D. Duncan: ROW 3: M. Hoyt, R. Schu macher, R. Ericson, J. Harper, P. Brasmer BACK ROW: B. Rock, R. Webb, J. Michaelsen, C Ross, M. Kloster, S. Ciaraldi 127 sophomores achieve recognition by generous contributions During their first year at high school, this year's sophomore class faced many problems. Looking forward to their annual class party, the sopho- mores discovered that arrangements had been confused and the festivities canceled. Undaunted, they finally did have their party, after the many problems concerning its scheduling were solved. Room lacation was an active sport in which many of these underclassmen participated. The trick to the game was to look at room numbers with- out arousing the suspicions of upper- classmen. By the end of the year each student could confidently admit vic- tory. This year's sophomore class stood out because of their generosity. Without their contributions it is doubtful that Share Joys would have reached its record-breaking total. Banding together, this class pre- sented the greatest amount of money ever contributed by any soph- omore class. Their generosity also was expressed by the money they gave for the Dennis Davis Memorial Fund. All of these experiences helped to make their sophomore year very meaningful. . .. Hr-in 513. ,- , .,..,. Like many other sophomores, Betsy Foster discovered that finding her classes was quite a problem on the first day of school. fxfx MQW Looking forward to their first year at Moline High are the sophomore representatives to 128 'Q' if GA J' Student Congress: Marci Jonson, Mary Tellene, Mindy Grafton, Doreen Atkins, Sue Bidding, Dave Swanson, Sue Thompson, Steve Gibson Mark Wilson, and Jeff Nelson. Y si 4 r an-nyfqa ' v Helping others free their cars after the Janu ary blizzard is a task that is not only benefi- cial but fun for these sophomores. f vi. Reviewing their plans for the sophomore class party are sophomore class sponsors Mrs. Nus- baum, Mr. Leech, and Mr. Coopman. Oh Butterfinger! This ornery locker won't open , Dean Spillum grumbles as he kicks his jammed locker. Sue Bidding gives others a chance to show their charity by hertrick ortreating. MRS. BERNARDI PERIOD 1 FRONT ROW: M. l-lauck, J. Burrus, C. Hunt, K. Jones, B. Stephens, S. Navarro, M. Graham. ROW 2: S. Hile, S. Carlson, P. Benedict, M. Lord, R. Von Thun, M. Romero, J. Douglas. BACK ROW: K. Anderson, G. Goebel, G. Sitler, B. Maddelein, M. McNeil, C. Cook, C. Taylor, K.Wilson. MRS. BERNARDI PERIOD 2 FRONT ROW: C. Amundson, C. Dangel, J. Ehr- hardt, D. Kerr, L. Spurgetis, M. Braatelien D. Hoogheem. ROW 2: C. Hepner, C. Dunlap A. Robinson, K. Workman, S. Larson, D. Ferral K. Peterson. BACK ROW: J. Tippel, S. Gibson K. Jones, M. Cackler, M. Meersman, K. Ellis, M. Mountain. l3O acting on annual tradition soph y-teens trick or treat tor unicet 'L l 7? V.-7. f V f' it Y . E Q A 7 ff 'qw if V .rg Elin .i Q A K If A A f t , 'Am P- .1 MRS. BERNARDI PERIOD 4 FRONT ROW: S. Buller, C. Mitchell, B. McNeal, B. Donison, C. Stambaugh, G. Teske, V Bailey, ROW 2: L. Sandholrn, W. Osborn, K Mack, K. Manasco, K. Danner, N. House, M Westcott, M. Jump. ROW 3: P. Heffernan, P Guerrero, M. Griffin, A. Zuccarello, R. McKay R. Lawrence, T. Sikardi, D. Martin, BACK ROW: L. White, D. Walker, T. Ruberg, D. Foulger, G Pond, S. Binns, M. Moftitt, G. Robertson, K Ekstam. MRS. BERNARDI PERIOD 5 FRONT ROW: L. Courtney, A. Padilla, D. Evert, D. Schinckel. ROW 2: H. Harris, R. Babincsak, J. Johnson, E. Cervantes. BACK ROW: J. Jore dan, D. Strong, J. Hoye. MRS. BERNARD! PERIOD 6 FRONT ROW: K. Danielson, C. Edgar, D. How- ell, D. Woods, J. Patton, ROW 2: S. Strom- gren, P. Vermeire, H. Langill, F. Maddox, S Buchanan, S. Goode. ROW 3: N. Thompson R. Terrell, P. Rolsch, K. Sandvick, B. Mitchum S. Gustafson. BACK ROW: J. Foster, J. Mce Neely, V. Baber, D. Skantz, C. Champion. MISS CARSON PERIOD 1 FRONT ROW: S. Cleek, K. Hunwardsen, V Douglas, S. Berndt, P. Snyder, C. Terrill ROW 2: R. Cain, T. Kraker, M. Olberta, P Patch, C. Duncan, D. Allison. ROW 3: L. Uni zicker, J. Jones, J. Anderson, M. Warner, C Nawrocki, B. Hillyer. BACK ROW: K. Schlundt M. Cornell, J. Ruge, B. Maxwell, D. Maddox B. Stevens, J. Harder. 131 Marilyn Smith proves that riding a unicycle is enjoyable as she speeds down her street. What in the world did I get myself into! Kathy Schaeffer seems to wonder as she attempts to mount her friend's unicycle. l32 MISS CARSON 10B PERIOD 2 M. Smith, G. Escarza, J. Beard, D. Gaghagen, L. Box: ROW 3: D. Kinkead, A. Gillen, C. Math, D. Neaves, M. Douglas: BACK ROW: P. Smith, B. Dyer, P. McKee, C. Arndt, K. Veach. FRONT ROW: C. Callas, D. Ecker, M. Telleen, J. Reischmann, K. Kephart: ROW 2: M. Johnson, MISS CARSON 10B PERIOD 4 J. Lauth, J. Ackerland, M. Rogers, C. Bivins, S. Strait, T. Martin: BACK ROW: T. Christensen, D. FRONT ROW: C. Thomas, A. Meredith, M. Davis, Schwarz, L. Quinn, J. Hemmingson, R. Brown, M. Madison, C. James: ROW 2: R. Watts, J. Oros, J. Flack, B. Elliott. soph girl discovers interesting pastime: tames wobbly unicycle MISS CARSON 10B PERIOD 5 FRONT ROW: V. Smiddy, P. Baker, P. Reese, R. Wichman, S. Van Houtte: ROW 2: S. Allen, S. Lawton, M. Grafton, V. Jamison, L. Duby, T Maharg ROW 3: R. Sarver, D. Clark, L. Schanfich M. Blakeney, J. Metcalf, T. Mooney, M. Herman BACK ROW: C. Hallstrom, J. Aitken, J. Roche, J Kimpe, W. Frank, L. Thomas, J. Spranger, M Evans. MISS CARSON 10B PERIOD 6 FRONT ROW: B. Davis, B. Guy, C. Ballard, T Kruse, W. Stemple: ROW 2: K. Faust, C. Carl- son, D. Coussens, P. Rohrer, L. Schourek, D Johnson: ROW 3: K. Allen, B. Noah, M. Mahieu G. Emler, D. Haws: BACK ROW: D. Tillberg, D VanDeCasteele, R. Quick, S. Morse, H. Black. MR. DEROUIN 10B PERIOD 2 FRONT ROW: G. Vande Casteele, C. Colley, G. Armetta, D. Nelson, Y. Cavazos, V. Lovestrand B. Forsberg: ROW 2: D. Cullun, B. Olson, D. Ellis L. Walters, T. Carleton, C. Serre, L. Wiese, B Payde: ROW 3: J. Feuerbach, M. Talbot, R Boom, C. McGovern, C. Dismer, K. Krebs, S Roegiers, T. Burke: BACK ROW: M. Poulos, T Smith, J. Lawrence, G. Abbott, S. Gorter, R Johnson, B. Zabloudil. I33 1 v v MR. DEROUIN 10B PERIOD 4 FRONT ROW: S. Buser, R. Davis, S. Thorne, P. Smallwood, Y. Malone, ROW 2: R. Coney, R. Ex- bom, J. Kiesele, K. Allen, B. Matters, R. Van- Landuyt, B. Henderson: ROW 3: D. Thompson, S. Dreifurs, B. Peak, W. Blette, K. Clark, T. Hancks, R. Gill: BACK ROW: B. Starr, B. Lewis, B. Deutsch, C. Beaird, B. Moon, S. Rohrbach. MR. DEROUIN IOB PERIOD 6 FRONT ROW: C. Bridges. V. Babincsak. P. Le- Comte, M. Moran, C. Allison, C. Willhousez ROW 2: S. Anders, L. Davis. V. Vogel. G. Flynn, T. Schrempf. L. Smith. S. Hallas: ROW 3: S. Dun- lap, A. Stevenson, M. King, D. Bealer, T. Hand- ley: BACK ROW: D. Toye. S. Ferguson. J. Herman. M. Nitschke, N. Miller, F. Cahalan. I Q .......N-We 5 if Like most students, this Sophomore finds that the library is a great help for finding materials or just catching up on his homework. 134 new library hours provide extra time for studies before school 'X X.. MRS. NUSBAUM IOB PERIOD 1 FRONT ROW: G. Clement, M. Bates, D. Young, S. Walston, S. Quick, G. Maniscalcog ROW 2: K. Hernstrom, T. Clark, B. Bybee, S, Roseberg, C. Koehler, D. Fraser, T. Miller: ROW 3: F. Williams D. Felgar, S. Perron, B. Snyder, P. Czerewko T. Almanza, J. Borkhardt: BACK ROW: J. Han neman, D. Dupont, R. Reed, J. Schultz, C. Taylor, D. Horlaerfield, D. Twigg, J. Seda. MRS. NUSBAUM lOB PERIOD 2 FRONT ROW: K. LeMaster, S. Rangel, P. Smith J. Carden, S. Watkins: ROW 2: J. Clinch, C Moritz, D. Anderson, L. Ferry, B. McDow, M Zmuda: ROW 3: D. Williamson, D. Trobaugh, S Douglas, M. Lambrecht, G. Boyle, J. Green, D Beck, K. Kinnan: BACK ROW: T. Fuller, G. Ealy H. Hitchcock, B. Sullivan, S. Czerewko, J. Sed lock, J. Papenhausen. MRS. NUSBAUM 1OB PERIOD 3 FRONT ROW: R. Wolfe, M. Miller, M. Mitchell, D Lothridge, D. Hugaert: ROW 2: G. Harmaning C. Nelson, R. Bess, J. Carmack, C. Vanvooren D. Verfaillie: ROW 3: J. Kinzey, C. Rockwell, L Forslund, C. DePoorter, J. Stille, R. Abraham- sen, S. Rynott: BACK ROW: M. Cothron, K Ewert, P. Paulin, B. Jones, R. Johnson, D Busen, M. Wilson, D. Muller. MRS. NUSBAUM 10B PERIOD 4 FRONT ROW: C. Lyseng, P. Nelson, P. lde, B Griffin, D. Hayward: ROW 2: M. Tracy, K. Biggs C. Carter, J. Ericson, J. Wirz, P. Strandlund ROW 3: G. Day, R. Knock, P. Spaulding, V Schmitt, H. Benker, D. Dickerson, D. Phelps BACK ROW: J. Kane, M. Franz, M. Alvarado, S VanSpeybroeck, S. Swanson. MRS. NUSBAUM 10B PERIOD 6 FRONT ROW: S. Reberry, C. Hoffman, P. Whit- ing, D. Axne, E. Lopez, B. Kakavas: ROW 2: D Harlow, O. Doolay, S. Ryan, B. Peterson, L Thompson, K. Rohrer: BACK ROW: J. Jabaay, J Catlett, J. Cordes, J. Wood, B. Routt. l35 v MRS. MOFFlTT IOB PERIOD 1 FRONT ROW: R. Johnson, P. Noel, L. Reger: ROW 2: H. Harris, S..Gengler, A. Smith, H. Baker: BACK ROW: L. Charlton, R. Leeson, J. Vermeire, J. Ford. MRS. MOFFITT 10B PERIOD 2 FRONT ROW: D. Hardi, G. Natsis, M. Sonneville, K. Carter, M. Foster: ROW 2: K. Anderson, J. Reeder, J. Lester, J. Johnson, K. Mclntosh, D. Ferry, C. Cortez: ROW 3: M. Johnson, R. Ear- nest, D. Hoffman, E. Collins, D. Sullivan, M. Ru- dolph: BACK ROW: J. Patterson, S. Dockery, M. Griffin, J. Mason, R. Malmstead, J. Brandt. Marc Rudolph and Sergi Czervvko demonstrate how they assembletheir violins. 136 sophomore boys fiddle around making and repairing violins Ns. .ul I an.- F Mal. W1 ,seal r 'mal swmag 3, MRS. MOFFITT IOB PERIOD 3 FRONT ROW: J. Rursch, S. Bristol, L. Holmes M. Vasquez, S. Collins: ROW 2: B. Beck, S Thompson, S. Srail, L. Mathias, J. Nielson, C Jamison: ROW 3: M. McRoberts, D. Richardson M. McCarthy, L. White, T. Dow, P. Koresko, J Nelson: BACK ROW: D. Kelley, J. Boyle, D. Spil- lum, D. Glynn, R. Delp, P. Welander, B. Fisher MRS. MOFFITT 10B PERIOD 5 FRONT ROW: D. Burke, M. Lerschen, J. Sidlin- ger, N. Webb, L. Egert: ROW 2: D. Atkins, L. De- Vrieze, P. Mitchell, J. Wood, R. Burnett, T. Davis R. Suiter: ROW 3: P. Johnson, L. Willett, J. Mc- Donnell, D. Richmiller, S. Heegan, R. Hundley M. Conner: BACK ROW: R. Morgan, S. Kennedy G. Vinar, M. Ross, J. Stiman, R. Van Brooklin M. Slater, B. Dye. MRS. MOFFITT 10B PERIOD 6 FRONT ROW: T. Knight, J. Septer, D. Wilson, D Foy: ROW 2: S. Newlin, S. Bauer, J. Soethe, C Van Daele, C. Hesser: ROW 3: G. Burton, J Harp, D. Swanson, D. Rhodes, M. DeLathower, P. Ross: BACK ROW: K. Anderson, B. Lindsey, J Fifer, M. Marriott, P. Impens, D. Villarreal, S Marolf. MISS O'BRlEN READING PERIOD 4 FRONT ROW: D. Wilkerson, L. Oliva, A. Gilmoe BACK ROW: B. Jones, C. Carty, B. Soliz, B Leuntjens. l37 I MISS O'BRlEN READING PERIODS 5-6 FRONT ROW: S. Rockwell, P. Tomlinson, N. Eastland, M. Hutton: ROW 2: M. Christopher, T. Parks, L. Decoster, R. Marks, BACK ROW: W. Mitchum, D. Kistner, T. Bullock. MISS O'BRIEN READ. MRS. O'CONNELL 1OB PERIOD 1 FRONT ROW: K. Schaaf, L. Stromer. G. Hag- gard. C. Del.aRosa, S. Bailey: ROW 2: C. Carsen. P. Scudder. S. Kelley, S. Williams, J. Winston. C. Culbertson: ROW 3: D, Hill, K. Dunn, B. Boden B. Churchill, D. Keloy, M. Rynott, R. Minchg BACK ROW: D. Lipake, J. Welsh, P. Powell. I. Cavazos, M. Hammitt. MRS. O'CONNELL 10B PERIOD 2 FRONT ROW: G. Vande Walle, J. Byrd, C. Col- clasure. B. Huntington, P. Hendrix: BACK ROW: D. McDowell. G. Reingke. G. Clauson, B. Fox, T. Roberts, MRS. O'CONNELL 10B PERIOD 3 FRONT ROW: K. Peterson, L. Torres, V. Black- man, D. Parr: BACK ROW: D. Estes, M. Hayes, P. Cook, P. Smith. l38 I V , 4 I ai driver ed becomes new challenge as students drive by themselves Larson: ROW 3: E. Salem, G. Kaiser, B. Gibbons, B. Criswell, J. Page, D. Thomas, C. Clark: BACK ROW: S. Kurtz, R. Strandlund, E. Sagon, S. Blaser, IVI. Dempsey, T. Hammerberg, S. Porter, T. Welsh. MR. COOPMAN 10B PERIOD 2 FRONT ROW: S. Briesch, L. Miles, L. Anderson, K. Hoyt, P. Ward: ROW 2: J. Driscoll, M. Tara- gowskie, M. Norton, C. Mathias, D. Sheets, N. MRS. O'CONNELL 10B PERIOD 4 FRONT ROW: M. Grafton, L. Oliva, L. Garcia: ROW 2: R. Tidwell, J. Sandburg, C. Crisel, J. Kizer: BACK ROW: T. Pynckel, S. Rockwell, B. Stevens, J. Roche, S. Schroeder. MRS. O'CONNELL 10B PERIOD 6 FRONT ROW: N. Johnson. T. Gunnerson, L. Rogers: ROW 2: B. Dainel, M. Muldoone, B. Stone, S. Aswege: BACK ROW: S. Cooper, D. Grimm, E. Richardson. w .4 Q' y ,MM-21+ W gy 'V 1 re' I . ' ft Ai :wif . , my- Z. ,Ffh -we ., I ay , ws, M f : ' tr M S- , , .. . . , ' T . . 3. Y . ,,,, .. . . . egg s.fg,,iQ.g::,,2.1 .,.,,.- Igy.:g-if-,,.glitz.:-3-..:'f3c':wr'::,,,.--f'1'f.5j-vi if-1,1-ei-5,,,F'. :f-fu.f-5::,-'g2..5,,:-,wifi-51gin-.,.-,,.,.,,. ,... .1-,.g,3-V. , I , H W y . 1 t fr' . .: H-H?-rw-421-4.5 1 -Q. .M A '.- . - ff-i ff? Me.. --ei. .. .. .. -. '. : Which way should we turn now? these stu- dents ponder as they attempt to park their car. 139 MR. COOPMAN 10B PERIOD 5 FRONT ROW: B. Chapman, C. Roberts, C. Jones, P. Spiegel, S. DeWitte: ROW 2: J. Mc- Craw, T. Washburn, C. Hickle, M. Sims, R. Garner, K. Hebdon:'ROW 3: M. Winters, B. Grimes, D. Armstrong, R. Rizzoio, V. Fitzsim- mons: BACK ROW: S. Soliz, J. Carlson, M. Sweers, J. Depoorter, J. Miller, J. Olson, MR. COOPMAN 10B PERIOD 6 FRONT ROW: M. Grafton, M. Sullivan, J. Wen- Inger, D. Lord: ROW 2: M. Flewallen, P. Smith, S. Christoflerson, S, Heath, M. Kuberski: ROW 3: J. Despain, J. Nipper, S. Sanderson, T. Houchin, S. Beitel, S. Van Erstvelde: BACK ROW: C. Parker, C. Wood, A. Maitlen, R. Serres, M.Carnicle MISS SHINNEMAN IOB PERIOD 6 FRONT ROW: P. Carey, N. Monroe, B. Craig, K. Maroon, L. Wilinsong ROW 2: M. Johnson, A. Tormeno, L. Simmons, S. Huennelens, B. Haake, F. Drinkwine, ROW 3: C. Warner, J. Libey, S. Montag, B. Olson, R. Beyhl, J. Thomp- son: BACK ROW: J. Callahan, M. Shipley, S. Hohnson, B. Robertson, J. Anderson, D. Rigg, B. Nelson MRS. TIMSON 10B PERIOD 1 FRONT ROW: K. Powers, L. Taylor, R. Mathias, P. Finch, T. Rosson, S. Anderson: ROW 2: J. Holmes, J. Milroy, E. Caras, M. Brashears, M. Newton, B. Griffee: ROW 3: S. Rippey, D. Sparks, A. DeMink, M. Berhenke, S. Seibert, N. Chinn, J. lwataki, T. Kondora: BACK ROW: V. Lorance, D. Woodard, K. Eastman, L. Allen, R. Rumlei, E. Haskins, T. Teachout, D. Webb, M. Garrison I4O MRS. TIMSON IOB PERIOD 2 FRONT ROW: M. Eaton, C. Kerofsky, E. Knees, B. Barnes: ROW 2: M. Johnson, E. Miller, A. Fahlberg, D. Graham, R. Buhrke: ROW 3: W. Williams, S. Bitting, D. Cooper, B. Foster, N. Simmons, H. Swanson: BACK ROW: D. Hines, A. Cowan, J. Rash. MRS. TIMSON 10B PERIOD 4 FRONT ROW: L. Dunton, P. Jones, P. Melton ROW 2: R. Hawotte, R. Tingley, K. Countryman BACK ROW: L. Dempsey, L. Hulting, J. Ander- SOD. MRS. TIMSON 10B PERIOD 5 FRONT ROW: L. Reinwein, S. Van Cleave, D Crowe, S. Finkle, T. Sullens: ROW 2: P. Holm quist, J. Nehlig, C. Kratzberg, E. Gaskill, G Sletteng ROW 3: F. Ryser, J. Lorig, E. McSorley S. Andrews, Y. Shipley, J. Tunberg, M. New ell: BACK ROW: T. Bingham, M. DeBaene, D Jarrard, K. Butter, G. Eckert, D. Oller, M. Mc Coll, R. Wiemer. MRS. TIMSON 10B PERIOD 6 FRONT ROW: B. McDermott, G. Swieter, L Youngblood, L. Schimmel, D. Anderson, C Garrison: ROW 2: P. Carlson, L. Huggins, S Covents, K. Bromwood, J. Nelson, K. Edwards K. Siebenman: ROW 3: K. Peterson, C. Toline, J Kirschbaum, J. Thomas, S. Buckley, K. John son: BACK ROW: A. Matykiewicz, R. Rogers, T Murphy, J. Westbrooks, S. Wills, M. Owens, P Dennhardt I4l underclassmen find ways to help others and enrich their lives sw: N W Stopping in for some advice before school, a come to aid Moline High in the counselling student talks to Mrs. Rollinger, who has department. Wwwmmgw . ' -f?Y '1 Rs-Hs4 :a1,,. , A. Louise Trapkus gives her aid with the Share Joys campaign. She helped the Line O'Type sort and distribute clothes and toys. Sue Hammerberg and Jackie Stange ponder problems presented by their rippletank. 142 H Doing experiments is fun, but Jeff Miller isn't so sure about the cleaning up after- wards. Admiring the athletic trophies, Diane Kincaid realizes how many honors Moline has re- ceived. 5 li airmen Making a blouse for her younger sister, Karen Maroon finds that sewing can be fun and rewarding, not only for herself but for others. A common meeting place in moline High step on it, or they might have to scrub it with is where J and B Halls meet at the atoothbrush, However, students must be careful not to l43 swf az' 1 N 4 We .,. ,ai from quiet to fanfare, strike, whirl and pose, bows in unison, thundering drums, quavering notes, gloved hands applaud, smiling faces, bated breaths, voices lifted-the show comes on. fine arts eight seniors are presented with fine arts awards for excellence Dramatics Dra matics Dramatics Stage Crew Gayle Hensley Dawn Hoyt Nancy vonLangen Tim Dyer Orchestra Band Chorus Dance Jackie Mathias Mark Ohlsen Lisa Carlson Wendy Henss Presented to seniors for outstand- ing performances during their high school years in various areas of FineArts. Just as important as the construction of a set is the removal of it after the show. 146 a 1-.1 wwts...w A winter reunion and homecoming float highlight year fortroupe 1900 The past year has been a time of ac- complishment tor Thespian Troupe 1900. Under the direction of Miss Delores Beckmann, it had the spring and winter initiations with a reunion for all alumni. The mem- bers sold pop during the intermis- sions of the plays, ushered at Broadway Theater League shows, and entered a float in the Home- comingParade. 433 Making preparations for the spring initiation are the Thespian officers. They are Scott Jo- seph, presidentq Sue Sumner, treasurer: Jeff Adamson, vice-president: Chris Moore, cor- responding secretaryg Dawn Hoyt, historian, and Nancy vonLangen, recording secretary. The Thespian members of Troupe 1900 are ROW 2: Jim Champion, Gayle Hensley, Lisa Holgersson, April Compton, Marty Lukens FRONT ROW: Linda Dilworth, Alven Barnes, Carlson, Leith Rosenthal, and Greg Stoewer. Carla Compton, Deb Skromme, Scott Friesth Deb Stokes, Barb Thomas, and Lou Trapkus. BACK ROW: Gary Donohue, Tim Dyer, Sue and Steve Dudzig. 147 Ralph consoles Mistress Merrythought by telling her that he will regain her jewels. M . We., ,A I ,,.M.,m Though he scorns Pompiono's love, like a true Knight, Ralph pays for her father's help. 'W-iii' l48 ii-- V ,- Ralph displays his true knighthood by slay- ingthegiantthereby savingthe prisoners. the knight of the burning pestle a play within a play on mns stage J sper L d reat Ii'I abner a hitg musical breaks friday night attendance record 150 Marryin' Sam convinces Daisy Mae that she is not past her prime in life and gives her new nope for catching L.i'l Abner. f 'W The husbands are changed to musclemen by Mammy's tonic, Iosingali romantic interests. The entire Dogpatch community pays tribute to their famous hero Jubiiation T. Cornpone. When the men are changed back, the wives are happy and harmony reigns in Dogpatch. His tonic changed the scraggly husbands back manticized Li'l Abner. He also saved Dog the way they was and Hpassionized and ro- patchfrom becominga nucleartest site. Daisy Mae is elated when Abner returns from Washington for the Sadie Hawkins Day Race. 151 contemporaires' schedule includes parades, games, and variety shows Continuing to display their fine danc- ing talent, the Contemporaires, under the direction of Mrs. Pat Shannon, have completed another eventful year. ln addition to promoting school spirit by performing precision jazz routines at football and basketball games, the girls did a marching drill in the Homecoming parade and per- formed in One Night of Melody. Contemporaires is an emphasis dance class scheduled for physical education in which advanced forms of choreography are taught. The Con- temporaires also attended a dance concert at the Civic Theater in Chi- cago and other concerts to help with their understanding of the fine arts. The 1970-71 Contemporaires are FRONT ROW: S. Metz, W. Henss, M. Anderson. ROW 2: S Powers, S. Bergstrom, V. Matter, B. Leuntjens K. Shipley, M. Almanza. ROW 3: D. Wendell E, Harris, B. Thomas, P. Eveland, J. Lemon, J 152 Dahlberg, C. Boquist, D. Allardyce, D. Peter- son, D, Pearson. ROW 4: M. Schatteman, J. Flatley, C. Furgie, V. Brown, S. Lundgren, C. Blomquist, V. Hallquist, C. Piecy, F. Seeds, L. Serres. BACK ROW: P. Schrempt, J. Oleson, B. Shannon, A. Moody, J. lngelson, C. Debo, K. Gatz, N. Schrempf, C. Kruse. Absent from the picture: P. Jackson, S. Morrison, and L. Moun- tain, The dancers practice a new formation that ' Mrs. Pat Shannon, supervisor for the third officers for the group, demonstrate a new l period dance class, and Sara Metz, one of the dance step while the other girlsimitate them. will be used in their next performance. Mona Almanza displays her dancing ability during the Homecoming parade. l53 twirlers highlight game halftimes, stage crew constructs fine sets Under Mrs. Anne Bell's direction the twirlers made a nice contribution to the music department. The girls practiced diligently throughout the year and have performed at the football and basketball games. They were featured at One Night of Mel- ody and marched at Homecoming. Practicing their duet which was performed that grace, accuracy, and precision are with fire batons, Carla Compton, head ma- jorette, and April Compton, assistant, realize needed to be good twirlers. fi? Using one baton is difficult but head twirler Jackie Carlstrom, uses two batons in her solo. Qu .4 l.. , This year's twirlers who provided entertain- are KNEELING: Michelle Hoffman. STANDING: ton, Jackie Carlstrom, April Compton, Connie ment at half-time during the football season Shirley Pearsall, Martha Ruhs, Carla Comp- Ballaffiand Karen MarO0n. 154 Scott Friesth, Jeff Dyer, and Jeff Adamson check the lights to make sure that they are in good working condition for the next show. The Stage Crew members are BALCONY: S. berg, D. Glynn, K. Hoyt, J. Champion, STAND- Luster, D. Neighbour, K. Schaeffer, L. Trapkus Ffi6Sfh, D- STOKES, P. Norlen, S. Teckenbrock, ING: T. Scherer, J. Adamson, T. Dyer, S. Hol- P. Jackson, L. Wambeke, A. Tormeno, S. Bit G. Stoewer, D. Benson, LADDER: T. Hammer- gersson, R. Boyle, D. Dunlop, A. Compton, N. ting, D. Jarrard. 155 choir stimulates interest in classic and modern musician composers Concentrating on molding and shap- ing an excellent concert choir was one of Calvin Hedegaard's main goals this past year. The importance of good intonation and good literature was constantly stressed and was portrayed in the various concerts throughout the year. The first con- cert, held in the fall, presented sacred and classical selections by early and contemporary composers. Next in the Concert Choir's chain of events was the Christmas Vespers followed by the spring concert. One Night of Melody was the variety show which added the talents of the pep band and Contemporaires to those of Concert Choir. Rounding out the year were the Commence- ment services ending a busy season. Mr. Hedgaard gives Deanna Goetz suggestions on how to improve her music interpretation. Members of Concert Choir are FRONT ROW: K. Porter, L. Dilworth, S. Sheesley, D. Goetz, J. Duburg, J. Le-Master, J. Clausen, S. Carothers, L. Carlson. ROW 2: S. Morrison, D. Schwartz, A l56 Buell, S. Allen, P. McKean, L. Colleson, A. Neighbor. BACK ROW: M. Harding, T. Ford, J. Moody, A. Friesth, C. Moore. ROW 3: S. Powers, Hanne, S. Joseph, R. Brown, C. Woodard, R. M. Lindsey, H. Kostka, G. Baker, J. Fletcher, B. Eggers, S. Friesth, B. Ruud, R. Westerdahl, R, Dunn, J. DeJonghe, D. Lester, S. Dudzik, D. Rudsell. l l f I 3 2 . i , The music for District Festival is reviewed by STANDING: Jeff Retz, Deb Woods, Scott Joseph, Jane Powell, Concert Choir pianist, practices ' SEATED: Lisa Carlson and Deanna Goetz. Becky Olson, and Dave Neighbour. a new selection of music forthe next concert. FRONT ROW: D. Woods, B. Olson, W. Henss, C. Eyre, J. Riddle, M. Harris, B. Thomas, D. Wen dell, J. Pfeiff. ROW 2: K. Bertelson, C. DeBo, B. Strother, M. Reynolds, S. Saunders, J. Pow- ell, C. Weissmann, K. Malmstead, K. Ballou. BACK ROW: G. Donohue, E. Goodale, D. Ben ROW 3: J. Campagna, P. Norlen, S. Acord, M. son, R. Fifer, J. Retz, S. Blaser, J. Williams, F Willis, M. Strandlund, T. Kirschbaum, M. Wood,J.Carlson,G. Hensley, L. Verhelst. Carlson, J. Lasley, A. Barnes, V. Mullarkey. 157 a cappella and girls' onorus study good literature and work on tone , The Girls Chorus members for this year are ler. ROW 2: D. Hardi, M. Moran, L. Schourek, C. Hauck, D. Nelson, L. Spurgetis, S. Sandersonf FRONT ROW: B. Barnes, C. Wood, D. Ester- Math, B. Dopler, T. Lindsey. BACK ROW: M. M.Cl1eek, L.Mullikin,F. Maddox, B. Stephens. danl, K. Allen, M. Ostrand, K. Carter, S. Geng- l58 FRONT ROW: Siebenmann L. Wilkinson Anderson, J G. Pond, D. Kistner, S. Shipley, K. M. Grafton, L. Mathias, M. Smith, ROW 2: M. Quinlin, T. Burke, J. Nelson, W. Young, L. Egert, D. Nelson, M. Telleen. ROW 3: R. Ryser, J. Fifer, padernos, S. Gibson, D. Richmiller, J. Page, M. Geddling, K. Allen, S. Beitel, K. Workman, L.Huggins,N.Simmons, L. De-Vrieze. A. Gillen, P. Smith, Y. Cavazos. BACK ROW: G. Trapkus, J. Miller, M. Owens, M. McCall, M. Pap- FRONT ROW: C. Duncan, J. Kieseie, K. Mc- Nipper, L. Trapkus, B. Henderson, D. Lord, P. rill, K. Miller, P. Heaton, B. VBDECKIWOUUG, S. Carthy, D. Anderson, M. Stablein, G. Hoi- Smailwood, C. Bartels. BACK ROW: B. McDow, Rangel. land, P. Whiting. ROW 2: L. Box, C. Dopler, B. G. Hoggard, S. Buchanan, P. Bristol, C. Ter- 159 excellent musicianship portrayed in the orchestra's performances Making an important contribution to the Music Department and to MHS was Moline's orchestra. The members ofthe group rounded out a busy and rewarding year after devoting much time to early morning rehearsals, practice at home, and private lessons. Under the direction of Mr. Merle Wegener, the orchestra performed at many concerts and activities during the year. Among these were Li'I Abner and Graduation. The orchestra also performed in the January, March, and Spring Concerts. Some of the members represented Moline in the District Festival and State Contest, adding to their eventful year. Nhirwggp The orchestra director Mr Wegener The orchestra officers carefully review a piece tice. They are Jackie Mathias, Deb Skromme, hearses the group in an early morning session of literature to be played during today s prac Sue Dee, and Joyce Stille. The orchestra members are FRONT ROW: J. Mathias, D. Skromme, L. Wilson, S. Tornes, M. Rudolf, M. Boom, and A. Bedford. ROW 2: S. Dee, C. Mathias, S. Czerewko, D. Exner, D. Olson, T. Martin, J. Stille, C. Carlson, S. Ham- merberg, R. Ericson, W. Williams, and B. Ol- son. BACK ROW: M. Martens, J. Cox, D. Lenc, R. Biorn, S. Dismer, J. Murdock, S. Sherry, J. Safe, J. Miller, D. Haddock, J. Guy, B. Clark, P. Carlson, B. Olson, M. Barber, R. Lynch, and S. Taylor. 161 band sparks pep in school spirit through marching and lively music This year, the band has helped add school spirit and enthusiasm to MHS. Under the direction of Mr. Louis Dilulio and with Mr. Alan Dalhaus as the assistant director, the band marched in two parades and per- formed at the Winter, Spring, and Pops concerts. The stage and pep Under the direction of Mr. Dilulio and Mr. Dal- haus, the pep band practices for their next band also played at the basketball games, pep assemblies, One Night of Melody , and Li'l Abner . Some of the members participated in the different contests such as District Festival, the Scholarship Recitals, and the State and All-State contests, completing an eventful year. performance. They perform at pep assemblies and basketball games. The band members are FRONT ROW: M. Mar- tens, N. vonLangen, J. Cox, D, Matz, L. Ver- helst, C. Amundson, L, Wilkinson, S. Sherry, J. Murdock, T. Anderson, K. Siebenmann, J. Rash, R. Biorn, S. Dismer. ROW 2: W. Young, L. Simmons, J. Sidlinger, M. Graham, A. Comp- ton, C. Ballard, N. Chinn, J. Olson, K. Dismer, R. Lynch, S. Taylor, C. Compton, J. Carlson, S. Gustafson, B. Olson, B. Foster, S. Wills, M. Douglas, M. Hoffman. ROW 3: P. Spiegel, G. Takingra break, this year's band officers are Jim Guy, vice-presidentg Gary Donohue, sen- VandeWalIe, D. Ingram, J. Godwin, M. Rogers, M. Barber, M. Ohlsen, L. Kendall, G. Doherty, B. Olson, P. Carlson, J. Jauhola, A. Lucas, J. Soethe, R. Hawk, K. Butter, T. Fuller, J. Kizer, R. Ericson, C. Hagberg, B. Maxwell, D. Griffin, lor representative, Greg Ballard, junior repre- representative: Mike Berber, president: and sentativeg Steve Vanspeybroeck, sophomore NancyvonLangen,secretary-treasurer. S. Bauer, D. Martin, R. Tally, J. Dispain. ROW 4: K. Kuehl, M. Bergren, S. Palmer, G. Day, K. Maroon, E. Baker, G. Wierenga, D. Franklin, J. Jordan, R. Knock, R. Serre, D. Gordan, D. Klann, M. Hoffman, M. Shipley, G. Donohue, D. Jarrard, J. Nicholson, J. Guy, B. Clark, M. Sale, J. Champion, P. McKee, T. Handley, R. John son, C. Treanor, B. Craig, S. Pearsall, S. Ham merberg, C. Carlson. BACK ROW: M. Meers man, B. Krueger, G. Ballard, A. Shattuck, K. Mr. Dilulio, band director and head ofthe Mu- sic Department, reviews their schedule. Clark, G. Vinar, C. Champion, A. Kouris, B Burrus, K. Chapman, J. Harder, T. Francescon T. Teachout, R. Rogers, S. Tillberg, J. Wilkinson. '-5533-ekggfv x ..-f V' XXX orga the crunch of cookies, napkins for a float, business meetings, unanimous voting, a group of friends, the sense of belonging, we work together. nizations During their free periods, students take ad- vantage of the atmosphere of the activity room. Thanks to the efforts of the Student Congress, the room has received paneling and a stereo system. Outlining a meeting are officers Scott Thomp- son, treasurer, Barb Thomas, secretary, Gary Donohue, president, and Eric Nelson, vice- president. ff' 3, J .-if. 'SQ . is My X Live . K., ,g,E i'f . wsixy . A f . A A . ' A . M 'Q Q., Serving as senior class representatives are Henss, B. Thomas, J. Tunberg, E. Nelson: The invaluable GXDGHGVICG needed in 3 SOVGVN FRONT ROW: N. Goebel, D. Olson, S. Beck, P. BACK ROW: D. Thompson, J. Vana, G. Donohue, ing body. Bowling, L. Humphrey, M. Kruse: SECOND S. Acord, M. Carlson, D. Hisler. Many of these ROW: G. Hansen, B. Burrus, M. Lewis, W. students, having previously served, possess 166 introduce new ideas for school year remodel activity room with paneling With its supervisor Mr. Jack Brown and president Gary Donohue, the 1970-71 Student Congress introduced some new ideas which were used throughout the school year. During the summer, plans were made to re- model the activity room. After the plans came into action, the room possessed a paneled wall, a new floor, and a new stereo. In October, the Congress held its first all-school festival in which various clubs spon- sored booths and awarded prizes. It turned out to be not only a source of funds for the clubs, but also an event enjoyed by the community, the representatives in the Congress hope it will eventually become an annual event. Besides the festival, the coun- cil instigated the idea of the Great Race in order to increase school spirit and interest in the school. An- other new plan carried out this year was that of a Student Congress of- fice. Since September, the represen- tatives have been given a separate room to use as they wish. Even though it kept busy with all of its new ideas, the Student Congress of MHS carried out its traditional duties. lt sponsored an after game dance, again took charge of Home- coming, and donated S150 to Share Joys. Comprising the underclassmen element of the include FRONT ROW: M. Vasquez, C. Hallene, 1970 71 Student Congress are those represent M. Telleen, J. Riddle, S. Thompson, L. Serresg ing the sophomore and junior classes They SECOND ROW: D. Blow, M. Johnson, S. Lund- gren, M. Karstens, M. Grafton, S. Bitting, D. Kinkeadg BACK ROW: M. Wilson, S. Gibson, J. Nelson, S. Edwards, S. Keller, G. Benejam. 167 pr'ze-winningfloat from members' talentsg augie planetarium in plans Determined to start off the year on the right foot, the 1971 Science Club gathered all of the energies and talents of its members and en- thusiastically worked on its Home- coming float, Maroon the Rams. lt was an immediate success as dem- onstrated by its prize-winning per- formance in the weekend's festivi- ties. Under the leadership of nu- merous science teachers, the club continued its activities by sponsor- ing an after-game dance which, along with the membership dues, provided the club with the funds needed for operation. Much to the pleasure of its over l68 three hundred members Science Club continued many of its projects which now appear to be annual events. One of these perennial activi- ties is the trip to the Augustana Planetarium, once again, many stu- dents enjoyed the opportunity. Later in the. school year, plans for the popular trips to Wrigley Field were carried out. One of the main contributions of the club was its large donation to the Share Joys campaign. lt suc- ceeded in producing the much- appreciated wum with its auctions of paraphernalia which delight both the students and the faculty. W- If . fi at 5 --V-euibvsgl - . . I 'K P'!t'R7FNY1 BPVELTB Uf Rr 4. KVKK LUYNEN! A typical member of Science Club, with face mask in tact confidently proceeds with her experiment. as-N. Science Club officers Ron Bernard, secretary- treasurer: Tim Hoogheem, president: and Sue Sumner, vice-president unanimously agree that charts make the learning easier. -f rdw-1-14 M' V 1 W W. mms i Q -rr . f ' 'Q ,A 9- ' Wi t l 2 gf' is , H Q L--' .K , l in elif i f 4 Concentrating on her every action, junior Kathy Schaeffer is fascinated by the elaborate equipment set up in the chemistry labo- ratory. K' Fx! 3.2! Make room for more! shout excited Science Club members as they anticipate a day at a professional baseball game, it .J ' As demonstrated by Chris Thomas and Rod Gann, Biology ll students dissected cats this year, in spite of reactions from horrified ob- servers. 169 Desiring to produce a prize-winning float and tition, Science Club members work as a team beat all rivals in the Homecoming float compe- on their entry, Maroon the Rams. Chem-Physics student Nancy Brandeberry un- fortunately discovers that a stroboscope is not as easy to use as it looks. 170 3 t i 5 5 5 1 if :Sf ligfeagiii g 3,3 , X epsivfkd ' is Af v t 5 tu i I Mriiw -i,. QRQO1 il Ki' lil While working on a chemistry experiment, Emily Harris attempts to find the weight of the water. club members produce winningfloat experiments, awards part of science After school hours are invaluable to Jim Miller, pendent study. During this time he strives to a second year physics student who is on inde- catch upon his neglected studies if' EE: Two junior science students, Sue Hammer- ceived by the highly ranked Science Depart- berg and Jackie Stange, admire the newest ment.. award along with the others that have been re- i- club's fall festival booth a success sell paper flowers, beads, tacos For the 1970-71 school year, more than 130 members comprised the MHS Spanish Club. Therefore, the club had more than enough as- sistance for its numerous activities, and projects. First on the year's calendar was the Homecoming weekend, however, the club decided to abandon the traditional idea of producing a float. Instead, sponsor Mr. Bill Lee's car was painted and entered in the competition. After the hectic Homecoming weekend, plans began to form concerning the'October festival. Many long days Awaiting Jim Vana's powerful stroke that will finally break the pinata and produce some delicious candy are other hungry mem- bers. 172 and nights of gluing and stringing seeds contributed to the success of the club's booth. The members sold paper flowers, beads, and, much to the delight of hungry onlookers, tacos. b Parties helped to balance out the work load of the club's members. After sacrificing many hours to- wards the booth and car, the Span- ish students enjoyed themselves at the annual pinata party where candy and caroling were part of the fun. Later, in the spring, a taco party was held for the members. At the annual Christmas party, Spanish Club members were amazed at their ability to sing Christmas carols in Spanish. Stuffing two of the animals which the club produced this year are officers, Edmundo Cavazos, treasurer, Sotero Escarza, vice president, Cathy Bolkcom, secretary, and Eliseo Valdes, president. instead of entering a float in the Homecoming parade, Spanish Club decided to try something new by transforming Mr. l.ee's car into a giant bee. Members of the 1970-71 Spanish Honors So- Nl- Kruse: ROW 21 C- Bolkcom. E. Knees, K. M. Romero, J. Hufford: BACK ROW: E. Val- ciety are FRONT ROW: C. Kerofsky, J. Nielson, Johnson, N. Hintz, N. Elhotfer, S. Escarza, des, M. White, G. Emler, R. Hammer, M. Cack- K. starr, P. sereg, T, Thomgren, B. Thomas. R- Sffafidlund. K. Allen, ivi. siater, G. Abbott, ler,A.Cowan. 173 Trying out some of the cookies to be offered at the French Club Christmas Party are Joni Rash, secretary: Nancy Luster, vice-president: and Darcy Graham, treasurer. This year, as before, French Club consisted of A. Gillen, D. Graham, D. Gaghagen, C. Callas, Wambeke: BACK ROW: J. Taylor, J. Rash, D sophomores, juniors, and seniors. Members for C. Halleneg ROW 2: B. Hughes, J. Holmes, R. Verfaillie, P. Johnson, J. lngelson, L. Hallquist the school year include FRONT ROW: N. Luster, Burnett, H. Benker, S. Larson, D. Kinkead, L. T. Dow, S. Gibson. 174 Apparently dreaming about the city of Paris as she puts up one of her posters is Mrs. Bell, the French Club sponsor. With Homecoming festivities earlier this year, late hours in order to finish their float, O'er French Club members had to stay up many the Ram-parts WeWatched. .3-.-i o s -F X.. E-lnjoying himself at the club's annual Christ- as party is president John Taylor. french girl guest at christmas party members' questions answered Parties, pastries, and a picnic were all a part Qf the program of the 1971 French Club. After Homecoming and their float, O'er the Ram-parts We Watched, the next big activity on the agenda was the annual Christmas party. Besides devouring some French cookies and singing Christ- mas carols in French, the members enjoyed a special treat-a speech by a French girl who turned out to be the foreign exchange student at an area high school. During the early winter months, the club sold French pastries to the fac- ulty. ln February, the students cele- brated the Mardi Gras by making paper mache figures and miniature floats. French foods were on the menu for the continental breakfast held before school one morning for the club's members. The year ended with a picnic in one of the local parks. l75 operate successful festival booth sell t-shirts, painted rocks, posters Under the guidance of lVlr. Loren Car- ey, the Moline High School Art Club met every Tuesday evening for two hours. After conducting the business meeting, the members, led by pres- ident Sue Sumner, worked on their various art projectsg some done in order to fulfill the requirements in their art classes, and others created for sheer enjoyment. One special project of the club was originating the posters for the dramatics pro- ductions. During the year the members partici- pated in several field trips taken to various colleges. While at the During an Art Club meeting, Laurie Gates paints some rocks which are to be sold at the cIub's booth in the October festival. I76 schools, including Illinois State and Northern Illinois Universities, they visited the art departments. Also, the club traveled to Chicago in January to visit the Art Institute. Besides the Chicago trip, the club added a film festival to its list of January ac- tivities. Dues and a booth at the Student Con- gress Festival made it possible for the Art Club to enjoy so many field trips. At the festival booth, which was termed extremely successful the members sold tie-dye T-shirts, beads, painted rocks, and poster. Studying Don Perkin's work, Mr. Carey makes some helpful suggestions for improving it. rf .gm Jjj ,,,5f,, ev' 7 L bm While a fellow club member displays a piece ner appears to agree wholeheartedly that the of work done by another student, Karen Hep- paintingis one of perfection and sheer beauty rewarding pickle sale, festival provides funds for german club Under the supervision of Mr. Philip Doherty, German Club began the 1970-71 year with forty members. ln- cluded in its membership were many who had previously lived in Ger- many. Struggling to earn some mon- ey, the club operated two booths in the Student Congress festival. After the successful Pickle Sickle Sale and bake sales, the members were thankful for their long hours of preparation and planning since the sales were rewarding to the mem- Gary Benejam, vice-president, and Brenda Shipe, secretary-treasurer, beam as president Gina Schatteman mounts a German crest. bers as well as being a tasty delight to many hungry students. After earning some extra money, the club donated a portion of it to the Share Joys campaign and to AFS. Al- so, the members sponsored a film festival which was a new experience for the club. Held in the auditorium, the public was invited to view several selected films. Finishing off the school year was a formal dinner held for the members of the club. German Club members include FRONT ROW Bruce Noah, Peter Welander, Al Matykiewicz, welcome in the club even if they are not tak- Dan Dickerson Mark Ruhs Jill LeMaster Lee Thomas, George Hansen. All students are ing German. I77 Literary Board members Deb Skromme, Gayle as Pam Morling reports on the after game Hensley, and Sally Lundgren listen attentively dance. lit banquet, paperbacks, dance activities on lit board's calendar Even though it is one of the high school's smallest clubs, the Literary Board sponsors many beneficial events. At the beginning of the year, the club once again ordered a supply of paperback books which were sold throughout the school months in the bookstore. Along with this sale, the members sponsored an after-game dance which was held in December in the cafeteria. With the help of the money earned from a bake sale plus these other two projects, the Lit Board was able to carry out all of its plans. One of these plans, the Literary Ban- quet, involved much work on the part l78 of the members. Many hours were spent in preparation for the dinner at which the Quill and Scroll awards and the Barbara Garst Art Award were presented. For the 1970-71 school year, the Lit- erary Board was under the sponsor- ship of the advisors of the three publications. These faculty members, Mr. John Adam, Mrs. Mary Young- dahl, and Miss Lucy Shawgo, were in- valuable to the club which consisted of staff members from the publica- tions and of representatives from the junior and senior classes. Examining paperbacks that Lit Board sells are Kathy Hank, vice president, Lisa Carlson, secretary-treasurer, and Jim Miller, president. Kaleidoscript honors go to FRONT ROW: G. Hensley, S. Francis. SECOND ROW: J. Swales, L. Gates, D. Brandt. THIRD ROW: N. Yaudas, M. Plitt. G. Bauer, S. Berggren. hard earned awards received by diligent and enthusiastic statters Stafters on the Line O'Type, M, and Kaleidoscript work throughout the year to produce an,outstanding publication. For their efforts, numer- ous journalists were presented the well-deserved Quill and Scroll award given to those students who have devoted their time, energy, and imagination to a magazine, news- paper, or yearbook. Those eligible for the award were chosen by the editors and advisor of the publication. The awards, sponsored by the Na- tional Scholastic Press Association, were presented to their recipients at the annual Literary Banquet held in the spring. The staffers accepted the membership pins with the same enthusiasm that they put into their productions. M and LO'T staffers receiving Quill and Scroll Schatteman, K. Olberts, C. Hagberg, P. Morling, are FRONT ROW: M. Hudson, P. Willett, L. Mess- M. Kruse: THIRD ROW: G. Donohue, J. Powell, mer, L- JSVTWGSOVL D4 Olson, K- Hank: SECOND S. Sumner, W. Henss, C. Moore, L. Carlson, D. ROW: D. Person, N. Williams, A. Pettit, M. Koresko, J. Barrowclough: BACK ROW: D. Nel- son, J. Miller, C. Compton, C. DePoorter, R. Gordon, L. Hallquist, J. Hufford, D. Skromme, E. Goodale. Steve Sward was not present. 179 Feature editors Carla Compton and Marla Steele assist Lisa Carlson, front page editor, with the bulletin board in the staff room. S 5 jdarw' iv-if: A M- e- S If V' 1 ' t't' 1 ff Q ii? I X M 7, . ga QOl 3'fkit,Vi6 Liz - 1. 2 fi ,Ph mer,ChrisDePoorter,andMarthaHudson. at university of illinois, champaign Boasting numerous awards, includ- ing the George H. Gallup Award, NSPA All American, and CSPA Med- alist, the 1970-71 LINE 0'TYPE is sponsored by Mrs. Mary Youngdahl. With the helpful suggestions and ex- tensive knowledge of their super- visor, this year's staff hopes to equal the performance of previous edi- tions. Apparently they started out on the right foot since, as in the preced- ing years, the staffers sent six repre- sentatives to a journalism clinic at the University of Illinois. Besides Mrs. Youngdahl, editorial editor Deb Skromme, and managing editor Jim Miller: a student from each of the pages attended the conference. l8O ln September, the 1970 staff sold the HMAROONS 70 booster buttons to the student body, thereby arousing school spirit for the upcoming year. Then, when the holiday season ar- rived, staffers began their drive for the Share Joys campaign. Each one hoped to reach the set goal so that some underprivileged families and children could have a Merry Christ- mas in 1970. During the basketball season, the newspaper sponsored an after game dance. Then, in the spring, the staffers attended the Lit- erary Banquet and also discovered who was presented the Quill and Scroll awards. Carrying out their various jobs at a meeting is the business staff, Laurie Jamieson, Lori Mess- Lending her assistance to Jim Miller, manag- ing editor, who is having difficulty with his article, is Deb Skromme, editorial editor. tsl .mast ,Ok V- I , , . ,' ' Glancing over a paper from an area high school are Kathy Decker and Pam Willett who are responsiblefor exchange and circulation. Anxiously awaiting the reactions of sport edi- tors Gary Donohue, Ed Goodale, and Mike Rid- dle to their newly-developed pictures are photographers Dick Nelson and Larry Parker, STANDING. X3-1 rl W...--f ,, i 1 Y , , i, l if ' iivi i gg, Examining some articles in the latest issue are Wendy Henss, front page: and Sue Vonder- haar, Ann Pettit, and Nancy Williams, third page. As Christmas draws near, Mrs. Youngdahl dis- tributes Share Joys containers to Marta Schat- teman, feature editor, and Sue Jauhola, front page. l8I , workshops aid m staffers in meeting the ever present deadline The 1971 M staff found that a good yearbook required a good bit of work. While most MHS students relaxed during the summer, the advertising editor and business staff canvassed Quad Cities businesses selling the ads that help pay for the yearbook. Other members of the staff assisted in the scheduling of senior pictures which were taken during the summer by Nordquist Studios. Co-editors Pam Morling and Kathy Hank spent two weeks at the University of Minnesota and studied the secrets of producing a fine yearbook. In the fall staff members received ad- ditional training during a Friday yearbook clinic held at Augustana College. They learned the principles of good yearbook design and layout that they were to find quite helpful in the challenging months to come. Much too soon the schedule of omni present deadlines was upon them. The section editors often forced the weary photographers to work as hard as they did themselves in a deter- mined effort to meet an impossible deadline. As M staffers encoun- tered new problems they received support and guidance from the advice of M. John Adam and the profession- al opinions of American Yearbook Representative Mr. M. Gardener. Diligently the staff applied them- selves to the task of completing the book. --Q., My Q 4---W... .... . Y 1?-ig 1 wkm 'T ' - 1 K f i S Deciding which cheerleading picture is the Morlingg and subscription manager, Jean most suitable to complete the page are girls' Hufford. sports editor, Doreen Koresko: co-editor, Pam 182 Making one of the numerous, but necessary phone calls required in producing a success ful yearbook is co-editor Kathy Hank. 311 ,d.,,....--- f X'A- S if, x -I Chris Moore, fine artsy Sue Sumner, seniors: and Carrie Hagberg, underclassmen take time out from their jobs to decorate the Staff Room tree. Q ,fi of-49 5Az,1z,.o .0-mn Getting together at John Barrowclough's house, M photographers Steve Sward, Jim Curtis, and Doug Person examine the qualities of the picture that the sports editor points out. - , Ruth Gordon, index and art, gazes in amaze- 4 A ment at the money as Deb Olson, business 4 ti' f iikt f 35, ' manager: Kathy Olberts, advertising: and W , Laurie Hallquist advertising manager emerge it ' i i ' from the safe. W On their way to take some last minute pictures heimer, copy editor: and Michele Kruse, stu are Jame Powell, faculty editor, Linda Oppen- dentlife and organization editor. 183 i.. n Kaleidoscript members are FRONT ROW: D. Kirchoefer, D. Burns: BACK ROW: D. Dun- Gleize, D. Stokes, R. Hammer, S. Sumner, B. can, J, Radosevich, S. Dee, S. Lundgren, L. Kaleidoscript Staff of 1970-71 also includes FRONT ROW: N. Yaudas, G. Stoewer, D. Hoytg BACK ROW: S. Berggren, P. Powell, K. Swed- berg, J. Swales. WlliklhSl'Kl 1 staff busy with editing, selling deadline results in The All-American MHS magazine, the Kaleidoscript, began another year under the guidance of Miss Lucy Shawgo and its two co-editors, Gayle Hensley and Jeff Murdock. Along with the sales and subscription staff, others diligently sought to sell their publication to the student body. However, all the work did not rest in the hands of these individuals. Other staffers either continually wrote various literary pieces or spent many long hours editing ar- 184 last-minute jobs ticles submitted by fellow students with the hope of being accepted for the 1971 Kaleidoscript, The art Staff was responsible for the ap- propriate drawings and sketches which accompanied the stories. In order to have enough funds for the year, the magazine needed to earn some money. Therefore, the forty- two member staff decided to hold an after-game dance during Febru- ary which succeeded in supplement- ing the club's budget. Glenn. Scn0fDD: Jameison, C. Dunn. rsrl O gfr , M Miss Ludy Shawgo advises her Business- Advertising Managers, Lori Gates and Debbie Brandt, Maureen Plitt, and co-editors, Jeff Murdock and Gayle Hensley. Members of the 1970-71 Forensics Team are FRONT ROW: T. Scherer, N. Collins: ROW 2: B. Dyer, N. von Langen, T. Carleton: BACK ROW: R. Hammer, S. Holgersson. M. Sale. high hopes in minds of speakers for district and state competition With Mr. Duane Roush as their coach, members of the MHS Foren- sics and Debate teams completed another successful year of competi- tion. As their to-pic for the year, de- baters discussed pollution control and whether it was feasible for the federal government to handle it. The varsity team attended six meets during the year while the novice de- baters attended three, one of which was the Moline Novice Invitational. MHS debaters experienced stricter competition at the district meet held March 6 at East Moline, and the weeks following the meet were spent in preparation for the state meet held in April. Various classifications of speaking were open to the Forensic team mem- bers this year. These included dra- matic acting, radio speaking, extem- porary speaking, duet acting, and verse reading. Following a Davenport Central meet, held primarily for ex- perience, the team prepared for meets in Kewanee, and East Moline, and for the state competition. The 1970-71 Debate Team includes FRONT BACK ROW: W. Lange, J. Wilkinson, M. Sale, J. ROW: G. Villarreal, A. Albrecht, M. Graham: Maitland, R.Hamrner.K.Ve21Ch. 185 Office Occupation students are: FRONT ROW: C. Knudson, L. King, C. Hansen. ROW 2: J. Har- ris, S. Hawkins, S. Taylor. ROW 3: C. Davis, K. Chandler, S. Glaus. Also in 0.0. are FRONT ROW: C. Smith, M. Lind uist, K Porter. ROW 2' P. Warren P i q . . , . S e- benmann, M. Carter. ROW 3: P. Heater, T. Na- varro, L. Baker. m Instructor Mr Edward Mitchell reviews some procedures for students in o.o. The Office Occupations class which meets first period every day gives students the chance to learn more about their interests in the field of business. They enjoy the opportunity offered them to become more ex- perienced with office procedures and up-dated secretarial equipment. With the help of their instructor, Mr. Ed- ward Mitchell, students improve add- l86 ing machine skills, increase their typing ability, speed, and accuracy. They also practice new techniques in business approaches. At one o'clock everyone leaves their classes to put their talents to the practical test at jobs located outside the school and in offices in and around MHS. Mrs. Helen Gehring reviews rules and re uire q - ments for the state contest to be held in Feb- ruary with Stacy Brownfield. students gain experience from jobs selling, advertising, and display Members of the Distributive Educa- tion class taught by Mrs. Helen Gehr- ing begin the day with a two period class and supplement their activities with jobs beginning at one o'clock. This year some of the students at- tended a workshop held at Moline in October along with club members from East Moline, Rock Island, and Galesburg. Here they learned more about advertising techniques and submitted projects to be judged by a panel of teachers in February. D.E. students also entered a manual as a class research project in the state competition in Springfield. The Distributive Education class held a co-op banquet in April which they financed with the money from the annual candy sale made earlier in the school year. Distributive Education students are: SEATED: B. Bloemsa, B. Simpson. STANDING: C. Farris, J. Sprouse, J, Rousch, F. Oritz, S. Miljush, M. Stone, C. Sell, C. Smith, S. Streit, D. Dunlop. Absent are: N. Davis, D. Dietsch, V. Dzekuskas, D. Fretty, V. Frutiger, G. Hartson, J. Hill, S. Knock, D. Mclntire, J. Preston, R. Ship, M. Woods, V. Woods, S. Zeiser. Participating in D.E. are FRONT ROW: M. Ma- Bradley, L. Floming, M. Versluis, S. Brownfield, roon, J. Moran, B. Taylor, D. File, C. Adams, S. R. Fifer, F. Egert, M. Johnson, D. Navarro. Stanbaugh, S. Francis, V. Floriz. BACK ROW: M. 187 l -- leadership, attitude, appearance Vocational Industrial Clubs of America, more commonly known as VICA which is now in its fifth year at MHS continues to offer opportunities for students to receive invaluable vocational training while attending school. Developed in 1966 after students attended an Illinois VICA Confer- ence, the club stresses the need for experience before entering into one's chosen occupation. In VICA a stu- dent's chance for experience is demonstrated by the fact that a member of the club is allowed to work part of the day and attend classes in the remaining hours. Among the numerous qualities em- phasized by sponsor Mr. Frank Wil- lits are those of leadership and citizenship needed for community life. Attitude and appearance were also given much consideration. stresses needed qualities for jobs: . fU?illlQllS - C.ll,l ' qt uf s Pointing out an interesting detail on an ex- hibit to VlCA president, Debbie Boone, is adl visor Mr. Frank Willits. 5 I!!! VICA members are FRONT ROW: K. Ball, S. Larson, ROW 2: D. Asplund, J. Fecht, R. Hawk, Gardner, J. Hanne, C. Meredith, R. Lackey, J. Goodman, P. Tingley, S. Belden, S. Byrne, L. G. McCain, S. Matters, B. Huntley: ROW 3: R. Glenn. 188 .nv RMP' The 1970-71 Home Economics Club includes FRONT ROW: J. Carmack, D. Wendt, G. Swieter, Pleased with the results of a Home Ec Club sale are officers Paula Snyder, Treasurer, Sharon Gengler, Vice President, Ann Friesth, President, and Debbie Powell, Secretary. i . if I 'N--.ine M VVS' S. Genglerg ROW 2: N. Sappington, K. Aldene, C. VerStraete, D. Powell, B. Guy: BACK ROW: -sg-ff if rg i. e' Qc... rr' A 1 - ' S. Rasmussen, P. Snyder, S. Gustafson, D. Kremer, A. Friesth. donate money to share joys, afs end active year with spring picnic Service projects possess a high posi- tion in the activities of the 1970-71 Home Economics Club. Besides do- nating to Share Joys and AFS, the club purchased the annual Home Economics Department Awards. Also, the members graciously sacrificed their leisure time to visit a home for the elderly on May Day. However, it was not all work and no play for the club. Along with the HERO class, members enjoyed a trip to Chicago in December where they visited two museums and the Buyers' Market. Earlier in the school year, Home- coming and the October festival were on the agenda. The girls had only just finished their float when it was time to begin work on their bakery and boutique booth for the festival. With so many activities on the club's calendar, it was necessary to raise money for the treasury. Under the guidance of sponsor, Mrs. Nancy Parnell, this was achieved by selling pins, candy, and station- ery to interested customers. After the busy year, the members decided to relax and finish up their schedule with a spring picnic. l89 females victorious on slave day key club adopts a chinese child Under the sponsorship of Mr. Fritz Boom, Key Club began its year with the production and sale of their school calendars which are invalu- able to MHS students. When the Homecoming weekend arrived, the boys had created a float entitled, Peoria's in a Grave Situation. Once again, the club ushered at the football and basketball games and sponsored Slave Day. Both of these activities were its main source of funds. Slave Day, of course, was a success, the girls, who turned master, basked in luxury as their slaves carried their books and pro- vided them with their lunch. After the school day ended, the Key Clubbers entertained their masters to taking them to the traditional Slave Day party. Meetings, which were held at Butter- worth Center, produced many favor- able results. The club continued to sponsor a foreign child in China, and, as a service project, the boys do- nated trees and bushes for the school's grounds. After examining the calendar sold by Key Club, officers, Bill Zelnio, Eric Nelson, and Tim Hoogheem express their approval of the product. Members are FRONT ROW: P. Brasmer, T. Mc- Minn, B. Zelnio, D. Hisler, E. Nelson, P. Denn hardt, S. Gibson, D. Swanson, ROW 2: J. Tun berg, R. Cain, B. Burrus, M. Carlson, G. Han l90 sen, R. Boom, J. Nelson, R. Strandlund, B. Paydeng ROW 3: Sponsor Mr. Fritz Boom, M. Cackler, S. Oleson, B. Longmire, J. Vana, F. Wood, K. Allen, G. Goebel, T. Hoogheemg BACK ROW: R. Nelson, T. Banson, S. Jamison, J. Carpenter, S. Caldwell, J. Miller, M. Lewis, M. Johnson, J. Bustard, M. Geddling. in an attempt to boost school spirit, president Laurie Hallquist makes a poster before a game. pep club in homecoming, festival sponsors dance and pep assembly After its fall membership drive, Pep Club discovered that it had acquired well over one hundred members which included not only girls, but also a number of eager boys. These talented students then joined forces and created their Homecoming float, Butt the Rams. However, even while the float was being assembled, plans were being made for a booth in the October festival, here, under the supervision of its sponsor, Miss Do- lores Hulse, ran a cake walk. During the football season, the club sponsored an after game dance and a pep assembly. Also, the members placed posters throughout the build- ing before both the football and bas- ketball games. Providing slogans for the library windows was another ac- tivity of Pep Club for 1970-1971. After game dances, dues, and bake sales gave the club the money neces- sary to carry on its various jobs. Participatingin Pep Club during 1970-1971 are 2: J. Holmgrem, S. Lundgren, J. Stange, V. Blow, F. Seeds, J. Conway, M. Youngvorst: numerous junior girls. They include FRONT Hallquist, C. Hallene, B. Greene, P. Schrempf, BACK ROW: M. Danner, M. Buck, J. Ingelson, L. ROW: S. Bishop, L. Serres, L. Felgar, K. Syl- C. Piercy: ROW 3: B. Mitchell, G. Frohreich, C. Aitken, P. Jackson, K. Schaeffer, M. Karstens, vester, N. Luster, B. Leuntjens, K. Ballou: ROW Furgie, L. Wambeke, L. Collison, D. Duncan, D. C. DeBo. l9l , V Q ' I is . 5? fig 1 . iff? - A P , .219 GSL, . W Getting ready for the basketball game that For the Second, Year' Pep Club evening, chairman, Becky Boyd willingly ac- stuck encouraging words upon the windows of the school. Senior Pep Club members are FRONT ROW: B. land: ROW 2: Sponsor Miss Hulse, M. Kruse, K. Koresko, L. Thompson, P. McKean, B. Kirchoe- Jensen, B. Boyd, P. Willett, P. Siebenmann, D. Olberts, C. Olson,.D. Driscoll, B. Libey, S. Mit- fer, P. Norris, M. Carter, S. Berggren, H. Allardyce, N. Goebel, D. Peterson, P. McCIel- chell, K. Coyne, B. Shannon, BACK ROW: D. Rasche, L. Oppenheimer, L. Hallquist. l92 pompom section at ball games boosts school spirit and cheering 535, 3.51 2 - . -1 . - i ' 1 usxtfj . t 1 A -gf, R'-s . 'AL' if . I 1' 4 '1g,Z't..-'lg if , , WA Q. aff Qfgdi wzfkft AW wi. 1,,, ' U x i ,gg -fs. up N'x'f 'TW' Y tv we , ff , :-' 1, - Q. -' rf' as , 9- - 5 -if 'ft ., . 1 'X'-R. .ar cepts the pompoms from her fellow chairmen, Pooling together their talents as carpenters plete their float, Butt the Rams, before the Deb Allardyceand Jeanninelngelson. and painters, the Pep Club members worked deadline. the week before Homecoming in order to com- During the fall membership drive the 1970- ROW: J. Sandberg, B. Griffin, M. Grafton, C. A. Gillen, C. Math, H. Swanson, T. Gunnerson: 1971 Pep Club drew many eager sophomore Callas, M. Eaton, K. Peterson: ROW 2: S. BACK ROW: T. Dow, L. Willett, N. Larson, D. girls. These sophomore members are FRONT Thompson, M. Lord, G. Excarza, M. Westcott, Kinkead,C. VanVooren,J.Holmes, S. Larson. 193 lVlr. John Julius and Lettermen Club President, Tex Stohl discuss plans for selling basketball programs atthefirst game. UEPZZ yr pw' I X2 -,., -f Anxiously awaiting the outcome of an tempted basket are the Moline and East E Q ,is at- lVlo- line players who, actually, are teachers.'The Lettermen sponsor a donkey basketball game each year. A portion of the juniors and seniors who let- FRONT ROW: Jean Lopez, Paul Davis, Dave Corkery, Dick Clinard, Fal Wood, BACK ROW: tered in football, tennis, golf, or swimming are Engstrom: SECOND ROW: Craig Siegfried, John Randy Nelson, Scott Jamison, Scott Acord. 'l941 Those who have won a major letter in one of Willaert, Paul Hingtgen, Bill Gerard, SECOND Ecker, Mike VanDeCasteele3 BACK ROW: Ron the various sports include FRONT ROW: Rick ROW: John Carpentier, Mark Padesky, Doug Bernard,Greg Blackburn,JimVana. h 'E i V ' .4 s ,- , f,-11 -1 . 'vurn f ' G fs X. vxf ff Y, Jah ' major letter winners sell programs sponsor donkey basketball game Comprised of male juniors and sen- iors, Lettermen's Club accepts all boys who win major letters in any of the sports-football, basketball, tennis, swimming, wrestling, track, and golf. ln fact, many of the ap- proximately seventy-five members letter in more than one of these strenuous sports. Walking into Wharton Field House on the night of a home basketball game, one often greets the face of a Letter- man. The reason for this occurrence is that, as its major source of funds, Practicing for the yearly Faculty-Lettermen Basketball Game held in the spring are Letter- men Mike Willis, Randy Nelson, and Glenn Wilkerson. the club produces and sells basket- ball programs. However, it also ob- tains funds through the Donkey Basketball Game which it sponsors. After completing their money-mak- ing venturesp the club members re- lax and enjoy themselves at various events. Traveling to Des Moines in the spring, the boys attend the Drake Relays. Later, they display their ath- letic prowess when they encounter the faculty in the popular Faculty- Lettermen Basketball Game held annually. 195 Members of FNA are FRONT ROW: B. Libey, P. McClelland, S. Milroy, N. vonLangen, K. Mat- ter, P. Healy, G. Latham, K. Swedberg, SEC- OND ROW: W. Henss, L. Humphrey, M. Carter, D. Peterson, S. Mitchell, L. Jamieson, P. Bowl- ing, B. Howard, C. Atkins: THIRD ROW: C. Ol- son, J. LeMaster, M. Walker, J. Vana, C. Pear- son, J. Tunberg CPresidentJ, M. Carlson, D. hayrides and cookout spell fun for volunteers and hospital workers One hundred juniors and seniors comprised the Future Nurses-Allied Health Careers Club this year which was again supervised by Mrs. Geneva Henss. Keeping busy was no problem for the members as many of them volunteered for hospital work along with the traditional nurse's office help. After game dances, dues, and their festival booth provided funds which were used to purchase clini- cal equipment. However, the club was not all work. 196 Among other things, the members attended hayrack rides and a cook- out breakfast. Also, Christmas carol- ing kept the club in good spirits de- spite the cold weather. ln order to satisfy the students' plea for enter- from various tainment, speakers medical professions were asked to Included were address the group. nurses, a physical therapist, and an M.D. who were of interest to those group members going into health fields after graduation. Johnston, E. Eihl, M. Lewis, BACK ROW: D Harsha, M. Ohlsen fTreasurerJ, J. DeJonghe M. Johnson, M. Lewis, S. Wicks, S. Acord CVice- Presidentj, T. Short, D. Lester, D. Neighbour. ,ann Class helpers, Mike Newell and Barb Thomas, get into the Christmas spirit as they decorate the nurse's office for the holiday season. The school nurse, Mrs. Geneva Henss, is also the sponsor of one of the school's largest Clubs, Future Nurses-Allied Health. fl WEP The class helpers who work in Mrs. Henss' OND ROW: E. Eihl, B. Thomas, E. Morgan, G. office are FRONT ROW: C, Versluis, P. Lawr- Whitebook, W. Henss: BACK ROW: J. Tunberg, ence, P. Bowling, D. Peterson, K. Matter: SEC- M. Newell, S. Acord, M.Ohlsen, D. Lester. FNA members for 1970-71 are FRONT ROW: K. Frohreich, V. Hallquist, D. Blow, D. Flynn, G. Shipley, L. Serres, H. Gates, L. Floming, B. Whitebook CSecretaryb, D. Spore, E. Morgan, B. Greene, C. Hallene, S. Lundgren, J. Simpson, Thomas, K. Biggs, A. Soethe: THIRD ROW: S. Salzmann, C. Flake, T. Scherer, D. Banfield: N. Kron, S. Saunders, K. Gatz, L. Mountain, F. SECOND ROW: B. Shipe, M. Cherrington, G. Wood, D. Thompson, G. Hansen, R. Sommers, H. Clark, R. Lundahl, C. Roman, N. Schrempf, D. Peterson: BACK ROW: J. Soethe, N. Elhoffer, C. Eyre, S. Edwards, B. Freeman, B. Ruud, B. Leaf, B. Johnson, M. Smith, T, Sears, M. Beau- champ, D. Engstrom, B. Haywood, D. Hisler. 197 , sell go moline balloons at game deliver food basket to the needy With more than eighty members, Fu- ture Teachers of America once again organized for a year of learning, teaching, and fun. Under the super- vision of lVlr. Dennis Davis, the stu- dents participated in various activ- ities. During Homecoming week, FTA'ers could be seen either working on the cIub's float, Wipe 'Em, or filling balloons with helium. The organization sold the balloons prior to, and at the Homecoming game. In November, a Thanksgiving basket was given to a welfare family in an effort to make their day a little happier. Christmas brought with it a party held by FTA for retarded children. After the holidays, those members who were available continued their practice teaching at the nearby grade schools. However, anyone wants to get away from school at times, even practice teachers. Therefore, a scav- enger hunt and hayrack ride, among other things, were scheduled. Dues and the proceeds from selling the balloons supplied the organization with funds for the year. Searching for a piece of string, Vice-President, Lenore Janoski and Secretary, Jill Ogden en- joy the scavenger hunt sponsored by FTA. FTA has been expanding as new students have Stille, N. Luster, T. Scherer, S. Twing, J. Pfeiff, P McKean S Anderson BACK ROW D Griffin become interested in teaching. Members ofthe B. Boyd: SECOND ROW: J. Ogden, P. Willett, L. C DePoorter J Robbins C Nawrodki P War club include FRONT ROW: S. Swanson, J. Wambeke, S. Enderton, D. Shlaes, J. Powell, ren H Rasche S Vonderhaar T98 This year FTA has been adding some male members into its predominately female ranks. These new members and others for 1970-71 are FRONT ROW: L. Bolkcom, W. Williams, H. Swanson, P. Orey, B. Hasty, B. Jensen, A. Pet- champ, J. Cirivello, P. Heater, S. Mitchell, R. tit: SECOND ROW: N. Simmons, C. Skoglund, Dow. D. Kiehr, T. Smith, P. VanVooren,' S. Aitken: BACK ROW: G. Bauer, P. Aitken, M. Beau- E-L 114x114 f' V SHCJESTFUNG lriRiLlt5S3 F3DTATUESi A 1 KWMQN Helping out a needy family, Jana Bender, Pres- them a Thanksgiving basket containing a wide ident, and Ann Pettit, Treasurer, prepare for variety of fresh foods and canned goods. Getting ready for the Homecoming festivities, Mr. Davis blows up one of the balloons which was sold by his club at the game. 199 Members of Y-Teens Interclub are FRONT ROW: B. Thomas. ROW 2: N. Schrempf, E. Eihl, M. ROW: M. Karstens, M. Westcott, M. Lewis, G. P. Bowling, C. Hallene, V. Hallquist, E. Morgan, Lord, J. Riddle, K. Hartzell, C. Roman. BACK Whii9bOOk. Y-Teens Board members are FRONT ROW: B. Salzmann, K. Shipley, B. Libey, L. Spurgetis, C. Roman, D. Spore. BACK ROW: D. Kinkead, V. Leuntjens, M. Grafton, M. Lord, V. Matter, M. VanVooren. ROW 3: J. Sandberg, P. Johnson, M. Hallquist, P. Patch, C. DeBo, D. Peterson, S. Eaton, J. Woodward. ROW 2: B. Greene, S. Karstens, M. Carter, G. Escarza, C. Piercy, C. Thompson. 200 ,Q XV K -., ,W ir I ' iff. fi! pf-...... 3 if iif s , Min. l -Ptigg 5 4, ,. gag :..x.1,, -S.: M I K 'Wi A 5 I .YQSLQ K ' S 2 ig. R. MM 15 ,ew , flwfyi - Ai ,WNW as -. Wrapping some presents for needy children is senior Y-Teens member Sancy Beck. Sophomore Y-Teens Amy Gillen, Jan Sandberg, and Sue Beitel go caroling which is a part of their cIub's Christmas activities. give parties for the retarded, needy dances part of club's schedule This year the month of Agusut ex- perienced the beginnings of the 1970-1971 Y-Teens when a workshop was held for the officers, committee chairmen, and inter-club members of the Moline and East Moline clubs. At the workshop, the girls were in- structed on their various duties. Mrs. Judith Carls supervised the group and with her help, the mem- bers started out the year with trick- or treating for UNICEF. Also, during Halloween, a party was held for re- tarded children. Christmas brought with it such things as a welfare party for needy children and caroling. Dances were an important part of Y- Teens this school year. Besides hold- ing the Saturday evening dances at the YWCA, the club sponsored its formal in November. Entitled A Time for Us, the dance proved to be a success with the help of Next to None which provided the music. Then, in the spring, the Y-Teens held its semi-formal. Funds for the club were provided by these dances and by bake sales. 201 . g.a.a. provides an outlet for the energies of athletic girls The traditional welcome tea for all G.A.A. prospects and members was held at president Nancy Goebel's house. The handbooks were given out, all the activities for the year were outlined, and the girls paid theirduesfortheyear. One new activity that was added to the cIub's activities was the modern dance session held every Monday night. The active girls enjoyed study- ing numerous kinds of dancing. Another change was made concern- ing the point system. Formerly, for the highest state award, an indi- vidual needed 300 pointsg this year only 225 points were necessary. The other three award requirements were also reduced. The Postal Swim Team members again came through for Mrs. Carl- So homore Doreen Atkins holds a ver diffi- D Y cult pose on the balance beam. 202 son to win second place in the state meet. The Moliners were edged out of first place by two points, the win- ner being Evergreen Park High School. The other facet of G.A.A. swimming is the Nereid synchro- nized swim group whose annual show came off beautifully. Included among the list of numer- ous activities were the Christmas Party, Dad-Daughter Date Night, the Mother-Daughter Banquet, the jun- ior high playday, and the farewell picnic for departing seniors. The girls also sold mums for the Home- coming Dance in October. The Homecoming float for the club was exceptionally good this year. The red, yellow, and black float entitled Rams R Lambs, won second place. After school basketball is one of the events girls may participate in. Pausing in the midst of planning a meeting are the officers: Nancy Brandeberry, secretary: Doreen Koresko, recording secretary: Nancy Goebel, president: Colleen Wood, vice-presi- dent: and Cheryl Nelson, treasurer. The board members, who are in charge of making all major decisions concerning G.A.A. are FRONT ROW: Debbie Kiehr, Pat Aitken, Kathy Raney, Sue Aitken, and Cindy Cooper: BACK ROW: Michele Kruse, Linda Serres, Karen Delathower, Marcia Klansek, Jane Reese,andJackieStange. Doreen Koresko Linda Oppenheimer Colleen Wood 1971 merit award winners 203 1 Sue Teckenbrock demonstrates the concentra tion needed to make a strike at G.A,A. Bowling. Em 9- rv . . Pl , P X, This year's float, which won second place, de- picted a ram dressed as a baby and was en- titled Rams R Lambs. 204 Seniors Colleen Wood and Debbie Kiehr learn ballet positions in the weekly dance sessions. G.A.A. Archery, the only outdoor activity, is archers shows. This year's archers placed well-attended every year, as this line-up of eighthin statecompetition. Sophomores, juniors, and seniors all come to- gether to G.A.A. activities to loosen up after thetensions and worries ofthe day. Student managers were senior, heimer andjunior, Jane Flatley. 1970-1971 members of Nereids ROW: S. Powers, P. Bowling, S. lander, C. Dangel, M. Eaton, SECOND ROW: L. Humphrey, G. Hank, N. Brandeberry, E. Eihl, Fisher, THIRD ROW: C. Kruse, C. Kruse, S. Morrison, J. Flatley, Weissman, BACK ROW: D. Atkins, Linda Oppen- were: FRONT Beck, J. We- J. Sandberg: Whitebook, K. M. Raney, D. Jamieson, M. F. Seeds, C. A. Robinson, C. Roman, D. Peterson, L. Oppenheimer, R. Erickson, N. Sears, R. Schaefer. 206 l i Cherie Jamieson, Jill Welander, Pam Bowling, Erickson were ants in this year's show, Doreen Atkins, Cindy Roman. and Rhonda Bugoiogy. ' Sparkling up the show by their brilliant per- ' formance are Michele Kruse, Sancy Beck, and ' Louise Leffler. You can be sure that these girls were busy as bees preparing for the show. FRONT ROW: Maja Eaton, and Lynn Humphrey: SECOND ROW: Faith Seeds, Cindy Weissman, and Kathy Hank, BACK ROW: April Robinson, Diane Fisher, and Sue Powers. l steady practice and careful planning make nereid show a big success Following a tradition set in former years, a clinic was held in the fall to teach interested girls some basic stunts. To try out, each girl was re- quired to do a kip, dolphin, somersub, and ballet leg. Thirty girls were selected. The Nereids under the supervision of Miss Jean Lundholm, presented their annual show March 25, 26, and 27. The theme of this year's show, which is the high point of the year for the Nereids, was Bugology. This year for the first time, the Ne- reids sponsored a stunt meet. Eighty- three girls from six schools partici- pated. Moline also took part in the stunt meet at Davenport West. Some members of Nereids also took part in other competitions such as the Inter- national Aquatic Art Festival in Cedar Rapids, the Junior Olympics in Des Moines and in Ames, and the Junior Nationals in Pennsylvania. 207 I 1 w X E. A',,W ,X ,,,, Aw W. the thud of helmets, the cheers ofthe crowd. A controlled putt, the eager splash, straining muscles, a piercing whistle, the wisdom of the coach, the will to win. athletics Junior quarterback Randy Peterson takes time out to confer with Coach Rollinger to find out the best strategy to use against East Moline. Moline's number one ranked defense proves sumption back in a muddy battle for first that they deserve the post by stopping an As- place. With the ball tightly secure under his arm, the Central line. With the field open, Ander- 28-14, Greg Anderson ends the season with fullback Greg Anderson finds an opening in son goes for the touchdown. As Moline wins an average of4.2 yards percarry. 2l0 li2HE5Z2!LEitE'a2ar3sn2S.??QlJ2'23E2lS,2ST'te vvi n over central gives mol l ne ,,,, tm, me .az fr, in z:1f1fw,53 share of quad-city metro crown 'Q Z -l 2 - 5-'.:i'f.:fm fi .ty iiiii Q . so tfssfnsflfsiw sem., wi,'ifziiffsivfsiifsifrlgssmy ., f sisy y , isys , ? it t , fi ,3,,. . ..,.ik.ili:v,A: ,.,.l fe ,,.f , , Mollineigfiiiiiiiilri . . . M i . , 'if 14, W s a stissfszwzfezfiszlsl 1, fgfzfgg-Qeg 2 lfggg , N r',g'jj.i'x ff-:fi--wivxszQa'ez:ssz,.lw'f If 'lee'4'zs2sw:-wff::fm: -K R efghsv- f . f, , s With receivers downfield, Moline quarterback line linemen hold ott the oncoming Central Randy Peterson lets loose the long bomb. In defense. ' order to give Randy all the time he needs, Mo- ami' 3,2 shim, Randy Peterson pitches out to Bill Stevens the Davenport West defense. The pitchout to put Moline in scoring range Moline won the moments before he is tackled by players of Bill Stevens was a typical play which often game35-12. mvp goes to senior greg anderson: peterson, trevor-'71 maroon captains The 1970 Football season officially came to a close at the Annual Foot- ball Banquet held at Moline High School. Both the Varsity and Sopho- more Squads hold the Metro Cham- pionships. Coach Rollinger praised his team calling the Gridders, champs. As offensive fullback and defensive linebacker, Greg Anderson was voted this year's most valuable player by his teammates. Anderson was the Metro Conferences number seven rusher with an average of 4.2 yards per carry. Selected as co-captains for the 1971 season were quarterback, Randy Pet- erson and Tim Trevor. Both of these players are juniors and both have promisingfutures. Coach Rollinger said that the team started the season with two things in mind: To have fun and to win the Metro Crown. The Varsity Squad ac- complished both objectives. The on- ly loss came at the hands of Rock Island in a rain swept game giving Rock Island a share of the title. In the other eight games, Moline came from behind five times to victory. Moline sweeps right as Bill Stevens gets ready to pass to receivers downfield. The 1970 Varsity Football Team members are: FRONT ROW: Mike Miller, Steve Lavin, Ben Lopez, Scott Acord, Bill Stevens, Tex Stohl, Mike Hancks, John Rives, Dave Harsha, Greg Anderson, Dave Funk. SECOND ROW: Jim Tem- ple, Dick Clinard, Bob Rock, Joe Soethe, Steve 2l2 Camferdam, Steve Schilb, Steve Keller, Jeff Young, Jim Vana, Ted Short. THIRD ROW: T. Bjournson, Don Carlson, Bob Stevens, Paul Hintgen, Chris Thomas, Spencer Craig, Wynn Fitzpatrick, Mark Bohman, Dale Keeler. FOURTH ROW: Bill Gerard, AI Surdez, Steve Franks, Dennis Pikuza, Mike Smith, Curt Mc- Lain, Randy Peterson, Robert Jump, Matt Cum- berworth, AI Pilichowski. BACK ROW: Tim Trevor, Russell Parks, Bruce Watts, Don Franks, Joe DeLaRosa, Steve Evans, Rick Law- rence, John Henderson, AI Eastman. Nl0lil'le'S defense SIIOWGU Nieman OVIIY three Scott Acord 1735, Ben Lopez 1665, and Steve throw him for a loss. Moline won the contest fiFSf downs, and held them to 3 net Yardage Keller C605 pursue an Alleman back and 12-O. gain of minus twenty-four yards rushing. Here ini, i we ..r ,,,,.'if-ffw'?:.wf-, tr - The Moline coaches, Herman Miskowicz, Bob ship at the Annual Football Awards Banquet. Brooks, Head Coach Harley Rollinger, Ken Coach Rollinger was named as the top Metro Bunte, and Don Morton, celebrate the victori- Coach. g g ous 1970 Season and 3 Share of the Champion, Senior end, Dave Harsha, leaps for the ball in a game against Lasalle-Peru. Passing played a key role in that game. 213 n MolineSophs'openingkickofftoCentralended season as undefeated champions After getting off to a slow start, the sophomore squad ended with a big bang. The Little Maroons had to set- tle for two ties in their first two games. After that they only wanted victory, and they got it. Winning all of their last seven games, the sopho- mores ended up with sole posses- sion of first place. Dick Matter, in his fourth year as head coach for the Little Maroons, with the help of assistant coaches, Bill Clark and Ralph Peterson, taught the sophomores the funda- mentals of good football. This year's great record relates fine fu- tureforthesesophomores. A ESL-V :if-i'5i.Ni--sitairr -eff, 1- f:,. ,- ' '- . - - , , , . i, W '- 141. iw-,-3, -.4g.:,5s,g,t,.,2,,,ge -- . -me f. sffwss-':-1-'. svwtgf -. . is f v f- '- ,--. 1- --1' is1.41,K,.,,-,wqgt--.f.s4.,,,,Q-f,f:fM,- 5 V ,I , , , :: - + Y f A ffl X Ri, page t My ,M , ,Kgs atm as,zftt.,, tt it e as-.t-qi at me fs, t ws . Q32 mf, A f W E - f f, I :1 73' :iff -ylffii ,- ,Q Q L .535'ifvfutg'--1-ifyfii ' I --42 ' J - - i'1NF1QQfs+f' 7' 'A if ., ,f L 'i :ii ff - 3916- t , , - A .- ,-Rub. ' -... 1 -Ulf, . -' mf fgiwaij-, ,t-sijmfr'N,1:,s Q, , , , ,nw , -X-Q:-wg Q yy' Hur-::7 YIQ if 1-A ' 'lf Ziff ruff 'Fang If, r I 3'-fe -,.:,,-Q fr 4, . z '- ,L . , . A , - ,.,1- gtg extggaf-pf? --ratify q - it ,,,..f,-at ef.iw.m - t 5 V. - - -sw , ti-:f ussy -' -t vw - . W' is ,-gtf gif. 1 fm sig, , :st : ,- at .. '5e'- ' - t.f.JgN1 . I fi:- i ,give-FYP5' ERFZM 6 I ' g -mi .. :i5'-Q n a. . K fifwxr 53--fi 'Qi U ',-- - gfgi-SEQ?-?'Q5,5V2! sk IAQ-'im s Q if, '- hwy! ,., . wa MM M1 . - , Q 1--f. - -,Lets i f-.?: 'fl v , . A -x lr gr W as ',g.fSf'4s:-Kinseyrf-Exif? - ' fM:f?2:-- Q: ,Q .1 :Q t ', , Q,-e.,i , 2 tr Q M '- we 2 L 1' -3, 51. J . -2, - . ,mea , Q' 1 V f - , I wi ' 1'-it ' N :Tiff xr my -mag,-, . 4 -grifyg-fws..f-an.-.,-,,af,4- -- Qzffggtff X, - ' . .f t ' ,L 1 ' is g. '42,-f, - w . :12:,g.2fig:if:.Qs---L .I -,ii 5 ' . 3. ' -v L 4,-, ,. .. ,Hay-3, ' -- v HLA -VT. Y We Tig' .kfkil -T vim' 'Tia 'f-ATM-Y - 'A - W -Q to gy.: W., .-,. ,ie .A-C X-is. , -. 45- -. sf.. 1. f ,v,-,,q5.s,,,:..1.L I , 1,51 -3 W T- , ,, . f ' ,ff , .-. 4 . , - ., ,if with the Maroons getting possession of the ball. .., L S7 A E :F W wwe'-fait' A y i TQ 'Y . . ofs J T f 1970 Sophomore Football Squad: FRONT ROW: David Hines, Terry Kondora, Jeff Nelson, Brad Dye, Jeff Pappenhausen, Doug Kelly, Mike Ry- nott, Neil Miller. SECOND ROW: Mark Poulos, Don Bealer, Jim Roche, Dean Spillum, Dave Miller, B. Nelson, John McColl, Ron Quick, Dave Ollar, Jeff Miller, Dan Bisinger. THIRD 2l4 ROW: Tim Libey, John Ewert, Mike Pappademos, Richard Routt, Greg Abbott, John Tillburg, Dan Richardson, Don Phelps, Mart Mahieu, Sandos Kennedy. FOURTH ROW: Coach Richard Mat- ter, Coach Bill Clark, Mike King, Mark Wilson, Fred Meersman, Mike Evans, Rick Gain, Rich- ard Johnson, Mike Hayes, Jim Ruge, Mark Mar- riott, Ed Sagon, David Swanson, Mike Geddling, Jim Bustard, S. Buckley, Vic Baber, Coach Ralph Peterson, Romero. BACK ROW: Jim Swanson, Jeff Lawrence, Steve Johnson, Shan- hon Doyle, Frank Cahalan, Mike Griffin, Jon Carlson, Mark DeBaene, Ed Haskins, Dan Mad- dox, Kirk Allen, Al Zuccarello. The 1970 cross-country team FRONT ROW: Doug Ecker, Mark Padesky, Larry Markin, Ran- dy Kelly, Glenn Wilkerson. SECOND ROW: Greg it . P 1 'XL Q In sectional competition, Glenn Wilkerson led the harriers to a second place finish behind Peoria Richwood with a course time of 131315 for first place. .1 wr-F , 4 Q ii -ln Clauson, Roger Rempe, Terry Anderson, Dave Rick Kramer, Scott Caldwell, Bill Fisher, Hud- Shaw, Jim Stiman. BACK ROW: AI Maitlan, son Harris, MarkSlater, Markwinters. ,Ml V ,K 1 v A 1 1970 cross country team runs successfully against its opponents With great endurance and a lot of confidence, this year's cross-country team kept up the tradition of victory. This year Head Coach Gene Shipley had an experienced team of runners. Over the hills and through the val- leys Moline Harriers ran to victory after victory. Starting with a win over Clinton, Moline won all of its meets. Moline also won the Quad-Cities, Big Six, and District meets. While plac- ing second in the sectional meet, Moline's harrier, Glenn Wilkerson, was the top runner. In state competi- tion Moline finished twenty-first. Uifi2Q'4!'i'2if'ff3fi':UtiQfWi':'1P4ffifwfiie,Sfwsfti'flttffwfwffi' v9ii?i?Wf'ffWifGlsiiiffifsziflffz.-fsiifimi-,i .fsztiilsigfezfim'ffffsagwssivlgfisfSgetfsisirwerfilrsiiapsggg:gelff-'fsi1F?i55,wfgttra,lggfmijy.. 5, ,, t K Q, Q ff vsiizeifivff ii vez df!-Q .assist -l semfitfstl f., f 5.17, fs,'lgmifitsfsz.'2f,iiyff2fsglJsa, -feiggfxs,ez:-isfistgevftf Iwi azsif fgwgji .. -gmgiggx sssiirfw.-sftiiill Erli-?az,fSo,fwww,asf-:sweet-ff gifafifeafe sew' w..ii,,1t,iW .ii ,W vias, A Q, -,W Wye them, 3 K K 1 sr.-Ssiiis-' s . -'uw 2, if at we mi f -We 5- S1 , 7 W: iv 2 f Ez :Q W Q 4 2: , lg X - : 'f ', .1-,lf 1pf.:ft-ig!vgaiQfleifQ?e?:. figs,:,'z5ifw::ftfsasfg5fQ,gw.gggis,miftqezfwgvstkmafagisf-segiadttfisftwiggfszzmwtfvgqefifxefszsmffmg:1 , K, 3.-1:15 -,fy-1 ,gggg Q..'ggftggg,,5,ff5,.5,g,L.,args f ' -tfzgrffilf KW t?SfE,t54.i5f4saiV-ifwi-,f2Yewsii.,fez,?i9tH wwf-,w2e:fifaiig73? M72 Jfeifflfwi r:5i,1f,ffi,'1-Ni: :xiii Q53Mig,,ssg,Q,gfn5g',v,g,fyzfigjgtgfi.vz,tg,'5.v?gg21,sgjg we 5'Z?f'i'f'f 4' ai' tfitgftff'rfr?f?ltsf2sfaa5i1es2's 2fQfAf1wf'fe2ftr2f5fSv4i ffm Q ,fri-fivftfw it of 'fmt -W . 3 f Bihar w 2-wsmfws weexixifissagfaesewfaitgg-Ee. get 1- wwf-tftffzsffftw, ...tr new me wefggfgggfsi--.s,sy,1t,ts ,cage-ygygggigstmQfiwrf-fmwsfwfi ,.,..,gf,,-t,,,t.tf,,-.lHg,itwas,,wt.,te,w- S1 wfratmfflwwfaxffeig gvfaifsfwt A f of rltgtfigffwegeg estxsifwimwfgsfisfmiswwtsfffs-A 42 Afwifitfvt:ftgzgftafmf. , wt.sW Q-I I f..fwMs1'-ewes' me .,-t2sg,g,gm,ets.QfgtQ,MQW,fasgggm,fttfj,4m,t.ty,t,fg1pi1?,e ff- gfsgwtiwfiistfsgevme ifgfgffiiff A , , V A , i 35 efiiwefgfsiggsgg A etfygfiiwfsigtsgi,M2353 K 5 Z :15 ifftlgglal Qtfffisftilfvsf, 45-fH!lg5WgfalW35Q'3fQ3fe9Ng3' ifswggftgietagtiwafff g:t.fftsHivi3tif'2?ifz ?Mf,ggf.2ssl',-?sf,ff'miigl--,SW ,i ,W ,SSW 73,1 -tr as 5-,i 1es2?5?S5il effbamfmeiatizutiezgw smgifafffsfg-lit,ggkEftgQg55Sisz,P1w. 4 isffzessmrgifegvfsgg itgekavtfffzf-vftfejwwg1523-:gi rastreggaatfiwf tiff-tasty' Wf?fsgff,g.nig2sfEss.52isfNeiwfifgsfswge s:i.t:1:i.wwtitggiasfeefwszfsgsf-fsgtsf-,feeasQ wefisKsa2fEsflfw5imiffv,g,Nffl,ffi3fsieimpf,,giiz,,,tg,5,3,.tgggfgi,,,,eiWgW,,i.twgeai was s fix..-fwsf it-svrieigkygititiissff fffsfftuweeafefpivssvs? is'A51111557fxskftztz,1fwvffls?fff?:'Esi25222252551 Mwfitsi fti vftigiiwm' V 215 1isis1was1PtS151emEi,31.tiWf'i1favff4r1tHN?11ziilffliaizissaffilifsvlilm?2figv4fz3ww , 'U eiiiS3i13?7g?ffSs'?fl'ff sgjlgiww A 7 Q fr4e?giQ5e,5s3f1ss1, i, fsl,,,Q5iny,,,ws'?12ewg6,f Amt542:ftimfefriififisfsi-afsffiegwgi. -- N ew i t :-1' Qffslw,sffifwie'wiaslffzggzssfwifggggm,gt,f5g:w,,gzf,.qgg,,5,f,,xggf,,15353 A ,,1Wge,g51QM WM K 'Y tim, 2 fe W' wtmsf fgfiifgfgtftffsftw pf FeiflttiifffffxfiiiWwirfifffztsemwst w 1fet . e .' ifwrwbsteswfttisffQta?'zw-refsifiezfiwizf-'issLffsteiffws kfttsfwiiwsfsre mifg,,tW5 ft, esta, ,sf its kg? L W W., .W 5,i,faltiMi,gi,fQ,gW-Wfii,M,,,,ftti, sl V g, ,M sg Wimimgege,lQQiQM3tm,tgf:fS,s,sf5,x,t,msxs,,tsMr,Wia35,,,,, I ,gsywts 92.3, 9 fgfmalggvfzx-vig Qvfeshwriggg-,isgrwg H255 . - Q1 f-N 1iP?,fffsi7,Jw1fdf.l:g3wai,:PfM:wgfiis,wsitlftlswsgifi,vtnigfggggfeigmgqgmvfe2, ,eww a51gfig,.,m,,igQE,.ts,,,iW34,tPwt,,,ii5,g,,g,,4tg,,3.5,5Wim,M,tQ,5,i,,g5,3,, ,N,i5ii,pX,,a?55. Vg fwf-eww ,l?f,,wfi,as, ef 5? -- frmtw- fav tfufi Fav: ttwfvtisfsifslfsfxlmfewmWiltsie? stwwfi ,ie . , Xfg m wg,faEtfssgasmwg,:amifw,gigwsA-,t,Q,w.Xaw,,w,sw,few,f,,,gtpqX,l.,mi,,gRfewt1w Mmufw 2451, , pu. X - . .. fc 53 mg.-. - -. ,aa iw ,mftdaffifgigimglit ,fer--fmi,,:ii-is-.ff,,fwfritz--,geek-miytszgva,wiesM 7 - fsiguartaM,si,a,imti,mrw7fist-wma-w.,.,,g,ff.iwg,..,W,,,.,g.VM ,,vr5,,m,,eR,as,,W,.m,di wqltwfs - . ' 7 74 N.. - f-ng rw. --3'f.:',- .. we snftfgtzgmfwesaww fesigferihfigfeifftffwrg.iwnifffe-e'fsv3ssfJP5,w yiirfgmggl-iiff?5ii1gQ,av?:eQw - Hw9fffQg,Ygww5?5w5,'?a?d ner-far-Effwm,-evlmS,g,fm,ffS5il-111W:stil-whilst f W M71 we-YL MW was 1 . l me - -. , .. . -- .. :: . -. , A f i f f. ,iz-,im,-img,-:ff.i .V it f f A fx :,, 1 X . A- , same:-szfrwtxe-WNY-.-wevi--aifeSPff,vs:q1lgri-1 www' W. ,. ,gw,..-lfrqgtfggra,.wi?..wi,,.i,g,i.,,,,ima, Q M, easy W. , t at K,-wwfstf ta -t8,. ,,, ,fa . U s Qi., ,, w su. --.. .. ,. i.,m75mz ,T A .Nates,.skxmtiyatlmiietf-.mfei,ewiitsgsians , .fa-:N,1,9e,f,,,,,t,.Q.4.s.,2, si, M .Qwgitffwt.,,fi,t,,t,, ,.,,ts.,s:im, ,SM ,L 1 M,.Ws 1ft?1ffWfi'H'f S'W7A ' Yasaiixgz rfiw w if? ft i -- 5 f?5?WfeA s2fi,3t' f?FW'?FffWifi?-iiilWa3H1wff'15f5FYs71iS?1fQifseiefla?v2vffsiFWifView yaiw?Rse'r svafgaslnw 'agtgQ,,,t2sg,?l5Qtffm21omits,gg,ti,sg,,agggqw,,.p5,,t,,M,,g5,g.,,,.M,1,i5i5a5,M,sys,'gi g mewgSttffQzif,T3mQ,g5i.gf5e'?5.fX:'2:mifQ??f5tt,he is fe .eggtesf 1Qf-fWw521m5wef4fdf,uii-isfwif,'fmi,eif., :vttfsgfwf-West Twista 1 AQts.a,,,.,.w5sws..N,f- ms.:wwwstwi iw,itsif,W.,,m,tfztfiasamyas-ifstzssktew 1 ,tw tt Y aiwvmwtsf-W fstwwagmiw 3553 w,5,Tgd,fts5siia'w-iw,1ilzPf1.tst,:5ws:mira if,wt.,,Wz-str,4iF51isa,fsg,,2,g,W2k W.,,gw,Ag,,,4,e, mwgggwlwfggi5..,lKi,g,,,g,y.g,,ii5,5,,tg,g.,fQ,tlVt,,Q,g,, gW,,., ,,,,3,,i,?5,2,i3,,,.,,.,5 311252425 Sw? 7 use .efleeffaffeatffatsitiyliisfwsmaffiifafziii.-:segisfgw,siffewslfffgfitiisgsffgwigfgsgfwpwggg151tfgfge'aff+e.Q.fgsggggsmlwasg,,w:tiitgeQ,,gg,twig.,giQS,gftlzffit,,5ffi,J it W -il fig?-ffSfJw?Tife' '27 cd iwizelfff9Ef-We1file?--t43ist2g?gsS4?!i-Wi,2,f1s22'ff2.'s'f:1i'fffm,1?g2,, S,E,frfwfsgilliwJQ'zfJ25FW.' iftliwff 'twat-,s2f'f-lreztffsf'sw wigmfs.'ifffsffif-Qfsv::1ff2.f,': 2f'i?wif'J1z,'l-tw-EarlZ1-:Mbyteswi W, fm Y. nwf.flei,t.ieN,a.Afe, -e 3ix,??'g,R1Qifg'i, '?fWs.,..mt5f.leE,.Pwwfw-- . , ii ,,,,.. .,,, . , ,, il,f,Q,..,,,,i-sg, is New ,..cQ2c,,f.i.emc,g cw .M-N,H-sf V, ,.., i tl, QW ., ,t,.We,g, We ,5,,1gg,,,g. K ytiigyy, igtafiugxg mg a f,yggM5,R5gg,,a ggbgsgiwygriggggggsfgkvgrtsgfgsiifffmmiis-'fsfa'if M-fgfiif-twv.w1'im,i:ffzQge:a3ffeif'--felggafffstifiafwmgi?sl5,11ffsi:setQle1fSee?aea'?4e651321555425mMgi?lf:s7m:sfy:.w3Qfrifswg,1fe:gfefs7g?:w'fu-415-swegserg iw 'hxggwfi f ' is f ' 'ww N5:Q2fff,ffgg:,SEif?gg,fe 5 N g53gg.3,27i,??Ss, C, s, i?f.f:fEi7291f55'm?Ef 35235'51fcK3!a7i?53n35Yuig?1o2L5fQQ'537'Q1Ea'?t 1512 X4 'fs '- '57l4 'li,lff7:iff1 l'2E5ivQ?' w'f11P'f 'vfPifis'fSfY'5ff1i5wis-'fSf?'2'ffa44f-Ywgtezgis1,siQ1QaiS27wMeslfs1f?ism,1se.eras'wt, l 1, zu ss., ft,siK,.,.3inf,,ta?'a,,gis,fisg2sf4aW s'w:2V:l, -- ' T- fe, of V.,fam...'ygfi5,ffgylfz,wggsyggesQgag,v72srmg.8,m,asggwggtsecegmg?fgqggzteggw 2,Qfsgsifxfcilg,,ewfzi-,gg.,1y1f,y.' 'if 1sgfm'mefgfJQ,f1f Q-sxtsfiif - ' , :gl :wi-fm--5'fsi as,L-c,a,5iM,g,a,,g,,gg,g5,,,.lfg,,flm,,5ft,,,f,.c,,,,.,.5.,,, . A ,g.i,,,,55ge1 . ii--WFT Tiff?iff5V5ElNiTlfiy'?f1-5 ' -4U3f?45!?5 251 '1'f!?'L?w A Mvmifi-Q2'?:375i3''T'?'i't74?'2e,Ei:4f5i5iSf5?'??wirSilfl7JU75: .in?i3W57':'Tia'.'? Q37'1i?L3ii,'ffilrfifaf' -Qin' 15ei' Af3i?515k?ciS5E:171-i35i?.l5s?l--if 9im?'5Y1f'S.L3i'fMi 'WJ 1 W1'Qifiiall f57iriH37?s1a?2i:f'?L?3i4 1 K 2 , Q-le 2 1. Viwifzfi 'ff W?551f'55357?3?'M J' if f41?5f?52:?E,I' M . v'ZT:.:'e15fiHf2fcr'35f?i vff55i?3'ff.Qii ?i3S,55Viff?i5 ':s.Lf::54,5672-Tiiiiklfctiig, sff7Jsfl7e.5?1f'.:f51f5i?j'175g1P:1?3i2Sf.,1,f5My'iV.i'5fj?f gg:urs Stfqlfi ' ' 'V elfzr2A5gJ:j 't1L5?o5 f li?5Qyg5f'f:'4i14 215 netmen finish fourth in metro as rain plagues play in fall season The Maroon netmen, under the di- rection of Mr. Tom Derouin, finished the season with a combined record, singles and doubles matches, of 2-3-O. Plagued by heavy rain throughout most of September, the netmen easily downed Davenport Central and Davenport West. The number one Rock Island team defeated Moline 9-O, while East Moline and Alleman also handed the Moline team de- feats. The Reserves fared better with a win-loss record of 7-1. ln the Quad-City tournament, Mo- line's Jim Gulley captured second place in singles competition. Scott Blaser and Jim Gulley teamed up to take second place in the doubles competition. VGSU HS Moline .... ilifiisi T . .Central ..... Moline .... i iiii TE-GST M0509 Moline .... Aileman ...... T. Moline .... Rock island .........,. .3 .ss'. Moline ---'--- .siis tiff-FS? 1 '- . - f f -. '-'--f 1 QUad'Ci'fY - P 5dBlaSef f00k 2nd in 1971 Tennis Team is FRONT ROW: Steve Gus- Ken Anderson, Mike Willis, Scott Blaser, Jeff Randy Ni-BISON Jeff SCDUGU Mark Dembosky tafson, Gary Gobel, Mark Olberts, Kevin Peter- Griffith, Craig Woodard, Jim Gulley, Mark Jim Mason Paul Pal-IllH'l Mr TOVT1 Derouin son, Brian Forsberg, Brian S. Olson, Joe Walker, Jim Maxson, Mgr. Tim Spalding. BACK CVGVSITYCOBCIWD Hemmingson, Gordie Panicucci. SECOND ROW: ROW: Brian R. Olson, Jim Ogan, Ron Hanavan 216 1970-71 team members are: FRONT ROW: Cam gren, Cathy Bolkcom, and Jane Cahalan. SEC- Olberts, Mrs. Donna Pettavino, Marilyn Smith, Dangel, Bettie Willits, Deb Olson, Teed Thorn- OND ROW: Sue Beitel, Sarah Carlson, Kathy Monique J0hnson,and Kathy Dismer. girls' tennis team ends fall season in a close race for second place ten 1 by si-Q 375 6 ii X ' W' . fi Having accumulated a record of 7 wins and 3 losses, the 1970 girls' nis team earned third place in 5 the Quad-City Conference. Coached Mrs. Donna Pettavino, the team , practiced daily in preparation for 1 tt the tournament. They barely missed ,4. winning the Quad-City Tourna- ment when U.T.H.S. edged them out in the last meet. Having received 1 point for each game they won and 174 point for each game they won during the tournament, the team's final season score was 7 172. Rock lsland's team, which beat Moline both times they met, finished their season with 11 172 points and won the tour- nament, with East Moline coming in second with 8 points, only 172 point ahead of Moline. Z W 2 Z 2 , . , t ,M ,Q U kewl, Qeri'ff,,iiffaiii'--Jgfefitt we V .5 sg.. iwea?iZZiZ'- .,i . J 4 at ' N A -t ..-,,,,wZ,Z.ZZ.. 4 . , 5-452 wagfw4?MZt,ffsZ,,f,..iZt,i iinttwf .mm-Za? Zfemew. mf M16 -ww. is . . Z u gg sa , gig, wseg,--Mmfme Ziiitm-Mi,-iNiZfis ,MZ,gZ,5m-- A-Smeg-ZfmSwqg-Wsff--,Z-avZ,3fiZZZ Q ZZ - ,E ,ee---etaszat--is -eQ,9wfw?viimive.i ,rag gn, 22 , Za 1tg?Wniepa,gwgpZQe-gAat,,ZZ,wZf 7 Y . it W sa-. , ,L is QyrgpwQffWZ,W3ZgZ,g,P.iZg,iZ,,t,,..,,Z..is.Zs,m3t?,sk5R,n1Zgff52'ifg-avg, Mwwnfwg..QfZ,gZt.wZZ.,fv.,Z,.,fQiZ-,.tiZf.5,,sZ,Z.-, , , W5 Jwmfwwaes.SMQQQZ,igiim:J?r-arZiZi?r.ai933'Z if- 75525935 F331 ufmfqiitfgwagglftftiiivsiewiiitQZZZ Zi.. ig . r t - . tugs , Zirtgfvmmai-5,5vileZii5Z'w3fwl3eifvM31swizgfewerffeg-ttfatgfsfyfgZfZrf1swifZiwit:-rtat'f:mZ,g,iw,Q,g - f ,f My sfiviarftffawsoiif' ew-ini imffifsskw-Z'f2 fi, We We was 272-Qfgifiagfwfwis--Qktmf-QQfwsZ?i1tw1-ziafitftl arm ff Q ,gqiwftmf We WetfffxlisawwZffifnr.-Yi-v!'t:ff-iZif2f-swfJffe54as,agQfem?rvwW4 Z Z- . .. , . .. an .Q-PM ---wit--to ist-LZ .-Pfwyw Ze , i it ww Z W QmZ,ZZ,ZZ.Zw.Z.g Zwifz iw ,Z . is Zf-2 , A tr nf. Zw,,mt,7,Z.Z5,m ,Zu.ZZ1SiZeQ.--ww.w-1-' if 1-fr--Z.-Zm-.. . gee Z Z if 'lt - -Z - 'iw Trl-in 5 I it 77 Y .si V t. is M WZ? ' A : Q V4Zf?fQSf I QYYN'-j1YlQL zf' V -39 QL A. . -K'-if MQW? iilf iii!fiifL:'5'iZf,l phil 1f:'iWf7J.J. i . , 1..g.'1,.': ..' ' -Z? i-AI-ZFV7 GR' iiikffj 72i7i9fil!fi'5iii4'fYQ1 ,'-tg,--f71 ' 3-Ri'r'-xi-'I1Q -ffifil-7961','Q 'ifQ .:ii,.,i' ifylffilffl A W -,fi , ' at , 'L Z 1. x V A f Jffgwffef' 1 ,gi ' 1 -2 ' r 4 -- -1 M . - 2 ' 5 W K : Z- ' - W We 9 - , Z , .WW Z - - . V ,--.1-'i.,,fZfZ5:t,--Z A Z- L a as-Qagsw-v-.s.f:'.ZxZ:,..t-.,,---WZ., - f , -' . ' W V A i 4 Z , 7 1 755 Y?-T, Z tw ff J , YW 5, Zl.fi,Zf1.w.h.gi,., futffiasffs-1f'Pi' -4322s 4.9--5T:kLQZgf2'i'!5ZjgW ,gm2r,Z,5J,5.g,5, Qi A ,s,s,2D ,ggZ-'gi-39533-r1,9'--Z?vb- ' ,,f wgfjR,Q'g5j4l!1Y':'yQZtw?g3 Q3'?f?g,ggg4:,fgi-,,:'. V5-Za., ,Z - . ,, Z , us. Z W L X., -M I .,..,.Z' - , H 1 . 'rw L Z i sf: . 'Z i'-.5 - - ' 1 ,it2ivv5MsZq125f2: as A ve Q -mritfsfiwii i -i, Hmfwi.mZ- www' f N-its iswwlwgiggw e A lt W mf giyiftx-Q1-7 .sg1sN.5Zw4wJ5iQfwiKgg5etx51Jwaf5'?Q11-sfriizw ...sa-1 umsfeitfr Z' ZiZ 'M we-f 1 , M. Z- i ,Bit Z,ZsM, Z.4ffmi'iZifit1tgggp,2 .Aggies 3 ,Q-,Wi yt7991,.A-,Z.Zi1ymb.'tfvrfrigibflwrifif wig,--Z Z -twat.. ZiiZ3S,et .gt?M15ing,3w,mZifi,2te,e swf f,2,gf,f,Z:'f dw- i-riatw ,ty MMV Z- 32155. Z i ma Z -32 -1 iia'vilLtv'm.-wwf we ra ow g f w zg we Zi iiZ.iAZP-MZZJ-Z1viZfZiinw... www ,aww - .Z as Mfrltitafmfeimn .gfefwifysefii-Q-,sift 'Eg -seZfinw,w,v,SfSfz5,Z,gg5?e-- sw wswmwffm-ZZ,Z.ie,'if - - H .,2.-ssZiii8tEZi-tiigrwiesif iafffww it 32 f .itsfnvmtts-wi5ffZs-ixiwisw ei 5655? f ftglfatsfweiftistrifitr it w,eZi2,Pr5' .' Riagg'WSL-fV G2's1?t25,ti53?reiw42:3f,?if?ffw5j-52grftiwwMffwsgggyg we ,2, ,5sZW,mZZgfZ8wig5p my Z . -,,q35ttZ3,tiy,guwaZ:gQggf5iiQ- , R-rt, ,iw r,iit..,-- i, ,tfvgigs-gfitQ5g,g,Z,im,qviZm,gy.i,.,ygf,zgggeteZ,en-1,-4,6 fewiswwiawgsemfrftttge.,ZwZZ...ZZ.ZZ.f ,ZW 1- Zz ci., . -A 7 A f n -Z A. f --1 A .- f AZ -Z f Z wi- Z i uiwime,-Qnwit-ZZMMMZ- mmf we gg., , , Z h ,,,t1i,,,3MZ .tg .. M vga, .Z:im..i..ft,ii?ZZ , ,it.5ZZZiZi-rt -.- . . -tg-is-ZvZggfmiw.Z.e -.gf-fswfdfii,-gwitii 3-ZMZZ is 1 P -... .. - 'lt 5-eg Q 1 img ta.ff,w,:Z 3 aeifzig. .. Z Zu.1.5.Zwsfifpemft-,5'w2-iiiiwt'fsZ fswfr f t , i f .-wteftife f.fi3Z.i,tZwfZiQ,-gZiZgw my Zmwsgf r 2- ' - r ggi,-, mf Q .fl wars?-te .' .img . , 1 Mggfwqfmsggmg yugo - -S5 wggggfggggrsiwitgiiffffgffgin -vi Z 5521531 .A .- - -' sift Senigr Kathy Olbertg Concentrates on her fo re- ,ggi Q,-, ft, Z at .wifffytt-Z5tZeSi22ZZ:ZS3wfa?3M'. ' ' r ig- 'L 'Q ai' QW 3- apes, Z Z 32-fem'sfwi,-iW,fw,r35iA-eff, 1 ggi!! f ti-Z-ff-fsi5mreQfiZmMZ:ZMfiii.ZZi,w-f ,Aww--,mZaZi5,,w'-i f ZQZ Z Z eZwwZi.ZwiZwfi'ZZ-Zwfwfkaffv-Z,Sg-5ai.Zuaega-f'wfZiawwZZ..MZefi.Zi.Z.tZ,-wr WZ gt. gai t . ,L . i . - -.,isZ,i-WY,Z5ZQ.- Z, -Y 555555 My-Z,,Zs,,y.g,emqZiw-ef QQvzgwfJ1w2faiaZ Z . i. ..i, QQ. 1 , Q ZQZQ11WiZa.-ZZ.g.Zu..ZZ,w,4i,gZZmiw,PM may1Zzwjg-Ze.4..ZZi'.ZZ-.i,,Z,,5,gf ,if,.ZZ,ZQ MZ,-,Z ' ' ' ' f-f f : . Z3 Z'Z,Zi 3f5f??vi'f' 't23aZ'fY135eZ .Hive 45 aging' ,1ii'siiE?Eir5'fi1-zfsfgav:,Zile1wL Erfei'e.22222 M et?-tvzqf fu .mir?-Qi-Ziliflyiligeigtfiftwa'Zl2:2!4PewWIQtr's5iZ Zsfggftfrils- ,e?'15HF1.?Y'ffi1fZ'f:' hand SW' '18 d U V' 'lg Pfa CUCG for 3 'W U P00 m ' me 1 c' Q ' 1 meet' Y' 217 Vis tough competition and fun prevails during the intermural seasons Played in the Bowl, intermural football en- tertained six teams this year. The hard fought season ended with Lester's boys and Budmen ter's Boys won 3-2 to finish first. tied for first. In an overtime play-off game Les- A ,-QQM? M .-iq'f'v-f Mwd',.,,,v ,if-ff1'1 l3iq' s J iti Team captain, George Hansen, looks on as one of his teammates scores. Hansen led his team to the championship after defeating Bill Steven's team in the senior play-offs. 2l8 'X Here I am up here! Who should l give it to? and senior teams fought to win the intermural This is how it looked as sophomore, junior, championship. i.2O.r23f.,i':.22,.i:Li'..zizsg.,?3:1.2iLfha mol ine hails as quad-city cha m ps as i they dealdouble defeatto rocky The 1971 basketball season often found Mo- With this kind of determination, Moline had a line fighting hard to win. Often players were great year. on the floor in an attempt to get a loose ball. ea Nuq,..,, , , as III Winning the 1971 Metro title, members ofthe Jeff Schuett, Bruce Elvidge, Dave Harsha, Jim Michaelson, Russell Parks, Packie Law- Varsity Basketball team are: Mike Leffler, Don DeLeu, Scott Thompson, George Huntoon, renee. Mark Bohman, Terry Lawrence, Phil McKay, 219 . Out-jumping his opponent, Bruce Elvidge starts Moline on their victory over Rock ls- land. With his best night of the season, junior Scott Thompson dumps in 24 points as the Maroons downed East Moline 89-86. 220 Shooting from between a maze of hands, Terry Lawrence scores against the Panthers. Breaking down the might Rocky defense, the this season by scores of 62-49 and 73-65 Maroons defeated the Rodks in both games to become Metro Champs. With the Alleman team looking on, varsity many shots which Moline made against Alle- guard Packie Lawrence, gets off one of the man. ,ff V ' 7-7f.ggr ffl f 3 N . 4 - V+ R air gi . 'lv' ' -sw? as ff' ,Q Vklk , A I N Nothing could stop the red-hot Mike Leffler, Pioneers. Moline defeated Aileman by a not even the double teaming by the Alleman score of 58-50. 221 . Gene McCarther presents Moline with the 'VI R N S W ' T H N D T H R E E trophy and nets after they won the Regional OVERTIIVIE GAMES TO CAPTURE REGIONAL TITLE. Speed, accuracy, agility, endurance are adjectives describing the 1971 Maroons. Coached by Herb Thomp- son and assistant Bill Baltzell, the Maroons captured the QC Metro title and also the Western Big Six title. They finished an undefeated season in the Metro Conference. Supported by a fine group of re- serves, Moline's five starters entered the Regional Tournament with great confidence. Their first opponent was the Riverdald Rams who had a great year. The Rams put up a tought fight, but bowed 57-55 in an overtime game. The last basket came with Next the Maroons faced Alleman. Having defeated Alleman twice dur- ing the rough season, Moline was wondering about the adage that no QC team has lost three games in one season. Alleman was beaten in another overtime game, 73-71. The final game was against East Moline who had won the tourna- ment last year. Midway through the fourth quarter, East Moline fought hard and tied it up at 65-65, a third overtime game. Moline with a shot by Bruce Elvidge, won the game and the East Moline Regional Tourna- ment. only three seconds remaining in the overtime. Scott Thompson made the basket. Moline ... Moline 64 Moline 70 Moline 55 Moline 77 Moline ,63 7 5 Marlene' - T Moline gig.-64. Moline .T Q fi.. gr, T M Moigine ji . . 7 A Mqtlfle A fi .Ai-.eiiir T 1 . ,... . ...,..,... ....... . , .. .Fj .iiie marines . Moline , T. 7. . T Moline Aili.i, 89 ' A Moline .. . Moline TQ,f?-Q56e g Moline .. gtfgyg .f', 591 Tournament. T varsity basketball results- 66 East Rockford West .,....... t . Quincy- ...... Alleman .,..... Aurora East . East Moline, Rocks island' Ng ceniraijy. Assumption Bloom i g ATA East Rock lslandllgf-lf. Quincy Y Central ..,. A6351-e?,l?l!4fS 73 41 63 50 87 57 ...Q4-9 56 48 45 58 Q if 5 52 A i 49 . .w 86 65 74 Moline . , liiiey 75, Marshall . . . . 66 Moline A, , . . . . . . 34 A Twfhament g C Moline gf A J A mfr' KRD. , l.i.l E . i 5i.i -5,.i, l irsslsle Coaching the Maroons to a 17-5 Season' Herb k,.hk. ,kkk ,.kk ,t.i i . , kvyr i Thompson was named Coach ofthe Year. T - A 4 'lliil A irfi 'r -1i'? if l AA' ii Y ' A ' - ' A 222 The 1971 Sophomore Basketball squad includ- Fred Ryser, Barry Nelson, Mike Romero. SEC- Dempsey, Jeff Westbrooks, Greg Eckert Ted ed FRONT ROWS Jim BOONE, BF-Hd Dye, Kirk OND ROW: Mike Geddling, Coach Bill Bishop, Spurgetis,JimSwanson,Du Rigg. Allen, Gary Goebel, Bob Stevens, Bob Jones, Steve Porter, Mike Griffin, Joe Kimpe, Mike With great determination, Moline sophomores drive hard for two more points. key victories at end of season supply sophs with qc metro crown -Mvli ne ' siiiii Mnlif' B lvloline Moline Moline Moline Moline .... .. Moline Moline Moline Moline Moline Moline 'Moline in ilismoisine i Moline Moline Moline Moline ..., . i. ' ' + f- 5,f,,'Yfi.-,wtgwifs ., Q' 'K i baskefb ff it 1 ' . - ,.,. 'ii - rki., . V K ff.: .kir i ir, :.r,t k I 5 iioi B East' Moline Rockglysle nd Central .,.... ...,. Assumption Bloom .,.. Galesoliivfe . if E - ' if ,, i L ,sl isiii fi: X - V . - . Cen'Cf2fif Q . Assiirnption ..: 3 ? l l place fourth in district competition four continue to sectional meet Coached by Mr. Bill Klier, five members of the Moline Gymnastics team placed in district at the Roxana Dis- trict Meet. Qualifying were: Jack Smith-rings C5thJ, Bill Burrus-side At the Moline Gymnastic Invitational meet, John Taylor performs his routine on the high horse C5thD, Steve Calvert-trampo- line C6thD, John Segura-parallel bars C7thJ. These four members continued on to the sectionals at Chicago. parallel bars. Moline Varsity won the meet by forfeit. ..,.. ..,..,,. . - t wakes With a tight grip, Steve Calvert is about to do a back-hip pullover on the horizontal bar. -.. , i l 1971 Moline Gymnasts are FRONT ROW: Larry Mitchell, Mike Lambrecht, Ed Caras, Kevin Pos- ers, Jack Smith, Dave Miller, AI Monroe, John 224 A N' 2 Taylor, Bill Burrus, Steve Calvert, John Segura. Jeff Slayden, Doug Crandall, Brian Healey, Jeff BACK ROW: Doug Adams, Dave Lipke, Randy Nelson. Pobanz, Steve Rogiers, Rick Lynch, Rick Cain, A Moline gymnast is probably asking, Where is everybody? as he performs on the trampoline. Senior gymnast, Bill Burrus, finishes his routine on the parallel bars in perfect form. A Moline gymnast performs on the side horse skill, Moline easily defeated these opponents in during a meet with Turners. Performing with two separate meets. . . ' , X f 9 .Q W, A W ,, A fr A , , L' K: K 'qi', 3 ., If.,-, I erhfgwi , .., . A A 1 ,.., t.., J kr 7, f rkk- 1. , y '.', r ,fy L,,, , .f ' A deep breath, a look of determination, and Senior John Segura performs a handstand on Steve Calvert prepares for his routine. the high parallel bars during a home meet. 225 taking first in quad-city action swimmers place ninth in state ' U W.'N1llL -..U .,,v,,,,A,4 5 mi will S. 2 ll .MHSNSUN 5 P film xlibs 4 GJLJIMSKJN 100 FLY l l5. WJ NUI. 2 it J0iiNS-03 5 lf l-emalil 4 Q, 'Nl ii 4iRi'M,?s g ii -'l1XSill.l, 9 rilcvsiix io N M1512 Members of the 1971 swimming team are: FRONT ROW: Mike Kettering, Ron Bernard, Rick Willaert, Mike Sweers, Robert Longmire, Jim Aitken, Tom Benson, John Carpentier, Scott Q' TNS ,M S 'hifi , With great endurance, Scott Harris pushes hard to win in the breaststroke competition. 226 i 0. iszisiiizs 2 iv. gotten 5 ,si ,ioitivssimig 4, iii ,ioiimsox 100 LM. I it aiu am Harris. SECOND ROW: Greg Blackburn, Bill ott, John Corkery, Bill Grimes, Tim Ruberg Gibbons, Chris Taylor, Max Norton, Bill Pay- Mike Dailing,JimSwales,ScottJamison. den, Brian Forsberg, Rich Knoch, Mitch Mc- Neil. BACK ROW: Craig Siegfried, Dave Marri- ,,,sss,, ,sst,,, S escer ,, c liiiiii'lii sices ,si f Gcse sscer 1 Q ices ae ,,,, i -e -1-eg-s..t,,,,11.,--,1.. .,-it ,.. ii ,T -, ,- . -V - i- e - . -,wif x ai - , K , . t-2 esti ,,, ' -1-L-sw,-fiij, ,- 'eww-, y.e,.,.s A,..f A. kk,, ,ea ifff issi -iissi cci, ,S iisr ,src 031 iiel ,iii eii . ,,.... W. ,W ,,,, ..,. ,,,, g5,y,f,5:,f,,gAm,5, k.,A w,,M.A:',,. ,V .T-TQQ lg. c Q, Q, . Ninth all , GSGCOUCIO G i,s,s,e T5fciiQjei f ,eiss p iissg c gsg, tce btfffelfffy 4 ' 's-i SWT f4F9l'Sbe S7 Ron Bernard takes off on his leg of the 200 yard freestyle relay as a Moline swimmer touches the wall. - QL V '41 . . A f.,:.1w? ,':5,!'fT? '--i lmwkk swf' V fa A an Q-1 dl As the gun goes off, timers and judges catch the start of the 100 yard butterfly. The quick starts Moline had helped them win this meet. W .wi ,. f -wwmmssm' Tom Benson and Craig Siegfried await the start ers gun to begin the race. 227 is Moline swimmers start off to a good season. 400 yard freestyle race. Endurance as well as Here several Moline swimmers start off on a speed playa major partin winning. 1' 'Q swimmers capture second place in district swim meet at richwood Totaling 200 points at Peoria Rich- wood District Meet, Moline swimmers took second place. Moline's Scott Harris captured first place in the 100- yard backstroke, setting a new record. Bob Longmire took first place in the I diving competition with 456 points for eleven dives. Other swimmers qualifying for the state meet were Rich Willaert, Craig Seigfreid, Mike Kettering and Brian Forsberg. Two relay teams also com- peted. Moline finished ninth in state. in 1 mfr f K , .. - r .fill 'Xie' 'M' 4 i 5 is X- 5? .. .Q . A, 'j ,g1,zff 'KggL.A 57, xfiiswf 4' . wh QA ff ffw3y'r W i . . af 7 'ii. 11 iers iiirs Stroke, stroke is all this Moline swimmer is yard butterfly race at the Quad-City varsity thinking about as he nears the end of the 100 meet. 228 W'-an . 911, M. Performing one of his dives, Bob Longmire helps the Maroons to victory. It was form like this that helped Bob into state finals. l V The referee signals Moline's Mario Barajas as the winner. Mario finished an undefeated year. MV , ,vs barajas, tahlberg sectional winners wrestle state meet at champaign Under the direction of Mr. Herman Miskowicz and his staff, Moline's wrestling squad fared well against tough, highly-experienced opponents. Two Moline wrestlers won three matches in the sectional tournament at East Moline. Entering the state meet at Champaign, Mario Barajas and Marc Fahlberg went on to win in the consolation bracket. Moline'5 1971 varsity wrestling Squad includes Caldwell, Mike Teaser, Bill Baird, Brian Baldwin, M-HFC Fahlberg. Rick Lawrence, Paul McKinley. FRONT ROWg Mario Barajas, Dan Allison, Steve Jim Hanne, Dean Sellers, John Cross, Joe B60 I-Opel, EHS0 Valdell DiCk Cliflafd, Jeff lm- Seibert, Mike Hoyt, Hank Torres, Rick Walden, Soethe, Don Franks, Stani Bjournson, AI Sur- pens, Steve Monson, Dave Bartel, Coach Mis- Rich Olsen, Ron Schafer, SECOND ROWQ Ted dez. BACK ROW: Coach Bunte, Rich Ridnour, kowicz. 229 A s ssisss .,.. s ' ' ssss Moline ..,. .... 3 O i s s 25' We - as 35 i ivioiirae 7 islisis 11 by Mogigjgse .... . . ,537 by 1 ' Mamie M iyss 36 s --Q- i s sysi is n Z2 1 Moline. , . .g . .s s Rock Falls .... -'-' EastffMoline g. . Gaylgibufg siss Riverdale . Roofgliilslandyigsyyy. . .X . gf gg Galesburg . s Quiricy i ii a i tsgs . 4 . ,g, i i + sstaieifffy. 4. s Come on, l'Il take you on, is the reply given by a Moline wrestler when asked by his oppo- 1 it :ri 1' nl' ,L 7 eii .s 4 lyye 635153553 i s fiitffh fFaF? 'gbv'SPi eiilel After taking down his opponent, Rick Lawrence gets a tight hold to assure that he won't get .nie '-,xl ' il i 29 s s so . .sg527 K Q--m?4f:22?iss?4eQ11 , ' -:K .- , 'lfVI5iiiYi??'T?5:FI-if ' k 6 A T 1 - t 5- if '- nent if he wants to tangle. Moline went on to finish the season with an 8-5 record. U To make sure he sees what is going on, the referee gets down where the action is. It looks as though this Moline wrestler is about to pin his opponent. 230 :rw lv' ' s s . 1 s ls,tts K i g My rif ,ffQ1 i uf ,Ai 5 ff , Q sa' 'ew' V t, f . Q? Z ?'4-o- Q W- M13 K, away. Even though Moline fought hard, they lost this contest to East Moline. ,522 ,is . 2.2 22.2 sa., I . - 1-rise:-22 2 ' 22.f2?i:H2f?i2f722 f- 21222 S sophomores end season 7 show promise for next year 2 2 2 2 .. ,,.. ,,,., , 22 , W , 2 ,22,.2.2 2. i,,. W, 1 egg 2 2 In L 2 2 K 222 2 18 S X Y 22 2 22 J S 2 22.222 2.2,,2:f 22,5 ,,2: .,22. ,mwl N2 2 12Zfr2g2f2'12.'2i' , ,KP X ZX2 a Kg KJ PEIEQEL22: . vs, ,.v ,2 22s.22..2,a235.s22sss2sw 1 2 , ww 22f2.2222wsfgss12Qfe2fvga,-222i4w1wH?i2 4s2gs2za24s2g?2?f 22f222f4s2:s?1i1?issl2sf2- zszslsiffissiswe . - a, .. 1-1s72swg12,- vzfv iss Q23 21-f2-f12222e2,22222 2-f2: 22 ,, 2, .2,222,.., ,,. 22,f.1,f22iffs22'f222-firas-22 2,s. fiifisifsilis X 2252212223 52 222522 2 .222 1 V ,,fy25i'fSx if 2. M.. ,Q 2252 22e22Qszfs m.22M2ff 22 iyiyei 2 2. ,eeii 2 seiee 2. ieeiie 222 iyeey 2 .ieeiiee 2eQy2Ay,2 eiesiieisee 2 isee 2 2 ..- 22 2,.22,,.2,,..,,..2 .2, . 22 22- We 22 ,' 2:52Pi i m2s21s22-4 2'seifi2,'1s2fQ3f9fM1ffff1 'e1fs22fBff?lis?i1s'iS'if aflisfg' 2 ' W 'KL Lrryk A ,Q .,rk,V 22,22V. 2..,, ,,..,,,., . 2,,. . .., ,,L . 2 lii 2 222 ,.,. 222 2.222 ,..,,. 2222 2222 ii2, X f-:,,--,,--2, Ms ,.,,.,, i,ii. X ,. ,2 2,f-.2f- 2 . -2,.22,.22,22,2-.222222222-2222222-e2 ., 22, 2, 22222 2 we 2-22312523 . 2 , ., 2 . me2222--2221222225224-2'2..22..22,.2s22.55s5s21fs22ffs 2'fe2,':sv-ffffflsfe 22 3 ,.. 2,,..,, S., ., , 22 222 ,,., ,f-,'i ,,.,. ,2 ,,.. .2 2 2 W, 22 - K K K 'K ' 'G ' K 4 'K K 'illaivifffz K K1 ':Zl,,'f5,..,Q.,,. , 'E .E .Els , is., ,lf i?':if.s,L:f:-fEKfl'f5?i..:2Q: il57:-ifgffiK- i5E5'5v' K- Til 5 K E 222222, 2s22,:22- - 22-ff-2-2222, 2.- ,-22222 22.22 .,,,,1,222.f222-fs 2- 2 2-222 -',-: 22,- 2 2222-22222222 i.,, 2,22-,22,,22-322222,222,22122,2,2,2,, 2:.,2 22 22222222 ::,,, 1,2222-.2222 N-,,, 22,2 2.2i2 22- .2 .22.2222222222. a 1 K 2 2. ,C 2 , 22229225225-fiisf., , .22:,2222f2:i2:15 ' 12 f221fi2:2T1a2sW.-2 ii122is:wf22- 1: 22-2:22 122,122 2- 22 12-2,-.222.222,.. 2?. .122 22, fei.222g,M 2423225 ef 222122 222222321 W ..2. 2. 2522.2,..W22222-2M,M,, 2-2 .52 22232, 2,2 -2- 22 2 ,,,, ,-22822.2,.2222.222ii22,622,.is,222,22,QI22222..,22.,QQ..2,,r2M.2,2f.,i222S-22,-2: ,K 5,7 iiil?5?If?il5:52W .22. 22..2..22,. i,,i, 2,,.g2g,222. , 2.,, 22 iQi! EEE?':?liE r 2 eg K 22221 2 i 2 2 M, g .,f- y: .f:, -f2.f22:: f mi., ,L '2,li22S?i125Tli11' 'fhi 22 -fi, fQss'::,,f 2- 'f 1 1TLi57?l5f2L' ,+ ,Swim -'22 i,',122Hw??siSfQ a2.- 2 , ,2m2222,f2 22 2 122 -2w2f,2 22 222 f2iWi2'2r'fr 'U2'i2f 2 gg A '23 Vf l' ' R' rgrivxl Kr at 2'432x6M srF l'n+?222ff22-Q-r222:is2fs5?s222- 22 2g22222w22r 12,2 smmieges' 2112 2122222222222 .fa- . , 52s22e12 .222 . ,,:, . T we .22 .2 222222-222-22:nwf 22 2 2,2 V2 fa 122 2f2'f?53 f2af1iQ'1isZiia24232522219 1 If ie ,, .,,. . 2. 2 ,,..,, 22::22gSs2s'e1is,2fs22 se K11f22i4221422i?f2w22 is H, ff-2252222 2222222 222 -221122. ze,-222222, A ,2,, ,,222,22.22 v,..v N. 22 2 2 2:2fe,,2222.f22- q in ,2f, 22:-22:u22f2e2 .. sr' deem--ig5,1.1, 2. M sz 22z2se22sgi:2s2ss222 gefeflfqfr 22222222222 22 . 22 2 234 Q ur.-2, 2 . 2- K ' '1 w f 2 A -2-222:f2:2issWf2iiU-'f2'1ifsffs7fs2.s2.212-M 211,'missamswrsi2.22v11Qx1222:e22:1'2:22.-r:1sf2r22'22'-sw-Q122-ff-22--2222212225222222-22: 22,-ff2222e2w2a2.22-f2'.21-1222-1222222322ff:f-M11s22:22M:2f---M22-122:25222-vw22m:-22252.--22g?l..22.222,:f2,.:2f.e2u12.f-ssfeezw . 22 ..,...,,.2 2 ,.,,,..,.. ..,,..,.. .,,.., M2. 2.,. . 2. 2 , 22 ,22,2.. 2 .22.2,. , .2.22 -22 2.2. .2 22 ,22..2.. . . 22 .22.,2..,22 . 22.,22.... 22 2.22..,. . 22 .,2. 2 2 . 2, ,...22Me2.22. 2, '24' 1 M 2211151 Sophomore wrestlers are, FRONT ROW: En- rique Cervantes, Paul Cook, Mike Cackler, Randy Brown, Terry Kondora, Jeff Miller, Wil- liam Johnson, Cmanagersb Lavern Thompson and John Lorig. BACK ROW: Coach Harry Lester, Miller, Dave Grimm, Bob Fox, Ass't Coach Don Ron Marks, Doug Thompson, Gary Griffin, Morton. Dan Thomas, Mike Evans, Roger Angell, Shawn Rockwell, Jeff Lawrence, Mark DeBaene, Neil 231 E 22 2 W 1 S i 5 Members of the 1971 Track Team are FRONT ROW: G. Lopaz, J. Wood, M. Padesky, B. Stevens, G. Wilkinson, D. Engstrom. SECOND ROW: S. Evans, R. Rempe, S. Caldwell, R. Kelly, R. Wise- ly, D. Bradley, D. Spriet, B. Fisher, D. Ecker, G. Huntoon, V. Baber, R. Kramer. THIRD ROW: M Cumberworth, B. Routt, J. Nelson, D. Peterson A. Eastman, L. Brown, J. Vana, P. Smith, R. Renner, J. Libey, R. Watts. FOURTH ROW: J. Metcalf, M. Geddling, M. Sullivan, J. Bustard, G. Clauson, R. Willaert, S. Johnson, S. Olson, S. Anderson, S. Jamison. BACK ROW: L. Markin, B. Gerard, R. Angel, D. Kelley, B. Stevens, A. Zukarb, M. Griften, S. Johnson, D. Spillum. Dave Engstrom clears the highjump bar in practice and hopes he does the same in meets. 232 ik... A - .fo Af',T'9 Q ' L ff Running before and after school is necessary fortrack team members to build up endurance. Randy Kelly jogs at practice after school to look forward to a winning season Jim Vana, polevaulter, concentrates on the form that he hopes will win him many victories. 4 keep fit and help him win inthe coming meets. 4 ,gr- M-as-,-u.,.., 11.41 W. 1 l,...,, lm .mmm xo 4'-fa. l E i ,Mgr ,,,,of.,,,,,m ,.v.,..,...,s 1 I W, .ik 4' N 4 W Q is.. r f+:f:.- ,.. 3 , gg'Q,.,..,, .. .. ,. TM ,U 'M . ,,.:l'iJ ' I , ,M ' A ,-Q1a'?-ff,,,,w,s1M , , ,Q vw - 14,5 :. il , 'fx' '5 ,. W r + was ' 7 1 of . if 'fu N, W if 'ro' r s .1 i W : .Q r . 1 9 ' H- W, M A -f , M - ' , 4- ffyk .. L V ,Q pw . K WGA K Ml is 'ann N' V I H k -14 N-La1ff?'22 f ' W-L-Tr ' f I o,k' E11 ,A . J- , I ., .,., x .' may -- 4- ,W V i H-wa... W- I 5, This earnest trackman practices his hurdling as he knows he can gain points if he wins. 233 track boys practice indoors await the coming of spring With fifteen lettermen, coach Gene Shipley has an experienced team to work with. Moline opened the season with the Proviso West Invitational. Capturing seventh place in thirteen, Moline entered without its full team. Several of its key members were still included in the basketball tourna- ment. Even with this slow start, Coach Shipley and the squad hoped that they would have a winning sea- son as soon as the entire squad was together. Several of the runners sit around and listen to Coach Shipley discuss the practice. Greg Eckert and Bill Gerard practice their Al Eastman stretches his muscles in prepara- starts for track. Fast starts are necessary for tion for his turn at heaving the heavy shot put winning. ball. 234 'N experienced golfers looking forward to an excellent season this year Hampered by rain, Molines linksters faced tough competition. Coached by Mr. Jack Dye the Linksters were con- stantly being plagued by the heavy rainfall which came in the latter part of the season. The last two meets Curt Spillum gets in a little extra practice after school and tries to improve his swing. were delayed two weeks and this did not help lVIoline's final outcome. Lead- ing the Maroons in the fall season was senior Curt Spillum. The Linksters look forward to a more successful spring season. Molines Golf Team consisted of: FRONT ROW: Pete Sherwin. BACK ROW: John Carpentier, Coach Jack Dye Andy Sherwin, Fai Wood, GeorgeHuntoon,Don DeLeuo,CurtSpillum. 235 1 This years baseball team is: FRONT ROW: Dan Coones, Steve Terronez, Tim Trevor, Tod Pu rce, Steve Shelb, Curt McClain. SECOND ROW: Tom Hammer CMgr.J, Gary Strayhall, Tim Foro, Greg 51 Z. Schwabe, Stan Graham, Jeff Young, Pat John son. THIRD ROW: Steve Larvin, John Rives Mark Peterson, Dave Lester, John Kipping, Mike Miller, Mike Van DeCasteele, Terry McKin spring training finds young team looking forward to a great season This year Mr. Bill Baltzell was the head coach of MoIine's varsity base- ball squad. He replaced Mr. Bill Best who left the school. He was assisted by Mr. Richard Matter. Getting a late start due to intramural basketball and bad weather, the team is looking forward to a winning season. 236 With only four returning lettermen, Mr. Baltzell will have to build up the team. The boys have been working hard and are ready to play. With only three and a half weeks of practice, Moline's baseball squad will be facing Alleman in its first encounter. nen. BACK ROW: Bruce Goddi, Mike Hancks John Barrowclough, Greg Ervin. Dave Lester practices the pitching technique that he hopes will lead Moline to victory. Exercising is a vital part of their conditioning as these boys on the baseball team are finding Tim Trevor practices his catching in spring out- training. A good catcher is very important. f' X emit! is - QW? , i Members of the 1971 Sophomore Baseball Team are FRONT ROW: Steve Porter, Jeff West- brooks, Kevin Johnson, Ted Spurgetis, Barry Nelson, Brad Dye, Don Phelps, Dave Miller, Sandro Kennedy, Gary VanDeCasteele. SEC- OND ROW: Jim Swanson, Greg Eckert, Mark Wilson, Steve VanErstvelde, Bob Jones, Fred Ryser, Raul Guerrero, Ed Haskins, Jim Roche, Ron Quick, Clyde Beaird. THIRD ROW: Rick Rumler, Larry Mitchell, Tony Smith, Jeff Tho- mas, Chris Benson, Dick Tillberg, Jim Ruge, Paul Cook, Bill Churchill, Jim Flack. BACK ROW: Tim Welsch, Tim Leachout, Mike Meers- man, Eugene Richardson, Rick Alvarado, Keith Eastman, Terry Hancks, Troy Mooney. 237 ' -N Q ix QA tb. K YT a X ,,,, 2 , I LI :.,, 'f' ggAg L ,iz . , ,y Ai, Z V yi , ri 'I 52 KTLA? f ' 55 Se,-J 'X W 1, Q Ss..-4 The senior half of the varsity cheerleaders this year were Sue Milroy, Cindy Atkins, Lynn Humphrey, Marcia Lewis, and Sue Chelstrom. tb Helping cheer our teams to victory were var- sity cheerieaders Kathy Sylvester, Mona Hard- ing, Deb Blow, Carol Hallene, and Vicky 238 VanDaele. Looking worried, Cindy Atkins glances at the scoreboard as Alleman rallies within four points. peppy cheerleaders encourage students to show school spirit With practice four times a week, Mo- line's cheerleaders strive for form and body control. Besides striving for the ability and skill to perform difficult stunts, the girls have origi- nated many new cheers. They work under the supervision of Mrs. Sharon Pirkl and in collaboration with Pep Club to organize the cheering sec- tions at games and programs at pep assemblies. In addition to the ten varsity and ten sophomore cheerleaders, the Mighty Maroon assist in leading cheers and boosting school spirit. Whereas this honored position had been ap- pointed, this year the squad of Mighty Maroons won full votes of popularity in tryouts with Pep Club members actingasjudges. Q.. Q Susie Quick, Maribeth Lord, Sarah Hile, Mindy Grafton, and Maja Eaton were members of the 1970-71 Sophomore cheerleading squad. Demonstrating lsome of the positions used in cheers are sophomore cheerleaders: FRONT: Jane Rursch and Cheryl Whilhouse: CENTER: Do- reen Atkins and Marilyn Westcott: TOP: Mary Telleen. 239 ff. rf '13 ' ' I , , 5.1 ,f uf 7 V' ' 1 Y 1 if , iq' 5325, 1 fl rj? J Q 2 'LV 131' ,5mVfW, a m 39 ' 1 .i HU' 51 Q4 if'fs5fI.Q'-?'?K5?Ti5QQ:,gff: X 'I A . fx 'fffizfg A Q W in Qi - if lu 5 ' fl A I . :,.1WAK -v.,-: F TE . M, - ff I 5, , - ,M J fm. . .1 .. 1 M Q 5 'H!?f'f1,.' 3 3 1, X 125,22 3,4 .1 5if'F -Q S I ki 3 -V i- X fs ff' ' NN f - A nn. , If 'gf 4 Q1 If ,My ' , ' m.Q'i, J' ab. 4' Q' fa ,N it ' H r wr- window displays, catchy phrasing, a clever jangle, brilliant lights, a shopping spree, rustling packages, the world attracts us. advertising Best Wishes to The Class of 1971 DEERE 81 COMPANY ad, Moline, Illinois 61265 classified directory I s E 3 2 L D w Q 5 2 wi , 1 f 1 5 2 hs 5 . we ewes 5 s is 31515, E I 5 E E 5 . sg 51 iw 5' '. sg 'if 3 51, EQ s. f it E, :gi 33225 ga , S SH 25558 Egg: WE' .EEE , NM X555 ff! F2555 fig A sag xy EEN QE ,gf is 5 A Z if ,L E555 VE 5 .. 22? gg? E 5 3 S s fs 353 EEE? g W -f'. L ,fafisx s 5 S, , gf Eg igglw EEE? 552 5 if EES 1 . S 51 F 51 5 .,. 3 3525 P3 age EEE R, ig E K Nl E EZ5i5.1 :':. Ks E in gas 'ms as .su A s SSW l , , 2 5 5 , E ig, 3 1 E a T 5 s 2 ig K 5 s 2 'gf K 53255 ff: 3 my Mfg Saga K , if fs if 4 ...Af , 1 Q 5 , 2 s EQ . gi S39 2 , Esii 55,13 5 ....... i E 2 my -W-if t Nga M YL' V- W-WFTQNQW 5. fs S 3 5 . ti Q fi 35 2 3 We wi 3 i gs E 3 55 K E'- E T is Z i 3 W X E 5 5 xi f 2 52 ig ,. Ei 1?f'if v Q' E E Ei ii Ss QW as s 5 Q , 2 : wh! k , 525 55 E Si :f,,a, v,,,.'-f.,:- ' Ugg 3 .. ., 3 , Q: 1 l.: E. li , - E ? K w1ss,-115.11135 11111 1, 11111111.11 ,3 ..,,, , 1 ',1113111iv5v,111.1, 1 111111 1111111111111 51111111 1, ,, . 112111111111 11., 1 1.,.11,1111111f 11 1 .11 , .. 1 ' 1 ?1111Q1111'11'11s,' , ' 1-111v1111.1,11. 1, 1- 1. 1 1:111v121111, .1 1 '111.'f114,f5111x,1: ,, . , , , L,,. 1,13 ,f'k 1 - , 1 11-1111 111.1111 1-1111111 M., 8' 1 11 111, jamygggeb 1' 1 j,11.7,S'1g,g95?3g,f?115, '. '1 7 1,ffY1jf7'11'?11-, 1 .- f'm5jL?131i1 , A 1 1' -X,-Vl?1Eifi?112? 1 ,-V.?15,51iE 111 11zQK31ifTi-'11j,f ETS?-5191'1 '11':fE-Vi9--l5li11-- 1 1 117 5715721 f if? k I 'l1111.,,M:11!f?i51-MSNEE,-f' ' f1715:?121?53lb51-915,-. 5 115'5,f?1SXL5J:11i'S ,..,, 1 1 1 - 111. 1, , ,lb N1 . 1 1 11 21121111111 f, 1 ' .1111 N,,.v1x 1 .1 ,,--12fg...r1111 1 1z,1-211,1-11111- 11111 ,.., .11 . 1 - 1 1111111w11,1111f'1.111111,,1Q1f?1s1M!2-1.a11,111,111111121157 i 1-1 1 11 . ,11111 N -, 131111 ' 111 11111115515 11--1Q11,,..111111.1,1?1.:gS11M,1115,11111, 11111151-1121-1g111,,11 1 -1 1111-11111 fa- 11 1111 11 -115111 . ,.,ff,,,f . 1.-11211.-VQ1111 1 ' -1 11 -:,11i,. 1, .1 ,W,5.,,,.,? ,1,,11L.V P my 1111111121 ,1.11.,., 111:v115?m11.11f1.' . , 1, 1111,,f112111 1 . 31 ?1'5'W1- 'Q Z 1111 1:11 ,L . 111. . 115111155 1 .,..,,,. 111, 1.1 . '1 .11 1 1-1115111511111-,-1 1. ,, 1- 1f11111111,111, 1 . . ' 1 ,. , 11 ,111.,11,111111 vf-, . ,f,.- 1,111111111,11 1 11 11 1,,,11111111, ' 'f111f1,111f?1s11111.111.: ,,., 1 11 11 '1 1151111211111 11,,m1. 5 -1 1,11. ,.,,, 1 1 ,,,,. 1 1. ,. 9vf1P5?1-f1115v1i11-- ,1f1S'2Sf1ea1511f1f111 11 T, 1 1 QS, 1 -1 1 11.-,111 1 ..,,, ,. 111 , 1111.11 ,..,., .,,.'f 1 1 ,.., ,,.1 ,..'L, ,. 1e11-5??f11?111.:- - 11,1N151111s1w11,11 1111-1?111,..,11,.1 1 J 1,1111f:1'?211i, .. -1 --., , ., 11-1,1111Swf1,s11,,f 111.--111,1111gw131ev1. 1 ' ' 1315111-11Q131:11.1 1 1 1.,f1111R,11f111, 1111111111 11 . 1, ,..,, ., ,.,.,., ,, .. .v,.... L,,.. he . ' -1 -1111111-1.1,.11 11111--1115111151111 1111Q11111111111111,111- ,1-1:11e1f1121::111, 111 111 ,1 11-1,.111f:111315111111-,1.1 11111?iwws1'21g1111, w1:11Q1?11'1,1 11- 1 1111v1m1f,11y11.111-1- .511 111111 1 1,11111155SQ1j?:11 1.1 .111111115111 1 - 1 1 1-1111,11f1111s11,11111 11,.111111,1,1 1,11 .1,11111,,111111.111- - 111111111111- - ' -11111115 1. -- .-1,11w11t-111 -1.1-1111115-1, -1111-111111-1 .1 1- ,:115,1q,fp 111131. Q1 -1 11 11 - .1 1315151111 1 , 5 .,,.1111,.111w11y1.11 11 . --111111,s1121.11,,, 1.1 1 111 111151111111 1,1.111Q.11,41111 .1 111,111b1111 ,,-111,Q,g11,1111,. .11 1111,111,,,,.1 -1 .21---mx,-11231311 1 .111 11115431 :rw 11,-11 1 111 1--1111: 1 111 .. mg 111 111 1- .1 1.1m1vm1-1 11111 11 1 rw j?1 ,111- 1.1.1.1 11,1 . M re1111f11. .1kk11,g1,g151111,11111 ,1,1311115,5??5Q 11g111111H1, 11k1,,11111,Sgf111g1 11 111111g11a51,g5gg,,1111,-,1 1k1H1111113f1mg1f111,w1111,1 11111151es1111P11111111 ,1,1'11g51bs1g?11111g 1.1-111..11:-2111 11 1.111111111:.111111 -1 11 1 11-1121111.11111111 .1 ,1111121,11:.111.111--11111 1 1 -1111111.11-11111 -1 111:111fe1111,3'1-'1-11'-1 .11111121f',r--,1 ,11-1,1111..1:1v111 'i'f11.5f12'1s1,11 1. 1 .1?1s1?1g11-11:11 1 A vf1f1151gf1f1f111 1-1 1 11 1111151115111 1 1 11111151.18-Q1'11 1--1511s111f1,,- gg11g?111g1,1 1 J 1 1 -1-. -11 .1,. ,..,. . , . 1 1.,,-. 1, . 11 1 .. 1 1 L1..,,111k,11,,11,.111,111.11 . 1,1.1,L11111g71w--1g111,.. 11111,111111,f-,1fff1,Q11 1111., 11,:1,1fs1:15121-111111 11, fwasgfw- 111111 111111Q1111111if1111 .,111,1111--11111111111111-,,1 1-11,,111a11-m1111111 . - -111115 , 11.-,111111111m 1 11.111-11111111 ' 1 ,111111111111111.1111.-,. . 1.1,11111,1111,--1.1,. 1,,111,z,11:11- . . . .1,11.121111121Q11111111 -11 1 1-.1111.11111.11 1 111.11111111111,111,,1.11.1 1 ,111111,51111,.1111.1,1 ,1,,. 1 1 1, , 1, ,.1 1 .K 1 H 11 111.11..1R11111m1111-.1,1. .. 11111,?:1g1111119,,1 . 11111,1:1g1Q1g1111M.,,11 111- 11111,,..,,, -11111 ,,.1 in . 111, 1111111111.-1,1 11,1 11111111 1,11 11,1 1, 1113111111114 .1 U. ,111,-11WA11111 11111125-1. 1111 1111-111111 1-1 1111-1111 111,111--11-111 1 11111111-1111111111 111,- ,-- 11,1111,111v11.w11 111 .1 11 ,, , , -- 1-1111 y1111111 1 1111115121115 31: 11 f11311111,1f1-- .1111,1115v,111-,-1 1111111111: 1 -1 1111111611111 -1,1111-1 111-1-1 1 - 11, 11111 111 1,1111 1 11 1,,,, ,.:V:V, 1 JH 1111115111 K 15 1 , . 11, 211 L' 1' f111,'111?11111511.1f1111 211 191111 ., , ..,, 1115, 1 ,..,. . 1 , .1 11 1 .1,,7r,11 - 111111 1 1111, . . ' 11s1:51g1fs1i'??11' ,..1 ,11, 1 1,1 .. , '11-- 11 H1'1f1s1g1 1157 '1'11f1111,11 .111111g,11g5,11111, ,., . 11 Q . 1 11, 511e1?1f11 1,1f11 .5 11, 7133 75151 '- 3 1 -,':?1'?1fe14?'11,'1 ,,., 11, .,,.. f,,1 ,,1 11,.1111,,1.1w,k. -1ff.11a1,1r151,1 1:1111111111,.1. . , 11 -1 11 1-,1f11?fw1gf1x,11 -111'1s11v1111111 ' 1 8' Y' 1 ,em- 111.11,1-Gfki 1- , ,,, V 1 11 1 1 - 11 1- ' 1..1,l21i3f111111 ' ', 1111111 1 A 1.1111151151 1, 1 ,. V, 1 511-Jf91s5'f15 1 '1E1111f5f+i11g11: 111-1511?1f,l11- 111111 -, 111111141 111111 11, .. W- 11 21-13111 11,11 11 ' -f11?131f11111 - . ' 'Mx -f'1.r,,: 11 ' 111,1111:111,p'111111 111 1 1 11111111 . , .6511 . 1 F1-1t'1?11':1Z?11?11f' 1' '5111 ' K 'm512?g?1f11s1 111131111111 '51s25B113 f11: ' 111,- 1 1.1 1- 11, . 31,1 11 W - 11111111 1..1 11, 15111,.11 111,1 , ..., 11,111 1 11 11 1 1 111,1,11g1,1 1111 1 , 211111111 .1 ',1111.f11s111Y1-1, 1 611111111- 11 1- 1:f1111,11111 1 1 1- 11.1 .1111 11111111 - 11-, ..11 K' ,fu Q 1 1 11f111111,,1 1 , . 111.11-11 11111, . .1-1 1 . 111.11111 1- 1115, ? 5'1?11i'I' ,1?11?'5Zf1. ,1,..,m 11111.-1 1111, 1 , . 1 3 11151111 1111:1w11.,1gg1z, 1 111111 111g,11f1Q15'l:1155,f1 1 - 111-11fj11Q,.- 1 ,gj1q12,111f11 . ..,1 ,.,, 1 11 1-'1.11,f 1111.1112e11122s 1 1511111213151-W 121122 ' .1111-11 1- N 11111 1115i21iif1111111 1. .111111Q111'1 ...11111 11111 .1 . 1,,111,11.,,1,, 11 11 . . 1 1 1.1.1 .1, ,..,..1 1. . --11 1. 1,111 11., .111 1. 11,11 a1,Q?s11?1TiW- -11-111.1 111s?Q213w1gTg1111 -11. - 11 1111,.,11,111 11 11 -,1w111 1.11 k ' 111111.-5111111 .1 1 111, Q 1. , ' '??iVQ21.5Z?1?11 . ,.1111111w11,,11f,,1 . .- 111. 11 11Ei1'f??fli-isfE15ff1T1,-5'lilfz'SWL'-'fNX'1131iii1fM5i1'?'1. 191ii'! 1'J?5Z211iimt'1 1 . 1- .115121 1t1?1x2,1:1.I, Us .111'11115251-11??1 fl11:5 .1' T115 15151:e1i-l??1's: 1- 1211111111f?1?115111111- .1 5,'111-1s5111Q1sw??111?11v,211111 1.115151--111x11Ff2m11Q11 1 - 11 11,11:111fe1gw111-111, 1 111 -w11111N,111.1 91'-V11 iS1s1:..?r3,'i1'fS 1 .1 1,.11 1 1, W , W' 'MQW naw' 3' 1, Y, , sid selhost marina On South Bank of Rock River 1 Mile East of Bridge gl Route 150 Sales 81 Service 799-3112 Everything for the Boater Instant Fun - - sterling cosmetology school 16081!2 5th Avenue Ann Pettit receives a manicure at the Sterling Cosmetology School which is franchised to teach the Marinella-Comer Method. moline national bank 506 15th Street For a safe place to store your hard-earned dollars Paula Nelson suggests trustworthy Moline National Bank. Sears sears, roebuck and co 3800 23rd Avenue Moline, Illinois Ann Tormeno and Sue Bitting model midis found among the many stylish fashions found in Sears' Junior Bazaar .2 ,.. f .fy lg f g,,'1E 4 f l JP .Q Tl 'r ,. ,', 1- ' .:f,'i35fZigf':f'5 X . inf :rr ,Q . 'VCD ': -' -1' -sag' il? L ' af? 5:0 ,fn w-1,. X I fi -'ll lil W 1 K Wifi elf . .:....,. -llllill ig 5k l Hx... ' P oDY WAEKS f B AWAY Y mills Che' S l61039tI'1 Avenue P , 3510 23rd Avenue John Barrowclough examines striped adidas found among the fine sportswear and equipment at Sportsland, Incorporated. olet midwest national bank 2200 36th Avenue As the newest, most modern bank in Moline, Midwest Na- tional has indeed proven itself to be a convenient place to do all your banking, with confidence in its security. F. 'lr . s ff' m. I. parker company fi' U S 3 an is-sus' whitey's ice cream 1611 23rd Avenue Where else but Whitey's can you buy a shake so thick that it can be turned upside down? sam's highland park and highland park bowl 4204 23rd Avenue Teens all over the Quint-Cities are discovering that Sam's Highland Park is the best place to go on week-ends. See well-known movies, eat pizza and tacos in the atmosphere of the 20's at Highland Park Bowl. carpets by edstrom Orchard Center 3707 23rd Avenue This is the purr-fect rug to put on a bedroom floor, comments Karen Edstrom as she admires the fine carpets sold at Edstroms. MA THE MA rlcs 42:- 'o 4014 oft 17506. x0 X' QW'-'45ov5x0'x Q99 Q eflarrfettqme 'Q lT'S CALLED SYNERGISM Where the whole is greater than the sum of its parts All your classroom hours, and extra-curricular activities give you much more than a diploma. They are your key to the future. Use them well. Then see us! We may be able to help open the door to that future. Eagle Signal a systems division of GULF + WESTERN INDUSTRIES, INC. 736 Federal!Davenport, iowa 52803 midwest typewriter 8r service co. I1ati0I1al Car wash 1520 6th Avenue 34th Street Si 4th Avenue Mo Johnson thinks that Midwest Typewriter is a great place to choose a typewriter from the wide selection of modern office equipment. National Car Wash. Speed and quality guaranteed- Only a half hour before calling for your date and the car is dirty? Try rlrtt 7111111 .--gnu 2 CAR WASH Q- N wwe K .1 i.-.e-..... ky My .W-wwe QF IVIQLIINIE Diane Kinkead and Mary Beth Jump enjoy the quick ser- ' vice atthe First of Moline National Bank. imimvutaiitfimus BAN 501 FlFTEEN'f1'l STREET'-NlIJLlNE,Il.I.JiS13lS S1255 , We Cohgratulate the Graduating Class of 1971 and Wish Them the Best of Luck and Success iri the Future - merican ir ilier temper air group 1824 Third Avenue IVIoiihe, Illinois Ieclaire hotel 421 19th Street LET US HELP PLAN YOUR NEXT SPECIAL OCCASION A1 holland jewelers maid-rite 1602 5th Avenue 421123rd Avenue Which one do I like best? ponders Sue Beitel as she tries on one ofthe Sancy Beck anticipates the first bite of her delicious maid-rite courte- many styles of class rings available at Holland Jewelers. ously served by MHS senior, Penny Powell. :I Egg!! 7, fi it 'i 3 lei if flowerland bill tuman motors 3160 23rd Avenue 164 5th Avenue Cindy Carlson sits amid the beautiful floral arrangements at Flower- Debbie Hoogheem thinks that owning or riding a motorcycle from Bill land, wishing she owned them all. Tuman Motors would be an exciting experience. l11 Complete Fraternal Life Insurance W5- for the Entire Family ZMIIILL M76'l:qL!U2'6' o F A M E R I c A SUPREME OFFICE ROCK ISLAND, ILLINOIS 61201 FRATERNAL LIFE INSURANCE SINCE 1895 roykouff floorcoverings 3707 23rd Avenue Marilyn Anderson looks at the wide selection of quality floor tiles that can be found at Roykouff Floorcoverings. snelling 8. snelling 1630 5th Avenue Snelling and Snelling serves students such as Sarah Carlson by sending qualified personnel applicants throughout the US as MHS. I g'.f.f.'.'9ififQ5f 'SETS 5255? Q24 sf f,'ir,'wt+jif'+i! i Hsu ,-. ,MX gfL'6Sh'i Ififns ' sy iefiiiflhgf igvxgfr viz 5 lsi,,.s,9.,,tJ tt i,,.+.i,k,4 W, ., ,ktggq v4'+4i hammond organ 8- piano studios 3606 23rd Avenue Kathy Chandler enjoys the skillfully crafted organs and pianos sold at her father's Hammond Organ and Piano Studios. temple's sporting goods 1524 6th Avenue Aluminum tennis rackets are among the large supply of sporting equipment examined by Peter Welander at Temple's Sporting Goods. , W X pg: I 4 gl-i-QE K fa f' ll lim X . , 'C ' f . ,,. -e af' '- ibff f ' 1:5551 ' ,. ! :l V. Ill I' ' 3 Hia? 5' Q ills ll 'llfl -ll R g N Y' , if 3 W! N U.: Illlli s snsv enanas ml Y V- Eg Hgklw jim's grey gables 601 15th Street I-UIEJOTL , Fabulous food and a friendly atmosphere are offered at , it Jim's Grey Gables, on the corner of 15th Street and 6th Avenue in downtown Moline. mosenfeIder's DOWN TOWN MOI-'NE Ron Bernard agrees that Mosenfelder's has the latest KING PLAZA men's styles available to teens of today. peter's bakery, inc. 1501 15th Street Jim Bustard and Mike Geddling purchase their lunch from the wide variety of sandwiches and rolls provided by Peter's Bakery. rnedd O lane A A DAIRY STORES 272421-3rd Avenue 5 . 1... . , 1 v -f -A harrelson motors 702 ww street Sophomore, Brian Olson should prove to be an excellent driver as he is being trained in one of the fine cars from Harrelson's 55 tl' 1 X E montgnmery ELEVATORSIESCALATORS POWER WALKS 8: RAMPS 7 baker's dairy 34-th Street Whatever your tastes may be, Baker's Dairy wi ll be N .X .N carson, pirie, sco 81 co. 1520 Fifth Avenue Downtown Moline Store Hours Tues., Wed., Thurs., Sat 9:30-5:00 Mon. 81 Fri. 9:30-8:30 11. . the daily dispatch Luann Verhelst and Pam Bristol observe how type is set for the dely 8ddy'S shape shoppe bob boyd 81 company, realtors 1526 5th Avenue Admiring the elegant nightgowns at Addy's Shape Shoppe, Pam John- IN son and Carmel Allen are sure they can make a beautiful purchase. ReSICleI'ltl8l Commercial Industrial Sales PROSPECT POINT Corner of 16th 81 Blackhawk Road yuqnmmw: . 5 obiti il- e ili axel carlson company 4414 River Drive Axel Carlson, well-known throughout the Quad-City area for a reputation of excellence in designing, is one of the leading contractors in commercial and industrial building. 1 - forl ,ziz-E :F'Ef........rE1E:E:E:E:i:f:Er',-2-1:-., ,1. . , 12: ,ri-:-zrirsg...,..,..:E5E11115:5:5:5:g:rf5:5-2-'-2:21:39 it 1..-. ',1V ,... , , ' . , ..,. , . Downtown Davenport Downtown Clinton Orchard Center, Moline PETERSEN HARNED VON MAUB VVILSCJIV 'S 1 V and APPLIANCES 3615 23rd Avenue Nloline, Illinois 764-4331 Complete Line of TV's-Appliances-Records Open Mon.-Fri. 10:00-9:00 Sat. 10:00-5:30 YBQY5 SYN? N.. hasty tasty food shop 2326 16th Street With a smile for the cordial waitress, L nn Hum hre repa st d Y D Y D at the pop I ft -g me spot, the Hasty-Tasty Food Shop. ESTABLISHED 1900 moline heating 81 construction co. incorporated Plumbing, Heating, Automatic Sprinkler, Ventilation and Air Conditioning Contractors 320 Sixteenth Street Moline, Illinois Phone 762-5557 SCHOOL OF NURSING moline public hospital 635 10th Avenue scHooL or x-RAY TECHNOLOGY The School of Nursing at Moline Public Hospital offers a thirty The hospital offers a two-year course in the School of X-Ray Tech- month program and is affiliated with Black Hawk College, where nology, approved by the Council of Medical Education of the the basic science courses are taught for which twenty hours of American Medical Association. This School is affiliated with Black college credit are earned. Hawk College. OPERATING ROOM TECHNICIANS A six-month course is offered by Moline Public Hospital for training Operating Room Technicians to assist the professional nurse, as a member of the Operating Room team. claeys 5 auto s te EMM ft' I S U p p I y A 't K , M H ' '. f' -- .saw Q g i in A 3 b y il k Q 65,2-fwmxi - 2321 16th Street Agsfitggmgylvf UTURS 51 Get all your car needs from hub caps to mufflers at Claeys Auto Supply, rnrivirifm, K ,, tl5l!.+kfIligU.5?x. AW imlitwzi Ugylilfll VM-in +I i in f 5 l Hifi t' ' ,, ,i , mc donaId's drive-in resta u ra nt 3433 23rd Avenue Howie Clark says, McDonald's is my kind of place, as he reads their menu that promises him change back from his dollar. williams-white gt CQ. 6003rd Avenue As a leader in Moline's industry, Williams-White and Company has taken great pride in its efficient technical machinery and has maintained a fine reputation established in 1854. l+ uptown national bank dairy queen 1601 15th Street 2724 23rd Avenue Certain of its security, Brian Johnson deposits all of his savings in Up- At Dairy Queen Billy Jo Shannon takes R th Gordo s orde fo a do ble town National Bank of Moline. header with two of her favorite flavors, vanilla and chocolate CONGRATULATIONS BEST WISHES GRADUATOIEG CLASS 1521 george evans corporation 121 37th Street I'0bbil1,S electric 41214th street Jeannine lngelson admires the unique lights and fixtures available at low prices at Robbin's Electric Contractors, Inc. tsl? ' w moline forge company maid-riteiir3 4101 4th Avenue 2036 16th Street After an interesting tour through Moline Forge, Chris Moore points out a After a hard workout at their favorite sport, Dale Spriet and Mike Vande large number of steel-forged materials made by the company. Cagteele heartily enjoy a Maid-Rite hamburger and a coke. 1 southeast national bank 3535 23rd Avenue Debbie Griffin likes to do her banking at Southeast National Bank be- cause ofthe friendly atmosphere and helpful clerks. 1 if bfi Wm! 5 7 ' if 5 'A' K i ., 1 ix, px Q' f-131. Y 5 ,,c ex 1' , v.4..J?- M- Q:-4 , A . 1'z.w 'Wig fx, A j if little king 2812 23rd Avenue Debbie Flynn busily slices meat and cheese as she invites a customer to have a delicious Little King sandwich. ratcliffe beauty salon 1630 5th Avenue Tired of your same old hair style? Val Malarky suggests help from the efficient beauticians at Ratcliffe Beauty Salon. I l l simon music center 1610 5th Avenue Dawn Esterdahl will tell you what fine tones can be achieved from the quality instruments at Simon Music Center. BOB MILLER SAYS: FOR QUALITY, SERVICE AND FAIR PRICES BUY YOUR FLOWERS AT miller floral gardens 3615 27th Street Moline Call: 762-3618 GREATER MOLINE'S MOST ACCOMMODATING FLORIST WE NEVER CLOSE UNTIL ALL STUDENTS HAVE PICKED UP THEIR FLOWERS. Gt th I tth MHS B mhs bookstore kt f J Btdmkeddlgmrncl J S dN yG bl i K-I Yi l,,J j. c. penney elliott camera shop 17015th Avenue 1604 5th Avenue l As Laura Mountain gazes into the mirror, she realizes that a coat from Need a new camera? Gayle Whitebook finds Elliott Camera Shop supplied l J.C. Penney's would beadream come true. with alltypes ofquality photo equipment. N X 1 .1 S-' ss, ,gives 1 ff if .if - 14, 1 ' ' ,j 5 T '5 'f ' We A 11 ,, We e 1 , ,. t h,,, sf. ,t,e , -A V ' ' MW- WST' ' , mn moline consumer's 313 16th Street Moline Consumers Barge has become a familiar sight. By daily supplying the company with sand and gravel, the maIcoIm's jewelers 1507 5th Avenue Holly Rasche chooses her class ring from the large selection of styles she finds at Malcolrn's Jewelers. N Q. 0 u li ff. moline tool company 102 20th Street l Moline Tool Cornpany's high penetration rate drlller with its full auto- matic cycling is arranged for tube sheet drilling operations. , dollars +sense life insurance ...and that about sums it up. Modern Woodmen of America Home Office-Rock Island, lllinois One of the Nation's Leading Fraternal Life Insurance Organizations moline board of education Congratulates The Class of 1971 and Wishes Them the Best of Luck in the Future Robert Seeds .... .............. P resident Roberta Pearson .. ........... Vice President Melvin Reynolds .... . . . Secretary and Treasurer Donald G. Almquist .. ..... .......... R obert Carlson J. Milton Ericson .................... .. Paul Edstrom William Millman nordquist and associates Your School Photographer Nordquist Studios . 2614 5th Street M I III 5 chester-lee stables one-hour martinizing 48th Avenue 23rd Avenue Chester-Lee Stables, where Gary Benejam and Sue Watkins board their R if .W W. s,..,, -I T E571 :i':gpfs,.f-fifz . horses, has reliable service and beautiful surroundings. LOCally owned by George and Estelle Spurgettis sbsse ' E E 2 ei.-I-s -,'--r . I.,-I i . 5.5, ty . is me . ue .rf Na., W T ,kgs Hg 54353333 ltggfls 5. N4 2, . ,K , 3, K, as 2 Sl 1 t 155 sim Exif, Q iii? fit? K X 1 X . 'MJ legwsf' H I fgll' ws 'Q Ss. TM 3 i E Q 44 if You've Got It-A Truck Brought It. american truckin industry THE WHEELS THAT GO EVERYWHERE xxxgegfitpvess vxoxavxv. ,xxuuoxs suse HRX B51 'SSS KBOSX 733 ' 5X7N Ringle Express, Inc. R. L. IVIcGriff, President city of moline 1 Mayor Jesse M. lVlcCandless W . I UA ...W-V 4 X ' N ' 4 3 3 5 1 f , . if Q 5 i 4 .. Q - . 1 1 3 ' f ? 9, Zy Industrial Jobbers, Pipe, Valves and Fittings. For the last word in service, look for the last word in your directory. 4208 2nd Avenue El JOHN ACKLEY, ADC 123 National Honor So- ciety 11,123 Float Committee 11,123 Heidelberg High School-Class president 10 vice-president 113 Track 10,112 Wrestling 113 Student Forum 10,11. SCOTT ACORD, ADC 123 Concert Choir 11,12, FNA 11,12 vice-president3 Hi-Y 10,11,123 ln- tramural Basketball 10,11,12: Letterman Club 11,12 treasurer: Li'l Abner Earthquake Mc- Goon 123 Carousel Bascombf 113 Student Congress 123 Football 10,11,12. JEFF ADAMSON, ADC 11 crew, 12 Script Com- mittee, CFGWQ Forensics 11Q Our Town Joe, How To Succeed Office Boy, Girls in 509 Rosenthal 103 Knight of Burning PestIe , Li'I Abner government man 12, Stage Crew 10,11, 12. PAMELA AITKEN, ADC 123 FTA 123 GAA 10,11, 12 Board Member3 Syncronized Swimming 123 Girls School Softball 10,11,12: J.A. 12. ALAN AKERS, Intramural Football 121 Spanish Club 10,11. JANE ALBRACHT, GAA 10,111 Home Ec Club 10, 11QJA 103 HERO 12. DEBBI ALLARDYCE, ADC 123 Chorus 10: French Club 103 GAA 10,11,123 Pep Club 11,12, One Night of Melody 123Y-Teens10,11,12. LORRI ALLEN, Chorus 10, A Cappella 112 GAA 10,11, Spanish Club 102 Y-Teens 10. SHERRY ALLEN, ADC 123 A Cappella 10, Con- cert Choir 11,123 FNA 10,111 GAA 10,11,123 Pep Club 10,11,123 Li'I Abner Wife 123 Y- Teens10,11,12. DALE ALLENSWORTH, Electronics Club 12. JULIE ANDERSON, GAA 10,11,123 Gymnastics 10,11,123 Intramurals 11,123 Spanish Club 10. LORRAINE ANDERSON, Spanish Club 11,123 Nat'I Honor Society. V MARILYN ANDERSON, Contemporaires 11,12 secretary3 Spanish Club 103 Student Congress 10,113Y-Teens10. SHERRY ANDERSON, ADC 12. SUE ANDERSON, ADC 12 Chorus: FTA 12, TERRY ANDERSON, Basketball 10,113 Lettermen Club 11,123 Football 103 Cross Country 11,123 Track 10,11,12. JON ARMEL, Detention 10,11,12. CAROL ARRINGTON, ADC 123 GAA 10,11,123 JA 112 Orchestra 10,113 One Night of Melody 11. DIANE ASPLUND, ADC 123 French Club 103 GAA 103 Science Club 10,11, VICA 123 Y-Teens 10,11. CINDY ATKINS, ADC 12 Chorus3 Cheerleading 10,11,123 Homecoming Court 121 FNA 11,123 GAA 10,11, Gymnastics 11,123 Tug Team 11, 123 Spanish Club 103 Y-Teens 10,11,123 Office b GARY LEE BAKER, A Cappella Choir 113 Concert Choir 12: Stage Crew3 Li'l Abner 123 Thespi- ans12. GARY LYNN BAKER, A Cappella Choir 103 French Club 10. LYNN BAKER, Office Occupations. CATHY BOLKCOM, ADC 123 AFS 123 FTA 10,11, 123 GAA 10,113 Pep Club 123 Spanish Club 10, 11,12 CSecretaryJ: Girls' Tennis 10,11,123 Na- tional Honor Society 12. STEVE BALLARD, Intramurals 10. GARY BANDALL, FTroop. Helper 12. 276 senior activities CARLOS BARAJAS, Electronics 12. MICHAEL BARBER, ADC 11,12: Marching, Pep, and Stage Band 10,11,12 CBand President 12, Representative 1153 Intramural Baseball 10, Football 123 Science 103 Orchestra 10,11,12. JOHN BARROWCLOUGH, M CSports Editorpg Science Club 123 Spanish Club 11: Baseball 11: Scouts3 RIA Flying CIub3 Nat'l Honor Society3 Spanish Honor Society3 Up the Down Stair- case 12 fPaulJ. CYNTHIA BARTH, ADC 121 Choir 103 GAA 10,11, 123 Home Ec. Club 103 Pep Club 12. GREGORY BAUER, ADC CChorusb 122 FTA 123 KaIeidoscript 123 Baccalaureate Committee, Senior Announcements Committee. CHRIS BAUMAN, Band 10,11. SALLY BEALER, Home Ec. Club 11,122 HERO 12. MARC BEAUCHAMP, Science Club 11,122 Span- ish Club 11,123 Hi-Y 11: Pep Club 123 FTA 123 Wrestling 101 FNA 123 ADC 12 CChorusj3 Intra- mural Football 123 Up the Down Staircase 12fMcHabe3. MONTE BEAUCHAMP, Gymnastics 11. PAMELA BECK, ADC 12 CChorusJ3 French Club 10,113 GAA 10,113 Tug Team 113 Pep Club 111 Y-Teens1O,11,12. SANCY BECK: Up the Down Staircase 12 QAIiceJ. SANDI BELDIN, VICA 11,123 Diversified Occupa- tions 11,12. JEFF BELL, ADC 12: French Club 123 Intramur- als 10,11,12, Spanish Club 10. JOHN BELL, ADC 121 French Club 123 Intra- murals 1O,11,123 Science Club 11,12, Spanish Club 10. FRANK BELLSON, ADC 12. JANA BENDER, ADC 123 FTA 11 CVice-Pres.J 12 CPres.b3 GAA 10,122 Pep Club 113 Science Club 113 Spanish Club 10. i TIM BENSON, ADC 123 Intramural Football 12, and VolIeyball3 Pep Club 12. SUSAN BERGGREN, A Cappella Choir 103 Ka- leidoscript 12 CSubscription Managerb3 Pep Club 11,123 FCYF CVice-Pres. and Sec.j3 Up the Down Staircase 12 CSadieJ. RON BERNARD, ADC 123 Letterman 11,123 Sci- ence Club 12 CSec. and Treas.J3 Ski Club 113 Spanish Club 113Swimming 10,11,12. NANCY BERNDT, Tug Teams. FRANK BERRIER, Track. PATRICIA BEY, ADC 123 GAA 103 Pep Club 10, 113 Y-Teens 12. RANDI BIORN, ADC 122 Band 10,11,123 Science Club 12, Spanish Club 10,111 Rainbow CPast Worthy Advisory CGrand Representative to Ohio in llIinoisJ3 Tug Team 11,12: Orchestra 12. BRAD BISBEY, Intramural Basketball 12. GREG BLACKBURN, ADC 123 Band 103 French Club 103 Hi-Y 113 Lettermen 11,123 Science Club 123 Swimming 10,11,12. BETTY BLOEMSMA, ADC 123 Mixed Chorus 10. 113 D.E. 12. CINDY BLOMQUIST, ADC 12 QChorusJ3 Contem- poraries 123 GAA 12: Pep Club 113 Spanish 10. DEBBIE BOONE ADC 123VICA11,12. CHERYL BOQUEST, ADC 123 Contemporaires 11, 12: French Club 103 Y-Teens 103 One Night of Melody Cdancerj. BETH BOWEN, ADC 123 FNA 121 Intramurals 12: Y-Teens 123 Young Life 12. PAM BOWLING, FNA 11,123 French Club 10 tSec.l3 GAA 10,11,123 Tug Team 11, Lit. Board 11 fRep.73 Student Congress 11,122 Y-Teens 10,11 CPres.9, 12, Inter Club: Nerieds 11,12Q Senior Class Secretary3 Junior Prom Commit- tee. BECKI BOYD, ADC 123 FNA 113 FTA 122 GAA 10, 11,123 Pep Club 11,121 Y-Teens 11,12. DAN BRADLEY, Lettermen's Club 11,12. ROBERT BRADLEY, ADC 12 CScript CommitteeJ3 Band 12 CAnnouncer at gamesJ3 Forensics 10,11, 12, Intramural Football 123 Our Town 10 CConstable Warenb3 Knight of the Burning Pestle 12 CVenturwellb3 Li'l Abner 12 CMuscle Many. NANCY BRANDEBERRY, ADC 12: A Cappella Choir 10,113 GAA 10,11,12 CSec.J3 Science Club 10,11,123 Spanish Club 103 Young Life 123 How to Succeed in Business 10 CcostumesJ3 Carousel 11 qcostumesy Tug Team 11,123 Nereids11,12. DEBORAH BRANDT, ADC 12, KaIeidoscript 12 CBusiness-Advertising ManagerJ3 Pep Club 113 Rainbow. ROBERT BRATHALL, ADC 12. BONNIE BRENSTROM, French Club 103 GAA 10, 113 Pep Club 111 Spanish Club 113 Y-Teens 10. DAWN BROMLEY, GAA 10,112 Ski Club 103 Chess Club 10,113 Saber and Spurs 10,11. STACIE BROWNFIELD, ADC 12 fChorusl3 Band 10: D.E. 12. TIMOTHY BRUCE, ADC 123 French Club 102 Hi-Y 10,11,123 Intramurals 121 Kaleidoscript 122 Student Congress 10,11,12, Wrestling 10. KATHLEEN BUCHANAN, Thespians 11,123 Stage Crew 11,12. ANNETTE BUELL, A Cappella Choir 10,113 Con- certChoir 12, GAA 113 Home Ec. Club 11. MARK BURGETT, Electronics 12. WILLIAM BURRUS, Band 10,11,123 Electronics 121 Gymnastics 10,11,123 Intramurals 10,11, 122 Key Club 10,11,123 Li'I Abner 12 fPit Or- chestral: Student Congress 10,11,123 Ameri- can Legion Baseball 10,11,12. WILLIAM BUSEN, A Cappella Choir 103 Debate 101 Orchestra 10,11,12: Musicals 10,11,12 CPit Orchestral. NADINE BUSER,H.E.R,O.12. BEVERLY BYRD, FNA 11,123 Home Ec. Club 123 H.E.R.O. 12. C JANE CAHALAN, ADC 122 AFS 123 FTA 10,11,12: Gymnastics 121 Pep Club 11,123 YFU Exchange Studentto Brazil. STEVEN CALVERT, ADC 121 Band 102 Contem- poraires 113 French Club 11,123 GAA 123 Gym nastics 10,11,123 Ski Club 121 Y-Teens 12. TERESA CAPPAERT, FTA 103 GAA 10,11,123 Pep Club 10. CINDI CARLSON, ADC 12 Chorus3 French Club 10,112 Y-Teens 10. CYNTHIA CARLSON, Concert, Marching and Pep Band 10,11,12, Orchestra 10,11,12, Pit Or- chestra for Li'l Abner and Carousel. LARRY CARLSON, VICA 11,12. LISA CARLSON, ADC 12 Chorus3 A Cappella Choir 10, Concert Choir 11,123 Lit Board 12 QSGCVGTBVY-TYEBSUFEFJQ LO'T 12, Front Page Editor3 Li'l Abner 12, Chorus3 Thespians 11, 123 Stage Crew 10,11,123 Illinois State Scholar 12: Nat'I Honor Society 11,123 Nat'I Merit Semi- finalist. MITCH CARLSON, ADC 12, Choir 10,11,12: ln- tramurals 10,11,12: Key Club 10,11,123 Li'l Abner 121 Science Club 10,11,123 Student Congress 10,11,123 Junior Class President3 Football, Wrestling, Track 10, Crosscountry, Track 11,12. PAT CARLSON, Mixed Chorus 11. SHEILA CAROTHERS, Concert Choir 123 Girls in 509 CMiss Freudj 11, Li'l Abner 12, CAp- passionataJ3 OurTown 10, Ctownspersonj. MARCELLA CARTER, ADC 12, Chorus3 Mixed Chorus 103 FNA 11,12, FTA 111 French Club 103 GAA 10,113 Pep Club 11,12, Y-Teens 10 Ccom- mittee chairmanj, 11 CTreasurerj, 12 Ccom- mittee chairman73 OO 122 Cap and Gown Com- mittee 12. MICHAEL CERVANTES, Electronics 123 lntra- mural Basketball 11,123 J.A. 11,123 Science Club 12. KATHY CHANDLER, ADC 12, A Cappella Choir, 103 Concert Choir 123 Contemporaires 11, Of- fice Occupations 12g French Club 10, How to Succeed in Business 10 Cdancerj. KEVIN CHAPMAN, Band 10,11,123 Gymnastics 11,12. MARY CHEEK, A Cappella 103 Girls' Chorus 11, 123 Debate 10. SUZY CHELSTROM, ADC 12, French Club 103 GAA 10,11,12, Gymnastics 11,123 Carousel 11 CdancerJ3 Li'l Abner 12 QdancerJ3 Science Club 123 Spanish Club 123 Y-Teens 10,11,12, Cheerleading 10,12. JAMIE CIRIVELLO, ADC 12, FTA 10,11,123 GAA 10,11,123 German Club 10,113 Pep Club 10,11, 123 Science Club 10,11,12, Anthonettes. GREG CLAEYS, ADC 121 French Club 103 Intra- mural Volleyball 12. HOWARD CLARK, ADC 123 AFS 12, French Club 10,11 CPres.j3 Hi-Y 113 lntramural Volleyball 123 Science Club 123 Up the Down Staircase 12 CDr.CIarkJ. MIKE CLARY, Gymnastics 113 VICA 12. DON CLEMONS, Intramurals 10,11, Baseball 10. STEVEN COLLINS, J.A. 103 Science Club 12. GAY COOK, ADC 12: FTA 12: GAA 10,11: Home Ec. Club 123 Pep Club 113 Y-Teens 10,11,123 H.E.R.O. 12, Tug Team 11,12. LEWIS CORELIS, Band 12. JOHN CORKERY, Hi-Y 10,11,123 Intramurals 10,11: Science Club 12, Swimming 11,12. CHERYL COX, A Cappella Choir3 GAA 10. JULIE ANN COX, ADC 12 CChorus73 Band 10,11, 123 FNA 103 GAA 103 Li'l Abner 12 CPit Or- chestraJ3 Spanish Club 10: Y-Teens 10 fTres.j, 113 Orchestra. KATHY COYNE, ADC 12 CChorusJ3 French Club 103 GAA 10, Pep Club 123 Y-Teens 10, MYF 10, 11,12 fTI'8S.JI Tug Team3 Cap and Gown Comm. 12. JOHN CROSS, Electronics 10,113 Hi-Y 103 ln- tramural Football 12: Baseball 10,121 Football 11, Wrestling 10,12. KATHERN CROWE, Home Ec. Club 123 H.E.R.O. 12. LINDA CULBERTSON, Mixed Chorus 10. JAMES CURTIS, Electronics 10,11,123 French Club 103 LO'T 11: M 11,123 Science Club 123 Stage Crew. d JOE DAEBELLIEHN, Football Manager 123 Track, Wrestling Manager 11. JANETTE DALTON, ADC 123 FTA 11: GAA 102 Tug Team 121 Spanish Club 103 MYF3 Y-Teens 10,12. CINDY DAVIS, French Club 103 Y-Teens 10, OO 12. NANCY DAVIS, DE treasurer 12: GAA 10,113 Y- Teens10,11. SUE DAVIS, ADC 12, Chorus 103 GAA 10,113 Home Ec Club 11,123 Y-Teens 103 HERO 12. KATHY DECKER, Band 103 GAA 10,11, L'OT Cir- culation 12, Science Club 11,123 SWF 103 SEA 11,12. THOMAS DEGRAEVE, Lettermen Club 10,11,12: Science Club 113 Swimming 10,11,123 J.A. 10. JAMES DEJONGHE, ADC 12: Chorus 10,11,12, FNA 10,11,123 Hi-Y 10,11,12, Swimming 10, ln- tramurals10,11,123GBU10,11,12. KAREN DELATHOWETR, FTA 10,11,123 GAA 10, 11,12 Board Member3 Science Club 12, Syncro- nized Swimming 123 Girls School Softball 10, 11,12. MARK DEMBOSKY, ADC 123 Intramurals 10,11, 121 Science 10,11,12. HARRY DEMPSEY, ADC 123 lntramural Basket- ball 11,12, Pep Club 123 Science Club 12. LINDA DEMPSEY, Chorus 113 Y-Teens 11. MARY DENATO, ADC 122 Chorus 103 French Club 113 Science Club 12., CHRIS DEPOORTER, ADC 12, AFS 12, FTA 10, 11,12: French Club 10,11, GAA 10,113 LO'T CAd- vertising 15 123 Pep Club 11,123 Spanish Club 123 National Honor Society 11,123 4-H 10,11,12. MIKE DEVOLDER, Gymnastics 12. DEDE DIETCH, DE 123 ADC 123 Spanish Club 10, Y-Teens 10. PAT DIETSCH, ADC 12. SANDRA DISMER, ADC 123 Band 10,11,123 FNA 113 GAA 10,11,12, Kaleidoscript 123 Science Club 10,11,12: Anthonette 10,11,123 MYF 10,11, 12: Pep Band 10,11,12. GARY DONOHUE, ADC 11 CMusic Committeej, 12 CScript CommitteeJ3 Band 10,11,12 CConcert BandJ3 Concert Choir 11,121 LO'T Page 4 Editor 12: Our Town CC-eorgey 103 Ten Little In- dians CAnthony Marstonj 103 Student Con- gress 12 CPresidentJ3 Thespians 10,11,12, Carousel Uigger Craiginb 112 Li'l Abner CLi'lAbnerJ12. BONNIE DOPLER, Girls Chorus 12, Home Ec Club 123 East Moline High School-Chorus 10, 113 GAA 10. CONNIE DOPLER, Chorus 10,11,123 French Club 103 GAA 103 Home Ec Club 12. GREGORY DORR, Electronics Club 11,12. CRAIG DOVE, ADC 123 Hi-Y 11, Science Club 123 Spanish Club 113 Free World Cleaderj 11, 122 Baseball 103 Up the Down Staircase 12 CJoej. RICHARD DOW, ADC 12 CChorusD3 Chorus 10, A Cappella 11,123 FTA 123 Baccalaureate Com- mittee 123 Announcements Committee 12. DIANE DRISCOLL, ADC CChorusJ 12, French Club 102 Pep Club 12, Commencement Com- mittee 123 Baccalaureate Committee 12. JENNIFER DUBERG, ADC 12 CChorusJ3 Chorus 10, A Cappella 11, Concert Choir 123 GAA 123 JA 10. BRENDA DUKE, ADC 121 GAA 10: JA 11,123 Soul Club 103 Up the Down Staircase 12 Cvivianj. LINDA DUKE, GAA 103 Intramurals 10, JA 11. BEVERLY DUNLAP, ADC 123 FTA 12: GAA 10,123 Pep Club 12, Spanish Club 10. TIM DYER, ADC 11 CCrewJ 123 Ten Little In- dians CFred Narcottj 10: Stage Crew 10,11,12. G FREDDIE EALY, JA 10,11,12. DOUG ECKER, Lettermen Club 1O,11,12Q Cross- Country 10,11,123 Track 10,11,12. KAREN EDSTROM, French Club 10: GAA 12. ROBIN EGERT, DE 12. RAYMOND EGGERS, ADC 123 Concert Choir 11,123 lntramural Football 10,11,12: Carou- sel CChorusJ 11, The Showoff 12, Knight of Burning Pestle 123 Li'I Abner CSenator Phog- boundj 12, Thespians 123 Mighty Maroon 123 Swimming 10. ELISE EIHL, ADC 123 FNA 11,12, French Club 103 GAA 1O,11,12Q Tug Team 11,123 Pep Club 113 Science Club 11,123 Ski Club 12, Y-Teens 10 Clnter-Clubb, 11,12 Clnter-club vice presidentJ3 Nereids10,11,12. SUSAN ENDERTON, ADC 123 A Cappella 10, Concert Choir 11,12, FNA 113 FTA 11,123 GAA 10,11, Pep Club 11,121 Li'I Abner CWifeD 123 Science Club 11, Spanish Club 10,11,123 Y- Teens10,11,12fSociaIChairmany. DAVE ENGSTROM, ADC 12, FNA11,123 Hi-Y 11, 122 Intramurals 10,11,123 Lettermen Club 11, 12, Science Club 11,123 Track 10,11,12, Wres- tling 10. GREG ERVIN, Science Club 10,11,12, Baseball 121 Football 11. SOTERO ESCARZA, ADC 123 Hi-Y 113 Intra- murals 1O,11,123 Lettermen Club 103 Spanish Club 10,11 CTreasurerJ, 12 qVice-presidentj. MONICA ESTERDAHL, ADC 12 CChorusb. CAROL ESTES, French Club 113 GAA 10,113 Gymnastics 10,11,12: Intramurals 11,123 Y- Teens1O,11. CYNTHIA EXBOM, ADC 12, Forensics 113 FTA 123 GAA 10,11,123 Pep Club 122 Y-Teens 10,11,12, CCD 10,11,123 Announcement Committee Co- chairmanJ3 Commencement Committee3 Bac- calaureate Committee. COLLENE EYRE, Up the Down Staircase 12. f MARK FAHLBERG, Lettermen Club 123 Wrestling 10,11,12. LINDA L. FARRIS, Band 10,113 GAA 10,113 Home Ec Club 10,113 HERO 12. JAMES FECHT,VlCA 12 KENT FERRIS, Lettermen Club 11,12: Wrestling Cmanagerj 1O,11,12I Baseball 10,11,12. RICK FIFER, A Cappella 10,11, Concert Choir 123 DE 113 Spanish Club 10. DEBRA FILE, DE 12, GAA 10,11, Intramurals 10, 11. BONNIE FINCH, HERO 12. TERRY FISCHER, ADC 12. CYNDEE FISHER, JA 102 Library Club 10. DIANE FISHER, Band 10,113 Nereids12gOO 12. CHRISTINA FLAKE, ADC Cchorusj 122 FNA 11, 12: GAA 103 TUG Team 11,12, Pep Club 113 Sci- ence Club 121 Spanish Club 10,113 Y-Teens 10,11,12. DEBBIE FLYNN, ADC CChorusJ 123 FNA 11,123 French 10, GAA 103 Tug Team 11,12, Pep Club 11, Science Club 103 Spanish Club 113 Y-Teens 10,11,12 Csecretaryll Nurse's helper 12. SHELLI FORSHEE, ADC 12 Chorus: Art Club 12, Library Club 10. JERRY FOSBINDER, Intramurals 10,113 Letter- men Club 122 Football 10,11,123 Baseball 10. JEFF FOSS, ADC 123 Baseball 10. JIM FOSTER, ADC 12. JIM FRANCIS, ADC 123 Intramurals 10, Pep Club 122 Science Club 10,11,12: Spanish Club 11,12. SARAH FRANCIS, DE 123 French Club 10,113 KaIeidoscriptCSalesD 12, Pep Club 11. DARRYL FRANKLIN, ADC 123 Band 10,11,123 ln- tramurals 11,123 How To Succeed CPit or- chestrab10. STEVEN FRANKS, Football 11,12. DENNIS FRETTY, DE 123 Chorus 10. ANN FRIESTH, ADC 123 Chorus 1O,11,12Q GAA 102 Home Ec Club 10,11,12 Cpresidentj Pep Club 113 Knight of Burning Pestle , Li'l Ab- ner CCostumesJ3 4-H Nice-presidentj 123 Hi- League1O,11,12. KATHY FULLER, Chorus 10, Electronics Club 123 GAA 11, Library Club 10,11 fSecretaryJ3 Tug Team 11. ANDREW FUNK, ADC 123 Intramurals 10,11 CChampJ,123Lettermen Club 11,12. 8 CHERYL GAGHAGEN, French Club 10,11,12: Y-Teens 10. 277 RODNEY GANN, French Club 113 Science Club 11,123 Track 11. CHRIS GANTZ, Electronics 123 Spanish Club 10. RICK GARNER, Band 10, Science Club-123 VICA 12tTres.J. IRENE GARZA, Pep Club 103 Spanish Club 10, 11,12. LAURIE GATES, ADC 12 QCDOYUSDQ Art Club 10,11,12 CSec.-Tres.D3 GAA 103 Kaleidoscript 11,12 CArt Co-Editorjg Science Club 12. KATHY GATZ, ADC 12, Choir 103 Contempo- raires 11,12, French Club 10,11,123 GAA 10,123 Pep Club 11. BILL GERARD, ADC 121 Choir 10, FNA 123 Hi-Y 113Intramurals1O,11,123Lettermen's Club 123 Football 10,11,123 Track 10,11,12. GLENDEEN GIDEL, GAA 10,11,123 Gymnastics 11,121 Pep Club 103 Spanish 103 Y-Teens 103 Cheerleading 10. SANDY GLAUS, Office Occupations 12 CPres.J3 Nat'l Honor Society 11,12. DEB GLEIZE, ADC 123 French Club 103 Kaleido- script 11,123 Science Club 123 TAC 11,123 Y- Teens 10. JOHN GLENN, D.O. 12. SHERRI GLIMPSE, FTA 123 GAA 103 Y-Teens 11. NANCY GOEBEL, ADC 12 CCDOTUSJQ GAA 10,11,12 CBoard Mernberj CPres.J3 Pep Club 123 Spanish Club 10: Student Congress 123 Y-Teens 10,11. DEANNA GOETZ ADC 123 Concert Choir 123 GAA 10,11,12: Gymnastics 12, Li'l Abner 12 fDaisy M8952 Spanish Club 10,11,123 District Chorus 123 Nat'l Society 11,121 Spanish Honor Society 10,111 State Music Contest Participant. LAURA GOLD, Y-Teens 10. ED GOODDALE, ADC 12 CChorusj3 A Cappella Choir 102 Concert Choir 11,123 LO'T 12 CSports Editorjg Li'l Abner 12 fChorusJ CUnsociabIe Scraggjg Stage Crew 113 Props 11,12. RUTH GORDON, ADC 12 fChorusJ, Art Club 10,11,12 CVice-Pres.J3 M 12 CArt and Index Editorj, Science Club 11,123 Nat'l Honor So- ciety 11,123 Allerton Art Award Winner 113 Tug Team 12, SEA 11. MARCIA GOUVERNEUR, ADC 123 Choir 10, GAA 101 Home Ec. Club 101 Pep Club 10, Fu- ture Nurses 10. BARBARA GRAMKOW, French 103 GAA 10. KRISTINA GREEN, ADC 12 CCDOFUSDQ FTA 12, GAA 10,11,123 Pep Club 111 Spanish Club 102 Y-Teens10,11. DEBORAH GRIFFIN, ADC 12: Band 10,11,12: FTA 125 GAA 10,123 Pep Club 12, Spanish Club Y- Teens 10,11,12, Tug Team 11,123 MYF 10,11 fSec.J, 12 fProgram Chairmanj. BECKYGRIMES, Home Ec. Club 123 J.A. 12. BRUCE GROSS, Singout Quad Cities fdrummerjg Up With People Cdrummerj. DEE DEE GUINN, ADC 12, Mixed Chorus 10, FNA 11,123 FTA 11, GAA Club 123 Tug Team 123 Young Life 12. JAMES GUY, ADC 12: Band 11,12: Li'I Abner 12 fPit Orchestrabg Science Club 113 Orchestra 11,123 Glendale, Wisc.-Band 102 A Cappella Choir 10,111 Debate 10,113 Swim Team 11, Cross Country 10,113 Orchestra 103 Nat'l Honor Society 11,12. 10,11,123 German Y-Teens 10,11,123 h DAN HADDOCK, ADC 121 Band 103 Electronics 10,11,123 Orchestra 11,12? Dance Band 10,11, 12, Pit Orchestra 1O,12. CAROLINE HAGBERG, ADC 12 fChOI'USDQ Concert and Pep Band 10,11,123 GAA 10,113 M 12 CUndercIassmen Editorl3 Science Club 10,11,12. LAURA HALLQUIST, ADC 121 AFS 123 A Cap- pella Choir 10, French Club 10,11,12, GAA 10, 11,12: M 12 CAdvertising EditorJ3 Pep Club 278 10,11,12 fPI'6S.Dj MYF 10,11,12 CPres. and Tl'GS.JQ Homecoming Honorable Mention 123 Nat'l Honor Society 11,12. RON HANAVAN, ADC 12 QCo-chairmanbz FNA 12, Intramural Basketball and Volleyball 123 Li'l Abner 12 fMuscIe Many Science Club 11,123 Student Congress 123 Senior Class President3 Tennis 10,11,123 Mighty Maroon 123 Third Homecoming Attendant 12. MICHAEL HANCKS, Intramurals 10,11,123 Let- termen's Club 11,122 Baseball 11,121 Track 103 Football 10,11,12. KATHRYN HANK, Nereids 11,123 French Club 10,112 GAA 1O,12, Lit. Board 123 M 12 CCo- EditorJ3 Pep Club 10,113 Stage Crew 103 Sci- ence Club 113 Y-Teens 10,111 Kings Daughters. CINDY HANSEN, ADC 12 CChorusJ3 Mixed Cho- rus 103 GAA 103 Stage Crew 113 Y-Teens 103 Office Occupations. EVELYN HANSON, ADC 12, Choir 103 GAA 103 Home Ec. Club 12. PAT HARDI, GAA Archery and Bowling 12, TIM HARDI, Intramural Basketball 11,12. SUE HARRAH, ADC 123 Mixed Chorus 103 A Cappella Choir 113 Y-Teens 10,11,12. EMILY HARRIS, Contemporaires 123 French Club 103 J.A. 103 SEA 123 Junior Red Cross 11, 12. JUNE HARRIS, GAA 103 Intramurals 103 J.A. 10,113 Y-Teens 10,113 0.0. Club CTres.b3 Soul Club. MARI HARRIS, ADC 12 CCo-chairmanJ3 Concert Choir 11,123 Tug Team 11,123 J.A. 11, Li'l Abner 12 CChorusD3 Y-Teens 10 CVice-Pres.J, 123 Third Homecoming Attendant 121 Senior Class Vice-Presidentg Up the Down Staircase 12fCarrieJ. SCOTT HARRIS, AFS Student 11: Key Club 10, 11,123 Lettermen's Club 10,11,123 Science Club 10,11,123 Swimming 10 CMost Valuable Soph- omorej, 11,121 Nat'I Honor Society 11. DAVID HARSHA, ADC 12, FNA 11,123 Letter- men's Club 1O,11,12Q MYF CVice-Pres.D3 Science Club 123 Football 10,11,123 Basketball 10,11,123 Track 10,11,12. JAN HARWOOD, ADC 12 CScript Committeey GAA 103 Tug Team 113 Pep Club 10,113 Curi- ous Savage 11 KNUFSGJQ Spanish Club 113 Y- Teens1O,11,12. BEVERLY HASTY, ADC 12, FNA 113 FTA 11,123 GAA 1O,11,123Y-Teens10,11,12. STEVE HARTZELL, Science Club 10,11,123 Foot- ball 10 fManagerJ. RICK HARVEY, ADC 12 CChorusJ3 Gymnastics 10,123 Intramurals 10,113 Spanish Club 103 Track 10,11. RODNEY HAWK, Band 10,11,123 VICA 123 Wres- tling 10,11. SANDRA HAWKINS, Office Occupations 12. BOB HAYWOOD, ADC 123 Intramural Football 123 Allied Health 123 Track 10,113 Cross Country 10,11. PAT HEALY ADC 123 FNA 123 Intramurals 123 Y-Teens 10,123 Young Life 12. PAUL HEATER, ADC 12 CChorusJ3 FTA 12, Sci- ence Club lly Office Occupations Club 123 Bac- calaureate Committee 12g Senior Announce- ments 12. KRISTI HENDERSHOT, GAA 10,113 Library 103 Pep Club 10. PAM HENDERSON, Turner's Gymnastics3 Home Ec. Club 10,122 Hospital meetings. JANICE HENDERSON, GAA 123 Gymnastics 113 Home Ec. Club 10,11,123 Intramurals 11,12. GRETEL HENGST, A Cappella Choir 10. CATHY HENNINGER, ADC 12, FNA 113 French Club 113 GAA 10,123 Pep Club 103 Science Club 10,11,12, Anthonettes3 Folk Group for YFC. GAYLE HENSLEY, Concert Choir, Forensics 11, 123 FTA 10,11,123 GAA 10,113 Kaleidoscript CCO-Editorbp Lit. Board 123 Pep Club 113 Ladies in Retirement 11 fthe nunJ3 The Knight of the Burning Pestle 12 fthe wifeJ3 Thespians 11, 12. WENDY HENSS, A Cappella 10 and Concert 11,12: Contemporaires 12 Choir 11,12: FNA CVice-Presb: LO'T 12 CPage 13 C Times Demo- crat correspondantjg Student Congress 10 CSec.D, 11,123 Musicals 10,11,12 CDancerJ3 Jun- ior Marshal Ili First Attendant to Homecom- ing Queen 12, Chairman of School Festival 12. KAREN HEPNER, Art Club 11,12. CHRIS HICKS, German 10. JEAN HILL, D.E. 12. DAVE HISLER, ADC 123 FNA 10,11,12, Hi-Y 10,11,123 Intramurals 10,11,12 Key Club 11,121 Student Congress 10,11,123 GBU 11,123 Track 103 Football 103 Wrestling 10. DEBBIE HODGSON,H.E.R.O.12. GEARLDINE HOLLAND, ADC 12: Mixed Chorus 103 GirI's Choir 11,12. ROBERT HOLLIDAY, Track 101 Wrestling 12. TOM HONSA, ADC 123 FNA 11,123 Hi-Y 10,11, 12 CSgt. at Armsjg Intramurals 123 Science Club 10: GBU 11,12: Football 10,11. TIM HOOGHEEM, ADC 123 FNA 11,123 Hi-Y 113 Intramurals 123 Key Club 10,11,12 CSec.J3 Sci- enceClub 1O,11,12CPres.J3 Swimming 10. BARBARA HOWARD, ADC 12 tChorusj3 Choir 103 FNA 11,123 GAA 103 Up the Down Staircase 12 CFrancesJ. WILLIAM HOYT, ADC 123 French Club 10: Hi-Y 11,123ScienceClub123Spanish Club11. DAWN HOYT, ADC 11,123 Art Club 10,11,12: Forensics 113 French Club 10,113 Kaleido- script 11,123 Curious Savage 11 tFairy MBGDQ contest play Mary of Scotland 11 fQuuen Maryli Li'l Abner 12 CMoonbeam Mc- Swinel: Up the Down Staircase 12 fSylvia BarretJ3Thespians11,12. MARTHA HUDSON, French Club 10,11,123 GAA 10,11,123 LO'T 12 CBusiness Managerj3 Nat'l Honor Societyg Campus Life Club 10,11,12. JEAN HUFFORD, ADC 123 A Cappella Choir 103 Concert Choir 113 FNA 113 GAA 103 M 12 CSubscriptiony3 Spanish Club 10,11,123 Y-Teens 103 Tennis 10,11,12. PATRICA HULL, ADC 123 FTA 103 French Club 113 GAA 103 Pep Club 10. LYNN HUMPHREY, FNA 11,123 GAA 10,11,123 Gymnastics 10,11,12, Student Congress 11,123 Y-Teens 10,11,123 Nereids 10,11,123 Postals 10,11,123 Senior Class Treasurer, Fourth Homecoming Attendant 123 Cheerleader 10, 11,12. RICK HUNT, Wrestling Manager 10,11. BILL HUNTLEY, Mixed Chorus 10,113 D.E. 12, Electronics 123 VICA 12. i JEFF IMPENS, ADC 123 Hi-Y 113 Science Club 12, Football 103 Wrestling 10,11,12. DEBORAH INGRAM, Band 10,11,12. CYNTHIA IRWIN, ADC 12, J.A. 10,11. I LAURIE JAMISON, ADC 12 CChorusJ3 Art Club 123 Forensics 11, FNA 11 Cvolunteery, 123 French Club 103 GAA 10,122 Kaleidoscript 12 fArt Staffjg LO'T 12 CAdvertisingJ. SUSAN JAUHOLA, ADC 12 CChorusJ3 Art Club 11,123 LO'T 12 CPage One Ed.J3 Science Club 1O,11,123WFY1O,11. SHARON JENNISCH, ADC 12 CChorusJ3 Home Ec. Club 12. BECKY JENSEN, ADC 123 FNA 10,113 FTA 11,123 GAA 10,11,12: Pep Club 12, Y-Teens 10,11 CBoard Memberj, 12. BRIAN JOHNSON, ADC 12 CChorusJ3 AFS 12, FNA 12: French 10,11: Hi-Y 10: M 12 iPho- I tographerJ3 Science Club 11,123 Ski Club 11. CHARLES JOHNSON, Electronics 11. CRAIG JOHNSON, Science Club 12. MICHAEL K. JOHNSON, Intramurals 123 VICA 12. MIKE JOHNSON, ADC 123 FNA 11,12: Hi-Y 11, 12: lntramurals10,11,123 Key Club 10,11,12. MARK JOHNSON, Mixed Chorus 103 D.E. 11,12. DAVID JOHNSON, FNA 123 Intramural Basket- ball 123 Wrestling 12, Nat'l Honor Society 11,12. PATTI JONES, GAA 10,11,123 VICA 12, Y-Teens 10,11,12. k PATRICIA KABLE,H.E.R.O.12. MIKE KURLIH, ADC 123 AFS 102 Band 113 Choir 121 Contemporaires 102 Gymnastics 10,11,12. DALE KEELER, Intramural Basketball 10,11,12: Lettermen's Club 123 Football 10,11,123 Baseball 113 Basketball 10,11. GUY KEELEY, Art Club 123 Band 10,113 SDS, Quad City Student Union3 Up the Down Stair- case 12 qLouJ. VICKIE KEENAN, Electronics 12: GAA 10,11,12. RANDY KELLEY, Electronics 11, Intramural Basketball 10,11,12, Lettermen's Club 11,123 Cross Country 11,123 Track 10,11,12. LEE KENDALL, ADC 11, Dance Band 112 Spanish Club 1O,11,12Q Pep and Marching Band 10,11,12. JUDY KENNEDY, Mixed Chorus 10. JIM KERCKHOVE, Hi-Y 111 Spanish 10. MICHAEL KETTERING, ADC 123 Intramurals 10,11, Lettermen's Club 11,123 Swimming 10, 11,12. DEBBIE KIEHR, ADC 12 CChorusJ3 FTA 123 GAA 10,11,12 CBoard MemberJ3 Pep Club 103 Senior Announcement Comm. 123 Baccalaureate Comm. 123 Commencement Comm. 123 Luther League3 Tug Team. LINDA KING, Mixed Chorus 101 Y-Teens 10, 0.0. 12. GLENN KlNKEAD,lntramurals10. JOHN KIPPING, Hi-Y 11,123 Intramurals 10, 11,123 Baseball 10,11,123 Basketball 10. BARBARAKIRCHOEFER, FTA 123 Kaleidoscript 123 Pep Club 11,122 Nat'l Honor Society 11,12, Church Youth League 10,11,12 CSec.J Nice- Presb. DAVE KIZER, Art Club 12. DAVY KLANN, Contemporaires 112 D.E. 111 Electronics 122 French 103 Hi-Y 112 Intramurals 11,122 Library 10. DOREEN KORESKO, ADC 12 QChorusI3 FNA 113 GAA 10,11,h12 CRecording Secretarybl M 12 CGirl's Sports Ed.b3 Luther League QPres.J3 Nat'I Honor Society 11,12. HAROLD KOSTKA, ADC 123 Concert Choir 10, 11,12. NANCY KNITTLE, GAA Archery 11,123 H.E.R.O. 12. SUE KNOCK, A Cappella Choir 10,11, D.E. 123 Y-Teens11. CINDY KNUDSON, Office Occupations. LYNDA KREBS, Girls' Intramural Baseball and Bowling 10,11, Football 11, Hockey 10. BOB KRUEGER, ADC 12: Band 10,11,123 Student Union3 SDS. CINDY KRUSE, Choir 103 Contemporaires 11, 123 GAA 102 Intramurals 103 Y-Teens 10 Clnner Clubj, 11, Nereids 10,11,12, Stage Crew 10. KRISTINE KRUSE, Library 103 Spanish Club 11. MICHELE KRUSE, ADC 12 fChorusJ3 GAA 10,11, 12 CBoard MemberJ3 M 12 CStudent Life and Organizations EditorJ3 Pep Club 11,123 Spanish Club 10,111 Student Congress 123 Swimming Timer 10,11,123 Nereids 10,11,123 Kings Daughters 10,11 fTres.J, 123 Luther League 10,11,12. KRIS KUEHL, Band 10,11,123 FTA 123 GAA 102 How to Succeed in Business 10 CPit Orches- tray, Li'l Abner 12 CPit OrchestraJ3 Science Club 112 MYF 10,11,123 Dance Band 10,11,123 Anthonettes10,11,12. ROY LACKEY, Electronics 12 CVice5Pres.Q3 D.O. 12. DENNIS LAMBERT, Mixed Chorus 103 German Club 113 Science Club 123 Air Scouts 11,12, Quad City Skin Diving Club 11,121 Church Basketball. LOIS LANDUIT, ADC 12, Home Ec. Club 12. GARY LARSON, Hi-Y 113 Intramurals 11, Let- termen's Club 123 Ski Club 11. LARINDA LARSON, Mixed Chorus 101 GAA 10,11, Gymnastics 10,111 Home Ec. Club 10,113 VICA 12 CTres.Q3 Tug Team 11. STEPHEN LAVIN, Intramural Basketball 11: Lettermen's Club 11,12. PACKIE LAWRENCE, Intramural Football 12, Lettermen's Club 11,123 Spanish Club 12, Stu- dent Congress 12, Basketball 10,11,12, Track 10. BOB LEAF ADC 123 FNA 11,123 French Club 10, Hi-Y 11,12 CPres.J3 Key Club 123 Student Con- gress 11,12. MARGO LECOMTE, ADC 12 CChorusj WILLIAM LEE, Intramural Basketball 12 and Football 102 SEA. SALLY LEECH, Art Club 11,123 Stage Crew 11, 12. JILL LEMASTER, ADC 12: Concert Choir 10,11, 12: FNA 11,123 GAA 102 German Club 10,11,123 Intramurals 103 Science Club 12. DONNA LERSCHEN, GAA 102 Spanish Club 10,11. DAVID LESTER, ADC 12 CChorusJ3 A Cappella Choir 103 Concert Choir 11,122 FNA 11,123 ln- tramural Football 10,11,12, and Basketball 123 Lettermen's Club 12: Science Club 12. FRANCIS LESTER, Orchestra 10,11,12. MARCIA LEWIS, ADC 12: FNA 11,12, Gym- nastics 11,123 Student Congress 10,11,123 Y- Teens 10 CPres.5, 11,12 Clnter-ClubJ3 Junior Class Secretaryg Cheerleading 10,11,123 Soph- omore Homecoming Attendant3 Junior Home- coming Attendantg Homecoming Queen 12. MARK LEWIS, ADC 12Q FNA 11,12: Hi-Y 10,11, 123 Lettermen's Club 103 Science Club 10,11,123 Student Congress 103 Basketball 10. BARBARA LIBEY, ADC 123 AFS 123 FTA 113 GAA 113 Gymnastics 123 Pep Club 10,11,12 CChair- many, Tug Team 11,121 Musicals 11,12 CDan- cerb3 Science Club 123 Y-Teens 11,12. SALLY LILJEBERG, ADC 121 GAA 103 Y-Teens 10, Cheerleading 10. MARY JANE LINDQUIST, Office Occupations Club 12. BOB LONGMIRE, ADC 12, German Club 101 Key Club 10,11,123 Science Club 11,122 Lettermen's Club 10,11,123 Ski Club 113 Swimming 10,11, 12. BEN LOPEZ, Lettermen's Club 11,123 Football 10,11,123 Wrestling 10,11,123 Track 10. ROSA LOPEZ, French Club 103 GAA 10,11,12. GAYLE LOPEZ, ADC 12 CChorusJ3 GAA 10,11, 123 Pep Club 123 Spanish Club 11,121 Y-Teens 11. ROGER LUNDAHL, ADC 12, FNA 11,122 Hi-Y 10,11,123 Intramurals 10,11,123 Key Club 10, 11,12QGBU 10,11,12,GOIf 10. DANIEL LUNDEEN, ADC 122 Intramurals 123 Science Club 10,11,123 Nat'l Honor Society 11,12. RICK LYNCH, Band 10,11,123 Gymnastics 121 Intramural Basketball 123 Golf 12. l'TI KATHY MALMSTEAD, Concert Choir. GENE MANNING, D.E. 123 Gymnastics 123 Biol- ogy Club 10. LARRY MARKIN, Intramurals 11,121 Letter- men's Club 11,122 Track 10,11,123 Cross Country 10,11,12. MARCI MAROON, ADC 12, Band 10,11,123 D.E. 121 French Club 103 GAA 11. MARY MARTENS, ADC 12, Band 10,11,12, Knight ofthe Burning Pestle 12 1Orchestrab3 Carousel 11 QOVCTIGSTVBDQ Science Club 123 Young Life 123 Orchestra 11,123 Tug Team 11, 12. LARRY MARTINEZ ADC 122 Art Club 123 Elec- tronics 11,12, FNA 123 French Club 123 German Club 123 Intramural Football and Basketball 123 Library 10,11,123 Lettermen's Club 10,113 Pep Club 12. JIM MASON, Electronics 12 CTres.J3 Tennis3 East Peoria Comm. High-Radio Club 11 CPres.J3 Stage Crew 113 Yearbook and Paper 11 CPhotographerJ. MIKE MASSEY, French Club 10. JACKIE MATHIAS, German Club 102 National Honor Society 11,123 Orchestra 10,11,12 CPresidentj. KATHY MATTER, ADC 12 QCIIOYUSDQ FNA 11,12: German Club 10,11. SUSAN MATTERS, ADC 122 Kaleidoscript 123VICA12. GARY McCAlN,VlCA12. GEORGE MCCLEAN, ADC 123 Hi-Y 10,11,123 In- tramurals 12, Football 10. PATTY McCLELLAND, ADC 12 CCIIOTUSDQ FNA 123 GAA 123 Pep Club 123 D.O. 11. DON MCCLUNG, Science Club 12. BOB McCOY, Swimming 10,11. RICKY McDANEL, Mixed Chorus 103 Demolay. DONNA McDONALD, Tug Team, Usher for Play 12. KEVIN MCFARLAND, Electronics 11,12. BARBARA McHENRY, Home Ec. Club 10,11,123 J.A. 11,123 Pep Club 123 Student Congress 10,122 Y-Teens 10,11,12. CHRIS MclNTlRE, ADC 123 Y-Teens 10. PATTI McKEAN, ADC 12 CChorusQ3 A Cappella Choir 10,113 Concert Choir 12, FTA 11,123 GAA 10,11,123 Pep Club 11,12: Science Club 12: Spanish Club 10. KEVIN McKEE, Band 103 German Club 11: Sci- ence Club 11,12, Exploring 10,11,12. PAUL McKlNLEY, Intramural Football 123 Let- termen's Club 10,11,12. DIANA McNEELY, H.E.R.O. Club 12 CSec.J. GREG McNElLL, Intramurals 11,122 Basketball 10,113 Baseball 10,11. AMY MEERSMAN, ADC 122 Mixed Chorus 10Q FNA 12: Gymnastics 11,123 Student Congress 1O,113Y-Teens 10,11. RICK MEREDITH, ADC 123 A Cappella Choir 10,11,123 French Club 1OQ Intramural Basket- ball 10,12, and Volleyball 123' Li'l Abner 123 Up the Down Staircase 121 Baseball 10. LORI MESSMER, ADC 122 Art Club 123 Foren- sics 113 FTA 11,12: GAA 10,123 KaIeidoscript 12, LO'T 123 Y-Teens 103 Nat'I Honor Society 11,12. SARAH METZ, ADC 123 Art Club 10,11,123 Con- temporaires 11,12 CPres,I3 How to Succeed in Business 10 CDancerD3 John Deere Post Art Club 11,12. LINDA MEYERS, Mixed Chorus 10,11, FTA 10. DALE MlLEFCHlK,VlCA12. STAN MlLJUSH,D.E.12. CONNIE MILLER, Pleasant Valley High School- lntramural Basketball 10,113 Pep Clubg Aria De Capo CShepardessJ3 Taming of the Shrew CGremio73 musical CCuban Dancer93 Drama Clubg Thespians. DOREEN MILLER, Concert Choir 103 GAA 103 Y-Teens 11. KATHY MILLER, Mixed Chorus 103 Girls' Cho- rus 123 Campus Life. JIM MILLER, ADC 12 CScript Comm.D: German 279 Club 103 Key Club 10,11,123 Lit. Board 12 CPres.j3 LO'T 12 CManaging Ed.l3 Science Club 103 Nat'l Honor Society 11,12. MIKE MILLER, Choir 103 Intramurals 11,123 Key Club 10,11,123 Spanish Club 113 Knight of the Burning Pestle 12 CGeorgeJ. MICHAEL MILLER, ADC 123 Intramural Basket- ball 11,12, and Volleyball 123 Lettermen's Club 11,123 Science Club 12, Football 10,11,123 National Honor Society 11,123 All Metro Con- ference 11, SUE MILROY, ADC 123 FNA 121 French Club 10,113 GAA 10,11,123 Pep club 11,123 Gymnas- tics 11,123 Cheerleading 123 MYF 10,11,12 CSec.D. JIM MISFELDT, SEA 11,12. SANDEE MITCHELL, ADC 12: FNA 123 FTA 12, GAA 10,11,123 Spanish Club 11, Pep Club 11,122 Y-Teens 10,11,123 Gymnastics 12. CHRISTINE MOORE, ADC 12 CChorusj3 AFS 11 fExchange Student to Germanyj, 12 CChair- many, A Cappella Choir 10: Concert Choir 11, 123 French Club 10,113 M 12 CFine Arts Ed.J3 Carousel 11 CChorusJ3 Li'I Abner 12 CCho- VUSDQ Curious Savage 11 qFlorenceJ3 Science Club 123 Thespians 11,12. ALLEN MONROE, Gymnastics 10,11,12. BILL MONTAGUE, ADC 123 German Club 103 ln- tramurals 1O,12Q Science Club 10,11,12. THOMAS MOODY,VlCA12. JANET MORAN, ADC 12 CChorusJ3 A Cappella Choir 101 Concert Choir 112 D.E. 12 CDist. Tres.J3 GAA 11. PAMELA MORLING, ADC 12: Lit. Board 123 M 12 CCO-EditorJ3 Nat'l Honor Society 11,12. STEVEN MOROSS, Electronics 11,12. LAURA MOUNTAIN, ADC 123 Choir 10: Con- temporaires 122 FNA 123 GAA 103 French Club 103 Pep Club 11,122 Science Club 12. SUE MULDOON, GAA 10. JIM MULLARKEY, Rifle Club 11. VALERIE MULLARKEY, ADC 121 Choir 10,11,123 FNA 123 GAA 122 Pep Club 11,123 Li'l Abner 12 fChorusD3 Science Club 12. JEFF MURDOCK, ADC 122 Band 10,11,12Q Ka- leidoscript 12 QCo-EditorJ3 Lit. Board 123 M 113 Li'l Abner 12 CMayor Dogmeatjg Knight of the Burning Pestle 12 CCitizenJ3 Science Club 10,11,123 Pep Band. I'I THERESA NAVARRO, Concert Choir 10,11, GAA 103 Home Ec. Club 12: Spanish Club 102 Office Occupations. DAVID NEIGHBOUR, ADC 12 CChoirJ3 Concert Choir 11,123 A Cappella Choir 101 FNA 11,123 French Club 10,11,123 Intramural Basketball and Volleyball 123 Knight of the Burning Pes- tle 12 CHumphr6yD3 Li'I Abner 122 Thespians 12, Carousel 11 CChorusb3 One Night of Mel- ody 10,11,12. CHRIS NELSON, A Cappella Choir 10. DICK NELSON, ADC 10,11,12 flights, pinrail, CTEWDQ J.A. 103 M 81 LO'T 11,12 CPhotog- rapherJ3 Ten'LittIe Indians 10 CRodgersb3 Plays and Musicals 10,11,12 CLightsJ3 Thespi- ans 10,11,123 Stage Crew. ERIC NELSON, ADC 12 CChorusb3 A Cappella Choir3 Intramural Football and Basketball 123 Key Club 10,11 qVice-Pres.l, 12 CPres.J3 Sci- ence Club 123 Student Congress 10,11 fTres.J, 12 QVice-Pres.J3 Football IOQ Baseball 10,11,123 American Legion Baseball 10,11,123 Illinois State Scholar 12. RANDALL NELSON, ADC 123 FNA 10,11,123 French Club 103 Hi-Y 10,11,12, Intramurals 10,11,123 Key Club 10,11,123 Lettermen's Club 121 Science Club 12, GBU 10,11,123 Tennis 10, 11,12. RICHARD NELSON, ADC 123 FNA 11,121 Hi-Y 11 CSec.J, 12 fSec.j3 Intramurals 10,11,123 Stu- 280 dent Congress 10,113 Homecoming Attendant 10,113 First Homecoming Attendant 121 Foot- ball 103 Wrestling 103 Track 10. TERRY NEWBERRY, Band 103 J.A. 10. MICHAEL NEWELL, ADC 123 FNA 11,123 Hi-Y 10,11,12Q Intramurals 10,11,123 J.A. 123 Letter- men's Club 103 Science Club 10,11,12, Golf 11,12, Track 10,11,12, Student Congress 10,1 1. STEVE NORDQUIST, Gymnastics 11, Intra- mural Basketball 12. RICK NORLIN, German Club 10,11,123 Letter- men's Club 11,123 Science Club 10,113 Trainer 10,11,12. PAM NORRIS, Mixed Chorus 101 Pep Club 12. O KATHIE O'DONNELL, GAA 10,11, Y-Teens 10,11. MARK OHLSEN, ADC 11,123 Band 1O,11,l2Q FNA 11,123 FTA 103 Intramural Basketball, Football, and Volleyball 121 Spanish Club 102 Basketball 10,113 Golf 10,11,123 Dance Band 10,11,12. KATHY OLBERTS, ADC 123 FTA 11,123 French Club 10,112 GAA 10,11,123 Gymnastics 11,123 M 12 fAdvertisinSD3 Pep Club 11,123 Science Club 123 Girls Tennis 10,11,12. CAROLYN OLSON, ADC 121 FNA 123 GAA 10,11, 122 Tug Team 11,123 Pep Club 10,11,123 Span- ish Club 10: Y-Teens 1O,11,12I Cap and Gown Committee 12. DEBBIE OLSON, ADC 121ChorusJ3 French Club 10,113 GAA 103 M 12 CBusiness ManagerJ3 Pep Club 11,123 Student Congress 10,11,123 Tennis 10,11,12: Swim Timer 123 Young Life 123 Kings Daughters 11,12. REBECCA OLSON, ADC 12, A Cappella Choir 102 Concert Choir 11,123 Li'l Abner 12 CChorus and Head of Costuming13 One Night of Mel- ody 11,12. MIKE ONTIVEROS, A Cappella Choir 10, Con- cert Choir 113 French Club 10,113 Spanish Club 12. LINDA OPPENHEIMER, ADC 12 fChorusJ3 French Club 10,11 CRSDJJ GAA 10,11,123 Postal State Champs 10,113 Pep Club 11,12 CMembership ChairmanJ3 Y-Teens 11: Nereids 10,11 CJr. Mgr.J, 12 CSr. Mgr.J3 M 12 CCopy Ed.J3 Tennis 10,113 TugTeam 11,12. PAM OREY, ADC 12 CChorusb3 FTA 12Q GAA 123 Announcement Comm. 123 Baccalaureate Comm. 123 Commencement Comm. 123 CYC's. DON OSTRAND,VlCA12. CINDY OTTS, ADC 12 fChorusb3 GAA 10,11. RUSSANNE OWEN, Rock Island High School- Camera Club. SHELIE OWENS, C.W.T. P MARK PADESKY, Hi-Y 11, Lettermen's Club 11,121 Science Club 113 Spanish Club 103 C.C.D. 10,11,123 Cross Country 10,11,123 Track 10,11, 122 Summer Track Club 11,12. PATRICIA PAGE, Electronics 12, GAA 12. SHEILA PALMER, Band 10,11,123 Home Ec. Club 12. JOHN PARISH, Intramural Basketball 12: Bas- ketball 10. ENA PARKER, GAA 103 Home Ec. Club 12, J.A. 10 CSec.J3 Library 10. PAM PARKER, ADC 12 CChorusJ3 FNA 123 Intra- murals 10,11,12Q Y-Teens 10,11,12. MICHAEL PARMENTIER, Wrestling Manager 10. DIANNE PASSINI, ADC 12: French Club 103 GAA 10,11,12, Pep Club 10,113 Tug Team 11,12. CHARLES PEARSON, ADC 12 fChorusJ3 FNA 123 French Club 103 Hi-Y 11,123 Intramural Volleyball 123 Spanish Club 11. DEBBIE PEARSON, ADC 12, Contemporaires 11, 12, GAA 123 Pep Club 11,123 Y-Teens 10,11,123 One Night of Melody fContemporairesl. DOUG PERSON, French 112 Lettermen 11,122 UM 12 CPhotographerJ3 Basketball Mgr. 10,113 Track Trainer 11,123 Basketball and Football ,Trainer12. DEBI PETERSON, ADC 12 fChorusJ3 FNA 11,123 FTA 11, French Club 103 GAA 10.12, Tug Team 11,123 Science Club 102 Y-Teens 10,11,12 CTres.j3 Nereids 122 Postal Bowling and Swim- ming. MARK PETERSON, Intramural Football 12, and Basketball 10,11,12: Science Club 12. TED PETERSON, ADC 123 Intramurals 10,123 Lettermen's Club 10,11,123 Science Club 123 Ski Club 113 Football 123 Track 10. ANN PETTIT, ADC 12 QChorusJ3 Mixed Chorus 103 FTA 12 CTres.J3 French Club 10,112 Lit. Board 123 1'LO'T 12 CPage ThreeJ'3' Pep Club 11: Stage Crew 113 Science Club 10,11,123 Nat'l Honor Society 11, ALAN PILICHOWSKI, Football 11,12. RANDY POHANZ, Gymnastics 11,123 Hi-Y 111 Track 10. KATHY PORTER, A Cappella Choir 103 Concert Choir 11,122 Y-Teens 10, Office Occupations Club 12. LORI POSATERI, ADC 12 CChorusJ3 Intramurals 1O,113JA10,113Y-Teens11,12. BRUCE POWELL, VICA 12. JANE POWELL, ADC 122 AFS 12, Concert Choir 11,123 FTA 122 French Club 10,11,12Q GAA 103 M 12 CFaculty Editory Li'l Abner 12 CCho- rusJ3 Science Club 123 Nat'l Honor Society 11, 12. PENNY POWELL, ADC 12 fChorusJ3 French Club 10,11,123 Kaleidoscript 12 CAss't. Busi- ness and Advertising Mgr.53 Pep Club 113 Our Town 10 CScriptJ3 Campus Life 11,123 Sr. High BYF10,11CSec.-Tres.J, 12 COrganizerJ. SUE POWERS, ADC 123 A Cappella Choir 103 Concert Choir 11,123 Contemporaires 11,121 French Club 113 GAA 10,11,123 Musicals 11,12 CDancerJ3Y-Teens10,113Nereids10,11,12. GEORGE PROSSER, A Cappella Choir 103 Elec- tronics 122 Intramurals 11,12. RONALD PYLAND ADC 123 Wrestling 10,11. I' JODEE RADOSEVICH, ADC 12: GAA 10: Gym- nastics 11,123 Kaleidoscript 123 Y-Teens 10. DAN RANEY, Intramural Football 12. HOLLY RASCHE, ADC 123 A Cappella Choir 103 FNA 11: FTA 11,123 GAA 10,11,123 Pep Club 11, 12 CBasketball Chairmanb3 Science Club 111 Spanish 10,11,123 Y-Teens 10 CPublicity Chair- man 11,123 Synchronized Swimming 12. CHERIE REED, ADC 123 Pep Club 11,123 Span- ish Club 11,12. TERRY REEDY, ADC 121 AFS 103 FTA 122 GAA 10,11,123 PepClub1O,11,12. JANE REESE, ADC 12 CChorusJ3 GAA 10,11 QAss't. Bowling Mgr.b, 12 QBowling Managerjg Pep Club 11,123 Y-Teens. g JACQUELINE REID, ADC 12, Choir 102 Home Ec. Club 12: HERO 12. JEFF RETZ, Concert Choir 10,11,12: MYF 10,11: Dubuque High School-Blazzers 10,113 Once Upon a Mattress 11CWizzardJ. JUDI REYNOLDS, Pep Club 11,12. MICHAEL RIDDLE, LO'T 12: Up the Down Staircase 12 CCharlesJ3 MYF. TRENT RlGG,lntramurals12. JOHN RIVES, ADC 12: Lettermen's Club 11,12: Football 10,11,123 Baseball 10,11,12. SUE ROBERTS, J.A. 113 H.E.R.O. 12. BERNIE ROBERTSON, Mixed Chorus 10,112 In- tramural Basketball 123 Baseball 11,12. RANDALL ROBINSON, A Cappella Choir 10, ln- tramural Basketball 12QVlCA12QCWT12. DEBRA ROCHE, ADC 123 Choir 10,11,123 FNA 103 GAA 10,11,123 J.A. 10,11,123 Pep Club 10, 11,123 Sophomore Assembly3Y-Teens10,11,123 Anthonette. MICHAEL ROELENS, Science Club 10,11,12. TERRENCE RODRIGUEZ, Intramural Basketball 12. RICK ROGERS, Baseball 10. SHIRLEY ROGERS, D.E. 123 Spanish Club 10. CINDY ROMAN, ADC 123 A Cappella Choir 103 FNA 11,123 French Club 103 GAA 10,11,123 Gymnastics 11,122 Y-Teens 10 fSec.J, 11 CChair- manl, 12 CPres.33 Nereids 122 Inter Club 10,11, 121 Girls Golf 10,11,12 CCaptainD. PHILLIP ROSALES, Spanish Club 103 VICA 12 CSec.J. LEITH ROSENTHAL, ADC 123 Mixed Chorus 103 Our Town 10 CTown's Personl3 Curious Savage 11 CMrs. Paddyy Spanish Club 11, Thespians 11,123 Stage Crew and Publicity 10,11,12. ROSS RUDSELL, Concert Choir. MARK RUHS, German Club 12, Hi-League 10, 11,12. MARTHA RUHS, ADC 12, Concert Band 10,11,12, Pep Club 11, Twirlers 10,11,12: One Night of Melody 11,12. HENRY RUIZ, Electronics Club 122 Intramural Basketball 121 J.A. 11,12Q Science Club 113 Span- ish Club 11,122 Y-Teens 10,11,12. DAVID RUMLER, ADC 123 Intramural Basketball 10, Baseball 10. BILL RUUD, ADC 12 fChoir3 Choir 10,11, Con- cert 123 FNA 123 Track 103 Hi-Y 112 Intramural Football and Basketball 11,12, Baseball 10: Football 103 Basketball 10. PAT RYAN, ADC 123 Hi-Y 103 Pep Club 12. RICHARD RYSER, A Cappella 10,11,12. S ROBERT SALMON, Gymnastics 123 Intramurals 12. SUE SALZMANN, ADC 12 fChorusb3 Mixed Cho- rus 103 FNA 121 FTA 113 GAA 10,112 Gymnast- ics 11,12, Tug Team 11,122 Y-Teens 10,11,123 Cheerleaders 102 Office Helper 12. DARLENE SANDS, FTA 122 French Club 102 GAA 10,11,123 Gymnastics 11,12: SEA 12. NETRIS SAPPINGTON, Home Ec. Club. SUE SAUNDERS, ADC 12: A Cappella Choir 10, 113 Concert Choir 123 FNA 123 French Club 10,112 GAA 10,121 Science Club 123 Dance Band 123 MYF 10,11,12. RON SCHAFER, Lettermen's Club 123 Science Club 123WrestIing 10,11,12. MARTA SCHATTEMAN, ADC 12 CScript Comm. and ChorusJ3 Contemporaires 11,123 GAA 10 and 11 CGAA Boardy German Club 10,113 LO'T 12 CPage Twol3 Pep Club 102 Y-Teens 103 Nat'I Honor Society 11,12. DEBBY SCHENK, fTransfer from New Yorkb L'Envoi Juniors 112 Pep Squad 10,112 Adminis- trative Aide 113 AFS 10,11. JILL SCHORPP, GAA 10,113 Kaleidoscript 12: Pep Club 113 Spanish Club 113 Y-Teens 10. LINDA SCHOLD, ADC 123 Tug Team 11. NANCY SCHREMPF, ADC 123 Contemporaires 123 FNA 11,123 French Club 1OQ GAA 102 Y- Teens10,11,12fInter Clubj. DIRK SCHROEDER, ADC 122 AFS 12: Knight ofthe Burning PestIe 123 Li'I Abner 122 YFU Foreign Exchange Student from Germany. DEBBIE SCHWARTZ, ADC 12Q A Cappella Choir 10, Girls' Chorus 112 Concert Choir 123 Y- Teens1O. BRUCE SCHWENNEKER, ADC 123 Electronics 11,123 Gymnastics 10C Intramural Basketball and Football 10,11,12: Science Club 12. CYNTHIA SEARLS, ADC 123 GAA 101 Library 10 CSec.J3 Science Club 113 Rainbow CPast Worthy Advisorj. JOHN SEGURA, ADC 122 A Cappella Choir 10: Gymnastics 1O,11,12Q Pep Club 122 How to Succeed in Business 10 CNGWSCZSTGYQQ Science Club 123 Spanish Club 10,112 Mighty Maroon 12. BOB SEIBERT, Choir 123 Electronics 102 Intra- murals 10,111 J.A. 103 Spanish Club 101 Wres- tling 103 Track 12. CONNIE SELL, ADC 123 D.E. 12: Pep Club 103 Y-Teens1O3 Rainbow 10,11,12. DEAN SELLERS, Mixed Choir 12: Wrestling 10, 12. DARLENE SELMAN, Choir 101 Y-Teens 10 RICHARD SERRE, ADC 11,12 CPit BandJ3 Band 10,11,123 Electronics 10,11 CSec.-Tres.l, 12 CPres.D3 Carousel 11 and Li'l Abner 12 CCrewD3 Assembly Stage Crew 11,123 Closed CircuitTV Crew 10,11,12. BILLIE JO SHANNON, ADC 123 Contemporaires 123 FTA 121 GAA 10,11,12: German Club 103 Pep Club 11,123 One Night of Melody 12 CDancerJ3 Spanish Club 123 Y-Teens 10,11,12. SANDY SHEESLY,-' ADC 123 'A Cappella Choir 10,11, Concert Choir 123 TAC 11,12, Y-Teens 10,11. DON SHEETS, Intramural Football. MICHAEL SHINN, Intramurals 101 Wrestling 10,121 Baseball 10. DEBBIE SHLAES, ADC 123 A Cappella Choir 103 FNA 113 FTA 11,123 GAA 10,11,12, Pep Club 11,123 Spanish Club 10,11,12: Y-Teens 10,11,12. BARBARA SHOEMAKER, ADC 12 QChorusJ 12, FTA 11,123 GAA 10, Pep Club 12. TED SHORT, ADC 123 Mixed Chorus 102 FNA 123 Lettermen's Club 123 Football 10,11,12. PATSY SIEBENMANN, ADC 123 GAA 10,112 Pep Club 10,123 Y-Teens 11,123 Office Occupations 12. KATHY SIMS, J.A. 103 Y-Teens 10. CINDY SKOGLUND, ADC 12: Mixed Chorus 103 'FTA11,123 GAA 10,11,12. DEB SKROMME, ADC 10 and 11 CCrewJ, 12 CScript Comm. and Music Comm.J3 Lit. Board 123 LO'T 12 CEditoriaI Ed.J3 Our Town 10 CTown's PersonJ3 Stage Crew 10,11,123 Science Club 11,121 Thespians 11,122 Nat'I Honor So- ciety 11,121 Homecoming Honorable Mention 12: Orchestra 10,11,12 fSenior Repg. RONALD SMARSTY, Science Club 12. CRAIG SMART, Intramurals 12, VICA 12. CATHERINE SMITH, GAA 123 Office Occupa- tions. CHARLES SMITH, Diversified Occupations 12. CONNIE SMITH, ADC 123 D.E. 12, GAA 102 Pep Club 10. MICHAEL SMITH, ADC 123 FNA 10,11,123 Gym- nastics 10,11,12, Hi-Y 10,11,123 Intramurals 10,11,12. LINDA SNIDER, ADC 12 1ChorusD3 Contempo- raires 12, Electronics 123 GAA 11,122 Intra- murals 12. JOSEPH SOETHE, Band 103 Electronics 10,122 FTA 11,123 Lettermen's Club 11,123 Wrestling 10,11,123 Football 10,11,123 Baseball 10. STUART SOLIZ, Band 1O,11,12Q Intramurals 122 Baseball 10,11. CRAIG SOMMERS, Band 10,113 German Club 103 Hi-Y113 Intramural Football 10,11,12. REED SOMMERS, Band 102 German Club 10,112 Hi-Y1O,11,123FNA12. STEPHEN SOPER, Intramural Football 11,12.- MARILEE SPAHN, ADC 12. CURTIS SPILLUM, ADC 122 FNA 123Hi-Y 10,11, 12: Intramural Basketball 10,11,123 Lettermen's Club 11,122 Science Club 123 Boys Golf 10,11,12. JOHN SPITZNAS, Hi-Y 11, Intramurals 102 Sci- ence Club 103 Ski Club 11, Football 10. DEBBIE SPORE, ADC 12 CChorusJ3 FTA 11,122 GAA 101 Tug Team 11,123 Pep Club 113 Sci- ence Club 102 Y-Teens 10,11,12. JUDY SPROUSE, D.E. 12 CTres.l3 Pep Club 113 Spanish Club 10,11. DALE SPRIET, ADC 123 Intramurals 123 Let- termen's Club 11,121 Track 10,11,123 Football 10,11,12: Basketball 10,11. DEBRA STANLEY, H.E.R.O. 12. ROY STEARNS,VlCA11,12. MARLA STEELE, ADC 12 CChorusl3 Mixed Cho- rus 101 Concert Choir 11, LO'T 12 CFeature Ed.J3 Our Town 10 CTown's PersonJ3 Spanish Honor Society 111 Nat'I Honor Society 11. BILL STEVENS, Hi-Y3 Intramurals3 Lettermen's Club3 Football3 Track. TEX STOHL, ADC 123 FNA 11,12: FTA 103 French Club 102 Hi-Y 112 Key Club 11,123 Intra- murals 11: Lettermen's Club 11,12Q Football 10,11,123 Baseball 10. ROGER STOLTING, Electronics 122 CCTV Crew 12. MICHAEL STONE, D.E. 12. SUSAN SUMNER, ADC 12 CChorusj3 Art Club 10,11,12 CPres.J3 Stage Crew 10,113 Kaleido- script 11,12 CArt Staffjj M 12 CSenior Ed.l3 Our Town 10 CTown's PersonJ3 Science Club 10,11,12 CVice-Pres.J3 Nat'l Honor Society 11, 12:Thespians 11,12 CTres.l3 SEA 11. NANCY SUNDERLAND, ADC 12: Forensics 11: FTA 11,123 GAA 10,11, Spanish Club 1O,11,12Q Y-Teens10,11. JULIE SWALES, ADC 12 CChorusJ3 French Club 10: KaIeidoscript 12 fSubscription ManagerJ3 Nat'l Honor Society. BOB SWANSON, Intramural Basketball 10,11,12. SUSAN SWANSON, ADC 12 CChorusJ3 FTA 122 GAA 103 German Club 103 Y-Teens 10,113 Young Life 12. STEVE SWARD, M 11,12 QPhotographerJ3 Sci- ence Club 11,12. KAREN SWEDBERG, ADC 122 FNA 11,122 FTA 11,12, GAA 10,11,123 Intramurals 123 Kaleido- script 12 fChief Editorial ASS't.Dj Spanish Club 10,112 Y-Teens 1O,11,12Q Young Life 12. VICKI SWEET, GAA 103 Gymnastics 113 Home Ec. Club 103 Pep Club 123 Y-Teens 10. 1 BRENDA TAYLOR, ADC 12 CChorus and Public- ltyyj D.E. 123 GAA 103 Baccalaureate Comm. 12. JOHN TAYLOR, ADC 121 Mixed Chorus 11, A Cappella Choir 123 French Club 10,111 Gym- nastics 12, Intramurals 102 J.A. 122 Pep Club 123 Li'I Abner 12 CSpeedy McRabbitl3 Up the Down Staircase 12 CEdward73 Mighty Maroon 12. SHEILA TAYLOR, Band 10,11,123 Science Club 113 Spanish Club 103 Orchestra 10,11,123 Car- ousel 11 fPit OrchestraJ3 Office Occupations 123 MYF 103 Orchestra and Band Concerts 10, 11,12. ANNE TEDELL, ADC 12, Choir 10, FNA 11,123 GAA 10: Tug Team 11,123 Pep Club 10,113 The Curious Savage 11 QMrs. SavageJ3 Span- ish Club 10,11,123Y-Teens 10,11,12. MIKE TEEL, J.A. 10. JIM TEMPLE, ADC3 Hi-Y: Intramurals3 Key CIub3 Lettermen's Club3 Ass't. Basketball Official3 Football. ROBERT THENNIS, ADC 12, French Club 10,11, 12, Gymnastics 102 Intramurals 10,11,12. ROBERTA THENNIS, ADC 12 QChorus and Pub- Iicity Comm.J3 GAA 10,11,12, Pep Club 121 Spanish Club 103 Y-Teens 10,11,123 Senior Announcem.ents CCo-ChairmanJ3 Commence- ment Comm.3 Baccalaureate Comm. BARB THOMAS, ADC 123 Concert Choir 11,122 FNA 11,122 Li'I Abner 12 CChorusJ3 Spanish Club 10,11,12, Student Congress 10,11,12 CSec.J3 Thespians 10,11,123 Y-Teens 10,11,12 Clnter CIubl3 Senior Prom Comm. CHRISTOPHER THOMAS, Football 1O,11,12Q Wrestling 10,11,12. 281 i DON THOMPSON, ADC 122 FNA 11,121 Hi-Y 11, 12 CSgt. at ArmsJ3 GBU 10,11,123 Intramurals 10,11,123 Kaleidoscript 12, Key Club 10,11, 123 Lettermen's Club 11,123 Science Club 12. LINNEA THOMPSON, GAA 10: Pep Club 123 Nat'l Honor Society 11,122 Rainbow W.A.A. 10, 11,123 Girl Stater 111 Illinois State Scholar. PAT TINGLEY ADC 12: VICA 123 Y-Teens 10,11. JILL TIPPEL, Mixed Chorus 103 Library 10, Luther League. ROB TOLMIE, VICA 12. JANET TONN, GAA 103 Spanish Club 10. RALPH TORNES, Electronics 12. COLLEEN TRACY, ADC 12 CChorus93 French Club 103 GAA 113 Y-Teens 10,11. JON TUNBERG, ADC 123 FNA 11,12 fPres.J3 German Club 10,11,12: Golf 12: Hi-Y 10,11,123 Intramurals 10,11,12: Key club 10,11,123 Let- termen's Club 103 Science Club 10,11,123 Stu- dent Congress 11,12. BRAD TWENTYMAN, ADC 123 FNA 12: French Club 103Hi-Y 11,123 lntramuraIs12. SANDY TWING, ADC 123 FNA 11,123 FTA 122 Pep Club 103 Science Club 11. U CAROL ULMER, Transfer-Library 113 Pep Club 10,113 Bark Staff 113 FHA 113 FTA 113 B- Liner Staff 113 Science Club 113 Powder Puff Game 113 Home Ec. Club 10,11. V ELISEO VALDES, FNA 123 Spanish 10,11,12 QPYGSDQ Football 10,122 Wrestling 11,12. . JIM VANA, ADC 123 FNA 123 Hi-Y 11,123 Intra- murals 11,123 Science Club 123 Key Club 10,11, 123 Lettermen's Club 123 Spanish Club 10,11 CVice-Pres.J, 121 Student Congress 12. MIKE VANDECASTEELE, Intramural Football and Basketball 123 Amer. Legion Baseball 10,11, 123 Basketball 10,11,123 Baseball 10,11,123 Let- termen's Club 12. CAROL VANDE MOORTEL, GAA 103 French Club 102 Y-Teens 11,123 Pep Club 12. CINDY VERSLUIS, ADC 12 CChorusj3 FNA 11,122 GAA 10,12Q French Club 113 Intramurals 11,123 Pep Club 113 Science Club 11,123 Y-Teens 10, 11,12 QCommittee ChairrnanJ3 Nurse's Helper 12. MARY VERSLUIS, D.E. 122 Pep Club 102 Spanish Club 10. SUE VONDERHAAR, ADC 12 CChorusb3 Art Club 11,123 FTA 10,11,123 GAA 10,11,123 French Club 10,113 LO'T 12 fPage Three and Dispatch Correspondenty Science Club 10, 282 11,123 ASA Girls' Softball 11,123 III. State Scholar 123 Tug Team 11,12. NANCY VON LANGEN, ADC3 Band 10,11 iLi- brarianj, 12 CSec.-Tres.j CLib.J3 Forensics 123 FNA 121 GAA 10,123 Stage Crew 10,11,123 Ladies in Retirement 11 CLouisaJ: Curious Savage 11 CStudent Directory Up the Down Staircase 12 CLindaJ3 Thespians 11,123 MYF 10,11,12. DENISE VORHIES, ADC 123 Mixed Chorus 103 Kaleidoscript ' 123 GAA 10,113 Y-Teens 10, 11,12. W MARK WALKER, ADC 123 FNA 11,122 German Club 10,11,123 Intramurals 113 Science Club 1O,11,12g Tennis 11,12. JENNIE WALSH, Pep Club 12. KAREN WALTERS, Choir 103 GAA 10,113 Home Ec. Club 122 Y-Teens 103 H.E.R.O. 12. PATTY WARREN, Pep Club 123 Y-Teens 10,11, 123 0.0. 12 fVice-Pres.j3 ADC 123 Band 10,113 FNA 113 FTA 11,123 GAA 11,103 Gymnastics 10,11. DON WASSENHOVE, Science Club 11,12. BRAD WATSON, ADC 123 Hi-Y 10,11,12 QTres.J3 Intramurals 10,11,123 Science Club 123 Wres- tling 103 Track 10. DEBRA WATSON, GAA 102 Y-Teens 10. BRUCE WATTS, ADC: Hi-Y3 Intramurals3 Letter- men's Club3 Bruce Watts Fan CIub3 FootbalI3 Track CState Champj. GARY WELLER, ADC 123 Electronics Club. MIKE WENTHE, Spanish Club 11. LINDA WHITCOMB, GAA 10,11,123 Red Cross3 MYF: Jr. Red Cross Volunteer at Hospital 11,12. GAYLE WHITEBOOK, ADC 123 FNA 11,123 French Club 103 GAA 10,11,123 GAA 10,11,123 Gym- nastics 11,123 Pep Club 113 Spanish Club 113 Y-Teens IO Clnter Clubb, 11 CSec.b, 12 Clnter Club Sec.J3Nereids1O,11,12. CRAIG WHITING, Electronics 113 J.A. 103 Ten- nis 10,11. RANDY WHITMIRE, Spanish Club 10. STEVE WICKS, ADC 12 CChorusJ3 AFS 123 French Club 103 Hi-Y 101 M 12 CPhotogra- pherjz Science Club 11,12. RICK WIEMER, ADC 122 FNA 121 Hi-Y 11,123 In- tramurals 113 Pep Club 113 Science Club 123 Spanish Club 11,12. FRANCIS WIESE, FTA 123 GAA 10,11,12. PAMELA WILLETT, FTA 123 GAA 103 German Club 10,113 Pep Club 11,12,103 LO'T 12 CCirculationJ3 Science Club 11,123 Demo- cratic Club 10 CSec.J3 Rainbow Girls 10,11,12 CWorthy Advisory. GLENN WIKERSON, Lettermen's Club 10,11,12: Cross Country 10,11,123 Track 10,11,12. NANCY WILKINSON, Art Club 123 Mixed Chorus 103 FTA 123 SEA 11,12: Quad Cities Drug Abuse Council 12 QMHS Rep. and on Board of Direct- orsj. NANCY WILLIAMS, ADC 123 Band 10: FTA 12: GAA 11,122 LO'T 12 CPage ThreeD3 Science Club 123 Spanish 10,122 Iowa Girls' Softball 103 Iowa Girls' Basketball 102 Nat'l Honor Society 11,12. RANDY WILLIAMS, ADC 12 CChorusJ3 Hi-Y 10, 11,123 Intramural Football and Basketball 10, 11,123 Science Club 122 Track 10. SANDRA WILSON, ADC 123 A Cappella Choir 10,113 FTA 10,11,123 GAA 10,11,12: Home Ec. Club 123 Science Club 123 Spanish Club 12. TRESSA WOLFE, GAA 12. COLLEEN WOOD, ADC 12: Mixed Chorus 103 Girls Chorus 11,123 GAA 10,11,12 CVice-Pres.J3 French Club 103 Pep Club 10,123 Y-Teens 103 CarouseI 11CChorusJ. FAL WOOD, ADC 123 Concert Choir 10,11,12: FNA 11,123 French Club 103 Hi-Y 10,11,12: ln- tramurals 10,11,123 Key Club 10,11,123 Golf 10,11,123 Lettermen's Club 11,12: Student Congress 12. SHARON WOOD, GAA 10,113 Nat'l Honor So- ciety. JACKIE WOODWARD, ADC 12 fChorus93 FNA 11,123 French Club 113 GAA 10,113 Intramurals 11,12: Pep Club 113 Science Club 11,122 Office Helper 123 Spanish Club 10,113 Y-Teens 10, 11,12CComm.Chairman7. CAROL WOOLLEY, A Cappella Choir 10. Y NANCY YAUDAS, ADC 12 CChorus93 Kaleido- script 12 CTypistJ3 Spanish Club 103 Spanish Honor Society 10. Z STEVE ZEISER, D.E. 12. WILLIAM ZELNIO, ADC 123 FNA 123 French Club 103 Hi-Y 10,11,123 Intramurals 123 Key Club 10,11,12 fTres.J. KENNETH ZUHN, ADC 123 Choir 103 Intramural Volleyball 1O,12Q Kaleidoscript 12 CEditorial WriterJ3 Science Club 10,11,12: Nat'I Honor So- ciety 11,12. book index academics advertising . . . band .,..,,. baseball . , . basketball ..,. cheerleaders .... choirs ....,,.,.... contemporaires .... cross country .... debate ......,,........ distributive education .... fine arts awards ........ football .......... forensics ....... french club ...i.......,.. future nurses ...........,. future teachers of america . . . girls athletic association .. german club ....t,..... , golf ................... homecoming ,....... .... home economics club ... Intramurals .,......... juniors ......... kaleidoscript ,... ........... , key club ...................... knight of the burning pestIe ,, lettermen's club .............. Ii I abner' ................. literary board ... line o' type .,.....,.. l'Tl ..................... national honor society ... nereids ...,............ office occupations ..., orchestra .......... pep club .............., quill and scroll ...,,....... scholastic honors group . . . science club ............. senior activities .... senior awards ..., seniors .....,... sophomores .... spanish club .... stage crew ....,.. student congress . . . student life ....... swimming ...... tennis ....,. thespians ... track ...... vica ....,.. wrestling ,,, y-teens .,.. 22 240 162 236 220 238 156 152 245 185 187 179 210 185 174 196 198 202 176 235 10 189 218 112 184 190 148 194 150 178 180 182 44 206 186 160 191 179 42 168 275 42 46 128 172 154 166 8 226 216 146 232 188 230 200 Aitken, Pamela 50,199 8 Abbott, Greg 133,214,173 Abrahamsen, Robyn 135 Ackerland, Julie 132 Ackiey, John 50,259 Acord, Scott 13,157,166,194,197,2l2,213,50 Adam, John A., B.A,, M.A., English, Admin. Ass't, 26 Adams, Adams, Adams. ,William S.: B.S., M. of Ed., Coop. Adams Carol 50,187 Douglas 123 Kent 126 Education 36 Adamson, Jeff 19,50,155,147 Aitken, Carol 41 Aitken, Jim 133 Aitken, Judi 121 Aitken, Laury 191,125 Aitken, Susan 199,125 Akers, Alan 50 Akers, Glenda 119 Albertson, Debra 120 Albertson, Lloyd 50 Albrecht, Ann 127,185 Aldene, Kathie 125,189 Allardyce, Deb 50,152,192 Allen, Jerry 120 English, Communications 30 Allen, Karmel 134,158,261 Allen, Kirk 133,159,214,190,173 Allen, Larry 140 Allen, Lorri 50 Allen, Robin 116 Allen, Saundra 133,158 Allen, Sherry 50,156 Allensworth, Dale 50 Allison, Christine 134 Allison, Danny 50 Allison, Danny R. 116 Allison, David 51 Allison, David 122 Allison, Doug131 Almanza, Mona 152,153,125 Almanza, Tony 134 Almquist, Mr. Donald 25 Alvarado, Mark 125 Alvarado, Michael 135 Amundson, Cynthia 130,158,162 Anders, Sandi 134 Anderson, Britta 51 Anderson, Dean 51 Anderson, Debby 141 Anderson, Donna 135 Anderson, Greg 13,51,1210, 212 Anderson, 26,49 Anderson, Jan 131 Anderson, Jarrin 51 Anderson, Jeff 159,140 Anderson, Jim 141 Anderson, Julie 51 Anderson, Anderson, Karl 51 Anderson, Kathy 115 Anderson, Ken E. 137 Anderson, Kenneth 130,216 Anderson, Kent 136 Anderson, Linda 139 Anderson, Lorraine 51,84,42 Anderson, Marilyn 51,152 Anderson, Mark 121 Anderson, Nancy 51,125 Helen, B.A., M,A., Counselor Mrs. Karen, BA.: Foods 38 Anderson, Sherry 52 Anderson, Steve 140 Anderson, Susan 52 Anderson, Teri 163,120 Anderson, Terry 52,215 Andrews, Shelley 141 Angell, Roger 115 Anselmi, Gilbert 116 Armel, Jon 52 Armes, Lucy 52 Armetta, Gina 133 Armstrong, David 140 Armstrong, Kathleen 115 284 student and faculty index 'Arndt, Christopher 132 Arnold, Patricia 122 Arrington, Carol 52 Asplund, Diane 52,188 Aswege, Scott 139 Atkins, Cynthia 1O,13,52,196,238,239 Atkins, Doreen 137,239,128 Atkins, Pat 123 Attwood, Lennice 124 Aultman, John 122 Axne, Deana 135 Axnix, Mary 122 Baber, Victor A, 131,214 Babincsak, Robert 131,610 Babincsak, Vicki 134,10 Bailey, Sue A. 138,10 Bailey, Vicki S. 131,10 Baird, William A.122 Baker, Gary Lee 53 Baker, Gary Lynn 53 Baker, Ernest C. 162,124 Baker, Harvey L. 136 Baker, Kenny A. 114 Baker, Lynn Ann 53,186 Baker, Pamela M. 133 Baldwin, Brian L. 124 Ball, Kathy A. 117,188 Ballard, Connie K. 133,154,162 Ballard, Greg R. 162,125 Ballard, Steven 53 Ballou, Kim S. 157,191,120 Baltzell, William G., B.S., M.S., Driver Education, Varsity Baketball and Baseball 34 Banfield, Denise J. 116,197 Banks, Danny 53 Barajas, Carlos 53 Barajas, Mario 115 Barber, Jeff 53 Barber, Mike 39,153,161,162,53 Barham, Charles A. Barham, Sandy K. 119 Barnes, Alven E.17,157,127,147 Barnes, Becky A. 158,141 Barr, Randy 115 Barritt, Lori A. 119 Barrowclough, John 53,183,249,42 Bartels, Carol L. 159,125 Barth, Cindi 53 Bates, Marcella L. 134 Bauer, Gregory 53,199 Bauer, Sally A. 137,163 Baughn, Kathy 120 Bauman, Chris 54 Bauwens, Robert E. 117 Baxter, Mr. Marlin 25 Beaird, Clyde 134 Bealer, Don E. 134,214 Bealer, Nancy J. 122 Bealer, Sally 53 Beard, Joann 132 Beard, Margo L. 126 Beauchamp, Markie 53,197 Beauchamp, Monte 53 Bechel, Kathleen 53 Beck, Bridget A. 137 Beck, Donald K. 135 Beck, Pamela 53 Bivins, Carol L. 132 Bjarstrom, Dorothy 27 Bjornsson, Thorsteinn 21,55,75,212,12O Black, Harold W. 133 Blackburn, Gregory 55,195,259 Blackman, Ola 125 Blackman, Vivian M. 138 Blakeney, Mark T, 133 Blaser, Gregory 55 Blaser, ScottC. 116,157,216 Blaser, Steve W. 139 Blecker, Elizabeth 117 Blette, Wayne 134 Block, Bridget 121 Bloemsma, Betty 55,187 Blomquist, Cindy 55,152 Bloome, Miss Diane, B.S. in Ed,, World History 32 Blow, Debbie 167,197,238,191 Boden, Buddy 138 Bolkcom, Cathy 55,217,173 Bolkcom, Elizabeth 199 Boom, Mark 161,125 Beck, Sancy 13,53,166,201 Beckett, Darreyl 122 Beckmann, Delores, B.A., Speech, English Communications, English LAV, Dra matics, Thespians 30,31 Beckman, Jim M. 124 Bedford, Ann 161,127 Boom, Fritz, B.A., MA., Algebra, Geometry Key Club, Senior Ball 28,49,190 Boom, Randy 133,190 Boone, Debbie 55 Boquist, Cheryl 55,152 Borkhardt, Jerry 134 Bottman, Mark 117 Bowen, Maribeth 55 Behnken, Kathy 115 Behrends, Bill L, 124 Beitel. Sue G. 159,217,140 Beldi n, Sandi 53,188 Beldon, Joseph 40 Bell, Anne B., A.B., French, French Club, Twirlers 32 Bell,Jeff L.121 Bell, Jeff 53 Bell, John 53 Bell, Timothy A., B.A. American Government, Bells American and World History 32 on, Frank 54 Bender, Jana 54,199,42 Bender, Sandy T. 117 Benedict, Patricia A. 130 Benejam, Gary A. 20,30,167,177,274,123 Benker, Helen E. 135,174 Bennett, Ellen M. 123 Benson, David W. 155,157,125 Benson, Tim 54 Benson, Tom D. 190 Berggren, Susan 54,60,192,184 Bergren, Mike R. 162,126 Bergstrom, Susan J, 114,152 Berhenke, Debbie L. 116 Berhenke, W. Don 116 Berhenke, Marilyn M.140 Bernard,Ronald13,54,195,257,259,168 Bernardi, Patricia, BS., English 30 Berndt, Nancy 54 Berndt, Sally 131 Berndt, Theresa J. 114 Berrier, Alan 54 Berrier, Frank 54 Berry, Mark A,125 Bertelsen, Karen B. 116,157 Bess, Ruth A.135 Burns, Rosalie E. 14 Burrus, JoAnn 99,180 Bey, Patricia 55 Beyhl, Ralph G. 140 Biggs, Karen L. 135,197 Biggs, Kathryn A.123 Bigham, Stephanie D.121 Bingham, Terry 141 Binns, Steve A. 131,158,131 Biorn, Randi 55,161,163 Birdsell, Darlos N.115 Bisbey, Brad 55 Biscontine, Rodney 114 Bisdorf, Debra S. 127 Bishop, Bill, M.A., Safety Education, Sophomore Basketball 34 Bishop, Sandy K. 191,121 Bisinger, Dan J. 214 Bitting, Sue M. 130,155,167,249,128,141 Bowling, Pam 13,49,55,166,197,2O0 Bowring, Nanette 55 Box, Lynn 132,159 Boyd, Becky 55,198,192 Boyd, Scott 125 Boyle. George 135,158 Boyle, Jeff 137 Boyle, Randy 55,155 Braatelien, Mary 130 Braatelien, Paul 55 Bradley, Dan 55 Bradley, James S., Ph,B., M.S. in Ed., General Bradley, Mike 187 Bradley, Robert 50,55 Brady, Jessie 116 Brandeberry, Nancy 55,170 Brandt, Deborah 56,184 Brandt, Jeff 136 Brashears, Mike 140 Brasmer, G. Raymond, B.S., M.S., Coordinator of Industrial Ed.: Key Club 24,36 Brasmer, Paul 190,127 Brathall, Robert 56 Breckle, Christy 117 Breecher, Kim 125 Breeden, L. 41 Brenstrom,S.114 Brenstrom, Bonnie 56 Breshears, Jennifer 117 Bridges, Constance 134 Bridges, Cynthia 121 Briesch, Sharon 139 Briggs, Jackie 56 Briley, Mrs. John L., B.A,, English 30 Bristol, Pamela 159,260,127 Bristol, Sandy 137,158 Britz, Joe 119 Broderick, Mark 56 Broderick, Mike 56 Bromley, Kim 141 Brooks, Robert C., B.S., M,A., Administrative Assistant folr Student Affairs, Assistant Varsity Football Coach 27,213 Brown, Jack H,, B.A., M.A,, Plane and Solid Geometry, Director of Activities 26,49 Brown, Patti 56 Brown, Randy 132 Brown, Rick 56,156 Brown, Veronica 152,126 Brownfield, Peggy 56 Brownfield, Stacie 56,187 Bruce, Ron 56 Bruce, Timothy 56 Buchanan, Kathleen 56 Buchanan, Sue 131,159 Buchholz, Phil 116 Buck, Maria 191,119 Buckley, Steve 214,141 Buell, Annette 56,156 Buhrke, Robin 141,173 Buller, Sana 131 Bullock, Tim 139 Bunte, Ken: B.S., M.Ed.: Physical Education, Assistant Varsity Football 34,213 Bunten, Steve 126 Burgett, Mark 56 Burke, Dana 137 Burke, Tracy 133,159 Burklund, Kathy 56 Burnett, Regena 137,174 Burnette, Melody 122 Burns, Deborah 118,122,184 Burns, Rosalie: B.A.g Spanish 32 Burrows, Marsha 57 Burrows, Sharon 123 Burrus, Jan 130 Burrus, William 13,57,66,162,19O Burton, Gary 137 Busen, David 135 Busen, William 57,87 Buser, Nadine 57 Buser, Sue 134 Bushman, Gary: B.S. and M.S, in Ed.: Physics, Chem-Physics, T,H,l.S., Science Club 28 Bustard, Jim 135,214,269,19O Butter, Keith 163,141 Bybee, Barbara 134 Byrd, Bev 57 Byrd, Jeanine 138 Byrne, Sheri 126,188 C Cackler, Mark 130,190,173 Cahalan, Frank 134,214 Cahalan, Jane 57,217 Cain, Richard 190,131 Caldwell, Scott 215,190,122 Callahan, Jeff 140 Callas, Cathy 132,174,193 Calvert, Steven 57 Camferdam, Steven 212 Campagna, Jeff 157,119 Campbell, Jo Marie 122 Canning, Garth 57 Cappaert, Donna 125 Cappaert, Teresa 58 Caras, Ed 140 Carden, Janis 135 Carey, Loren K,: A,B.: Art, Sculpture-Pottery? Drawingand Painting: Art Club 38,113 Carey, Patricia 140 Carmack, Jean 189 Carleton, Cindy 115 Carleton, Teresa 133,185 Carls, Judith M.: B.A.: Girls Physical Education: Y-Teens 34 Carls, Larry M.: B.S., M. Ed,: Boys Physical Education, First Aid: Athletic Trainer 34 Carlson, Bob 124 Carlson, Cindi 58,42 Carlson, Cynthia 58,161,163 Carlson, Cynthia M. 133 Carlson, Dan 212,112 Carlson, Gayelene 114 Carlson, Janet 58 Carlson, Mrs. Jean: B.S.: Physical Education Department Head: Head of GAA: Assistant H8 ad of Cheerleading 34 Carlson, Jean 163,125 Carlson, Jeff 157 Carlson, Jon 214,140 Carlson, Larry 58 Carlson, Lisa 58,84,156,157,180,146,147,42 Carlson, Lonny 123 Carlson, Mitchell 13,58,157,166,196,190 Carlson, Pamela 39,161,162,141 Carlson, Patti 58 Carlson, Mr. Robert 25 Carlson, Sarah 20,217 Carlstrom, Jackie 59,154 Carmack, Jean 135 Carnicle, Mike 140 Carothers, Sheila 59,156 Carpentier, John 59,195,190 Carsen, Cynthia 138 Carsen. Carson, Carson, Carson. Dave 59 D. 41 Michael 59 Opal: B.S.Ed.: M.A.: English Department Head 30 Carter, Catherine 135 Ca rter. Carter. Ca rter, Karen 136,158 Marcella 59,196,186,192,2OO Steve 116 Christensen,Tom 132 Christofterson, Susan 140 Christopher, Mark 139 Christopher, Sandra 59 Chumbley, Kristy 115 Churchill, Bill 138 Ciaraldi. Steve 127 Cirivello, Jamie Diane 59,199,543 Claeys, Greg 59 Clark, Bill 214 Clark, Bob 114,161,163 Clark, Chris 139 Clark, Donna 133 Cark, Howard 59,197,265 Clark, Keith 134,162 Clark, Theresa 134 Clark, Travis 116 Clary, M Clausen Clauson me 59 , Julie 116,156 ,Gary 138 Clauson, Greg114,215 Clauson, Richard 59 Clayton, Debra 122 Cleek, Rodney 121 Cleek, Sandra 131 Clemons, Don 59 Clinard. Richard 194,212,119 Clinch, Jane 135 Clow, Ellen 124 Cochuyt, Rick 121 Coder, Jack: B.A.: M.A.p Counselor 26,49 Colburn, Gary 60 Colclasure, Cathy 138 Colley, Candace 133 Collins, Elvie 136 Collins, Phil 158 Carty, Craig 139 Case, Cullen R.: B.S,, M.S. in Ed.: Social Studies Case, Elinor: B.A,: M,S.: Library 31 Catlett, Jerry 135 Catlett, Max 116 Causemaker. Pamela 121 Cavazos, Edumundo 173 Cavazos, Ivan 138 Cavazos, Yolanda 133,159 Cerra, Carmine 59 1 Cervantes, Elizabeth 116 Cervantes, Enrique 131 Cervantes, Mike 59 Cervantes, Nancy 126 Champion, Curt 131,162 Champion, James 59,155.163,147 Chanay, Lynn: B.A.: Math 28 Chandler, Kathleen 59,256,186 Chapman, Kevin 59,162 Chapman, Linda 140 Charlton, Larry 136 Cheek, Mary 59,158 Cheek, Mike 122 Chelstrom, Suzy 59,238 Cherrington, Marcy 197,127 Chilberg, Marty 122 Chinn, Nancy36,162.140 an Collins, Nancy 120,185 Collins, Sheri 137 Collins, Steven 60 Collison,Lissa156,191,120,121 Compton, April 154,155,162,122,147 Compton, Carla 6O,84,154,180,163,147 Conelly, Carol: B.Ed.: M.A.: Latin, Latin Club 32 Coney, Robert 134 Conner, Mark 137 Conrad, Donna 120 Conway, Joann 60 Conway, Judy 191,125 Cook, Cary 130 Cook, Gary 130 Cook, Gay 60 Cook, Linda 118 Cook, Paul 138 Cooley, Marsha 125 Cooney, Patricia 119 Coons, Daniel 60 Cooper, Cynthia 116 Cooper, Deborah 141 Cooper, Steve 139 Coopman, Dave: BA.: English 31,129 Cope, Duane 115 Copeland, Thomas 60 Cordes, Jeff 135 Cordes, Tom 60 Corelis, Lewis 60 Corkery, Joe 117 Corkery, John 60,194 Cornell, Larry 61 Cornell, Mike 131 Cornmesser, Sue 125 Cortez, Chris 136 Cothron, Michael 135 Countryman, Kent 141 Courtney, Lois 131 Coussens, Denise 133 Covents, Sally 141 Cowan, Arnold 141,173 Cowdery, Beth Cox, Cheryl 61 Cox, Dave 126 Cox, Julie 61,161,162 Coyne, Barbara: B.A.: S.M.: Biology: Biology I 28 Coyne, Kathy 61,192 Craig, Rebecca 163,140 Craig, Spencer 117,212 Crain, Ken 119 Crandall, Doug 119 Crane, Michael 122 Crews, Steven 118 Crippen, John 115 Crisel, Connie 139 Criswell, Beverly 114 Criswell, Bonnie 139 Cross, John 61 Cross, Rachel 121 Crouch, Wm. R,: B.S.: M,Ed: Electronics: Electronics Club 36 Crowe, Barbara 124 Crowe, Debbie 141 Crowe, Kathy 61 Croxton, Nancy 124 Culbertson, Carl 138 Culbertson, Linda 61 Cullen, Don 133 Cumberworth, Colleen 61 Cumberworth, Matthew 212 Cunningham, Sherry 117 Curry, Kathleen: BS.: Library 31 Curtis, Games 61,183 Czerewko, Peter 134 Czerewko, Sergei 135.161 d Daebelliehn, Joe 61 Dahlberg, Jan 115,152 Dailing, Dan 125 Dalhaus, Alan: B.A. in Music: Marching Band, Music Appreciation, Elementary Bands, Stage Band 38 Dangel, Camilla 130,217 Daniel, Bruce 139 Danielson, Krista 131 Danner, Karen 131 Danner, Mary 191,121 Davis, Barbara 133 Davis, Cindy 61,186 Davis, Dennis D,: B,A., M.A. in Ed., Biology l, ll, T.H.l,S,: FTA: 28,29,199 Davis, Lamonta 134 Davis, Michele 132 Davis, Nancy61 Davis, Paul 194,120 Davis, Rosa 134 Davis, Terry 134 Day, Carla 123 Day, Gregory 135,158,162 Dean, Cynthia 61 DeBaene, David 61 DeBaene, Mark 214,141 DeBo, Cindy 152,157,191,200,125 Decker, Candace 120 Decker, Kathy 51,61,87,181 Decker, Keith 61 Decoster, Lisa 139 Dee, Sue 161,123,184 DeFauw, Kathleen 61 DeGraeve, Thomas 61 DeJonghe, Jim 62,156,196 DeLaRosa, Carmen 138 DeLa Rosa, Joe 212 DeLathower, Karen 62 DeLathower, Mark 137 DeLeu Don 126 DeLong, Wanda 124 Delp, Ronald 137 DeMay, Mark 126 Dembosky, Mark 62,87,216 DeMink, Anna 140 Dempsey, Harry 62 Dempsey, Linda 62 Dempsey, Lloyd 141 Dempsey, Michael 139 Denato, Donald 119 Denato, Mary 62 Denkhoff, Jan 126 Dennhardt, Paul 148,158,190,141 DePoorter, Catherine 135 DePoorter, Chris 62,87,180,198,42 DePoorter, Joseph 140 Derouin, Thomas: B,A, English, Varsity Tennis Ass't. Sophomore Basketball: 31,216 Despain, John 163,140 Deushane, Mike 116 Deutsch, William 134 Devinney, R.A.: B.A,, M.A., World History: Audio-Visual Co-ordinator: 32 DeVolder, Charles 124 DeVolder, D. 41 DeVolder, John 122 DeVolder, Mike 62 285 DeVrieze, Joel 115,122 DeVrieze, Leeann 137,159 Devrieze, Sue 127 DeWaele, Mike 115 DeWitte, Sharon 140 Dhaenens, Steve 124 Diamond, John 63 Dickerson, Daniel 135,177 Dietsch, Dee Dee 63 Eckert, Gregory L. 141 Eddy, James 116 Edgar,Cindy L. 131 Edlund, Susan J.117 Edstrom, Ka ren 64,251 Edstrom, Mr. Paul 25 Edwards, Beth A. 123 Dietsch, Nancy 127 Dilulio, L. H.: B.M.E., M.M.E., Band: 24,38 Dilworth, Linda 149,156,119,147 Dismer, Cathy 133,217,162 Dismer, Sandra 63,67,161,163 Dobbello, C. 117 Dockery, Steven 136 Doherty, Greg63,162 Doherty, Philip M.: B.A., German, German Club: 32 Donison, Beth 131 Donohue, Gary 13,5O,63,149,157,166,181, 163,147 Donohue, Jeanette 119 Dooley. Dooley. Dooley. Dooley: Dopler, Gary 63 Karen 116 Orval 135 Rita 63 Bonnie 63,158 Dopler, Connie 63,159 Dopler. F,41 Dopler, Tom 116 Dorothy, Cecilia 114 Dorr, Greg 63 Dorr, Paula 126 Edwards, Kristine M. 141 Edwards, R. 40 Edwards, Robert A.: B.A., M.A.: Woodworking 36 Edwards, Steve 64 Edwards, Susan L. 167,197,125 Egert, Lana L. 137,159 Egert, Robin 64,116,187 Eggers, Raymond 156,64 Ehrhardt, Jeanne M. 130 Eihl, Elise 64,196,197,2OO Ekstam. Jeffrey 64 Ekstam, Kendall J. 131 Elder, Patty 64 Elhoffer, Nancy K. 197,125,173 Elliott, Cole 64 Elliott, George F. 126 Elliott, James 65 Elliott, William D.132 Ellis, Diana K.133 Ellis, Kim R. 130 Ellison, Jennis: B.A., M.A.: English 31 Emler, Glen C, 133,173 Enderton, Susan 65,198 Engstrom, Dave 65,194,197 Engstrom, Evelyn 27 Engwall, Patricia 65 Douglas, John 130 Douglas, Mary 132,163 Douglas, Shawn 135 Douglas, Vickie 131 Dove, Craig 63 Dow, Richard 63,158,199 Dow, Traci 137,174,193 Doyle, Shannon 214 Drefchinski, Joe 116 Drefchinski, Anthony 116 Dreifurst, Kenneth 124 Dreifurst, Stephen 134 Dnnkwine. Freda 140 Driscoll, Diane 63,192 Driscoll, Julia 139 Drummond, Kim 121 DuBurg, Jennifer 63,156 Duby, Laura 133 Dudzik, Steve 156,121,147 Duhm. Pamela 120 Enstrom, lrette 41 Erickson Debby L. 119 Erickson, Joel: B,A.: General Art: inting and Drawing 38 Erickson, Julie 65 Ewert, Kevin 135 Exbom. Cynthia 65 Exbom, Raedean A.134 Exner, Danny J. 161,126 Eyre, Colleen S. 157,197 f Fahlberg,Andra141 Fahlberg, Mark 66,35 Farrell, James 119,126 Farris, Cindy 187 Farris, Linda 66 Faust, Kimberlee 133 Fecht, James 66,188 Felgar, Darryl 134 Felgar, Lisa 116,191 Felsman, Rex 66 Fentem. Don: B.S. in Ed., M.A.T.: Chern- Physics, T.H.l.S., Chem-Study: Science Club 28 Ferguson, Steve 134 Ferral, Debra 130 Ferris, Kent 66 Ferry, Daryl 136 Ferry, Luann 135 Ferry, Tim 118 Feuerbach, Joel 133 Fiter, John 137,159 Fiter, Richard 66,157,187 File, Debra 66,187 Finch, Bonnie 66 Finch, Peggy 140 Findley, Denise 125 Finkle, Cheryl 124,141 Finkle, Julie 118 Fischer, Roger 122 Fischer, Terry 66 Duke, B renda 64 Duke, Cheryl 124 Duke, D avid 117 Duke, Linda 64 Duncan Duncan Duncan Dunlap, Dunlap. Dunlop, Dunlop, Dunn. B Dunn, C :Cheryl159,131 :Diane 191,127,184 . Dorothea: B.S.: Clothing, 38 Beverly 64 Carol 130 Donna 155,187 Scott 134 rian 64,156 ynthia 120,184 Dunn, Daniel 120 Dunn, K elth 138 Dunton,Larene141 DuPont, Donald 134 Duyvejonck, Cliff 126 Dye, Brad 137,167 Dye, Cathy 114 Dye, Jack: B.A., Government, Geography, Golf 32 Dyer, Jeff 155 Dyer, Robert 132,185 Dyer, Tim 64,155,146,147 9 Ealy, Fred 64 Ealy, Guy F. 135 Earnest, Randy W. 136 Easter, Lawanda A. 119 Eastland, Nancy E. 158 Eastman, Allen 64,212 Eastman, Keith 140 Eaton, Maja J. 239,193,200,141 Ecker, Debbi A. 132 Ecker, Douglas 64,195,215 286 Ford, Timothy 156 Forest, Annette 125 Forest, Rodney 67 Forsberg, Brian 133,217 Forseth, Miss Deborah: B.S.: Foods and Nutrition: Clothing: H.E.R.O. 38 Forshee, Shelli 67 Forslund,Leeann135 Fortin, David 123 Fosbinder, Jerry 67 Foss, Jeffery 67 Foster. Betsy 163,128,141 Foster, James 67 Foster, Jim 131 Foster, Mrs. Mary: M.A.: Government History 32 Foster, Melody 136 Foulger. Dave 131 Foutch, Elizabeth 115 Foutch, Lynn 116 Fox, Keith 115 Fox, Robert 138 Foy, Dawn 137 Frame, Dawn 122 Francescon, Terrance 163 Francis, Jim 67 Francis, Sarah 67,187 Franck, Mr. Harry 24 Frank, William 133 Franklin, Darryl 67,162 Franks, Donald 212,125 Franks. Laura 115 Franks. Steven 67,212 Franz, Mike 135 Fraser, Denise 134 Frederiksen, Alan 124 Freeman, Monica 116 Freeman, Robert 197,112 Freisinger, Danny 125 Ericson, Jacqueline 135 Ericson, Mr, Milton 25 Ericson, Rhonda L. 161,163,127 Ervin, Gregory J. 247 Escageda, Ruben 126 Escarza, Gloria M.132,193,200,173 Escarza, Sotero 65,173 Eslinger, Terry J. 65 Esterdahl, Dawn 117,158 Esterdahl, Monica 65 Estes, Carol 65 Estes, David R. 138 Etzel, Sam: B.S., M.S.: Mechanical Drawing and Woodworking 36 Evans, Michael D. 133,214 Evans. Steve D, 115,212 Eveland, Patricia J. 152,127 Everett, Gary 115 Evert, Debra J. 131 Ewert, John K. 214 Fisher, Bill 137,158,215 Fisher, Cynthia 66 Fisher, Diane 67 Fitzpatrick, Wynn 117,212 Fitzsimmons, Vincent 140 Flack, Jim 132 Flack, Chris 67,197 Flatley, Jane 152,127 Flesner, Gene W.: B.S. and M.A. in Ed.: Plane and Solid Geometry, Intermediate Algebra and Trigonometry, Vocational Math 28 Fletcher. Jerry 114,156 Flewallen, Marsha 140 Floming, Laurie 115,197,187 Floriez, Vera 187 Flynn, Debbie 67,197,268 Flynn, Gail 134 Folmar, Susan 121 Ford, Jim 136 Fretty, Dennis 17,67 Frey, Kevin 119 Friesth, Ann 67,156,189 Friesth, Scott 155,156,12O, 147 Frohreich, Debra 68 Frohreich, Greta 197,191,121 Frutiger, Vicki 122 Fuller, Kathy 68 Fuller, Torn 135,163 Funk, Andrew D. 68,212 Furgie, Cathie 152,191,120 8 Gabbert, Michael 125 Gaghagen, Cheryl 68 Gaghagen, Donna 132,174 Gaghagen, Patricia 117 Gain, Rick 214 Galassi, Jane 116 Gann, Rodney 68,169 Gantz, Christopher 68 Gapinski, Tamera 124 Garcia, Christine 118 Garcia, Lisa 139,158 Garland, Gary 118 Garner, Richard 68,188 Garner, Rita 140 Garrison, Chris 141 Garrison, Michael 140 Garrison, Terry 116 Garza, Irene 68 Garza, Raymond 119 Gaskill, Eva 141 Gasperovich,Carol 120 Gates. Holly 197 Gates, Laurie 68,176,184 Gatz, Kathy 68,152,197 Geddling, Helen 27 Geddling, Michael 135,159,214,190 Gehring, Mrs. Helen: M.B. Ed.: Distributive Educationp Distributive Education Club, 187,36 Gengler, Sharon 136,158,189 Gerard, William 68,195,212 Giacomelli, Sue 115 Gibbons, William 139 Gibson, Emilie 123 Gibson, Stephen 130,159,167,174 Gidel, Glendeen 12.68 Gierlus, David 68 Gill, Randy 134 Gillen, Amy 132,159,174,193 Gilmore, Robin 115 Gipson, Mike 126 Gisel, Jane 68 ' Glaus, Sandy 68,186 Gleize, Debbi 68,184 Glenn, Johnnie 69,188 Glimpse, Sherri 69 Glynn, Daniel 137,155 Godaire, C. 119,115 Godwin, Jan 162,127 Goebel, Gary 130,216,190 Goebel, Nancy 13,69,166,269,192 Goetz, Deanna 12,69,156.157,42 Gold, Laura 69 Goodale, Ed 69,80,157,181 Goode, Bruce 69 Goode, Sharon 131 Goodman, Shelie 69 Goodnight, Mary 124 Goodwin, Sarah 126 Gordon, Daniel 162 Gordon, Mr, Les 40 Gordon, Richard 69 Gordon, Ruth 39.69,87,183,266,42 Gorge, David 69 Gorge, Debra 69 Gorter, Steven 133 Goswick, Anthony 118 Goswick, Jean 69 Gouverneur, Marcia 69 Grafton, Melinda 10,13,133,139,159,167,239, 193,200 Graham, Darcy 174,141 Graham, Marilyn 130,162,185 Gramkow, Barb 70 Green, Amy 201 Green, Deborah R, 122 Green, Diane 119 Green, Don 70 Green, Jeff 135 Green, Kristina 69,70 Greene, Beth 197,200,126 Greer, Lauretta 120 Griffee, Becky 135,193,140 Griffin, Debbie 2,70,198,163 Griffin, Margaret: B.A.: Typing l and ll 36 Griffin, Michael 131,136,214 Griffith, Harold P.: A.B.g M.A.3 Counselor, College Night 26 Griffith, Jeff 117,216 Grimes, Rebecca 70 Grimes, William 140 Grimm, David 139 Grimstad. Norman 115 Grzanich, Bill 70 Guerrero, Paul 131 Guinn, Valerie 70 Gulley, James 216,124 Gunnerson, Teresa 139 Gustafson, Jeff 70,193 Gustafson, Marla 116 Gustafson, Sally 117,163,189 Gustafson, Steve 131,216 Guy, Barbara 133,189 Guy, Jim 70,161,163 h Haake, Rebekah 140 Hack, Joe 70 Haddock, Dan 70,161 Hagberg, Caroline 70,182, 163,42 Hagberg, Milton E.g AB., M.S., College Algebra and Trigonometry, Algebra ll, 28 Hakeman, Dan 71 Hallas, Sharon 134 Hallene, Carol 167,197,238,174,191,20O Halloran, Kitty 122 Hallquist, Laura 13,11,183,191,259,174,192 Hallquist, Vicki 152,197,191,2O0 Hallstrom, Charles 133 Hallstrom, Ellen 119 Hambright, Lee 71 Hamer, Karen 116 Hamman, A. 40 Hamilton, Tom 71 Hamrnar, Thomas 119 Hammer, Richard 125,173,l84,185 Hammerberg, Sue 171,161,163,123,126 Hammerberg, Tom 155,139 Harnmitt,Mer't138 Hammitt, Mike 71 Hanavan, Ron 1O,11,48,49,71,216 Hancks, Mike 71,212 Hancks, Terry 134 Handley, Tim 134,163 Hank, Kathryn 71,182,259 Hankey, John 127 Hanne, Jim 71,156,188 Hanneman, Jan 134 Hansen, Cynthia 71,186 Hansen, David 115 Hansen, George 13,72,166,177,197,190,42 Hansen, William 123 Hanson, Evelyn 72 Hanz, Mark 125 Harder, Jeff 163,131 Harder, Steve 126 Hardi, Diana 136,158 Hardi, Pat 72 Hardi, Timothy 72 Harding, Mona 156,238,121 Harkey, Orville: A.B.. M.A.T.M.: Basic Math, Algebra I, Analytic Geometry, Calculus: 24,28 Harlow, Doris 135 Harmening, Gail 135 Harp, James 137 Harper, Joan 127 Harper, Laurie 126 Harper, Mona 122 Harrah, Susan 72 Harris, Emily 72,152,171 Harris, Hudson 131,215 Harris, Hysonja 136 Harris. June 72,186 Harris, Kyle 127 Harris, Mari 10,11,12,13,48,49,72,157 Harris, Scott 73,42 Harsha, David 10,73,196,212,213 Hart, Debbie 73 Hartley, Mr. Don 24 Hartman, Don 73,116 Hartman, Jane 114 Hartman, Jean 118 Hartson, Greg 73 Hartzell, Kathy 117,200 Hartzell, Steve 73 Harvey, Ellen 116 Harvey, Rickey 73 Harwood, Jan 73 Harwood, Karen 115 Haskins, E. Edward 214,140 Hasty, Bev 74,199 Hasty, William 115 Hauck, Melanie 130,158 Haun, Jeff 125 Hawk, Rodney 74,163,188 Hawkins, Sandra 74,186 Hawotte, Rick 141 Haws, Dennis 133 Haydon, Olive 27 Hayes, Daniel 126 Hayes, Michael 138,214 Haytcher, Mr. Karl 25 Hayward, Dawn 135,158 Haywood, Robert 74,197 Healy, Brian 123 Healy, Pat 74,196 Heater, Hadley 74 Heater, Michael 116 Heater, Paul 74,199,186 Heath, Sandra 140 Heaton, D. 159 Heaton, Roxie 74 Hebdon, Karen 140 Hedegard, Calvin B.: B.A,, M.A., Music: 38,156 Heegan, Sally 137 Heffernan, Patrick 131 Hellberg, Patty 121 Hellberg, Robert 120 Hellebuyck, Ruth 123 Hemmingson, Joseph 132,216 Hendershot, Kristi 74 Hendershot, Mark 114 Henderson, Brenda 134,169 Henderson, David 115,117,125 Henderson, Janice 74 Henderson, John 74,212 Henderson, Pam 74 Hendricks, Danny 118 Hendricks. Debbie 74 Hendrix, Kay 125 Hendrix, Paula 138 Hendrix, Ricky 74 Hengst, Gretel 74 Henninger, Cathy 67,74 Henrichs, Wayne 124 Henry, Ken 115,122 Hensley, Gayle 75,149,157,184,146,147 Henss, Mrs. Geneva: R.N.: B.S., P.H.N.3 School Nu rse: Teacher-Nurse Consultant: Future Nurses-Allied Health Club 34 Henss, Wendy 10,13,66,75,87,152,157,166, 181,196,146,42 Hepner, Carol 130 Hepner, Karen 75.176 Herman, Jeff 134 Herman. Mike 133 Hernandez, Enrico 119 Hernandez, Victor 126 Hernstrom, Kyle 134 Hesser, Audrey 75 Hesser, Carolyn 137 Hinkle, Alan: B.S.: Power Mechanics 36 Hickle, Cora 140 Hicks, Art 75 Hicks, Tom 117 Hile, Sara 130,239 Hill, Duane 138 Hill, Jean 75 Hilligoss, Barbara 114 Hillyer, Beverly 131 Hines, David 214,141 Hingtgen, Paul 195,212,122 Hintz, Nikki 119,173 Hisler, Dave 13,75,100,166,190,197 Hitchcock, Harry 135 Hodgkin, Michele 121 Hodgson, Debbie 75 Hodgson, Terri 118 Hoeltzner, Jane 114 Hoffman, Cathy 135 Hoffman, Douglas 136 Hoffman, Michael 116,162 Hoffman, Michelle 117,154,163 Hoggard, Gwendolyn 138,159 Holgersson, Susan 155,12O,185,147 Holland, Gearldine 76,159 Holliday, Bob 76 Holmes, Bruce 76 Holmes, Jessica 174,192,140 Holmes, Lynn 137 Holmgren, Judith 191,123 Holmquist, Patricia 141 Holroyd, Dan 121 Honsa, Tom 76 Hood, Mrs. Mary 24 Hoogheem, Debra 130,255 Hoogheem, Tim 76,190,168 Hordaerfield, Don 134 Horton, Toni 76 Hotchkiss, Steve 116 Houchin, Tamara 140 House, Norma 131 Howard, Barbara 76,196 Howdeshell, Edie 126 Howell, Debra 131 Hoye, John 131 Hoyt, Bill 76 Hoyt, Dawn 13,76,184,146,147 Hoyt, Kathy 155,139 Hoyt, Michael 127 Hubbard. Lisa 115 Hudson, Martha 76,180 Huennekens, Sandra 140 Huff, Rita 77 Hufford, Jean 77,87,182,173,42 Hugaert, Diane 135 Hugaert, Janilee 77 Hugaert, Steven 31,77 Huggins, Leslie 159,141 Hughes, Barbara 174,122 Hull, Don 116,119 Hull, Jeanette 77 Hull, Patricia 77 Hulse, Delorisp BS.: Chemistry: Pep Club 28, 191,192 Hultgren, Mr. Lamont 25 Hulting, David 116 Hulting, Les 141 Humphrey, Bill 120 Humphrey, Lynn 10,13,49,77,166,196,238. 263 Hundley, Raymond 137 Hunt, Carol 130 Hunt, Rickey 77 Huntington, Barbara 138 Huntley, Harold 40 Huntley, William E, 77,188 Huntoon, George 124 Hunwardsen, Karen 131 Hutton, Mary 139 Hyink, Dorothea: B.S.i Shorthand, Transcription 36 I Ide,PatJ.135 lmpens, Jeffrey P. 77 Impens,PatJ.137 lngelson, Jeannine 117,152,267,174,191,192 Ingram, Deborah 77,162 lnskeep, Robert 125 Irwin, Cindy M. 77 lwatake, James E. 140 lzer, Steve 122 I Jabaay, Jack 135 Jackson, Marvin 77 Jackson, Patricia 155,191,120 Jacobs, Laurie J. 125 Jahns, Martha G. 125 James. Cynthia C. 132 Jamieson, Joann J.122 Jamieson, Laurie 77,180,196 Jamison, Cherie A,137 Jamison, Scott 190,119 Jamison, Vickie J. 133 Janecek, Richard D. 116,77 Janoski, Lenore T. 198,125 Jarrad, Dennis L. 155,163,141 Jared, Tim 120 Jauhola. Jauhola, John 162,122 Susan 77.92.181 Jenkins, Mr. Arthur S, 25 Jennisch, Sharon 77 Jensen, Becky 77,199,192 Johnson, Johnson, Johnson, Johnson. Johnson, Johnson, Johnson, Johnson, Ann M. 125 Brian A. 78,197 Charles 78 Craig 78 Cyndi 120 Deborah L,133 Dwylan 78,196 Edward A. 119 Johnson, Frances BJ A,B., M.A.: Special Education, Prevocational Coordinator, Occupational Study, U.S. Constitutions Safety 38 287 - Johnson. Johnson, Gary 125 Georgette 126 Johnson, Glen G.123 Johnson, Jackie J. 136.158 Johnson, Jeffrey D. 131 Johnson, Joyce E. 122 Johnson, Julie K.115,173 Johnson, Kathy M. 117,125 Johnson, Kendra 141 Johnson, Kevin C, Johnson, Laureen K. 115 Johnson, M. 30 Johnson, Marci L. 128,141 Johnson, Marilyn K. 140 Johnson, Mark 78,187 Johnson, Mark S. 117 Johnson, Mike K. 78 Johnson, Mike 190,78 Johnson, Milton D. 136 Johnson, Monique A. 132,217,173 Johnson, Nancy L. 139,158 Johnson, Pam J. 137,174,200 Johnson, Patrick S. 118 Johnson, Phyllis: B.S., M.A.: Algebra ll, Geometry 22,28 Johnson, Randy L.126 Johnson, Richard A. 135,214,163 Johnson, Robin M. 136 Johnson, Steve C. 214,140 Johnson. Johnson, Johnson, Johnson, Johnson, Terri 78 Vanessa J. 78 Vonda 122 Wayne W, 116 Wes: B.A.: Physics and Chemistry 28 Johnston, David G. 78,43 Jones, Bob 139 Jones, Bob G. 135 Jones, Charles 119 Karlin, Amy 121 Karlix, Sandra 116 Karstens, Marianne 10,13,167,191,200,125 Kastelic, Karen 121 Kauzlarich, Carol 115 Keeler, Dale 78,212 Keeley, Doug 137 Keenan, Vickie 78 Keeton, Sharon 120 Keim, Mrs. Eleanor Jane: B.S.: M.S.: Clothing 24,38 Keller, Steve 167,212,213,127,112 Kelley, Sandy 138 Kelly, Doug 138,214 Kelly, Randy 79,215 Kendall, Lee 79,162 Kendall, Lucille 27 Kennedy, John 79 Kennedy, Judy 79 Kennedy, Sandro 137,214 Kephart, Kim 132 Kephart, Kyle 79 Kerckhove, James 79 Kersofsky, Cindy 141,173 Kerr, Denise 130 Kettering, Mike 79,208 Kettler, Bob 122 Kiehr, Debbie 79,104,199,204 Kiesele, Jan 134,159 Kilby, Robbi 125 Kimpe, Joe 133 King, Linda 79,186 King, Michael 134,214 Kinkead, Diane 132,167,253,174,193,20O Kinkead, Glenn 79 Kinnan, Ken 135 Kinsey, David 79 Kinsey, Keith 114 Knittle, Nancy 80 Knittle, Rick Lemon, Edward: A.B.M.A.: Athletic Business Manager, Manager of Wharton Field Knock, Richard 135,162 Knock. Sue 80 Knowles, Margaret 127 Knudson, Cindy 80,186 Koberstein, Terry 114 Koehler, Cindy 134 Koeppel, Frank 124 Kofski, Tom House 34 Lemon, Jane 152,120 Lemon, Mary 119 Lenc, Debbie 114,161 Lerschen, Donna 82 Lerschen, Mary 137 Lesley, Elmer 41 Lester, Bob 82 Koker, Goldie 41 Kondora, David 116 Lester, Dave 13,82,156,196, 197 . Frances 82 Lester Kondora, Terry 214,140 Korch, Bruce 116 Lester F , Harry: B.S,: Gymnastics, Wrestling, itness 34 Koresko, Doreen 8O,183,192,42 Koresko, Patricia 137 Kostka, Harold 81,156 Kotez. Alma: B.S,: Shorthand, Typing 20 Lester, Judy 136 Leuntjens, Barb 152,191,200,126 Leuntjens, Bill 139 Lewis, Dickp M,A., B.A.: Plane Geometry, Algebra ll: Ass't Track Coach 28 Kouris, Andy 162 Kraker, Terry 131 Krambeck,Tim 39,115,117 Lewis, Lewis, Marcia 10,13,82,166,196,238,2OO Mark 13,82,196,19O Kramer. Richard 215,121 Kratzberg, Cheryl 141 Krebs, Kay 133 Krebs, Lynda 81 Kremer, Diane 140,189 Kron, Nancy 116,197 Krouth, David 81 Krueger, Bob 81,162 Lewis, Tom 116 Lewis, William 134 Liberty, Susan 120 Libey, Barbara 82,196,192,200 Libey, Jim 214,140 Liljeberg, Sally 82 Lillybeck, Eric 127 Lindquist, Mary 83,186 Krulik. Kruse. Kruse, Kruse. Kruse, Michael 81 Cindy 81,152 Karla 120 Kristine 81 Michele 81,166,183,192,42 Kuberski, Carol 81 Kuberski, Maryann 140 Kuehl. Kris 81,103,162 Kuffler, Thomas 81 Lindsey, Brad 137 Lindsey, Martin 156 Lindsey, Treva 83,158 Linzer, Victor 123 Lipke. Dave 138 Long, Mark 83 Long, Sandra 115 Long, Vickie 126 Longmire, Bob 83,259,190 Lawrence Kurtz. Scott 139 Kusnierczyk, Thomas 123 Lopez. Lopez. Lopez, Lopez, Lopez. Lopez. Benedict 83,212,213 Elsa 135 Geno 122 Jean 194 Rosa 83 Tony 114,126 Labotte, Charlene 117,158 Lackey. Roy 81,188 Lambert, Dennis G. 81 Lambrecht, Mike A. 135 Landry, Janet M. 122 Landuit, Joe 122 Landui t. Lois 81 Lane,Chris 166 Lange, Langill Larson Walter J. 123,185 . Holly J. 131 .Gary W,81 Larson, Larinda 81,188 Larson, Nancy J. 193,139 Larson, Richard J. 115 Lorance, Valerie 140 Lord, Diane 159,140 Lord, Maribeth 130,193,200 Lorenz, Gayle 83 Lorenz, Richard 123 Lorig, John 141 Lothridge, Dena 135 Lovell, Len 83 Lovestrand, Vicki 133 Lucas, Ann 161,162,124 Lukens, Margaret 127,147 Lundahl, Roger 83,197 Lundeen, Dan 83 Lundgren, Sally 152,167,197.125,112,184 Lundholm, Jean: B.S.: Physical Education: Jones .Cheryl A. 140 Jones, Jones, Jones, Jones. Jeffrey L. 131 Karen R. 130 Keith E. 130 Patti J. 78 Kinzey, John 135 Kipping, John 79 Kirchoefer, Barbara 79,192,184 Kirchoefer, Bob 127 Kirschbaum, John 158,141 Larson, Susan J. 130,174,193 Larvenz, Dennis R. 81 Lasley, John W. 157,125 Latham, Gail L. 81,196 Laughead, Don A. 122 Lauth, Jane E. 132,158 Lavin, Stephen P. 212 . Jeff L. 133 ,Jeffrey T. 214 Lawrence, Lawrence. Lawrence, , Terry 117 Lawrence Lawrence Packie 82,197 Richard 212,119 Rocky 131 Jones, Peg G. 141 Jonson, Rick 133 Jordan, John 131,162 Joseph, David W. 120 Joseph. Scott L. 17,1 16,148,149,156,157,147 Julius, John L.: B.S.: Biology: Diving Coachg Letterman's Club, 9th Grade Football 28,194 Jump, Marybeth E. 131,253 Jump, Robert K. 212,125 K Kable, Patricia 78 Kachevas, Judy 78 Kachevas, Sandy 118 Kaiser, Gary 139 Kakavas, Becky 135,126 Kalomas, Ann 78 288 Kirschbaum, Tom 157,120 Kissell, Debbie 126 Kistner, Dale 159,139 Kistner, Don 79 Kitt, Rex 80 Kizer, Dave 80 Kizer, Jennifer 139,163 Klann, Cathy 122 Klann, Dave 39,8O,162 Klansek, Marcia 115 Klier, HerbertC.: B.P.E., B.S., M.S.3 Safety and Driving 34 Klier, William M.: A.B.: Pool Manageri Gymnastics 34 Klingborg, Karen 119 Kloster, Mike 127 Lawton, Sherri 133 Leach, Stan: BS.: Art, Crafts, Sophomore Class, Junior Class, G.B.U. 38,129 Leaf, Bob 82 LeComte, Margo 82 LeCompte, Pam 134 Lee, Bill: B.A.: Spanish, Sociology: Spanish Club ADC 32 Lee, Bill 82 Leech, Andrew 125 Leech, Sally 82 Leeson, Roger 136 Leftler, Diane 116 Leffler, Mike 82,208 Letler, Louise 112,238,120,112 Lehman, Kathleen 127 Klugger, Steve 80 Knees, Elizabeth 141,173 Knight, Donna 124 Knight, Teresa 137 LeMaster, Jill 82,83,156,177,196 LeMaster, Kim 135 LeMaster, Nancy 82 LeMaster, Steve 1 18 Nereids 34 Luster, Nancy 155,174,198,191,122 Lynch, Ricky83,161,162 Lynn, Gretchen 117,173 Lynnon, John 126 Lyseng, Connie 135 IT1 Machado, Rebeka 118 Mack, Kathleen 131 Mack, Mary 83 Maddelein, Robert 130 Maddox, Don 214,131 Maddox, Frances 131,158 Madison, Mary 132 Madison, Peggy121 Maeglin, Kurt 115 Mahar, Terisa 133 Mahieu, Mark 133,214 Mahoney, Dawn 119 Maitland, Jimmy 127,185 Maitlen, Alan 215,140 Mallek, Kathleen 126 Malmstead, Kathy 83,157 Malmstead, Ronald 136 Malone, Yvonne 134 Manasco, Kathy 131 Manchester, Lindsey 120 Maniscalco,Giana134 Manley, Patty 114 Manning, Gene 83 Marckese, Patricia 122 Marion, Denise 116 Markin, Larry 84,215 Marks, Ron 139 Marlin, Richard G. B.Ed.: Vocational Auto Mechanics 36 Marolf, Steve 137 Maroon, Karen 154,162,140 Maroon, Marcilene 84,187 Marriott, David 115 Marriott, Geoffrey 214 Marriott. Mark 137 McDaniel, Michael 85 McDermand, Mike 116 McDermott, Betty 141 McDonald, Donna 85 McDonnell,Jean 137,158 McDonnell, Steven 85 McDow, Beth 135,159 McDowell, Denny 138 McFarland, Kevin 85 McGill, Cathy 85 McGill, Ronald 122 Marsell, Mark: B.S.: Driver Education Safety 34 Marshall, Carl 41 Marsoun, Milton 126 Martens, Mary 84,161,162 Martin, Brenda 84 Martin, David 131,163 Martin, Theodore 132 Martinez, Lawrence 84 Martinez, Tony 161 Marzolph, Wayne 117 Masengarb, Steve 115 Masias, Rick 114 Mason. James 84,216 Mason, James 136,216 Massey, Mike 84 Maston, Shane 120 Matalik, Debbie 84 Math, Christine 132,158,193 Mathias, Corene 161,139 Mathias, Jackie 84,161,146,42 Mathias, Laura 137,159 Mathias, Robin 140 Mattecheck, Eugene 116 Matter, Kathy 84,196,197 Matter, Richard: B.A.: Driving, Driver Ed.: Sophomore Football Coach 34,214 Matter, Vicky 152,200,120 Matters, Barb 134 Matters, Susan 85,188 Matykiewicz, Alan 177,141 Matz, Deborah 162,125 Maxson, Jim 135,216,131 Maxwell, Bill 163 Maxwell, Vickie 120 Mayes, L. L.: M.A. and Voca. Cert.: Vocational Machine Shop 37,36 Mayfield, Jack 120 McCain, Gary 85,188 McCandless, Mr. Jesse M. 274 McCarthy, Dennis 127 McCarthy, Kathy 85,159 McCarthy, Lynn McCarthy, Mary 137 McCIarrinon, Linda 126 McClean, George 85 McClean, Greg114 McClean, Karen 85 McClelland, Patti 85,196,192 McClung, Don 85 McColl, John 214 McColl, Mike 159,141 McCoy, Robert 85 McCraw, Judy 140 McDanel, Rick 85 McGovern, Christine 133 McGrew, Dwight 85 McHenry, Barbara 85 Mclnerny, Sara: B.A.: American and World History 32 Mclntire, Chris 85 Mclntire, Danny 85 Mclntosh, Kathy 136 McKarty, Joe 126 McKay, Darcy 118 McKay, Phillip 119 McKay, Rob 131 McKean, Patti 85,156,198,192 McKee, Kevin 85 McKee, Paul 132,163 McKinley, Lane 115 McKinley, Paul 86 McLain, Kurt 116,212 McManus, Nancy: B.S., M.S.: Plane Geometry, College Algebra and Trigonometry 29 McMillin, Brian 125.126 McMinn, Ralph: Ed.B., M,A.: Counselor 26 McMinn, Thomas 190,120 McNeal, Barb 131 McNeely, Diana 86 McNeely, Jim 131 McNeil, Mitch 130 McNeill, Greg 86 McRoberts, Mike 137 McSorley, Ellen 141 McVey, Diana 119 Meersman, Amy 13,86 Meersman, Mike 130,214,162 Meier, Karen: B.A.: Government, World History 32 Mier, L. 116 Mellgren, Christine 115 Melton, Phyllis 141 Mendoza, Norma L.: BS.: Spanish 33 Mercer, Arthur: B.A.: Swimming: Swim Team 35 Mercer, Dana 125 Meredith, Amanda 132 Meredith, Christopher 124,188 Meredith, Richard 86,158 Merrick, Cathy 125 Messmer, Lori 86,180 Metcalf, Jim 133 Metz, Sarah 86,152,153 Meyer, Kurt 125 Meyers, Linda 86 Michael, Jeff 124 Michaelsen, James 127 Michl, Mark 86 Mier, Linda 116 Milefchik, Dale 86 Milefchik, Ronald 134 Miles, Lynn 139 Miljush, Stanley 86,187 Miller Miller Miller, Miller Miller Constance 116 David 214 Doreen 86 Ellen 141 Jack L.: B.A., M.A.: U.S. History: Liberty and Law 33 Miller Miller Miller Miller Miller Miller Miller Miller Miller Miller Jeff 159,214,161,140 Jim 86,171,180,19O,43 Kathy 86,159 Marlise135 Martin 86 Michael 86,212 Mike 87,149 Neil 134,214 Ronald 125 Tim 134 Millman, Richard 126 Millman, Mr. William 25 Mills, Steven 115 Milroy, Jon 140 Milroy, Susan 87,196,238 Minch, Randy 138 Minear, Charles 115,158 Minear, George 115 Misfeldt, Gary 119 Misfeldt, Jim 87 Miskowicz, Herman J.: BA., M.A.: Physical Ed.: Varsity Football and Wrestling 35,213 Mitchell, Barbara 191,127 Mitchell, Catherine 131 Mitchell, Edward M.: BS. and M.S.: Office Occupations: Office Occupations Club 186.36 Mitchell, Lois E,, B.S., M.A.: Typing, Shorthand 36 Mitchell, Margo 135 Mitchell, Patricia 137 Mitchell, Paula 127 Moritz, Cheryl 135 Morling, Pamela 87,88,182,259,43 Moross, Steve 88 Morrill, Robin 119 Morrison, Deborah 115 Morrison, Sandra 156,120 Morse, Steve 133 Mortier, J. F.: B.S. in Ed,: Graphic Arts 36 Mortier, John 125 Morton, Donald J.: B.A. in Psychology: World History, Psychology, Varsity Footban 33,213 Mountain, Laura 88,197,270 Mountain, Melody 130 Mudd, Brenda 121 Muldoon, Mike 139 Muldoon, Sue 88 Mullarkey, Jim 88 Mullarkey, Valerie 88,157,268 Muller, Dave 135 Mullikin, Lynda 115,158 Mundell, Keith 122 Murdock, Jeffrey 88,161,163,184 Murphy, Debbie 117 Murphy, Timothy 141 Myers, Phyllis 27 Fl Nagel, Jim 89 Nahrgang, Kay: BS.: Typing 36 Naslund, Martha 125 Natsis, Georgia 136 Navarro, Daniel 187,118 Navarro, Suzanne 130 Navarro, Theresa 89,186 Nawrocki, Cheryl 198,131 Neaves, Debbie 132 Nehlig, Jean Marie 141 Neighbor, Dave 89,155,156,157, 196 Mitchell, Sandra 87,196,199,192 Mitchum, Walter 139 Mitchum, Williams 131 Moburg, Donna 122 Moeller, Randy 126 Moeller, Terry 116 Moffitt. Mike 131 Moffitt, Mrs. Virginia: B,A.: English 31 Monroe, Allen 87 Monroe, Nancy 140 Monson, Steve 121 Montag, Steven 140 Montague, G. Bill 87 Montgomery, Rick 87 Moody, Angela 152,156,121 Moon, Beverly 126 Moon, Bill 134 Mooney, Thomas 87 Mooney, Troy 133 Moore, Christine 58,87,156,182,267,147 4 . - ,iw We -V . , Moore, Robert: B,A.: U.S. History, Gov't.: Sophomore Baseball 33 Moran, Janet87,187 Moran, Mary 134,158 Morehouse, Sue 88 Morford, Glen 88 Morgan, Eva 13,88,197,2O0 Morgan, P. 40 Morgan, Ron 137 4 Morgan, Sally 124 Nelson Nelson Nelson Nelson Nelson Barry 29,214 ,Carol 135 .Cheryl 89 Chris 89 Deborah 158 Nelson Diana 133,159 Nelson Dick 57,89,181 Nelson Eric 10,89,166,190 Nelson Jeff 137,159,167,214,190,128 Nelson,Joyce141 Nelson Mr. Hollis 25 Nelson Paula 135 Nelson RandyC.89,195,216 Nelson Nelson Nessell. Rick 1O,89,190,119 Sue: Social Studies 33 Dorothy E.: B,E., M.S.: Shorthand l Accounting ll, General Records 36 Neumann. Barbara: B.S., M.A.: English 31 Nevell, Miss Sue 22 Nichols, Mrs. Lorraine 24 Newberry, Debbie 119 Newberry, Terry 89 Newburg, Becky 89 Newell, Mike 71,89,197 Newlin, Sandi 137 Newton, Kenneth 125 Newton, Max 140 Nicholson, Jeffrey 163 Nielsen, Julie 137,173 Nipper, Betty 159,140 Nipper, Rich 115 Nitschke, Martin 134 Noah, Bruce 133,177 Noble, Roger 115 Noce, Mary 119 Noel, Pati 136 Nolen, Debbie 120 Norlen, Paul 155,157,123 Norlin, Richard 89 Norris, Pam 89,192 Norton, Mary 139 Nusbaum, Mrs. Tom: B.A.: English 31 Nuss, Linda 116 O O'Brien, Joanne: B.A.: Reading Lab 31 Ocken, Peter 117 O'Connell, June: A.B.: English 31 O'Donnell, Kathie 89 Ogan, Jim 216 Ogden,Jill 89,198 289 Ohlsen, Mark 39,89,196,197,146 Olberts, Kathleen 89,183,217,192 Olberts, Mark 216,131 Oleson, Julie 117,152 Oleson, Stewart 190,119 Oliva, Lupe 139 Ollar, David 214,141 Olson, Barbara 133,163 Olson, Betty 27 Olson, Brian R.135,216,163,14O Olson, Brian S. 39,135,216,258,161,162,140 Olson, Carolyn 90,196,192 Olson, Cindy 90 Olson, David 124 Olson, Debra 13,9O,166,183,217,161,43 Olson. James 162,140 Olson, Rebecca 90,157 O'Neill, Mrs. Frances 24 O'Neill, Steve 90 Ontiveros, Mike 90 Oppenheimer, Linda 90,183,259,192,43 Orendorff, James 90 Orey, Pamela 90,199 Oros, John 132 Orsborn, Keith 125 Ortiz, Francisco 187,122 Osborn, Wanda 131 Ostrand, Donald 90 Ostrand, Melalie 158,119 Otts, Cynthia 90 Overton, Frank 120 Owen, lva D.: B.A.: Special Education 38 Owen, Margaret 126 Owen, Martha 115 Owen, Russanne 90 Owens, Mark 159,141 Owens. Merritt 90 Owens, Shelie Goodman 69,188 D Padesky, Mark 90,195,215 Padilla, Andrea 131 Page, .lan 159,139 Page, Patricia 90 Palmer, Carol 125 Palmer, Mike 123 Palmer, Sheila 90,162 Panicucci, Gordon 216,125 Pappenhausen, Jeff 135,214 Pappademos, Mike 159,214 Pappas, Thomas 126 Padesky, Amy 115 Peterson, Ann 116 Peterson Bill 135 Peterson, Debi 92,196,197,2OO Peterson, Diane 92,152,262,192 Peterson, Eric 121 Peterson, Kathy 130,193 Peterson Kevin D. 216,141 Peterson Kevin K. 138 Peterson Kirsten 122 Peterson Mark 92 Peterson Ralph J.: B.A., M.A.: World History, Asst Sophomore Football Coach 33,214 Peterson, Randy 126,210,212 Peterson, Ted 92 Pettavino, Mrs, Donna: B.A.3 Physical Education, Girls Tennis Team 34,217 Pettit, Ann 93,181,199,248 Pfeiff, Jane 157,198,124 Phelps, Don 135,214 Phillips, Julie: B.A.: English 31 Phillips, Ray 119 Phillips, Robert 93 Phillips, William 93 Piasecki, Andy 125 Piehl, Mrs. Helen: A.B.: French, Foreign Language Department Head 33 Piercy, Connie 117,152,191,200 Pikuza, Dennis 115,212 Pilichowski, Alan 93,212 Pirkl, Sharon: B.S.: Girls PE.: Cheerleaders, l' Radosevich, Jodee 93,184 Radovich, Mr. Steve 24 Raes. Jeff 94 Rahn, Kurt 115 Randall, Charles Raney, Dan 94 Raney, Kathleen 125 Raney, Mary 119 Rangel, Silvia 135,159 Ransdell, Theresa 94 Rasche, Holly 94,198,271,192 Rasche, Nancy 158 Rash,Joni 174,163,141 Rasmussen, Steve 116 Rasmussen, Sue 127,189 Rea, Carolyn 94 Rea, Steven 94 Reakes, John : B.E., M.A.: BSCS Biology: Ass't. Science Club 29 Reberry, Sue 135 Redman, Danny 126 Reed, Cherie 94 Reed, Roger 134 Reeder, Terry 136 Reese, Jane 94 Reese. Peggy 133 Reger, Linda 136 Reid, Jacqueline 94 Reingke, Gary 138 Reinhart, Gary 125 Reinwein, Liz 141 Reischmann, Janis 132 Rempe, Roger 177,215 Renner, Rick 125 Rettig, John 94 Rettig, Ronald Retz, Jeffrey 94,157 Reyes, Frank 116 Reynolds, Beverly 126 Reynolds, Judi 94 Reynolds, Mr. Melvin L. 25 Reynolds, Michele 131,157 Rhodes, Dennis 124 Rhodes, Doug 137 Richardson, Daniel 137,214 Richardson, Eugene 139 Richmiller, Dawn 137 Riddle, Julie 157,167,200,123 Riddle, Mike 94,181 Ridnour, Richard 116 Roelens, Pat 95 Rogenski, Natalie 41 Rogers, LaDonna 139 Rogers, Marsha 132,162 Rogers, Richard 163,141 Rogers, Rick 95 Rogers, Shirley 95 Rohrbach, Steve 134 Rohrer, Kent 135.158 Rohrer, Patrice 133 Rollinger, Harley: B.S.: American History Football Coach 33,210 213 Roman, Cynthia 197,200 Romero, Michael 130,214 173 Romo, Teresa 122 Rosales, Phil 95 Rose, Sandy 123 Rose, Steve 125 Roseberg, Betty: B.A., M.A English 30 31 Rosenberg, Sheree 134 Rosenthal, Leith 96.147 Ross, Craig 127 Ross, John 115 Ross, Margarite 27 Ross, Mike 137 Ross, Pat 137 Ross, Victor J. Jr,: B.A., M A Principal 26 Rosson, Teresa 140 Rotch, Paula 131 Roush, Dewayne: B.S. Ed. English Speech Debate, Forensics, Thespians 31 Roush, Joseph 96,187 Routt, Robert 135,214 Ruberg, Joseph: B.S.: Accounting Swim Team 36,218 Ruberg, Tim 131 Parish, John 91 Parker, Connie 91 Parker, Curtis 140 Parker, Ena 91 FarkinParker, Larry 181 Parker, Linda 114 Parker, Lynn 91 Parker, Pam 91 Parks, Christine 139 Parks, Russell 212 Parmentier, Mike 91 Parnell, Mrs. Nancy: B,A,: Family Living: Home Ec, Club 38 Parr, Donna 138 Parsons, Pat 91 Partridge, Mrs. Marjorie: B.A., M.A.: Art 38 Passini, Dianne 91 Patch, Patricia 117 Patch, Priscilla 200,131 Patterson, Jeffrey A. 136 Patterson, Jeffery D. Patton, Judi 131 Paul, Jon 114 Pauley, Doug 124 Paulin, Paul 135,216 Payden, William 133,190 Peak, Bill 134 Peak, Daniel 120 Pearce, Dave 92 Pearsall, Shirley 115,154,1 Pearson, Charles 92,196 Pearson, Debra 92,152 Pearson, Melina 119 Pearson, Mrs. Roberta 25 Pendelton, William 40 Perez, Herlinda 119 Perkins, Donald 176,125 Perron, Steve 134 Person, Doug 92,183 290 Pep Club. GAA, Girls Golf35 Plitt, Maureen Karen 21,93,184 Pobanz, Randy 93 Pond, Gary 131,159 Poppy, Gary 93 Poppy, Raymond 118 Porter, Debbie 93 Porter, Kathy 156,186.93 Porter, Steve 139 Posateri, Lori 93 Possin, Marc 123 Potter, Roger: B.S..: Athlet Director 26 Poulos, Mark 133,214 Powell, Bruce 93 Powell, Debbie 120,189 ics: Athletic Powell, Jane F. 93,157,183,198,43 Powell, Paul 138 Powell, Penny 29,93,184 Powers, Kevin 140 Powers, Susan 93,152,156 Preston, Joy 93 Prosser, George 93 Ptak, Michael 114 Pulfrey, Kay 93 Purse, Todd 121 Pyland, Ron 93 Pynckel, Tim 139 Cl Quick, Ronald 133,214 Quick, Susan 134,239 Quinlan, Marty 159,126 Quinn.Joe Quinn, Leo 132 Quinn, Margaret 116 Quinones, Carmen 93 Quane. Terry Ridnour, Terri 114 Rigeman, Sally: B.S.: Biology 29 Rigg,DuEthan14O Rigg, Trent 125 ' Ringquist, Miss Marie 24 Ripley, Pa ul41 Rippey, Shari 141 Rita, George 94 Rives, John 94,212 Rizor, Mary 121 Rizzolo, R ichard140 Rizzolo, Thomas 94 Robbins, Jill 116,158,198 Roberts, Bill 117 Roberts, Candance 119 Roberts, Chris 140 Roberts, Sue 95 Roberts, Tom 138 Robertson, Bob 140 Robertson, Bernard 95 Robertson, Greg 131,158 Robinson. Robinson, Robinson: Robinson, Roche, De April 130 Emmett 40 Michael 122 Randall 95 bra 95 Roche,Jim 133,139,214 Rochotzke, J. 114 Rock, Rob ert2l2,127 Rockafellow, Dr. Theadore F, 24,25 Rockwell, Candia 135 Rockwell, Shawn 139 Rockwell, Shelley 139 Rockwell, Teresa 122 Rodell, Greg 95 Rodriguez, Janet 122 Roegiers, Steve 133 Roelens, Dennis 125 Roelens, Michael 95 Rudolph, Marcus 136,161 Rudsell, Ross 96,156 Ruge, James 214,131 Ruhs, Mark 96,177 Ruhs, Martha 96,154 Rulz, Christine 116 Rumler, David 96 Rumler, Rick 140 Rursch, Jane 137,239 Russell, Diane 124 Ruud, William 96,156,197 Ryan, Patrick 96 Ryan, Steve 135 Ryder, Mary 115 Ryder, Regina 97 Rynott, Mike 138,214 Rynott, Stanley 135 Ryser, Fred 158,141 Ryser, Richard 97,159 S Saelens, Mr. Robert G. 25 Safe, Jill 161 Sage, Rick 119 Sagon, Edward 214,139 Saint Dennis, Pat 125 Sale, Marc 19,87,97,163,185 Salem, Ed 139 Salisburg, Cedric: B.S. and M.S. of Ed,p Machine Metals 36 salmon, Robb 97 ' Salsman, Rick 124 Salzmann, Sue 97,197,200 Samuelson, Susan 125 Sandberg, Janet 139,201,193,20O Sanderson, Deloris 97 Sanderson, Sheila 158,140 Sandholm, Dave 118 Sandholm, Linda 131,158 Sands, Darlene 97 Sandvick, Katherine 131 Sansale. Rebecca 97 Sappington, Netris 97,189 Sarver, Randy 133 Saunders, Susan 97,157,197 Schaaf, Karen 138 Schaefer, Rita 117 Schaeffer, Bill 124 Schaeffer, Kathy 155,191,122,169 Schafer, Ronald 97 Schaff, Jay: B.S,, M.S.: Assistant Principal 27 Scanfish, Linda 133 Schatteman, Gina 100,177 Schatteman, Marta 87,97,107,152,181,43 Scherer, Theresa 117,155,197,198,185 Schless, Nancy 120 Schilb, Steve 115,212 Schimmel, Leslie 141 Schinckel, Debbie 131 Schinckel, Linda 120 Schlaes, Deb 198 Schlundt, Kent 131 Schmidt,Valerie135 Schnabel, Scott 121 Schnoebelen, Mike 97 Schnowske, Frieda: B.A., M.S. in Ed.: Counselor 27 Schold, Linda 97 Schorpp, Jill 97 Schourek, Janet 124 Schourek, Louise 133,158 Schrempf, Nancy 97,152,197,2OO Schrempf, Pam 117,191 Schrempf, Teresa 134 Schroeder, Charlie 125 Schroeder, Dirk 21,79,97 Schroeder, Scott 139 Schuett, Jeff 216,122 Schultz, John 134 Schultz, Kathleen: B.S,, M.A.: World History: Government 33 Schumacher, Barb 121 Schumacher, Robin 127 Schwabe, Greg 116 Schwartz, Deborah 97,156 Schwarz, Dwayne 132,158 Schweitzer, Susan 123 Schwenneker, Bruce 97 Scobey, Vicky 97 Scott, Mrs, Ardeth 24 Scott, Diedre 126 Scott, Pat 118 Serres, Randall 140 Sevick, Mrs, Beverly: B.S,:Typing, Notehand, GOP, TOP 36 Shah, Barbara J.: B.A.: U.S. History 33 Shannon, Billie Jo 98,152,192 Shannon, Mrs. Pat: B.S.: Dance, Gymnastics: GAA, Contemporairs 35,152 Shattuck, Alan 162,119 Shaw, David 117,215,128 Shaw, Dianne98 Shawgo, Lucy: B.A,, M,A.: English: American Lit.: 'iKaleidoscript 31,184 Sheesley, Sandra 98,156 Sheets, Debra 122 Sheets, Don 98 Sherry, Sylvia 161,163,120 Sherwin, Andrew 120 Sherwin, Peter 117 Shicks, Oscar40 . Shicks, Pearl 41 Shlnn, Richard 114 Shinneman, Phylita: BS., M.S.: English 31 Shipe, Brenda 177,197,123 Shipley, Barbara 41 Shipley, Gene: B.A.: U.S, History: Cross Country, Track 33 Shipley, Kimberly 152,197,2oo,126 Shipley, Mark 163,140 Shipley, Steve 159,141 Shipp, Rhonda 114 Shlaes, Debra 98 Shlaes, Marc 125 Shoemaker, Barb 95,98 Shoemate, Dennis 98 Short, James 122 Short, Ted 99,196,212 Sidlinger, Joyce 137,162 Sloan, Reita 121 Small, John: B.S.: Weilding 37 Smallwood, Pam 134,159 Smarsty, Ron 99 Smarsty, Verna 27 Smart, Craig 99 Srniddy, Leslie 122 Smiddy, Valerie 133 Smith, Ann 136,125 Stohl, Tex 101,194,212 Stokes, Debra 17,116,155,124,184,147 Stolting, Roger L, 101 Stone, Dr. Alex 103 Stone, Bill 139 Stone, Mike 101,187 Storbeck, Clyde: B.A.: Typing, Business Law, Business Education Department Head 37 Stotlar, Emily: B.S.: M.S.: Counselor 27 Smith, Carol 99 Smith, Catherine 99,186 Smith, Charles 99,187 Smith, Connie 99 Sn'iith,Jeffrey 115 Smith,Julie120 Smith, Larry 99 Smith, Linda S, 134,125 Smith. Marilyn 132,217 Smith, Marina 159,119 Smith, Michael E. 117,120 Smith, Michael L. 99,197 Smith, Patrick 138,140 Smith, Patty 135,159 Smith, Paul 119 Smith, Paul 126 Smith, Phil 132 Smith, Randy 119 Smith, Mr. Ray 24 Smith,Tony 133 Smith, Vivian 41 Snider, Linda 38,100 Snyder, Paula 125,189 Snyder, Phyllis 131 Snyder, William 134 Soethe :Ann 197,126 Soethe, Jean 137,162 Soethe, Joseph 100,197,212 Soliz, Bruce 139 Strait, Shelia 132 Strandlund, Mike 159,120 Strandlund, Pam 135,158 Strandlund, Roger 190,139,173 Strayhall, Gary 126 Streeter, B,: Library: 30 Streit, Susan 187,124 Strom, Randy 101 Stromer, Laurel 138 Stromgren, Sandra 131 Strong, Dan 131 Strother, Becky 115,157 Sturgis, Barbara 122 Suess, Deborah 119 Suiter, Ruth 137 Sullens, Theresa 141 Sullivan, Brian 135 Sullivan, Dennis 136 Sullivan, Michael 120 Sullivan, Michele 140 Sumner, Susie 147,168,184,18,51 87 101 182,43 Sundberg, Carl: M.A,, B.S. in Ed.: World History, lntramurals 33 Sunderland, Nancy 101 Surber, Margaret 116 Surdez,Allen 212,118 Swafford, Sandra: B.A. and M.S. in Ed Typing Searle, John 98 Siegfried, Craig 116,194 Scritchfield, Craig 115 Scudder, Patricia 138 it Searls, Cynthia 98 Sears, Nancy 125 Sears, Torn 98,197 Seda, Jim 134 Sedlock, Joe 135,158 Seeds, Faith 4,122,152,191 Seeds, Mr. Robert G. 25 Segura, John 18,98,208 Seibert, Bob 98 Seibert, Sherrie 140 Seibert, Steve 120 Sell, Connie 98,187 Sellers, Dean 98 Selman, Darlene 98 Septer, Jolene 137 Sereg, Patricia 119,173 Serre, Carolynne 133,158 Serre, Richard 98,162 Serres, Linda 152,167,197,191,121 Siebenmann, Kathy 159,163,141 Siebenmann, Patsy 99,186,192 Siirila,Sharlene127 Sikardi, Thomas 131 Silversmet, Rick 115 Simmons, Lynn 140 Simmons, Nancy 159,199,141 Simpson, Billie 187 Simpson, Jeri Lynn 116,197 Sims, Kathy 99 Sims, Michell 140 Sippel, Weldon 99 Sitler, Gary 130 Skantz, Darrell 131 Skoglund, Cindy 99,199 Skromme, Deb 12,13,14,49,52,99,180,161, 147 Slater, Mark 137,215,173 Sletten, Gail L. 141 Sletten, Karen S, 116 Slinginger, Edward 124 Soliz, Stuart 100,140 Sommers, Craig 62,100 Sommers, Reed 100,197 Sonneville, Melanie 136 Soper, Steve 100 Sosbee, Sheila 124 Southwick, Richard 15,100 Souza, Gregory 123 Souza, Scott 122 Spahn, MariIee1O0 Sparks, Debra 140 Sparks, Ronnie 114 Spaulding, Penny 135 Spaulding, Tim 115,216 Spenler, Sandra 115 Spiegel, Jane 115 Spiegel, Patricia 162,140 Spillum, Curtis 100 Spillum, Dean 137,214,129 Spitznas, John 100 Spore, Debbie 100,197,200 Spranger, Jeffrey 133 Spriet, Dale 100,267 Sprouse, Judy 101,187 Sprung, Rick 122 Spurgeon, Diana 101 Spurgetis, Luann 130,158,200 Srail, Susan 137 Stablein, Maya 159,118 Stambaugh, Carmen 131,187 Stambaugh, Jean 126 Stange, Jacquelyn 171,191,123 Stanley, Debra 101 Stanley, Travis 119 Starkey, David 114 Starkey, Dr. William A.: B.S. in Ed.: M. Music: Ph.D.: World History 33 Starr, Karen 127,173 Starr, Robert 134 Steele, Marla 91,101,180 Steenbock, Jana 126 Steffen, Esther: B.S., M,A.: German 33 Stemple, Wendy 133 Stephens, Barbara 130,158 Stevens, Albert: M,Ed.: Ass't. Principal 27 Stevens, Bill 10,12,101,211,212 Stevens, Bob 139,212,131 Stevens, Mark 123 Stevenson, Al 134 Stevenson, Donita 124 Stille, Joyce 135,198,161 Stiman,Jim 137,215 Stoehr, Donny 116 Stoewer, Greg 155,122,184,147 I, General Records, Business Math 37 Swales, James 124 Swales, Julie 101,184 Swan, Bette 124 Swanson,Courtney126 Swanson, David 137,214,190.128 Swanson, Dr, Frederick 24 Swanson, Heidi 199,193,141 Swanson,James 214,269 Swanson, Paul 41 Swanson, Robert 101 Swanso Swanso n, Steven 135 n, Susan 101,198 Sward, Steve 101,183 Swedburg, Karen 101,196,184 Swedberg, Mr. Robert 24 Sweers: Mike 140 Sweet, Bruce 120 Sweet, Victoria 101 Swieter, Gwen 141,189 Sylvester, Kathleen 238,191,122 t Takcer, Johnny 101 Talley, Raymon 163,127 Taragowski, Mary 139 Taylor, Brenda 102,187 Taylor, Chris W.130 Taylor, Taylor, Taylor, Taylor, Taylor. Taylor, Taylor, Christine 115 Craig 134 John 102,158,174 Karla 102 Kirk 120 Lilie140 Sheila 102,161,163,186 Teachout, Tim 163,140 Teager, Mike 115 Teckenbrock, Susan 155,123 Tedell, Anne 102 Teel, Michael 102 Telleen, Mary 132,169,167,239,128 Temple, James 102,212 Tenorio,Maria125 Terrell, Paul 125 Terrell, Penny 117 Terrell, Ronald 131 Terrill, Cindy 159,131 Terronez, Steven 102 Teske,Gerie131 Thennis, Robert 102,132 Thennis, Roberta 102 Thomas, Barb 13.87, 102, 148,152,157, 197, 200,173,147,43 Thomas, Carolyn 132 291 -7 Thomas , Christopher 102,212,169 Thomas, Thomas, Thomas, Thomas, Thomas, Daniel 139 Jeffy141 Lee D. 177,122 Lee S. 133 Marilyn 114 Thompson, Don 102,166,197 Thompson, Douglas D. 134 Thompson, Herbert C., B.A., M.A.: US. History, Varsity Basketball 33 Thompson, John 140 Thompson, LaVern 135 Thompson, Linnea 102,192 Thompson, Neil 131 Thompson, Scott 166,121 Thompson, Susie 137,167,193,200 Thornberg, Barb 123,173 Thorne, Sherri 134 Thorngren, Teresa 217,120 Tidwell, Randy 139 Tietz, Marion 102 Tillberg, John 214 Vanert, Terry 114 VanHoutte, Sue 133 VanHoutte, Karen 122 VanLanduyt, Coleta 125 VanLanduyt, Rosemarie 134 VanNorman,John 116 VanOteghem, Richard 123 VanSpeybroeck, Steve 135,29 Vanvooren, Camilla 135,193,200 VanVooren, Pattee 199,125 Vasquez, Margaret R. 137,167 Vasquez, Rose 121 Vatt, Debbie 126 Vavrus, Joseph A., B.S. in Ed., M.S., Boys PE: Varsity Wrestling 35 Veach, Kevin 132,158,185 Verfaille, Deb 135,174 Verhelst, Luann 260,157,162.127 Vermeire, Jeff 136 Vermeire, Pamela 131 Versluis, Cindy 104,197 Versluis, Mary 104,187 Waterman, Loring 115 Watkkins, Sue A. 135,274 Watson, Brad L. 105 Watson, Debbie S. 105 Watson, Bruce A. 118 Watts, Bonnie R. 121 Watts, Bruce 212 Watts, Randy A. 132 Wear, Earl: B.S.: M.S., Biology 29 Weaver, Dean L. 117 Webb, Dan P. 140 Web, Denise A, 122 Webb, Nancy K. 137 Webb, Randy M. 127 Weeks, Barry 125 Wegener, Merle: B.S.: MS., Orchestra 38 Weine, M. 40 Weintraut, Janet T. 120 Weissmann, Cynthia 157,123 Welander, Jill K, 116 Welander, Peter 137,177,257 Weller, Gary 105 Wilkinson, Laurel L. 159,162,140 Wilkinson, Nancy J. 106 Willaert, Richard J. 195,126 Willett, Laurel K. 137,193 Willett, Pam 106,181,198.192 Willey, Nancy L. 120 Willhouse, Cheryl L. 134 Williams, Becki R. 106 Williams, Fred L.134 Williams, Jerry L. 127 Williams, Joan D. 115 Williams, Nancy L. 106,181 Williams, Randy R. 106 Williams, Steve J. 37,138 Williams, Wendy S. 161,141 Williamson, Dave N. 135 Willis, Mike M. 106,157,195,216 Willits, Bettie A. 217 Willits, Frank: B. Ed.: M.S., Vocational and Cooperative Education: Diversified Occupations, Vica 37,188 Wills, Steve R. 163,141 Tillberg, Rich 133 Tillberg, Steve 163,127 Timson. Mrs. Juanita, B.S. in Ed,, M.A.: English 31 Tingley, Patricia 102,188 Tingley, Ruth 141 Verstraete, Connie 120,189 Villarreal, Dennis 137 Villarreal, Gwen 119 Wells, Pam J. 127 Welsh, John 138 Welsh, Tim R. 139 Wilson, Debra S, 137 Wilson, Diane K, 106 Wilson, Kevin P. 130 Wilson, Laurie J. 117,161 Wilson, Marilyn M. 125 Wilson, Mark W, 135,167,214 Trapkus, G Tippel, Jackie 130 Tippel, Jill 103 Toline, Colin 141 Tolmie, Dick 120 Tolmie, Rob 103 Tomlinson, Paula 139 Tompkins, Tonn, Jane Lucille 27 t 103 Toops, Henry 116 Tormeno, Anne 155,249,140 Tornes, Ralph 103,43 Tornes, Steve 161,124 Torres, Hank 115 Torres, Lupe 138 Torres, Mark 120 Toye, David 134 Tracy. Colleen 103,121 Tracy, Maureen 135 reg 159 Wilson, Rosella 126 Wilson, Sandra 106 Wilson, Steve 106 Wilt, J. Kermit, B.Ed.: M.S,: Mechanical and Architectural Drafting 37 Windisch, Robert 106 Winston. John J. 138 Winter, Paul 125 Winters, Mark A. 215,140 Wirz, Judy A. 135 Wisdom, Michael L. 115 Wisely, Reed W. 116 Witherspoon, Bonnie 125 Witzel, Janette 120 Wojcinski, Kim C. 124 Wolfe, Ranae A. 135 Wolfe, Tressa 107 Wollerman, Mrs. Roberta 24 Wolverton, Janet L. 126 Wendell, Deborah K. 116,152,157 Trapkus, Louise 148,155.159,127,147 Treanor, Charles 163,127 Trevor, Tim 212,125 Trobaugh, Darrell 135 Trobaugh, Penny 114 Tschopp, Mark 115 Tunberg, Jon 13,103,196,197,166,190 Twentyman, Brad 103 Twiggy, Doug 134 f 11 1 ..-: . I 9 Wi MM: 125 ,, FROM Y IZA sszusfz J .Q . ,'.. it 2 T . ti Q ie,l Vinear, Gary 137,162 WaShbU Zabloudil, Robert E. 133,158 Twing, Sandra 103,198 U Ullrich, Pamela 116 Ulmer, Carol 103 Unzicker, Lee 131 Urbain, Linda 117 V Valdes, Eliseo 103,173 Vana. Jim 166,13,104,195,196,190 Vanacker, Connie 121 VanBrocklin, Robert 137 VanCIeave, Sherry 141 VanDaele, Chris 137 VanDaele, Vicki 238,125 VanDamme, Tony 117 VanDamme, Vince 124 VandeCasteele, Dave 133 VandeCasteele, Gary 133 VandeCasteele, Mike 104,195,267 VanDeGejuchte. Steve 125 VanDeMoortel, Carol 104 VanDeMoortel,Joline125 Vanderheyden, Dotti 104 Vanderlinden, David 126 VanderVennet, Paul 123 Vandewalle, Gail 138,162 VanEchaute, Susan 115 VanEckhoutte, Bette 124 VanErstvelde, David 104 VanErstvelde, Mike 123 VanErstvelde, Steven 140 292 Vize, Gary 115 Vogel, Vickie 134 Vonderhaar,Soo-See18,104,181,198,212, 284,295 vonLangen, Nancy 13,19,104,196,162,185, 146,147 VonMotz, Charles 104 VonThun, Robbin 130 Vorhies, Denise 104 Vrombaut, Sue 104 Walden, Walker, W Rick 122 Dwayne R. 131 Walker, Mark 105,177, 196,216 Walsh, J Walston ennifer 96,105 . Sherry 134 Walters, Karen J. 105 Walters, Linda A. 133 Wambeke, Lauren 155,198,174,191,122 Ward, Jerry D.114 Ward, Peggy A, 139 Warfield , Bob 105 Warhurst. Bruce 119 Warner, Warner. Alan 119 Chris C. 140 Warner, Marcia H,131 Warner. Mike 105 Warren, Patti J. 105,198,186 rn, Tara S, 140 Wass, Judy Ann 141 Wassenhove, Donald 105 Wassenhove, Jeff 115 Wasson, Joe K., B.A.: M.Ed.g Counselor: Director of Guidance 27 Wendt, Donna J.118,189 Weninger, Julie K.140 Wenthe, Mike 105 Westbrooks, Jeff W. 141 Westcott, Marilyn J, 131,239,190,200 Westerdahl, Bruce 126 Wheeler, Mrs. Debby: B.S., Physical Education 35 Wheelock, Mrs. Barbara, B.A.: Communications, Composition, General English 31 Whitcomb, Linda 105 White, Elizabeth A. 137 White, Ken J,127 White. Lawrence 131 White, Mark E.105 White, Michael 105 White, R, Monte 117,173 White, Stephen 120 Whitebook, Gayle 13,105,197,270,200 Whitehead, Susan E.105 Whithouse, Cheryl 239 Whitting, Craig T. 105 Whiting, Patricia A. 135,159 Whitmire, Judi L. 122 Whitmire, Randy 105 Wiborg, Bonnita 106 Wichman, Roxann T.133 Wicks, Steven M. 106,196 Wiemer, Richard 106,141 Wierenga, Greg 162 Wiese, Frances 106 Wiese, Lee 133 Wilkerson, Dianna J. 139 Wilkerson, Glenn L. 106,195,215 Wilkinson, John 106,163,185 Wood Wood Wood Wood Wood Wood ,Charles L.140 .Colleen 107,158,204 ,FalE.107,157,194,197,19O ,Jan M. 137,158 .Jim L.135 ,Sharon I. 107 Woodard, Craig L. 156,216,122 Woodard, Debra L. 140 Woods, Dael 131 Woods, Debbie J. 116,157 Woods, Janet: B.S., Counselor 27 Woods, Michael 107 Woods, Stanley: B.S.: M.S., Counselor 26,49 Woods, Vickie L. 114 Woodward, Cindy A. 116 Woodward, Jackie 15,107,200 Woolley, Carol D, 107 Workman, Kathy D. 130,159 Wright, Debbie K. 122 Wright, Nancy 125 Wyers, Kathy 122 Wykert, Edward 40 Wykert, Nila 40 Y Yaudas, Michael E. 123 Yaudas, Nancy 184,107 Young, Deena A. 134 Young, Jeff L. 125 Young, Wilma L. 159,162,127 Youngdahl, Mrs. Mary M.: BA: English, Journalism, Line O' Type 31 Youngblood, Linda S. 141 Youngvorat, Marcia 191,126 Z Zeigler, Mr. Laverne 24 Zelnio, Bill 107,190 Zmuda, Mindy K. 135 Zuccarello, Allen K. 131,214 Zuhn, Kenneth W. 88,107 autographs guidance, a friendly farewell, rejoicing in glory, growing with eacn otner, we react with our world. f is 4-Q. -N85 CQ- 1 -... In appreciation of the extensive amount of time, patience, and coop- eration needed for the completion of a yearbook, the '71 M staff would like to express their gratitude to Mr. Vic- tor Ross, the faculty, and Student body of MHS, Nordquist and Associ- ates,the Dailytbispatch, the Times Democrat, our student photographers, our advertisers, our parents, Mr. M. L. Gardner, Mr.iDoug Groesbeck and the American Yearbook Company, and our advisor, Mr. John Adam mer Jbwlagyagpwfww? f 5 bi? A A J 3Q:,iff.EX I v A- dk 5 f we 4,-A I Y i EMM! m a Wffffi ff' , 1, K ,4 ufngraplzs ff V x Q W N- JV C3 UK FGMMX mmwwl QUT X WHUB QQm VQAM Mgvki Owf' XlL, Mqvffxb lfy J f xl xm NYM Mags HOWJQ MNT WTQSSVWQNXQ Q qw we My WWWM diiikgga My QLWEMWWW W 5' U Q F W Q QQHQOUOQ, S P W wi L Q , f E, E. t. Rm Lg kj QR Q qi? A ,V f.' , V? I . 'Q 5 ff A Cf 4 1 F' A ,Q 'fx J O W I M CA A g tsl AJC-3 1,1 gi! fl if nf! 3 f-ff A-I , ? 4 6 7 A ,4 M9 H if U fl' fw f. ? 1 3 J 1? ' X' ' 46 J 0 7 Cb V - 3 ,E fo ,f 5 J x Q j 1 1 ' 5 pi Q fx ' Q f 2 N Q f Q , b Q 5 2 f QV 5 9 is g 4 ' .. if X Q f 21 ff! j 2 f Q4 q V , J, wr 41,1 A .L u 4 VJ ,Af , Y A Q K7 ' Q .- K Q Dffffffb fu we 'QMXQ :A .4 x My vm 'Q' .. ' , ' ' ,li lxf- X f. ,xifzcfj 'CA Q-'WQKH 'Vamp u FL9 A3 .,, ' Orff? fgsflgxo 'fi gi ' .fi JH f,,Q'5'N'f.g3 'C if Lf- ,TQ ,Sf Sf iss my LQ , Qi I ,,c' 4 ,ZFX l ,ff , , L 'V E W M M m M W xkh X WM- MMM A, ,fj,,,1!Q7,gJL ,WwffWf0,,QJk W Miiffi QfQJg3?g5Wff Q C x by M5 Jii'3M 5 M Dfiiiggbgg ,N Q 3 VQJWQ 3 Vwgwggf 55525 ZW fi Eiikdi 552 y.A My wif ww 4515, , K9 iffy Twig diff? vig ,ff L M jigwffififjff K fgffffgfwfw afwffdifg 2i2wf W N FEM W YQWEQVW QW ggfwjywigwmfgwww Q fUif? ijQiWfMmUWfqW W? WWW M W1 W fp wi e www W , A X q QQfbM Q .Q N N . ,E i 5 ESQ A SQA 1 ESR? X Q ggi? we , , ., . f ,. V, , - .,,, ma V' ' ' aww- Q o,,.,.Q..sz,-k,sw.-AvQfkg,..,,c.3,. uDg,..:.Q.v--v dlpoxvbxwu- j 55 kvii' .hmk wx-.Sit ESQQJXS '-V Exi SN 'mb 'Sw N mm wQXvw Ng .S Q M, if :QQ SQSQWW QA . axawx x 523 Tfmbxxg VNNQXJS XS, dwg QQ15x.N 5. vb 3635. X gv 'Y Y 2 Q gf bg? Q NS Fw SWS-3' Cwxvq ifkvxm