Mira Mesa High School - Mirada Yearbook (San Diego, CA)

Text from Pages 1 - 334 of the 1987 volume:

1 Vfv JVC, V. A X' x ,L U' ' Twbctgfw iv NW L,,1S',7g- xiiwsl Ax VWXW gag . 1. I A . , g , ,A . ., V. -W -, 2 K N fl- , ,J x ' 1 1 . ' X' ' X' ' ' x fl .av k f - 1' '- X v X. X - f' Xu, Kp Xa 1 -me M X A Q X f 'X A .L -' , f' m - . f X CL , 1 -f I xy ff? RQ' N f i' . r A l ' V 4 , ag s 1 -- , 1 A - r iff ' Y , E 1 . 1 ' . ' ka X x X x - ' V ,A wg, x. , N. K KI? 71 Q . V I fa , . A M film ,J , A NYJ: , y.Q- 'xii It AK .K xg S J ,t . w V W K 1 Xb? it My 78 Vx lx ' 7 ' . Y I if .wig uwfw' 'x'x X, N Y ' 1 M A ' A X ' 'x ' 2 My 2 3 , W, -,fm 1 Nxgl i QNX ' ,K , , 1 F-.. .-, 1' Q, fdf ,fx ff I Mg f 'M' 'iw XIWND-L N Vi ' . .72 ,- Q 1 RwL11M 'fl...lwkf5J'- ' my L' f WM J M W L. , - W-g A .M K Y X34 WUY55 XV- 3 a 'kk M,Xw.l..,, u A . I 5 V. V3 S L'w,R. nv sifzix Exif K Q LR ,KQ , XRMVX, XM ,A A M, 1. A , Y vm nw' ' 5 , MM A x Q 5, 'xi T b-f.,i,9 ,,-f L XX I 'K M - , 'f 'h M , , , Q, MQ, L M 1- wx- E u M HWE5 wxvyixfi gg X 1 Y . , if Q X Xx 'M gk.,- ,, X f' umju if N : ...'..,Q-X R-kfx Xxx' X K RJR N. 'L A I v , giqxif 315: J 2 'Q' ' X F 2 Rl AW ff gffi 5, 1 f 7 ' f Hx ,f 4 V F if Y' ,P uf QW Sswgxmmgs me r X4 , INTRODUCTION ver majestic jagged mountains, beyond rolling blue vvaves, across barren desert vistas and fertile plains, people from every corner of the world knevv. For Tl-lE WORD IS OUT! Cheering Nlarauders decided it vvas time to inform the vvorld of their success and pride, proclaiming this simple yet direct message: lVllVll-IS IS JUST TOO lVll.lCl-ll With an abundance of organizations, activities and so many opportunities to get involved, no one could complain of boredom. And sports dominated the scene vvith championship teams. The student population mushroomed to over 3500 students, but instead of a hindrance, the large number of students served as an opportunity to make more friends and to greet more smiling faces. Volume eleven of The lVlirada chronicles the year's many events and serves to d d' er for keep alive our precious high school memories. Plead on an iscov yourself that in all aspects lVlira lVlesa l-ligh was JUST TOO lVll.lCl-l! Q9 59 QQ 2 N Q TX MUG THE IVIIRADA ME EL 1987 IVIIRA MESA HIGH SCHOOL 2 Em cf 4? Q ,, Au. WUI!-nw MW 15-55221: E, 1 -1-4,ffv::1,.-v . ,qv 199: '1 V . H., 555-'E-H mfwfwm '- an l?2?5E335531i,a3??g:,:QiEW3:N'fN 1:1 W,'ffvy+.gg'Hw'g1-W- Homecomung: Tradnnuonal and Tameless ..... pg. 15 TW . 717 Q r f V MQW f 5 H' Ez '- Spirit. Week: ltle Ahve! ......... pg. 1 1 Sensor-ez In a Class Above the Fleet ........ ...... pg . BAA 2 sz 'Syn 1 5. fi ,V 3, ,,,, . gap' -fn' ffazfii I R- .- 1 E-mgafA1'.5i.f V . H 'Qvfsflul '- 40' ' f p fl? a .fi :mal , Jug .wif ' , 15: w w' 4 1 1 ' 1 ' ,wa ' f X Q' . . , . , w ' a Q Q ii ' 1 M' 25 ? ii if Q 7' YQ, Q ' ix' QQ41.: um- QQ if MLW. ,WM , .4. 2 4 A F -f::m.gPw5' , -,fm Mi , 1 . I J ! wswawmwhu Faculty: Too Tough? ........... pg. 41 if- '-ffm .. - .ul a 4,-fig K j A , b QP! 1 1 f a g A -wa g , I 14 0-,f - 'NV 44121311 11:-'-fx N 3: X-15332 1? 1 1 1 I Football: Branching Duc! pg.Q197 ' -Juniors: Too Wild? ..... DQ- 115? yi r ,J he Word Is Out: IVIira Mesa is the place to bel The once quiet community of IVlira lVlesa continued to grow and expand as hundreds of families flocked here to reap the many benefits this young and thriving community had to IVIIVIHS, as new students helped to maintain Mira IVlesa's status as the county's most populated high school. county's most populated high school. The much-envied location of IVlira Mesa offers close proximity to nearly all major attractions, yet is detached enough from the city to escape the undesirables of a metropolitan area. Beaches are just a short drive away, and major shopping centers are within minutes. All the offerings of America's Finest City, combined with lVlira IVlesa's prime location led students to proclaim that lVlira Mesa High is JUST TOO IVIUCH! 1 l l 'tri ig . s 'l, Brian Ells and Vinny Lopez strut with pride on campus. 2. Missy Boll, Erin Sumnalt, Allysa Chardie find the beach the place to be. 3. One of the most luxurious hotels located at La Jolla is the Marriott. 4. Michelle Muir, Elizabeth Bridges, and Melanie Sheramie take time out on the football field. if 3 ' ful l fl il lf mu KW Lf -3 mg' ve . M ' f V He 4, 4, aa,-:Br I: ' a 1? i W 5 'pf 1 chill movin, 1 Ml . i, i ,Aga 5335 QL Q . W 'V' lv , M i W f' J S' I - Nm., MMANM-. v... WWW' M., M 5Gaspar'e Manno shows us how he Esnakes during a lunchtime pep E VV gl dxf .pda R H K Fun V YW , s aillfffmnw 'rg'- E I w 1 I E 1 i i E I I 2 MARW Q A w'w7ww IVILJCH hen it came to stu- dent life this year, Marauders found out quickly that MMHS had Just too much to offer. Students here kept incre- dibly busy, participating in athletics, political organi- zations and othercIubs,the band, the newspaper and yearbook staff, or any one of countless available activities. Marauders also found time in busy sche- dules for special school events, such as football games, dances, pep rallies, and spirit week. The remainder of most stu- dents' waking hours were usually devoted to going out with friends, or just bummin' around. And on the rare occasion with nothing exciting to do, there was always the ever present homework crying out to be completed. Throughout the year, Marauders were not ones to pass up a good time, and the many exciting activi- ties available reflect this singleminded dedication to fun. X, I 'Yq',1!1.vu'cahnival NU,-Ki5:1.n-ur1m:s 1mm,LInuk.I um lumw. un utw I mu Eh'rn.uivI.Iv tiswhkw, .md l.N1l'fl lnllw' aww Llmvu' www K. X. fl me Ll:-tv, L' .NJ-PVHIGH1't'i1UCk.Huil7.HAHl5!'t'xi.4:1f1LWl HIe'lr15sUul'li nu fn.1,x.miL uw: um um MAX-, A - 5 Ailldllkfd KWJUSFUl1gI'.11klf.lll 2i Hvrsult un IHJRIHU .1 gu's'rm't - wi 1 -1 Ulllzihl-1Illl!k'F1I'x!UU.lfflwixHUX .l.fx.jnmvr'.sm1lxivSlvm.zf't m'um'g'1l m' fidfd Lu Hub?u1'.-arvzwpiv I , WEEK N3 714 -cw 1 55' 1. Mi! - Xa :ra hE.,,K,,gK 4... 'a -WLM , Wie, 1 Y Dnc Upon A Time... in the lush and rolling hills of lVlira lVlesa, there was an enormous kingdom vvhich lacked spirit. The Black Knight lNlr. VJ held the kingdom in his evil clutches. He kidnapped the Presidents of each class and held them for a special ransom lpenniesl. The damsels and gents, sorrowful over the evil deed of the Black Knight, sent messages for help. The lVlarauders heard their plea and they came forth with a tremendous charge, determined to capture the Black Knight, and to restore spirit. They were victorious and the lVlarauder royalty held a spirit week celebration. Students became royalty according to their class . . . Seniors-Kings and Queens, Juniors- Princes and Princesses, Sophomores- Dukes and Dutchesses, and Freshmen- Counts and Countesses. For five glorious days the royalty dressed in rags and held bags lScavenger Dayl, became favorite literary or TV characters, went primitive lcave and toga dayl, in a daze of Robin Hood and lVlaid lVlarian Nlarauders dressed merrily , and spirits gathered on Homecoming!Hallovveen and masquer- aded in costumes. The Marauder royalty held up their victory banners to prove an old addage--that, if you believe in fairy tales anything can happen. They all lived happily ever after. The End 5. Wendy Ehrlich and Tammy Flodr go trick or treating at lVllVlHS. 6. Clovvriing around on Halloween is one of the teachers. 7. Floy Jazmine prepares to go to vvar on Halloween. 8. Heather Riding and Flochelle Rosa find time to spend with each other amiss the confusion of spirit vveek, ,iilll M K ,iiilllw 'smnrr f ' H Y L- k SPIRIT WEEK? 1 ' 'g ' -' - l, Joelle Suclvveeks shovvsa her Spnrlt durrng Falrytale Week as Raggedy Ann 2 Tranny Anderson and Kelly Kammerer dress up for spirlt week as Tvveedle- Dee and TWEE-3f.llEADllIWl. 3. Duke lVl1ke Akluf: takes aim at the photographer IH a valiant effort to Save fan' IUEIIUEIIS lll dnsstress. 4. Queen Laura Toller rlsks her Infe dunng the archery tournament to prove her ll'll1OllCEI'1CE. 5. Chieftain Cathy Patacsil lourneys to the maglcal kingdom to partlcipate ur the ceremonzes. 6. Town Greer lVlancl: Smith announces to all the loyal Subjects of the kingdom the lestlvntles that are to take place throughout the week 7. Chrlstlne Campbell rounds up Sensors to he Kings and Queens for the week '4 f 'W gif 1. Q 1 W vu . U Lbpez 'Q ffw lll,1 ff Wil Jwllfflfjrl f wf'u f, Cflfj IIQBA'-'F I Af' 'K-H 15 si X' -.. ff Q, ix . ,Q f 5,1 li G' 'A M. I , V 'wiyibf wha 1 J wtf 1 gf-1 1 V-1 ff? 4 Q , -il' . , V, ' I5 E 3 W W 3? waht:-F? 5 gi 'Lreptow cook dxsolavs ref TFBCV X no vu-my '. - mi? winnins 5 . C,-Owned Q . Lopez after hem amine e 1935 Homec T,l'1 G UQEU. I., li.- 5 ff 3 ' l e c l 'SX V Nl' he Homecoming game was an overwhelming success, as the mighty Nlarauders annihilated the PatrickHenryl3atriots42-7. Both the game and halftime activities sent the crowd into a frenzied state of spirit and enthusiasm. Essex Burton paved the way for the lVlarauder victory, rushing a phenome- nal 242 yards and scoring three touch- dovvns. The Masquerade theme of the dance created a mysteri- ous, romantic at- mosphere that was enhanced by the silver and lavender decorations ador- ning the gym. The high point of the evening occured at the crowning of the Homecoming Queen and King, Tracy Cook and Vinny Lopez. As the pair commenced their spotlight dance, hundreds of white and lavender balloons rained down upon the crovvd, vvho soon returned to their magical night of ,JM dancing and revelry. 5 HOMECDNIING suivlivlsn 5--,Essio ading aromas of tropical coconut suntan lotions, grains of sand hidden in cracks of shoes, and red peeling noses of sun-kissed faces were reminders to Nlarauders that while school had started, summer was definitely not a fading memory. Nlarauders headed near and far to make the most their summer. For heach bums craving the sun, surf and sand, La Jolla Cardiff, and Del lVlar were the places to be. Locals searched high and low all over San Diego for things to do. Shopping, movies, parties, and working helped fill up the long hot days. For the more adventurous Nlarauders went past the shores and traveled. Hawaii, Australia, lVlexico, Japan, and Canada were some of the far away locations that were explored. Amusement parks and fairs were overcrowded with ongoers. Nearby many trekked to the Del lVlar Fair, worked their way on up to Disneyland, Knott's Berry Farm, Magic Mountain and ended up with the Biggie, the 15386 expo in Canada. Summer of '86 was definitely a period of time to have fun, fun, fun, in the sun and a chance to live up the freedom before returning to school. Being a senior, it was my last free summer to really let go and have a great time . . this expressed Tracy Codzik's summer, 'l, Tim Kalke takes a break for the camera. E. Kim Van Wagoner tests out the rocks in Cabo San Lucas. 3. Natalie Woodward and Kris Anderson: back to back. N ,N SUMMER fm' ' H fl' .. ff M ff W ill 5 , f i T 4 K 7 gain '4 ,f 'ii X 5 , , I 5 kkk' T T x it ,iififnwllx L f, ,f...:.N,,W. ' , , +7 ' q, 61 . mi - . wal, ,, ii W6 XZ 2 X T ,,,,,,,, 77 .. ' f X Y ,, ' g ahlwmf ff ' f I k 1 V, . ,,,,, :X T. V , L, , ,,,,, , v,,, I V fWf,i1,.. ' . , ff X , ,,., ...., , , W 1 ,via , T it ' ' Ini T , T T irlllll f f ,WQQW , ff W Af , , W I f f V f ,LL,,, , 4 51 i X a5 T'f gffmgg ,, .. . ,, ...,, E- I 1. Diane Garant fantasizee the Canadian male. 2. Two available guys, Ty Logan and Scott Blake, on the provvl in Cabo San Lucas. . 3. Ty Kincade attempts to use patience by strapping in a brat at Malibu Grand Prix. 4. Kenn Kashima stakes his newly acquired property on top of IVlt. Fuji--for his condo complex. 5. Tracy Godzik and Janna Simms wave good-bye before they swim the Pacific, ust the hottest, toughest svvankest, snappiest summer EVEP OW WGS VOUPS u - - tt ,.,.. . .... ,, .... -- H N H .... .... . . ...,,,,, ....., W .-.. :1-L:H.,:-:- 1 a M, ,. umm ,.,.,.ee'? L. ,. .,., 1 ., A- ' -,, -::f- - --: at M -1 houts from a seemingly faraway place pierce the Monday morning silence. Bill! Are you awake? Breakfast is ready! Silence follows. Finally a muffled groan forms Bills unintelligible response. As expected, Bill, who never fully awakens from his uncontrollable sleep, misses breakfast and the 7:30 bell. With uncombed hair and glazed eyes, Bill finally staggers into class, not-so-prepared to face another five days of demanding work and boredom, all the while feeling a longing desire for Friday afternoon. The preceding sequence of events is the result of a successful weekend. The story is real but the names have been changed to protect the innocent. Although weekends are not always as devastating as BilI's, they do provide a time to socialize and have fun. A quickly- created excuse could sometimes serve as a ticket out ofthe house into a satisfying weekend. Students could always be found at one of the many nearby beaches enjoying themselves at any of several beach activities such as surfing, bodysurfing, volleyball, or just catching rays in the California sun. South of the border, T.J. attracted students each fin de semana because of its great potential for adventure and mischief. Some students joined the working class and labored hard to earn money. Those B-hour shifts on Saturdays didn't leave much room for socializing, but the monetary rewards allowed more freedom to plan future weekends. A 3 i g fili. weeicsnins WE E OUT Q . L 01. i i 3 ,za - it ' T is zi 2 33 V A .2 lilif ilfq W W fn i is A. 2 l lE'tllMj2 'l. Nicole Klein shops for school clothes on a fine Sunday afternoon. 2. Norman Transeth, Smiz, Carrie Carambus, Damon Cook, and Greg Guerra depart Solana Beach in style in the ever-. so-popular Bed Beamer. ' 3. Terry Sanabia takes in the scene of all the chicas walking on the boardwalk. waterskiing. lVVait, Lisa! Wheres the boat'?l 5.JuIie Henderson and Christy Bosado practice for the Olympic Chugging Team try-outs. B. Lisa Spears takes time to pose in front of her Bitchen Duster before going into La Jolla Village Square to extend the limit on her mother s Visa. 4. Lisa Nicolaysen prepares herself for some serious 4f?b's!'f'3HWWj52Z21: F131 hf2lAig4i22 , , r, wif' Km. A4 ga Mglfi- asf,-Jgfzzsfrf' W ,EEWMwQQmm - X Wiffi- r rf :afa:z1'fz:s'a,g 'K -V - EQ!-lf Q in 3: ewes 1: :.: z:gf .1-Q, , P ..V,,,,,, . .1 , 1357 :HW ' Eiiffvu'W f?'if1 , ,. Q' 4,1 1 ' i fflii ' ' ' 51-25'-ki3aqp.hz-.QE -vixif. ' Y , , ve 1- 55, 121 5E+.wF..w.M - ' A iwwwwwih Qikaiiff ' 'A Z ' ' 'llT'1 5235-?:fEE,w,gf:,x,+, K4 ff! 'Ili M KNEE KEND K S 3, ai 45' s'7 ' 4 Q 4fff'mg,, ,E A 'if' A K M , ff If , ' 7, my 1 f f W 4 A fi '.,v5 Y-522 1 2. ya' Mx ' .. 4 , mf QM H Y W if 4.111- S 1 ' . wmuwww ww W x u if 355.1 ' , J. , nm- ,W , . M ww N -4 X my Q 4: T' F E, ,W:--- 9' L X 5? , 1 M, , 6 I ,Y + b 1 1: ' A his x .Lk W' .asm ai? ml -indif- fr if 9 4 if? 1 2 b 5 fa 3 2 tl r'ick'0 ' rea dark fog settled over Mira Mesa High on Halloween as hordes of goblins, witches, and other creatures of the night descended upon th unsuspecting campus. Bloodcurdling screams echoed throughout the school grounds as slimy ghouls snatched up unlucky freshmen, who were never seen again. Mira Mesa High School, once filled with happy Marauders, was now a playground for spiders, spooks,and spectres. Actually, Halloween this year was quite different than this. The school was filled with cheerful, smiling faces as students and staff alike showed their spirit by displaying costumes. Along with the traditional scary costumes, a variety of other outfits could be seen, ranging anywhere from bellydancers to slices of pizza. Once the sun went down Marauders set out in search of a frightfully good time. Some joined in on the festivities at the Homecoming game, and cheered our team to victory. Others, desiring a spookier All Hallow's Eve, visited one of the Haunted Houses in the area. Costume parties were also a popular destination for students. And there was always the traditional trick-or-treating, which provided both fun and a truly monstrous feast of goodies. wi Till. M ilf liftiff f , li . .E i'1l lf' ,i-l i .xii X. iifiiflrfr' 5 1 91, if H ffgtwli N , 1 7 'hi 1. Jeff Spangler, Zane Martinez, Handy Bunkley, Mike Rumen, and Tony Flooks: Who says we have a gang problem? 2. Poor baby! Dawn Curatolo cuddles her teddy bear after escaping from her craddle. 3, Snow White, Michelle Duibladi, gives in to the temptings of the witch Nay Carini. 4. Stacy Miller, Kim Woods, and Julie Franklin prove gangsters can be female too. 5. Joan Gozalo and Michelle Ella treat each other with Halloween carnations. 6. Kim DeMatte and Heather Diem are partners in crime. 7, Stacy Miller and Carol Flossberg pose for the camera before g ggrr hitting the beach, . ,., : -'- l 1. Eileen Bisooeho and lriend show that the bobsev twins live! 2. Lisa Spears and lVlelissa Vega show that the grass is greener on their side of the fence. 3. Mark Stogskill and Joelle Sudvveeks have a ball while being together. uf ia-N17 N f 4. Nlelindv Craine, Adrian Slater, Michelle Johnson, Taimadge lVliller, and Lenora Lambert have become .. The Lunch Bunch! 5. Proclaiming to be the Fab Four Amy Desiardins, Jamie Smith, Christy Flosado, and Christie Upton mug for the camera. G. All for one, and one for all , exclaims Jackie Pulopot, Noelle Santamaria, and .lov Nlatalavage . .. alias the Three lVluskateers. tand y M w 7. Alvin Anguillano treats Arlette Eciia like a queen-- that's what friends are for! 8. Nae Carini and Alex Flinn display their true affection for each other. ith the large student body at IVIIVIHS, every- one had an enormous variety offriends. While making new friends was a goal, old friendships stood the test of time. lVlany have come through the years as close and intimate friends while others, purely by chance, form lasting relationships on the spur of the moment. When times were tough friends provided shoulders to cry on and someone to talk to. No matter what the situation was, true buddies were always there to ieno I - i uuu uu ii i fifty A, iiitlvi :Et ifiiz H iiiii l ,. l W a helping hand, relay good advice, and just have fun. The bond of love and caring strength- ened with time. Nlarauders said that they could accom- plish anything Just as long as you stand by me. wif i..,- H i FRIENDS ,W , py if V 1 SPIFIIT DVERLDAD e've got spirit, yes we do. We've got spirit . . . how about you'?!'? Waves of excitement burst out in frenzied motions of activities as lVlarau- ders showed their spirit and pride for lVllVll-lS sports by attending pep rallies. Cheer, drill, flag team. letterettes and the band helped boost lVlaraudermania. Pep rallies were the icing on the cake of spirit because it let charges of excitement explode giving everyone the chance to show their pride and spirit. Everyone left charged up for the big game. ready to cheer and root their lVlarauder team! 1. Sandi Chong announces the class winnerof the penny collection activity. 2. The spirited bunch of Kim Flikansrud, Laura Horn, and Donna Mattson definitely show that three is not a crowd. 3. Raise your hand if you're sure! Being a drill team member is no sweat. 4. The Marauder mascot becomes an aerobic instructor for the day, as cheer follows his lead. . PEP RALLIES FQ9 . q , Geo EUSQS mem G mf. K- iw:wq-M ,i , Q bi may awyhv ,g y 620077729 'WM W- W W KE A ta SVG Emo Flosello and NWN Blaise the 553695 Them' rowd appi Fidencio Pampo boogies to the beat for Jesse Johnson's Flevue ii 'i I. ,,, 7 3. lngrid Stabb, Whitey Hagadorn, and Julie Sefkow pass the lobster as the B-52's. 4. Sam, Kevin, lVlike, Jeff,Vinny,and Lee, confused about their masculinity, find Paul Galvezon to abuse, 5. As Janet Jackson, Shelly Palmer and her solid gold dancers work their way to the cop. 6. Todd Flosenberry fiddles with guitar strings as EDO people stare. 7. Craig Logan tries to hide his acne and has gone to drastic measures in the GO GUS. 8. What do you need? Asks Robbie Zides. Saxg Brian White. 9. Mark Leary, Scott Cummings, and Jim Huber give it with a whiffle ball bat. gm, Q, S0 W In kms ', . 3 - l Wav ' l i we v 5 T33 1 fig .. ' i s l - 5 .Ma , gm ...., .. f . H ww! A W ill ,..1. ,fwwa ff . -' - 11 'ref L4 0 6 if o the background of pounding drums and a screaming sax the energetic vocalist leaped madly about the stage singing to the wildly cheering fans The song vvas familiar and so vvas the band's look. Was this actually the famous group INXS, come to play to hordes of screaming lVlarauders'? And did the rowdy Beastie Boys, and the smash band of the 7O's--The Village People--truly perform at IVIIVIHS? No--not really. This vvas not a vvave of superstar musical groups descending on lVllVlHS, but another exciting All3lBAND COlVlPETlTlOlXl. lead Students turned out in record numbers this year both to perform in airbands as vvell as to vvatch making the event a smashing success For over a vveek lVlarauders were treated to several airbands each lunch period, bands that vvere judged by ASB members from other schools. Nine winners vvere chosen to advance to the finals. The semi-finalists turned out to be Leslie Gore, the Beastie Boys, the B-52's, Janet Jackson, The The Four Tops and The Go-Go's. According to one students, They vvere the only reason I came to school then. 99 9 V' We 5O'l's and denim s hit the scene at lVlarauders found a way of expressing them- selves, not only with words but with their choice of clothing. With the tremendously large student body on campus, it was important to stand out from the crowd. A new fashion was lassoed: Boots, fringed tops, and prarie shirts. Beach wear hit the shore with tee shirts-with-sweats, and flojos-with-socks. Leather jackets expressed tough personalities. Sweaters--no longer just for warmth, came in every color and design to bring out everyone's tastes. ls it a banana clip? Accessories were the creme-de-la-creme of every outfit. The casual look outweighed any other style. Nlarauders made sure their clothing was as laid back as possible. lVlira Mesa High exhibited fashion day after day, adding to the fun of being in style. Jason Mendez and Suzanne Pulopot Priscilla lVlcKnight and Leigh Hallenbeck f X 2 5.2.5, sum ' ' , v 1 4 - Q 2 1' lar In 'I -i-,w . si I Y- :C '. ,V U If 41 :X ,., W --A 1 5 :V .H . . W H . I I ,, ,R i , , K, x .4 . ii ffkx . ,,Qv 'dd il ti if i ff , . e'sM V ,ff ' . - f-'D' . idyg Jamie Shew and Scott Cummings Maryjane Bernal and Janei Wing Julie Henderson, Janine Kamisky, and Christy Fiosado Christine Winter iand.Pa.m Ordonez- i i t . ,Kyle Laureano i i 1, i Britney Ehriich r e Lee Hendrickson is Kevin McDonald 3 7i i FASHION 31 ASB BALL 1 Shelly Palmer and ,Mike fielfer .ASB Hall King and Queen Sembr Attendants Hemqdette Smiley and,M1yuel Rub Sembr ,Attendants .fww me W l 61' leee llllll i Wg w. ,, 2.1 I V Zyl, -J .,, 1. Angela Alves, Paul Wade, Marki Bowen, and Jason Adam flaunt their formal evening wear. 2. Shelly Palmer, astonished with her crown, smiles as Kim Thompson and Mike Eicher look on. 3, Embracing each other, Cindy Rodgers and Ty Logan flash their winning smiles. 4. Philip Solomon and Cathy Patacsil smile throughout the crowning ceremonies. W 11111 11'1111A1 .VL711 Stly 111 111111 y1111 1111111'1'1'11h111y5 1111111111 111 111111 1111191 711151 1111111111111 11111115 11'1'11' u'l1fsUK'ff'1f 111117 1111' 11115 1111111115 111111 A'l2'1'S 111 111134511 111111 F1115 y1'111'5 S111'1'111111111w1111 11115 fflvhf 111 M1 1611111 1611- C1110 1111 51111111 15111111 ,11111111111111 f111'11115 111111 A11 '1'1'S 11 111155111111111' 51111111 1111 ,H1111111111111 Elly 2711 511111 1y711 ,!1c'1f'1'f 1'1'1'1111111, 11111 111'111A'1111111 111111111 111 1111 1l1t1y'S 1111111 111111 11 11111111151111' 111 5110115' F1111 ,-lf11'1 5111111111111 50111111555 11111111115 171111111111 1111 11115111115 111111 111111111111111'r5 111111 ,!70S11Iy for 11111111111 11111111 1111111115, 1111' 111111111 141715 11111151111 11111111 for 11 I'0l1Il1l'I11'I' 10111111 111 1111 t'lf,0t'1'lS11'1' 11511111111111 l,f7!7Sfi'11 511111, 111111 11111111 fvlflfllflalfflfff ffffrlvs ,111111111 111 11' ,U.4t'11Sl1I11 111 1111' 111511' 111116 y1'1 111111,1y11'11111111 111 1111' 1111111 4711111111 1111' 11111 111111111111 111111 '111 1l'1111111c'11'1'11'1l1I' 11111111111' 111111 1111' 1611111 16111 U1111. :'11'111'1111'111 5,4111'1111 111111111111 1111' 1111. Fflt' 1111151 1111'1111111111A' ,111111 17 1111'1'1'1'1111111 11115 1111111 111111115 11111 111111 1111111 1111111 111111 511111111 111 101' 111115 M 51'11111111'111111 51111115. T1115 5111'1'11111'1'1'1111111 14 111111 11111 1111 11 1111111111111 111111' 115 11111 111111 11111 511111 11111111 11111111. .7111 1111111y, 111151 11111119 111111A1 11' A111111 11'1111'11111'11'11 'L-i1111.1'11 171' yL'11f 11111111 111111 ,1'11 171' 111111 A1111 Zl'1' 111111'1 111111' 111 111' 11111' 1Vff1lc'1'11I1'K..1l'1' 17111 M' 00111 111 111111 1V111t'11 I ,Nay 6411111 111111 Kevin ,M1Do11d111 ,711111211 ,1411c11d1111t5 Kathy Patarsil dlid 17111011 504711101 501110111011 .Attendants 1611111111 1305211 a1111,41111y ,M1111111'11 gfdiffllldli .Attcndzzfrts ----' ASB BALL 1.NewIyweds Prince Andrew and Sara Ferguson attempt to hail a cab after their highly publicized wedding cere- mony. 2.The pilots of the Voyager traveled all around the world before real- izing that they were doing so without a port-a-potty. Mini Zn THE BESTO 86-87 3.To save his house from being destroyed by the burning wreckage of the Aeromexico disaster, this resident, seeing that his rain dance had failed, resorted to his trusty hose. 4. Soviet Leader Mikhail Gorbachev proudly displays his new colored pencil set which will enable him to complete his Soviet Bloc coloring book. w across the U. S.to protest Nuclear Arms. 6.President Ronald Regan practices his best trusty leadership face to pre- pare for a press confer- ence on dom- estic affairs. - A -.'f. ..--',. 400 wnut nnnnss mr u.s. In vnnirsr Nuntfnn mms 5 . Q ws . . it ti 2 Xilxss 7. Originally gaining fame as the proud owner of the largest known dandruff collection in the world, Corazon Aquino went on to become the head-honcho of the Philippines. 8.The Mayor of Carmel, Clint Dirty Harry East- wood takes charge of his new city and challenges criminals to make his day. OSITE PAGE Theo 8 8 Cosby Top G T C e Wlnt ey Ho to o a a a oo A e o a a o o Cybl Shepha d a d B S d P sta Cha We S ee OPP : eople vvhornadel9 6- 7 rage .FunnyrnanBnII - unneru om rulse, sing r I0 us n,obn xlous talk-show host Davud Letterman, the young, loud, and snotty Beastie Boys, top-of-the-charts-singer Janet Jackson, the computernzed person my M x He dr nw, the VUQFICSVS Cup vvlnner Dennis Conner. thenvvond rfrorndovvn unde-r PauIH Q n,prlrnet1rne'sf v rrtec uple 1 r n ruoe Willa , an latoonn r rn h n. 06166 QX0'!'x'0o NX be XKME QXX eo fa V V-og U , 2 ,Q , Z 9.9 ...2 E E... -C Q -ai QQ Chic, hot, live, raging, to- ta-ly cool! These are only a few of the words used to describe the sizzling trends and humming fashions of the I986-87 year. From the month of September to the month of June, Marauders put a dent in the fashion industry by creating their own styles with true blue individuality. The word out this year was OUAUTY. Trendsetters arrived on the scene in the latest fashion wear which might have consisted of the original Benelton sweater, colorful Esprit pants, 6uess ieanwear, Gucci handbags, and Swatch watches piled on arms, ankles, and even hairstyles. Baby on board, surfer on board, party animal on board, I 'm bored, mother-in-law in trunk, and illegal alien in trunk were plastered on car window after car window. These yellow signs proved to be hazardous to the health of drivers and pedestrians because of the 99 For those who preferred to take a far side point of view, The Far Side, a cartoon by Gary larsen, pin-pointed the warped sense of humor. turns the average person into 'the' fashion statement of the 80's? What else but... fashion accessories. Big bangles, tiny charms, big face watches, western style baubles, clunky chunky old chains, au faux pearls, ani for those who are doing all right and getting good grades, the future's so bright, you've got to wear shades! 0ooo la la, look out rubber band, seems that you have been outstretched by the hottest hair accessory around ...the big bow. Made to accentuate any and every outfit, the bows added a touch of style and class to everyone's doo. i ull ' pn- ' ' ' AP -A f : fi? 23epIf:ifaf.fi'ig+i N X H-12252 K e ' f'f- ' Q ' X? - ll, YOU'VE got c blg MOUTHI Jungle wear lBanana Republicj drove today's Tarzan and lane bananas with the enormous amount of safari and tropical wear. Create the total sporty look or just kick back in tennies, sweats, hats, and socks from Adidas and Fila. These were no longer only typed for the jockliockette. g look out cows, leather apparel is on the loose? fland bags skirts, shoes, pants, jackets, everything bas leatherized, despite moos of protest. Yes you can drink your beer and wear it too. 6orona T- shirts, tank tops, and sweatshirts were the latest rage from Mexico. Banned at a ew high schools, Marauders took the pleasure of living in them. Speaking of beer...this Sfuds for you. lt seems that t at lady killer, party animal Spuds Mackenzie bas been frollicking around in bud commercials. ls he a beast or a ladies man? Well one things for sure, he is definitely a dog. Crack kills! This mind- wrecking drug was constantly in the news. The dangerous drug, a cheap form of cocaine, not only ki led but the use, ruined lives of those involved with them. This and all other illegal and misused drugs were, and still are, definitely uncool! There were many 'crazay' and wild occurrences not mentioned above, but unfortunately this copy has to end. So stay cool and don't be a fool. Do what ou want to U04uZUZq 6 fi . init: do, reach for the highest star but don't get bummed, and above all HAVE A BlAST! Glitter, glamour, time, dance time, club time, fun time, all the time! During the weekends Marauders danced their feet off from C' em, Escondido fAfter Darkj and Distillery to East 6ounty fStrattusj. For the adventurous and daring, I8 year olds ventured south to the world famous 0h's laser Club. CD OUiSVlittOH. 33 mwevg YYNEGXK and lov edge BVVXYNQ UQYX VB YNAN6 YXNX6 XE: K 9 dean I Z me game, X Xgme. Y, W? A amadov 1 FAV. COUPLE 1.Maddie Hayes 84 David Addison Q. David Geary 84 Kris Anderson 3. Cneecn 8C Chong 4. Mom 84 Dad 5. Mr. 84 Mrs. I-Iuxtaole FAV. TEACH ER 1. Mr. Parent y Q.Mr. Granrn-Caso Ufif. 3. Mr. I-Iall + 4. Mr. Lux G 5. Dr. Payne X 1.Toio G Q. Ferris Buellers Day Off G PAV. 3 Q OUT 1. TJ. Q. Beacn 3.Todd's House 4. Parties 5.MaIiou Grand Prix FAV. SONG 1 .Bizarre Love Triangle Q.PauI Revere 3.Situation Number 9 4.Brass Monkey 5.Brand New Lover Golden Cnil .Crockodiie ' Dundee 3.Stand By Me fi. ' d J UI M N .39 E he DDy and gwlng mfg-V comfomng rn S ' O 0 CU E Il'll Ehfbugh :Ffa push E d V 'ho A 0 'il fn.- 'Q 2 4 ' MW 3326 M ,X Q W Zi Zffa4cJ M -4 1 f I A I , aw 5 g Q Q 'Q ,A ,V 5 k fig ' f fwwmmm My f Lim, www ,..,,, AL ,y X W mb ff , 7 ,Q , f 55 W V v' W-xj --', 'fl QE TCJLJGI-I ho do you turn to when you want advice, know- ledge, or a beef and bean burrito? The staff at Mira Mesa High School spent many hours during and after school perfecting the campus academically and physically. Under the direction of Principal Jim Vlassis, the administrative staff made sure that everything ran smoothly and efficiently by setting excellent examples of leadership. Who do you turn to if you need a schedule changed? Any probem, big or small, was efficiently handled by the counseling staff. Marauders were not only taught the ABC's and 'l,2,3's, but many teachers advised and supported extra-curricular activities. Who should you turn to if your locker is broken into? the fearless security team keptthecampusinorderby discouraging tardies and truancies, student miscon- duct, and other problems. Do you know how many grains of sand it takes to make up the shores of Waikiki, or what kind of a platypus eats? The librarians helped find the answers to these and many other questions. Are you hungry? Prepa- ring delicious cuisine pleasing to the Marauder palate was definitely a challenge. The cafeteria crew kept things cooking with an array of delicious dishes. Why is the campus so attractive? The custodial and gardening crews kept the campus of MMHS it beautiful best with their hard work. .'l 1 i::.1 2. David McMenanmyiatteh1Dts to waken Mr. Regaseafter a iong days work. ' i . 3. Kris Anderson and e Mr. Saunders discuss the clarity of a picture for the yearbook. 1, lVlr. Bolden flashes a charming smle at the camera. 2. John lVliranda takes a break after a long, first-day at his new job as Vice Principal. 3. lVlr. Otis Punches takes a break during his hectic schedule to sweat out a couple miles. 4. lVlrs. Barbara Wells lots down some notes during another meeting. 5. lVlr. Vlassis tries to soothe his inflamed thumb after accidentaly slamming it into the refrigerator door. B. Attendance clerk Valerie Clem smiles happily knowing that it is she who runs the school, not lVlr. Vlassis. 7. lVlrs. Cora Brown asks, ls there anything else you would like me to do? ith gracefulness and enthusiasm, lVlr. .Jim Vlassis flawlessly led the students and faculty to yet another memorable year. As principal, he claims that he ls responsible for everything, and does everything. However, the general feeling is that this is an overstatement and although lvlr, Vlaggjs plays an important role, the complex drama of the school administration requires the efforts of many people. Four vice-principals performed a wide variety of jobs. Incumbent VP's Barbara Wells, Otis Punches, and Gus Bolden, along with newcomer John lVliranda, were responsible for evaluating teachers' performance as well as acting as a liason between department heads and the administration. A dedicated group of nine counselors shared the responsibility ofguiding students through high school. As always, they helped students get into college, or get a diploma, or get a clue about life. i AoiviiNis'rnA'rioni Ed Allen Algebra Business lVlath Romana Anderson l-lome Economics Child Development Priscilla Anderson District Counselor Alton Bailiff Advanced lVlath Geometry Midge Backensto Librarian Julie Barnes Data Clerk Helga Barthold Spanish German Sheri Bean Special Education Assistant Paul Beck Counselor Marcelle Benjamin Imaginative Di English ..., ,,.. . .. .. .. . -Q' .. ' - -' ., 5555555 eader o f t h e Charles Bentley a c k Industrial Art Diana Bentley Advanced Science Gary Blevins History Athletics D. A. Bolden Vice-Principal Kathleen Boschen EngIish!SkiIIs Lab Don Buechler Driver's Education Maureen Burke i Is- , ,,. , . N American Literature i 5 ix Imaginative X ' . . J - Dimensions 'Xe ee st Leo Casias Spanish I' Cathy Carricki Art V E Another roblem? his is the land of confusion. A land filled with immense student demands, conflicts with schedules, and enormous amounts of paperwork. Handling this was no ordinary job for ordinary people. These hectic tasks were amazingly conquered by the super counseling staff of of MIVIHS, consisting of head counselor Cindy Snidecor, eight other counselors, a district counselor, career counselor, registrar, secretary. guidance clerk, and a guidance aide. Together they assisted Nlarauders with academic and career decisions, and personal and social problems. They provided information on colleges and universities, tradefvocational schools, financial aid, and scholarships. The staff also assisted teachers to balance and solve discipline problems. They communicated with parents about school, and they worked with the administration regarding student placement. Even with the over populated student body here on campus, the counselors managed to give personal attention to each and everyone. Only the best would do here at MlVlHS and the super counseling staff definitely fit the mold! COUNSELING? si - Mag . .. gf Sherry Castle Counseling Secretary Everett Chaffln . Advanced 1 I r U .S . H i sto ry I . , f . L : if Q kifki Olga Charles Spanish Lois Cirner lVledia Center Technician Rita Claiborne Life Science Biology Richard Clem r ' ' TEQN C Physical Education ,1-e 2 - i f I ',.. A f ,.,.e . iisets Valerie Clem Attendance Secretary Joan Cohart Basic Skills Carla Coffin Student Store Financial Aide Louise Conner E Spanish French Kim Coody Student Government Janelle Cook Counseling Secretary Patrick Curl' Algebra Joe Cristarella Security Aide Angela Croce Child Development Maria Dailey Attendance Karen Davies Art Lynn DePaul P.E.!Aerobics Michael Derisi Special Education Donna DeYoung Alegebra Computer Science 8 we 'Q mm My .',, 53 KI 5 k ,,.- W ,,, V l 'l. Being the helpful person as he is, Mr. Beck tries and pleases a student by searching through files. 2. Mrs. Sobek explains to a student that he can have either metal shop or child development. 3. Hello, lim Mrs. McMullen. My job is to help your child during high school and make sure he takes the classes that will benefit his future. 4. Not another picture. exclaims Mrs. Duffy as she tries to work on schedules. 5. The Counseling Staff consists of: lback rowl B. McMullen, M.Johnson. S. Duffy, K. Liles,J.Jackson. C. Snidecor, C. Sobek, lfront rowl P. Beck, and H. Hunk. counissuni ll A Ka ii I ... ... A A ' sections teachers. in Spanish, French, of these languages to grades Q-'l 2 at lVllVlHS. student vvas required to actively - orally and learning to read language. Fourth year Spanish students Mexico, to live with lvlexicanfamilies fora in order to practice their Spanish skills. 42 19 ff 'W .,,. ,.i' . , . ll... it Ina Deiner Financial Secretary Sharon Duffy Counselor Shirley Duchock UB. History World History!Geo Pat Duncan ESL U.S. History Bob Durham Advanced U.S. History Judy Earle Ceramics Larry Elliot Physical Education Athletics Suzanne Emery Journalism Advanced English Otis Funches Vice Principal hovv to communicate ina i Rosemary Fev Librarian Robert Gabrielson Geometry Pre-Algebra Intermediate Algebra X ' ',11q,- Q Wells G ood h u e X Advance Science Q Physical Science ,tgagi i .l A ani i P Q F ra n k G ra h a m - C a s o America n History dlli :j i at d Directive S tudy G ove rn m e n t a n d E c o n. ,,, ,. Philosophy c Q Tina Graham-Caso Adv. American Lit. English Brad Griffith PE Weights Athletics l3lOl0Qv g Physiology seas' Ska .Ansar Ann Marie Hake IVlarketing Shorthand Typing Noel Hall Government and Econ. Englisw maginative Dimensions World History l ii'i Gene Hanchett: Political Science r'f'1u12 L Katherine Hanks A iiii American Literature A English V 1. lVls, Oberhaus talks of her day vvhile relaxing vvith a coke, 2, lVlrs. Toma prepares herself foranotherone of lVlr. V's surpnse visits. 13. lVlrs. Lopez amuses her class by trying somethrng new-aread:ng Spanzsh :n braille. 41. lVlr. Gasfas deczdes to try and act cool vvhzle posing for the Nerdsest Teacher of the Year avvard. I All Adds Up earing his two-all-beef-patties-special-sauce- lettuce-cheese-pickles-onions-on-a-sesame-seed- shirt, Bill enters lVlcDonald's and begins to fill out Scanning the form, he finds it to be and straight forvvard. But suddenly, he l-le shudders. l-lis mind at him, with a large white HYPEB- In the beginning a long, industry. skills learned from his math probably be a transient wandering lVlesa's math department feels a great .. When it hears about students like Bill-- vvho are able to relate their mathematical abilities to the vvorld around them. The story of Bill is only one example of hovv math can serve not only as a means of success, but also as a source of hope, inspiration, and joy. Neil Heimburge Wood Valessa Hentges Attendance Secretary Jane Hernandez IVILT English IVITL Resource RES Sped Ruth Hicks Algebra General IVlath Christopher Holtz Chemistry Terry Homiston Physical Education Athletics Dick Hull Discrete lVlath Algebra Trigonometry Julie Jackson Counselor Herbert Jamerson Government and Econ. Gwenn Jensen Foodfpre-Nutrition Gourmet Intl. Food ----- i Jii' f,?5Qif , t K M N x N , 5 Sa N l is X 'S X KX ix 55 gg , X X its bi K f X, ,Q s Mary Jensen Biology Cheer Advisor Marlene Johnson Career Aide Judy Johnston Algebra Computer Science Intermediate Algebra Mark Jones Security Stan Kalinger American Literature English Richard Kalling Electronics William Kennedy Choir English Jean Korhonen Career Aide Mike Lanz General IVletal World History Dun Lee Government and Econ. Amer. Government! World Affairs Z 4 Z Z 5 it Z 9? 5? ti l x,, ZZ S552 1, 5 , , f, l 51 1. lVlr. Hull tells David Smith vvhere the lavatory is located. 2. Beth Each would rather listen to the audio bulletin than lVls. Johnson, 3, Feigning happiness, lVls, DeYoung goes through another distressing day. -MATH ck, 1q1E he robed priest stood atop the majestic pyramid, and slowly lowered the mummified body of the king into his dark tomb. Elsewhere, armored knights engaged in fierce battle within a gloomy lVledieval Castle. And at yet another time and place brave pioneers rode in their covered wagons along the winding, dusty Oregon trail. These are but a few of the scenes that could be found within the classrooms of the Social Science Department. Whether it be to ancient Egypt, Europe in the Dark Age, or America's pioneer days, social studies teachers were able to transport students back in time to experience history. Valiently led by lVlr. Ted Parent, this hardy band of teachers struggled throughout the year to delve deep into the past with their students, learning all about the long, rich history of mankind. The social studies department, one of the largest in the school, had an incredibly broad range of msronv .A Future subjects, and sometimes could be found to satisfy anyones historical curiousity. The classrooms of the social studies department dealt with not only the past, but the present as well. In Government classes, students learned of the intricate workings of American Democracy, while Political Science courses stressed a comparitive approach to the study of foreign governments. The teachers were responsible for the success of the department, as they avoided presenting history as a dry, boring list of names and dates, and instead breathed new life into the subject, creating exciting, realistic and memorable historical tales. Having a good department is essential for a high school. History is perhaps, the most important subject in school, since, according to Flobert Durham, All we can ever know is history. Sy via Lee Business lVlath Tvirlino Kay Liles Counse.or Es-l-le Maria Lombardi Vllor d l-listory! Econ. Government! Econ. Evangeline Lopez Spanisn Dennis Lottermoser Physical Education Ath etics Thomas Lux Physical Science Life Science Leslie Mack Algebra Trig. St Adv. Algebra Athletics Sharon Mankins Financial Secretary Harriet Nlarriner AP English English Public Speaking Andy Martinez Drafting Arch. S Drafting . f,. ...t 'U Q E X EN X egg X x -X T X L E X E. ' im '52 X If gl X55 .SE W' kr .5 gg YS N rs NN 1 5 :X R' -f ' Matt McGowan American Lit. English Drama Chuck Mclntire Physical Education Athletics Christy McMahon Geometry Consumer lVlath General lVlatr Rebecca McMullen Counselor l-lf-Li Geri Minott Adv. American Lit. American Lit. Phylis Mique Instructional Aide Dennis Morgan Adv. English English Joseph Mullen World I-listoryf Econ. US History Paul Murphy Adv. lVlath Algebra l 9 1, IVlr. Lee chats vvith Ronald Fieagan on the Iranian missile crisis. 2. lVIr. Prosser kicks it after a hard days vvork. 3. You don't have to do anything, hovvever, ifyou vvant to get anA in the class ...... gays M,- Durham. fl f-'wo We -im7m,1ifammf4fMv,4fBK Sus Nakamura Career Counselor Howard Nordeen Intermediate Algebra Geometry Ann Norman Psychology Ann Oberhaus Imaginative Dimension Advanced American Literature Ray Oberle Drama Ronnie Olson Geometry Algebra Consumer lVlath John Orendorff English Contemporary Voices ln Literature Paul Otis AP English Adv. American Lit Government and Jean Palmer Pre-Algebra Phusical Education H v,:v- '15, V f iv? A t h I E t I C S M ,iil. .i i - A iil,, - ii iJ,,-.' i ,,l,ii,,,,,ii, i,, 2 - L ,:g'f ' Ted Parent UG History Q.. Fiff 55.1 , . '5,. - J L kg ,.-if fi 51:5 an aw :i.ii QQ N X sX X X X X X X i 23 Q X 1 A 5 S web it SSN QW 1 ', A , Q 7: N c E lv fff ik ZZ: AP American History t Generia Perkes Typing Business Computers Jewel Poole Spanish Jean Potter Library Secretary Marleen Peterson Physical Education Jack Ray Applied Fleading Applied Science Applied lVlath Applied lVlath lVluIti-level Science Dan Flegas Drama Louis Regas Advanced lVlath Computer Science Consumer lVlath Katy Rieker Library Technician Lee Rocheleau Advanced World l-listory Government and Economics Earl Romero Advanced Biology Physiology 1- 'I lVlr Holtz offers a refreshing acid facial to Shannon Niespodzlany while Ruby Pagaduan turns away from the gruesome act 2 lVlr Schmidt sacrifices his precious time for cleaning test tubes to help his utterly confused students Z 3 lVlr Lux ravenously attacks his lunch of French cuisine ala formaldehyde n the fitful light of the bunsen burner a strange and eerie group of figures Could be Seen clustered about a table Geckling with hideous insane glee the group worked feverishly on some unseen probably diabolical proiect Who were these mysterious creatures'-' Evil experimenters attempting to create strange new monsters? Witches and warlocks summoning terrible creatures of the night? Horrifying alien beasts performing disgusting experiments on earth life forms?--No it was worse than this. These horrible demented individuals were lgaspll science teachers testing a new lab to use with their classes. All over the campus the science teachers, involved in subjects such as chemistry, biology. physics, and physiology, made great progress in their goal of creating a scientifically educated and capable student body. While the teachers of this department were perhaps not as insane and demented as those in the above paragraph they were just as excited and energetic in conveying their knowledge of and love for, science to their pupils To raise funds for new and improved equipment and lab suppllies as well as field trips the ,department successfully conducted candy and poinsettia plant sales For scientifically oriented students who wished to pursue their interest outside ofthe classroom a number of clubs were available including the biology and environmental science club. Along with teaching pupils to deal with and relate to test tubes and calculators science teachers helped students deal with people as well. thus accomplishing their goal of helping students understand the relationship of science to society. hat Clijiiyou Want to diotinirith your life? Doiyou have any special interests oreislitillis? To help fitndttieeanswersito these questions, many students signed and took the tremendous seiection of specialized classes availabie at lVllVlHS. lf you wanted to learn hovv to drive, act in a major production, type forty Words per minute, program a computer disk, or make a book shelf, lVlira lVlesa High was the place for you. Elective courses helped many students become successful in school by presenting them vvith courses which not only interested them, but taught them new skills. Nlaraucieirsiireceived oniyiethe best trainingifrom the highly experienced instructors in each elective course. Specialized and required courses were mixed and matched on student schedules to help meet graduation requirements. Specialized courses made school a fun and interesting place to attend. Nlarauders had a wide variety of courses to select from. Courses in Fine Artsiitgincludedz introduction to Art ,get i Cammercial Art,qE3eramics, crafnsgfr swing and seating, Fiber o.eisiQn,. sand chorus, seginnmg Guitar, Drama and Stagecraft. Courses in Practical Arts vvere: Business Law, Typing, Office Training, Business Communications, Shorthand, Accounting, Business Careers, Business Math, Marketing, Clothing and Textiles, Parenting, Consumer Education, Family Studies, Foods and Nutrition, Gourmet and Foreign Foods, Contemporary l-lousing, Host and l-lostes,s,. gChild Development Aide, Drafting, Graphic Arts, Electronics, Woodworking, Auto Mechanics, lVletal Shop, Drivers Education, Computer Science, Word Processing or lVlicro-computers, Public Speaking, interpersonalCommunications,Journalism, Video Production, Yearbook, and Student Government. 'l. lVlr. l-leimburge takes a break with Caressa-Li Baker in wood shop. 2. lVlr. Kalling flashes his pearly whites for the camera. i't1,li1l.l1 ,!N, ,, L ELECTlVES '1 i Anna Roseboro Imaginative Dimensions English Coleen Roseman Textbook Secretary Kathy Rotcheck Drill Team American Literature English Howard Runk Counselor Pat Runyon lVledia Center Janis Rutland Word Processing Computer Applications Jerry Sandlin Intermediate Algebra Advanced lVlath Technical lVlath Earl Saunders Art Commercial Art Yearbook Mike Schmidt AP Biology Physical Science Tony Schiraldi Computer Science Consumer lVlath Advanced IVlath Advanced Geometry Craig Secord Chemistry Biology Jane Shanner Advanced English English Lydia Signorell Student Store Beverly Skinner Business Careers Typing Richard Smith Health and Drivers Education Cindy Snidecor Head Counselor Carol Sobek Counselor Linda Sommer English Interpersonal Communication Gail Struffer lVledia lab Larry Stell German Physical Science EIectives-- I A ll' y 5 it e an l araudersl Did you have a bulging stomach, thighs vvhich resembled puckered large curd cottage cheese, flabby arm flaps, ora double chin often used as a pencil holder? For anyone with any, all, or even none of EQQTAEKQDOVE characteristics, the PE department came to Carol Stowe Physical Education Athletics Richard Stowe Accounting Business Lavv Typing William Swain English Fleading Development Clarence Thomas Advanced English English Dale Thomas Advanced English English L. Thompson Fletail Merchandising Suzanne Thonert American Literature Advanced English- Wfa-ifiidiai ,. at , , ,,,, v,,, .. ' iii laiy ' W W Zi f f 25 at at X W2 f 2 if , f is 5 if W, ,, . ' WW? Q f fi ,, When it came to shaping us up, they were Clustelq wwf teachers like Lynn DePaul, Brad 3 if3riffiity,f5l7E1FWfliltoifnifajtong, Dennis Lottermoser, and Earl Tolar A S' fi R ' QTGfi2?E?'dWiiefilffiefdifrsidetrrmtslle,lifelilme fitness- WY Advanced ividnh elri rfrr QQGQQKHQTSCQEetwaflsiixtetarssiaveigop basic SKINS- SUUGEHHS AI b , asea i HQlf5953flsfilltll'-ffll'befmU5l? i3if we but also QE la . VSI1lfQgQQ15ZlQB,HBEljQQGd asdcfialf idcdraci:idydl - 5 Q t t Intermediate Algebra tfffesiifwesrisliasndQ1dleiahUmQvesfiifloiflliidfieduifed DHSH2 l rrl A PW?-5lf1Gfllli9il?l?lf2f'i'tlG'?iTAGQWSESEfflilatgindiuded: raddenddii, Q volileyballiistennlsgasoftbafli'andbasketball. Juniors and Larissa Toma Qseiniorsfzhatl plsiviledge of working out in full French Lsemeisteriicalyassess like aerobics and weight training. H - S slgts F attire Refrigerator Perry's, lVlary Lou Fletton's, and Usslan Huik Hogan's received the chance to shine by participating in lnterscholastic Sports held during sixth period and after school. Kathy Villanueva Xerox Aide P E -' i f:- Jim Vlassis Principal Mary Wagner Library Magazines Nancy Wahl SIP Virginia Ward Geology! Economics World History Barbara Wells Vice-Principal Story Wery Biology Lifescience John Whiteman Teachers Aide Marge Wittstruck Technical IVIath Advanced IVIath A Pre-Algebra Len Wolfe Advanced Band Intermediate Band Beginning Guitar Typing IVIarching Band Kim Yerly Instructional Aide E::4f 'QfjIW.,nlfifgy ffyibllll? H ,,,,, ..,,,, I , I f M Wi J Wwyf - Www, Z , f ff Kwwwdwff f ., A I 50' W X If Mx f, ..,,, f jf gf f 4 wwf ff fr mwawfwf a W MM WH 1 ff f fw I , l. Coach Cunningham checks his students for correct athletic A 5 footwear. ' ., in , 2. Bruce Willis here'?I No..,it's just Coach Lottermoser. - ' I ' 3. IVIs. Peterson discusses the meaning ofoadmitton in relation to V .,..-'. .QQ fl A Q life. ,',' .- '.,,i I , 4. Coach Griffith - No pain, no gain, p t V' 'PE .. ear E aww Q H? sig? at H510 P5 Qi g z :ES gi. 225 E Em gig v Ve: J? S Q2 e Ea m i? , E 2 SEC., R.0.P. D.E5 L ' H! hm gr , Q l Shirley Young English English Literature Kim Yourczek General Math Computer Science intermediate Algebra 1. A diligent officer Blackburn pores over the latest news from the security department. 2. With an unwavering interest, Kim VanHouten listens intently to Ms. Thompson lecture about the working world. 3. The few, the proud, the security personnel. lFrom leftl M. Jones, M. Shirashi, Officer Blackburn, M. Runyon, M. Gault, J. Cristerella, J. Whiteman, and M. Garcia. , I ' at esac., n.o.p., n.E. as W ff V 'ffggikslwwemmffnfffffaf', , -ffr 4, ,M ,pw-H' Kr zz' Aww e w,7,.w.f W g g I if Qwlfk I aw:-,ggliaf sg,-W ' xy, ah, 4 , 0 'r V' ' M, A 'ga' A , ? ff,-if 'iv '-b , 'zf' V J' w?2n'!wY'f.,5,f 'Luffy 'M ,V ,,44.iQi2 iffy: . -3' 1 , ' - ' A 32' V,,,, ' ' gif , ' , 1 V f ' X ' v 1 f F 1,1 A , 'Hi' ' 5 a-'tg t vQ2vZ74f1 4 ,L ii av f Q 4 'w W4 f LJZFZ5' mf: I 125 x f J Y 2 , f hile the cafeteria staff, the ,fd gardeners, and the librarians appeared to have little in common, they are in fact quite alike. All three departments are entrusted with enriching the school, each in its ovvn special vvay. To the gardeners vvas assigned the task of providing Marauders vvith a beautiful campus. Lush foliage, stately trees, and gently rolling hills of grass vvere created and maintained by the gardening staff, vvho in this vvay contributed to a better Mira Mesa l-ligh. The library staff, headed by Midge Elackensto, enriched not the campus surroundings, but instead the minds of both students and faculty. With counter magazines, films, waiting to be checked out, the library had something for everyone. All vvho entered this vvondrous palace of knowledge could not help but return more intelligent, vvhether it vvas due to reading a scholarly article, experiencing a great work of literature, or merely conversing vvith the learned and wise library staff. And yet the very backbone of the school, the driving force behind Mira Mesa l-ligh, the thing that kept us going throughout the year, vvas the CAFETEFRIA. lts staff prepard and served delicious feasts of nourishingmostly vvarm, and very interesting food, to the student body, keeping us healthy, alert, and happy. reference books, and novels just .4 1. Mr. Talbott takes a break out of his wrestling schedule to teach a class a few ruIes of the road. 2. Mrs. Floseman, part of the library staff, takes time out of her work day to give information to a student. 3. The gardening staff and John Clarke show off their tools of the trade. 4. Mrs. Wheeler checks out a book to a student as Mrs. Fiosernan looks on. 5.A The cafeteria staff consists of: Sharon Aguilar, Grace Sloan, Margie Barierski, Rosity Tajilla, Miyoko Kosaka, Wuchichen, Cindy Bailey, Brenda Schuffel, Angie Flomano, Lorna Underseth, Flita Wold, lcite managerl, Jackie Josefson, Anne Reyes, Mary Lou Swelland, Burtha Mendez, and Edie Hernandez. Driving Fore CAFE., GARD., MEDIA WMA. u ,Z,,, ww Mf 3'-sy. Wbh-up ' ft, 3 ,Z 5 Q A X i fiii. lek feels 1 L- .,', 'wi 'f,f f ,,, :V'i 5W:f3dWEZ:41:4 ,f. , M , :, A ,,, 'f - ', pg, V ., :gg 5 ,,:, 5j,g.,W5f1- ,,'.. ff , ', ,f .,f,1 f'4x.i2Aa,Z1-'Wm 2 0' . N ,, . ff, ,f,.f!0f.m,fL. M 6, 71-pmff' iv' , wtf we War- W,?mtZ4.v,E , -- f i , ,, i a be if Q .,, W . THU --jAIgg.3g-ggi:gg.,:2- ' '..,g:g:g,5:E. -' ,... ...f:2fg25.i:'5f5512255 53'Ef5i:':i5'55 '1i?E A , , . ::, 2 inf ':': zif.fi-ff:.:i.:ffff:.15f:3::i -'-- 1 at '-2- g'f2.,::g '- .,'.g :-g:- g'f-jgjgjgr -5-: 3, as : ..,: 5 .,,,5 , M A A ., A 5 HOT ' eniors are here to rule the schooI. Even with the overcrowded popula- tion of more than 3,500, Seniors stood out among the crowd. It wasn't hard to tell who the class of '87 was. They approached life with an over abundance of animated spirit. After three years of anticipation and waiting, celebration burst out in a frenzy of excitement and elation. Anxiety filled minds as seniors shook in fear over the unknown zone--their future. Minds were stretched to the limit as students hurried to fill out college applictions, sign up for the draft, and plan their lives. Senioritis set in and snoozing in class, day- dreaming, and hypnotic trances diminished study- ing. By the end of the year seniors snapped out of their daze and began to prepare for the prom and graduation. As Seniors approached adulthood, memories of school, friends, and childhood faded away as visions of maturity and a bright future took over. 5 mf A ff ' 0' .zy jgz V ' w v,, 43337 up S M if-'WW' M ,,,, Www S A W, .,,,,,L. , .. , ,2fzgfgz,g,i,ggw?1fifgL4g-1 if , gi 3 ,,., , . X iw a 'm ' 'M-M-w ffr. A ,gg f , ' 1 f H 5 ,Y 1 , g L, 47 iw QW . W5 ,Q h Q , fx s 4 e E . , 3 , . , ,, wi- Q, it f wi:-Q , 55,25 225 i ,,,A.M , a,,,-,u,,.a. , .,M,f1Q-W4 1 4 K ., V 2 Lf' F ': , S ,,,, 5- W, I 5559 , W aa, 5 411 ,fwzazwqfgwzdeaa sws7s,',,5 QW? :iff V ' f 'x1155ffU2?5i'::fMww Q ' Q 'W 55? f Wf , f ,z k I k,,,L ,fy ,f,,, , V 1.,. , ,ww .. V fs, I 5 wma W 1 w..:. , , KVA M53 QQ? , 2 K M , :ev W' K A 155556 ,WW?'35,,zf' 5 W , :Minis gg sw X X Mixing? ? WA 'fr E 4 wf J .58 ,aw Ee? ,, whffjw gf K MASW V SIVSLQQM WJ .agmgilgfw Q fm 3 ' , Q ' W hu-ui' 5' if l igyyi 2 4 3 3 5? 5, ,,, gi E 1 S 5 . 1 2 335,22 Q ii g5,,,,? 'i'4w, E132 5, vii ,, g ii gi, 2? Y ff ff 4 vvv, , ,I, , V X. N ' Q , m , 5 ., , ,I ,, QL Wt' ' 5 ' S M5 may 2 1 v'hf Q .. A if y, , LL ' ,, 5, A Q i iffffff 'F,, .. K 'E 'HN...,, .ig V, .-,,,-- 55512 ---, Wim ,, F ' if Q 3 'Est is A A 222221 2 i , . , q E P Wi? Q V 5? , f .42 W k f iw , , 7 , M A s , 5 W, 'EW ff ff-- I , fr -f ,Q , QL 1, E 55 'v , mW, f J 1 W ' L , L .' X 5 ' ?'7Em' Li, : 9' ,. ,, ,,.,. T932 -- J ,wxwmmyf . nib 5 Mc, ,,.,.. ig, was , v X L ,,,,, , , ' Jkfazw, WJ? :ui-,33?,3f ff W ,f 42 -IAV K 5 ,f . QSM f S299 f- if . yyyy , wh W' W , Q--,wfnf gsm X X gf- W E Q A , 5, wewgw gm 5 , , M,, 4 ' ? ,,,,,, WZ f f fi g fi? a if is I ' 1' 3 Q , X :WML ' A l 3152, 144 Q' 1' ' I L 5 552251355 - Q f 1 ai ., A W Ei f 5 21 Q V . ',', 2 , . 1 A 1' Q 1 A 3 fa: f ,Q 5 ,.L - ' X 2 fam ,QE 32 53 QE? if - f ' 2 W ' ' i A' 'H A K , 2? ' 5 ' 1 K .1 N,-g Q ' ' .erm . A , 3 , N ' f J 1 M, AM- ' f ' i gg E 53 Zim f ,,.,. 3 ! , f ,' ,, A , . ,, 5 A' 7 73 5 Q, '14 Q 5 3,5 K 5? , HW f Emi '65 we ' if 'K ' ' - 5 2? A , 4. 4 ' ,,,,,,,,,, , ,V WW,fsgg'NWw'1L ,, ,f5gg,wggg,,, f,,,f:?.:4,f hwy ,, ' 'H 2 ' fi,E:f.:f,, ' ' ' ' , , T M' ' v ' 7 Q5 f , f5,,,g5,g,,w:- f ,,,, ,W ,4ffw13Ezf'gpg4 gi 5 ggi-,ww ,,,-. ,,,,y55,4f53 wh . x ' V ',, 2 s ' , M27 WN' 'fi J 5 Eg i ' iff 1114 f f' A 1 2 ,V if gi Z M 3 5 A ,W W , ' V 'm ,, ' , , K E221 , 5 wi f W W 2 iii , 'mww,m, 5? 5, ,Q gi Eg! 2 . . fl we Q 5 ggi H L- , ,,, ,Lb Z Sz ,ii Q Y' W L,,f ' i ff, ': ' 1 : f , 1 g ffgi fix, , ' , 1 ' 4 QQ 2 if ii h ' ' M V' -- . ' f ' ' f f. M , W 221' Es fix? QE ...... ,M I y ,A , .JE N 2 N- , f, 3 .n , 1 f , ,, W ' ? ,,.W,2mm. ' .Q ' X I2 , H ..1,,, V N A A',' I W ,- f fl VIL: ' as ,Y 2' ' , 4. 5353 g 'X Q, ,,.. , , A ,Qi W1 A EL , Q 'if ff ff my Qu A a 'Q ' Q. 5 F 4aESfX5',f, L ' 'A 1: , fi 59' 5 l F ff X g pil' , ,, 'wil' LW . 47 I 6 '. :-- ,, , 3' Qs H I KTAKFBQ A , fy? A , , 1 gf! im., mss,m, .. Y , , ' , ileww M,,,,,,2, R i Nw P4 w 4 l 4 , ,W ,,.. pi 21 .V Mw' qf W , Lp M, 5 N A M, N 4-5 ,Vi ' wi-Q. W W at .. 1 V P+ -' ' - , w M M f , 34?Af3Se . , A wr J K WH lm Q' V 'V . , X V E U V 4? Q , Q f wg ,I 'L My A V f w 1 -, 1' Q ' ' E - :er ' Y - M- Q 5 Q, ,, i ,k f1'l. 3 V ' 1 5 i L ? ig f W 1 if : gg ' w ' ,V K H 1' V : 7' W MMA QV M1 . 2 A ff. ' ie Q A '1 M L , 5, M M 92 ga fy , , me, mfg 1 HD .4515 ' A .. i 4 , Y ' ,QQ f win fu iw . ..AQ- ' rf--, ' QQ ' X N vw wif- 2 Y ' 2 - ' 2, 1,J Tl' 4 1 1- ' P 155 9 15 'W W 5 gag' f W' b vw' ,W W W w A X M if J, 1 ,W mm, ag JWMEQHW., xf -V , - dn, 1 44 mst Likely To -aura Toller and wif -15, ..1 I ' 4 5 1 Q 4 4 1 gm Y g it W s R 11 9 I 3 i 1 y T CLAS f , V 1 1 4 ' . ai 5 i! ' f 4 ' . ig ' ,3 , g 1 il Z' J, 1. , 1,4 4 1 I Y r a Ai ' ff A, 55 I 3 CIF 4 1 0 if 5 ,. J a ,Q , ,E n 'I , 1 v . , , . Y 1, . 5k , x M 1 ' X I , f if 1 'L 1 'f ff 4. 'I A 'A 1 'f 1 ,V 0 2 1 I x L f 1 1 v ,, W,-13 Iwi. Voted' Wnidest: Smiley and Voted Cutest and Leah Stahl. K Voted Best Cummings and Scott Godzik. Anderson Kris Anderson A -Y, Tammy Anderson Audra Angoaya Alvin Anquillano .XRVM .v J my Mark Antonetti Erica Anzalone Tim Arendell Aileen Arning Yvonne Arterberry Mike Aruoan Ryan Aruoan Tiffany Asnoraft Jesse Asnley Angel Asunoion Flufino Autos Danilo Avlinion Gina Baoala Robert. Baonrnan lrrna Banana Flionard Baird l SENIORSV ' i 'al 'I Aba no Anderson Jeannie Abano Kristen Abbey Gloria Abejar .Jonn Adams Jeannie Adelrnan .Jolie Agle Peter Agoinaldo Joel Algar Brad Aldredge Laarni Aledia Davy Alexander Albert Alivia Greg Allen F-'atriolc Alonzo Alfonso Alvarado Teresa Alzona Veronica Alzona Clneri Anderson Jaoen Anderson Jeff Anderson 'SENIOR he Year-'s avor-ites Favorite Hangout Favorite Song Favorite Teacher Favorite School Dance Favorite Paettime Favorite IVIovie Favorite Saving Beet Memory from High School 5 L, .Vi , , 5 ,M W E iff? 'gf ms? wif.. T X A J 1 ,,,! E A Y 'Q M H F L., 1. 'RL K M W Q fi- . '- 9 ':ff Q ' , W we: V i 'W ' w 'f if X Y If We i K Y ' gg R Vit, - t '1., if VXV5 -3 su My h Y ,E ' mr W ' T F n: N , xr ? W Y ki K Ai 1,3 N N f I -wx ,INW XM I WM W f' an 1 if. 1 W N I I s Tfgfmw-X -X ' Y 'I A bi' W 4' gif 'Q W E ' 4 , - ' f x, W 1 R A Q ,LW 1 S X Ad A It W' ' 3 ,. A I x , 3 'K Ax f A Q.. 'si . sw 2 K Ml 5 M, '38 , ,N v V' Ywfwwm wp fi Ba rksdale Caraeeeali Baker' Bobby Baldwin Mike Bamford Arlene Baquir' Jasmin Bariba Eileen Bark Lam'-y Backer' Michael Bar-keclale X' ,' 35l'R.,:Q The Senior Class Council consists oft lback rowl Christine Campbell,Jenny Mique, Florida Tiqui, Pat Alonzo. Joey Velilla, Arvin Saluta, Cheri Anderson, Mr. Lee lAdvisorJ: lfront rowl Flich Matthews, Tracy Cook. Bernadette Smiley, Jodi Matthews, Laura Toller lpresidentl, Melia Young, and Lynn Fredeluces. LEAD ING Tl-IE VVAY o guide the seniors through 0 a memorable and fun filled senior year was the mission of the senior class council. ln order to finance this costly undertaking, the council sponsored many fundraisers, including a computer dating service, a sweatshirt sale, and Santa-grams. But fund -raising was only a small aspect of the immense job undertaken by the class council, which was responsible for organizing senior activities such as the Prom,'Grad-Nite, and Graduation ceremonies. Led by President Laura Toller and V.P. Jodi Matthews, the class council did a commendable job at encouraging seniors to get involved, as this proved to be our most spirited year ever. As Commissioner of Correspondence Flich Matthews puts it, The San Diego Zoo proved to be an excellent place due to it's incredible variety of animal life. What Rich actually intended to say was that the class council was a great place to get involved and help 'the senior class, all the while having a fun time and meeting new and exciting people. 5 ' Bar Bemetra Bar lVlionelIe Bauer Blaoye Bautista Kevin Baynarcl Doug Beard Booert Belen Jeff Bell Nancy Bellez Carolyn Benclall .Joeeon Benedito Floyd Bennett Bnane Benton Bita Bernal Georgina Berrynill ,ig i-r . 1 l ' +- San Diegol-ligh B o I I i n Biaqlabaczlfm -I . a Banks Blacocho me Blackman I Bland Board rm Boattchar' Bollin ESENIORSQ Bonwell a m .Joe Bonvvell Matthew Bouok Steven Brameon Dawn Brannon ,Dawn Breda Snan-Belle Brent Bnarlene Boron Bobert Burdett Donald Burns Eeeex Burton Samantha Butler Torrie Cababa Bnoda Cadaing Patrick Cagaanan B Lorna Calaop Ted Caldwell my Bioky Balero Cnrietina Cameron Boxanne Camorae Cnrietene Campbell SENIDRSE n I H :SS-: H 1,15 Clester Carolyh Cahoh Adriehhe Card Lisa Carihi Angelo Carrero Michael Carrillo Edward Carry Deborah Carter Eret Cavallaro Allieoru Cecil Caroliha Cervahtee Sahdra Chaee Patrick Cheek Shahhoh Cheek Sandi Chohg Edward Choduette Timothy Church Brian Churchill Curtis Clark Tiha Clark Erhie Cleeter SENIORS C E72 oburn Alosrit Colours Jonn Collisn Lsons Collins Tnomss Collins l-lsstnsn Cornsn Cnioistins Conts Erfiean Cook l.oPi Cook CALJGI-lT IN THE ACT t's 'l:UO a.m. The wind rustling through the trees is the only sound to be heard. A quarter moon sheds dim light on dark, quiet figures furtively creeping to their destination. The intense beam of light of a passing automobile sends the mysterious people diving for cover. Strange bulges can barely be noticed in the jackets of the dark-clothed figures. After stealthily scaling the chain-link fence which encloses the high security area, the young terrorists armed with mysteriously concealed weapons begin their merciless assault. Who are these people? Are they Hare Krishnas seeking to liberate their captured brothers in Palestine? Are they Nicaraguan counter- revolutionaries attacking the enemy base camp? No, they are lVlira lVlesa l-ligh School seniors participating in the annual lalthough illegall toliet papering ritual the night before the first day of school. Seniors emptied the shelves of nearby grocery stores in an attempt to out do the efforts of previous classes. Hardly a section of the school was left uncovered, as members of the class of 'S7 ruthlessly strewed toliet paper in all directions, easily surpassing the accomplish- ments of seniors of past years. The faculty charged the senior class S250 for the clean up of the decorations --a cost well worth adventure and excitement generated annual endeavor. fff !P if 'sw J A 'lv ea. L LV , C 3 Davie Traoy Cook Kim Corey Lorrie Coeio .Jill Cottel Kent Cottle John Covarrubiae Michael Cowles Jeffrey Cox Booi Crawford e Cruz tit Cumminge .Jeeee Cunningham Landon Cunningham Craoe Cuoat. Flemy Dang Lalaine Danilo Elmer Datuin David Davie iSENIORS DeLisIe Anna Del.ieIe Kennetn DeLiele Annette Del.ozier Ted DeWitt Brandy Decourcey Kimberlie DeIVlatte Loreen Demetrio Clarence Deperalta Amanda Deedardine April Devilla Dnelley Devine Apollo Diaz David Diaz Karen Dickenman Erin Dina Steve Diuco Vickie Dixon Agnae Domingo Rebecca Donagne Traci Draner 5ENIORSi 2. ,-H if f. 3 W' ii I ' X ' W .QTE L, 7 S3231 H Kerry Viera prepares for an upcoming football game. o Eicher Micnael Driskell Flobert Drummond Duc Du Diana Dufault Sean Duffy Lisa Duncan Mai Duong Tristan Dupeyron Monica Durant Dnrisie Dykes Dari-Lyn Earp Arlette Ecija Lee Edwards Michael Eicner iSENIORS 4 Elfers Ev ssi Sharon Elfars Lori Ellis Allyson Elis Bryan Elis Vicki Emmert Cheryl Ero .Jociss Erskine Jules Erskine Carl Ervin Qommsi Esoina David Espinoza Trioia Esteban Erio Estsy Tnarasa Estuart Penny Euoanks Joan Evangaiista Carolyn Evans Cnaliss Evans Jana Evans Tami Evarson Foreman alkquay allon -ever-den ener 'ma arma 5 Fermanclez rnanclez Fernandez a Fernandez Ferrer nley Fiecner itzgerald itzpatriek Florendo :Iournoy zontanilla n Foreman SENIORS Fornaci Stefanie Fornaei Fiobert Foto Snavvntel Fowler Victor Francnino 1 Lynn Fredelucee David Fugate Joe Gaano Garol Gabrieleon Glynn Galvante Dnrietina Gamboa Diane Garant Karron Garman Mike Garrido David Geary .Jennifer Gee' Geraldine Gemenez Ana Gernardt Deear Giananga Eric Gilbert Pam Gillnarn SENIORS L SE Tami Everson, AI Colburn l'l J and Kris Anderson, David Geary l2l all Show ' their spirit on Senior Group picture day. Griffin vw' Era, ln! Dean Giet Tracy Godzik Garneron Goins Gebekan Gormley Katrina Gorrell Kimberly Gould Wendy Gravee Nlicnael Gray Leigh-Ann Green Kevin Greene Tavvnia Grevvell Beverly Griffin El E 'S ' 2 -aseiuions T I 7 ayes i , E' . ,ir ij i'l'7ii',l.fQ,,QQfQil'il,l if A E119 V . ,, 1 ' ii -W i i ii M nf' U . 1' N ' Y mi' iw' - Q , , , , p 'f 5?.:J,,,., faith 'E' '-lil fQf1':i i-' A D vga Q. ' f'-iii Y g ' 'V 71,193 iff 'ir '55 ri ' Fiueeell Hahdy Iqbal Haha ' Jennifer Hardy Michael Harrie Leah Hartheee-Stahl Deborah Harvey David Hawley Alan Hayes my sullen brow: Alas! l cannot smile Such were the sentiments of Lord Byron, a Gemco employee, concerning the shut-down of the popular groceryfdepartment store. A significant number of lVlira Mesa Seniors lover one percentl were employed at Gemco, and those who worked in the grocery division were suddenly laid off in October, 1986. Not a single employee escaped the implications of the unexpected closing. Each of the seven Marauders employed in the grocery section enjoyed their work, and a void entered their lives after the shut- down. Affectionately known as Team Gemco, these employees felt a type of comraderie with each other and the many friends acquired through their endeavors at Gemco. Some students have found other employment, but the general feeling among Team Gemco is that employment will never be the same. Andy Sefkow, Nlatt Hoerr, Jason Mendez, Tracy Cook, Kim Robertson, Kenny Nelson, and Jon Nations protest the closing of Gemco. -1 :sermons E Hedges Kevin Hedges Julie Henderson Lee Hendrickson Dennis Henry Scott. Hermanson Alvin Hernandez Federico Hernandez Denise Hickman Joseon Hignt Sebastian Hill Ann Hilzer Pamela Hines Eric Hirning Lori Hlavka Bruce Hoang Kathleen Hoang Brian Hobbs Nlattnevv Hoerr Aaron Hollinsnead Debra Hollrnan is ' sennonss Jahn Amy Holstein Peroita Holtz Mary Honclel Jeanine Hopkins Laura Horn Sharon Houck Airon Hough Monique Howell Billy Hsiung Caroline Huber James Huber Andrew Humphreys Karey Hump rey Bebe Hunter Chris Huot 'Thien-Kim Huynh Kemlyn Ikeda Conoepoion Infante Keith Jackson Oliver Jahn . fsemions ,M 45 K, mul f-Silva arm Steve F?lc:k,u'1zgur1 Mgmpfly VPI,Uv'D Lo dawn LU l't?EiHIT'1E? Llwfizu' GLM Kingston l'll Heidi Flatal, l2J Tamara lVlcCarthy, l31 Ted Petit F1-1 P Q K WM V Tim Kalke Bojolyane Kan Chr-ietine Kaplan Kenn Kaehima Dahci Keener' tt Keller' Kelley mmy Kennedy William Kenney Bryan Kenton Sheryl Kieeer' Dawn Killian Ty Kincacle Michelle King Eric Kingston sermons Kirk Ahh-IVlarie Kirk lVlike Kirkpatrick Dave Koch Lcreh Kcpff Phillip Kceaka Karih Krickhuhh Kerry Kujavva Ahgie Lacea Kelly Lacy Alah Lagmah Darreh Lambeth Tammy Lahghamrner Sck Lac Emilie Larahahg Dchalcl Laubehthal .James Lauermah Kyle Laureahc Ngcc Le l-luhg Le Ngcc Tuyet-Phchg Le-Ngcc .fs . ssnnons Nil , ,,, L E L L Xl 3 if in Mark Leary Cnannelle Lee .Jimmy Lee Fkayrnond Lee Shu-Fen Lee Nlienelle Legerretta ,Jaeen Levvie .Jeff Levvie Laura Liberty Flobin Lieberman Jonatnan Lieura nee Brandon Lillarcj semlons i 1 McCurtis Dawn Manor ' Darryl Maneneim Donna Marcus Otto Marion Marcel Marrae Gaetanc Martedi Deborah Martinez Leo Martinez Beca Maruezak Matalavage evve n Mauel Snanncn Maya David McAdcc Tamara McCarthy Q Stacey McClain Tiffany McCcnaney Walter McCormick Amenia McCurtie isisiuions McFayden Denise Mclzayden Erika McGenee Jeff McGr'avv Erin McLeod David Mc:Menarny Lance McMillan Torei Mcl:'ar'land Jenn Medina Patreick Meenan Angelina Mendez Jason Mendez sermons gfhllllgg, Andy Sefkovv, Matt Bouck, Todd Rosenberry and David Geary attempt to decipher , heaps of college literature. l- i l l F-Tl ESSLJ F2 ES u :i-icics i ollege is very hard. Lots of seniors want to go to one. They have to do hard ifapplications and write lots of stuff about their activities and plans and goals and pets. fMost seniors will 'be happy at colleges in California. They like the beach. The waves Qare good. Cool guys hang out there. But i getting into college is hard. You have to fill out stuff and get grades and do things. But all work and no play makes college kids dull i people. And that's a bummer, so college is T fun too. One neat thing about college is that you get to wear college sweatshirts everyday. You can impress your friends and family with them. At college, you can make . cool friends and do fun things. Lots of kids like that. But if you want to be a shepherd. you can't go. But that's OK. Shepherds are i very cool. Monteclaro Lisa Mendoza .Judith Mer-cadc Jose Michel Mar-Qahita Michel Vanessa Mierfa Patrick Miles Michael Miller' Sandra Mills Glen Mings .Jennifer Mique Melissa Mihabal Grace Mitchell Monica Mcehioke Eicly Mcnteclarfc l i l V ' SENIORS WQ1 L Monte Larry Moriteforte Eva Moog Jaoouelyri Moorhead -Joseph Morales Melieaa Moreno Greg Morria Saaeari Morelfieoiari Grace Mortera Gram: Moaeley Keri Moolt Miolwelle Muir Michelle Mullarie i,if 4 - 1iQfgfif.., . g V ai ,-i.i .,. . A 2' 71 1475? -' 1 fi I' 3 E 9 ssnnons gill Navida Giselle Mullen Glorfie Munoz Chris Nlunzer' Erin Nakano Kanenele Napoleon .Jon Nations Karol Nations IVler'y Nevelte Fllenend Neverette Bar-l:Jer'e Navarro Alan Neveece Joeepn Navicie Tssnnons 5 94 il 5ENlDRSl N a w r o c ki .James Navvrooki Sean Neale Ken Neleon Kathryn Neville IVly-Xuyen Ngo Xuan Nguon Ann Nguyen Duo Nguyen l-luong Nguyen I-luy Nguyen .Julie Nguyen Linh Nguyen Mary Nguyen Kenneth Niohole Reginald Noble .Joe Noon Davvne Norman Reginald Norrie Andrea Null Danielle Dakry Parris l Pamela Drdchez Trieh Clrdchez .Jeff Oreihelli Luce Ortega Katherine Drtiz Mihette Clzaki Michelle CJ'Brieh Michael Pacarcue Diane Padua .Jcb Padua .Jeeeika Pallaree Sylvia Pallaree S-Bhelly Palmer Neil Palmer Ficlehcic Pamco Mahuel Pamcc Patrick Pahdee Michael Paraiec Liea Parker Paul Parrie P PSENIORS i r U33 . II .f A ' s 1 'I' jg U Sv . M X J! 1 'Iwf 1' I ,..i.i-W ill its 4 1 I 1 .8 , fs, 4 A x Reislg SENIOR SRIRIT he day of the bag lady. This is the way Nlarauders novv refer to the fateful day in October when our once proud campus was overrun with hordes of garishly clad scavengers. As a part of Spirit Week, the ASB. invited these bag people to our school, an invitation that they readily accepted. Ignoring all rules of fashion, these scavengers wore clothing that even Good Will would reject, and created nightmarish of colors, patterns, Although normally at lunch the frenzied school-wide scavenger hunt. They rudely tore various articles of clothing off of students, and at times abducted entire individuals in their mysterious quest for stuff. Overall, it was a traumatic experience for IVIIVIHS, as the usually polite and well-dressed student body was invaded by hundreds of bums. The event. which the ASB. states was meant to be fun, unfortunately caused severe emotional scars for several wimpy freshman, who are now unable to pass by any K- lVlart store without screaming in mindless terror. y Pugh -2-.av Craig Raoke Joseph Ramirez Tito Ramos Heidi Rataj Rebecca Ratliff Andrea Reeves John Reisig seniions ahielle Pritchard one Pulopot Renison Rcbeiet Reriiscrw Luis Reritcr' Rachelle Resz lVlicbael Reyes Rcber't Reyes Gale Reyrmcsc IVlicl'1ele Rbevv Debbi Ricketts Steve Rickman Kimberily Rikarwsrnud Sally Ritcbie Bobby Rcbbiris Torn Collins Angelo Carrero. and Mike Bamford return to class after a muncnie run. Mandi Smith, Suzanne Pulopot. Kim Haier, Joy Nlatelavage, and Noelle Santamaria re-unite after a long Summer. Tricia Esteban, Lisa Tuffin, and Tina lVlallari hem it up for the camera. ssnnons R Rosas Todd Roberson Kim Robertson Jennifer Robinson John Rodriok Delia Rodriguez Robert Rodriguez Tiffany Rodzeoh Keerine Roebuok Anna Romero Romeo Genan Romion .Joseph Ronoal Q Aldrin Rondero Arthur Root Alex Rose Christy Rosedo Gina Roses Shepich Ter-Py Senebie Elcle Sandejee Sene Senided Seni Senided Noelle Sentelvlerie Stepnenie Sentilli Fnedeniok Serie Seem.:-.Jean Soenlon Scott Schooling m Sonultz or'iven Sefkovv Clenoline Segovig Temene Selonede Enio Seyfentn Kur-1: Snedof Tbeoy Sneinneueer Lise Sneive Tim Sneoion sennons Shew James Snevv David Silva .Jamie Silva Kar'i Silva .Janna Simms Serie Simpson l.anie Sioson S l-leatner' Sismev Antnony Sitav Zulioa Sizik Kevin Skaggs Adrianne Slater' 0 Son Slavey Ser'nadette Smiley Donna Smitn Jamie Smitn Kimoeinly Smitn Mandi Smitn lVlar'k Smitn Nicola Smitn semions Levis iean jacket, high tops, and a pair of Ray Bans are essential parts of Jason and Matt Hoerr's daily appearance. A Stabb Flebecca Smith Jagade Snyder Jeffrey Snyder Elizabeth Sommer Robert Somaeh Steve Sohgalia .James Souza Sharon Soada Chari-a Sparks Tracy Sbeegle Ingrid Stabb sermons y : YQ-'I' 45 . ag 1-f?E??r V N ' Y 15 V AlL. if iiiiif if WS Tevepaugh Mark Stogedill Ira Stokes .Joel Stranger .Jill Street Andrew Stubbs Tiffany Stuck .James Stuermer Marty Stuthere Nicole Suiclan ci Suleiman-Khel ullivan onica Sweet .Jenivy Tacloban Brian Tarbell Thanh Tat Tuyen Tat Flodney Taylor Michelle Tehevv Tammy Tevepaugh sermons Theil Briah Thiel Tim Thiele Bobby Thoehhee .J D Thomae Debra Thomoeoh Kimberley Thomoeoh Laura Thomoeoh David Thortoh Ahdrevv Tierhah Alex Timmermahe Florida Tiooi Putak To Tamara Toevve Sohhy Togohoh Laura Toller Graht Tomaeulo David Tomohek Lori Tohey Doloree Trajaho ADD-TDD Trah ssnnons Valdez l-lon Tren Nghi Tren Ngon Tren Paula Trento Brock Treptovv Brien Trice I-lung Trieu Nge Trieu Kien Trinh Thi Truong Michael Techeuechner Liee Tuffin Tenye Tully Denny Turnbull Kenneth Tyner Devvn Underhill Chrietie Upton Mike Llrlinen Teheeen Llemen Aileen Veldez 'T in VTSENIORS 'S W Q ix' l Weisz Steve Vavrunek s Phetdara Vaykham .Jose Velilla Delilah Ventura James Vick Kerry Viera Villanueva rie Villegas Vroman Paul Wade Davis Wallick Jeremy Walters Shelley Walton 1 Melissa Ward Sam Ward Harland Weisz Q as I l I E ssnnons Welch g Jay Weloh g Patti Weloh Deanna Wellborn Jennifer Wessel Angela White Brian White Bradley Whitehead Lisa Wigand .Julie Wiggins .Joseph Williams Lavonne Williams Lorelie Williams 4 Noel Williams ' Tris Williams Flooert Wilson Cammy Wolske Natalie Woodward Cynthia Wright l.ena Yahja Kana Yajima SENIOI-ISE i E :F Zuerche m Funk flashes wide grin for the 2. Kenri Kashima and Terry Sanabia are interrupted during their discussion of current events at lunch. Felicia Young Geor-ge Young Nlelie Young Jennifer' Zenuk FQODEPU Zidee Nicole Zimmerman Scott Zoldek Katner-yn Zuerionerf 1.5 sssf senncms i i Tl-IAT VV!-XS THEN TI-IIS IS IXIOVV 'I. Ed Salanga and Lynn Fredeiuces 2. Katheryn Zuercher' and Kim VanVVag0ner sermons --4 Ky W 1 2 senuons . 7 E f m f x i 5 z ag E z A M Z .5 S, 4 if 1 f Qs? :S 5 i Ss 5 f--: E K E ,Q s ig 5 E HSE gg :':C H if W A, A 5 S Ez.: E I l S ix E S, 35 I ii .... 'f::' -,J ww if .,..... N S N 1 W - W mm ..... HWQEEF M mn- Q wi , , s ' , Q 5 Q E 3 Q s 5 mf , 315 5 aim H 1 E W 2 M .h I ,,,, w. L,.. ' 4 H. , ...T vae'fze72c4tz'oa VVILIIJ eet Dick and Jane. They arejuniors. Dickand Jane are having fun, fun, fun. It's neat being sixteen. See Dick drive a car, he got his license yesterday. Can you say yesterday? Dick is happy because he can take Jane cruising and he can drive down to TJ. Don't get caught speeding Dick! Look! Look! See Jane. Jane is taking the PSAT. Jane is sweating. ll hope her Lady Speedstick is working.J Jane must practice for the SAT. Jane is scared, Jane knows that if she does not do well,aII hopes for college acceptance go bye-bye. lBetter load upon the underarm deoderant.J Being a junior is wild, wild, wild. Everyone knows that the Class of 88 is the wildest class at MMHS. Dick and Jane are proud to be iuniors. Only one more year and then...Senioritis! What ever happened to Spot? Spot lives a dogs life at home. He can't go to school. Oh no! Poor Spot. 1. Garry Belen, Alan Salute. Leo Nepomuceno. show their strength in the weight:-oom. 2. Julie Franklin is flabbergastod by the guys that walk by. Asharf Abdul-Flazak Edward Abernathy Darci Abker Jason Adams Richard Adriano Jonathan Aeria Vinit Ahooja Linda Ahrens James Alexander Jason Algar Frank Allen Adrian Alli Edward Allison Lileana Alvarez William Alverson Angela Alves Susan Amann Don Ambalada Lorena Amores Leovita Ancheta Celeste Anderson l' l ,if Jai: in W I U ,.,am55Vili1 -IUNIORS E-M EM ' ill ' 'lf 'M Q 3 , QM X XX X Sgli S -x...':5E: M ' J. lssi i-a1 i Qi 5 X...:1 5 N. X X fm? X we X Xiii is-ff ,,-- .-mf - 1: S as f me f X wmaw 9 Neva? X K X x im Qs Qx s x. X we NX im X S . NSI, W A' NW- -A'-A V- T. , :L --Q.. P . V . X X E- , kk-- 1. :Nw i, XAQS' A -any Ein E x , A we 2 ow do you create the recipe of spirit? First you mix together a ton of dedication, hard work, and motivation. dd a pinch of leadership with advisor Mrs. Carol Sobek, co- dvisor Mrs. Midge Backensto. and class president, Steve Emmons. Top it off with a handful of talented and involved juniors who blend together to get things cooking. To get things fiaming, place a cup or two of hot ideas and a burning desire to succeed. Mix it all together in a pan until well blended and then you will have the Class of 'BB class council. With graduation l John Anderson Kerri Anderson Tracy Anderson , Dawn Andrews . Joy Angeles Gilda Anonuevo ui' Amy Anspach Cynthia Aquino Lila Arab Janice Aragon lsabelita Arai Monina Arai Dena Austin Michael Austin Jose Babaran Fiaul Bagaporo Mindy Bailey Stephanie Bailey ,M Denise Bailleul uf 'it' Sharon Bakeman at Charles Baker Jo Anne Bala Gerald Balaoing Frank Balistreri Cindi BArcelon Rebecca Bark Jocelyn Basco Gilbert Batac Anthony Baughn Joseph Beach Jerald Beardsley Elizabeth Beaver . Garry Belen only two years away, the junior class spent many hours planning activities and fundraisers. The major goal for the school year was to get as many juniors involved as possible. Some other goals consisted of raising as much money as possible for their senior year and to obtain many spirit points in lunchtime competitions against other classes. The juniors held fundraisers, sponsored dances, and sold class-related items to strengthen and enrich their class flow. With the overwhelming success of the past two years, this wasn't hard to do. The Class of '88 strove to prove that they were just too wild! The Class of 'BB class councill consists of: lback rowl Albert McDaid, Mark Kerlin, Tracy Anderson, Kelli Kammerer, Kari Draher, Debbie Lou, Angie Carson, Imiddle rowl April Jackson, Mike Weissenburger, Debbie Lew, Sharon Tang, Jocelyn Poblete, Nga Nguyen, Patti Peluso, lfront rowi Mike Evaristo, Charles Litt, Sam Pamolares Benee Lewis. Leo Francisco, Cherie Donahoe, Chris Harvel, JJ Aeria, Steve Simmons, and Bic Tran. JUNIORS Malaivanh Avousinh Leilani Anquillano Rodolfo Aradanas Jennifer Arendell Jackie Armstrong Nada Asgharzadeh Cheryl Ashworth Evangeline Banatlao lVlaribelle Belisario Peter Bell Evangeline Bello Melissa Bendy Leslie Benga Kathryn Bennett Robert Berg Scott Berg Sheryll Berg lVlariejane Bernal Helen Bernardo Deborah Berryhill Alex Best Dennis Blahak Stephen Blaisdell Scott Blake Nicole Bleohynden Kristin Block Lisa Blurton Patrick Bollin Angela Bongioanni Kristin Borchers Shannon Borse Jason Boutwell Leony Bowdler Bowena Bowdler Bryan Bowen lVlarki Bowen Stephanie Bowen Lance Bowman israel Braff Lisa Bravo Joseph Bray lVlaria Brimmer Penny Brinker Andreas Brown A .1in:.:.-ffwiwfwawz vi Nw. -if ,,,,. if ..., ,. , ... Lea Ancheta and Daphne Kendricks take a breather after a strenuous day of practiceiamg mar ' A---W1 L N t Y . - Q -- f: 2-15:55 Jumions'--'-' -- V. Danny Brown Julie Bruton William Bryant Scott Bucky Erma Buclatin Long Guoc Bui Long Bui Gerald Bulatao Bomeo Bundoc TAmi Buniger Christopher Burksaze Scott Burnett Samuel Burt Mary Burton Bobert Bushner Gregory Byers Garry Cabading Carlo Cabarlo Edfardo Cabatbat Patty Cahill Allan Caimpon Buth Caimpon Maryann Calcagni Benee Calero Adam Campbell Lori Campbell Kelly Cannon Tessie Carambas Laura Cardwell Jeanne Carini Pamala Carr Joann Carrasco Kevin Carriker Amando Carrillo Angela Carson Christopher Carter Gretchen Carter Kristine Carvajal Lisa Casey Michael Casiano Candice Castillo Adeline Castro Boderick Cayabyab Paul Celendro Stacie Chapman Alyssa Chardv Marilyn Chavez Buben Chavez Melanie Cheramie Michael Chetister Maylee Chiar Kristi Christenson Flandy Claman Scott Clardy Charlotte Clark Huyen Chiem viii ,, spew .t,b5'5 .iunnons Romulo Claros William Clem Holly Clifton Michael Cochrane Steven Cochrane Todd Coffin Lisa Colburn Catherine Colby Stephen Cole Stacy Collins Rachel Colville Helen Compton Erin Connell Keri Conner Brooke Conrad Carrie Conroy Damon Cook Denise Cook Christine Cooper .Julia Cooper Kelli Cooper Melody Corpuz Efren Correa Criselda Cosme Susan Coulter Kimberly Courtney Lori Coyle Damon Cox Mylende Crane Collin Crannell Kevin Crawford Richard Crawley Rebecca Credle Jesse Cruz Todd Cumo Randy Cunanan Sean Cutshall Kate Dale Jonathan Daly Michael Daly Linh Dang Guan Dang Trinh Dang l-lien Dao Minh Dao John Datuin Jumyr Datuin Amanda Davis David Dean Elisa Decker Rosalie Deguzman Diana Deines Leilani Deleon Reneeboy Deleon Roseann Delletorri Dino Delmar is 'Ffa . , W Q ,si . .. ,. ,X I . W : ' - 1. Q iz! i S 'N xx as X A X ESM X l ,E XX is gt X f i Q EQ , x ' S 3 X my . . f Xx 5 ax K t..ge-:wg -5 -:rr ..:. -it ,s,,,s..:.ts 2 ' SW .zffsiea-sfimsfa nffQss15f t . -- me .eases se ,ssl ., A... ie:-K,-as .ei iw 535 3s - in iii - X I X fi 7--- is-i. g f- S sr ewaigxit .ki 4 sire Qs, tk. it Raw' -. -r ss. , :al fi? el'--2: N - ze-- :.aff N -- . X Na Q X X X at Qt K K up S X2 X1 A we-,I ' X Q N as RR ' N K t . Q ri ' N 1. J X W ff Amr :ig 1 iii 9 -'::k- , , rt, ' 5 :,.. . JUNIORS E F I F e i !E .5 sl xii X peg Cherie Donahoe gg fr:-1 Fx. he junior year is of crucial importance for those seeking a college education after high school. Thay are pressured to get good grades and score high on the PSAT and SAT. Many colleges consider only the grades received in 'l0th and 'l'lth grades, so colleges encourage juniors to put extra effort into their classes. The PSAT, basically a preview of the SAT, is taken by juniors in October. The PSAT can be instrumental in the acquisition of scholarships. especially the National Merit Scholarships. The all important SAT, a grueling, mentally- devastating test of a student's innate intelligence is con- fronted by juniors late in the school year. Of decisive importance, the SAT marked the end of a year of preparation for college. The academic performance of juniors could either pave the road to success. or sidetrack them toa dismal life of emptiness and despair. Kristine Dell Kingski Delosreyes Kristyn Demko Michael Demko Libby Dengler Janette Deru Teresa Desantiago Jennifer Desmond Donald Devlin Sabrina Devon Luana Dias Toni Diaz Heather Diem James Dinapoli Tam Dinh Tram Dinh Sara Dinsen Fiichard Dintino Nicole Dirnberger Michelle Diubaldi Flaymond Diveley A Bao Do gp .ii. - Huong Do ,T T Trung Doan g - a t , Fiichard Dobbins A iiirgg Nicol Dodd E i as -, as aaumions Fieynalod Dominguez Michelle Doneux Kathleen Donovan Angela Dorame Barbara Dorenzo Deborah Dornberg Nicole Doty James Douglas Joseph Dow Michael Dowling Cari Draher Jeffrey Dualan Megan Duffy Becky Duhme Chris Duncan David Dunhoff Donald Dunn Thanh Duong Thy Duong Willie Duque Shawn Easter Arrninilda Eciia Marc Eddolls Alexandra Edery Donald Edquilang Karen Edwards Britney Ehrlich Wendy Ehrlich Antonio Elamparo Bradford Ellsworth Peter Erb Katherine Ermels Jeffrey Ernst Brenda Ervin Noel Espiritu Maritess Esteban Danielle Estes Flonneil Estrellado Buillerme Eugenio Michael Evaristo Matt Fagan langlenn Fallarme Brendan Fallon Tou Fang Eerna Faravardeh Yvette Farias ' John Farrell Tesha Farris Matthew Fay Mikel Featherston Kimberly Fenslce Virnalisa Ferrna Edwin Fermin Herald Fernandez Christopher Fero John Ferrer Stacey Filbeck gs X 5 ' - .: - it : jig: - D F ttte K 1 -- l., , . balsa, i ,NX N -A x ' X . , JUrNIGFlSE D a-E an--an as Newifm f' - ..wiW..:,,,,, ' ,gd N N ,,. QW' Nlirko, Ed Gorner, and Jeanie i5ii'i'i ' Kmineky wait with anticipation fo: : g:::: . in Grease. Tammy l-loustan strides vviL confidence, 'WW' 4, 1 i inf l i I N..- 34 ! df, 9 X ka- V,- 4 W,,,,, fm as , l Heather Fink lVlarie Fink Brandon Finucan William Flinn John Flippen Philip Flood Jerry Folvvaraki Elizabeth Fortin Flohert Foebenner Craig Foster Jenifer Foster Lauri Fox Leonardo Francisco Julie Franklin Kelly Franklin Michelle Franklin Kevin Frederick Jeffrey Freeman Jennifer Furlong Davvn Gaines Luiaito Gallardo Carolyn Gana Dennis Garcia Joseph Garcia Karen Garcia William Garrett Eclrion Gawaran Jess Gaytan .lumens John Gee Miohael Gelle Paul Gelvezon Jordana Gender Amelia Gentry Trisa Gentry Marissa Germar Charles Geyer Paul Giobbi Panje Gish Michael Gitz Shelly Gladden Sean Glithero Steven Glor Shawna Godzik Stephanie Golisch Mario Gonzalez Salvador Gonzalez Jessica Gormley Edward Gorner Tyla Gower Jennifer Gracia Flose Gradel Matthew Grant Jack Gray Thomas Gray Brenda Greco Joel Green Fionald Grierson Amy Griffith James Griffith Tocia Griggs Romy Guanzon Luis Guevarra Pamela Guffey .E if X M 179 l 11 5: sv' '-,,' 14111: 'lf K4 V1 1' 11 ' 11 11 .' -17 if o 1 1 ' ' I E ., 1 11 f 1' 111 'W' w e 11 65454 1 ' P' W , mil ' ' A, ' 2 ji-,fr E, M, all 1 11.1 V 11 1, 1 , lu. levee or some juniors who were sixteen it meant having to be cardecl for dance places, R-rated movies, and swlngingsingle bars. This was a very traurnatizing and embarassing experience. But some juniors managed to get in to these heavily guarded places. ls it because they have cute dimples, extra cash, or a M-15? . . .Of course not! Some juniors use phony identification cards to get themselves through the door. How does one go about obtaining these phonyl.D. cards? Do they borrow them from older brothers, sisters, and friends? Ur do they pay five dollars and send away for them through the mail? Do some juniors take drastic measures by encountering fat, bald men with putrid garlic breath in seedy and broken down shacks? Sometimes they -wondered if it was worth the time and trouble to obtain the phony ID. - as 9 X Xx .L X ' N :n :fr :. Se N Egg X if if xx X X 'mf ner-'rw' f i, f i fn , I f W f 7? ff f f K ei: 315 7' ff . -im we 125 i i W 'WA wr We W X 3 y f ff f ASM --f' i , iii ,. , W,,..:,. f V M 1 ,f faq ff ML if ' W2 ,, , 7 QW , , Q74 W' 'W ff X My f fa K , , X X f f A 5 it 6 X '7 iff f J Z f i Q W' 'Z' it , 4' W A f BE' Pfuumlons Peter Guiriba Catherine Guro Julie Haas Joel Hackett Janet Hagadorn -Julia Hagl Leigh Hallenbeck Michael Hallett Shawn Haley Tracy Haley Charles Hanchett Charles Hamilton Victoria Handy Kerry Hanley Flichard Hannah Steven Hansen Christopher Hanson Fiichard Hanson Alicia Harper Christina Harrell Christiana Harris Colby Harris Thomas Harten Heidi Hartenau Michelle Hauer Thomas Hauxhurst Philip Havel lVlichael Haworth Robert Helms Deana Hembrador Arlene Hernandez Edgar Hernandez Helen Hernandez Ellen Hernon Erik Herrin Michael Hetrick Sharon Hey Fiuthcecilia Hickey Christopher Hoaglan Binh Hoang Chong Hoang Nivone Hoang Timothy Hoffland George Hoffman Jason Holm Shawn Holman Edwin Holmes David Hondel Vien Hong Kristen Hoppe Karin Horowitz lVlui Hounsouvan Tamara Houston Cynthia Hoyt Sharon Huber Gwen Hughes 13 353: . - ' tial d Cecilia Hunt Anne l-lurley Dat Huynh Dieu Huynh Duong Huynh Tuyet Huynh Q ...,aw 'X1 Q Corinna Ibanez Annamaria llano Leonardo llog Heidi lmm Wendy lmm Alan lntalan Donald lrvin Clifford Isaacs Ronnie lsaguirre Jason lson Atorena Jackob April Jackson Kenneth Jackson Michael Jackson Cynthia Jacobson Erin Jacobson Michelle Janzen Brian Jarvis Jackie Jarvis Maurice Jeanmarie Flichard Jensen Mark Jepsen Gail Jerde James Jerrell Aaron Jilka Aileen Jimenez Chad Johnson Christina Johnson Christopher Johnson Jermaine Johnson Kirstin Johnson Michelle Johnson Flandy Johnson Flobert Johnson Carolyn Jones Debra Jones William Jones Garry Jordan Keri5pelhaugsmiles with delight. A- 5 yi y l . ,,...., T' .1 1529! ,- w,,a,.M 52522252 :-r sgsaa: E in 'ffl i: c W 7v-:- :: - 3 H yqia, :unions :fm as as l J' 1 it ,, .. is 8 ,x w yt px, ., A N-g' so t T KX x N N K . s fi inf X sw ! Ruth Carmpon and Jocelyn Ramirez giggle as they . K gaze at the ideal man. 59' A -- ,l . I X H Norman Josett Carrie Joyce John Joyce Linda Jung Steven Kaluza Emir Kamilev Kelli Kammerer Robert Kaneshiro Dennis Kaping Kevin Karaer Eric Kasimatis Joshua Kassel Tamera Keane Ralph Kebbe Stephen Kehle Daphne Kendricks Jonathon Kennedy Kelli Kepner Mark Kerlin Brian Ketelhut Clifton Khong Diana Kikuchi Albert Kim Pamela King Dayna Kingsley Christopher Kline Valerie Kolk Christopher Kosek Reina Kreyling Karl Krueger Kristine Krueger lVlichelle Kunavich Laura Laberge Theresa Ladwig Melinda Lagg Daniel Laguardia Anh Lai Toni Laird Caroline Lalanne Philippe Lalonde William Lamar Daniel Lammers James Lanuza Laura Large Nancy Lashley Troy Latimer Chris Lattimer if ,fqff . , we I as H e - 1Junnons Veronika Lauerman Todd Lawless sss f I 1' ff ' Leander Lazaro I u I Tuyet Le f Christopher Lee W . ,ei :I ' David Lee i iiid 1., -1 ': I-loua Lee gsm I A251 Paul Lee Fiichard Lee 1 . , gm as fe1:,'?,:3Li'gi? ii1INf?'ft'E Rollie Legaspi Michele Lemay Craig Lemieux Debora Lew Flenee Lewis Teresa Lewis Stephen Link Charles Litt David Lively Joyce Llewellyn Clint Lofflin Ty Logan Cristy Long Jacob Long Lo An Long Cina Lopez Marshall Lott Deborah Lou Sharnell Lowe Mary Lucena Julie Lungaro Erik Lutz Flenee Lutz Mai Ly Beth Lyons Lucila Macapagal es, I'm a junior and I'm cool. I havea car and I can do anything, go anywhere, and never come home if I don't want to. My parents don't even recognize me now that l've got this car. It's a clunker, but that's ok. I have so much freedom! Where should I go next? I think maybe I'II drive to, uhh... China. Yeah, that's the ticket! Oh no! My tank is almost empty! There's the Mickey Mouse Gas Station up ahead. It's a good thing I get SOO miles per gallon. I wonder if I'II even go to school again. No, I'II iust keep driving around, taking advantage of my newfound freedom and privacy. No one knows what I do with my car, except, uh . . ., Morgan Fairchild, yeah. That's it. I feel like l'm in a cartoon-like world of makebelieve, with big animals and pink polka-dotted roads. Someday I'lI go home though, because I have to feed my dog. Julvlons 2 Ql ...mii- llrr r X N X Q 1 sr K at 2 N 5 XX i '51 Y ,,.. J. 'wmmmwm , 25512 E: E' .,., K at .Q x N X fm 'D' N X X X Wfwgfx 'SQ ti S X Q X gs- ggi. I 1.F1f2'1fSf1 .- i vi 'Ns-1-1-fifj' QQ X X Y is X 4 ,JW .5 X x it L, - 1 M -. .iii af .ai , --f:::a- yvziisssfrfsi .1 .,,,A. ws.: We :its Q: X -: ,, K LL . X .w.,,,,iAQ,esJi,..:- . M m. Kelli Mackay Brian Mackey Polly Magner Kimberly Mahnke Patricia Major Stephen Malcangio Arturo Maldonado Norman Malinis Alana Malmgren Lisa Malone Alexis Mangahis Jennifer Mann Michael Mann Richard Mann Shanna Manni Bobby Manuel Alysia Manzano Sheri Mapel Joseph Mariano Thomas Marino Flayanne Marlow Gregory Marrone Amora Martin Jesse Martinez Michael Martinez Kinberly Martorana Walter Matkovich Paul Matteau :Junnons Mark Matzen Dennis Mauricio Sean McBride Todd McBride Billy McCall Sean McClure Flobert McCooey Robert McCraw Albert McDaid Joseph McDermott Kevin McDonald Jennifer McElliot Scott McGill Shannon McHenry Eula McKinney Julian McKinney Priscilla McKnight Scott McNeill Monique Meeks Maria Melencio Angela Melfi Christopher Mellor Sheri Melton Ruben Mendez Heidi Merrill Cecilia Michel Flobert Miller Sheila Miller Sherri Miller Talrnadge Miller Yvonne Miller Howard Ming Adana Mings Henry Minor Flosernarie Mirano Vikrant Moharir Miklos Molnar Michelle Montano Jennifer Moore Maryellen Moore Christopher Moran Jon Morrisey Mirko Morschheuser Paul Mortera Michael Mostaio Mounthala Moungvong John Mulock Jeffrey Munar Wendy MVEVS Emmanuel Narvaez Renee Navarette Patricia Navarro Erin Nelson Kyle Nelson Leo Neponucno Craig Newby , W' ' ' JUNNJR53 ct l--1-l S it . X s X Nm X H X X X 4 X X N Q wk X X,,XX Xi X X N' xv N Q tx Xi K t Q gi is 1 k kk X sa ,ix Q- 3 .... . WMM' . ,... ..L,llf, - f' 'k....:xi E S: 5543 . vi . .gig L .X ..,. . bbyb i llll Z ii.y:ll .gg 9 A XS . it , ss's 5 W X E wx -X., X Q X X X N 411 X- .,,,. , - SES . ,... . . X rf we W ixXX Uh. i mv- X Q we - S SX , K 3. X 3 .K - if Q ii w , 1 - 11 - i , . idx ws u, sq X. X.. ,sf . 'X 5 ..., X an max ...X . ' Q ..: -- f- '- f ' C A .. as 1 . ' -.lf l- -f - 1 ,fggg .... l 1 'rf-' R . -Xe. . ..-H111-X . - :Ni w w'-:L X . 5 x X We , Wi NX A- 1 .xg A X - .... .- - - ' E I ,... s . X s- V ,, qt S Sl if we W X Q QQ X X - X.. :I :s Xe - - f- M J . . :ses -f 1: ...if --fl fn.. ,....Q. Xt tw! - ,ee was. . we S ...kkk , 1 if - sz- 'r X X . nlsaifiisft-iE:::f:E5' ' X X X XA. X XX i as wx X X X S ' W i - A 1 2 S 54557115 E Q - 3 XMMNE? 5- 2 IF -1 5 i fm m ---- C We f V 1 J 1- 2? W i A , 1, jf! QW -L 'Aj ACS? M Q, N g: , f 3 i V W fr ,Ml ,gf Zi , 42.M,' ,ly .V f 7 gi if J f 3 W i ' Ml 2 3 i 2 , as + ef al 9 i , E,-'ig' i,5, 1 'ill li i WEEE r ii :Ja l E W Ez 5,5 i ge if ,i,,,g,w,, :wi , , V 'W ii :- him l Z 5 i gi in 3 l 232 52 i i s l lf Samantha Newman Robert Newsome Lah Ngo lVlai Ngo Brenda Nguyen Cam Nguyen Dong Nguyen Huyen Nguyen Lan-Huong Nguyen Linh Nguyen Linh Thuy Nguyen Long Nguyen Phuoc Nguyen Tam Nguyen Thanh Nguyen Thuy Nguyen Tung Nguyen Van Nguyen .Jason Nichols Lisa Nioolaysen Irene Noble Anne Norris Christopher Norton David Oberle Wade Oharrovv Kelly Okamoto AnnelVIarie Olsen Sven Olsen 'I Jay Pulido is caught by surprise 2 Anna Lllit and Jennifer Gracia share gossip Martin Olkleil Minh Ong Tricia Ornelas Ramon Ortega Debra Oeoareon Laura Ouellette Shawn Owen Tyler Owen Primo Paderanga Ruby Pagaduan Rhonda Pagano Jose Pallares John Palmer Sunny Palmer Samuel Pamoleras Ernesto Pampo Val Paraiso Thuy Parisi Susan Park Linda Parker Arminda Parreno Maria Pasenelli Matthew Patacsil Katherine Patay Daniel Patterson Gregory Patterson Stacey Paul Russell Paxton Kenneth Pearce Jeffrey Pearson Kerry Peeler Amy Peiss Alicia Pelekis Patricia Peluso Virginia Pereira Kimberly Perez George Permadi Leonora Persichina Anne Pfeffer Maitho Pham Phong Pham Benjamin Philyaw Co Van Phung Michael Pierce Arthur Pightling Jason Pilon Liezl Pimentel Ana Pinto Sandra Pluta Jocelyn Poblete Manuel Poderoso Christina Pollard Renee Pomerance Gail Porcionoula Richard Postell Michael Power .iululonsi ,.,,,,h, 'f E' hm Lg fr '1 ,V ,- www f , , f i f 4 , 4 4 W2 5 f f if Y it r f f A l if iii- ' ff' Q f 1 A A W up-1 i ZW! 311' ,ei ' ,,' if i l 3 if ,. 'eu f Z iz lg Eg ! I if f if Er 2 ,Wi W ,,.. ,- V ,fii , - A iiiv A -. ' : 2 5 127 f ff'1 5' if' .. ::iyI I , - ffi- , , , iii: ill ,i. W i i 1 gi i Z X MW f f , W , rf 'gf .1 Mi f E for Hair' xxx'-...M , .... G I N K JM f ,1-J' W ,f of cheating ill has a history test today. Bill did not study. But Bill has a plan. Not just any plan. but the king of all plans. Fixed under his desk is an alpha-numeric keypad which is connected via infrared radio waves to his computer at home. which is simultaneously accessing the data files of ENCYCLOPEDIA BRITANNICA and relaying information to a microscopic speaker in Bill's ear. Bill saunters into class and confidently begins the test. The first few questions are incredibly easy for Bill. who receives the answers through his system as planned. But intense static interference from a solar flare unexpectedly fill the airwaves and sends thousands of volts into Bill's ear. turning Bill into a mindless. quivering vegetable. Bill has failed the test, but more tragically. he has failed in life. His terrible story should serve as a valuable lesson to all students. 'lf you're going to cheat, do it right. Your life depends on it.' Tracy Pratt Jay Rulido Jackie Pulopot Cuc Hong Guach Reymond Radoc Jeffrey Rago Remedies Ragudos April Ramirez Jocelyn Ramirez Vincent Raquino Sandra Rasgaitis Jennifer Rea Eleena Redondo Barak Reeves Jennifer Regeski lVlichelle Reid Robert Reiter lVlarnie Reynon Victor Rico Robyn Rider Laura Ridge Karl Rivera Larry Roberts Larry Roberts Dawn Robles Cynthia Rodgers Tamera Rodr lVlylene Rodriguez Daniel Romans John Romeo Raymond Rosado Brett Rose 2-21 'RJUNIORS '-La 53 1' . 'l, Sonia Torgerson and KirnTrammellvvalk across campus during lunch. 2. Sam Ramolares Joy Wahah Debbie Lavv and Michelle Tones lounge in the shade on a sunny day before facing the tortures of Mr. Chaffin s history class, ' A' 1 ....,..,. . .... .- ...... H. ' i M Q x f W' Xiilfs 1 exam Y , . .. V is Q U 'P' A ly Q M274 A ,yi 46 7 MMM? 3533+ fe is wi i , ., , 4. i W G 4 sa X' Q 'f' , are at N l H an WW w i ' v I svjaofhn 1,5 'gn N4 A I X William Roseboro Marvelyn Rowe Tommy Roxas Antoine Royster Lynne Ruckle Leah Rugnetta Kimberlie Ruiz Monica Ruiz Troy Rule Daniel Rupe Gordon Rushton Annette Russell Kerri Ryan Celia Sabbs Cynthia Sabbs Deanna Saoman Eric Salanga John Salomon Alan Saluta Michael Sanabia Elisa Sanchez Jennifer Sanders Michelle Sandman Angela Sangalang Carolina Saniuan Maria Santos Charly Sarno Robert Sarno ii Juiiiinns----- 19.3 i S as XX s 4 X' Z., . K -A X ' N Q N Dyes xx X N X Qt x A N x X tgf.. . : ix ,, X , s .. y ig? is S wr S ,Sk X X ak Ns, ..t' X ,, .lw ,, ifwmv fi 1- ,f f f -,- , ,,iif,,wif-W , ., 7 ' f yfff fl , H . , we , , , W by , A x illw ' y i li 1 l lllliiw T 'lllll l l ' iiiiii wiilillliy li Mi M ii? i i BMW i llll l in ggi i ,, lm i 1 'U Minn llmgiilif X Teresa Savage Pamathsa Saygnarath Flebecoa Scarbrough Tim Sohartung Jason Schauer Jennifer Soheidt Chelsea Schissler Jill Schlife Jayson Schmitt Dennis Schnarri Seth Sohoenfeld Jaime Schuett Christopher Schwartz Brian Sohvving Christopher Sciosoia Stephanie Scotzin Eric Sealey Deanna Seguban Carol Selig Kenyetta Shabazz Kayten Shah Thomas Shannon Curtis Shauger Kerri Shaw Toanne Shebloski Poorvesh Sheth Deanna Shipman Chad Shirley Kirsten Shull Karl Shultz Steve Shultz Kelly Shumate Brad Sidook Sella Siev Andrea Silver Diana Silvestri Steven Simmons Manish Singh Christopher Sink Brian Skaggs Flichard Slaton Angela Smith Brian Smith Dennis Smith Gregory Smith Randy Smith Robyn Smith Scott Smith E' F ss' Q 2 Jumons Crystal-Jean Synder David Snyder lVlarcy Sommer Joshua Soper Sincerea Soper Alexandra Sotello Lisa Sousa Kenny Spalding lVlichille Speakman Liisa Spears Keri Spelhaug Deanna Speno Wendy Sperling Jeffrey Spritzer Jonathan Stallo Craig Steepleton Carla Stevens David Stitt Holly Stokes Fiebecca Storman Victoria Storman ith a surprisingly realistic bird call Bil alerted Tom during his English class. Seconds later a small paper projectile sailef through theair, hitting Tom squarely on the ear Unfolding the note, Tom decoded Bill's hastiii scribbled words and discovered the cryptif message: The falcon has landedg the fat mar walks alone. Tom was startled. He quicklf sent his own covert message to Bill whici read, There's e dead salmon frozen in Q waterfall. Bill realized they must act quickly? l-le fired another note to Tom, but it was unexpectedly spotted by the teacher, whi made a leaping attempt to extract the note from Tom's clenched fist. Heroicaiiy, 'Bil reached for a nearby airtrack, and, holding it like a samurai warrior, delivered a crushing blovvt the teacher's forearm. As the classs stared ij awe, Bill and Tom fled through an open window only to encounter a group of awaiting securiti guards, who mercilessly beat the two boys an exiled them to a remote artic island. Notesar a risky method of communication, and Bill an Tom had paid the price. Unless you're l-Biilo, Tom, notes usually hold less dramatic results and actually provide a very convenient form o keeping in touch with friends. During class notes were secretly passed around when a important message just couldn't vvait ont after class. in other classes, notes provided . quick way to relay info to friends, or just to say Have a nice day! -dw? X sf 'QW X il SSL. Derek Struhar Lone Sturgess .Joelle Sudweeks Amir Sulaeman Mark Sullivan Michael Sullivan Neil Sullivan .iuniionsl . 1 .Nh f f frifii' lil.. f W., . W ' Z5 5 f . 2 ,,,, mi, Y '- f , .in I 7 Z 5 Eugene Supnet Karen Supnet Suzette Swadner Jennifer Swanson John Sylva Shannon Szeto Scott Tagaban Simon Tam Sarah Tan Sharon Tang Dao Tat Phonsay Thetsy Chris Thoelke Christopher Thomas David Thomas Michael Thomas Barbara Thomason James Thompson Russell Thompson Stuart Thompson Editha Tijidor David Todd Reginald Toledo Conroy tom Sonia Torgerson Lori Torrence Michelle Torres Rocco Torres Kimberly Trammell Bich Tran Chinh Tran Dung Tran Hong Tran lVlai Tran Tho Tran Tran Trang Norman Transeth Cynthia Treantafilos Thi Trieu Anh Trinh Xuan Trinh Dale Tripplet Tuan Truong Jeremy Turner Jason Turpin Anna Lllit Eric Urban Antonio Valdez Sarah Valdez Joyce Valecruz Jason Valenzano Elena Valverde Wendy VanHouten Steven Vandel Nichole Vanslambro Carlos Vargas uunnons Melissa Vega Patrick Velasco Victor Ventura Charles Vergara Rommel Viado Andrew Vierra Gerald Visoue Carrie VondeeAhe Joy Wahab Dionne Walker Aerann Wallace Lauren Walters Scott Walther Stacy Warner Gina Watters Ronald Watters Brian Weaver Jennifer Weaver Kenneth Weaver Jennifer Webb Rebecca Weber .Janice Weddle Cindi Weiss Michael Weissenburger Debra Wellborn Deborah West Sumone Westerhaus Erin Whitaker Shavvn White Bernadette Whiteman Wendy Whitesell Susan Wilborn Karri Wilburn Melissa Wilensky Robert Wiley Calvin Williams Michelle Williams Randolph Williams Randy Williams Gina Wilson Jim Wilson Andrew Wimberly Michael Winberg Carolee Witman Sean Wolden Kimberlee Wodd Paul Woods Valerie Woods Phillip Wooldridge Mike W Noah Y Paul Andrea Y X, ,,XX l ' ll ' ' ' ll X , ll1l:ul:lflli l ll ' lllllliiill,,: , , i ' lll.llXllll1:ll H , wtlh'lill,X ll l' i lm, l ll if lllv i l lil l llfll M l i P W 1 ,l ,iii l lik ll ilk Sllllll l A W Y lg All X X law- Xgwll E ww ill X V il l l.llll-lll,ll l ,lil il: ' llri' ,l ,,l'l l,, H ' Ht, , , lint ---- lll l ,,ll,, l lr l-llllll l l, ,li l ,fl ll l, l W Illllll - l llllg, ll ,fu l., 4 . l -lllll, ll , lllllwl ' ' l WM' ll X XXX' ,l , l ,, lv Al will ,lr l,, ll :ll llllllll ml W' l ll Wl ml l,llXXXQ QW lll l wi l Wl .R l-gal ! Xllll' W il.. l' X 'X X l l.l'wllwlll lt l1 lll, , l' J l ,l ll Xl lt Il' llllllll M ll lllll ll, ,ll l ,Xi hws, X. l ll f 2: lll,Xj XX l l f l ,X ll., , X XX l ,llll illllltl, QQX QXWQQHT ' alll. lil ll flllll lilly 'll llllldl ,l, M ,, XA -M 'N , ,ll E l. lv. l ' l l , l lf l X X X , ' ,ll XXX lr ffl ,, l llllwl -ll ll f llllll' l, -ll W ll l lm t Wm y 5 ll, M , l ll ll l ai. tl ll l l l lllllllllllllll X l l l l l Xl I Xll j A l .,l M, ll if l Wil ll :wg 1 Xl , l' lul l' , ,Nil Alliwll ' ,Ml ln f ll ,ll llwlwl y li7 .. ' Tfl, l wyllllll XM 'll ll, l X l b l' ' liwmllll We lilEl,ll'l ll 'Miki Av . ,. W' MRM Wil , ,l l lylxwll :bl X,,,,,t,ll ' ll: W- ll iw , , ml XlXxgfX as N. 'A ll-ll - 'lw MX Xl, l ,XXQ ' 'Flllll 4 l il 'F 'X l ii., Q3 , WX , lltllitll-l V, llwllrlwl ' will -llrlwlll l l l,l'lnlll ll, , l. .l ,l, ,l .X ,X 'l l.,-l XX l l, l lX ' ' , 'ISF MI. 'WE W' l,Xll ,ll XJ l ll lllt l1lX MX l we X X l lg' will X X g l , W ,A lX W XX l XXKW 4 l qnfwllu ,WX l l ll i X l l ll A lil 1 l ll l llll-l- ll-1l,,'ll,rlllllll':ll llll lllllll-l-'ll-l ,ll ,l, l lllll lllilllll' 'l J ' l Tl PMN X 'X XS: X wwf ,'4 X, , , l 'fglw i z llfx l -l X l Pill illll Y ll ..lt.,,, :li , X l flilllillll l, X ll 'll ll?l yllgl X X l Xi Xl X l, ll l i ' lllllll l X l'l l WM Www l l J ll ,,,, ,. .X.412?f ' fi AWPU Z0'9V1Sk' ' ' X, 45 E313 GP OPUOW X X , X . mn NMR, :ggwvlh W ,, XX XX 'WWE'-f'3X9fYil'fF3SfiW 5 ,,Z,5,X E , X X 19 MX' XXBXWM-5XgXpLv--'f . 'I, Amy Anspach, Valerie Colk, and Carol Selig bw A I M f ' 'W AX Nm NXXEKQQM 'X ' - W W ' X 2. Nlomca Ruiz and Marcy Scammers W xx M x xX X X gf, X X x 'QM X,.X w X XW NXKWXXQX' XM. 'J if X fxyfw MNQmNEXAWq'XxKfx X ,,XX N 3 Alec Draper' 'WX XXXX Nw x 0 x X QM x N N -X 4 X - M t w wxskmwwwwy . Kristin Block ' 5, Eddre Alluson ww 1-'XM K 'R Wm HX ,ww XA! v1,.r3px1g K, , Y ' N X, XXXX -wifigfffsf ,va 2,3 ,mmm , fn ,nw .115 4 v n E mix :M , W, X.XX,,.,.,.,.,.,.,,.. . . ,M M., X ,WMM X ,LM mme- ' fj'j a MW'ff1em -,X.X..., X 3 523 .,...,.,,., M. ...., 2 3? wif. gi ,EL QM NNW 2 El f MW MX W he ww QW?XbYwu1wr-mfkfwwvisitwbsepfaif We wMvfw'5??W'5WXrvfwaa'w's-wwww,X .Q W - -- Y-W, at 3 5 W. - 5 , Emp Q ig if 5 '22 Q E is E z EJ 5 5 3 Q :..,..,.,,.:,.:..,,.,..: MESH E E Eu 29 EH sg L E uluu 52 if .ji.Q122 22 Ili 2 4,:: :.:. . 22 Q 2 2 2 ii? Q E E , ill 2 , EE 3 2 2 2 2 2 H 9 Wifi 4 2 TLA 2 .:. f2:. 5E5:5 :5gg,g:fg:f: E22 :E 2 225 ..: :- 222 A .-..... 2 . 2.2. W.: .5555 Q5 -' AMT Q3 3 S 1-3- 5 Eii 15 5 +4412 2? W ' s I-X1-Q Q 222 2: 15 2523525 25 :2g5ggIgIg2 Q: EE ,gi 2, , , .M W 12 7 , ,W W if 2- 29? qi ,f sf 93 46343 M090 93-Q Q1 QNWM?-2? 03 We cae'fze724a!z'oa CUDI. ello, we are here today to talk to the marvelous tenth graders, otherwise known as the sopho- mares . Yes darling, these wonderful fifteen year old human beings do exist. Eager to put their embar- rassing experiences of their freshmen year behind them, the sophomore class tackled their second year of high school with a new drive on life. This was the last year to kick back and relax before the anxiety of harder school work. The P.S.A.T. and S.A.T. test preparation for college entrance would punch them in the nose during their junior and senior years. While many sophomores bummed off rides for their transporta- tion, a majority went through the strange ritual of obtaining driver's permits, and torturing parents and DMV emplo- yees by displaying their newly acquired road skills. In all, the sophomore year proved to be the entrance to the marvelous life, of life in the fast lane. A a t sopnomones 0 My Turr t's a sort of transitional stage between two very different situations. Freshmen are used to having mom chauffer them around, while upperclassmen can drive themselves. So those men in dark suits who make the rules decided that kids needed a few months where they could drive their parents around and show them what they learned in driver's ed. Hence the invention of the driver's permit. Students are free to drive with a permit, provided that a parent is attentively monitoring the actions of the new driver. While the experience may be fun for the new driver, it is often mentally traumatic for the parent. Cardiac arrests are common among the parents of permit owners, so many have installed EKGs in the passenger seat. After enduring around ten hours of this instruction , the parent lnow undergoing psychological therapyl hears the child's plea for a license, and, after analyzing his own pitiful condition, succumbs and allows the child to take the driving test, which he fails anyway. At this point, the parent lnow experiencing suicidal tendenciesl gives up all hope. Of course, in the end, the child does receive his license and is able to drive his parents to and from the Institution for Mental Disorders, Dad, can you tell me where the key goes? asked lVlike Castiglione. I think I forgot! replies his nervous father. Nerissa Abbott Q ,,,, i , Wahee Abdul j Flobert Abela X y Joey.Abelon M N A Eric Abila e , t if i ttee ? Edison Abrenica I iiii a A r y raari ff - ' 'mfg Eric Acda + 5 Primel Adaiar Stephen Adams Zachary Aeria A Victor Ahrens lVlike Aklufi IVlaggie Alcoser Serena Alexander N Norms Word 1,.l f Libby Allen N g I Danielle AMOS i a Sandy Alvarado g g eea ,.,, Alicia Amat ': Q ' ll 5 , I will Q ww M X 4 F wi 'i -' , , iii ll f , . kQ,L' A was ws. Ai, +9 i .-Q, rr l X M . l l ,lf Ml: iiii i lg i' W W '- r l A i y 0 ily Ni? ll , ll XS i X X l f 4 vi l ,. W mmm - 4 ' 'Nil ,wg ,A -1 .ii .Q i l 1 fill g gi rw l, 9 xy y 'ii l lt Eg x xx X I w X 'tx x S W x X N fill X N X i i ii I X 'X All A ' i , , it lla k QQ ll it Q ix f D -y -ig.. -- gc: 'A Y ll 'Q - i Gil, W W if , ilw lip, , i Q A . , i lhiylww W. wg i ii ww E 5553. wx , z LN A l filf law. VxL ' e W, Q X 4 A N KX M x l X WV i A .i N it ii' d X gil i W l 'J f. ui l. -my is il liwilkii ll ll ' .A 'I xi , .i KN I Editha Anfiores Brandee Anderson Jeffrey Anderson Debi Annala lVlyla Anoche Alan Anonuevo Nicole Antibus Trixie Aquino Albert Aradanas Anna Aragon Natalie Arazi Janice Arbogast Travis Arnold Jesus Arroyo Melissa Arucan Ronnie Askew Chad Austin Christina Avakian Nancy Avila lVlustapha Ayoub Rebecca Bachrnan Christina Bailey Rena Baker Ricky Baldwin Bobby Bamford Jeremy Banfield Regina Barajas Perry Barcelon Laurie Bardin Michelle Barker James Barnes Jennifer Barnier Kristen Bartels Suzanne Bartole Elena Batoyon Arlene Bautista Ernest Bautista Eleanor Bayan Aundrea Bean Charles Beaver Edward Bejar Shawnda Bell Eileen Beltran Travis Belmer Dennis Benavides Pradith Bengmana Tresa Bennallack Nicola Benson Sean Benson Craig Berkson Heather Berner Elaine Berry Roman Beza Aaron Biggs Brandon Black Jessica Bloomquist isopi-iomones Scott Boates April Boatman Victor Bocaya Grace Bolano Melissa Boll Erin Bolton Honore Bonin Lauri Borck Leslie Borromeo Deanna Bovee Denni Bowen Michael Bowen Jason Bowman Steven Bowman Jim Boyce Theresa Breen Elizabeth Bridges Vanessa Brissault Alan Brofas Christopher Brown Mary Brown Meredith Brown Norma Brown Jane Bruce Myles Brundage Dawn Bruno Michelle Buack Michael Buccola Erica Buchwitz Michele Buck Catherine Bunag Michael Burkhart GaNeane Burns Andrew Bushby Kevin Byler Amabel Cabrera LaLaine Cabrito Monique Caetano Jeffrey Cagaanan Justin Calapp Beth Campanile Jennifer Campbell Kerry Campbell Bebecca Campbell Adhemir Campos Eric Canon Carrie Carambas Anthony Carenzo Carla Carey Anthony Cariaga Enrique Carino Lisa Carlin Brett Carstens Bernadette Carter Francis Carter John Cary 1 sopuolviones F , f f 1 f f f W X r K If If i f f W, x X 7 A K if sv ii px? have S f 3 'V D22 ,.-f if V 49 9 fi Z, Maravic Casanada Dusti Case Mike Castiglione Tweet Castillo Stephen Castor Geirallyn Castro Roger Castor Vicente Castro Joseph Causarano Mary Chaney Mayger Chang Marvin Chapman Todd Charette Maychi Chiar Patricia Chincharr Ea Christensen Shun Chuang Juliette Cieios Bryan Claman Benjamin Clanor Kristin Clark ' ' VSOPHONIDRES 'i. Angie DeLeon is singing in the rain while showing off her new umbrella. 2. Marybelle Marinas decides to go on a ten minute break after five minutes of 3. Libby Allen and Jessica Bloomquist take a break and catch up on the latest gossip I Michael Clavir Miranda Colclasure Gregory Collins Lisa Conley Christopher Conrad Robbin Conroy Jeff Contreras Lisa Convvell Sheri Cook Daniel Corley Jason Corley Mariam Correa Stephanie Correa Melissa Covvan Jason Coz Randall Crone William Crosby Emily Cruthirds Ed Cruz Gerald Cruz Christine Cugzia Jeanette Cudino Stephanie Curry Derek Damon Thuy Dang Bryce Danico Carson Daniel Arlene Dao Van Dao Mark David Jeffrey Davis Richard Dawson Angela De Leon Randolph Dee John Deines N X -x X s Sir XG siw Xml?-F 'A X .. -FX L X x.t: - lz- .. IJ X iX 5 X X XX X 35 S fl it 5 S X Q X Q X X WX X is X Y: X : S 57. will-' FX Xe E M 3 X. , . 'N din XX QNX . New X ,M rv' N-Y X X X f ' X - 1 i X if in as l I lag-Ex, 2 me X 5, .... W, XX K' XX ,Q:.X,,,s .. .Xa .tu- ' ' ,Xi X X X S X X We X ii X jx W ig' ,..t,, X X X SZX XX X Q 'SN S 5 X X 5 i E X Q XX . X Sis X i E X XXX nce upon a time the realm of Sophomoreland vvas a dark and dismal place, for it vvas infested by the dreadful beasts of poverty and indifference , Luckily, a band of brave, hardy class of E39 councilmen, led by Sir Michael Aklufi, Lord of Sophomoreland, decided to rid the land of these horrible monsters. Using their devastating weapons of T-shirt, pen, carnation, and hotdog sales, these champions of Sophomoreland did battle with bloodthirsty, ravenous beasts. Aftera long, hard vvar, the council was victorious, and the creatures vvere slain. Sophomoreland, freed forever from the beasts of f'poverty and indifference , became once more a lovely, joyous place, full of cheerful voices and smiling faces. 'l. Class of 1989 Council Members consists of: lfront rowl Sara Kashima, Tina Del Mar, Mike Aklufi, Linh Hoang, Jeff Rudiger, Michelle Ella, Leslie Borromeo, lback rovvl Aaron West, Jose Tacloban, Laurie Bardin, Kristi Matson, Kris Spurny, Jessica Bloomquist, and Jolene Toler. 'SOPHOMOFlESl ' -iSOPHONl0RES Souphaphone Dejvongsa Concepcion Delacruz Sean Delane Tina Delmar Killete Delosreyes Mark Delunas Michael Demers Michael Dennis Sharon Deperalta Al Desantiago Gelyn Devera Carl Diamond George Diaz David Dickenman Albert Domingo Melanie Donovan Christopher Doty Derrick Doyle Trinh Du Judy Dualan Maria Ducote Brian Duffy Frederick Duffy Jay Dunbar Mary Duncan Jeffrey Dunn Du Duong Lang Duong Linh Duong Cesar Duque Christopher Dyer Joseph Eakins Karen Easter Victoria Eatman Amy Echols Michaela Edelhauser Annette Eden Kevin Edmonds Debra Edrington Joanne Ekstedt Philip Elamparo Roy Elegado Carol Elfers Michelle Ella Edward Elliot Doreen Ellis Jocelyn Ells Jason Elston Timothy Ely Derek England Lucille Erb Joanne Esch Lesa Escobedo Flay Esteban Mayra Estrada Cherry Estrella W Dave Evangelista Sarah Evans Sam Fakhimi Vang Fang Anthony Fannin Jeffrey Fanno Robert Fant Angelic Feigt Farid Feretti Troy FErnandez Christina Finkle Jason Finley Angela Fisher Matthew Fisher Laurie Fitzgerald Flenee Flesch Alex Flinn Paul Flood Gerry Florendo Alison Flores lVlaribel Flores Oscar Flores Olga Florez Jason Flovver Bethany Foch Fluel Forbes Bruce Ford Christine Ford John Fose Toni Foster Anthony Francesconi Lori Franklin Fiiley Franks Christian Frantz Peter Frederick Tracy Fry Fiobert Gabrielson Alicia Gaines Charles Gallagher Grace Gallardo Howard Galliguez Ganan Gwen Cathy Garcia Elizabeth Garibay Kevin Gay Stephen Gemmell Paul Gerlach John Gibson Michael Gibson Dennis Gilliam lVlichelle Gleim Shelley Glenn Stephanie Gloria Amy Goddard Kyle Godzik Kimberly Going V ,,f.,414-Q ,,,,.. ..,1,, A ,y 1 I f ' -1- fff ffvgf A f yy? iQ,fN ,QGX M t Q, A f , ' ' ff ,f V f gn f fe if f if J ,Z M2 'lf my , ,, ,, liitiiifyli ,, 'iit ,, W' 2 1, Af ' mv 3 X g , , f ,. 5 ...,, - v,,, 2, VA , fi Fw 1 aw Www, W-W, si. vw 'Q ' , 7 7 0' . ' ff! 'f V' . f 5 QZ, f vw gfgmf ,Q ,MW .M ,f Z5 , ,. l ir- ww V:-2. 217 I i ff ,i yw . Sz sz ' Z , -ff gif' 'f ,. ' U ,- g f i 53ff'j?EW'fiigig, 75g ' j rf Mini? f ' gi' 5, K -- ffm., if ,3 J , ' ' ' i ,...a L -- SopHOMURES gr 5 W.. f . 4. 'QVQZ7 fff E, 7 .xi 7 f W 4-1 MWN we W M W Z 5 , W f Z 3? f ' fvv' 4 Checking out the guys, but trying to look inconspicuous are: Nancy Le and Judy Dualan. Z if E Q ? ii if 4 Z A :M it .Z :, . 1 ',,, ,' ,ww V Kris Spumy attempts to coach Tina deIMar the art of braille. 1' ' ' l i i e ' Fariman Golshan Shonda Gomes Gustavo Gonzalez Craig Gonzo Jessica Good Frank Goodwin Richard Gopez Christopher Gordon Robert Gordon Kirk Gorman lVlichele Gossett .Joan Gozalo Chad Green Wendy Grevvell William Griffin Flussel Grin Sherri Griswold Tanya Griva Leah Hagan Michael Hahn Akimi Haley :som-iomones Dana Hall Glenda Hall Michael Hall David Hallet Tamesan Hamilton Jacob Handy Danielle Hansen David Hansen Gary Hansen Jason Hansen Jerry Hara lVIalia Harrington Rickey Hastey Carlin Hausohild Jenni Havel John Hayes lVIichele Haygood Jennifer Heaton IMI my I X X XXX Vim X I X X If - .4 x::- , xii? t x ,M X N X N af' 15 mf X 'N I gi X X XX XX X is NW .V ww 7: I s gs I i ij T 5 - .. 1-QSNQQ,-X .,,- .,. . . .. grim - . 1 ' H. .... L X X 4 2 2, 5 W ilt ,,f-: X VX . J , 51:6 ,X N, Na 5X s i g 2 it ,fig SQ is xii X XX 3 X ' i ::1-Xen.:-i?5.:.5sf - rfs. 2' ,. ' , we, xX N' i f X NN 5. .A ' r K .,. ' X X IX X 'M .X X XX 2 in an 'g I It t . A Kli:.L:L:- 5 t ,1 5. M 5 J 3 ,X E 3 I I mum WWE W r-ivate open-ty ophomores generally place an overwhelming importanc on their bedrooms and consider it one of their prize posessions. Bedrooms have a multitude of uses. Fo example, some students enjoy sleeping in them. Others us bedrooms to seek refuge from parents, While still other utilize their bedrooms as a place where they can sort ou their worries and frustrations. Bedrooms are also a sourc of privacy and individuality, since to decorate one's ow bedroom is to reveal one's interests and highlight one' creativity. Personally, I feel that bedrooms add a great de to civilized life. I would not be able to function without th love, support, and guidance of my own bedroom. Withou those comfy Snoopy sheets, and He-man bedcovers I woul not be half the man that I am now. Bedrooms are my life i I E1 . X, X X 'X x S X X , 1 5 X XX Xi' X X9 'W N . 2 2 5. t 'If-milk? IIIMIH v H, S 0 P H 0 Nl 0 R E S I 'Nh ' 'NI XXXT A,AA X 1 is Zi 1 Z- . ,,,, X K X X, X ,, ,... W if mf X XX X 441 4 W X f f X X - XS mf' i ' A'A' ,g 1 A X0 ,, , ,, , WX!! fx X4KXX4...,XX X X - . lf AZ A Qs! H f it X y 1 XX 5 fix Wim 5' Q 4, if 4, f f .KQV X , I T' X X + . . ,, me X X . - ' ' If, V W . H f-I Q X ,X ,' V , .L f. , ' , ' ill ' X . ---- X ei- f f ' X 0 2 Q fluff-1 fn-' X ' ' i f X X X in XX 1 X , W 4 f 422 MXXXXXXXXXX XX if XX,,f622:z:-.W,fn:,' up- -XXX , f f 1, fs, X :EX, . X .X ,, ., M , K :Mk X an M 1 X f ,r VX X XM ' M X XXf ,,, I Xu 155 6 as ' N-5, X 'Yi ax -3 X 1 X ,, ,XXX X, XXX XXXX 8 X, cw X X ,,,X, X.. Vykk I it ,V XXWX X, W X X AX ww X X ,fw , Xg f- WM' , 'L ,. , Wy ,, ,, , M 'I W H fi Q55 ,X , X XX X X f . 5 , X ZZWXXX, , f,XX,,:: X, -517,7 f 7 fag X, fav M X Barbara Heisser Paul Hemming Diane Hendricksen Monaliza Hendrickson Chelsea Henken John Hentges Sean Hereford Yvonne Hernandez Martin Herpst Tracy Herr Jose Herrero Theresa Hery Brian Higgs Sharon Hipolito VZA , Z , VIVA i A Bachelle Hisavv X M ic ha el H oa g gzf Cuong Hoang Linh Hoang '- -:2' X. ,f fl, X Melanie Hoerr X , f Melissa Hoffman Donald Holdridge Kevin Hollinshead Chan Hong Debra Hooks Stephen Hornyak Andre Hoth Teddy Hovvell Alice Hu Sally Huck Betty Humer Ai Huynh Dung Huynh Thach Huynh Tong Huynh Marygrace lntalan Thomas Irwin Anita lsaguirre Gary lshio Jennifer Jackson Kenneth Jackson Boshon Jackson Shari Jacobs Jeffrey Jacobson Hemant Jadhav Arne Jahn April Jeffrey Jeffrey Jennevvein Michael Johnson X Sandra Johnson XX . J ' 'H y Jennifer Jensen , g 1 2 Ann Jerde g Mimi Jimenez Brett Johnson Derrick Johnson - E , I l ls, 'f isoni-iomones Shavvn Johnson Flachel Johnston Michael Jones Neil Jones Kimberly Jones Sharon Jones Sidney Jones Thomas Jones Gary Jose Kimberly Joseph Jolie Julian Kathy Jung Scott Kaluza Sara Kashima Marcus Kauler Michael Kelley Mary Kelly Kevin Kennison Charles Kerr Michael Ketch Patrick Ketchum Kristi Khong Christy Killpaok Nancy Kim Natalie Kind Paul King Brenda Kludt Andrew Knapp Jason Koehler Michael Kolbeck Kenneth Kovzelove Mervyn Kovvalsky Donna Krager Flachel Kuyper l-luan Kwok Macy Labayen Geraldine Laoonico Bich Lai Anna Lalicata Kien Lam Leonora Lambert Laura Lanich-Trent Soy Lao Jennifer Lapuzza Michael Lariviere Todd Larson Jason Lassos Enrique Lavina Gene Lazaro Kim Le Nancy Le Jennifer Leake Elizabeth Lee Desirae Lefevre-Bauer Marvine Lemay Adam Levin '43 t .... .M as .: ,, ,. - assists S.. M , - 1.-1 .,...., gg WL EM.. y Y xl K se L S 5 K aw 1: Ha ., ksttxifgg .sg H -wwf' gi: X Nil? x L x X 'N V, .ttt .K ww SOPHOMORES I sei Q- ::- .-:-at .- M W Wwi L k at M is . ., X X? ' xi ,Eg X Q KS, KE-K ' K 1 'N tm' r K S K A if igftggff. L. , Q.: x. L FM . Q- 'S K 7 K -' ti si .. L- .. if K1 ,. N K.. Rx' x 2 Erik Lewis Nicole Levvnes Crystal Liberatore Mathew Liberatore Larry Liberty Nho Lieu Joshua Lierance Flhone Lillard Jessica Lincoln Sherry Lingenfelter Deborah Livelsberger William Livesay Arlan Lloyd Kimberly Lofft Kristen Logan Jessica Long Royal Long An Long Camille Lopez Hugo Lopez lVlichelle Lopez isopnoiviones Steve Lopez Flana Lotfi Harry Lough Mike Lovejoy Cheryl Lozano Lisa Lozano Sonja Lubert Aaron Luce Tisha Ludwick Todd Luikart Van Luong Binh Ly Lan Ly Phuoc Ly Trinh Ly Michael Lyon Paul lVladeen .Jeffrey Nlajor ophomore days were filled to the brim with fundraisers, dances, pep rallies, sporting events, club meetings, and other school activities. For many tenth graders, this was the first time that they turned off l-le-lVlan and The Jetsons and turned on to the SPlFllT channel. This was the year of many firsts, due to the fact that last year lwhen the sophs were mere freshmenl, participation in activities was practically nil. Now with the ongoing antics of the upperclassmen and the various soph. leaders, the Class of '89 jumped onto the roller coaster of fun. Never before has a class at IVIIVIHS been so anxious to let off steam lohh, hotll. Buy your sweatshirt here! The Class of '89 went all out to raise cash for their senior year. There were hot dog, candy,tee-shirt, sweat shirt, and Nlarauder peni sales. Nothing was held back! Sophomores gave the word SPlF?lT new meaning as they did what came naturally to them...l-lAD FUN! of' . S 5 l l, l 5 l in 5 f 5 gg... Wy, Volunteers, anyone?!! Class pres. Mike Aklufi takes l f ,,lV ff- '44 25 6+ A : '? X VF 1 I- 5 count of sophomores who attend council meetings. l ,V L ff f 440' ef f f L Af l . ,,.. , f 4 WWW ,,,, V .:,,,, J --in fy if ,,, ,gm mt.- wg W ,nv 4' I ff f f 1, f A x 5 562 f 'qw of V with ..,V5 as ..,, My W s , , if A ,J :wmv :g,,,,W,-wf'1'w ff'f ,,,, A.., V , ,,,.t..,WWW, 4 fmi?,vWl5,E5ffewiwsifiw-zwwcim Christy Maki Paul Maloangio Christyne Mandagie Mae Mangohig Flobert Manno Flosamaria Manno Shelly Manor Tina Manthorpe Shelly Manuel Cathy Manzano Stacey Marbrey Marybelle Marinas Doug Marko Davvn Martin James Martin Robert Martin Sarah Martin Eric Martinez Zane Martinez Jason Mask Tiffany Mason Jason Massey Kristi Matson Kathleen Matthews John Max Heather McAvoy Kerry McBeth Scott McCallum Tommy McCarvel Melissa McClain Scott McColl Rachelle McCullough Toria McCollum Teressa McCoy William McCready Mickey McCurry Veronica McDermott Graeme Mclnnes My if 1 r , ASDPHOMORES 2 . , '1:f2 Q A 'Q aaaa N ss, , i Q :LL :-5 , My . . - Yrs '--- xr' 9- . ct - K it Xi ..., .,., , . .,.,,,, J, k.., J J it , - -- . .. Stao K me Diamond Nigga K SN to X Q wi K he .XXX 1 ks .ry :,-.: ..: ---- 2 5 L , X f X5 af igggigi , -:X I Q1 . - - P, Q ts ,- ww ' An rei MeinYa?Qafe5i? ' ' ' ' d ,..,,, ., . Kevin MeY?i 5 ,.., 1 IWW M. . .. J h 'VI lbiw? LL.1 ,mmmi T1 0 l e J ttt . - L J Mandv Melendez Eileen Meloeantos i' J 1 Marcus Mendoza K J y at H g Y gg . ,q Keith Mentze K n KW eeeeee K J 'S - --N -1- .. -. S Pam Mercado Rey Mercado Kevin Mercer Gwen Merkle Meyrick Mesina Sherman Metcalf Marlon Miguel Stacey Miller Joe Minami Debbie Minihane Michael Mlinarich Steven Monday Adrien Montgomery Alain Montgomery Tracy Montgomery Eric Monton l-larold Moore Lakan Morales Michael Moreno Jennifer Morgan Julie Morgan Claire Moriarty Brian Moult Julie Mucha l-larry Mulder John Murdock Jason Murphy Kelly Murphy Thomas Murphy Jimmie Murray Flichard Myers Stephanie Nagel Katheryn Najarian Terry Napalan Teeey Napalan N i X Y gt X A. .. , 9 W Q N,,..,e.Mw,.,,,M ' Mel i F INS ...V ig. Qi X 5 Q an K i 5 .. i ..,, i EE fg in x ' 5 X S 3' t - r: 'E l SHS , .t.... , ij f gf 21 1..i- i 3 iaaaiiaa liiii fl w x 5 S x L V E i . T Q E Q N. N i K 'll Xia 3 NSS? 4 g fx: Rf' x 3 N X X 5 Q eg-:.,::a::v 1 v ,tg 5 W L Hi Chad Naples H ' Q 2 Sl? : X: if i ii: if: -- - K THVB Naravanan 5 5? V i . l K :'t . 1 -- Michelle Navalta 4 K or 5 M' alatlt it Tom NHWPOCKI x J J iida g in 2 ' X it titt 5 B bbJeljf 'Neil my .. Ei O e Son gggtt an ., t V I' . L -A xi l Xl E Duyen Ngo faa i 3 1 tt. FQ ' i '-Iiilwiiff .silfkgiifieei-lr--'E . . . V SUPHUMORES F l if Z 5 1 Z 1 if 2 3 3 2 gi 2 5 2 2 gl Hue Nguon Ahh Nguyen Binh Nguyen ,v-, HCV un ,fy Ouoo Nguyen Giang Nguyen Hung Nguyen Hung Nguyen Jenny Nguyen Khanh Nguyen Yes, vve are studying hard!'f exclaim Phillip VValker,l-leather Riding, and Gene Lazaro. Khoi Nguyen Loi Nguyen Long Nguyen Phuong Nguyen W' Shannon Niespodziany James Nixon ' K J V f Pon Noble ..-uf. ix Xlorman Nooris Dana Novotny lVlylene Obille Sean O'E3rien Kerrie Ooampo Jason Odom Kevin O'Hara Alex Olaes Shannon Olson Belinda O'Ouinn Eric O'Piley -M' Ojana Orlioki Jennifer Ortgiesen Shantelle Overly Todd Owen Wendy Owens Joel Pabelioo 4 ,1 Jaye Padgett Phillip Palaoios Soyla Palma lVlariam Pandes J i'ii Nlirabiel Papa lVliralynn Papa James Park Kelly Park W. Douglas Parker Janeen Parker K Keith Parker x ' -' fsonnoiviones- Christine Partido Gina Partridge Juan Pasoua Jed Pasion Cathy Pataosil Heather Paterson Andrea Patrie Jeffrey Patterson Erio Payumo Jennifer Pearce Jaden Pederson Stacy Peel Heidi Pelak . Frankie Perez ear-ly Whites il I'm a sophomore. notice anything different about me? N0 MOFIE BRACES! No more brushing after every meal lnot that I did. but don't tell my mom thatl. No more worrying about embarassing traces of food stuck under a wire. No more monthly visits to my orthodonist. Dr. Ouch lhe has bad breathl who always tightens my braces a little too much. And most importantly. NO MORE TEASINGI Now I can eat anything legally popcorn, gum, caramel. ice, and apples. I can smile, knowing that l won't blind anyone with my metallic grin. The only thing I have to get used to is how slimy and naked my teeth feel. How come l didn't notice this two and a half years ago? Now living with the retainer. which feels like hardened peanut butter. I'm collecting a full day's worth of spit. Well. I gotta go floss i IBrought to you by a senior. still wearing brac who likes to B.S.I . , ,, . See. we re BRACES-FFIEEI , smile sophomo g llzzl Carey, Jeff Pudiger, and Tracy Fry. Jamie Perkins ,.,., -I Pioha rd Perkins lVlike Perono as Grant Perry S John Peterson . I Noi Phabmixay sis lf is X X eiii Pfeffei- M wil X ..:.-. ts Phuong Phgg N .s Theo Tun SEM S5 Bounnamtia fai l P in 1 x... . My H a n 2. .g:-it-: -. -:- --'- : ,ax g e -'-' wt. I -.... 3 g ..-.. 3 . :.. :-:1.: -:1:'g:,-s- ------ : E ,I Y Q 5 3 sg awe is. 4 233. K SSRN gi. .M-1-21-I-:I-. ---- I -H:-':::::.-.:-:.'- :5. ::..:--I:-g.:5:,::.-I..-:-: :.-::5.2.-g--:-'::-:.-:Isg-g:,':,r?r:a-i:':::::.2. S ERYW 9 was 'gmt .. X ,Six xl .Wigs tg? .. Ew a 5343535 .swakfisisi 2 i is S Wifi m .5:- 22 ff E is L NV as I fm Q li ff 2 si-as M as ass? X 2 X st R .gk be f Q M i 9 is igwkiiik K M 'ggi 1 'Eg 'X X N 3 X :X Qmifixi 'FK it Q 3 W tw s Q Xt Wy 1 Q56 g gi E 3 E35-1 Q gk X Yr was KWWNWQWW E? new mamma ,te if 'E , I W st Y V Y ml? X Nt X sssmswmarfatw EEE Ngfmiefid. My at it W 2 if M v sagem ' 5'- 'i-'-.ffl E?':. i -if'--' 5-:S-2 New M -'W was mi mg S S W'5igsk EW til WN gig EwtQg?MS EEE me ga wg Hg X, Xi X ENN X Bla Within-5 .Y jig N li 5 S' 'Z 5 5 fi val 5 ff... fx if Z X 5 Q N ff 411215 9-fi fl i ., l ll X l ET' .35 if F im- Ni? W e s ri : 5 Q ix F l m er X .x.,Q X is ' QQ5Q Q .. , if f 5- , at T 52,3 -Thx .. - - l Q-Lk ff. , - 2- ... i i Q mi xnxx E . .....A I X1 . Xkk, is - r P R C f eeatt f . r ' ' r L'L' 2 ,Qi 'L'L 11 E Q. i if , 5 P it at 5 J 'h': Lk .K I W' i eeei at C h'l ' ettit if . J-,., X X wie .Y-vw' 'I l N gf: G ii in . sf ev Xxvk Xi .3 -deg i , ' . as ev -Fsiw ' M x gi Q R i g i ff x g 1 gl l i 3 Q . E is if 3 f . 2 i i 3 3 i i i fi 5 E l Z Z Z l l A ' Q Hao Phung Lyn Pimentel Carey Piper Mike Pisoiotta Michele Platt Marc Plotkin Deanna Podsiadly Marydo Polangous Donna Politano Elaine Popa Gwendolyn Potter Karen Powell Paul Power Elizabeth Duinn Khrista Quinn Claudia Duintos Allison Ragsdale Daisy Ramirez Sherry Ramos Shannon Ramsey Marianne Randall Jeff Rasmussen Samer Rasoul Akiko Rataj Clifford Reeh Cary Reissner Sam Rensberry Shannon Revak Ronnie Revoredo Stephen Rhodes Michele Richardson David Ridge Heather Riding Jennifer Riding Adam Riley Sheila Ringo Jenny Riopel Matt Rios Allen Rising Thomas Rizzo Courtenay Robb Jarod Robb Deanna Roberts William Roberts Michael Robertshavv Chris Robertson Danielle Robinson Rebecca Rocha Henry Rodrigo it iu. . e sy Rodriguez Rodriguez i':f Eh r -,-- 12245 'f ' 555 i. i . g.g , ski ag 21313: ,.,..i.. , E Q a v f'O igggyf i , 1 ,-4 : as E if fa O lg 1 its-fgsfg l?l ii si, lil 21 , . 3 l 1 , .. l -:fb-exif , . , . V .. ..., .A ' l 1 i :az 4:55 l ,::5ffe2 :2::2: Eze: f 5 f 1 fl 1 Jiri- 3 52:11:52: 5 ' S:-XE i 255255 :2:?1::ia:si2-iii: rl A 5 lc l '- ' 1 :I '-'- - I ia. il f,i,g l.i.l aiEJi?z 323 g!f,iaaiii,i N li if lil i f ff n e il iifimg il. EMllt:E e,t.5 t i f,i i fglll iggiiil. ffiiigg f 'E lil ll if 3 lirwfazsw 2349155 .,,, , , . ,i.,. .. ,.,,.,..,., lil l if I X g K l fll A women M: ,... : l lg l i ..... , ii . we ' -f ww MM ' ' ' . - W? F '-F?'?f'ffi.f3K QQ' W :Tl 1 , 1 ' -1 5 2' wz1w'f'U,Sw',g,e?P ,' f a W Wa P mfg as W w ra-'f'-af: :fff' J wf-W-if ,- if if 1. i,.f..fga,:fyf1l1'wf af, .affm,a+11i mf in 'f. , :w . +1 i t if .' H .Jw is 'i,i?s.ffgr.f.f2w ,fgr?'m.' , 'si ii, . if diff, iiifmf' . . . '5 'f'fiv hi ' , ww. '. ' W ' i L' ff'H2. ' -i ' wif' H f ' .J ' vw +v,?'W'gygsi'Wwq 5 , f-e.,- -Q'W W W-3559 . fi : f' 1 .i fi if .,faiQ?2ig4 f , 1 i ,w - ' fi ww 'aa ,'aziiil'pif H' Q - ini ,Y ,Him -I ,.i5-ily,-,ii,5fKi,,f mwqiiqm lwiid ff iii. ihwweq, -mcwib w wi iw hmm E5 ggi'-if ii -ii, My fp ,W 4 ii mf- ,iw 5 it i 'isivfivl-'ill 'ir M Jf1':F if' Vi. -Wh im iiw, mai, ff- ig., ,- wwi: i,i,ii4m1:'wvi'wwf if ,ii ,awp ii ii O lil' J' R ic h a rd 'U'imgiizwlwviiiaqziwili R ri n c e 5 S R c at J a S 0 n R ovvaf Jeffrey Rudiger' Eataban Ruiz Sophia Ruiz Michael Runion Rache Saccentc Richard Saccento Eddie Salazar Michael Salazar Richard Saldivar Cynthia Salindong A Tv:-SWG' will X -i,SDPHOMORES 1 I ,lil . 5, X in ifeiifglzwgmlciimsim iumwf,i:gg,f,,,wfl5ww E-. ,,,, .. I V A W QM , , JF . 4 7 M5125 W f X X Vzrziy , ,,,,.,,,,,, Q .W 1 I x ,Vyiu ,f win: fa an ,,,,. , W www iiiiiwifvi , .-iw -my ,, in., ' .ii 'FTW 'W ' WW ' Milli' fi H W if Mmmn,iiii.,.,,. M ,,,.iw,4'1:rfig,f1 Jimi, ig ' 47534 , ' s W j fm, , , aff! f f f Q .- ,, WiZmi,1f!g,, f i W 4 f 'K fs - M 5 Q ' 5 i-aii' f A li 5 A -irri f , 4 Q ff 'iiiigfifwwlf 1 Mia ,7 f' W 5 f ,fm ways gs Being a Sophomore can't be that A af ...' ' ii 5 li 3111 ll -. i E ' 3 if A 'A A . 'i'fi..w i f ' ii:1iii f I 4 if . . : ll -i iii' fiq ii ,,, , M 1 li if i n- ' P l ' f ,ii ' ' Hifi as ' , 7 A 'i a , 5 'QS' 2 :-i f Qi A , 1 i w J H a s i - rf' 1 :J M' ' I 12 ' if iw a , 5 5 J 1 ' if . H 5325 1 A J ,,,,, .. fffifqiq 5 Z ff ,,,, ' Mai,-:if ,, 4 , ,,,, ,,,, . ,, , 5 ll if Patty Chinchar is all smiles about ic!!! if EW ' 1 '-,-'WS JW' -, H1 'ff ri ' F 31 iid MW 'NW' il' X Katya! i W in , , 2 f X WW-ff ,Z i Z ip- 6, H. pf, 5. 4 11 ..,.,, H 5 gp of 42 .... 415' ii i l r Santos Sapienza Sasse Savvyer Glenn Scharf John Scheid Jacob Schlenz Paul Schmidt Davvn Schmitt Stefanie Schofield lVlark Schooling Adrianne Sealey Amy Seckman James Seckman Sona Sharma Brian Shepler James Shrieve Marissa Sicat Seda Siev Scott Signorelli Jason Simms P, Sisouphone Jenny Sisson lVlichelIe Skinner Amy Sloat lVleg Smallin lVlarkay Smirl Alex Smith Angela Smith David Smith Dee Smith lVlelinda Smith Westley Smith Jeff Snovv Kirstin Snyder Tina Snyder Cherie Solansky Philip Solomon Cleo Soriano Agustin Soto Claudia Soto Kasey Southgate Danielle Souza Kim Spafford Jeff Spangler Bernice Sparks Christy Sparks Natasha Spillios Jacqueline Spooner AU' i I V , i som-lolvlones iii John Spradlin Kris Spurny Samara Standridge .John Stanfield Suzette Staples Angie Stark Susan Stec Walt Stetter Colleen Stevens Todd Stevens Annalisa Stevenson l-lenry Stoker Jessie Storman Monique Stowers Alisa Street .Jamie Stubblefield Amber Stuck Tiffany Sullivan Erin Sumwalt Eric Swanson Eric Swanson Charles Sweet Joselito Taclohan Lisa Tam Raymond Tam Lourdes Tan Yvonne Tan Nancy Tang Angela Taylor Christine Taylor .Joe Taylor Tricia Taylor Te Kong David Thackaberry Khuu Thanh Phonevilay Thetsy Trevis Thomas David Thompson Maureen Thompson Sensabai Thongrivong Melvin Tiangson Steve Timothy Shawn Tinker Hardip Toor N-Gai Torain Steven Torok Betty Townsend Tracey Toyne Buu Tran Donna Tran Duy Tran Giang Tran Hoang Tran Lai Tran Phuc Tran Flosalyn Tran H SOPHOMOF-lESi ,w i T ,V ,7..:g,:j ' v1,:.5v:g,Q W: I nv A H Iyuil i,,,, T yyk y l y yli ,,t,,,, llyyl 5 y yyy T TV I , i ' af '--- f WH ,ffl fiiiif ' ,..3 6 f 'I 5 X, Y' Wgddff f f f qiwfff 5 X 1 4 3 ze , iiif -. -i mf! f 1 f f ZW! WW J 5' , i, , ff i eff X 'if f H ww f A vi ' f J , , lk. V z, ,, K 4 ,Z , L U if , ,, ,if,, : ,E 'WH 5 ' 2 f- if ' A 5 i f ' is Mmm eww l ' 1.. ' X X 111 nf Ed Trento Garrett Treptow Scott Trice Phuong Trieu Tony Troncale Travis Troxler Cuong Truong and never been kissed? Becoming sixteen is a major turning point in anyone's life. For sophomores, the sixteenth year means an end to being an innocent and naive fifteen year old and a step toward the pleasures of the freedom experienced in adulthood. After grueling ordeals at the DMV, sweaty palms were dried and readied for grasping a driver's license, and sophomores no longer had to beg parents and friends for rides to school, the beach, and hot spots. Begging for a car followed, and once the automobile was purchased, sixteen year olds soon disappeared. Being sixteen opened up doors to employment. Sophomores were no longer satisfied with weekly allowances or baby-sitting jobs. Many searched help wanted ads and combed through shopping centers, looking for minimum wage jobs at fast food places. Some sixteen year olds were finally allowed to go out on real dates with members of the opposite sex, but unfortunately, parents were still strict with curfews. Loaded with balloons, roses, and a birthday Cake, Michele Flichardson festively beams at finally reaching sweet 'l6 l Hien Truong Nhu Truong Vinh Truong Michael Tu Scott Tucker Pierre Turner Tom Turner ,.i W. Z 1 5 6 A '- f ,s wi fi, ,, My ,, , . . , i ,,,, 7 saw? i Danielle Twitchell Danny Tyler Adam Tyndale Antonio Ulit Paul Unger 4, fs M 1 'll 1 l f W , f l x, :ww 5 3 ' Qisfgsff iii ii if K I ., , ,, , ,, ,V ,,.,,,?s,-an . .. , If .1 , , fi , mf-eviiif -nw ' W: W ,,?fQ,,71,',, Frank Llren Flenee Uzel M ,, , , , , 6 fy -,mv if Av' if W 5 Q2 i wmv s ssoni-ioiviones M , 1 1 1 1 1 to S2 l l 3 fill illlgglfilli llw 1 5 l E5 551515 E 1 15 , 5 Wm 2 mms :51E. 3 X H i 1 1 . . I 51 l E Q 5 1 133 l , ll l l 5 l NH' H ff: 5 f fi gif i ii' Justin Valdivia Erna Valencia Eric Valero Denise Vandekieft Flay Vandenbrink Brandy Vanderheiden Paul Vandevviele Lue Vang Flobert Vannoy Angela Vaughan Flicoi Velasquez Joanne Velilla Lee Ventura Van Vi Lisette Viera Joey Villa lVlichael Villalobos Jennifer Vinson Theresa Vinzon Judy Visque Edna Vista Hai Son Vo Jennifer Vogel Quang Vu Thao Vu Don Wagner James Walker Phillip Walker Adrienne Wallace Joey Wallace Flichard Walters Jennifer Wanner Jennifer Warren Kim Waterford Cynthia Waterhouse X 1 1:21111 1 H fl 1 l ,Q , .1..: .1 1 S I i l 5 ll 1- 1 ii I 1,1 1 llgl 'f 1 Eff 21 ESE llkl Q 1 315 1 3553 '1 Els 1 ll 1 552 age 1 1 . 11.1 1 1 l 1111 S fgi wi wg El lib.. 5 l N' Q1 5 i 35 5 Q X 1 EQ Q I 5 ti lx BM r if 1 I l 1 l l E ....... mama ,.,.,.1.,. 1 .,.:1.:.:. J ills ll i E 5 se wswaisyge 1111 5 112 2 H1 1 1 1 EEE , illl,li11-i11lsl if 3 111 le l 1 if 1,11 gl il ligi l 1 '5 lg l1 i11g1z5iEg2sa1g,,1 11 1111 all 1111 l 1 121 11 1111111 11 ilfi?111l1 11 lx 12 3 115125 g gi t1 1 il 12 1155222 3 55 1 i 5512 gili i sfigsl gl iii? X, X 1 1 1 3 -1 , I gl E, gill? 5g Sigh EE' if O 2222 1 1111 2 ' lr l lf f lggi iffe l ,E 51 153 511 f l 1 f g gi, 1 15 f 1 J l 1 1 s if si if 1 ,E l g 3 5 E 1 ll 1 : 1 1 l i 2 E I N 1 1 if 5 l J E 5 ,M ' 1 ,1 V M ? Nj ,1 Z N if -eisxsg 'M MM W ' W AW' H YV 21' ' gm B ummm E we 'M N I EBSQ sam -2:2args:-s::::::::::g?ggggggg f:'--'1 1 m igmm -a , ,,,, ii, 'g ,,,,,,,,,,,, 3? gwswg 2' -2-2'- 2 - -1-.1-1 k 5:,.A,1,,:, 1 ,....,. H ,, E 1.,1.i ..,- 1 3 :': ...:.. Qig'fjfQf1'lE'CE lzyil -,1., W YQ ' 2 7 f E: .. t .1 wrt' X, - fe .1 y K fl l'ii 'ag 6 'Q Iiiifiriiiff T1 15 'TW1 EJ!iam::EE:5EEE:Vl'?!EEE Wh E: :. 'I X 11 412 3 L1 11.. 3 X W 1 W gy H11 ' 2, f f ,QW 2' - 111:11 512 1 15 if som-ioivionesi iv I 5' ,i Wm g jf H451 fe 11 1 1 W f X? fgkxm xg lVlichael Watkins Curtis Weber Shane Weber Cary Weisz Kerry Welch Aaron West Jason Whaley Karen Wienold Arthur Wigand Pilar Wildey Q.. ,.-Q Sean Wilhelm lVlastisha Wilkins Jamie Williams Michael Williams Flandal Williams lVlatt Wines Janel Wing Christine Winter Gerald Winter lVlary Winterfield Michelle Wong Nw' Ernie Woo Christopher Wood Flussell Woods ' Y Timothy Woods Valencia Wooten Tammy Woster Dean Wrench ...Rv-Q Corey Wright Renee Wurtele Christopher Wyer Linda Yap Diane Yoo Matthew Young Kianoosh Zabeti i me X, f W N kr if Lunchtime is a welcome break from the daily rigors of schoolwork for lvlapiam Coppgay Pam Me,-Cado, and Theresa Vmzgn i - . isopnolvionss me V7 1' f w :wf:f.,,v E in lf 1 Q W ,W E iw ? 3 'Q 'W V12- M ., , ,H W , f Q Z if S f my f X f 4 Q My ' I J A , , t was a dark and gloomy first day of school. Suddenly, the clouds parted and a brilliant light shone down from the heavens. Amidst a chorus of joyous voices from the skv the Class of 1990, the Class of a New Decade , entered the school. The other students crowded happily around the freshmen, eager to welcome and befriend these wonderful new people. Actually, the freshmen began school in a more normal way. It was an excitingtime,a time of new faces and new beginnings, but there were no heavenly lights or voices. As ninth graders soon found out, being a freshman was not an easy job. One had to face the indifference and contempt of upperclassmen, all the while attempting to adjust to the rigors of high school life, and more importantly, to fit in . It was truly a giant step from junior high to high school, but most freshmen are glad that they took it, and look forward to enjoying many fun, memora- ble years at MMHS. 'SSS Q . f I r- l :- E Jeffrey Aase Patrick Abare Joven Abrenica Tesse Abriam Philbert Acda Josegary Acuna Glenda Adams Matthew Adkins Susanna Adriano Michael Agbayani Kenneth Aguasa Ajit Ahooja Tammy Aiken Charlene Alcove Domingo Aledia Darwin Aleiandro Nigel Allen Terry Allen Katherine Anamos Kristina Andrassy Frank Andrews Paul Angcaya Geronima Anoche Mark Anoche Matthew Amoche Joey Anonuevo Parwana Anwar Walter Araya Jeff Arns Ryan Arnold Daniel Arroyo Navid Asgharzadeh Michael Ashworth Victor Asis Troy Austin Mahmoud Ayoub Fernando Bacala Aaron Backer Dorene Bailey Michelle Bailey Greg Bailleul Jason Bailly Ann Baird Tony Baker Sandra Baquir Melissa Barker Vanessa Barker Bichard Barlolong Larry Barron Sean Barron Todd Bartholomew Aldrin Bartolome Jennifer Basco Beverly Basuil Jennifer Battaglia Keith Batteau -:---- . w E-, , Wigan FRESHMAN rf S' rx 12 1 K , .Ni x , X .vas - his :elm if Www. , xi . A Q :Qi Q K kg i -. it X 0 't f ig . -- KAREN i 2 5 M mga as gk3 as gg ri gi? f S 25 :ass - .J as-K 3' X EN QS! i, ,f N XX s , X 55 f f . ap: E :fri Isgs :gags . as fs . - fs: Sis-- . , A ' l i .... ii BENQ:-f 5: , has .fff k:2j1j53,5511 i.55:,z1x F ' i- 551: k 'fx-1: k ' sas-- . Mx .. t T ygzyt .. mills My I Michelle Beaulieu lx Jacqueline Beaver Alexisadrian Beck Chris Beck Mark Beck Frances Bell F in Santiago Beltran eeee i . Kirsten Bendall - 3 kk aa Paul Benga Carl Benson .... Q? . fi ,,... -. . T t Michael Bermudez ie a j exxee ,...,,,,', Marife Bernal iiek i iasai ieea T Tricia Binuya it Susan Blaisdell Melissa Blaj Jennifer Blase Anna Bloomquist Emmanuel Bognot F T Aaron Bohl Angela Bolano Lori Bolton Susan Bond Lorelie Bondoc Michael Borger Irene Borromeo Tianna Bostic Michelle Bowerman Class Of The ew f ecade aced with the monstrous 59 task of raising enough money for class activities, land eventually the Senior Prom etc...J the Freshmen are often too overcome with terror to accomplish anything. Not so with the Class of 1990 class council! Led by president Boy Jazmin and advisor Shirley Duchock, the Freshmen council sponsored a number of financiallyrsuccessful fundraisers, including candy bar, sucker, and sweatshirt sales, as well as. Goodbye Grams . This year's freshman class quickly established themselves as a short but spirited group of people, ready to work hard to make their high school years as fun and memorable as possible Class Council of 'ISQO consists of B Villapondo, Fl. Flores, G. Anamos, V Meintjes, J. Grey, M. Flores, N. Tran, T Tsui, K. Quinez, K. Nusco, E. Flubia, E Borromeo, B. LeVeau, Fl. Jazmin, IV' Correa, and B. Tran. it . Wig ' , i r T I i F EFRESHMAN w i - . 'W Z ::,,.. , if ,..., i ,,,... 22Q Y A w lzz.. Q B Va'7 B'n'0. ETS Daniel Brislin ttta Flolando Brofas L i a tiii Namsha Brown ilu' Francisco Bryant Keith Bucky Jason Buell Monique Bugarin Glen Bulato Bomil Bundoc Bandy Bunkley Bobby Burns Timothy Cain Trina Caldera Trebor Calloway Byan Camoras Brian Campbell Kevin Canivel Tara Cannon Donald Carlson Armando Carmona Susan Carpio Christopher Carson Philip Carter Leilani Casanada Bobert Casiano Rosemarie Castaneda Scott Castanon Carl Castle Philip Castle Greg Cavallaro Charles Cha Suzanne Chambers T Beau Champoux Lisa Chanover Troye Chasey Christine Cheek Yao Lin Chen tthew Chivers FRES ...M X gs V . I if E Q2 Xixwwsx spy N I 5X X XX X5 x X Si- is 1.1 , Eileen Bubia and Cecilia Thomason wait for Angela .Jordan as she gets her books for her next class. 1 5 Q X N XX X X X X XX R E Y X xxx si 2, is 3 Welsh Q 6 N X Q ..., ., -1 .5 -ff 251 :ssize- -' ,Q - , .. ,1 ..:e2'isiQ5g5i WW W, M fa s gt ' t 6 wig Ni 6' is - I .S . ..... if X g e t , J f' V 5 Q .3171 - -' - ',,- :sig f .. i r' ' S X s N Sw Sis, . misss sq, X X w x QQ -: -Nik . -. ..M:: -ss.. X Y N5 xx X X St X - 5 .2 .gg FRESHNIAN Crystal Choate Fico Ciuz Jason Clark Tasha Clendinen Eric Clifton Heather Close Christina Cole Erick Collier Brent Collins Troy Constein Doug Cooper Susan Cooper Dirk Copeland Kari Cornelius Anthony Coronado Liberty Corpuz Marilou Correa Garrick Cosio Cynthia Cota David Cottle Patrick Coulter Lisa Cowles Heather Craft Dionne Cramer Sean Crandell Genny Crane Brian Crawford Kira Croft Anne Croulet Mark Cruz Flobert Cruzen Joseph Cuevas Fieynaldi Cuevas John Cuff Wilbert Cui Eric Cummings Noel Cunningham Davvn Duratolo John Curtis Janice Cushman William Cusick Margaret Dalton Tom Dang Tracy Daniel Deborah Daniell Anh Ngoc Dao Terri Dao Eric Datuin Ralanda Davvn Melissa Deal Cherie DeCastro Carina Decker Fflachel Decker Evangeline Dee Anthony Degollado Paul Deines J Souvanna Dejvongsa ike, mom, donkey, car. Which of the aforementioned types of transportation does not belong to a freshman? Take some time to think about it. lPretend you hear the music from Jeopardy J Times up! That's right--you guessed it! The car. llf you guessed donkey, that's incorrect, because donkeys are available to freshmen in certain third-vvorld countries.J Freshmen do not drive cars. They never have. They never will. Consider the following scenario. You're driving to school in a near downpour. Windshield wipers at full speed are nearly useless as the rain pelts your windshield. The windows fog up, so you crack your window open. a flurry of wild rain streams into your car. Quickly you roll it back up. Dff in the distance you can barely distinguish a moving figure amidst the dark rainfall. You recognize a bicycle, which leads you to conclude that it is a freshman. He has no parents, no friends, no adequate means of transportation. Only a bicycle. He is the embodiment of Pee- Wee Herman. He is only one of the many freshmen who rely on the bicycle for transportation. You may notice him pedaling to school in the early morning rain. He has a brown stripe of mud running up his back. He is wet. He is alone. He is very unha Liezelle Dela Pena Marie Delano Joshua Delhomme Brett D'ELia Gene Demay Joey Desmond ND CHOICE rf' X. ,ax Amber Detmar Denise Devine Florito Diaz Flamel Diaz Phyllis Dietrichson Suzi Dik Derek Dina ma f Duoc Anh Dihn Beethoven Diosa Jane Diwa Jenny Dixon Minh Doan Gregory Dodd Dolores Domingo Sean Donahoe Sean Donato Andrea Dorame Leeann Doshier Jennifer Dotson Michael Doughty Scott Draher FRESHMANi L- l Thomas Du Myra Due Gregory Dum Renee Dunning Buu Tan Duong My Tu Duong Nhan Hue Duong Erica Durrett Jamie East David Eastlick Lamaar Edwards Don Elder Chris Elejorde Amy Erb .Jaime Escamilla Marco Escamilla Mike Escamilla Freddie Espiritu Anna Estep Bryan Eudy Matt Eyre Lynette Fairchild Marialuz Falsario Matthew Fang Xang Deborah Fanno Daniel Farias Jennifer Farmer Tori Farris Terry Feagin Joel Feaster Kerri Fenske Adrianna Fernandez Stella Fernandez Eric Fernando Melissa Feuge Kelly Finlayson Heidi Firestone Christy Flippen Lorena Flores Michael Flores Flodolfo Flores Flichard Folvvarski Michael Forrest Amy Fortin Brace Foster Angela Foto Lisa Fox Michelle Fragoso Kimberly Frame Nicholas Franchino Joan Friess Darci Fritz Holly Froide Tina Fryar Susan Fullerton Deborah Furlong FnEsHlvlAN Tina Gaines Michael Gaitan Julie Gallardo Fiichard Garcia Dominic Garegnani Hillary Garrett Maybelle Gascon Andre Gavino Geodi Geiger Dana Gelle Michael Gerardi Jeanne Ghannam Nicole Gibbs Jennifer Gilbert Fiobert Gitz Aimee Godoy Missi Going Amie Gojkovich Harrison Gold Flichard Gold David Goldberg Michael Golden Paola Gomez Monica Gonzalez Fiicky Gonzalez Heather Good Jacqueline Gormley Bruce Grant Lisa Grant Kimberly Gray Wendy Grear Joshua Green Alexander Greene Todd Grevvell Michael Grevvenig Jennifer Grey David Grindle N A Marie Guerrero Brian Guffey Jenny Gunther Fiicarte Guro Kristine Gutierrez Lina Habhab Miki Hackler Kareen Hager Kenneth Haines Michael Hairgrove Gorey Hale Brian Hall Megan Hallett Sara Hallock Steven Hamaguchi Misun Hampton Christine Han Ladondra Hancock FRESHMANi , .a. ,Xi Q 5:1 . .gg In QR X 2 K5 K sw X is s is x D Sgt 'Q 2 . ,gawk-i Denise Hanson Brian Hanzal Clinton Hargan Flobert Harris Stephanie Harten Gregg Hartness Felisha Harvey Christopher Haas Omar Hassanein Jane Hawes Joshua Hankins Christopher Hayes Patrick Hayes Christopher Hayietf Melanie Hedges Jason Heinitz Jon Helsel Leland Henderson Elizabeth Henson Rebecca Hernandez Redentor Hernandez Laurence Hespel Heather Hickman Joel Hickok Ed Hines Tu Ho Loan Hoang Loan Thanh Hoang Son Hoang Daryl Hobbs Craig Hodulik Terri Hoffman Lisa Holmen Laura Holmes Julie Hopkins Jacob Hough iFRESHMANf FRESHMAN: Jennifer Hubbard John Huber Kimberly Huggins Nicole Humphrey William Hunt Scott Hoot Hieu Huynh Puby llog Wes Irwin Michelle lshio Daniel Jackson Jeffrey Jackson Mark Jackson Shane Jackson Jennifer Jacobs Heather Jacobson Amy Jamieson Katie Jamieson lVlissy Janke Geary Jazmin Sandra Jerkins Nla Alona Jimenez Neil Jimenez James John Anthony Johnson Chris Johnson lVlichelle Johnson Timothy Johnson Troy Johnson Cheryl Jones Jody Jones EO Please et off the phone! Please help my child! She is a freshman at lVlira lVlesa High School who is addicted to the telephone. It has gotten so bad that ATST has become her best friend. At first, she did push button once in a while, but Pacific Bell introduced cordless phones with radios, a three- way talking system, and an answering machine. She hasn't been normal since. When she gets home from school, she abandons her homework and heads for the talking machine. l can no longer sleep at night knowing that she's still on the phone gossiping about clothes, friends, and heaven forbid . . . boys! Please help this freshman before it's too late! lVlight as well face it, she's addicted to phones. wal, 7 , N I I My fn ' - ' M 4 ,Of , X Lisa Jones Stephanie Jones Angela Jordan Angie Jorgensen Raymond Jose Stephanie Josett Nicole Juarez Kevin Kalen Gregory Kangleon Stacy Kasimatis David Kassebaum Morgen Kassel Walter Kearns Clint Kemerling William Kepner Tyson Kerr Joseph Keser Ngoc Kim Khuu Sarah Kim Michael King David Kingsley Franklin Klein Lyndee Knipps Kristina Knutzen Scot Koch Maribel Kohn Michael Kolarov Laura Kopczynski Crystal Krampf Dietke Krickhuhn Karyn Kuyper Judith Laberge Maricris Labrador V Jon Labree Willis Lacy Lani Ladou Lisa Ladou Stefan Ladringan Ruben Laguna Gabriela Lalicata Larry Laranang Tamra Lassos Suzanne Laubenthal Adele Lawlor Michael Lawrence Donald Lawson Guoc-Phong Le Ngoc Richard Lee Kenneth Leek Brian Lemay Kenneth Lemieux Thaddius Lengyel Terah Lenz Paul Leonard Betina Leveau Benny Lewis RESHMAN Timothy Lewis Stephanie Lian Laura Lichte Jamelin Liening Brenda Lieurance Robert Litt Daniel Lively Marivic Llamas Mel Lockhart Luke Logan Laura Long Damon Lopez Aaron Lovejoy Shavon Lovve Alfred Lozano Raul Lozano Jason Lucavs Eileen Lumbres Adam Luna Lisa Lungaro Jocelyn Lunod Phong Ly Rachel Lyons Michael Macarag Derk Macpherson Alma Madrid Arnold Magalong Norma Maldonado Michelle Maloney Richard Manley Patrick Manosca Efraim Manuel Veronica Manuel Carlos Marin Kevin Martin Lisa Martin Shannon Martin Dana Martinez Paul Martinez James Martorana Jeffrey Mascolino Dylan Mason Jeanette Mata Phillip Mathews Frances Matkovich Betsy Mattern James Mattern Donna Mattson Todd Mauger Arlino Maza Cary McBride Erin McCafferty Shari McCarty Faith McCaulley Jimmy McCleskey Robert McFarlane FRESHMAN fgy Yondell McGinty Jason McGowan Julianna McCravv David Mcl-lenry Cleminatu McKinney Davvn McKinster Mark McLaughlin Richard Meeks Vicki Meinties Christina Meisner Albert Mendoza Dlegaria Mercado Mark Merrill Aimee Mertz Noel Michel-Casas Charles Miller Corrie Miller Paul Miller Cindy Milligan Jeffrey Mills David Miilum Lisa Milota Michael Minor Blanca Mirano Joseph Mistretta Edie Mitchell Joanne Mitchell Marcus Miyaguchi Maribel Molina Alvin Montgomery Jason Moorhead Elizabeth Moran Jennifer Moreno Raymond Moreno Diane Morris Michael Morrow Fnesi-:MAN Vicky Nlostaio Pheng Nloua lVlarika lVloung Amkha Nloungvong Andrew lVlulock Mark lVlulock Timothy Nlungie Fredisdante Namayan Joel Napalan Aileen Natalaray Alfredo Navida Jennifer Neely Scott Newton Chuc Nguyen i H L...,.-A , Giang Nguyen Hoang NQUVSU Huyen Nguyen .Joe Nguyen K Linh-Ha Nguyen Minh Nguyen Scott Nguyen Thanh Nguyen Thuy-Tien Nguyen Tien Nguyen Tri Nguyen Tri Van Nguyen Trihn Nguyen Herman Niederschrnidt Ali Niknejad Tracy Noble Jennifer Norling Chad Norton FRESHMAN! What's Hot -- What's Not V . , X 5. we Y. l Laura Long decide to go for Naugles food instead of a brown paper bag. X-J I at X K K ,T 3 U y name is Andy, and P-l'm a peanut butter sandwich. My task today is to introduce you fine freshmen to the wonder- ful world of lunches. Face it, as freshmen, there are only fevv lunch options open to you. There is Taco Sell. Or,forthrill-seekers, the school cafeteria offers a menu created entirely out of natures vvonderfood --the soy- bean. The only alternative is the traditional favorite, the brownbag. Picture yourself the proud owner of a magnificent bag lunch. Imagine the smooth, rich texture of the peanut butter in your sandwich, or its refreshing, delicate- ly fruity jelly. Picture the crisp, golden goodness of your potato chips, or the luscious, juicy flesh of your shiny apple. All of this,and much, much more will be yours if you bring your lunch to school. i Gregory Norton Chella Novillo Kerry Nowadly Kimberly Nusco Bituin Ocampo Shannon Ochoa Jeanne Ogrodowski Felton Ollison Janelle Olsen Eva'linda Olvera Ngan Ong Sean Ornelas Eric Oropilla Sergio Ortega Michael Pablo Carol Pack Dale Packwood Nancy Paderanga Alison Padgett 1 Jose Paixao Danny Palacios Ines Pallares Alexander Palma Jennifer Palmer Michelle Papa Billy Parks Carrie Parks Dayan Parra Rhonda Paul Emily Payne Engelbert Pe Marlene Pellerito Fiichard Perez Margarita Peru Deth Phakonekham Khane Phakonekham Douglas Pham Duy Crystal Phelps Craif Phillips Souvathana Phimmachack Thanh Thi Phung Michael Picotte La Shonza Pittman Sarah Pitts Mary Plantz Michael Plunk Catherine Poehlman Heather Poehlman , iFnEsi-:MAN Louis Pollock Diane Porter Steven Potkonjak Anton Powell Derrick Powell Shannen Powell Patrick Powers Craig Prest Marjorie Purcell Uyen Guan James Guiett Matthew Guigg Kristine Guinez Melissa Quinn Yesenia Gulntos .Joey Guitania Michael Rafael Jacob Ralston Gerardo Ramirez George Randazzo Frances Raquino Hector Redondo Christy Reed Kelly Reeves Tanya Register Eric Reichenbach Philip Reily David Renison Dexter Reyes Beverly Reynoso Sean Richard Dana Richardson Stacy Rickman Keri Roache Deborah Robbins Leslie Robbins Steven Robertson Thomas Robinson Teresa Robles Kevin Robson Regina Rodriguez FRESHMAN '61 si elk Cheryll Jones, Nicole Humphrey and Marife Bernal wait for the bell to ring so they can go to their first period class Tonya Rodzach Christopher Rohrbach Aldo Roman David Romero Fiona Rondael Andrew Root Anna Roque lVlichael Rose Robert Roseboro Richard Roseth Jerry Rowlett Donia Royster Rachelle Rozsa Eileen Rubia Paul Rubin Timothy Rumph David Russ Billy Saberon Michael Salas Ronald Samaco Renita Samera Charles Samms Johnjohn Sanders Katrina Sannicolas Alex Santos Wilmer Santos Derek Sauls Kimberly Sawyer Amy Schauer David Sohlack Eric Schlafer Brenda Schlenz Rebekah Schlottman Stacie Schneider Lora Schwinck Catherina Scott Shannon Scott Joseph Sedeno Laura Sefkow Tiffany Selbrede Layette Seriosa Catherine Serrano Jose Servin Kevin Seyfarth Keith Shadof Chadwick Shafer Atul Sharma Brenda Shearer Todd Sheive Tenshi Shrum Kurt Shultz Serey Siev David Silvestri Omer Simeon Rachel Simpson Joannah Sison ' :S '-'H' -'L FRESHMA Matthew Sittmann Summer Smal Emma Smith Michael Smith Phyllis Smith Shedrick Smith Dawn Snell Joseph Soliman Ethel Solomon Jennifer Solomonsen Shell Sparks Marcie Speakman Andrew Spear Natasha Spillios Amy Spracklin Lisa Sragovicz Kandy Stahl Nicole Staples Jami Stark Lindsay Stewart Quincy Stewart George Stidham Alexander St John Ronald Stott Kimberly Stratton Richard Stratton Wendy Streule Michael Suarez John Sullivan Maylita Sullivan Deanna Swader Ricky Swanson Brett Swigert Cam Tat. Suzanne Tavares Aaron Taylor Erika Taylor Erin Taylor Sandra Tecson Sy Teisan Sandra Telles Jeffrey Tenen Lysley Tenorio Hong Thai Bee Thao Phonesith Thetsy Cecilia Thomason Antoinette Thompson Somsanouk Thongrivong John Thornton Sheila Tiangson Jennifer Timberlake Vivienne Tiqui Charlaine Tocco 'ine Todhunter 'rmon Tom Q s igantic metallic balloons sporting Garfield logos, ooey gooey chocolaty chip cookies, fudgy yummy cakes with fourteen candles, fragrant bouquets of flowers, huggable teddy bears, and Mickey Mouse party hats. Birthdays were celebrated in grand splendor at Mira Mesa High. The campus resembled one gigantic party with tremendous B-day decor. For freshmen, birthdays were extra special because they had finally graduated from being pesky adolescent preteens , to mature and sophiscated teenagers. Being fourteen meant that childhood was far behind, and adulthood was at reach. For many of the frosh going out in style meant celebrating with pizazz and a growing hunger for maturity. Unfortunately birthdays were only once a year but plans were already being dreamed up for the big 'l5 . Who knows maybe the Goodyear Blimp can be rented out? John Tomlinson Angie Torrence Michelle Toti Heather Tousley Gary Townsend Bao Tran l-lung Tran Minh Tran Nicole Tran Tuan Tran Stacey Trapino Richard Trickey Thanh Trieu Huong Trinh Christopher Tritt Particia Trolan Michael True Giang Truong Jenny Truong Kim Truong Teresa Tsui Joanne Tu Marisa Turner Roger Turpin Darlene Tuyay Nicole Tyler Craig Upton Shiela Valdez John Valenty Jill Valero Christopher Valle Lan Van FRESI-IMAN Vinh Van Gregory Vanard Christina Vargas .Jonas Velasco Roger Velasco Carmen Velazquez Gina Ventura Leilarose Ventura Ronald Ventura Andrew Vergara Na Vi Roberto Villalpando Michael Villareal Alvin Viray Rhuong Vo Somvang Vongphakdy Tuan Vu Bee Vue Kai Vue Vang Vue Peter Vukov John Wageman Denise Wahl Penny Waibel Christopher Walden Keith Wallace Susan Walsh Timothy Warner Monique Washington Alicia Watzek June Webel Cindy Weber Kristin Weber Theresa Wellborn Kiersten West Rhonda Wheeler Stacy Wiedmann Jennifer Wilborn Charity Wilcox Faith Wilcox Troy Wilhite Wade Williams Brooke Wilson Sally Wilson Shelley Wimberly Donna Wiseman Meredith Witka Tom Witman Michael Wood Edmund Woods Amanda Woodward Shari Worthen Jan Wraase Bee Yang Edward Yankovich y Laura Yorba FRESHMAN I W aff? Sheila Yosuico Gina Zaccheo Jesus Zamora Katayoun Zarrinkelk Kristi Zazas Candalee Zerr Marc Ziegler Alan Zonkel iff E i My ,fa yy 5 A , i rmiwwu, , ,,,,,, , q ,,,,, - B -iv-Yva -fi, xxfffi Y' ig V their departure from this educational facility deeply grievee me HWS and ige Ome UQ Dm b xx 'zfi 1 X931 ww ff F LJ Ill Uh smggalo WS 6 S 9 61' Oo 60' I O' '7zS'549 on 21 3 X92, I wiesix 9 YQQPX5. ve wie QW fxxa Oo Q0 ware! ' I ,J in Q, Aavfls 0 wan? oe qmer ii, Affect S hy, xcypai Tx' that qqouid time oh wen Nm-Q of .J fx ' - B a W 'dba COKHPXCYBA- Schboxs grae :av WU' 1 i Parkdaw SWQWSA yresidenga need 501' bv -ga!! Wad i 4 mica? io! bra ?2'1X150f'L ?? iiiiii iavvv of t Undef The A dim B25 ffvmim X002 . ' f .- dual the Bow' the MBA, i been? bak? xc QAfmouS- On Y'eb1ggQ0uSlY WWA Egiaster ffofggxfs decsignighiuidhavehav 2202 VG Q wi - una 'mes . ' g. i fi . We giwave tgzxg gauge Fam X it tknemcojgggi yeafS?90Q, Unified W here s,Dl-iey ev wo 'LEE gan. lan Wmbe in eiiigjbglxigo Wfxgose me SiixiSDiiKm?, S3323 2 SP i W1 'thi'-'29 men ' ' txifi iiit f X . an l f. J V K Exe Ofarg hugh Dm ,,, ouxd exp d L- awe' tear, Jefabe A 3 new fem ,gm 50 . 13911 xhaiwf' a year-Wm Baer mat, Y xanga Yag'5,daX6- , Xegysla. to up with 5 S53 Year Sched '39 88 V395-key' ukhotlw M'-5 45,0 e099 toi 95 .GS th grade . . 111 ' 5 3 ggfam . guinea , g3Y YN .X 6 ind, the qbegin Opegigqssason eiegfgftfezggie. ixgcqgl wcreagigngiefcent, X0 Yschooi' QQONIJXX WS a Ericson T4-gun .nba mdgg1t.S, Amit, N ,, , th6Yea. XW1 ,000 5 e i . 'Q , '70 S wh? WNW on rich High Schogsx W5 3 Aggie next 13 Wars 99 O05 Qsbfsfws, 1923 SerWpSff,L:swCii0 hT'ghlaeszgnawd t wW M ,pe 9306 Q' 17 1 ., d f K 4 . 1 , ' AIQI , L .1 X SbS ,7Q ' vi, OXEP 35039993 WMM if 009 owl: w i ,.,,.1, I .ivf 5,555 '.v, as 5 6 '17, ,I ii une QCD? teachers CGM Owbsfishs B xeavifig she? 1, l'1eart-breaking O7 3r'6 FRESHMEN EXTRAI W.. ui.. mmm .. W N 1-I ear-round'???? was the question of the day in December when Ed Center head honchos decided that Mira Mesa High School is just too crowded. lt will go year-round in 'l9B8, they answered. John Miranda was transferred from Bell Junior High to become vice-principal in charge ofcomputer processing and program development. What?...No freshmen? became the question at mid- year as Ed Center head honchos decided that the ninth graders will be located elsewhere. The MAFZGUEE answered our questions in its lead story of March 27th. Both students and staff expressed their opinions. Besides losing the ninth graders, 35 teachers were declared in excess. Although the actual loss will not be known until school opens in September 1987, the questions of who will actually be assigned elsewhere and what courses will be dropped was on everyone's mind. Disheartened. many staff persons felt helpless to change the course of events. Long time friendships among colleagues would become something to cherish in memory. Site seniority is not the name of the game where staff assignments are made on the basis of teacher-student ratios. DISTRICT SENIDFTITY is the name of the game in capital letters. So the most disheartened staff persons were probably those who had opened the school in September 1976 when it was called Mira Mesa Junior- Senior High School. Included in the list are six of the original faculty and staff persons: Ed Allen, Fiichard Clem, Lynn De Paul, Larry Elliot, Christy McMahon, and Ann Norman. VAYO CDN DIOS, NUESTROS MAESTROS 0 COMPANEROS. l'- df Seventh graders!...over there'?'? asked residents along the east side of Parkdale as they viewed the site of ChallengerJunior High destined to open in September, '87, Gone ut Not Forgotten JOHN MIHANDA, vice-principal, joined the staff in December. -' FRESHMAN WV and Tyner. H 2' .- nm' . ,,.. f 4 NC ff W, Keri 'Nelson 'wiv-3? :ff im ww, W , 1 ' 4, Ienette Deru len 1 'txt ' NQEQQQN ew -fb Best k ,-,. . :Y 'K 3 at K, A S K Q 5 A A Anderson '-aysn-ou-v-'- :rr-QOHP-A -R Y . RB' Writ eat . ' c ?:'3:l '?'F3-H Kee Vkleet NJ'- xr UTDGRAPH flg 52 ee 574 ig: if 19 gg E51 iiw E v 4 .3 5 E In ?,7i,M- ,V fx- f, ,V f f . f fag le , , 2-.sq gf A X ,Q fr 1 . 1 ' 1 X A E .ifa fe J .1-f.f?Z 1, wwf. , fflf W7 HW ,vfyf a h,,,, ,f .M ,Qfff J 'fc K' we'fzeju4Zl'04 AVVESOIVI ttention all you Marauder fans! Where do you go when you want to find excitement, fun, determination, strength, spirit, and victory? Join the crowd of Marauder athletes who showed their pizazz in various sports. The fall, winter, and spring sports were successful in league play. Many sports teams such as Varsity Football, Girls Tennis, JV and Varsity Field Hockey proved to be just too awesome when it came to winning. Many teams reached the CIF playoffs and won their division in the Eastern League. The athletes put all their strength into their sport and many weren't afraid to give it everything they had. Both fans and players alike were proud of the hot athletic teams. Massive Trophies piled upasMMHS participated in sport after sport . With the overpop- ulation on campus, coaches did not have any problems finding capable and dazzling athletes for every sport from A to Z. Other high schools in San Diego County would soon learn about the drive of Marauders. Marauder teams weren't afraid to show off their blueand gold and prove that they were just too tough! 2 N eg 3 E. Having to take a PE, class is part of every freshmarfs schedule. 3. Sindy Sopper spikes the ball while .JennilVloore coversforner. 4. Sara l-lailock and Allison Cecil .ff warm up before a vicious game. W ,,.,...,, W ,W ' 1 V I ,, , , aaaa. . ,,,,, l ,,,,. , ' W Y, wmgwf , 2, H ' , We , f , 1. ,, we 1? ' I , ' , M ' , 4 n,.3,qf. M, , W I Aww. , ' .iv ,,,. h, , is if fy, f 1-1, L V - l z A f ' Z f ,:g5,,i5W,: Q' 5 .M , 919 7, ., if WMV 1 , f' , V , H , .4 ,,,,, ,, , Z V , ' . , a ---' Mama-M-me ow , H '----1 , Q HQ we ,,,,, ...EE if ,,,,,., We-W .Mfg f -f'1:f:W lil y ,... ,igylll e ly -l.-- 'l. Essex Burton break I s oose for six against University City. 2. Tne lVlira lVlesa Football team consist of: T. Bourus, F. Saria, lVl. Harris, A. Falkquay, Fl. Slavey, J. Shevv, J. Orsinelli, Fl. Baird, E. Allison, B. Nelson, J Snyder, A. Floyster, P. Solomon, J. Souza, J. Morales S. Neal, R Hanson, E. Burton, N. Staples, Fl. Crowley. R. Williams, J. Bray, P. lVliles, lVl. Fleyes, J. Josett,T. Cumo, C. Logan, O. lVlarion, J. Cleavinger, Fl. Autos. IVI. Evaristo, J. Dualan, lVl. Pataesil, lVl. Haworth, C. Kosek, Fi. Drummond, C. Thoelke, IVI. Paraiso, B. Hanson, G. lVlanno, S. Glor, lVl. Casiano, J. Schmitt, T. Coffin, J, Pelak, T. Ramos, Fl. Rowe, K, l-ledgles, lVl. Jeanmarie, S. Stokes, K. B aynard, S. Owens, J. Bell, and B, Clem. fp A-,lwK.. Y 'Y II Ansnv FooTBAi.i. ow boys and girls say victory! VIC- OPY! With skill, strength, and stamina, the Marauder varsity football team sizzled on and off the field. They were determined to show everyone that they were just too hot to handle. The season started off sow with two losses, but with growing desire to push it to the limit, victories became the name of the game. Marauders faced tough schools winning game after game. The two hottest games of the season were Homecoming, where the Marauders slaughtered Henry 42- 7, and the crucial 'lil- 'IO win over Pt. Loma, which clinched the Eastern League Cham- pionship for MMHS. Winning was easy with the offense and defense working toge- ther in sync. Eddie Allison started off slowly as quarterback, but with the help of offensive players like Essex Burton, Pay Powe, and Craig Logan, he showed the team what he was really made of. The defense stomped all over rival offenses with no mercy. With key defensive players like Andre Falkquay, Mike Fleyes, and Patrick Miles, who said, The defense are wild animals! The Marauders finished with 4-1 in the Eastern League winning seven out of ten games. HOT was the word for the Marauder varsity team to prove to everyone that they were just too awesome! 13, C-luarterback, Ed Allison turns to hand off the ball. 4. Punning around, trying for a touchdown is Essex Burton 5. Pay Howe punts the ball to the opposing team. MM Opponent 'IU Madison 8 21 Serra O 42 Henry 7 'I4 Pt. Loma 'IU 5 Morse 23 ing Out 'l. Butch Hanson and Bill Clem stop the opposing team from gaining yardage. 2. Sean Ovven, Kevin Baynard, Joe Bray and Kevin Hedges show off their mental intelligence by gazing nonchalantly at the game 3. Eddie Allison goes head-on as he attempts to break through a couple of University City linernen. 4. Punt returner, Tom Bourus, eludes University City's defenders. VARSITY FooTBALi. lil ' 5. After a winning victory, Kevin Baynard, Eddie Allison, Jimmy Souza, Mike l-layvvard, Otto lVlarion and Craig Logan show that lVlira lVlesa's football team is iii. B. Jagade Snyder, bullform at fullback. 7. Flioh Crowley and Essex Burton run down the field as Fliohard Baird kicks off. :VARSITY FOOTBALL aking I In trid M , M1 ,V , 'ffl Vqfh . If I -1, A I H I 'KVM' ,AA N Z..W,.W 4, W , f, 4 V M.. ,, ww ' L ,Q sf 1 'Y A. , L . T 'K' ' 6 f , .- , , W - A W , ' 1 ,, ' ' 4 . f Q ,V 1, ,. 'VM I , Q n, 4 , . . J 4 ' M. 1 1 ' I f f' 1 ' 4 'Wi' I ,aff - 1 I .W 1, qc? .4 ,x4- 2 3. The Boys' Cross Country Team consists of: Crow 'I -back1Coaoh Lottermoser, S. Donahoe, B. Treptow, G. Moseley, J. Massey, E. Lewis, L. Henderson, S. Bramson, R. Ross, M. David, Coach DeFlisi, Irow 21 A. Montgomery, J. Flower, J. Green, O. Flores, G. Cavallero, L. Logan, Fl. Roseta, R. Walters, A. Flinn, S. Vanard. G. Bailleul, A. BOYS' CROSS COUNTRY l Tyndale, K. Lam, D. Parra, lrow 231 B. LeMay, C. Rohrbach, E. Reiohenbach, M. Pierce, C. Duque, T. Mungie, J. Moorhead, J. Fanno, Fl. Reiter, J. Farrell, T. Luikart,J. Mistretta, J. Spraldin,lrow 41 M. Herpst, J. McGowan, J. Ralston, R. Flores, T. Sheive, T. Dihn, D. Grindle, E. Clifton, and V. Mohair. 1. Ready for another race. Jeff Fanno, Greg Cavallero, Rudy Flores, Lee Henderson, Joey Mistreta, Rob Reiter, Jason Moorhead, Sean Ponaltog, Rich Ross, Luke Logan, Jacob Ralston, and Josh Green line up on the starting line. 2. Grant Moseley and Cesar Duque concentrate on theri consistent speed in another race. 4. Brock Treptow leads the way against the runners from Serra and Point Loma. 5. Brock Treptow slowly passes an opposing runner from Point Loma. 6. Grant Moseley and Steve Bramson are once again in the lead. 7. Jeff Fanno and John Farrel show the observers what running is all about. uff, puff, inhale, right. left, right, left, I want to stop, I have to keep going. I can't stop, only 37 miles to go, inhale, exhale. got a cramp, I have to stop, I can't stop, Iod, plod, incredible pain, huff, puff. almost done, left, right, finally done. This. Marauders, is the essence of cross-country. Why do they run? The whole thing seems so pointless--at the end of a run, they always end up where they began, and basically have gone nowhere. The substance of that enigmatic drive can only be defined in the minds of the fifty members of the Boys' Cross Country team. Coached by Mr. Dennis Lottermoser, the team finished second in theri league behind CIF winner Serra, prompting senior Steve Bramson to declare, We have nothing to be ashamed of. The team this year was very young, possessing only three returning seniors: Steve Bramson, Grant Moseley, and Brock Treptow. As a result of grueling daily road runs of as much as ten miles, the team placed well n all three major invitationals. Coach Lottermoser anticipates a successful season next year, with promising prospects such as Cesar Duke and Junior Vic Moharir. I BOYS' CROSS COUNTRY MIRA MESA OPPONENT O MONTE VISTA S O POVVAY 32 'IS MT. CARMEL 'I 4 7 UNIVERSITY CITY 21 SS CRAVVFORO S 26 MADISON 32 32 SERRA 7 7 PATRICK I-IENRY 42 7 PT. LOMA 'I5 3 MORSE S 3-IV FDOTBALLI old phrase year. This year's possessed more freshmen than ever before, while their opponents were primarily juniors and sophomores. The largely inexperienced players had a difficult time competing against these teams, but as the year progressed, the team showed dramatic improvement. Despite their E-8 record, several individual standouts and future stars were created. Freshman quarterback Jerry Flowlett demonstrated great ability, foreshadowing great years in the future. Mark Matzen and Tim Crone led a large, talented offensive line. Freshman tailback Don Elder also showed signs of big things to come. While the 1986 season yielded only two victories, Coach Blevins is convinced that the team holds great promise, and will provide a solid foundation for future Mira Mesa teams. 1 . Kicker Pat Abare attempts the extra point while Travis Arnold holds. 2. Quarterback Jerry Rowlett hurls the football as lineman Randall Crone looks on. 3. Patrick Barcelon sacks this feeble DB fore big loss. 4. Flunningback Don Elder sweeps right for a beneficial gain of yardage. 5. The Marauder front line awaits the snap of the football. '-'-'W' ,,,,,..w.,......-iq--0' , 'inf :MW MW iww 9381115 .vmwww an , ,,-, Wa . wi ' s M, , if 3 ' ff ,M vs nk 5 W 311 if .w I. K f A A Q W ' fu 4, PW WWW 44 ya M' if 'N' gm' Eg' if M' fl Q M fain. it M R 4 , if in 316, ng W H ,fr Y, A , M , f fin , ,, my X M, V' gf Wd ' f PK fx f f'r, , f M 1 ..., W ' Mfr W .- , , ' V w Y ,,,,Wm:, ,,,, , ' I 7 1 ff - a f f , 'f-- ' ,A 1 5,, MZ 7 I - . A if ' 5, W' ' W f L ' ::f 3 rf , 'nf Ja 'W I Mkf ,lem '4 jk? W 4. 5' WWQ, ' ' f ,J ' r .ef ' 4 ? fs f ' if V -K fm Q' an a, Man my wi W WMA mm , 1 ,fm f, , ,QW M ff' ,M W dv. 'Q The Shap of Excellenc 'l. Karen Rowell, Lauri Borck, and Denise McFayden run in style during a Cross Country workout after school. 2. Rhoda Cadaing, after being savagely beaten by the Serra Cross Country team, is carried off the field by her faithful teammates Karen Horowitz and Leah Rugnetta. 4. Only three more miles left until l can throw these old running shoes away, says Julie Sefkow. I l 4 V 264 f' ,tl A f gl Zwf ft MIRA MESA OPPONENT 20 HENRY 40 15 MADISON 50 16 MORSE 45 31 PT. LOMA 24 Lowest score wins ,GIRLS cnoss coulurnv -1-l F -.,,,l . dr ff, 3 Q A+' mb ed by such superb runners as Denise lVlcFayden, Lauri Borck, Karen l-lorowitz, and Nikki Zimmerman, the Girls' Cross Country team once again proved to be one of the strongest in the League. These outstanding athletes, coached by Dr. Terry Gregor Homiston, put in long hours of training to be the best they could possibly be.The work definitely payed off, as the girls' were undefeated in League, except for a close loss to rival Point Loma. Unfortunately, the team did not take this year's Eastern League Championship. But next year, with a combination of strong returning talents, including this year's outstanding freshman, Debbie Fanno, and the hard work and dedication characteristic oftheteam,thelVlarauder girls should once again be W Eastern League Champs! if 4 Z l 'Tw 'A ,, x aw f 'V' 'Q ' ' it- f V M22 f ,ffm 3. The Girls' Cross Country team consisits: lfront rowl Dr. Terry Gregor Homiston, Lauri Borck, Denise lVlcFayden, Ingrid Stabb, Nikki Zimmerman, Valerie Kolk, Daren Horowitz, Debbie Fanno, and manager, Cristina Avakian. lmiddle rowl Fran Flaquino, Margarita Peru, Karen Powell, Joan Evangelista, Shelly Wimberly, Sara Kashima, Sarah lVlartin, Jennifer Battaglia, Rhoda Cadaing, Fleina Flodriguez, and Tisha Ludwick, ltop rowl Jolene Toler, Juler Sefkow, Desiree Lilyroth. Leah Hugnetta, Eva lVloog, .Janelle Dlsen,TheresaVVelIborn,TammyHouston, Michelle LelVlay, Wendy lmm, Olga Florez. and Cathy Serrano, 5. You can forget about running another mile. Nlrs. Homiston, replies Valerie Kolk. 8. Joan Evangelista displays her winning running style during a tiring workout on the lower field. E 1GlRLS' CROSS COUNTRY 42 his year's JV Girfs Volleyball Team showed dramatic improvement over last year's squad. rising to forth place in the Eastern Legue. Coach Carol Stowe skillfully drilled the girls in all aspects ofthe game. creating a unified team which played well together. According to Coach Stowe. the 14- member team was the tallest and most aggressive in many years. Featuring the talent of sophomores Heather Berner, Kiko Flataj, Debbie Minihane. and Grace Boland, the team worked its way to a respectable 9-B overall record. Says Coach Stowe of the team, They dominated the net with their blocking and hitting. lf anything did get through, the fisty, quick back row was there to cover. We wiil have a lot of depth and experience returning next year. if i , . l- of -,,,...W-l 'l. Akilco Fiataj and Heather Berner lump up in an attempt to block the ball from the other team's spike. 2. Debbie Nlinihane gets ready to give a powerful serve to the opposing team. 4. Grace Bolano and Leonora Lambert are determined not to let the Tigers score a point. 5. Jocelyn Poblette gets ready to return the ball as Grace Bolano Candalee ZEN' and Carrie Carambus back her up, 3, CandaleeZerr, Jocelyn Poblette, Parks, Wendy Owens, lVlaIia and Leonora Lambert take a before going onto the MW M , Q is W Y X ,, f w 'Q I X M if ,'f ,, ff 4 M W ,,... , fy Q' 1 UW vm 53 ,z MIRA MESA OPPONENT E HENRY 3 2 MORSE 3 3 MAOISON 'I 'I PT. LOMA 3 O SERRA 2 2 HENRY 3 O MORSE 3 2 MAOISON 3 E PT. LOMA 3 'I SERRA 3 'l. Team captains, Torrie Cababa and Jenny Moore wait with anticipation to win while being told the rules of the game. 2. Keri Spelhaug perfectly sets the ball for a spike. 3. Sindy Soper and Eula McKinney use their blocking skills defensively. VARSITY VOLLEY BALLI ith spirit and dedication, the varsity volleyball team completed a not-so-successful season, placing last in their league vvith a 'l-9 record. l-lovv- ever, there vvas a glorious highlight of the season. The Marauders defeated top ranked Madison in a stunning upset. Coach Ronnie Olsen enthusiastically managed the team and helped the players to vvork together as a team, led the girls as the Most Valuable Play- er. This year's volleyball team contained several junior standouts including Jenny Moore, Sindy Soper, and Eula McKinney. Coach Olsen attri- butes the team's poor record to the fact that most players vvere unex- perienced. l-lovvever, with nine experi- enced juniors plan- ning to return next year, and only three seniors leaving, the team is expected to dominate in 1987. WN f 5 E 'QQ J -4 rg' ar' hzst UFT19 HW the ten th e f M ff MMH9 OPPONENT 2 -V , . ' ' - -' N ,ww JiEgiaeiZ5QQ6w3gggeeQi QQ: Z5E5eaQQ2e55?Qig.ps V l' fffa,m41HwfL: v,,, uf' V M7 Miff54ffil':fkl,H 5'Hf f T' S ' ' V .f .. A wi fi ' 'V .-4 5' lx'5'fflfx : f'a5 Z5h1f ,W2M'fk: fi 'iI'H,Z'W ' lf 1, ,MIQM 'f i ' V 1 f I' w A ' ' A H lg, - f H .. -I 1 ,il ' ' I ,413 4, , , , ff,,,jg,j , 5 ji i I f l ,W . Q - . 1 V... f + A V' V, , V, I F V H in .f ' 2 5 A f I , A l 5, , X ' 4 ' A , l W A lv ' 5 ..,.. 13 , ' . V K ' ' f 4' l' W .. ,, V- ,,g ,.., W VIAI ' f , lg ,,fw,v,,, ,fax V' f ' .4 -' ,.4.,,fA.m 'I , ,, .Wy '- 1 ,,,,,, , .,, :yn,:g,5,m' , E MN A. 5 IE 25 me wm-W.- 1,5 QW A .M M, N,.. W- f ' ,W lil fs WM--Mvgwt A-, , 'Shame M, r 3 ,f ,,,M, we- ,,,,, Ma l a WE, ,'l'M alm 1 sEnnA O 4 elsnops O o 9 eoNnA vlsTA, 1 1 SEHHA ...nl l P? , lVleks Hackler plans mental strategy for her next move. 2. Cheryl Ashworth attempts to pass the ball, 3, Kelly lVlL1rphy battllng-it-out. 41. Amy Goddard hostles to save the ball agaznst Bsshops. The .J.V. Field Hockey Team conslsts of: ltop rovvl VV. Greer, B. Greco, C. Ashworth, A. Goddard, S. Hallock, E. Batoyon, lmeddle rovvl lVl. Duncan, J. lVlorgan, K. Clark, P. Azua, lbottom rovvl D. ' Wahl, K. West, and lVl, Hackler. JV FIELD HOCKEY A i fi S f' 5 R WEWAEAZQ 1 Lf 1 M if , - 'Y' . as wk , 3 , E f'L - W' i ik ' Q V LL wi. i ' , A gf B if ' A ALIAII M I 1 if LV : 5 1, W mg H VZVV ,W ,H Q Q 52? aa ls, 1: . :NW lb HL 2 1 Q fy f .. S. .W x qs ww .Q , f ..,, , 1--Qgzsiii, 5 ' J if A ' , f f'a,Qf?L W, Th fi jk 1 i 1 ,,, ,V , V fha ' - M new V S f Q was ,Jw uf, ' ff - gQ Y' ! fa fi J.:-E5 7 V, Q W 5 ff? I f Q V f 452 ww, W V A i f-f an , 5 M' M fs Q mf, I v Y I A b 6 , . , H 5 ,Ziyi 4 nA f A 1 ' + ' , V :rw 4 .W ,.... I V 2 Q A-2 D ' ,Z A A,,? A4,V 5 ' f A Q ,,. 1 if ....,V 1 1 f f 5,937 M .f 3 h 1 f L ,, i1Mw5wfwm'z fi 3 5 X V' f i M A Q-it WWQQQ 4 2 1 i 'Q Q V - ,, Q 'AAI , ..,.. ,, ,.. Q f E 1- 'Q ,V I 2 ,K fy ,,,: K i 3 1 ' 5 , M41 'w . ' , i f 1 Q ' 2 L f M b ' F ' , . 3 E Q, 1, 3 1 3 , 1 5 ,es G N E max y if i I , i K ,,,, f JQwx 5 gf ? dkjy' 5 , ,, Ja j,j,,,,-Q M. - ,.V ,A. W, A ,A ,,,,,,f , L.: x,, ,,W.W...-Q WMWW.WV ,,,f f W ' :wi 4 ' I 5' 'Z f ff I I Q T 4Z,,'1f ,,,, i A , ' 31 M Q . 9? AA ,wb 4 1 ,A,V , Q Vg X, 'Z 5 L X o xf., Q3 v . ' 'sk we D 1 :Iii . WQJ Vin ' 5 Tgifgf' fm W , - was in gf 1 7 54,5 if I MQ A ,,,W,g,y:g' .a 'Y I ilfygl If v , 1 'I, Anna Mendez positions to take a hard hit towards the goal. 2. Kristen Logan, Anna Mendez and Sheryl Berg assist each other in attempt to get the bell past the opponent. 3. Anna Mendez successfully acquires the bail while Marydane Bernal races to receive a pass, is g if 5ffg' Mgpggfffo MAUf3UNLiff2iisisi c BSSHOPS i f A 9' K BONITA VISTA,- 1151, c EL CAJUN f K 3 EJ 'i 4 Ci 1 O 9 Jog U 2 U of MAomoN'Ui V V, A fi W I M, 4 W 5 Y we S E ,W f if it fl s 4 2 My ig he 2 571 Q A X ii ggi, 4 W Q f w , f , KW , K, me WW W 'Vx Kiwf X M ,, W M Q www 4. Allison Cecil and Jenny lVlique attempt to distract the opponent and prevent ner from scoring a field goal. 5. Janel Wing and Christine Winter race the ball before the unprepared opponent. I FIELD HOCKEY Missi Boll displays perfect serving technique. Jenn McEIIiot and Mandi Smith anxiously await for The team raises their hands because they're sure. Nivone Hoang strides to make a perfect return. GIRLS TENNIS ,i gk 0 . ' r 5.3, Ig, -i' ' j f ' their opponents' serve H V ith devasting overhead smashes, incredible ackhands, stupendous los, id superhuman agility, the irsity girls tennis team :ached new heights in the orld of tennis. Equally iportant, the girls looked Jsitively smashing in their innisuniformsandvverethe ivy of every tennis player in Juthern California. Under ie expert leadership ofco- aptains Mandi Smith and ristin Block, and Coach aslie Mack, the team had an most undefeated season, sing only to Patrick Henry Weir first loss in 3 yearsl. ie squad was co-champion league play, and sent averal players to CIF Jmpetition. Although the sam vvas young lless than alf were returning varsityl iey more than made up for in spirit, determination, and ard vvork. Due to their forts, the girls again intinued the legacy of a iampion MMHS tennis iuad. As Jenn McElliot cquently summed up the eason, We hit the eastern ague with our best shot, id again came out :torious. 5 7 4 75 S 45 7 MM 4.5 75 75 Patrick Henry Madison Point Loma Serra Morse Patrick Henry Madison Point Loma Serra Morse OPPONENT 4 'I 3.5 'l O i 4.5 1 25 4 O 5. Kristin Block concentrates on the ball while hitting a winning retu TTI. S.. Back row: Karin Dickerman, Heidi Pelak, Carol Gabrielson, Missi Boll,..lenniferWiIson, Kerry McBeth, Rachael Simpson Middle row: Anne Hurley, Mona-Lisa Henderson, Tenshi Shrum, Kirstin Snyder, Jenn McElliot, Mandi Smith, Kristin Block Denise Hansen. Front row: Lori Coyle, Gelyn DeVera, Nivone Hoang, Miss Mack, Britney Ehrlich, Kim Lofft, Melissa Fuege and Laura Trent. i l GIRLS TENNIS 'l. Shed Smith casually runs down the court attempting to make a basket. 2. Jerry Poseboro concentrates avoiding the other team from getting the ball. 3. The JV Boys Basketball Team consists of: G. Balaoing, J. Beach, E Cummings, S. Gemmell, P. l-lastey, J. Huber, G. Kangleon, T. Navvrocki, S Owen, A. Povvell, J. Floseboro, J. Howlett, S. Smith, S. Tagaban, P.VVaIker T. White, and M. Zeigler. NIM Opponent 42 Morse 50 47 HGUFY 46 55 Pt Loma 55 41 Madison A3 54 Serra 59 51 Madison 43 53 Morse S7 55 Henry 56 59 Pt Loma 49 Serra 51 50 BOYS JV BASKETBALL Z ' 2 -- wmfmwm,:mwz,wzwavm:.wmmw, F, l Just out of l'eael1.,.SCaLL ClllTTITl'lTQS eboote a basket as IVlacl:eOm players are 'H me vevge of blocking. Q. Dawfl Lee Sbovva bas skulls agalrl5tlJmlveV51Ly Hlgll. 3 Tal lVl:ller scares al1ULllel'vv'rw'mg pam for lVl1l'alVle5a 5 Flay Rowe attemms LO L b all we ball at Lbe Hwrt ol Uwe game E. Jw Navvvack' takes anlvamnage Lo Score amut,llel'pa1mLf0r Mira lVles3a Sabal, amd lVlanageli VARSITY BOYS' BASKETBALL 1 41. The Vavelty Boys' Basketball Team Comelets Of: Coach Curwmngbam, S. Cummmgs, T. lVlllleP, J. l-lagadom, lVl Elcl1eV,C.Sbsrley,D.Tbomt0rw,FT.K bb R FZ N 1 w f - e e, , 0vve,J.NavlnOCkl,J.B0ard,K.l-lumbbley,S.Smltb,D.Lee,Fl.Dang,A I! on V2 Y 4, W ww, I yy R 53. NINI Opponent 44 Morse 75 553 Hemwy 53 L17 PL. Loma L13 L15 Mad 5011 F35 53 Serra 4111 75 Maciesom X3 39 Morse 38 55 Henry GO 63 Pt. Loma G5 73 Serra SO GVARSITY Bovs' BASKETBALL 5 We H 419 V ,- MEM . 'WZ J ,...,,,, We-'ve got e goldmine and it's so fine. We've got a goldmine and its on time. Mira lVleea's goldmine is lust too fine. Winning rein or shine. our beam is divine! Our golden team's story eo fer: he seconds tick quietly off the clock and Debbie Ivlinihane is pressed to make a move. The crowd chants wildly behind her, the shouts of Coach Elliot drowned out by ,the intense noise. She mueteceqoickly! bk',7-ki.k great eleme the ballicthfeeighiithe hoop, iehalzlieivifig the backboerdg eoeo eeusing glass to cflyf every- where. p OK, Akiko didn't break the beckboerd, but the girls' JV Basketball team was able to sueeeesfully vv o P k tqo glee the r'. G o neideriienifg iiei'gi tenant only founipplieyers had experienced theirdl-E record was evidence of the team? ability and potential. MVP Debi Minihane felt that everyone improved a lot. and worked together. Key players Diane Yoo, StaeeyKesima- nie, and ilpi Benny Townsend igie f helped to me ke s a sucoeeelf ieie ' g in 7' ,W 45 ,HS ni! , A Q- ' W ani 4 milpa WIUIAI ga.: i s H !VIV V, , 71545 mifffff , , ,,,, -vw mf . 5 fi , I ' 1'f2S'V V , fw4gff,f,Xr.QiWq ,,,,,. 43Q,,,4,,,,,,2 N., ,M,-v,,,.W,w,f, 1mwQqww:.Q, f' - ' ,J -,,f,,,4 3.,.2,,1 y' ,4:,:,Q,, M f H f - M- X 1 ff AW ,Ms-rf fx 4 V , 2 my? 4 W f 2:1 3 i5LULHHf nyg t.sf4nnwr1rLgsonnrmponwt Lowa P , ,,. X H a ny Opponent MM 34 Morse 46 38 Henry 54 48 Madison 41 B7 Pt. Lorna 23 33 Serra 53 52 Madison 37 36 Morse 49 93 Pt. Lorna 44 47 Henry 59 53 Serra 57 1. Carrme Carampas stops snort as ner Morse opponent gets avr. 2. Darla Vaughn strateguoally passes around ner opponent as Leonard Larnoert anxwoosiy looks on. 3, Postsonzng for the free-tnrovv. Mary EHen Moore hopes for a DO:nt 4-5-B. Darla Vaughn and Carrze Cararnbas demonstrate ..., I . . fl -- ,y,,... , GIRLS vAnslTv BASKETBALLE X 'V'V'A in L4 w It if Q 45 . W Mm U 'S--3 y H , f Juli W my .M The Freshmen Fleserves consist off lfirst rovvl B. Bayley, D. Boyett, C. Carson, K. lVlartin, G. Flandazzo, FQ. Turpin, Fl. Flores, E. Trento, C. Vergara, L. Guevarra, J. Moorhead, J. Lucvas, lsecond rovvl Fl. Legaspi, A. lVluIock, A. Roman, Fl. Oropilla Hamaguchi, K. Kennison, C. Hoang, D. Russ, IVI. Grevvenig Sullivan, lthird rovvl Coach Bakevvell, D. Cox, S. Donahoe, Fernandez, E. Valero, J. Saludares, A. Jahn, P. lVliIIer, J. Aase, Eirislin, B. Litt, G. Cavallero, ,S. ,S H. D. l Q 5 'ii 1. Oscar Flores shows his wrestling skills while the other team's member tries to get out of his grip. 2. Jay Navarez takes a breather before going down into the referee's position. 3. Shawn Johnson uses a wrestling manoeuvre to gain an advantage on his opponent. 4. Matt Fisher legs in and tries to get his opponent onto his back. F-Man- . . .. . ' VVV- 'ry' mm W VVVVV i JV Wrestling consists of: Ifirst rovvl C. Nguyen, Fl. Velasquez, 1 'WM W ' Ai U M ' Z f 2 'V W N Y W G. DelVlay B. Lamar, IVl. Fisher,S..Jonns0n,O.Flores lsecond rovvl i 1 i Nlanager-Nl. Barker, D. England, J. Navaraz, B. Bamford, E. Villanueva, lVl. Watkins, B, Detmar, E. Payumo, Manager-S. Wirnberly, Assist. Coach-lVlike Garcia. MM Opponent 35 Henry 35 49 Morse QQ 52 Madison QU i 43 St. Augustine 24 35 University City 33 49 Serra QQ W 70 Pt. Loma 5 l JV WRESTLING VARSITY WRESTLING Tuff Guys fiiiiy? 3 if if 7 . .wwf ...wig T mz.. ii ,im ,X wigs? hen somone mentions vvrestling, most people immediately envisage the savage, merciless l-lulk l-logan delivering repeated skull-crushing blovvs to the EOC pound Death-Beast vvho despite the fact that he has received enough beating to kill an elephant, shakes it off and retaliates by jumping on l-lulk l-logan's spine for three of four minutes. Either that or tvvo Japanese sumo vvrestlers svvatting each other vvith theirstomach fat. In reality, true Wrestling such as that practiced bythe lVlira lVlesa Varsity Wrest- ling Team, is a very civilized and competitive sport. Finishing second in the Eastern League with a E3-l -'l record, the lVlira lVlesa team sent eight vvrestlers to the CIF finals. Among them vvas sophomore lVlarc Santama- rea, vvho emerged as the league champion in his vveight class. Senior John lVledina, junior Todd Coffin, and sophomore Jeff lVlajor each captured second place. Coach Talbott vvas very satisfied with this season. and has even higher hopes for next season. Nearly the entire varsity team vvill be returning next year, and the J,V. team holds several valuable prospects. i The Varsity Wrestling Team conszsts of: lback rovvl Coach J. Talbott, T. Troncolt, E. lVlartineZ, C. Logan, T. Coffin, lVl. lVlatzin, J. Robb, Fl. Guanzon, L. Hendrickson. lVlanager A. Pelekis, lbottom rovvl Nlanager S. lVliIler, R lVlarlovv, A, Salazar, A VVimberly, J. lVlajor, lVl. Santamaria, J. lVledina, r. Bundoc. and Manager S. Scotzin. MM Opponent 42 St Augustine 33 414 Una Czty 93 48 Selva 95 28 Patl'1ckHenry 31 53 Pt. Loma 19 31 Madison 94 32 Morse 32 'I . Walt Don't leave me out. I'm Easter n League Champ' says Mero Santamarza. E. Let me go or eIse.,. exoIa:ms John Malo: age nst h s Madsson opponent. 3. Lee Hendrsckson shows has svvzft vvr est! no techn ques for a hundred cheersng fans. 4, Watch out Hulk Hogan, John Med na s out for the k II VARSITY WRESTLING 'HR was Q- , i. yf rf, ' MQ ,, f , ,rty ,, f WM f Ax 3 6 Q ef'-W' ,MM,n.,...,..A,.,,V , wma-U ,,,Ng,, , J-1 Awww. -wwe: . - -2? .......... .. MM 4. The Boys Varsity Soccer Team consists of: lback rowl R. Baird,J. Lewis, D. Fugate, M. Demko, A. Bushby, E. Sealy, V. Lopez, lmiddie rowl B. Burns, J. Masculino, T. Kincade, C. Kline, K. McDonald, S. Stokes, G. Smith, M. Fiuiz, lfront Fowl T. Valdez, S. Ward, P. Gelvezon, T. Shepich, J. Fiago, D. Cook, and A. Leven. 5. Paul Gelvezon and Mike Demko lace up before warm ups. K Opponent Patrick Henry 1 Pt. Loma 1 Morse '1 Madison Q Serra 3 ' -IIDYB SOCCER .. 'r2-555222213 :.., iff. I-Q Q,-H H ' 'ffEjfjf:fffZ'f'f :,.,.., H ,,., ,I-,,g.2:-za,1s::g:f'iQf52Q-me .:-,: ,A ll' 'tj ,,,,:.g 33-T' H we eip hmm e 3 3 1--5 -E MMFWM' Tig, f A' izi' 5 f': V G ':A 'VA A'A 'V 2,: WM W Emi -V :AQ1 A2' '1A M. mf W. d J d fm J :--: '..,A:-f: 1 A:'Z A ' .-..: . ,AA.' -:-:1'-: in - M ar ...,f IPAIA ,IAZII M . fe f naw r 2 1': f '-15 - Mmm W ' ': ' ': : ' : ,gr A,.., M g W f if f ,,, f V --v-,f: t tf .,..:: E : ' M' J H J .,.,.,... e - J J N J le ., 1. 'l. The Girls' Soccer Team Consists of: Coach Nlaroelle Benniamin, Fiobert Paterson, Florida Tiqui, Jennifer Gee, Nay Garfini,fSteoheinie Hargden,wf3,heIsea Schissler, Jenny IVIoore.-' mgfgtanf ooffyfsheryi i.Ae egrgginaneifnowin , Jge'm1MecEIiiinnr, Ei-in Paterson, Khrista Goinn. Nliioheile LeM-ay,'FihondatiPaU'I. Sandy 'N G Mills, Christine Winters, and Jennifer Swanson. 2. Going in iiiihyeylh-kiAII, Nfiohele Lefiflayiii-,attaokysi a' f member of an oiioosingiteam, 7 W A'ir,i ' ' J 3. Rhonda Paul attempts a 50-yard throw form out-of-bounds. fe ' X 5' 5 Sa. Jenny Moore makes a winning goal during a game against: Point Loma. fm GIRLS' soccsni fi' . , , v NM, ,A , sm. O 3 2 1 1 Q 1 0 J ' 15 4. A halo of light shines upon Jennifer Swanson as she attempts to kick the soccer ball. 5. Erin Patterson takes a break during a vital soccer game as Jenny Moore watches. 6. Jenn McElliot, Jennifer Gee, and the Girls' Soccer Team prepare themselves for and upcoming game. MM Opponent Madison Wm Henry win Serra win Morse Wm UNDEFEATED!!! lGIRLS' soccen f iii 22 f 3 2 3 5 5 l55Z::1.4ax wil:wi9Sf:ISiw1r4i:4-1Jffinsfeek-1ma55:L::e''12 gvlwliiiggffmliiflflfi'NTT'wff?5S,5?'3?f5f14lf, '- 'Jii5sfffLQg:gaW:J.f3.Lmzsmzzazresgsxisszkzffs :gggwlighggggfw , w:w.wmQQ,:::ffm W w,,::rsfm.,v:g:f fx.::v:wWg:, Wfzssqrasezsx,-wwggl l : , ,,f On The Road To Success 1. Audie Sabal smashes the baseball really hard using, by the way, Eddie Salanga's bat. 3. Safe by a mile, Patrick Cheek slides gloriously into third base. 4. Pondering his options,ln midairno less, Travis Arnold scans the infield, using, by the way, Eddie Salanga's glove. 5,5,7. Eric Estey demonstrates flawless form in this stop-action pitching sequence. BOYS' VARSITY BASEBALL l ith a deafening crack the curveball struck the bat of the muscular Marauder and. was launched into the air--past the outfield. past the fences. and into the parking lot. As the batter triumphantly rounded the bases the cheering fans went wild with joy, for their Mira Mesa Varsity Baseball Team had once again been victorious. The other team sat sadly in their dugout, some players sobbing quietly into their mitts while others sat still with shock, for they had been horribly destroyed by the mighty Marauder squad. This victorious scene promises to be a familiar one this season, as the MMHS Varsity Baseball Team appears to be the strongest in many years. With the devastating pitching ability of Mike Eicher and Eric Estey combined with the brutallyl consistent batting power of Ed Salanga, Karey Humphrey, and Mike Eicher this team has the ability to strike fear into the hearts of even the braves opponents. Flanked second i y the county by local newspal pers, the Marauders see destined for their thir consecutive Eastern League- title, and possible C.l.F. glory. Under the expert guidance ol' Coach Larry Elliot the player have practiced long and hard t reach this level of excellence putting in countless hours t develop natural talents an hone skills to razor-shar perfection. The road t excellence has not been an eas one, but the Marauders see to have travelled it well, for a Ed Salanga says, lt's going -t be tough, but we'll come out o topl 2. The Varsity Baseball Team consist of: lfrontl A. Carrero, K. Humphrey, A Sabal, E. Salanga, P. Cheek, lmiddlel E Estey, E. Olsen, Fl. Somsen, A Maldonado, T. Arnold. C. Klein, B Slavey, ltopl E. Sealey, V. Pico, J. Souza M. Eicher, E. Choquette, and P. Wade J. 'Wm ,I , we 'f . v ffwgwliif f gi V ,V 1 wg? I m 1 3 -ff A WH, W-. .ff -4 , ,,,, ,J 'W M W? W ff www W! f ff Q X ffmwwww E jyigiif? 14,5 W? KMWWLA 'mi' 5' H,,f'i!,fk 'lf' jUiis,,,'fl' Ali, 7 H fl H ,, wi, i 5. V, Y, V, 5,7 ,mn l'aiZef'WhMv'fe,,..lls, 'wifi ' 1 I ' lllll , V fff, A- Z fl LM: K' I sw The J-V- Baseball Team Consists Of D. Tvler. B. Struhar, H. Knudsen, E. Niarninez, D. Powell, R, CTTETTTDOUX. S. W0ld6r1. -J. Dunr1..J.VaIenzano, D. DeLeon, K.Shah,J.StaIIo,S.Br'igham,A.Futo,and Lammers, J. Martin, S. Smith, W. Stetter, Fi. J, Gr-een, Hastey, H. Williams, J. Nlinami, IVI. Flios, D. J.v. BASEBALL f ff il as 7 we gin si Q , K E Ai iii' 2, at :rg , A sy 2 E E E z Z 3 2 arslty eam Die Q0 J u n i o P Baseball Former baseball and traveled lake the 4 My and the Prosser is socaal studxes the farthest EEBW mnwas ECE: CBVE this like Tam Pr ff if 1 Torrey Cababa Coach Stowe and Erma 2 TorreyCababa attempts to pitch anotherout IVIcGehee check out the rules with University City before their game. 3 Tammy Hamilton makes nt safe to farst base MIVIHS OPPONENT MORSE SERRA PTLOMA HENRY MAOEON MORSE SERRA PTLOMA HENRY MAOBON VARSITY SOFTBALL E an we :: ,:1- Y . 1'2.g:'m vn:'4'asw. H . , D JQV. SOFTBALL The J.V. Softball Team consists of: ltopl B. Flodriguez, lmiddlel Coach L. Nlack, S. Wiborn, L. Holman, C. Zerr, Fl. Simpson, N Juarez, R. Decker, C. Castle, J. Stark, H. Berner. lbottoml B- Duhme, and D. Fanno. 'l. Becky Duhme readies herself to field a grounder. 2. Nicole Juarez takes off in a flash to reach the next base. 3. Betty Townsend 4. Nicole Juarez, Rachel Decker, Debbie Fanno, Becky Duhme, and Heather Bernes round up to discuss the winning strategy. 55. Debbie Fanno prepares for the pitch. i l i 2 1 E E Q i . '3f'f:2fQ:,fEe5i1-1 --cafe? i' Q:-ra::EE-E2-3553521552225:22 :Ei i 'i ,, i ,: :::::.:g,zg'ggag5, , ,,. . ...,, , i - .,.. is gi. :va -N. :g::E :Sei--1 13-5 2'1'f': ' I ' .3 , ,L,k,,, .,.. .M ...., . ..--. - .,... . ..,...,.- . .,..,.. ..,.. .. . Q :.,:,.:., :.,:: ,,-, .. .,.,.:,,.: .::,.. . , .:.,: , ,,-, i 15.1. .--. ::.:. .- :,.,,v, - . ....., ..,... 'in :-5:5 :.. - - -f -...FQ . :-W V- -::.:.. ...ui -V :-': i i J i ii il if iii V' it Q i ES iglgw i-W K M i N W1 W . ii .-1 1: 11: 11-1:4 ' . 1A:.2.2,i1E, .giE:.E:.:.EE1.2:, ::Q.g,..gi,2:,:V:.: 1,.:. 2,Q. t Q,,-Q i zi, b::,:. :l:: :1:-Q: Q,2E 1f:2 -.f1QQEg.:Q :1E 1--.i L22f2 air: -f-1'f- 1.i.. i e .,:., ,...: :,' f ,.A. 2,:.. E-Qi ,QEIQE :5 :, ,,: . fflf iil'E' e i e P eed ! , 'inn 1. Flay Fiovve puts full force behind his discus throvv. E. Essex Burton receives the baton from Rommie Viado and streaks toward the finish line. 3. Dennis Mauricio shovvs his outstanding skil! in the pole vault. 4. Kevin Carriker gracefully leaps to victory in a quest for the longest jump. 5. Hurdling ahead, Todd Stevens shows e Bovs' TRACK ai.- perfect form, 1 ' A A ,WEWMW i f if , , ,iff , . .. ' flfi? 2517.2 we 3 7 Q Q 5. The Boys' Track and Field Team consists ot S. Bramson, E Burton, G. Cabardo, P. Cagaanan, M. Hoerr, M. Leary, S Flickrnan, F. Saria, J. Silva, S. Songalia, D. Staples, R Stevens, B. Tarbell, B. Treptow, S. Vaurunek, E. Allison, V Bocaya, J. Bray, K. Carriker, M. Casiano, N. Espiritus, Fl Hansen, D. Druin, P. Lolande, P. Ly, J. Mariano, D. Mauricio R. McGraw, R. Miller, V. Mohair, M. Pierce, Fl. Reiter, C Shauger, Pl. Viado, M. Wester, P. Adajar, J. Cagaanan, M David, B. Duffy, C. Duque, J. Fanno, A. Flinn, O. Flores, J Flower, Fli. Gopez, S. Hornyak, C. Jackson, M. Johnson, K Lam, P. Lilard, Fl. Manno, J. Max, S. Metcoff, A Montgomery, H. Nelson, J. Nixon, J. Poblenico, W. Roberts Fl. Ross, M. Punyan, P.Solomon,T. Stevens,G.Tran, P. Tran T, Troxler, A. Tindale, G. Vu, A. Bartolome, S. Beltran, T Calloway, G. Cavallaro, G. Dinh, S. Donavan, C. Elehardy, B Eudy, D. Farias, M. Forrest, D. Hassanien, J. Helsel, L. Henderson, J. Jackson, G. Jasmin, T. Lewis, J. Mills, M. Manor, J. Mistrella, R. Moreno, T. Nyugen, Fi. Drofillan, S. Drnellas, A. Palma, A. Spears, E. Taylor, G. Fanno,A. Viray,T. Vu. BOYS' 1nAcK 'I. Patrick Meehan smiles because even though he missed the golf ball, he still looks spiffy in his golf clothes. 2. Greg Byers concentrates heavily as he prepares to putt a hole in one. 3. Lyle Stewart shows Sue Laubenthal the professional way to play golf. 4. As Derek England shows Paul Berga techniques of golf, Sam Parnoleres tries to show off before them. Q l I ,,,, 4 Wwf3 ' vw The Golf Team consists of: G. Bryant, S. Pamoleres S Laubenthal, P. Meehan, P, McNenamy, G. Byers, P Benga S Monday, L. Stewart, M. Pirie, and D Enga ,,.., , hw d ff gi 4 ,... , .ff .f Aw' . . ,,,, i ll yi 'wif 5' - f we .1 ,- I . Q 4 5 f 5 7.45, fl ' M A MW V , I it '15 f 2 'l. Angela Jordan gets in the starter's position. 2. Getting ready for the big take-off, Angela Jordan looks for encouragement from her friends. 3. On her way to the finish line, Angela Jordan slows down to pose for the camera. I 4. Breaking a record, Eula McKinney jumps to new heights. V 5. Laurie Borck runs at a good pace on her way to the finish line. 6. Getting off to a good start, Leonara Lambert uses all her strength to run a good race. The Girls Track Team consists of: lrow 1 1 Coach M. Kent, T. Shrum, S. Hallock, Manager A. Tahernajad, J. Evangelista, S. Butler, A. Stacy, D. Vaughn, R. Cadaing, D. Barr, D. McFayden, l. Stabb, lrow 21 D. Wahl, Y. Guintos, S. Staples, T. Farris, J. Gozalo, S. Marbrey, T. Delmar, K. Dale, C. Schissler, M. Bailey, C. Parks, D. Austin, lrow 31 K. West, C. Serrano, L. Sefkow, M. Johnson, C. Phelps, B. Greco, L. Lambert, K. Edwards, N. Staples, M. Smith, A. Jordan, B. LeVeau, C. Patacsil, lrow 41 C. Sabbs, E. McKinney, M. Ishio, K. Jamieson, M. Llamas, K. Quinn, M. Hoerr, Fl. Deguzman, T. Ladwig,J. Hagadorn, L. Borck, M. Johnson, and T. Toyne. i GIRLS 'rnAcK ffy, K f M ,, ,,,, N wywfm E ,am ,.,fM,,. M. 'I E, Bovs' TENNIS ww. Wawwa v 'l. The MNIHS Varsity Swim Team consists oft lback rowl K. Martin B. Livesav, RJ. Scherl, S. Aparis,T. Selbrede, S. McCarty, L. Conley, M Smith, A. Smith, J. Havel, S. Pitts, N. Humphrey, H.Stott,J. NlcElliott, K. Floseman, J. Lauerman, lmiddle rowl J. Fleisig, J. Spritzer, S. Schooling, J. Fiubio, M. Kolarov, B. Gabrielson, J. Lewis, J. Snow, C. Foster, K. Demko, lfront rowl D. Geary, D. Jerrell. 2. Dawn Schmitt portrays perfect form at the climax of her back dive. 3. Bobby Gabrielson uses his last ounce of energy swimming into the finish. 4. Julie Sefkow, Jenn Heaton, and Karin Horowitz attempt to attract Joe Lifeguard's attention. 5. John Reisig and Scott Schooling team up to show off their school spirit. B. Jeff Snow feels a little crazy during practice. 252 ESWIMMINGP J t the shot of the starter's pistol the tanned, muscular swimmer was instantly in motion, 1 skillfully executing a perfect starting dive and smoothy entering the cool blue water. Stroking powerfully toward the finish, the athlete. soon outdistanced his opponents and won the race. This victorious scene promises to be quite common for the MMHS Swim Team, as both the Boy's and Girl's teams appear to be the strongest in years. The coaching skills of Head Coach Dick Clem and assistant coaches Chris Gibson and Charlene Payne. combined with the hard work and dedication of the swimmers has created a well- rounded team of strong, fast, and enduring swimmers, able to compete and win in all events. The boy's team was greatly strengthened by the addition of several speedy underclassmen, including Mike Kolarov, Jeff Snow, and Bobby Gabrielson. who complemented the returners, Carl Ervin, Jeff Lewis, and Hooch Scherl. The Girl's team standout swim- mers include .Jenn McElliott, Tami Selbrede, and Cindy Hallock, all fast versatile athletes. Perhaps the most valuable addition to the team is freshman Mike Picotte, a phenomenal swimmer who has already broken a majority of school records. The team practiced long and hard all year to reach their goal of an Eastern League title, putting in countless hours of swimming as well as daily early-morningf' Weightlifting sessions. The result of all of this work and dedication was the creation ofa magnificent team of lean, mean, swimming machines that struck fear into the hearts of all opponents. the mighty Marauder swim team led by co- captains Jenn McElliott, and Dave Geary, was a spirited bunch of athletes, devoted to the sport and willing to put in the extra-effort needed to be champions. The path to the championship would not be an easy one, but the swimmers were confident. As .Jeff Snow put it, Anyone who swims against us is a dead puppy! SPEEDO SPll2lT ' 'N its 6 476 .f v K 'wi utqqtxg 4 4,-5 l . r . I XXX C X t4 ' B ix 1 H Q Y J iswimmiiusaiesa 2 IDH, CK.w,,A-c,. 4 2 E E 5 Z 4 E E e Z s ww L SWIMMING f 0 dw V 5:- ,,,A , an Jfwnww 'gm vw, wefzeykwttoo Organized s Bill rode his BICYCLE up the hill, he tried very hard to keep his RADIO, SPANISH dictionary, and VARSITY Ietteriacket from spilling out ol his BACK- PACK. When he success- fully reached the top, he was so happy that he let out a big CHEER. Sadly, Bill then rolled back down the hill, and was hit by a car. Unhurt, Bill sued the driver in a MOCK TRIAL, and was awardedSi'I million in damages. Bill wrote of his story in the MAROUEE, and also acted it out in DRAMA. A movie of his life was made in T.V. PROD- UCTIONS, and Bill became even richer than before. Ouite clearly, Bill was an active student. He belonged to 'IO clubs and organizations which filled his life completely, leaving no time for eating and sleeping. Yet even Bill could not participate in all of the organizations of MMHS, for there werejust too many! Whether you liked to see a planet, speak a speech, hike around,wave a flag, yell a cheer, or debate an issue, Mira Mesa had the club for you. Literally thousands of clubs could be found on the campus, giving students a wide variety to choose from. Whatever students participated in, it was clear that one goal stood clear in their minds-a good time. Organizations proved to be some of the most enjoyable aspects of the school year, and served to make school a little more interesting, and a lot more fun. sl i Yes, mom , replies Ken Nelson after a lecture from Jackie Pulopot. 3. Arvin Salute and George Roselle enjoy being in Speech class. l ' I ..-ffl 6 .. ' , . -ff X PWS , 7' , 4' i-.th X- rx ' 4 - ' f ig 6, , .N by--s ASB ck edication, determination, and the desire to be leaders were the qualities that made up the 1986-87 ASB. With the supervision of advisor Kim Coody, ASB worked hard during the summer and the school year planning and carrying out fun and exciting activities involving the entire student body. President Judy Mercado, elected, and appointed officers, strived toward the goal of making lVlira lVlesa High School the most spirited high school in San Diego. Student participation in fundraisers, Homecoming, the ASB Ball, lunch-time activities. and spirit week made the ASB huge successes, due to their hard work. The ASB budget grew steadily throughout the year with money from the Student Store, Coke machines, dances, ASB card sales. accounts, locks for lockers, and a small percentage of GATE money for football and basketball games. The ASB worked hard to make sure that lVllVlHS was the best in the West! 'l. Laura Toller and Chelsea Schissler show that A.S.B is fun, fun, fun. 2. ls it 100010 cotton? , asks Tracy Cook and Christine Campbell. 3. More posters'? , asks Peter Aguinaldo, Commissioner of Graphic Arts, to Joey Velilla. 4. Suggestions are anxiously anticipated by Mike Eicher, while Mike Demko ponders for a moment. 5. Steve Simmons anxiously awaits for another exciting lunchtime activity to begin. 6. A meeting means serious business to Cathy Patacsil, Gigi Gemenez, and Tina del Mar, 7.EiIynn Biscocho and Judy Mercado prove that ASB. and fun go hand in hand. B, ASB consists of: Peter Aguinaldo, Mike Aklufi, Joey Velilla, Christene Campbell, Tracy Cook, Troy Latimer, Mandi Smith, Kristin Block, Joelle Sudweeks, Holly Clifton, Mike Demko, Mike Eicher, Ms. Coody IASB advisorl, Eilynn Biscocho, Judy Mercado lpresidentl, Noelle Santamaria, Cathy Patacsil, Steve Simmons, Demetra Barr, Gigi Gemenez, Kim Thompson, Tina del Mar, and Floy Jazmin, ASB Awww . - wgmm mf V , . ' 'f,1.w,,W,,, 'www , V K V. .wiwq fav: .. kfhwfwmw 2 'QW .,-.r ,, Q f Ki 5 , , Wwwwmo H df The Bacwackxog Goh oohoxo-no oft Kham vow X4. Johnson, L. T rem, C. 9-ohwavnz, Wool vow Ik. NNQVUUGZ, J. HQGQGS. NN. Doe, X4. Daxneo, C. Sm .XNeaxlev, 5. Sxmmo ooo N4.9wfWW5- 41 1, V. M 'f lWff,..T??ef Q, ' ,,,, 5 if 3 WIWWZW ' ,:-fm-, 4929 ,,,, K f' 1 w Z V... WL ,,,, : .A ,,,. I., I A , Qgwg ffii TW 3 , ! Q ,V :Ez ,. . . . , ,, .. V .,, V 9 . ' ,. M J Z f, The BXCNJCXXUQ Ohio coooxems of. JNQLQQ, J.'5oahQXev,NN. Pxuhqoo, E. Svvoheoh, S. Lomax, L. Them, ooo M. Edmhaooer, and oowoov, J. Orehoovik. ,amy .515 5 Amate UP R S:gZdr1:o,JligJTOU Club Cons .Kallmg Za,C.Lee Gwgilgfls Of. M p V ' Eifgf-,ey R' Eyum , .Lee J O, J- ' 'SOppV A M A KPACKINGI BIC s 1 KJ Q' . Z ff 4 W, Af 45 1? Q ' fi, if' .v-J, KZ 94-iz .gggw qi ff , 'A my f 9- 5 I f:4'iM .W , : W. L N Q E :fi , ' 1 , , S 95 , , ,, ,qi I . ' M ,W 'lf ' jan sin V FW 'Q' L f-MQ' . K v A yfif fl F' K 42? ,, 3' , , 4 4 Z '::': frg, i Kin ,K 412 'M i 2 Iv v W .. 92 -. . f , ii' , m ,ga , ,y f' 'f , A ' 9 l l l l 5 l . i i l l ln her unusual state. Mrs. Suzanne Emery relaxes before a deadline. LEADERS... ho was caught flashing in front of the media center? WE WANT TO KNOW! What ever happened to Mr. Valassiss' toupee? WE WANT TO KNOW! When did lVlMHS get angrily rarnpaged by toilet papering' terrorists? WE WANT TO KNOW! Where do you go if you want to meet members or the opposite sex? WE WANT TO KNOW! If you want to find out about the hottest and latest news happening at MMHS, pick up your latest copy of the Marguee. With the supervision of Mrs. Suzanne Emery and the co-editors Lynn Fredeluces and Jim Huber, the talented Marquee staff was the hottest thing since pink tofu. One ofthe most exciting organizations covered this year by the Marquee was the Junior Statesman of America. These talented youngsters attended debates, conferences and conventions in order to push politics into student aware- ness. JSA members were interested in what was going on in the world around them involving politics, decisions, world affairs, and local affairs affecting students. According to President James lWhiteyl l-lagadorn, JSA consists of people who have heart and desire, who are not afraid to speak up for what they want. With advisor Bob Durham, JSA attended two major conven- tions, Fall State and Spring State, held at the Los Angeles Hilton Hotel. Cars were washed and hot dogs and candy bars were sold in order to raise adequate funds for the conventions. The Junior Statesman of America proved to be an incredible organization and one of the most awesome clubs at MMHS. z E : iii ,V ,, . AND THE PF-I 'i -,IL as 3 i A L 555553 MZ i 'ff, .W L L . t W F J i , , , , ' ,, ,il li ii 4. Carolyn Evans enjoys reading the article she wrote. 5. lVlembers of the Marquee staff are: Back rovv: Jim Huber, Kim DelVlatte, Lisa Sousa, Debbie Lew, Kirstin Johnson, Flon Askew, Christie Ford, Carolyn Evans, Joy Pulido, Ingrid Stabb, Cathy lVlanzano, Linh Nguyen, Arthur Root, Lynn Fredeluces, Shannon Niezpodziany, Lisa Nioolaysin, Scott l-lermanson, Flay Flosado, Terry Sanabia. Front rovv: Airon l-lough, lVlrs.Suzanne Emery, Leslie Hunnels, Loren Kopff, Sean Cushall, James Navvrocki, Larry Soloman. S. JSA members party before attending a debate at Fall State in Los Angeles. JBA ' f The Mock Trial Team consists ot Advisor H. Merriner, G. Galvante, J. Huber. S. Ward. F. Pampo. N. Sentamaria. A. Saluta. S. Cummings. C. Hallock, D. Barr. L. Cosio, G. Roselle. M. Pabarcus. A. Sabal. L. Toller, P. Smith. S. Leary. and D. Peterson. 1. S. Ward, S. Cummings, F. Pampo. G. Galvante, H. Le Ngoc, and A. Saluta listen attentively in a demonstration of a practice trial. 2. Demetra Barr direct examines Audie Sabal in n practice trial. 3. George Rosello rehearses his role before the actual trial. 4. K. Joseph, M. Anoche, L. Arab, R. Lotfi, and A. Stillwell discuss their next oroiect rl . . Mm - figs- W V 1 ' ' w fi K ' 'pdf ff Z: 7 SKZQE 9: he-f N , Q W X 5? J if 1 X11 fv U f f W , I 1' fi I wh, ., 'W ' ' 4 I. 1, 4 ...- V : fi 3 ak If S f 4 ff 1 4? ,, ,, j M, iw WML' 5 1 'X 'Q Q I W if y 5 fff, ,,,, United With Spirit iming to promote school spirit and support Mira Mesa's athletic teams, the cheerleaders gave Mira Mesa one of its best seasons ever. Sandi Chong was this year's varsity captain and Cathy Pataosil was the JV captain. Although their presence was most noticeable at football and basketball, the squad suppor- ted every sport in some way. The contagiousness of the cheers performed was made evident when the crowds at the games chanted vibrantly along with the cheerleaders. A new mascot, the blue and gold Marauder horse, supplied a new and exciting drive for the cheerleaders, while the male members of the team continued to provide unique- ness and diversity. The squad received much of its publicity at pep rallies, where they instilled school spirit into the cheering and frantic crowd. Exciting fundraisers, such as spirit ribbons, badges, and seat cushion sales, allowed the cheerleaders to continue in their tradition of spirit and enthusiasm, it C 'mlhliiw to mmvsrefwas-:,eef,:mv:vr':w:,...4mf:.g:x:t:ziitfsmfxilsrfrrcsry-ew CHEER 'Ut 'H t, My A wit ., ,, is K ' up in 5 'Hg ' W fm Q,-mn l. With a little help from the 2. Mindy Bailey attempts to 3. The Marauder Horse K , vxkqlv if in EN! Vlarauder Horse, Pam Crdonez can novv see the field. :scape over the stadium fence. shows the .JV souad how to aoplaude their team. i 4. Varsity Captain Sandi Chong between oo-captains Kerry Vierra lleftl and Cristeta Gumban lrightl with Junior Varsity Captain Cathy Patacsil V Ibottom left! and co-captain Tina DellVlar Ibottom rightl. 5. J.V. Cheer consists of: ltopl Heather Fliding lmascotl, Sarah Kim, Tracy Fry, Flaohelle Flozsa, Juliette Cielos, and Kevin Nlejia. lbottomJTina Del lVlar, Brice Danico, lVIarylou Correa, and Cathy Patacsil. S. Varsity Cheer consists of: ltop rowl Neil Palmer, Mindy Bailey, Kristyn Demko, Joelle Sudvveeks, Imiddle rovvl Tracy Cook, Kerry Viera, Buffy Whiteman, Anne lVIarie Olsen, lbottom rovvl Sandi Chong, Sharon Hay, Shannon Cheek, Holly Clifton, Pam Ordonez, Trish Ordonez, and Cristeta Gumban. i cnsen W is W 425 3 Z ss' if 55' .. fy fbi, ...fig 1,1 ,, .Aw mg W9 Fl-ll-UVARSITY CLUB --- YL, f ff f-,W ln summary, the allowed letter-earners to participate in rschool s, a united force fighting for truth, their devotion justice, and the American way... to the art of homemaking. ...and also to ski Utah! l. Britney Ehrlich discusses the upcoming ski tripato Utah with Advisor Leo Casias. 2. FHA members include: lFirst Bowl B. Hernandez, A. Bennett, C. Donahoe, T. Buniger, N. Benson, A. Ells, D. Bickets, K. Dihn. lSe-cond Bowl M. Crane, K. Matthews, C. Avakian, D. Valenzuela, A. Nguyen. 3. Models? Maybe in the future, but for now FHA president Kathy Matthews and vice president Christina Avakian will keep their minds on FHA. 4. With the strength ofa varsity club member, Scott Cummings sweeps Mandi . Smith of her feetmliterally! 5. Varsity Club members include: L. Casias IAdvisorl, J. Shew, P. Galveson, V. Bico, K. Viera, J. Morales, K. Lofft, J. Gee, K. Block, M. Eicher, J. Medina, M. Smith, T. Coffin, L. Shieve, C. Gabrielson, K. Macbeth. M. Bohl, S. Cummings, J. Mique, B. Gabrielson, C. Duke. ' 5. VVhewl Strenuous work at sewing a blouse makes Ms. Angela Croce and Ann Nguyen a tad bit tired...so here they break for the camera. D eat? lood, sweat, and tears, was endured by the Marching Band and Letterettes. They worked together ineharmony, sacrificing time and hard work in order to be the best. With the leadership of advisor Len Wolfe, and assistant drum maior Michelle Williams, the band won first and third place in the two field tournaments at Mt, Carmel and San Dieguito. The new drum line placed sixth out of twenty bands in competition, and they are second only to Poway in San Diego County. The Band and the Letterettes practiced twice daily, two hours in the morning and after school to strengthen their skills. The Letterettes competed in their very first competition, and marched off with and impressive third place win. This was the first time that the Letterettes competed against other schools. l was ten feet off the ground! , exclaimed Len Wolfe. The Band and Letterettes marched away with impressive victories, proudly displaying true Marauder spirit. 'l. Trevor Calloway marches to the beat at a Mira Mesa football game. 2. Leading the band are Michelle Williams, drum major, Nancy Bellez, Letterette captain: and Doug Beard, drum section leader. 5. The Letterettes consist of: N. Bellez, D. Seguban, L. Borromeo, S. Flasgaitis, J Drtgiesen, C. Killpack, J. Lincoln, C. Weisz, S. Bauer, D. Brannon and L. Green. 8. Leslie Borromeo,JenniferOrtgiesen, CaryWeisz, Christy Killpack, Shelly Bauer, Sandra Flasgaitis and Dawn Brannon salute with pride at our Homecoming game. L l ll. A? 5 E 523 -ini, ,lm , 1 ,W,.,, il lflfllll jlflll' mwvw 5 lied 3. The Mira Mesa Marching Band consists of: N. Allen, M. Anoche, A. Aragon, D.Arroyo, N.Asgharzadeh, A. Bartolome, D. Beard, B. Bennett. Fl. Berg C. Berkson, D. Bowen, T. Calloway, K. Campbell, E. Carry, H. Compton, M. Correa, G. Cosio, D. Daniell, M. Franklin. G. Gallardo,J. Gee, G. Geiger, T. Griva B. Haley, E. Hirning, M. Hoag, J. Hubbard, J. Jacobs, G. Jerde, K. Killian, K. Kuyper, P. Leonard, S. Lopez, T. Ludwick, L. Lungaro, J. Mata, K. Mercer, M Morrow, M. Pellerito, M. Perono, D. Benison, S. Flitchie, P. Flubin, G. Stidham, H. St:oker,V. Tiqui, A. Vergara, K. Wienold, S. Wilborn, M.Williams, B Wilson, C.Bagsdale, A. Flondero. D. Underhill and D. VandeKieft. 4. The Pep Band consists oft A. Aragon, D. Bowen, C. Wright, T. Grula, G. Jerde, K. Campbell. G. Geiger, K. Kuyper,T. Ludwick, K. Wienold, G. Gallardo M. Correa, B. Haley, J. Nelson, P. Leonard, M. Anoche, B. Bennett, N. Allen,J. Gee, S.Wilborn, Fl.WiIson, M. Hoag, L. Lunjaro, E. Hirning, D. Killian, K Mercer, M. Franklin, R. Beru, G. Gosio, A. Vergara, D. Beard, S. Clark, B. Foch, A. Bagsdale, D. VanDeKieft, T. Calloway and H. Stoker. 5' EBAND ml-fji v Individuals of Academic Decathalon are: 1. Laura Horne, 2. AndySefkovv, Kristi Van Devvark, Kirn Flikanstrud, 3. lVlrs. Groff, 41. Jennifer Desmond, Cindy Hallock, 5, lVlike Aklufi, lnot pictured Jill Cottell 5. lVlr. Flegas dictates to Peter Aguinaldo that he must be consistent with his office in CSF. S x Q A l '19- USA 2 l '61 1, 'L' T5 ,sf X .g1'1,wV,.-, U 1 W K 3 'A-GH J l 5 N ncc, fy ,K f MMMQQ N f 7 VVVNW ,,WllCSFlACADEMIC DECATI-IALON ,ff ,M ,WM 4,5 f X , ,,V 'Ay 1:5242 W sw 1' ' th r-id ' ' wp... QE sl ,avg y ww -M,-N l fm. 151515 K' LW 17 I ,J 'Hu g h ' N W Tfxxfii JW , ' 1, ' 2 if 1 ' 5 - 1 Ef f 1 :i , . , Q .j HJ, X5 Q f' - S 2' .n - . . '1'1 ?7--'H V qw Kendmcks Smyth, Dame!! 'Ja' ' fi is I' ,,- ,VN-2 . T 1 llH4 A?PW 5Ql W F51 ,f 5. Cathy Guro, Gwen Merkle, Kim Spafford, and Edna Vista demonstrate enthusiasm in their Hag routine. B. Princess F?oatrata,NikkiSmith,Pam Mercado, and Kim Spafford march on the fieid with pride. The Drill Team consists of: J. Adelman L. Anoheta, T. Anderson, G. Anonuevo A. Anspaoh, E. Banatiao, M. Belisario, R Caimpon, A. DeLeon, C. Draher, T Draher, M. Duoote, K, Easter, A. Eoija G. Galvante, S. Glenn, J. Graoia, C Ibanez, M. Jimenez, K. Kammarer, J Leake, M. Lucena, M. Mangohig, M Marinas, M. Melenoio, S. Melton, R Mirano, K. Ooampo, Fi. Pagadoan, S Palmer, S, Paul, K. Peel, J. Ramirez, A HBSTTIUSSEITS.RUlZ,C.SEl4Q,T.SUllIVE!l'1 M. Torres, A. Yturralde, and H. Zornovv The Flag Team consists of: I.. Deokee K. Fenake, C. Guro, N. Levvnea, L Lozano, P. Mercado, G. Merkle, M Navalta, D. Oakry, I.. Peraiohina, G Poroionoula, P. Fioatrata, K. Fiuiz, N Smith, K. Spafford, and E. Vista ...wi QF' nnlLLf FLAG TEAMHQW .... , X581 QQ? SSCINHSI .4 f, 5, ,HM , :M g if: - E ! lm U 511 'I ff' fx ' ' J f ,M l The lvladrigals are: Becky, Zulica, Jennifer, Lavonne, Erin, Arlette, Eileen, Panie, Holly lVlichelle, Sandy, Cheri, Kim, Jonathon, Jason, Jim, Jeff, Anna-lVlarie, Shanna Leonard, lVlilce, Bam, Andrew, Dean, Larry, he CHOIFUIVIADRIGALS sas HIGH NOTES eople in drama are not your basic Joe Six-Packs. They are a unique, motivated. talented group of aspiring actors and actresses. They are part of the select few who have fully grasped the concept of character, the concept of entering the mind of another person. They have utilized their talent well, creating one of the nost popular and publicized organizations on campus. This year, the Drama Club produced, designed, and acted in three main stage performances under the expert supervision of lVlr. Dan Begas. Grease was a smahing, as was The Dining Boom and the ever- popular West Side Story. Drama members also had the opportunity to act in local haunted houses. Boasting lDD members, the Drama Club produced professional plays at the high school level, and the entire school was able to enjoy the results of their dedication and talent. Surprisingly, the lvladrigals shared several similarities with Drama. Both dealt with singing, and all the letters in the word drama can be found in madrigals, Along with the regular choir, over 'IDD students were involved in lVllVll-lS's choral music program. Choir and madrigals produced several outstanding performances, including a Christmas concert, and added an element of cultural diversity to lVlira lVlesa High. ll. Panie, l-lolly, Jim, and Eileen show their enthusiasm for singing. 5. Brad, Jonathan, and Larry listen tentatively to lVIr. Kennedy's instructions. 7, Natalie Woodward lBandyl and Larry Nlonteforte lDannyl give it their best. B. Joe and his women 9. The gang from Grease 'lD. Bernadette Smiley as Patty Bimcox and lVlike Weissenburger as Eugene Florscnyk. E - ' is M 'g' 'kwa-as A The Drama Club me ' consist of: Idoe i Chi'isLine H., .Jen G., 1 a F., Brett l., 54 1Ti'icia' S.. H.. lfahvcggb M5fTiflany M., Krieien Shannon Pwaytaliewi Sliavunde ,, prilB.fBr'igei:neB.,Merry!B., C.,FlobbinC.,Kirn Lonelie B.,Lisa C., Holly edentor H., -L ' :VF J ennyFl., Q il xg ' Pamela C., Flichard D., Michelle D., Leigh ., 1 ' H. Flonniel Renee Emily C., David D., llgaryorblj., Melanie D., Tony F., Camille L., ion N., Sean M., Michel e E., Leah H., Daisy Fl., Flichard Marvelyn R, Mylene Fl., M., Elaine F., Michael D., Khara V., Anna-Mariev C. Dawn M .Ciii'tC.. S.,VVendyV., V. Ted C.. Leo M.. M.,NaLalieVV.. Dean S., Am Jennifer D., Kirsten B.. Jose P., lvlarivic L., Angie J., Sqz Kaifenfw., y S., Tina S., Christy S., Michelle W., Rachel J., GaNeane B., Scott S.,, HQ. i iii i' i ll wi AI ' ,M 3 Envkque Lev 'ma Meyer wx me Xe Near wxm Gma sonfaxeme o vexgon, 'X . 2. Nxamkae BNNQX Dao eats We sm: A Fovexgo exchange swdeme S Weenevhaue. J. YXBQX T. Omg Eiamae. vx-ae. NXBNISVB, , Blue, maven LQXIXOB, lk. Berman gens SMS. Xooxae no Marv Luna. mevman' 5 Xackaem? NN aXmevebeX1md. and P. YN amp Wop vow V N1 em duram T. Ly, J Farkas, T he Spams XC U Kthkrd Y Rosas Eaeme vom lk. N P er E v is f' INTN. ' Cl-ua ISPANISH CL ES 241 ira lVlesa students associated them- selves vvith numerous foreign countries, and various clubs allowed these students to promote their nationa- lities. Led by lVls.Lopez, the lnternational Club was an association of international students vvho basically did international things. They sold international grams and sponsored the International Faire in order to promote an international atmos- phere around the school. 5 grid Another club that promoted international awareness was the Spanish Club, an organization which consisted of Elaine Bennett and her AP. Spanish class. They strived to promote the Spanish culture, and also to halt the devaluation of the peso. A final program involved foreign ex- change students from various Worldwide countries, including Germany, France, Austria, and Spain. 'l. lVlirko lVlorchheuser yells to passing friends. 2. The International Club consists of: C. Partido, S. Eator, L. Fontailla, K. Fang, lVl. Kohn, D. Carter, K. Do, K.Yaiima, G.VVatters, A. Lacsa, J. Barba, lVl. Pampo, K. Alejandro, A. Luna, and P. Ferrer. 3. Y. Farias, C. Fernandez, Nl. Gosset, and J. Carini smile for the CBTTIEFB. 4. Angie Lacsa sorts out grams. I- eb- fo 'ill if ta PS ze-rf: ' ' 1, , . 275 ':q.s?W'C . : swf '4b3?'lf-W-,',1'-' Y' .L ,wit--' ZZ' 1553 w5'fi2,1f'-4251 ' 5.2, .fir V way xi, 722 ,V ,1 4, ,,w,,..,,, W.. .,4.,,,, 61,-...e V-.mmf f e-Emu.-effffv, , :Li-L' 3-' -rw , .- , ,ww- 1 45' FTE. .1 ' ' +-',:F2'i'fJL1e H 'L ,gf -. We ,x ., Q., - f' wi' i:Qari?i':I i T'.GfQfia. 1,15 . e,-'2 . .4 N 2'1 -lff' fz'57S-'-3511-5531 .f:,.:,'rw , ge ggffvrjga? .,,,v,,,,5 , K, W .5 ,, ,.?,, ,f,,,,,-,f.g-f,1..1h.4g,9,i,-Vg.,-:f,:g.,,-.-, f-ef., new -, pile.: 'Ein--wg ,. .ff 1.1 f-rg A Q ,,,.M,4x.. s-?'.w4:.ph-...:-fp ,Q .ww :. .fl 9 ffl:-'n-:-'f : '::-1:-. -fa 5-awe:www'.1,':3'v-'f-fm-mf w--fgxf'1flff-..'fw f - 1' ' ' ' 1 r f , , f f:-2?ffz'2 21 :j : 1 ' 15' 'M Fw-J' ff- 9 -rf'. ?5f'2ffZv1-: 'e'2,' -' f:f'e.:x,f H.. -f.Mgf.,e.. - ,mbeee W uf .1 fr '. 'F 2 1 Y' IH, YW-' fvwdiiffff' Q.--HA X In 'fc 'If 'S A X 'i'3,x.,.z1:qeg ' ' ' ' ' ' 'W 51:1 'I 'f' TUC? : ?Qf.',3-f- 4' ul? L' r J.',. '.i'?'377 72. ' 1- '7-' 1 -1' Q 2 7-' A -if - f . ., .: v V'-':f.L:v.4:'f .e,vr4v.a'gg..1125:L,,1.w:f2-1'-w-,ff-fi.new :ee--13.1. 323,147 Ae- mv.--5 ,,, .M .... ., 1 -f ,m .,H,,.-.- .,.. , ,.,Qq.,,, .7 ...M -..Nw -sf.-. dw.. Q, W 1 . .'?'W-'.mf'r.v. .M .- .er ,H .mf-Xa' 1-.xr M Mfr 'Gm , if. .gf 50.5.2 J. 5 5 f rflfv-14 -fwfs-:fi 51 Q. 'I If :af-461239: ff 2 1 F4 ,,,,.,4y.z,. .'... . .53-:4ff3a:,,:,f-:1g-:?f.':g1,fwqr',.-J! .fm 1x25::5 1f63 nL12!g.n,,v-lffsfe 'Y ff- pf ' Y ,f ,fr we V5 VL ff S, J' Q ,fx ' A F ' K3 0155155 . .ef ..g..,,. 3 FEL' .1 1 - ., '15 ' ' Vf,,3,,,,vd,,,,g,WJ, ,Jil .g..,W, ,,,,!,Qi:e,,,t .g,,v,V,., ,,.,,,,,. ,.,.1.,?,5!1q ,3fvwi.i,i,.,.fQ. ..q,,z,.?.f3w...J.g v.,,.Q.,s.,q ,sf , , gf L 5 I - ,W yin! 4 me 9 ,hw 25 f l, M w3f6fvef6VK,jfff'iwL' M . .. . , -V . . ..., . ,,,, ,, V- .4 1 f, 5. ,W .W-4..e,,ff,w121.-.MWx., w..Wvf-: 44f, w?25?'ig5 iw e f -w igewfmralwfg'Q'f'?f Zf W iz!! gfi' vf'Z':Q W ' ' ' ' 1 3'f325iuo1??'fiix'5'i2 if . v .. 1, , . - 1 ., Q ,Z ,Q 5, 4 nw Ja A' 4 W 'L '2?mQe7 if Q? Eu 19 few ' .. ' 'A , il l gfivsfeir ik' f f' + ' 5 ,ZX 4, L , A . - K , ,M .. :fL,,,,r 3.2, , -Jw , ,. , f ', .5 ,. : 3. W f ,, 1 43 bw www' :ff ff if ffm , Q .Tw f f 1: fe ,X ' fr femaw -- iff 3 ? JRE! ggi Xb ga-5, Q 'gpg' 7 A 't igegfx f f2ff i xl:L T if : ' ' 'k , Q 4, 2 W A g g . Q- .gsegflr r M fy 4 450 gig? Af Mmm bifkvivf W 1? r L- ' V K Q , mf . - , wk 332- - ze ,, , 333 Zim .Zf,. L?J: ,444 . . 4 ,, . f Q , ...yu ww, 4 VA-1. K ,.eaw,.1,g-we f-if ww wfw fff' - -, fkfwf g. f- .lf ,. , '4,2'1n:w 'iv,.fm,:11:::l '- f if '.- L ie .. , ff ,NW - , fem 5325 ' exam , ., my ,wwf fn we-ff ' v i 121 W, , V, if ' ?,1 5 . , ,, , , ,,w.V,n2,, ,, V in WHY? . , . .. W wwf ' f my QW? , xr . , , L '-f'v ,,- ,. V 'Q fi . df , f px' ffl f J ??fi e rv r x ' y 2 W e -, r y :r W . r N 1: , . ' 6 4 + , Q r f' EZ f ? ii 9 fe 24 Legg ? f f 'b vf. ,gtg ff V U4 i Y 1 3 S . 5 1 - 7 '21 W... ti. 1 Ve if re r . l 1 1 . The consists of: ficirikirjieeleyda, Lile ly f Eilynn Bisqgjeho, ChrisizeneCampbeilg-Jeff Contreras., Ed' Gawaran, Gigi Gemenez,-Jectgie Jar-vis, Jay' Judy Mercado, rVifi,ky.Nguyen, Ty 1 1 Owen, Art Brien, George Roysellpgjkrvin Satuna, CeroIi r1aS3nrJuan, Laura Y Twoiiery,AThaQ,VqgfaOd.C0ach HarriejcNIe rrihner. Q V. . 2. Leure' her before presentinQ'GfE1fe iiHeClaes. 3. V The fun-ioving but hardworkmg officers of the Speech Team are: Vice President Ty Owen, President Arthur Hoot, Secretary Eilynn Biscocho, Treasurer Chmetine Campbell. and NFL Secretary Arvm Selma. uh. F VT. l 4. Jennifer Gee and Missy Moreno prepare to film another exciting segment for the Mira Mesa Update. 5. Gigi Gemenez rehearses her speech before an upcoming tournament. S, T.V. Productions consists of: Cheri Anderson, Lance Bowman, Kevin Crawford, Jesse Cunningham, Joe Dow, Mike Driskell, Chrisie Dykes, Jennifer Gee, lqbal Hans, Carolyn Jones, Kenn Kashirna, Dan Lamrners, Lara Liberty, David MoAdoo, David MoMenamy, Fluben Mendez, Missy Moreno. Michelle D'l3rien, George Flosello, Carolina San Juan, Lisa Sheive, Mark Sullivan, Kim VanWagoner, Paul Wade, Brian White, Kevin Workman, and Robert Zimmerlee. 7, Lisa Sheive and Cheri Anderson memorize their lines before going on the air. Q Fri, ,ir rye' viii f . f' . j 5 5 .if il ,ua C 'TP' itfipl, K .- 1 2 AZ 55,33 Q Jw swf: 4 -2 W. . .QW 4 It T, The Agape Club Consists of: P.Ca5spole, C, BendaIT,J. I.weuranCe,J. COOpeP,J. Anderson, D. Puddle, A.V1nZOn, S, Lond,J. Bray, D. Savant, K, BendaIT,J Dotson, D, Carter, H. Moore, Y. Arterhury, J. Lweurance, T, Toyne, and H, Nordeen. Q, The S Club Coneaets of: S. Caruso, J. LaBePge, M. Papa, A. Padgett, P. Ildg, E. IVlcCafferty, J. Padgett, D. Smith, I. Nguyen, T. Le, K, Nu5CO,J.Tu, D Lou, S. Tang, P. Nguyen, L, Nguyen, and IVI. Anocne. AGAPE CLUB! S-CLUBl ' Wa l I l . .0 75p'7?ad. l9U9dW'll wi .VV A f'9'.l7e9?F- '?P4'Q'h?lF?21,1fFl??W? 'VAAA Sf?l700'T. 'G0n7m'49!'.FYf F9 55499 .l?f?95????9??.f9 3Ff 3931. 1Vff95??. Q??.Pf'9??f?9L .'A A .' Kiel- - .--, 5 .. .-!- .M .,,v X., .,-:f ,,:,,,i .. ,. , .,f., EV v..,,, . . . . .Q 'H M' mmf W 4 'gy Hwmrwwrm jo? 3u?f5E?115M.iQf2i1 .,,, 2 f 5 g V .KM m..N....,,.. ig... 3.4 5 W ar 55552 M. f ffgihfg 8 -W K ,ff Jw 24 M a .M maui? ,Q,, 2 ' - A -' f iv ?f4:f, e:fzm fW:3v, .z ffi3 azlQ,f,?1ag3:5,lf : ,f ':'zf,: ' ,mfg .Q Q ,,,, . .- A- Z ff. , .g,Q,.1gM5g, . ,f W J ,,,, f f ' .?7iI?5iW:,1Q?4 , - fy, ,,,,'74 if17,7.L5fgl1'7i71,'ll 1' ffM35Z5?'f'52f!p,'I,?ffwX2,i!ZSZ1ffQi.5Z?XJQWZZX ' if' Ig' fl-l,',f179I5?g9f2f? ' 1 4 -W W C M pw raw 'Wi W ,. , 4114! N-JW-y, . W , I .073 W ,W ,Uhr W 7 l'f':i C hflf- 5??'l:l E,W'?7'i FQVJZ ',Tvf'f3.i ,', Q ij 5 if 'H I 9' f Fi: ff' ,ffw pw Qi fmvrlff fwwww , Mlmfmwff''miwwvf VN, lv 'fffclXWfzff'fMl j,L4:mg,f3QrQgM qywgya1Q10fJffff,L,,ggiMawg4gW,,zzs4g':,Wg ffvww '1-awgqw 'ww ,M W Maw, ix W lfiefwft, .' w ,V ,,.,w,, 44.5, ,Pig 1 .. - . wht.,-'z wumfv22:-'ffvwtw,pw,fifiH2w..,,,l,,, W, ww: f,f,1,,L,.fWffw. wwf ff W X ff. wf ' M,W.,,wh.W1,fwe ? ,.. ..,f. ,ff fmwww m?ff1j.w--ww. .lf ,N . f .,,,,M M. ,MM 1 V.: f ,, , ., 1' IW I ,J '-Z2 ' f' '4 'f ' 'l ' ' ' f VY wif' f ' 51, Q1 0,311 A ,fl 1 , , ,LU W , -' h fs, X,Q,w,x2 w uf ,. ... ,, ' ' ' ' m15fm.. ff ,'f,4Ww,JWw ,Q ...Q-,,w,.ff f,,f . . . . . ff fwfxww:ffw,.'w,f Www 1 .G . f . f A ' + ' .,ff'L' T' ,Fi A A , f ff' We wfv l W, ,- . b....m,,:, f, ,, , vf,,,f.,f A , f 5 ff-f f. x mm lf ,f,y,:,f,. , W 1 J vj 4 x , f Q, yi, lf . ,Z,'ibfh'44f,-620.1-xyA N 7- fi., f If .ww - x ' f 7 M 5 4 f ff f K L25 awww.: ,Vw 4, 7 4 ,.af,,lWW:,f1vffffw 6 1 4 ' ' Q , f f, , H. P 'f LA ' ff Y 1 1 a Q w Q 2 M 3. The S!-.DD Club Comslsts ofi J. Beaver, K. Neville, L. LQBEPQE Lalfierge, T. Owen, D. Ambalada, G.Textor1,ar1d J,Smytl1em. SADD CLUB , wi, i iii Y I 3 Tl :eaqfsf f Gi 5 ii A ..., N' 4. ' em, -.r 2 V ig' e E The Yearbook Staff consists of, Top rovv: J. Henderson, J. Mendez, L. Anquillano, J. McElIiott, K. Anderson, D. Geary, T. Aquino, K.Zuercher, J. Deru. E. Alliosn. Middle Pow: J. Velilla, G. Mullen, Pl. Matthews, D. Padua, P. Aguinaldo,V. Meinties,J.TirnberIake, C. Evans, S. Kaehima, M. Esteban, A. Sefkovv, J. Pulopot, J. Sefkovy, K. Nelson, and Mr. Saunders. Bottom Pow: B. Maruszak, J. Grey, P. Ordonez, S. Pulopot. C. Goins, K. Tyner, C. Posado, and D. Hedrick. NOT PICTURED: Jennifer Gracia, Natalie Woodward. VON., Eyani-3 Natalie Woodward and Gisele Mullen Te Hendereon, C16 an abgut- exhibit their fine talent of typing. view iyieifwieg' Jiiflyv what veafbm DSW 5 and Jenette -VVK men- I I in YEARBOOK STAFF 13,2- Seniors Photographers Kristin Anderson, Ken Nelson, David Hedrick and Photo Editor Kenny Tyner get caught on the other side of the camera. b V1-X ,elf ,, is :' M . . ,, gg u he i 'M .sf l r-essur-e ea ks earbook editors are not normal people, They scream, yell, become hyper- active, and experience severe epileptic seizures for no ap- parent reason. All yearbook editors have a distinct anxious expression on their distorted faces. Three of these mutant poeple exist at MMHS operat- ing under the alleged names of Beca Maruszak, Jackie Pulo- pot, and Katheryn Zuercher. lt is surprising that other people have volunteered to serve these wretched people as yearbook staff members, con- sidering the fact that all editors carry lethal weapons which they are very eager to use. Free psychological counseling is given to those afflicted by the wrath of the editors. In order to inspire the cre- ativity and uniqueness of this year's yearbook staff, advisor Earl Saunders arranged for some interesting provisions. The three copywriters were re- quired to spend eight weeks in the Altai Mountains of West- ern Mongolia, where they par- ticipated in ancient rituals de- signed to make them at peace with nature and the Buddha. impressed with the results, Mr. Saunders plans to allow the staff to participate in the event next year. While photogra- phers were in Europe sharpen- ing their photography skills, the layout people helped ma- jor worldwide periodicals pub- lish material concerning the staffs latest endeavors. All over the world, people joined hands and sang joyous songs in every language, celebrating and glorifying this wondrous creation and work of art The 1987 lvlirada. 4. Editors, Baca Nlaruszak Jackie Pulopot, and Katheryn Zuercher kept their cheerfulness throucih i ng, hard deadlines, 5. Copywriters Dave Geary and Andy Sefkow always had a smile on their face, especially since Carolyn Evans w as by their side. H Julie Sefkow takes time from her layout to smile for the camera. 7, So were camera happy, exclairns Pam Ordonez, Suzanne Pulopot, and Jenn lVlcElliot:t. - 44 -at ' YEARBDOK STAFF 'cr-....,,,f Aim ffiff 1, kg, 52 :gg , k Q g , ,wiimi , Q A. K . Q ' QR' - L- f 52 gl 1 . , ' i Q gfvlifg I I , J lm -- f1f2241ff:.7, 1 fmwigfifwrfaf-'H K 1 w' 3 - J ijffgfi-,-2' .. 583337 Li, 'fulli T' ' YW? ,gs ' 2 iff? .. A if gg, , M, -1 W W A fha. Q ff , ma: ig.:-Q K V sf 1 Q Q41 , W . . f y I f LM, wwf, ,,-. . ,, .. A Lg-yn, H W x v Q v-' A Time T BV ar-ewell .n the beginnihxgl a shimmering ligh appeared upon the desolate canyon of Mir I2 B Mesa. From this light, a highschool emerged, destined to be filled with warm bodies. Year S flew by, freshmen entered through the doorwa of education, while seniors exited through th golden arches of graduation. Throughout th V e years the school s population built up steadll until 1986-87 when BOOM, an immens overload of Marauders dropped from the sky o to the unsuspecting campus. They came from a over the world to create the Marauder meltin pot. V e n Il From the start Marauders knew how to hav fun. For those interested in sports, cheering, for football, basketball, and many other sport proved to be pleasing. At games, Maraude the chance to express true blue and gold and zaniness while rooting for Marauder Just can't get enough! For students wanted to show off sizzling moves, engage members of the opposite sex, and dress to dances like Homecoming, ASB Ball, and Hawkins made evenings romantic and fun PS 9 Who has spirit? Freshmen, Juniors Sophomores, and Seniors battled it out in lui time activities to gain spirit points and respect With dress up days, contests, and excitin activities, Marauders did n't have to search ver far to find spirit. With the departure of around 750 seniors 5 Dt 9 V freshmen class next year, and around 30 teachers leaving, MMHS will no longer b cram-packed and overcrowded. This is not good bye, this is hello. Hello to new friends, hello to good and fun times, and hello t a fresh future. No one will ever forget yo 0 U Mighty Marauders. YOU'RE JUST TDD MUCH! As the end of the year approaches, these students say bye to lVIira Mesa High... 'l. Cheri Anderson 2 Heather Paterson 3. Penny Eubanks 4, Dawn Underhill and Dawn Killian 5. Donna Wiseman, Charlaine Toco. and Katrina SanNicholas 6. Kerri Floseman and Claire Moriarty 17' 3703 Avenue San Dre-go Callfornna 92 - -' Photogrcjphs me if ity X X ,f ff , Af 1 1 l I 4HHImIFmu gnf:IfikmhHn2 lmmnndls Hfiwn mx Nmhnn Earuzmdlm iLHIEIl3IIBJI'mEImI what now .Xp ' I 0 X ,,,z if X 2' Pi V, VV ,ffkaizwzrf Ll rr fwnmn up 111 .1 umm nf 7lllllfyA,l!AllllQ1v ruvrfgwalf fbnzxx, yan: 1.1 nuff qf.-rf, L 4 r'nk'.1'z1r1 1 1 iw, f1'M.x yan 111111614 :aff bbw: . . . fkiuvuf L1 rf fzfmnn nrfnf V rrfwyf 10am hm, ,ffuf mffw lynn nrbf 'ffl-1-mff A11 fzjawzf 1.1 you ' x JF S LLle wont uou To Hchieve the Cptimum in Heolth f-ind o Beoutiful Smile! 0 Tooth G1 Jow Hlignment For odults ond children ' TMJ Dusfunction Theropu 0 Removoble ond fixed oppliohces Cbrocesb Jock D. Bortroff, D.D.S., P.C. Specialist in Orthodontics NllRFl MESH RHNCHO BEFTNFIRDO Dr' All vu.u1Kwxi.li:nd Orthodontics Exclusivelu In me Medical Moll In me RB. piezo lO737 Comino Ruiz 16787 Bernordo Ctr, Dr. Suite QIO Suite Q T 161 9l-695-3 784 Aozifzfza c!Qa.ncg flbzug X071 QUAHQOU Pnesiosm' 9984 SCRIPPS RANCH BLVD SAN DIEGO, CA 92131 fixa ti- . 'Wu office PHONE ,' ,ie 1 16191578-5347 I1 XLMFX TSGT Ted M. Starks UNITED STATES AIR FCIRCE RECRUITER USAF RECRUITING OFFICE 10717 CAMINO RUIZ, SUITE 158, SAN DlEGO, CA 92126-2623 .1.HM u 7 I ' Q f--X ll -L'lX1 'Yf' N x ' 1 ' ' L L ' N 1 'l 'v' ff r,.v fn rv - A7 PIQ3x:rJ lx -fXxN,,xXgxL'x-,NE,:xiy J 'xfxi UQM: Xfffl'fxlif-'Lxjgl5Lf:x,I'5,1TXfX1N,1':, Xffiju lNl1x!'xxflNf-X ,NC-N lxf,x'x N ,XL Lxlf., N :fl -l,f,lxxLX:Xx1:NlxN,lxfIN1xxlx. . , x ,. ru-Ilyxciilxfxl-'lil,X-xi- f.,sxls!i, xl A-If J-, 11,56 ,X ,nf xl ffxzx ,fx x-f-fxff, I 'xxx' N 1 x,x 1 x I , , xr N ff.. . xl- X ,,!- X Xxx - X X y f ffl 1 K 1 K fl f Q I I f Ql,.,I ,Nl-xl, 'XIX' -fl, lxf,NlXlX,xx X xxfl' xl -x- NIN-X 'x'-'fNlN,NlN',,-,f,',l'X5 Ixfsfx xl, -I, -'.,--f,,Nl-fxl X fxffXlxNIffX,I'1Xyx, -N,,xl-I yXxfN, 'X . ,pffl-Nfxl .,7,-.ibxfxxxlllxfxfx-!yxX Xxx, v.S, T ,,gl,: x f ' - f , I a ' ' P .4 V f, - , a ' x lx 1- X 3,1 1 xflfxl 'X ' AXGLXL O uno 0 o 'p x' N zfmffii,-' Z L , 1 1 'UPI' , T 1 1 HWY J ban x , GX, V if . .T ,V 4 IX C, 3- x - .- -1 - - i4 A 3 , . N 4 , ' 1 -, A 'I f V ,1 ffzfkf ,:, , , fx X, Xu Qdmvfmiswv www mc M f - W nv- , O fl , , X 2 Zi w g, , M' GY I ,C 'XL , fl , Y iii gf n,f4,f:f,, fl W 1,3 gf NWA' gbfy XJ - 52, ' an Q ' ffxixilfgqifj-ini lj I' Ifiiflm , it Wi'07i1,f' . K I-Ng ' F avr, , 7:f'iNfl ydnvimq Wu V in fgnlwi' 'PC x 'H f?5,,j N' -ffl X XHTQU pl ' lf M fi ,-J' f ' ' ,l f eguf X - ,f , 4' X Wlfifr. A I f'vWFR P A f'NuS?b ,V ' ew H+.. X., f I 'QB 1 nr vel -X Le ' Q fw- f.. N X RNX ' 'NO N -xflx 0614, JN! W M M , C X Nfl f 'DW 0 X '- 1, is , W X N xfxl 'QGQ X ,Nz I N N fxf fs X ' a1,,MHW4,Z,5f . A ',x1N 'mwa Q D717 176 f -ff X ,,, , X , N ., 1' J -UL'-f fv- ,r, - 'U' 'xl-,NNI n J , V1'.',,,QN yafbld'-Qlxl NOX 1, Jw KI .fQf l'x1'9y5 vJ? 2xZ1P'y j'f1 5' V 1' 'lf IKLXTJ yaodzla-llgiS?EyWdfZ6?'?Qf2xl!x ,E I ff ' fx I K 1, X- . 1 I X , I- N Q - I I 'V 'LLIWX 'Wa x N :Sig 'O NIJ XQEGK 6ffi75P,+i5a,e, N Q mag Asa 'Kr t lx Q XEIX. , f P-arty B , x 71 ,XL ew, X- may gf, x - sf V V' f ' ' ii 15' ,N fa xi 19' N1 N ,X X X , I jug ' ,j'f1,,m . 1 xl xx .XIX ,I , ,L x N- , , .fl ' M X IX I me: ,nf--, M W-- , -lj xXfffLQ,,igxuf.,-f . Hmxff X X A I- x:lTP:9lE:xxQl?il?' I N X ' g ' ' - 1 1..'X'- x 'x x1'x'l7X'fX N N w1XI,X ,fl - x Lxfxk .xif, Ill lyx, XXXl X , xXf Xxlxl, - f 4 'lfxlxx PXIQ, ,X'Xl,, .iuxilx LIRUQC, xxx jx' lxyxxl R I lxufxllfxs ff ,l:X,X' 1 X ' IXLXXIXIE 'xf NN--lxxx x- ,fx I 1' X, iff, 1 w xq,,N, --fN- -- N, 'N,x, ,,g'fWf 1 Ny, X, 1,XV,x - xx - Plfxlxqi ' PX-ZIIXVF tlxxxlx xx I N , VX -1 x X -1 X X1- -fX 'Xl 'f Xlx' 11 X - - - .. N N- ' N fx - +'11f:1f5Q::fTf f11'fv,x Xl x:X,1fvffw2.' emu .Q xl'1.sflfLfAI-N lX g:,gTlfl X-I If l-lN1XT.'Nl-Nlxl. If lS,Xx.l'x'lX'x.,xxx':lXT!:',f,x,lNy'lN'1.lf4NL3xD ,xx fxlxg,-,'l N fi 2 f f 'f Y Q , f .-f,,, 1 5 ii I 5 f Q J A X f 6 L ,,,, . 1 el M , na , L ,,VV , Z wwf , ff 2 , ,L A W f W 4 f f H, ,, . ff We? q ' 5 1ui ' w, .. A W' I, , , ,,, z and Amusement at the San 92122 17141 Con GalifO1-0. '6 ,Q The Best emi, d cnxev-29 B a in th e West 4545 La Jolla Village Drive San Diego, California 92122 2 - in University Towne Centre X . Skinless - Marinated Chlcken Charbmiled Best wishes to th Class of 1987 21 LOOK THE .,4,l2K95?aA.zA.9?aAJ 2160611 '84 J'7. .fddzlf , 552.6 ,, 34-'yfffbwwwfuz yung Z boaweuvnaf W ' M 922z...,.a,.,f'fe.,. aizcfaa jllfdwyawlem Kwan? The Women Together Forever! bi 9 3' S I1 .E .77 Christene, Laura, Jodi, Tracy lm 5 'H q 4 Friends 5 3 969 eae Forever! J B 2 'E s Otlx 0141 I EB kno W0 3 3 Q, we a1Lr 0, F N ... 0 Thee ap 8 -' I 3 'I B m 4 1? 9004, NIFF 630 N Tops! Q-ybip' F CBVQH ETHNIC IAM! Fm., Og -Q, E HONEY? 0 SUQAIQEQQ Old-out Mamas Bm sHELLsHocKz TRIO... We Mom, Dad, Kathy - I LOVE YOU! Words can't say how much l'll miss you when I go to L.A. Chaz - Thanks lor all the advice. You are a true triend. Harrison - No one will ever understand what you mean to meg they can think what they want, but thank you for helping me gel through it all. You're my inspiration and you'll be with me forever. V The Clan - Thanks 'star listening. I hope I did the same for you. Yearbook - Stress! I love ya! O UW buds wx- arx- I 'ou mi-an so xnurlai nx for helping mv 1 lu L-know-wluo, In I Las -Vegas, 'X Duran 2, :uagir :I The .WV , veam Warn e .f nn 65 999' 7 I:IachsISLLynn A Will Bs Friends 4EvsP Asian Invasion 2 Q BaII'B7I:IuSI:II3I?SD U Goin' in style Q Class of'B7no.'I Aloha I-Iavvaii! Lynn-n-Ed Wa have our' Pings! HEAVEN CEIAZYFCIFYDLHQTCJNIGI-IT I CELEBIQATE IVIY LOVE ALJ AUQEJEE 71 'I 99459961 E-'I 'I -'I OO Ona For' Ma ,wi 9 0 OM, I QD. QQ 65... 1 9 has st J flie I 1 o ti I zmai' '11 mmf il. lest if tim I Yearbook-83-87 crease Tennis-83-87 ,Doane Story The Dinning Room Drama-87 Dav- what's up bud? K,K-thanks 4 everything. Mom-friends 4 ever Larry-sober and free. Linda-I love you. Ken-yearbook 2 years. Jen-aIateen,Iife,frenz 4 ever. Dean-moo moo said the cow. Rick-rick Rick RICK. Live to Ride God grant me the serenity to accept the things I cannot change courage to change the things I can and the wisdom to know the difference. Ride to Live G Well merri its,...been! I'll miss u all 9th everything. 10th grade fun fas year THE Darlene, '8 7 Sly Shell8z Delirous won't forget. the flag team,Feb 10 Wendy's,Fresh Fest whodidi,run,Grand,others... We be friends Dreamteam Mt. Carmel yo spunky member Berkley.12th grade Capt. Fun but 85 LisaL. and Julie K.,86 Telia R. and oughtn let U know. Don't want to list all the Tracey Briley U the 1. Wendy be fun, Claudia much 2 say so little room. Janet be fun such, snake of LJHS '87 Cheer 85-87 life time BF ha. Well gotta go ...See you at Spelman CE8zDV Love Thanks to everyone who put up with my Ms. Beth thanks for being a friend. I wish y u think I ', ready for a relationship. Love you be greedy. Bekki thanks for teaching outs.Smile. You've got to learn. Rapper G, though. Thunder Cats Hoo! Boobz still a lot to for letting me cry on your shoulder. Teddy best. Mom and Dad, I know it's been hard, I and ASB Ball, My dreams come true!Prom ? there for me, I couldn 't have done it without worries are over. ASB, thanks so much Love Forever. Chris, I love U says it all. I cherish make me lose it. Janet Jackson 2 Nasty! We did Irvine, Stronger than ever. Good bye Mira Mesa. Class of 87. My 4 years o Love, Shelly Palmer I Too Sly.U Later MMHS! fMullls?2'llf'llls,l,,l Wifi' al,gf'41slEllf I ,llflllgim fflffnl, A A A ,,- THANX MOM Ke DAD SPECIAL ,FRIENDS- have jus' begun! I CANT Later Guys,Finally I'm out! Twelve slave driving years of school and now, Party Time! MMHS all the best. Iim sure I'll miss this lace p Naw!! Summer first, life second. believe ii! Starts wf UNI, now MMHS and look out LMLI. The curious streakl? Why-gy Michelle- Ya li'l puchi! Where's the beef? Penny-Naked bods! Innocent, take Kim8zAnna-Let's partee-Sexy Ralph- You've got it all luv C E. f l ci QQ c y Sean- I want you love ya, l in uh, oh! We be jammin'! Pam, see u in it A tit 'fisfaii Erica, you'oe come a long way baby. A iii zu! u and Chinese dinners, my life is I I Renee- jacuzzis, Smirnoff, 61 OI. iiiiiiiiliiissii l you're my silly bunny. RioRita's, y MEMORIES . Lucinda my bud. 5eagram's, yri yy BK, Diwhiffg, 5 finger mac. Always will love ly fT0ZPfgj,NTZjg5cQjc2j2 Algebra and strive for a llnsn IQFTW, B-ball, shows, Daddy, you're Boo is on her lliiyl pg, Down South, yrs of understanding, loveyf lll l y parties, emu, Disappointment if fnininlf I if ilii l'll i l i 5337 W :th beat' . ll, ,l :ll me Vylgll n,,, 4:V,Vf5E,,,il,,Tf ,V - in t' e u Outta here guys- so Chill! 53 , 5 All fo,-ever! wf l , l I nn beginning' on f' ieca Nfaruszalcwn ' be fo J' llbe 0 06 , Vwve printed more than one hundred million yearbooks... Than ks to you! 1 FII N5 Ed Shoen 13428 Samantha Avenue San Diego, California 92129 l619Q 438-1535 Congratulations to the class of '87 f5E'lL.L.7 Q5'M 'fi'ii...1.,, M1151 macleilllgluajnwnugfoflqplourllnegrvaledg Inv u Ilia luv, na encoumgemenl, NJ myvjnam my ' 1 ever Lael -aiu... I-14,084,675 ,2QCi,..i1jc.,...,.,l.ef ur nc ou n a lo me. our i .W1 ..uf'..,i,.7'Q?ftf.f ZZ Agfa ...J EI. ' II Iwi: ufwml-aJ ,Naam .13 5, ,l,,,1't'5.,'g!,,5g5.1... grifpgaaaax 4 Q9 Q32 564 QA Da cmdy' Loma' A ' and may umasine! Like A virgin! sail! oooon Baby! rears! ' Get a Clue! Whatta Cow! Scooby! Spare me! B-word! Water slides! Massively! Fab-4! Dobie Time! DNA! 0 we ,z 50 SN Reach for the stars! Slumbers! Movies! Chicago! z qiinli find By Hard Habit to Break! Tip toed! The bean! Nails! Slips!-'N Me! Renaissance! Torrey Pines! Flutes rule! Romancing! BW' on wh me Houston! ran Belliesl 5.1. shim and Ponytails! craps cows Gotta Problem! We'll talk about it later. No! We'lI talk about it now! Stoner! Guido! B'Nanie! Dancing! Film Express! The B-Gooks! S5 81 S10 store! Babysitting! Marshall's K-Mart Crew! Team Gemco! Family Fitness! Badmitton! Softball! Basketball! Cheer! Cross Country! Danners! The model! The Ferd! Sweet sixteen at last! Truth or Dare! Bike riding! The Pole! Nasty-D! TSSSS! Friends Forever! Abolutely Stunning! ls it love! Of course not! And Much, Much, More! Everlasting Friendships, Love, 'Bekki and Joan' To all our friends-Goodbye, We'II miss you' l ee ix 'Ill-IBM l kiihem- s CIIIO 'X Z 1 IUIES 8 CIIRISI SENIORS 87! I-'INAllY...WE'RE 0UTlll6T'S Pl0WII Rad Men1orles:FMRNI New 0rder lsf rowl Vlolenf Femmes 22nd rowl Fronr Dodge Darts 8 Ilre Blfelren Camaro fo Rablrlfs 8 Porselresl Boonslarnr Slrawlrerry, Corona Extra, Alrsolufe Vodka, and .lose Cuerro, Tlre Mollrerly Volee, Exeederlne 0ueens, Ilello, wlro loves you, I flrlnk lf's lrlnr The 6ernrs M6IlK! Dlxlellne, Vllllage X' liquor, Tlre Mallbu Crew 4-ever ..I need fo fake your plefure n , agaln.. ll2 day af 0. Normans, Morning wake-up oalls 0 need , enrU Skefolrln ls lrlfelren, Palnflng flre room 8 all flre olg breaks, lel's fake flre kids! long Bar, El Torlfos, Tllly's Flfflr. klo Rlfa's, El Tuean, Margarita Vllllage, WE RAGEDIII Renrenrber, wlren flre sun goes down so will Ire KA78AIRON:Take flrls oneIPAlIl86IIAD--BUTT:We lores ya Bill and we always wllI!.IEANINE8EllEN: I need every nrinufe wlflr you ROBIN:No slrlf Clref, No slrlf.MR. NORTON:IIlleeyl0R. 7IlEOP0lIS: , ,ff You're oufa slrape, l'll kiek your assIIAIMIE:Keep analyzing! CHRISTY: MazafI SPEARZOID: You don'f graduafe llll l988IIIailn Waller Payfonl IENNIFFER:TIranx 4 the parfiesIAMY:4-get flre Irad,renrenrIrer flre good.RON86ASEY:0nE word says If aIl... Il6III an ll :H I ' Il ound IUIES .lanraloas Mrnel IIASTA lAVlSTA,BABIESllll -V,,,.,,,,,Vf , 7,4q,,,,,W,., g'V V, j',,,::,,,f'if2,yV, VV - , LA,-S , 'HV ,4,V,,, :V V. f,v'w4,V,z:1-2,,,,wVt V, ,,,, , ,, . V ,V V. V . N ijWQ7y,w+VVVV+,:VVV7-V:V,KV:,mw,g,,fQVV:n!,,,, V- VV ,,,VVfw,p iw V' 5 f A ,s , ,,,VV1 ,NV f 4 , ,V V , ,,,, 1 f , I M, W LV ,N,,gV VV 4 ,V,,,LL,?V,:V,Vw f ,,,V1 , VVVVVVMWV' VV Var' LW--l TV , Vf: ,, ,,,,, V VV ' , V ' I H ' QZVAMV v V , ,, Q AVS, , :c,V1m,,wa,s,,VVVm 2,,fE7,,,,'2ziE,VVVV IW , V ' 4' 40114 V Z 'A ii. ','A V 'f I , ffwf 1000 WW ' 4 U ,if.,,,, mg - ' ' I . ,,. V W V V om VV woman no 060 VV V' V 0600 0M M0'Vww df 5 5 ,, Z, ..,, 5 4 L K 4 0 0 , , QV . ' V V 4, V ,,,,,,,VNm-wff-ff, ,VV H ---mm,,A577,,-WL ,, ., ,. ,, ,, Alta ' ' that wen' cm ww, ow at ,gf,:i,,VwV. :w5,VV':w Vwsm, ,W V, Vmfpwq V' M fr 0 ww I V, ' V Y., a j VW' , V .i V ' 4 V, Kg, 9 - V ' , 523 4 ,S-,V .23 4 V , ffrr 2 - 2VVV,,l',,f l- EVM, ,H Vf ,, V. f, VV 7 5 ,a ff'f,,V ,VV , ' , VV wV,,V V '- - VV Vivf, ,f VV f f ,,,f.VVV,V .VVV ,sf-V ,VV , ,V V V, , V gf V V ,,,, 'A V ,V,, V VV k , , , ..., ,, ,V V, ,, ,, , , :,:i'Wf41'3ffW'1VE,,V,,2ii5ggJ -f,ggV gVf,'!mV?VVV4'iEiXMMM? V4 Z' 5' :JW W V EV' Eff,-. VU ' M iigggxmf V' ,V V' if' WM A V V5 , 'ZVVEVVQ-QM, Vi, ,, , V' ,V V' .. , VV ' V VVVV V i f , , ' , , ' V, , ,eV , i V , ., ,, , ,, X ,- V , VVVV 'VV- , , - V V ,,,.-fl',,,,,i5?'f?i'VVV .V ,, ww, ,, -V,,VV,,,,,,,,,V,,Wx WH, ,,,,,,,yg,,,,M,h,, ,Wh ,V ,,, ,1,,,,,,, ,,,,,, ,,,1,,, ,,,f 5 ,,,,m,V,,4,,VV,V V, .. ,,,,,,Q, ,VV,-,,,,,VVVfV , ,,V,V f,V,,V,M,,Qwf- V- VV V 'f VVV L' A' V VVV,,,, V,,,VVVV V' VV V V- VV 'V V ,,,V ,,X4e4,,,,,,m,,,,f 1, , ,M ,ff ,V f ...,. L, , ,Mf,4AAf,9L,,,f W W. xx'h,4,,,,,,f,,,V ,,,f4,m , ,f, .Y .x . ,ff . g ,,, L, 4,, , ,, ,,,, ., ,, , V,,,, x.,,,, ,,,V,WVVV,, ,Vw ,,V..4,,,,,,4VVVVA--VV! , , , 57 y ViifaV :vV,g4f, ,V ,,,, ,V ,,,V4gVf' V VV , V V ,V -V,,: mf 1 ,pw ,V W U G f ' ,V 'ff V , Z , ,,,,V , ' 4 , V V' V f W W 1- -, , ,,w. i,,,wVL ' 'f wi f' ' 5 f f k , , MM , , ,,,,, ,,,, ,, ,,,,,,,.. W, , ,, ,, L, L, f fi ff ' V WW ,y , 1 ' VWQ ' 7, , AVVws:f,, V ,ffvmw Vf' AVQTWQV 1 , V , ,,,f7,JlVa ,,,vVVW fVff'iQ rl V' f , VVVVV.. V,, , , ,B ff! , , 4': 12,3 2 N ,www ,mp Y ,, A milf! -,V V ff, , WI, f ,,,,,V W iam,-,V,,'-,,V, rwi.-,,,f 2 f z4,,wfWZfKtsaU4y,,,,, 5 3, , V fi 2 V 2 2 f i ' ' 3 A , iZiff'j.z.?uL VV Saw? W V A W 1 6 X y Vw I ,nw W ,ZW Wg ,Vgm ,M fffff 122 4 fw V f ,V :nVff,,f,,fzw f VM if iff V-Vfw ,VV QM W: if S Q, X4 , gf ,fgwfi 1 1 M! ff A U M Zfwzgfi 45755 1 My A3530 gfggyf Ki! ,QV MW? f!Afjj,ff ff mfg! fy V' M .. 4,25 it , , , V V . f VVVV w V VVVV V ,, V Vf ,, ,V QM!! 1 lm. f finsffif I f M 2? 0 JV wffff QVC? wwfff f ff 71 mme. if f M WA.: 1 f V Wm fi 1 f , 4 V' f?V4f5V4,A1z,m, , awww f,,,2':g-WWW -5 V,,,, ,, ,,QVVm,,m,,,,, 4 . ,V,,,, ,VW ,,,V,, ,if V H ,,,,, , , ,,,, ., ,,,, fm , , ,, ,T ,,,,?j,,,,,g,vW,,. Agro ASBYEFIBU FFIENZNF ELESJAMA 4GET CC4 Y458! ILL TheTIME!AL- 1MomDad8I oIdUIcn PAFITYZ87 FLIP LC,GM,DB,LG, IndyJ8IAha VaIley!SFl Icome AIlthnx2GODFAML cantLns ST DA MadiosPALONZO WITHALLMYLOVEMOMSD. WITHOUTYOUGUYSTHANKST THE JASONZSIJAMESWHOHAVEAL DONNABESTFFIIENDALWA WILLNEVEFIFOFIGET MAN FIS FIE -IOI J,ADEL' Luv2myfmIyThfrnzIgrwupwidlIIaIwaysrmmbrThyosr1- painsWewentThru!Thnx4beingbymysdeIIuvUaII!WeIIkp Prtyr1gMMstyl! Lttrs8586BstFrn DOF1OTHYmybuddysII missU'JAMESIvUThnx2GODnOcivrlmadeitIALEDIA THANX2Mm8.Dd4EVRYTINGLUVYANZDAMECCAG ANGGDLUKNUFISENFIYHHANGLSEBFIAZITANXIIDA KILLRTIMZTAKECAFIEI2KRISNDARLBESTWISHZ BUDNALLMILUVNDEVOTNZMIBABEEFCETHANX4 DABESTMEMFIIES,HAEVRONMIMINDIHMAFIUCAN BYDF1AMA!THANKS MFIRegas!-Somedayyou'II be primeministr!Mr. MorganfDadIThankyoutoo!LARRYMy cizanowouarethegreatest! Keepintouch! LONG Livethe os,theJets8Ithegreasers!!C-YAIBJALDREGE ThanksMomDadSandy8I MichaelHangir1there! Debrah YourSpeciaI!LUVYAALL!!TimYuriAIexMikePAF1TY ON!!!JoeIBLives'on!C-YAMMHS!!!ImfinalIyoutofHere CIass87 PERU-COLUMBIA-TECATE-Connection AALVARADO CHIPMUNKSAREGO!TheBESTof'86-87SUPER SCOOT!MadnessUCSD!TheRiskSDSU! UT-DeIMar8I SDSU! PWELTER-no1 LateNightsOUTl LongLiveThe KJB!Brent8IKarlStayCooI8IOutOfJAIL!!RUDERTHAN YOUIAILEENARNING REYaIwaysBspeshl2rneNevr4getUr1XwesharedUrmy 1st!IaStS51Wait4meIloveUIOZBestBudS4IifeRBLYLA SMECODI-IespdrigWIdPrFunx POfrnzAIwyzRm br Rcondo'?LilPixPrfctFrnzMoDrlTm86ThnxManfamly AANGCAYA ThanxM 81D4LettingGo-I LearnedSoMuCh. 8IW!Deepest Appre-ciationCl'1arIie,YouveBeen Mylnspiration From God-IFoundVaIueByExampIe8IHealthlnPerception. May AIIAngeIsFly2TheirTruePotential.JACENACE 2 sermon MEMORIES' otOfGrowingUpW Beasts FLO:TP4ever:sax8I bassDENISE:reIaxTESS:you'resu- perBREE: thanks UJW: WeaIlbeILLIN'!WorId HereIAm! DEMETRABARR OPSOPSOPS1stitwasulamesPobeIicoNnowItsJoe?QN meUNIQUETECHNIQUEmustaIwaysBUCSD87TarW2aIl whogaveme-supportBYE2DFre-nzlmleavingbehindespe- ciaIly2al1myIilsiswhoRsofine4getmenofIuveJDBENEDI TO ldid it!ThanksM 8. DF1obin L. frenz4everRememberfunts! ChristinaJ,one-dayyoucandrivemyVW!VictorBy,Qy5q1,y wholelife! DeliciousIyHOTCouIdn1doitw,!olyouthanw' everythinglLoveYouByMMHS87DBFIEl'5O'Y 87FINALLY! I LOVEYOUDAVIDLIEVERITHANXMOM ANDDADFOPIPUTTING UPWITHMEITSNOTMYTUFIN TODOTHEDISHESITHANXPAMANDDADFORHELP- INGOUTLOOKINGGOODDOLDHOIPEACEITINAMY PEFIFECTSOULMATECTKEASBBALLITBIEDEBACH GoodbyeThomas, Oberhaus, Young, Chaffin, Yourczek, Durham, and Burke. FIememberYourOnceandfaithfulstu- de-nt.ThankstoMom, Dad,and Kyle, myloyalsupport. SHANEBENTON SOO8CQ8ABOUTTIMEOFIWI-IAT?LATERMMHSWHAT NEXT'?GlTMAYBE'?THANXMOM8I DADFORPUTTING UPWITHALLTHENOISEGTOMASULOM BAM FORD BUYASTRATISHANNONNITWASWOFITHATFIYJSBA CHFIOCKSGOODLUCKBECKIEI'MHISTOFKYFZBACH- MAN ILOVEYOUMOMDADDORYANDTHERESUBESTBUDZ NIVSTFIISHGEENANGIEFIAYDONNAANDGANGSLUV YAG UYSSWEETRUTHTCAREGREGMEVERUGB GOODPCILVESHIMARKTHANXNICOLECJFUFNRICY OURG-REATPARTYCLASS87CHIQ12JBARBA I'IlalwaysrememberTHELAKEFiSforgreatB-ballthe DOORSforgreatmusic,andAndyBushbythegreatsoccer pIayerwithaGREATsister.JMorrisonlives.Seeyaseniorsin tenyearsJOSHBOARD ANEWLIFEVVILLBEBEGINNINGFOFIUSALL,SOIWANT TOWISHNIOFISGOODLUCK.THANKSDAVIDFORTHE WONDERFULLIFEYOUVESHOWN MEILOVEYOU THANKSMOMANDTANYAFORANDSUPPORT8 MY FRENDZLOVECAFIESSABAKEFI THANKSmOm8IDAD4yOurHELPSSUPPOFITIMADEIT CLASSOF87GOODI3YEMFISTHANX4BElNGTHERE4 MEYOULLALWAYSHAVEAPAFITOFMEZLISAMY FHIENDHEMEMBEROURGOOTTIMESAALLTHE YEARSSAMTHEFUTUREISOUFISQGETHERLOVE GBACALA TodebsTlFFY8IIorillleavemytardiesa FRIENDSHIPtoJA- CEN8IJEFFi LEAVEmySMILESmyBRACESiLEAVEto MYorthodontistTOmom8IdadIIeavemyIoveTObilIIIeave myheartTOaIlGOODbye8-GoodIuckMBLANDg ILOVEYOUMOMDADMDORYANDTHEREST! BEST BUDZNIEVSTRISHGEENANGIEFIAYDONNAAND GANGSLUVYAGUYSWEETRUTHTCAREGFIEGLIEVER UGBGOODPCILIVESHIMARKTHANXICOLECTJRUF NRICYOUFIGFIEATPAFITYCLASS87CHIO12JBARBA I I HANKSMOMDADARLEDFORALL WAYSLIVE65S TIONDEC1784OURBEGINNlNGTHA Toall MU8BT VAV won MchIemlssbothofU TAHDY!DriII84-SS PEECH 85- ! KimASBSeC87 Laura IPmyGUPPYBUTT COCHO The Great FINALL JILLBYEDA TesT GROUP8 HthrJir TmaRobMk HAWIS THANX DOFITE HEATH TZFINC RIAMA CIassof87 goodtir Thanxh thanx4evry1 CI 1IIIIl'1 GREAT bllndfo FINEIJ eyebrowGFIEATGOLDSHARKthar1x2y' ORY-TEDrexCALDWELL GdbyMMHSByuHerelComeGdxsNvr4GtBndGooksCin LouBFFJaonWiseOwITraceBrn Bag DaniBekAnnJLAL GdXsLisLISKym boAniFY KYDLTLFFCH BGdVsKDFIu VUHawaiB6BurShan Happ4EVRJWCGdLkLuvU Mom DadWeMadeit!LCALAPP LCTJTheWomer1RBestBudsHoneyBut1SWEOn LYE thnic4 LCFarceFatersINC-B's'?-B81Janestoya,Y!JUST SAYNO-NOSKIRT?ASBGikieimiLUVYAMUCHO 18 BASHFoldoutFWAPPASPMEMSWIJMSCARYMARY JEM1STXX02M8IDCCAMPBELL CYAMMHSTHNXmapa4spoiIinmeIIuvuJulaIwyHmbr16 bdayBarbingrwngup2gthrurtopsAimdnt4gtIcepIntmov- ies? hehefrnd4svaSl'1wnthnx4carintI'1rwgd Bdtymsur Spcalgd byerIckgdBdtymsfn LygdbysLy4evaBCRAW- FORD WithAIIMyLuv2MomnDadF1onnieUAre-The 1 Thatwleans TheMost2MeILuvYouWithAIIMyHeartAbeerNJeannie V AreMy2BestFrienzMissUDonnaGriseIeCaroInLisaThanx AnitimoTimNRay4AIITheGoodTimesClassof87K COFIEY THANXMOIVI8DADIMADEITIMMBASEBALL U THEBEST81 ELODY81EVERYBODYCO87CDEPER- trxic ASGREATSPAZ? KEEPINTOUCHJLOVE AMI'?EVERLASTING HAVEFUN DIILuvUThanx4Bein EjKHS JVCheers OVI CHEEK 2TI-IEBESTP SON POSTCM COOK Sure MDJP LORICOOK afFCCChereI Mysplrlt2 HONG R I ENDS I URVIVEDIWEVESHAREDWILDMEMORIESTOGETH- RSUMR85 87YOURTOOGOODTOLOSEDEANNA OURSOOCUTETAKECARE''DUDES' ' THANXMOM- MlEFORALLYOURHASSALINGCYAMMHSCCERVAN- TES ARTYORWHAT'?ALLYSON,WE XmasW! Dad8f BABES 4YRSJUSTLIKETHA UDEVIL.JM HATEMEBEASTIES METARY DA GoodByMMHILuvUSTJRThanks4bein iYrImsorl EVEP '?SWIMRANC ITSFINALLYOVERGOODTIMESBADTIMESYOUKNOW IHADMYSHAREMMHSTHANKSSLADIESOFEWFOR ONJCOX True TOM DKMECPCEE MEICHER SPTOJAYCARDINAL WILLALWySLUVU'AELLS supportBUD WEFINLYMDIT.CLASOF87iF RALPHmLUVY CGLDMLAECA-N-ZDAREST ou' IvlGreatFrenzT Xlaf !JE81MHfond ScottFun IM OFF 2 SHOW LONG QUARTERS ANY1? FLAMIN- .1wLasLFz MIKE DEWEY I zifsqa, VX.. V 1- T I TOGREGIYLLALWAYSLOVEXI wiigg5LNEVERFQiI3GET THETIMESWEVEHAD'LOVEYiSQIEIi25315IEN:fMICHLELLE8 BARBIEWHATCANISAYWE'REEf?IgIE?iEE2IE OGOOD' DAD MORGANBI REGASTHANKSFGSQXQURSUPPORTf LOVEYOUMOMDADSISISTERS'A DE LOZlER RAGE, MY SYMPATHIES 2 LUCK 2 ALL. 12tI'1lTSBEEN ATGREG JSAJA1rak THANXIWALYFMT F THANXMOM81DADLIALOFYRLUVSSUPRTEMNOM 'RECBEANSMISSNOMREGEMCOBTHRMSIMPNTS NMPHTHANXAIEVRTNGLUVUBOTHLINHTCKLLUVYR CRALRMTHANXFRENZ-4MEMRIESGIGSISQEKJOAN Sg1'EJiE-8AMORETAKECAREBEARENEYAOWR FON- MANYTHANXTOMYPARENTSGOODLUCKTOALL THEBEA .. QJONNDENISEILUVQBOTHKEEPONTHERADICLDE- LAI EgEig'Qf'Qf'g6WAQFQEEQSQrgHXEfxQEn V'NETRADITIONUONILOVEUWTUALLMYHEARTIM gI'IiIIA? RALLTHEYEARSOFFRIENDSHIPALLTHE Y0RS4EVERTANKS2L Y ETJDAVEBREN- I YSWITHMRTHOMASYOULLBEREMEMBERED DA81CHADWICK67MS1f ,.w, AL NITEBONGSA -Q Om TH ESHRZJINTEDPRTYA' I ' A Ziuq 13. : 'f'1 'il' : ' ' A ILOVEYOUFOREVERMOMANDDADTHANKSTAKE UCSDLukOut!WatMemres! URTheBestLONNY-Futbl Feld HerWe 'cum' ! I LuvU!YorStnds4evr, HD! PPSecrts! AIR8 HD-CACuIer-HEIAMY-SQRHedLits81 LatNit Munches!OOHBABY!ThnxMomDadJaSar4evrythngIIuv UKDEMATTE r 81 DADTAKECAREOFYOURSELFSISI'LL ISICCA- WILLNEVERLIGETUREYAR- ANGEL LOLUANA PETER DAR- CARETOALLMYFRENZEUGENESANDRONNIEWJIN- GOYANGIEDONNARAYNIEVTOMYLILSISLORILIE143 HEYANDTOMYBESTFRENZMISSGJAZZGEN 1A'E3HELLER,URTHEBESTJVH5254PARTYFOREVER ERRER MOM81DADLOVEYOU!BESTLUCKRRSOJAKC!DEE LUVYABESTLUCIKWITH MARKARNOLDALERT! I HAVEACOOKIEFORYOU!DEBYOURTOOMUCHIFUN TIMES3IBTSIJITROYILUVYOUIMARCH22!MAYTHE I E E22 SS s .x Ks w X px ' L -: . A A 1-:,,:..g: if - LUNCH UBSFORE- 5 N i, X.-- 5 ....H,5,, A -X.. why, M w .--,,L. f f':k,,,fLw.f-,K,.,l,v,m,,a, ,L ,X .X ....... . .53 fx-Q.:X...:g:'.. 2 1 is . 4 X XX- 1-SR 49-iii?-fi k1i,,---324555,fisisriia- .57 ifiik.-EEE,i15T?11'i5355?Eg-gr: k -fif- yi Q 1 A gi 55 ERIN BECKYWNETTELOVEAYOU MOM 81 DADHOLDON TIGHTJSKCMISSYOUMMHSCLASSOFSNSTH EBEST SDSUHEREICOMEPGILLHAM , 'Kip' GREG8MOMICOULDNTHAVEDONEITWITHOUT YOURSUPPORT,MYLOVETOBEK,GnUIDO!,TF1ACE. ERlN,TAM1,aJo.D.SPABKvgATHANkSFE5WF?K7FAK4N GME S yClose TAKERISKs,Tou RcsUlDET oLlFe. lL0vEYoUaQ 5 AQrever. A mGoodByeMMHitsBeenQreatToTraceDanicinLofnJoan AAAAA .A Af'dAfmRemembef16b'f1hdf:wSBQ0QKSWa1efS''QGSA'' . A , A A if - 0UrdreamsMomDgi gpm-CookneCmlou Britney 2MyFrlendg,?f 5f2gngQBraln:mQymrfe'prtyn'gtsW8Q h ChaunteIIBethanzILmg uAIIVeryNfg'gQiQg:hYmuch!!!! dsrtwkendai , fi4Beaner:Thnx4Iustemng-RweBK 1 BGORMLEY fdouwetffii wiffme!MomaDadURswckwfme4 AAA , , AAA A ' , T TnanxMMHs1affaAmlgos-Twasrun-vvmLongHeCauTP a'Tt'e'n?eAfi S5QiYWfhn9U Vedoneme PHOL Z - Aa? I -f '- 5 4 ' fx .' ...- . - - 5 --:, A H E K k yDEZ JobW1thFiobt81Tad81BobbysRagerJune86-Henmburge BYEBS? Lf-7 5 LTHEGOODXTOMYBST! sp HallxjensenUMadeItBe-arable-Thanx2MomiiDad4Puttin R E ' fi! U W-tm-NSBS-N OW2.ReaI,WOrI d2BUH CMU M IKEGR AY F R N D Lx L'-1 A 411 X F O R B E I N G H E P ' f BRINGGRTX 5 . is 3 ITS DIS-DIS AT BEAC QQLOVH TH E PLAC E L ETS THfNKS MOM BOBCASENT OT? MR ELQSSQQTQWWS Goca YS QQEFUNWANDYN MIHAN- 1f LSTUDSMY18 MELETTERSWEWEFUA 'NS '7l-O ABHUNTER QNI,-Yh ED EL UC ES R O N ' K R L N A N C M A TT L U V U G U Y S B Y M M H H EE' A Q '1 LOUCSD. , .ALIs3LAIl?1EgLJ1iL.iR EBRILLANTANTHR - . . QVL -1mvLL rtfruends Auomysmw f f TBc SmrALwZ mfunmnonwelwe gwgQi2g35QQ if11SNofman1neTvJim - Am L A YHY1HONLYLOVEMAHKIQQZWWTBfeH'if7'URf4 Liilfgi . me2B0fLme4e5E Ql LQgQ 'SXYSYOPU 'f - A :--- ' h':f-: A LFLORENDQ 87 A i M gggbgfggmgggg HEAT? Thaf1XM0m8Tf'mDOiUQNW?igh10 Q R ! AA W' BUT G0diikeWiSd0mS5BMU!WSOCCSI ?Fifi5S3giLgglQ?qe3iAifA AiAf 3+UVUPARENTAL34YRPAT'ENCEG-GALVANTE C ta'nNotTooBadHuh'?Steve OOAUHY ,ic az A I 11 :m: :'k G A FUGATE ii 9 W AAAA m YZ' . . ' f 1 AAAA Q A AAAA ' A A A HOUSe4WeR?'f 1 A ofyawg-'ilBek1ck1nntun Dsu n NC RUZI N M ASSG4x4 Sth 1 Q t O beg i n a Q feat tu My . A A A A V .A AAA Y T1-uNxMaD4 m UFZE'R8LUVU2!LUVUM'k B 1 enoushfvfif Q S SUDp0r1fhfOUQhfhOSQfg Q !iP?eS A 7 byrFf?r2auy.vANbsrBuDs4eAva2fsEi1ESf2z T0ddwewi1t Hnsimhefe-'LUVUK g ifg 'ded0THNXABNme'eSHEL URmeGRSeSu N53g L55iSQEEYA'Kf Q -ILUVU'SAD2SAY ii Q : iifiii-ii i?3SMYl-UVIUWOUWBWOUGJH!D0m4QGfSPEC'A AAAA AAAA 1 AAAA ' v A AAA SUWN 4 S ' LO N E za A FRA I Di- ,KK' ' WaterPolo-TheREALMansSport!4r8BudsESCFJSFox AAAA A A ' awsomepauMa-myBouckMyowns-LUVUBUNCHES NEVERM ':.: I Always!NomoreSpeedoSwimpaIsMSJMJS81KL-missu I A awoffmfopfcMzunThanx4evefymmMum !'LOV?ua '!Bei3 L,,, ...L EM K JGDGEARY 3 , yLove CmdyH, A A A UfNOfA HWj5'gg'g S - A, . 1 ., ,. k: , atheryn- 1- L, ADaMeCC8G2f1Q1LUV5Bi5iVfi Qn' .g - k-11-- '1'fX -VIIP - 1 4 F f .,,i , . DeannRichFiiChUm9N3if4 EJ B ' QQQIQ zq: 1 ' .. is erewecome'Deb Diana TorrieYou'A1,,i5 A 0nlvUHeWGfaQelBCANUAi f i -irf irilz' : ' 3 A 9 pf 'K 5 E embennssfimei-everlkennHove A Lgh- A .:fL.. . . i . , ingm heartforyou 4,eVer!iBroCk AAA , .. QQ: ,. . A A A' B 52 f 2 -f R utrr t K S0Gl3d2S3Yf3,60dbY9! 'HMV I Late' Dyg AQLFH M U ULGO ' SPA 1 DMSABQQENTCOLLINS I K ' 1 Wen - SUE JAA ' A ,P V ' A . 7 ii DA A ' f A , A A --E A SEZUZLEESRLTVSEZZEZ S AQAA A A ANXY4SYPcgggLg5,gfg,gggyEgg5gggg , mmAA v' A A. Q QA 1rfNALLsEQ Hvf A E A QBEACH L , S - ?f'E? WFREA f AA I 'ug U! J?'tBfiiSj M A HALLMYHEW'MHAM'-'N -LUVA ! l2lf11 lO A- ties A AAAA Slay AAA eepawav mm 2 QWS- A A A LUCKQAAKW GAND Nick 1e:sfUefAsum mg BLACKBOYS mas sumf 2 my gan END,HEATHERREMF'Y'BERJMS MAYZQUNE LTABLEMM X YVH-AT...i 'bud the Big ou nohow 1 feel or U Should! nuvuau Thanx' Q AVENTHNXKIMMIE-hlsxs-REACH Novvvuc f AAA 1 GHEWELL A it Qggggggagbfigg-gggxHsNEi ' 1 , A A . . i K A - THAALS A DAD4THENc: Rg 5 QS ODLU SEPCHINESQ A AVTHEBS1-OF .V QEAULA FOR BRI NGING MET!-:XT o we FREN M ANXABINGT E A E b OWNSOFSENIORYF?-TJTFNPS YTJMA A ' GROW L f IZEICL SEZDOWNS.KENREMEMDBERD1?-ALEQJEQEQFQYELEQAGEBEE A 'gQOMMY8BE2EF5gf3'i?SRli,'ggS55ifQE A 4 A A 5 A A M A T - U A -DuANEaALLMYB1gQsATBrBLEsTuDv A A AA EVER CYA CAPTPPUF 1:,, ?iR?iSPEECH873fCShGNM0maSG1Pd012i - f BROJOHN8L. ,qf .gA?1 i1iSf gg. g EL toftht ar tmabrown S4eVerMAR3 , w ,.,:k5igf:f ,1 3,Nw!mG0nIlvrnyMmnQ 4,5-FufiQQ,3wl A1A,i QA11. 9 C p Y A I NoGoALP ALSSs l Az AiQQf?i g ggi? QQQMNHODYDOBQEMASBMIFOLKS g 5 , Q ,E yCnsQgl Psr,Bu1vur If Q , 3 JSALLMY JG EE ' AAA A A W A AAA i E an3SYGf3bY.We'llMfA93k i s k i! Aw A AAAA A AAAAA A BYEMMHS f TTAH EBEQQDSUQH AAAA11 A AAAAAA ' A ' AA B ESTOFLU? DDSXS LJ KKSKRUSTN QS Q A bf' MAMf35f?5ada9ftmZ'Tef?SWWanW'i5 A A RON : A FROMWAIKIKI ia hnxsmuciyzmysIsTrac1G:grsa. BfOllf'lhTiklS8nA 1 M DA DTHANX!TOM g3g AA ? m EW?-MsyDeeTk1ienSqkBry8imchmchmor.AIlmyluv2my ' SwEETEA1 ,gg A.f!i 1UALvvY2'DEAR BYE i f A E +' AmygeSS4evef1TQkCafeeVe'Y1-1987CHS'UNG - .'A.i 'm.1 . ' A AN AA AA nvrb4hvu?3E4?ofrbpronobziiyuBEDEMnJiIvusonwshuh5Qg535 ship4EverfMefQ, m LQQQJQS3'S'0DDATfhe8SUD9f pelyf2gthrffQfA OOPlsnocrslikiIIlvu4evrBonthsSpcIxsIwliigi? yis2gQther,5th-152tf?Qg h - MeNotHere s2AIIMy aiwysrmbegklstbmtlstalmyEimwarmstwshs2MATHlAS , 1 portQale Efiendf3g4TheGoodTxm A,gQgs4everGood Bye AfymwuwglfippruwbfmbrDLnQ4xfrrufGonToGDzlK AnT.KQ YNH ,V h' ,SUNPAHTYINGC IZINGSENIORITIS H1 ZAA MMI-15 kSfUURbf1HMKUFfQ5: 4 :55 A MMHSTOFUNTHANKSTOSPEC A FRIENDSTAM MY DA f AA T7MikSsG6A 'h3FCUfRbI'thVGfUUhi'f'5lX,-5, QODSKTISH r NA A K is - S 1 kLV,:h ji , Tgggf ,,,,. .g1:: .. - 5 5 1 5:-:: ,qs kVkhVV : A i my S- - A Q - 1 2 Af.. . A AAAA A A fAmbNfmnQfMODH'ShOpfbnmKdiiidasnichi AAAA ' f AAAA A A AA A i A AAAA AAAA1 AAAAAAA THEBA gg5oNAsBasnLLTHnNKTHATwEa2g,AQosgf3g5 AfALA AAAAAAAmLg3 ECT fi LATE2 AAAA AA AAAAAAFECYRATTHETOPK'DDOlLUVY , . A AAAA AAAA OFFTOTHEIVYS!MMHSYOURTHEBEST!TH?fi5liXM6M A AA a DAD FOREVEEQXIHING TQALL MYFRIENDSJKFT ooNAAA AA15Ge3ATheS?F za D4Ax:Y5Qg g gA A5igg515ffwon1sayByeA2B est A D 0 N T P AFQYTAQ QA1 A H D J U L K uv: IG A 1 R BAAAL S gd Cf D B A 1 I T h eS pee i as DANCINQQDISTILLERYHAILUVUWHAGADORN A AAAAAA L A 1.'f.A A . - XL.. YA MAN A A 5 A AAAAA:BSTMY'? AANNARBSTFRENDEVRTHKSAEORTHE AAAA AAAA LUGHSAQA AAAARGTROBWSNssMoKnNc3PmYBuDsT A A AA A A A A A A LkkkvDR'R-Mi z SEEALMDOWNBUFFBHCSIMMGETYOUR AA AAM.D.BA, AAAA X- A AA AA AHEADQASLSIHEWQNDOWCHIPYQUR4r12MElLuvu4 AAAAA AAAA AAAAAAA A A ,AAA A A A A EVRM MEADSQRYFQRALLTHEPRQBSILUVUL AAAA A A A A AAAAAA AJCKVSBTLJMSPI 3?gESAEf31?AYJE4SN?LATERRHONEAL 1 AAAA ',kJHOPKfSig2Li,, ' V2137Wenii?3f5Ai!ll?4m3i9? A8Dadwehavebeenthrough A 'AAA ,AAA A'AAAA , A QAZNCSTOHII f 'GHGSGS 9Ci3HY AA AA AA'A A AAAA1 AA-A D d 81 .IB T -L k -LKL -VAA ' A LL' A-,' A ap FTTBZ AKAI feam O Vihk f?A3?3gi tgMgTMSOWELLrO ed' OO Outsmmany 1TSOvERAaA1hnxToMomaDadTheBeS1GF1UP1A LUV2MOn?AF2?5i5?'?fA'SLa9f?E3?fLAB?3?A?'ANDLOFF AA A AAAAAAAHAA ,L WAX- AA ' Gr8FrdRniiigi1?rQmFidoHung8L AI WI'1atAGroupILLNVR A AAAA I A A A 4GETUGU5SfSQSCOO Teri10fAKindMYLUVTOSA-IFiS- A 4EALEChQSEFf5iiTBELMifEX?SREi oe-HLATDAAQATclassofewmeodBIQSSMYMLOA FAST LA N E5 7C H EVY LIVES 1 S K1 VSUAHUCDAVISFYIPSBKENTON U HERE'COMECUALL'N1O A P221 ' AA A AAAAA - A ABY'5'MCMATTCf01987MLH0EFiR CWMMGWDAOWV1Und9'ThnXMUm'-UVUF'ShBOYFmdS4 Q AAA. AAA1 AAA eve-2rJuIes8LKamRmbrAHfunBwarsurfme-tsturfDUrmbr f Mrqes5-7wrdTmsKATa KARBetr guysKimamTnsTnnXTr.aS.1enidoizeucriwsuffefsmore- Bg5tg1L8AA U mite? N A ! J 8 CD39 nl? ESIUV Udrly spectEHhvfnItaIyMThnxFunchesGottaJam DKILLIAN sta LaVsta. A BABYHmCmng872mch A A A , . A AAAA AAQsABH giiAA wA2f1ssD AmaDHuvUJuSTUNLEvEAU4EvERN SeU'OfY?21S!Pf'YhL'NHS9SPeC'a'GEM'N'VSOCCeF - NLF ALAA A L RQQHOUGH AAn Q1igLQfS5fSyAQuAFM1LxIQg1lAmyFffAeQQSLvnnmAyff1f?Qd459 r an eCareOf SaJa-ASgAg5 'A -- - QA A 1-L AAAA AAAA' K5ffR1PPAF?2TYSYl'AC ' AAAA A A AAAA AAAA AAAA AAAAA AAAAAf AAAAA AAA AAAA AAA AA AAAA AAA A Espoffrhsli NBERNJuAdee1nayvmzaa MA-A .AAA . AA.A erluvs AAAA nw Q Y AAA A AAAA AAAA AA AAAA AAAAAAA AAAA A 'AA1A A - A -A AAA AA A A AAAAA bros, love. It AAAAA Thganxalsqgbhon. mina, gloriakgileeg gggrahfor MORIESRQIZLEBIM1 UCHSKIING bemgsuqtgagqod frenzforeveggx A Y 7AV A' AAAA 1 cf ABLE MEMORESAA 86- WO- CLUB' A Thanx WYQQAAAAAAAfAAAQUmimeS29 if UVA? Aput' - - SA AAA1 AA ' H AA A A m A tingUpWithMeAndfWi'ihUTheBesEEJflfE1CkIn+E Eiuturel QIBGIQEAAEEAQ-JHSOHPA 4f2hQ1L4pAs-LQFQEEYOU DOWN. ILU- A AAAIAHANXMAMABSSAEF-i ii AAA A n3AogiNPMoMDAD A LuvumovvraDADoragsofa7Ru1esAAf Semis ASHAKIA A, LACSAAA A AAAAAAA MEESQIAESSQEQZAE i f55GUTf0UADA'-'VES 5 KEDA AAAA 3 AAAA A AAAA' A AAAAAA A A A -AMA N!WA 9NT4GETANY AAAA AAAA J A AAAA2 OG AAAAA 0f1 4A A AiiQyOU OA A AAAA A ' LJ AAAA A' AA A A A AAAA AAAAAAAA A BAGELSANY NQA A AA oTToLaura4f1g3Qga BuIlYoure 315452553 HQASPRTVCIALVUARLYHMBRALTH A AAAA We'COmeLAMBQH Omf'rStSQuA'AQgQtChOUt4'aAd- ALALWYZBASPCLMMARQL3 AAAA AA dewLTGO423K 'QiSAA?A2E?2-'2TF'AYfMYBAHHSYP!GLWT'm AAAA AQSEFF SSSR AA 590313NGMYPRFRNZGDLCAKINAL DAD4eVef- LRSPLL2M5GMMYSPCL AAAA LY In A VUGDBYMMHSCLOFS7 FirStIWar'iTTi5Sf8yTfiQf A AAA A THANKY E1 iS3 ii'5E1ERYTHlNGILOVEYOUQTHANKS AAA AAA i E E S gt th an ks M r Durham Mrs A - - 'A AAAA AAAAA AA A AA A X A AW'LLLOVEUF0R5YE5?AUMEANTTHEWGRLDTOME! MMHSfuHUW!34'85f?1f???8?CiaSSQ?i3!fiCi1N0e'4Sf8ASU- A TEDDYBEARf5aNDf'igE2iEi.fi?3'NEFfAJJENNWGS A AAAA 1 AA A AA FDne-WHSSQQQJSJBEAM?Q1E33i9?0'5SWE?lQVUHII!LiSii1QADUdA TA 5 . AAAA M M al BST Ofx DUCK' Ek feme Mm A A?rRefQh!QAUaTSQfSW0m UHGSAYGVATIHWHAQOYMAEALA- A EXafBaSEfQif!f4?3l5QiS?24?A3?AAgA TIFSSHANMQHWB-2Qdffn2 :VASE A A 'JSMJthr1x4bQAfHjfQiQfQfLuckKEVlNLvU!ThnxYlDM4 fQRWAfl3ffQQgQAKEYA AA A A AA AA A, A AAAA A A , A A A AA A . andnnp11vengaf3e4zAAAQAAgECT'CLZ0F874EV CSJOHN- gAsvERusAwsBfAcARuN13 gA LQQQAONEANA QNLY- AHAEYHOLETSGOGABBAGABBAae1AEvrTHEAMEMEK A mr,A,,,,AAAJA,A . A A L A AAAA ,A A AA MA , A A AA .A SON A AAHWAAA AAAAA AAAMA, AA A . A QAALQAAAA AA,A AAQAAA AAA AA A,g,A,,,A AAAA AAAAM ,A AA A A A, ,, ,, AA AAA AA A AA AAAAAAA 4 AAAAA A AAAAA1w1i4sAHEDWITHITTHANKSAGIDGETGEAAANCHRSMQKEMIAAAA+A- YOVICVWESPENWAYRSATMMHSWENEEDABREAKA :Tnng4AUAA54AAAAiQ51grDad4A1ixf igzg5cffgZsexeuMarauders:1AAn ACHELELAURATAMMYANDALLMYDRAMA1461001 THEBEACHFQRSTDAYOFSUMMERIROMZGREGCO AEBA EP.LLSES p P A D B b I MUSICFRIENDSDROO402WIZODDL MARTINEZ A A A AAAA AAAA A .AHA AAAAA 'jiAA0Sm0 H ll O rom a A SMOSTAYCQOLDUDESTHANKSMOMANDDADFOR- Agiggdgfggsgggggfsou15g dj1gTimeggetmgoodnuckg A A EVERYTHING! QEYAMFMRSARMBQAAWIAHADLOTS AAAAAAQcnag5AQgggaggusan1A Af A AAgg1iA1ucLAKuTnTccncLuv :ALWAYSHADANEXCESSIVEDESIEAEQLEARNQDIS- OFFUNINTHELA A JHANXHJUANEAQGO AAAA AAAA TlNGUISHTHETRUEFHQMTHEFALSHNQRDERQSEE ...A A --AA l - EF AA A AAAAAAAAAA - ' SENIOR NIEMUFHES AAAAA 305 2 H::- , DENCEEQETHIS LIFETHANXMOMDADEVRYBODLUV2 ALLAgg52E2.N.E. P.YHBKEDITORGODBLSSBMARUS- ZAK ZII h,L:-- L L LLLLAA A L I-g L A L ..:.:',:: L New L LLLNLLLLNL L A.L IEE, L ZEEZZL LL L L LL L L A ::: ZLZ .:,AA L L L CLEARLY! N MY ACTIONS 8 ZWALKWITAHCON FI- LLL LL LLLLL, L LLLL ,ALL L L LL LLL L Z AALMANYVI EW'SLLLOVEYAlSgi1?FiY MAN BON E THANXMOMSADFIDMHEREQCOMESAQNPEDROSJEN- L QWQUE L i Li L ThanxMom8LPop4everythinQThanx2Bes1BuddiesBDRL SSKRGoodIuckPat8L MiQueITotheGOODT!MESwehad F!ormies4everSurf4everRickLaschCLASSOF87LOVEU ALLSQgmerdaysBAFKBIENAVAFIRO LLLL L L L L L LL L LL LLL L AAAA LAM. MON! ADURTHEBESTILLLUVYQUALWAYSDAVE yalLuvygwomenAJAAg3iL!3ustlLOenyg5EraceChnslgPwedTdat L m 1 'if or1Mbstfmd4AALEVAmnygrQyrsLuvYa Nhrihaelmnyfqfzo- ANDAKENNY-BESTFRIENDSNEVERFORGETYEAR- nojuksnegepeFfvreeeggeunesPigiesLpufzTreeLPerefxivee LggunxneeLEQKLLUVUBABEALLC1.AssOEfA87 KlX L LL B Y- BOQKSDFIEXPLRTNS-VVESTSIDEEA-RAB-4-HLIVES LLL LL, LLL H EWS LLL L L L LL LLL HS MOL LLL L 4 L LL LL l L L FLOAEQESERJ-GRELEKL4ROC-GEMCO1960-TQSQTTTPLKL L L L LL L L AL L LL LL MOnggggg3gggigeBradALEQ533ShrisChazC3iShcrew8LG1S 3511-xpgi, LLLL Lggiotothenegfworidmomggddadthangggffgyery-ThinggpiiLL LThnxLggfTTDURgr1i5ai5iLigsaUfflgdfrndFurmBioLnchMMl5- 3ONf5Lg35L4LAp1uvgLSugLpArf37QnGQg5LbAkg,ggcefgimgggg L sasatsyourtuynil.uvUalLl2alirf3yirenzlamgggngtomnssygge- atghigrg3sovrnwFr3nLPrsrAIlhdfnitblMrKKenStphKarma LLLL L5L QQA?dbYeM!!fLif4eSaH'QhLE!4iQSTECLAB9LAL L L 1 ggfg4i3SggL3ggU?3g3gfgL?ffvU:g,QL8bSfffH2inWf'dDBSAQVT LLL 2 LL L LL L AALL LL LLL LLLL LLL 9 if LLLLL SP-Q,LLALL QQntsweyourKNEvlLLE L h AALLA kLLL:: IQZ A 'L'k: ' -'-:LL LL. LA A -'hk .. L--'1 :-hi h' A A tL L L L1 AALL l 1 LALL L LL L L LL EDL1Bw1a1L1 qge nFLofeveffgsgQiaHQAGLSKLQWGW-'SLYQQ wi L ALfA56P8f8iGAWSS?SbAUfOUffffE53ShfD5f-fi!lQQ?ifSf0fevGfIHAEAAA GG QEAQMZWILG DFRENZiiSLAKUZ'N:ATTSLSISLTAP, THANEEKJKA'-ESSNHAT?5'3NlLBRUN0J 534900 A AAESV'ES'fhSQ?Y3! -afefAf?S???Yf3SB fY'Ld'?iE?'meEEM9F?i5AA TMDQAEAFL TH 4-0730136000 LA FFS SL F U N - LLLL LL LL LL LLLLLL L LLLL LL ?ILLL A LLLLLLL 1fL j L Vihz :::L mm A : mAL mLb: LLLL ALAAAAEEAAA LLLAA f LA A AAAAA AAAAAAA ? AAAA ' Awifh LNSAAL ATHALiiffSAM0M4E1f23f5Bi3inQfLUYLA?3E5f0fhef8fSf51+?fSSLe- AA AA1i?iiAQOfnfQA'ifQeLvvUWISE? 3dAnvfhf19ffS?OSSJMAQQ?1?A WBWCCSMM LL LL LL L LLLL Irs The Law A GIMP L L L LAA A: L LLL LLL A ALLL L LL LSL 7kh-: L I 'k k-::: A ,-:: f1:LLL 1 AA A A Ikf A Qziili 1-X- LLL1 ff LL :hk X:h,, L L4 LLk1Z7' LQILAATLAAALLL AA L L1ALi1L --LL ALLL A L L A L LLLL'L .L.hi- -'-- LL K1-1. L' , ' -L h1 LL A YLLL ,L11, - AAALAA AAAA KTM i TGAIAIAEAQLQWGYQTSSTQSQBHAEGTNLYQAAS-fA'SOT0Tf1?fQF?G0DleAALAAALEYAEMJASJERTRAC'BLLLYREUFIDESUNGBREEUP Juuecnmus vu never forgefA1AAA2i1i iiThenxeL Ted! LAAA W LA ATE8g-87RmbrMEGDLCKZUZFRLHAUCSDBYEMMHI ANA-Eddie Mufpnyfesg snn .QAiiLiiThAanxefoE5E1ek1ng me AAAAAAAA NBRYTKCRALYNDRMLL ALLLLMMORENOLL n L AMIE-T Luv U FOREVESEQNORLALLT AiAAi L L LL L L L W' LA' L L LLLLL L L LLLL L LLLLL LLLL LLLL LLLLLLL LLL L LL LLLLLlQ iE LLLL AAAA 1A AfigiiGwi1dKeepdenemLAThnx41Ahem6rif2QuysisBrexhny DOHmvQ0OfYSiSfefShHf1Qif1QOUiWiThmyiifdiiiiiiffilliepafi- ffl , --L.LL LI - A LL W? X AA'EAi5mDadHuvU2theguyIholdthekey2hiSAheartyouIIalwaze A??EEAEg LLL SLLLLLLLLLLLLLLL nersF!ickyMarlonJoeGerryHomeboysLP3gg1giiXgTkChris L L LL MakeAmendePemmgbynereerfmwnNoREi5A2LLL L L LL L '-LL LLL L L LL L L Cl u t 55 ta rw cl I 1 A B E O R N f L O N G 5- 5 V E T E A M V O N S H O W Z I T L L L L A ITOPUS 4 PR ES 1 BEST o FT: RTHO MAS f OuePasaWhat Bthe Deal 1 ml nQWE!??5Sa2? TN?e'Sfhe lei L R EG L3 A H EA DH O L E f G -LY A BGSAALAAHJJ LUVA'AeF'a9T'Aia'f1 As L LFAQWOYUA AAAAA A AHLL LLLLLL LLL. L LLL AA AAA AALL1 LLLLL L LL LCUS DO L AAAA A AA AALL LAAA LA Af LAAA -B TM LLLEA LALLLA z L 5 AAAA AAAALA AAAL L fi-f LL . A ff Izh V' A i 1 A A AAAL L ALLLL ,LLLL'LLL AL-g-LLg:gg '-L- : :: gL-:g ALAAA iiixy L A ' fA: 'Ai' giigg iii L LLAAAAA A ALA ALLLA L A LL LL L A Eg A T0 CH6Z!'A'fLA L AALAAA L LL AAAAAA L LAAA AAAAA L L LA AAAA AAA AAAA LAAL LAAA AALLALL ALLAA A LAA AAAAA ALLLL ALLLL LALL L AAAL LLLLAALL L LLL A AA LL AAAA LL LLAAAL LALL AYSLUVUTHECQSLSDFSWQ 555-S2 AA LAAA LA A A A HeerdnBuminJSiiiSEQfeshPrefiPEbSQv2Demfii5SHogzPer 1 LLALL A lA r AAAA A AALLL FavBudsSM 1.efLs?gQf5SARMyPaLiEigEefTimLovevesmorive LLLL M Cr RueSumS:iEzfsHerelwiivULALLJohnM Ldve-4UwiIl Nfedlpamela L LLLL L ALLLA 5 5 SQLLXQ L A L L 3fgLn4ge1ebue1emeeg1uTJTAHQSAPQPAR- AE L L LLLLL LLLL L L LLLL LL L LL LLLL L L LLLL LLLL, L LLLLLLLLL QHEEFW1p,nkS4wgfTRUgBiLLUE9Um5ifaQiiyqwfBuds ROPOCANTUUAHSTARWNHELEA W'LDf3LUfGW932YiENAL ALAA' LAA L AAA PEARHANMARKTSWSLPTXISA yBREN EAS??FrenzJen T AEANMIAQ A-L-LLLLLLLLLLLL LLLL,AALL LLLLLLLLLLLLL LLM LL ALLLLLLL L' ALL, ALL L L ' L L LLLLLLLLLLLLLLLLLL LL Bw OUTGFHERLEAFTER4BTC-.YRscLAsLsoFa7JAMs ?ggg,'2ef',GQ,LESaVffff'Z U2RLf'E',ff,i f, 2ggEUR?g UCh :LA AAAA L A ADlLLMAKEYouPL uDwE LAAA LLLL A LLAA ALLL L L ' a on Le! U UV me me A L L L SLHALNXZPLAQLDAN'-E0BR'ANGREQ 5AALLMYBUDS SCQTTTEuRAzwyemMyHeenmrsmofconez LLEMMHS ALLAA L L NSYBRY L 1419004 Evaac-YATDAB EACHTTILXSLTH E N A LH A L L B UT, FI N A L LY M A L, E , T SKe1NGaPARTYHARD'RAMoNEsRULETHEsTAcsEf TQALQKSTOALLQLTHETEACH ERSWHO H EL P ED M E LLLL LLL LLLLALL CMUNZER A L ALGNGTHEWAYANDSPECTALTHANXTOMOMAND AA, LLL L L LL L L L L L LL L 1 L L E A LLLL 1 LL -AAL E LLLLL LL LL LLL L L LL AA A AAAAA LA A E7 W - LALA L L u.uvu MICHAELREYES FOREVER as EV Em Thanx Mem! ALLAA 1 --LL :LLLL LALL :f LLL LLL-i-AL L Thanxoaff9n4AlW3ySbemQthere4me-SVSQNUGVSV4 A L LLLQ LLL 1 LLLL LLLL U gm Semomemof lwmafwa SL0veg QgMOmgL 31gL D3 Q ieLiVUAl-QTQSIUXQLSM'a4'if'Uh3VdU'A4meLUVU LL A LL LLLLA LL V LL, V L Y AAAA LLLLLLLLLL CLHTOILUVUALLMT- LLAL A LLAALL 4a ? 9m'eW U3Q Y'S 3Y9A531 LLLL LLL LLLALL L AAAifTTz2getivi6iAANvr4get U4 Evrry B N m ggjeml LL?gghareanoutrageoussumrTTer8Juture!Aclo87ENAKAN A LLL L L LL Y A A A? L A ALAALA A LLA LLL A' KL S LL L A L ' . . Ae L b H k ,L K, T'B II d W K- L LLLL HLLMEL TODAYLNL tc? SEECESSTTT DoN'TF3Q+L OZAK, LLLLL KYQU UID LLLAL AAAAAGETMELnLoLYou.86fa1ToGETHERFOREVERJNA- LLAAA A LLLAAA BQYZ L LLLLONS L LLLLL LL ALALALLL LLL LLCTSRFRANIHA ffililLLLLAL1 L L A A LLL AA AfLLLLLf11zLwheL:wf1e1AQKwhexmveeefdfheefiwwwfmeone P E: PfSC3t L L LLLL LLLL L L A AAAA A A A Ak L LLALLLL LLL LA wifi LLLLL LJQAQAAA L: wee QLLLALLLA LLL L LL AAA neea.neAugr1AegLg3freeTas.TKaAzeaf41TAerenafsgfA2Les1myfrdnemx4 gdxeThxMEHQLQADAMk3gQMeexaexKNAAT1oNs LL LL EG A Do- DBYE M MHS4 MLZRSLZVTR LLLLA L F A M L Y 4 YRS A L T L L ALLL AAA A DJ LL BA L LV FI EL QKEY R N E E 1 M ALWAYS A L PeNKgLggLveRL0vEYoLunEEELS BEEN REM E NG ESPECALYGMAG PAAsLAUAz13EEiafADuTPzsqTxf13NL sumfm ERAAzc3EnsLLg5sBoAvTHEMOVIESANAQTHE AXQEARETTE LLLL L A LLLL A LLLLLLLLL LLLNLLL TL ew LL 'AA L N Af?sA9:L:L K K V KA U K LAAKAAATLLLQLLLLTNAAA A L AAA A LA AA L L LL LL, LLLLLLL LLLLLLLLSQQL LLLLL L L L LLL LLLLLLA L LLLLL Tneiiimda MMH5daidnelpeS3MfLREGAsrnbfmuv MomDad.Tanx2aimyfrenzspej?3QM!LArvinSeanlupelsy- zaidtgfqckelsapamilLydv3yidma 3enny8almyIuv2STEVE yrul. 87JESSI KAPAL- LLLLLLL BQEiii55lggCfE0A37HERElCCE3AEUCIFRENZ2DENDD' LELFYUSLSLSLLLYSUEUVELUVL31BGREDYILUVUCHRIS 5 LLLL LLLLLL L LL Luke L LLL L x LL :L L LLLL: L:L:ALx Aims LLLL' JLAA L L L LLLL LL LLLLL . L L LL LLLL LLLL L LL L LLLL LL LQLLLLLLLLL LLLLLLL LL AS ALLLLLLLQLTL '4 AAA ,L LLL L L AA LLLPEWLTLLAQAL L LLL LL AL LAALL LLLLL A LLQALLSN L LL ALALLLLLLLL LLLQALLLAAAALLLLLLLLLLLL LLLL, LLLLL LLLLLLL L LL LL A AA A A A A 'V ' L A-'ELL N Afi ...,... LLLLLLLL L.L.,. LL... M 'L I K K F- 306 SENIOR MEMORIES 5'- g LL and A LLLL LLLL LLL LLLLLL L NSW LLL LLLLLLLLL LL 5 MMMMM M MM 4EvEf25AsoNE13319a61'1Mj2f5f1M2aeOIff5THNx4S21EMoa2MMM 1F1NALLYMAoE1:1T11x2MANANG BENMYNEPHEWRY MM UYQACH 151111151210 N2 M091 1 MPPEO PLE MY DA 13 EL N MM M .:-',-:kL MM 'fzf 1M ,----,- 1: ,L4Q. MMz'Mi11L1 7-:'- '::-.:- MMMMM :.--1. MM: :-:: M E LL MY 1 111111 OFBZM31 a M M MMMIFQEZ TRIPPN?RENZTfSVAJGMMBENFR8'ZRULSVPO'iflMCO M freNhzL1Qfi?Uali! Esp2i1:3iaMIIyLHV4beingih?15yLif9!MTliiMnhxMa. Pa.BrQ3,S1S!J.SLiRcute!TwfiStedsis87A.PHAMM M ENLMMQMQADTHANXALLMYFRENZILLMISSYAHSSTAND Zevrygii ?1fu55sY3QiMMThf111KQ1r0sl1! why'?!ravsrY31ifdadMM2utr!r1ihtYrve4qr1dnml4378 adiQoYMIIVXXXLMCModbsk1'1atr1adYIogrmbrGod i1f1! cnvrmjrrennoclhcacmgnpmgolahamerehftuomiay- crnmahoIa!u4rehtbnuevolzywlaI!inerfraedymwyoJRA- 1 AYS M MID d 1 E vv ow-1 K L S 0 U L SIS M .1 YO L1 111 SOSPEGEMALBDMYINSPIRATIONKCGODBLESSYA PEFISDRAMAILUVYAMSBYOURTHEBESTBFZETTMY m M M 1 . --.M 1.. M 11' M M iMMiSMf5R3TLQVEALVVAY5TQSWLOVEYOUKROBUCK ra m '1AL 1 Lui? 2 MSJJV1 n nylfhie Rd Lv U JILLLQYQIWZILNEQSKLPARKER 1 FreSfTUBiHn'?MGTi'1nxNYll4QOi'?2mchfunZMHSAPMCKA 1 1 :A 'XAZ 1 M L M 1r1GfM5,g1enns1LMgsNM1Ewe11sEEHEAVENQGETHEHQCUN Lfrnds PlkNG'Yf0 NK12GfNACLRSSOFWISAMNDIE GOMTRA MESAHIGHCAILIFORNIABEACH 2mGSLfCC9SS H.UVLJ5fgIMM MYESlfEBYTh1ngQ3ataccQ5,1nMtmeIsMDg53gdxcated M M HSm:MGODBl6ESYou!lXiY6en Diah1eCaroly5Stacie AGAPECLUBFLOBHQS-MrSSwad2KaraKarQI1KriSti PLOPANDSISJULIEILOVEYAALLTOALL MYFFHENDSKARVVEHHCANDTDYAMADEHSFUN! 1 M-,-, BAND83f57LIBRAR!AN85VICEPF?ESS86PRES87 THANKSSTDFQESQREATYFRSGOODLUCKBAND87- MMM M M MM MQMM MMMMM MM MMMMMMM MMMMM MMM, M MMMMMMM MM MM 4M MSSTOMANDSAMLFQFIEVERILOVETOMBYESFRITCHIE WELLZTSFINALLYOVEFHTHANKSMOMANDDADFOFZ M1keAn WLUVXQT anxlfifin FM1kemT1mK Th11ikGodV mzzf 1 m1 1 'M N 1 1 MMM il MMXMMM M' MM MMMMMX MMMM5MMM,MMJMiQM MMMM 2.1 MMM Y MMMM 1 ooMa5iM511avMWMaaf?Yfuf?I11iS211voNSffMr,1L'eg5fsPf1yS2 vv1LogfM1N1SsMJMMNYQDREAMa1psQv11QR1KH11w1g1M1fMs4A13- MMSMSMMQN'M6+JS1s1fQf?BTYi f1r1vQFi f2f2v!MLeQ W JM N ucLAg1g1Qund1sPL1MLoPoTMM M1 M M M MMMMMMMM M MiiN0TTKigEAFTERQEMToALLOURBEACHT1MESANDTJ MQVERXISMMSMNGMILQMEYOMUBOTHONYAYOUBETTER MONTDarP1111oLOMM A 1 A ILOVEYGUSHANCUSMLDKGYOUGUYSARECFQAZY!I M QM M M M LOVEYQQANYWAYSHITTHMEBEACHTRODZACH I i M 'SEA ND M M M M1 M 1 ' M M M UMMEA NMENEEMB ESTJAYEA R850 N A N D B O B B Y M A N Y MEMORIESDEEDEEFUNTIMESATTHESIZZLER NEIL M M MMM IM M M MMMM. MMMMQEMMMMMM MNNN M MMM MMMN . iM MSTAYIMNEQUCH05113-MBEAILIUPTODELANDDONAA :QM MM11mes11xs1xdJpSiMiMzMMMi NMMN i Me11MN1QN1MbfrwA?1rNEsp12m??wonMr41 M MMMMM1iSPTY? SMH 1?M5??iB9fGf1S1MY?C0-C5 321112NUMTQHMWMAf!fM MMMMMMz2MMME120 MMNN MM M NNNNN NNNM ge:u2G11dLuK1T?fANKu21s311YLovEEE0Nv4evM51ryf111ng11 LeaQUeMh1ihbbacKer.1LovEvoL1-KATHEP1INE+ANNo12- MNNN M M lAg5'5QLg7LlQ1glg3iEgAMgMgMavERML:AsT1NQMLMovE11 T52'?1n?YSff0f9ef?MTM1M0URSP?Cfa'm0H1GUfSMM-MMMMSEYESM MM M ,1g1M1g11SQMNQQ1naySgfgpvefaf1gsfeeS1ramesspwpafryang M.N M N.M.- NNNIIA Y NmMM FOVGVGV --N1 NNNN LININN M 1-MMM 1. MM ,M .MM1M1M .fM. MM M--MM 11 MMMMMMMMMN -,MX.. M MM M ,MMMM. MMMMMMMMQM M MM MM MMM MMMMM MM MMMMM MM MM M M M 1 ' sd1SE3Seife1M5oME!Nsnc BU !:GOOdXSWfAnG?MM iiii'MMFUTP?3f?ANH I-V Unger!CUN33CUZTHANX2MOMN DAD MM ,MMMMM M MMM' Yvi MM M AC!AMFmiLetsgQ ncinguiggsiaMaREEnltsBeenRea!- MHANSCMOMsi1i59iP3giEi1?1?LUvU211LwAYsM?oMYQNLYLOVE M21MMi 'M1MMEL11M1:QvEYQQSSMMTYHEQWRSALWAYSza415vER13AB13 Y aM T o M Y 1: 121 E N z 4'2TsU12svvET1ASASNLCEu2R2Mc1-1.2MYcaM1Ffenz1 MM1ssL11gQoHQQMMc111BI1ggBEM. oQ1gouTH515Mg1QoME NEVERAGETMAYVQSMY1sTAND41EvE1fzLUvK15N JONESCANTHELPFALL1Ne1NLuv11f7vFooTBALLv CHEERB5-aewH1TEYoocssF1sH BRICKWEMADEIT Mi!fSMbeeQg1QngM1Mgiiggfgafxrii weto get out lw1II remem- J B Aand Ford I h0peforifjj3 bestfQrVggyrr1ends3513hejrgradLuvCRADKE ELM ISS U G O O D BY E N N HS TN A N X 4EV ERYTN ' N G UNO T E D M r 1111 11M1ii 1 PA M o H Fl- E H A NG I N T H E R E! 1 '23 7 M ROVAPRILC' NDYMOM PNLUVYOUALLGREYNOSO 13f:j5xLL1jf15laYS?MiJM M M PER MMMMMM MM M MMMM M M M MM Q 5 M - M M MMM M M NH-111M24EvER1QAM1M Avi MMMM M 'NT' me PEN SPEUALY PA O 1 M 7 ! C LMJDIAYMSAYB ET A L 45V Tf RiL' N E R El? N M M M AL MYTHNXQMESEEENDOZACAN EVT1-1 N K U E N 0 L1 G. H DEBEKWOVEYAMOMSDA DTHEBEST! N KS N' RNBENTQEYMM EfNL'CAf5WEET M URT1-1GRses1 LMSTYOUTOTBWCARS AS Bvv Asc L AS 0 N YOU ' A H 1 N L11 K1 M ST M E-?iii 1??E91A DO L N CH 1 N1 W MM NLNM LNNN MMNNNMM M 1MM'1NN M M M M1 DCMLENWHMPURPDPD ASEMERBRU DD Ml- C H AMN' PS ! ! L L 1 E G U giflffzfgflfffi LLEQ?CYAA1ffYHEBEACH!!MPARAISO M M Kika '-HW' J AN A E LLSP1-3c:1AL2MEMANYLAFsM1ssU5ff111fM tlrribsalways 18bdayletSgetdru nk H IN EEK Lo 111 L N NNNM M 1 iiauvis OD13335EQDDMoN1cAGLAoYsANHJOERE- MMMMN N'MM M-M MM MEMMMMSSUMALKMQSXSMRGMMCAS04AiLYOURf3AFNNG MWHTNXTQ1LLM1ssYouBOTMHTONYTHESSEARCH HASJMMMSTBEGUN-1Lov15YMou1oAD,GnGLovEam:1 MT1-1 NxMa1Mcs12zEwU121MFuNMTM1MMEscHsvs13 KD NWAHMWH DGAHICYRS.BYMMHIMGCNEKSENDSSSJKIMRIK MOM81MIKELUVSLTHANKSMDADTHANKSFORBEING M M MTHERESHAN LUMVYAMYVKIQGIRLFURSUREMBUTCH THANKSFOFZALLOUFZSPECGALMEMORIESMAYBE SOMEDAY!LUVYA!RICKYYOUMEANSOMUCHTOMEI LUVYNQMLWAYSMBEIHB13sTOFFR1EN 13s1DFNQKETTS THANXMQMANQMQAD4PuIf1NGuPwfM121LuvuJ1LL if 1 ANDON LY4-EVER EVERGQGDLUCKLITTLESESTERLUVYALOOKOUTSD Msu13YELQR1.w1MMg3QMNE1Q7yA.AM12151511153 ff , M1MMMM1MMMMMMMMMMM MM M MMMMMfMMMf1MMfff1vsnx1:M1' MM M,MM,,MMM1MfM,1MMMMM M fMMMM MM MMMMM M M 'MMM Q MMMM M M M 1 MM MMMM MMMMMMMMMM M MM M1 M MMMM M M tr1but5T5EAyFutUkeSLYS53I?DeliriousandT8NAThanks forbeigigsguchgregEj1ienMdsggS33s1luckwith yourfutures. YO- LA MMMMM M 1 Ll MMMM M MMg32?MfDMNos2i?1ifRJMMe?iiQe1 wDY4JFEMNNTmxMARKGDBY iTH1S1SM11t?ThnxEiAMDM5. MG11M1.uvYa13om1111f1u1dmaKe111 LGDXSWiihGDFrh235sKR ISTI8RANDImAYOurFuture MMPAFZTIESbeAWfS1Masa1vvysmoreFUNXS2come M 1 M MM MM ,-M- -M-M 'KLL K kk K Lhhk NNNN YNNN 1 M1 MYYM M mM1neaqe1hebeS1111 1 frenz 1'11 miss you most an 3?Ye'YbQd5T 9' 3Yfm9MFUYbeC'aZY5'W dNYe? You M MThAnx4a11DaGQQDT1MesM M HSTraKb2 DEFMOM as 11 an 111 'XNN INM 'NNNN 7 Tfi-qY??fzinL8f53gLI3g?Eufi1?J115 M.MM11MMM'1MM1 'CTE X'MM 1 :1 :-M MMMM M M iix :ik MM M K K7 1 M MM M MM , M M M MM M M M1iM M '11'MN1MM' 1 MMM'MM 'YNN tif MMN'T MMMi M M M MM M MOM M MMMM11a5a1UDEfo th 1111 1 b MMMMYCE!-5591 'NUR M E'-'EVE'N A 11135'3iEMxMwfM3E5f1ggM1ML1SAML?S'5i1A1'Q,ZMpaOZVf61?5??.S'3Ue1f MCONEfR11ESSGNgsAL1A N1K1NMMGOGEEs1aMirme11KeMyQufs1S1A1M1my1uv1QFRANKf MM M M MMMM J Boy Uk Qyrs Ccfgyfs ,unidmy me and bk. Bst fmds SOULTHMANXMGMNOWIMUST PROCEEDWWH MY YMMM M M M' NM: MMM MM: MM' 1 M M 1 MMM5 M'M-M M M MM M ,,MMM MMMMM M 11M M MM 3fffMMmMac1eiM5 QBTHQNQX4A1v23?sggefx1nqsg1ias149dfemessaay .D8fTM11eQQL11jnesggi5ggTnang EMNDYggggfsS1111a1131LuvuR JS, MDMMMLC, rexjiibr U. Dewey the mkt man MOWNLIFEUNITEDSTATESAIRFORCEALLTHEWAYSO hope tQMMCU at LBS1MNxt Y'eaMr. Won't frgt ski 1131513 GM! LUV U MOM SRICKMAN A : 'If A A Beat1es4-ever!CsurprisesurpriseluvrichSjilljwhoaneellie MM T N 73MljiiftiousmarrinerflrankybabYiiMRONMAIQENrL1iz?6QlookMM11M'M1M NNM1 1oompngdeane-ar1M1we1uvu1MG.a1oUSSEAU M M MLMate1Vg-gfgggzaLanrgfgiiangstegifiisepupglfgjeWaxerlfradition M M bi EM M M M M OM 8 DADTHNKS 4EVEFiYTH NGSK1 BU DHVFUNW 233MG1reQEEQr1dus1E wiawwsfyllaaafaigavfwzaxf QThere,LetesA MQUTMEB-CYMAB MiJNMDM1Mi:TErF1NAk1HfM0UTHM1NgiCGR8 M BAPTCUS MMMM M M MMMM 1M T1-1ANKSc3134w1f11G1-1T1Ncs.HQMMEANDTHESAMETQ M1avALLsoAB1GT1-1ANKsTocoAcHcsf11m114ALLHE D1D4MEQNANDGFFTHEGR1D1HQPEONEDAYYOL1 iALLSE1EiKEDNTMPALY1NGPROBASEBALLCQACHE IEiotYOUFfAVEHECPEDALOT 4112613011211 g1Tsov151i3icDKv1MNQTTHEONLYMARYED1JVMNGR SNMKFFE5iNMQTsAiIt1EHSEUMEANLNQJTQMYDSIRE FRNDSSTPHNGQDDLUCKSKS1NGMHLLBARQUNDL1N339SOMQDAYBEMHMEANMMMQHEQMETHN UNO orso DONT4GETERiCHSOUTHCOASTMELMYLILSIS M 5MMJOHNNYBABYMSSYALOVYALLEFSZLESLIESAMIR 'MNYTHGS1OYRSOFFRNSHIPHIHEREWECMEMOM DADDEAMNALOVEUAALUVUALWYS814EVERSSAN- T!LLI MMM MMM, MMMM MMMMMMMMMMMMM M MMMM M M5 M0H5532352mQQff1iKQvMUafiQfQF19h1'1M11aJ0n1Qh1NPALM- MLIENNlF'ERLUVYMLOT8MCM?f2XSSOFSYFULESMTHANX MMOMFQREVERYTHSNGBEMAGOODGQRLERIKALQVYA N11 hasraMMN1MMHshcwiiYSDSL1Long L1veTH E3131c11nos111 NVR4GetUDARCi81RANDI!lTSABEAUTIFULDAYi1'1the MMMM MMMM M Df111Team85-8vsAvveSome1 1 NM N NNNN N NLMM M MMMY MMMM M M MM MMMM M MM MM MMMM M M MMMM 1 MMMM MM i M -1 MMM NIMENIDRIES - 307 : N MM11M MMM MM MMMMMM MM S Dmir 81TlFFSeeYaKSULLlVAN Thisisit! S ltrlp Than DAD n KOW lT'STHEBEA Thru87w JoeAl81theBUS81 K ' B XM See ROOM BALL aa DontoM KEEPC DLINQA SDSUor meroUno HvfunTh everNoD MQJDSIL THNKS MAKEU REYGDO WYS4evrJAMY NNlCEKnc LANDDontLetSo YouHangInTHEREAHHoI meoneEIseFiumItForYouJC HEERLEADINQANDSMILINQDVKEEPHUR NDDONTFALLNWYOUKNOWILLALWAYSBE HEREFO FZYOULOVEYAKAREYASLATER BUSTMM if 1 TrackfPVJCIFJS DM LeCIiqueNu KareBearTrippAngShaChrisJeffJoeILuvYaAII eYearsToComeSteveANDGIennZbeStFRENZ oubtTheB-52'sUQhGmStangThnxMOM DAD VA MASQPA4ALLYFlSUPPRT81GUIDNCEIWILL PROUDWHEQUADCORTEZ-SUMMITZQTOR- LDYS!AI-ODSQJAPSUMFKCRUSN81DANCN- : 308 sennon MEMORIES I ToMyFriendsToddJasonJerFIobAndyIv1attAIRONAEFI- ANN Fonde-stMemoriesOfYou510TOFIaceHardcore I3eaStieSWeAreSpeedNODbINickIeFrIendSDon1DisS3- pearI-IeIIoUnivColoBouIderLoveMomN Dad87ATTMER- MANS ThanxfvlomICouIdntHaveMadeItWithOutUILuvU-DADI MISSYOUANDLOVEYOUSOMUCHYOUWILLALWAYS BEINMYHEART-KelIyIWiIIAIwaysLuvUTamBes1Frenz LLKGLunchBUDSJDIXaTOdDOn1CI1ar1geTTULLY BYBYMMHSITSBEENFUNICORKIINKILLEFIBEST FRENZAEVERIBEBAGOODLUCKINTHENAVYIGET TI-IOSEFLYBOYSIPOWDERPlJFF87LIVES!SOCKERS! LovEYA1.sIQAPTP52SPPQZAADMINGHTSTNDIKQP1' A Mom8.SaIMLuvU bothSockersPopcomSaIAHinK 1 UW TRC-BF4.E.Igig3?IWSS+.D.IQigIgEY!IHA.NX4AIgL!IVISINGI-IA-I NNN i 7 g1giitIeQ?waxepgPres?Icann0rfmdPeysc3AILYBandToo LovEusPPPTTYINPIN.Igf5g5NAmAPIEvI LLE Qf.As THANSMOM DADAL.szP21.LQvEapsUPPOOPT!mysPE- CIALSOMEQNEDAVID4355-M.ESSUCLAILUVYASO, L. muchfun! I3Iai.EzkMTJuIie!2TammyYVRar1dPISTOP SHOUTINGSNOD. H.IIMISSUALLIFIUSHI-IINKBFIOS WILLSTRIKEIRVVILSON QFETOCOLLEGEIGO: UCSD'?SDSU?THANKSTO M UO H I BE QLZTDDI H EI CO GR E53-.FO P A L L T H E S U P P 0 P T T H ES E P A S T Goo E T H E P E s T A L o N G vv IT H P I L L ea A A 5 ' If f 2PLPAP N Ei TQLA U RI B B E S T P P E N Z P E NI E NI P E P T H E ILOVEUSQMUCHUNAYAND''TAYTZICKMACHKPEIPSQ IBSIEAGIUETFIIIEG-C'SHIRICHCHILDANDTHEGANG PPIENDSIGQOD-PYESENTOPS LETSHAVEFUNELA1-EEQEWHITEHEAD AI N E LIZIBENXETR ISH AZZ EDETHQ ,,L, A JA NG1AE.AzN.SLDONNPA!.NQ. JAEWI LLEMEBREP TH E B EAC H PARTYS KS LOO- T H E J O Y 0 P S 1 x I G O N1 A D D 0 G 1 Y A I T H A N X S M I S31 LT L STCANS THANX MCLIZAHATTANZ g P U RK E! TH A NX M o Nl 8, DA DFORA LL I 871 LTO N EY Q - TPLTP PTLP A . f T1P Y WAITSA N G E L A YOIUOFITHOE1 F09 OSuz. ILOVEYOUThanxForAIlToUHaveDoneandBeIng There FEB 1 686M MI-ISThanxForTheTimesButitSHISTO- FIYPAFITYUP87MikeSDSUKICKSMOMLQIIIBYOUBQTIOIE? Familywith LoveSuz BABES I AT7-LILhrdIi92oIymp25hoOpnDIirusInchtymeCevans- ZTMELUVYAZEIEWAAYSMMBASEBALLin1-2.2NnLLIoN .1TAwAnTsTHANxMoMaDADLUVYACLSQHHPWADE . mymenSIySadePerIAT6jbneedsastrwAD4getSacrmbr1IQ..Qgg3 I .LA246JstanApr85Jn86w!Ug1Ithewybabe11uvuPL25gg LLLTL ' - . , iXAg87we- nzgggm DacI4evryth mg nluvUBob 1 ATTiL. TOMASULO A f , A TTTP THANKSMAFIKJOEYJULIEJOELPAUILIQTILADANDBILLI forMAKINGMYSENIORYEARGREATLONGLIVEMYVW SEEYAATTHEBEACH IGRADUATEDLEITHEFUNBE- GIN MILLER DRA FT FoPgy.eP Gus.s.Q.s.co1NG.o- POINGQILOVPSUPlLLN3.g5gg39gYSN ILLggiggg gL P. WEMADEIT87TOOKLONG4-ENUFJOHNIPAULKAREN STEVEPAPKTAMAPAJASQNGENIPTEPPAUPALL cPAZYOINKsUEYUPNwPAL4EvEP2P0PEPTvPa PH EAVYGOFISHPONQMYNAIEJLUVSOMUCHNEVEP LEAVEU URMY1 a Vemu!BroCK,WhattImeIsIt?JasonNyouBigLug!ForCin- '1-1- 1 dyYouLookGreatOhYouTasteSoGoodHUH?SparkIe .Memoriesf-XIwaYs Eest!W-I1ereAmIbound?CCC-YA 1 . A . Heyl-IowzItGrJi?a'?CCFtImesWereReaInice!YOmark!SteiiS?l' .I th ere Dan nymy bqpef fgsiip2DgahQ3IE6EpPPTvTvisggg.snBJcTcbyeJULIEWrG2f2P HGINS A OO I E- WG I7 CI 9 In I 1 I IOCONQTHNX WERYNAISQTEACHSMSHGGFITLNCH PELPQQSNEPEOUTOPHEPEI LETSHTTTJ, TEH UNDPSONME.LATEPPvvasM.v.soccEP.BALL TS P F1 TYI8 3' PAUGH I 11T Bumovvfe. Lav.L.vlLLAGE PEOPLE87. PAFITYINLACOSTE. LN-SOFIRY4EVEFIY-I KYMCHLUVKXQAKBTGMISQSGRBGREFNWTCHTVRDTPT P INFASHGQP RNKPCPAC Af111 Di3TF?CKGYSLKNG4WRD2w'Q' .. ' . . - I A -1 AK - A FHSBaIIaI . TI-IING,CANIMAKEITUP7S.WARD . ' .. ,Lqi,,QL . EIL I .HOmeCom,,39qg1gQIw,5hyQwgasa5ehereIwon1stpIaceDeI VT1 - 1 A .. A TTTT PTT ff atFu ' I d U It' . LLLLL LIEEPWAS WHEN 'T WAS LLPLL AP1 LLL - PTTL . A . A 111 I O ATT1 OO 71 everspkn4mvyAHc1KP5ff2xi2iBginerdefZ?nseiSIagnIAEP' TTA NIKEMIOUEI- ZIPSLURP JASON BFIOWNIPEMONAOE memoPovssxshMs4eTfc3gggigwiweIlmungmmwrmsbm I LOVE THE SUN HGWEISZ A ' I - , r Mo AAT' Y li1 in 1,-X . in surein THNKSmomwAD4pumUPwfMwHpnMErhfuBT LLLP 9 APPAL Sis. L1 2 T11 QUC1LUKIIISISILUVUFMLYUWISLUVSTfI1fIKS4TAKSiII'Uf A .P PTL . MYbestestB.LJ QZUIMEMPPNQZQBQNITA ag1mmnPAsP . 1 PT.Tg f V mlm2ALLmXX,s3PLIgcLLEbudys4THoSspec1MEMOPYSIan za ' LAPA A Hcammv ' 1 ' . WhataYearIINXSAirBandKicksitSkiTripAwesome2De- BYE Larry-URMYjnomyil,QggggggggfjLpy3 he5g2gyrghvbeango me-trail!NeverForgetUArtPadsJamTodJerAIandother DAZE Miss Pe-asrseSwePade7upda1eNo10mgoP0m9QcarSPolice4 Us 2 ma Joe Rex everLove2MomDadandDaveGoodLuckFrIendsBWHlTE Class of Dear1BradHT TLPT A f A M-M.N.D.L1 g1anyThjPX2MKqgMamfgDigggg-QFUEATKNAGRHZPLLE ZARUK f A .I TAT, ' gether ever- mem er - - T2 3 M 1T1'l TT1 Q ANATALIE-thanx4Bin thereKRlS-Show'emwhat ouve AA11 g j Ifl PPIPF f A QACHEPTPMMHSDPAIIAD-PTWEGOQGETHEPTIISS- LOOkOU'Wf 'dHe'e'COme'N'TWOODWARD A PPP PP LLA LLLLLL LLLL T . ThanxMOM7DAD4aIIyourLUV8-SUPPORfIf KAfTHthanx ,L'x PXTTZ ,P1' I f 0 A 4beinQHQfPH1PFI'ENDdUfiHQibeyfSMELISSMfGRP-CIE COFIEYHARIWUZH ERE SQGJRA I' I Iaiwysre mem berthemoviesfiOurfantasticTALKSG I NA VVV. US! OOKTXSISPNESOG 'Omem DUO EOM O HIIWPOOOOTIMESGOOOBYE''BT' 27'-TAPE 12 FRDY A LI SAW' G A N D 599935 THEF GYKAT 1L i1l2fByByMMHSILUVUMOMandDADURTHEBSTCRISTYL PPT PLL T LLT TPTP A A ' A A A ' - A AMYPSTBUD4LPEHDSAEVPTANH-THNx4EvYTHNGTO ' A TOOLWITEMNRTYQUAKEEU-NVVATYUHSPHLSPH KOIVIITHY-UHAVMYEVRLSTNGLUVIRMBFITJ? 1. 1L PPLL LTLT A A I YPLTYBEEPBUYEPSENIQEgg3.uTPoTN3g5gip.g1yPRS. AWTPPDGEQJETSKIPsESTAISTOMYMOVIEBUDS-zues A TTPA A A CN EH OP HISIKUL ye-arswe'veoried so manytears Nowl' ve2 ? JVICK . 1 ktkk I .K .,.k K. .. K. .. A WLD8 CRZYTIMZwItI1SaUQ3gSQIISie1a.87 j:2.QHEER-Ouff I TUQQOUSIQT9Od'U9kiOI'm?315:QAVE3W'3?fff?355'9?'7?S9If.?..a NX iHmPCOmDQ347MOMH I Bsad4 MyfrienztheschooIwiIIretreave. 'OI' memoriesESPECIALLYTOMYFRIENZE.D,L.H,L.D,E., P. A A ILBAr1dToAIIIknOwLOVEP.WELCH A . I OLAALK 'iEVAmonnitemovies LISAsummeratpoofiiffjieciaii 'BYLLKVIERA A f I A A . To:PAYJYELPEsToFEL2QiPEwqHPo.gQZPATJOEYO GREGJOEWILLMJITWASALQNG4YEggQ33SYETNOT NX momdad s. famiuyfw ' rIuvREM PP: ,L Tpifehcil crayon leaf 81 joan W. G RAC E I Ong PTT1 iguyss-'THEPPOTHEP''wawawaa.JAsoNf2cu1eNsM,jT'IjlI5TQ35g -INAPD . -Sfenior'BestBudsLorn DaIIyRoutine DaniD3eQSeCreTg i Lo NG EN UPN EVP wi LL , . . . . . T.11O.P g ..... A , . . . e ary-rr Ce e M Ounta n-YU IL- , Lf nbfe EOZM sOfLufe! Donny Babe Feb. 14,OurN1teP-iff f?j5TiIy.youByeMrxY!Thanx DadMom DGooPdI.uckOreo rPerrisbestbHc1811winIuvyQI1TiI5HBBBfnayvfP4IPverIshoTjP331155 VVSAMOthanxlibeingguk'eIf1iTmy2ndcIose5I8gSushibudg U WERENIW9 BTH If QSQWPIGHT PINESTIVEEVP 1P.T IPEACHYTPAMCONEBBIOKPSQPQ I DIALICATCOC KLINEDWELL-. NIO NOEISH U MA N A H S U LVI A L I FEGOESON PINUCAN-TPUCEQnoUNQUHAVETHEPQADEYESNQQQQQPN1 4 A . I - f . yi. - ',-I , . - ..-. -'1.. . - T J 5 . A ' . I' '2-1 .- 1 ----- .. 1 T- -T'. 1 - I - - - 152' TTTTT IIIT 'X -ITT 1 I PTTT '.L- ' .. -- . -- g---... ..P..-,, 1f.... . . .. ......... QL.. L ...--- . ...IL :N kkrr VV.. ,,,t,,,.. .... . O . -1- g --1 NAPA-X' , A III' L ... RN E fi PTHO If O.OT . I A if ..T. .g IO.O I O. Ii .f AASE, JEFFREY 168, 203, 226 ABANO, JEANNIE A, 65 ABARE, PATRICK A. 163, 202, 203 ABBEY, KRISTEN L. 65 ABBOTT, MERISSA 142 ABBOTT, TROY ABDUL-RAZAK, ASHARF 116 ABEJAR, GLORIA TRIA 65 ANZALONE, ERICA 66 BATTAGLIA, JENNIFER 168, 205 I ,.1 EBOWEN, DENNI L. 144, 235 ANZALONE, NICHOLAS BATTEAU, KEITH 188 MARNI L. 82, 118, 129 AQUINQ, OYNTI-IIA 117 1 BAUER, MICHELLE' 13,68 MICHAEL W, 14,.1. g hIi . 1 AQUINO,-MEDIATRIX J. 148, 288, 320 BAUGHN1 117 MICHELLE . ARAB, LILA-NI. 117, 264, 285, 282 1 .. .- ARADANASLALBERT 148 1 OEFIOZ ' ,11 B1O1N18AN,1LANOE TII 2113 1 ARAOANAS-.SBODOLFO 117 ,,R ,BC3V1QMAN, II ARAGON, ANNSA- M, 148, 271' --QBAYAN, 1 IBOYCE, JIM M. 1 ARAGON. -.JAN1cE .117 196, 198, 199 1 -- .1 BOYETTE, DAN1EL..11ZO,11'22e ARAL, ISABELITA R. 117 11.i -.BEAOI-I, JoSEPBl1fRg1,g1 1-7, 218 BRAFF, ISRAEL 118 f ARAL. MONINAIR, 117 ARAYA. WALTER 168 BEAN. AUNDREAi1ISZi 11153 - BEARD, DOUGLAS1 58,11 270, 271 BRAMSON, STEVEN B.I7O, 200, 201 - BRANNON, DAWN K, 70,1270 ABELA, DENNIS O. ARAZI, NATALQE 148 se -'1BEAROBLEY,,,9ERAEp-L, 117 . 77., - WBRAVO, LISA ANNEITIQ ABELA, ROBERT O. 142 ,,,,. ARBOGASTQ'-iQf2QN!QEIIM,I 143 ,27 : QBEAULIEO, .NI1g:19EIgLE,..189 Q- BRAY, JOSEPH L,.-1118Sg198, 198, 284 ABELON, JOEY R. 142, 203 ARENOELLL-1,JE8g113ER,,,A. 117 IEE -BEAVER, .. 1 BREDA, OAWN-M,-f-1.0,178, 289 ADERNETRY- EDWARD 115 TI ee v - ---1 , DREEN- THEDEEA-SA-1 144-1,2 ARILA- ERIC M- 142 x 1II.f ZE- I T11 '711 117.1 ABRENICA. EDISON F. 142 ,,-1 BECK- ABRENICA. JOVEN 166 202. BECK- . A SHANNON ABRIAM, TESSA 168 - 1,', 1 , 11,. 1 . ji-ARNSg 1,17 BEJAR, ZI.. 'III'-31'-I-BOWEN, STEPHANIE151El11'111 AOOA, ERICSON O. 142 ' 1 11ARROYO,-gz AN1ELf1 1768, 271 II BELEN, . 1- 1 BRIGGS, JOSEF AOOA, PHILBERT ARROYOLIQIESQS 143 BELEN, :..ii BRIORAM, STEVEN 16251-fII70,'238 AOUNA, JOSEGARY 168 .. ,,. 2,, , ARTEBERRY, YvONNE188, 284 BELISARIO, 275 BRIMMER. MARIA Y. - ADAJAR, PRIMEL 142, 203 J I if ,,,, ARUCAN, MELISSA L, 143 BELL, ,,,. 1 BRIONES, BRYAN 170 -1., ,',, 1 1.. AOAMS, GLENDA , ARUCAN, MICHAEL 66 BELL- BRISLIND, DANIEL 170, 203, 226 AOAMS, JASON MICHAEL 32, ARUCAN, RYAN 66 BELL, BRISSAULT, VANESSA 144 AOAME, QOHN 120881127 36535 .11 ASORARLAOEEI,-NAv1B 188, 265 EERE 111,, . BROFAS, ALAN 144 ADAM , TERH N 1 , 1 ASGHARZAD NEDA 117, 271, 273, 277 . , BROFAS, ROLANOO 179 AOELIVAAN, JETANQII? ASHCRAFT, TIFFANY M. 66 1 . SEILIMZFEXQQQ Q5 1 . BROWN, CHRISTOPHER-1-44 AOKIN , MAT H . ,III . .. . , , 2,.,. . BROWN- DANNY FI- 119.' ADRIANO, RICHA11-1Q,B.i, ASHLEY,....1,,1QL:k ,g E11 1 IIIII' BROWN- MAKEBA ' ADRIANO. SUSA51I518 .116i-1 211 S J ? 1 BROWN, MAR, LV ,M AERIA- JONATFI ASHWORTH??IM1CE1AEE1e8. 250 1'- 1 I AN. . I BROWN, MEREDITHILL 144 AERIA, zAcRARY.i1R5il1421 ,,,. ASIS, vIcTORf'1.88 f '1.- BEMBO, II BROWN, NAMSHA 170 AOBAYANI, N1IQ1-115EL..168gjg II 111 1'A 1 ASKEW, RONALD L. 143, 263 1 1 BENAVIDES. 1-- BROWN, NORMA A. 144 AOLE, Julia .1 . ,,,, ASUNCION, ANGEL R. 66 SEAYER, 3 -BRUCE, JANE L. 144 AGNAS, ,IEZINL . 1, ,.,7 13 AUSTIN, CHAD H. 143 L , . Sw 1, 1 JJBRUNOAOE, MYLES 144 AGUASA,ggENNg3ggg AUSTIN, DENA N. 117, 249 QQIUSZLS. A BRSNOV DAWN1144 AGLIINAL .4-.-R211I.J .,,, 1. 51-. 1 ...Lf AUSTIN. MICHAEL D- 117 L1 17-EBRITON. JULIE A- 119 277, 288, TROY 168, 212 BENDALL, 1 1 IRBRQ-YATST. FRANCISCO ,1785 RUFIN0 F- JR- 66- 196 '111 . BRYAIAIT1 WILLIAM G- 11911 - AHOO.1j M.,c1-1RIsT1NA 143. 205, ,,,, , B. 2.. -144 'mg 1 1144 1 1-. i 1.,118 I1 1 ..... '.... . i LII N IIRLI-E - AKUERI 27 I 71 S II 119 .QRYAN 153 1 .1., .EI 1 ALCOVE. 1'1 .11.. . fi IEP1-1AN1E.252, 259 ... '111ii2,,,,BUOARIN, MONIOLQg1?11I' ALORIBOE, 211, 288 OSSSS ...-S 8 LONG OUOO 11I9I ALEDIA. DOMINERSEQ ,,'- 1 ,, ..' GERALD C, 1-119 ' . ' ' ' 11 - 1 7 ' I ' ALEXANDER. 8. I 7227 JUSTIN , ,.,,, IIS. M 8111 IEE, .1 8 5 1 1 ALEXANOEERE .. - -8911996311-'CATHERINE R, , 144 ABKED- S,1 A BUNOOO. ROMEO J: 119 ARDUL- 712 ,.,,, BUNDOC. HOMIL 170- 227 .1,,. 1 .. BUNIGER. TAMIS1 119. 289 -MARI 1 171AIIIII'?A- 214 I ' RANDY 22-111.170 11 ZDDI 1-.i 1 DETT. ROBERT J.-101 ALGAFIQIQII , ,,f1L.iQQEjQ5. IXI, 11-1 - 71'7 77'1 ....... 11.. -BERNAL. BURGETT, DAVID B. 65 1 .,. S11 8.1S A 1 8'111 1111 TTT BERNARDO, HELEN--11811 BURKHART, MICHAEL. 144 ALLEN. ALLEN, ALLEN 11 ' 1 ALISENIIII HEIESQIQS .1-18 1. 1. 207 KEYINQWAYNE 142 -5511 -- ... .........,. AL I I 8- if 190 1961 AI97,,,, 1 7 ,..-' ,.,. .I-. -1 . 1 .BAQA 1-EARL Of-117-.fx I BAGR,EI3Ig-E1gI9ANOLLARg.- 1 1- -BERNER,HEATHER'S. 148, 206. 207, 242 II BERRY, ELAINE. 143 BURKSAZE, CHRISTOPTFIER 119 - BURNETT. SCOTT 119 I A SS7 11429 , ,EES 1 O. 85. 67- 2805 ...1 1.1 1 Ap 65... II I 116. I ,,,,,,,,, S5 ES88 1 1 16 2 7'11 .1 ,,,. - . - . 211 f?II1K .?. I, . ,A f-.EBINE 168 1 1 1 . R. 116.1 1118. 274. 275 143 My ....... ,,, 1 AN 23 5 I AN A- '-...- CELESTE M. 1116 CHERILYN M. 65, 67, 283, 289, JASEN 65 , JEFFREY B, 65 JEFFREY O 143 f JOHN 117, 4284 KERRI 7, 117 KRIBTIN N. 15, 41, 66, 79, 190, TAMMY LYNN 66, 273, 2755 . . ...,...,. . . 111..g'4N!NEI3.-., g,, , RTRAOY L. 13, 117 H5133- . 1.1 1 ?'iKRISTINA 169 M. 117 A15fDB5111g?SQiR?RANcIS 188, 203 M- 117 ANOOHNNQQEALIORA 66 143 . 153 . 188 A .... ...EW 168- 277- 284 1 143. 261. 255 J .,. . 143 117- 275 1 1 II r F 1 A AINERSION, 18. 1 AMANN, SUSAN1-16' AMORES, LORENA111-6 AMORES, EOITHA 1431, ANGCAYA, PAUL 188 ANAMOS, G, 169 ALLEN, O, 223 11'. .-1... -,.g1...1 ANOUILLANO, LEILANI 190, 272, 282- 286- 320 '111 -3 1771 ....E 1. ANS PACH,' AMY A, ,,11 ANTONETTI, MARK c, .,, ANWAR, PARWANA 188' Mr- my 310 M INDEX BAHENAEQBMAQ1-66 ., jg . .BERBYHILLS BESQRAH M. 118 '11 1- BURNS, BOBBY 170, 1 ,...... ,7', , 1iBERRYHIElg,,SEQBGlNA M. 68 1-S .- BURNS, DONALD J. 7O7IfI .... .... 1 BURNS, GANEANEI144 BAILEYa1'f?11fIf3IEI1iIiLE 1685 ......, BUFIT. SAMUEL -119 I BAILEY, M1991f..111 1.7. 249' 1, . HURT. -11. BAILEY. STEP11ANfE-117. f . BRINKER1 RAILLEUL- UENISI? C- 24, 68, 282 .1-..B.R0v11N, ANDREiAS'1f1-1f'19- BAILLEUL- GREGCRY 153 Q III- L if E. 143 T -BUI. LONG 111QI4i11il1II I BAILLY, JASON 168 .11 ..1 69 11- RIQQBION, MARv'1-1138 ,. BAIRD, ANN F. 188 . ...ll 118 JASON 170 IIII I- 1 BAIRD- RICHARD C- 56- 196- 199- P- 115 I 1'BFWAN'I'- G- 247 LI BAKEMAN, SHARON L. 117 169 BURTON, ESSEX L. 7, 9, 3915.199 BAKER- CARESSALI L- 541 57- 15911 ..11 1111'11 1 BUBBBY, ANDREW R, 144, 231, BAKER- CHARLES A- 1 -12 7 BOEHNER, ROBERT A. 119 BAKER, RENA 148, 17, ,,, ,,, 18, 295 SAMANTHA M. 7o5Q j Ii921i!fiii EASE? RQBWARQS BYERS, GREGORY D1 119, ' II BYLER, KEV1141 W- 149 BALA- MIZRHA JC AN... 118 . J BALAOINB, GERALD 259 269 1 1 1 1 . BALDIAFAINZIICHARLES ' ' BALDWIN, ROBERT 143. 145, 146 BALISTRERIE FRANK J, 1.711 1 BALLANAZIN---1'.-ERIC 69 II T BAMFGRBEFMICHAEL A, gABABA,gORRIE S. 70, 208, 299, 240, 2411. BAMFORD, ROBERT E. 2 -A ABADIN , GARRY 119 . 1 ,A -- BANALES, STAOEY M, - 1-,1 F 1 .D..7 CABARLO, CARLO L. 119 . BANATLA0- EVANGELINE CARRERA, AMADEL 144 Ii , BAOUIR, ARLENE H. 67 CABRITO, LALAINE G. 144, 164 V 1 BAOUIF1. SANDRA 168 4, 203 SQDTAAQIG- I311CgDhIRAJEgI-rv?0A1fD5-A49 .,,,, ,- 1- . - BARBA, JASMIN 67, 265, - 'O 91 92 : ,A AANAN, PA Rl K YQ 1 . ',f, BARCELCN- CINDI M- II 11. CAHILL, PATRICIA I. 119g 265 BARCELON, PATRICK B. OAIMPON, ALLAN O. 119, 203 --,11 BAADIN. LAU11112 ANNE 217' CMMPON' RUTH GLCRI 119- BARK. EII-EEN 67 i II7 CAIN- TIMOTHY 170 BARR- REBECCA A- 117-I '117 1 EALAEE- i'-62112 W- Q614- 203 I71 II BARKER.1.l:AF1RYC. 67 ...1 5 I 1177 A . ', L 1171 S17 1'1 1' ' - L- I BARKERI -117 MELISSA 11' '1 OALCAONI, BERNAROO BARKER- MICHELLE .1 ...11. 1 Si' CALDWELL. TED R. 70 1.'..1 ii BARKEFI. VANESSA ,-' CALER0- RENEE 119 - 1. BANFIELD. JEREMY.1E5SiiiI111L.-1212.111-Ta--5-. CALLOWAY. TREBOF1 170. BARKSDALE. I CAMERON, CHRISTINA 70 DARLOLONG- CAMORAS. ROXANNE A -... BARNES, JAM 1111 1 . . ,,.. - CAMORAS. RYAN 170 BARNIER. I 1 1 .... .OANII-ANILE, BETH 1 1- 1111 ----- 1 -- .4 - ------ 1- 11- 115 ----1--1 11 - 1- I -. BARR- - -1118 I CAMPBELL- ADAM 119 '--- 277 2424. 205. 248- 249 I - CAMPBELL- BRIAN 170' BARRIO3- ,,,, ,I-- I fiiii i CAMPBELL- CHRISTENE BARRON8 r188' ---- A 1111111111- ?lIF1ENI?jE169 259' 273' 277' 282 - 7I1II 1- 1 BARRONQBSEQSNHSSII Qi, 1--. II I' ' I EORROMEO, LESLIE E. 144, 146, 270 CAMPBELL, JENNIFER O, 144.-235711. 1 --11. BARTELSQQQEEQSSIENQ-11,43-.Q - BOSTIC, TIANNA 159 CAMPBELL, KERRY A. 144, 271 .I S I II BARTHOE QQEQQOQ-1581111 1. BOUCK, MATTHEW C. 70, 90, 212, 254, 273, CAMPBELL, LORI A. 119 , BARTOL 1- 3' 277 - CAMPBELL, REBECCA J. 144 1-,,, I --1- I . ..... 1 1 BOURUS, THOMAS 196. 198 BOUTWELL. JASON C, 118 BOVEE, DEANNA LYNN 144 BOWDLER, LEONY M. BOWDLER, ROWENA M. 118 BOWEN, BRYAN R. 118, 271 CAMPOS, ADHEMIR 144 1 .--- - 11-iff 1 I'1 cANIvEL, KEVIN 170 CANNON, KELLY A. 119 CANNON, TARA 170 . . OANON, OAROLYN O, 9,711 -I - -11'1 CANON, ERIC D, 144, 212 . Si iii '- 212811--1.--1-N---, Q-5577712 7 E5S'l3Ti'?!f'i:ii155 .Y I r I 1 - 03 A .. . .1 KA A A A' A 707 0 1 C7 4 162 L S. 1 Q -S.:-122574 fav- g,L...:7 -:Erie-.2:.-..f .E1'.E,,A.:S:.6sLL11.-.1:.fi.-ra E, MICHAEL S, 120 E, STEVEN J. 120 ODD S. 120, 196, 227, 269 , LISA C. 120 THERINE S. 120 RE, MIRANDA J. 146 ISTINA 171 PHEN 120 ERICK 171 JOHN T. 72 BRENT 171 GREGORY P, 146 LAURA 72 K iwi ....A.-. X..X.... ..., --.- ::, .-:-- , -....... ,MA-,A-1 ---.,, ..h.1 . ,. A 1 ...,.. .1 TT .-.1 A 224' COCHRAN C00HHAN 117 COLBURN .-.. COLBY, CA 4 , 41441 254 COLCLASU Af . 11 H 5 .4-L---5.0:-1 i-. ' 63, 119, 280, 281 COLE' CHR COLE. STE I' vi 232 CQLI-'ER TRDO 118 I s f , COLLIEF1, RI 119 COLUNS' A no COLLINS, A -A-A COLLINS, 1:4 93 A E X A .-.AEK IO UE 144 -A M. 144, 209 , .,.... , S -A .7 .LSL My .LL L .E 1 5 E, s .1 75 12 1. f 1 1 1 1 .2 .,, . .. S 6. A :ASQ AS.: ..EL1..1. L. . 1. I5 511.0-. - . 1 THOMAS XF . . . AMA SCO, J RO, ANG 1 1 1 A CDONALD 170 A. ARMANDO SUSAN 170, 284 LA L, 119 OANN C. 119 ELO 71, 98, 236 . gy ...4 , . COLLINS. COLLINS, COLVILLE, COMAN, H COMPTON, CONLEY, L CONNELL. CONRAD. CONRAD, , E , ..., STACY L. 120 THOMAS J. 72, 98 RACHEL E. 120 EATHER A. 72 HELEN E. 120, 271 ISA 146, 252 ERIN C. 120 CHRISTOPHER B. 146 TIMOTHY J. D'ELIA, BRETT 172 DALE, KATE J. 120, 249 DALTON, JAMES DALTON, MARGARET 171 DALY, JONATHAN R. 120 DALY, MICHAEL J. 120 DAMON, DEREK D. 146 LINH THUY 120 QUAN NGOC 120 REMY THE 73 TAM 171 THUY LIEN THI 146 TRINH NGOC 120 DANG, DANG. DANG, DANG, DANG. DANG, DANICO, BRYCETON N. 146, 267 DANICO, LALAINE N. 73 DANIEL, CARSON R. 146, 203 DANIEL, TRACY 171 DANIELL, DEBORAH 171, 271 DAO, ANH NGOC 171 L01 .1 .,. w .., DIOSA, BEETHOVEN 172 DIRNBERGER, NICOLE 121 BIEIING, THOMAS DIUBALDI, M1CHELLE 121 DTUCO, STEVE B. 74 DIVELEY, RAYMOND A. 12 DIwA, .IAME 172 DIxoN, JENNY 172 DIXON, VICKIE A, 74 DO, BAO KIM 121 DO, HUONC KIM 121, 281 DOAN, MINH DANH 172 DOAN, TRUNC Duc 121 DOBBINS, RICHARD 121 DODD, GREGORY 172 DODD, NICOL R. 121' DOMINGO, ALBERT v. 147 DOMINGO, DOLORES 172 DOMINGUEZ, REYNALDD 121 DONACHE, REBECCA C, 74 DONAHOE, CHERIE C. 121, 269, 273 DONAHOE, SEAN 172, 200, 226, 277 DONATO, SEAN 172 1, 318 SEXMQCQR. 7, CONROY. CARRIE E, 120 DAO, HIEN BICH 120 DONEUX, MICHELLE D. 122 EDWARD JAMES 7, 27, CONROY, ROBBIN R. 146 DAO, MINH NGOC 120, 280 DOMINGO, AGNAS 74 E SON, ,ANGELA S, 1,9 CONSTEIN, TROY 171 DAO, PHUE NGOC DOE, M. 260 ON CHWSTOPHER 170 226 CONTE, CHRISTINE A. 72 DAO, THI BICH DAO DONOVAN, KATHLEEN 3, 122 S h' TENS BRETT K 144 ' CONTRERAS, JEFF 146, 282 DAO, THUY NGUYEN 171 DONOVAN, MELANIE L, 147 BERNADEWE R 144 COOK, BRIAN A, 72 ,,, .. .. .. DAOOQYAN BICH 146 DORAME, ANDREA 172 -55 ER. CHRISTOPHER 119 COOK' DAMON S- -, DA7Ei!NEELN.!5R 73 DCHAME- ANGELA M1 122 EQDEBCRAH 7, 28, 284 COOK, DENIS E , DoRENzo, BARBARA 122 . ' COOKE DORNBERG. DEBORAH A122 ER--FRANCISM2-144 A ... . .. .. . L .EAS GQEWJHEN H19 .1 ,CCC DOSWER- LEEANNE 172 RQPHILIP 170:75 . -1 DOTSONIJENNWI 172' 284 ' JAL KRISRNE A .2 ARI 4-.6 .. COTY' CHHISTCPHER 147 JOAN L .... DOTY. NICOLE R. 122 11,1 II,, ' ZIX- 1'I DOUCI-ITY, MICHAEL 172 A I DOUGLAS JAMES 122 -I MARIVII3. Il ' 7 . -.-. .f'1' JOSEPH P' 1221 283 0145119 '-- 6..1. MICHAEL E- 122 .M1611AE1.. 7 :gg Qi A EA f 1.114 AAAA g a g, M 74 275 277 1 1 5. 3 I' 1,, 1.1 1115 .--' .-1- ' ' ' A . ,. 5511 129 530 -A I11- I Ei ...,,. .., DEE. ' 1 CE X CI .--. .., .1 .... 1. I Q . Eg A I A . ,--: 1 Q . ,- 1 I A I,.11 A I ,, 1 ...A DEINES- -'CHN C-7146. , I 2 A CBNES- PAUL '71 A 1.. .A46 SQHYANNA L g I ...I.. L A- ' I DELAGPU21 MA77C0NCEPOIOB27f47.TT'S 4 DELANO, MARIE 172 I ' A A DELEON ANGELA L 145 275 280 DELEON: LEILANI FJ120' ' II'I A , DELEON.RENEEBOYS4120.233 1 .1 RS ,,-. . DELHOMME JOSHUA 172 .Q.ea:- 'AAPII 1 5 ' 1 . LS.L 6.II 4666 A QELISLE, ANNA 111,73 IIRR A 1 . R112 A 7' DELISLE- KENNETH O. 73 6 5522 .1..711 6,. - j . gEtiifF0BRI. 505231311 120. .. . y - A. . '..., . A ,,,. I 76. A 1 1 1 5 1491 2494 - ... ' - . I v, I D7 f i 1 . 72 s. .... .... E S. KINGSK' 121 A 00 0 . 1+ 3 Y , .... ., , A' ' 1' , 147 6 1 DUCNC1 75 .L 1 1 A-1-:: - DHONO, MV 111x173 5 gf 1.,.g4S1,1,2g, 123 A A A 33333. 0:7113 H15 173 .14 ' 121. 252. DUPEYRON. TRISTAN G. 75 . Eff, 1 I ARAA 2591 257 UUOUE-CESAHO'1471200.201 , 7'7.7 171. . DUQNQTHANG1122 VASE . ,.... - Q7 7 - DUNBAR J y '..' 47 A 331575 I 1553-ff Es . I A 1 1- NCE B. 74 DUONG, LANG 147 5 DEFiU,fJENE1'fE'F. 121, 190, 206, 320 DUICO. STEVE 260, 251 I i ii DESANTIAGO, AL M. 147 DUONG, BUUTAN 173, 280 1 C7 A . A ,,... . . 1... ., 1. .. , LTO E. wILL1E MAE 122 ,,,,, , ... . I.1 . L DESJARDINS. AMANDA A. 24, 774, 300 ' DURANT, MDN1f:A'A, iii W E L.. 15 3 9 DESMCND- JENNWEH 121' 272 UURHETTI ERICA 173 ' 227 ,I DESMQND. JOEY 172, 277 DYER, CHRISTOPHER ...I S- DUMA9H? 7AM.57E34-171 DYKES1 CHHISTIE L- f fbf DETMERF L I Q ZZ7 - DURATOI-O. DAWN f A DEYERA. A 7777 A , A15 - ,O WL -'I DEVILLA. A ,,'. . -1-' -... .11 1 DEYINEQ f A ..4.. . . ,'I.. . 1. . I ...- . . Qs .1.. .01 - 1 66.1 . .... A 1 1 ' if'+f2 -T LEABP,cAR1 7s , . ALLL RgggT,gA1gg,,gg,f7g7,,, 2,5 531 ,' DEE, EVANGELINE 171 EASTER, SHAWN L. 122 ,I-f 1 f AAAF DEVLIN, DONALQLS .... 121. .... EASTLICK, DAVID 173 b - ---... 1 A, .. 1. .1 --f. ff.. .. - .. . 71 . A NA R 1+ A1 Ay .. . Q- '- KLA . ':- S-E i ,,.:: ,--:,- Q 1 2 ,1 41 f.11 i A EAIMAN. VICIQQRIA P. 147 1-1 1 R AAI f ., md A --- ' 7 '711I' , 1 , 1--- 7. -..... 1 1.- I E61-IGLS, AMYB- 147 2. 7 ECIJA. ARLETTE v. 75, 122. 274. A 1 .... M R I A.::. , R 1 CAR -I f ECMA. ARMINILDA CHUA - CDIAS, LUANA -EDBOLLS.MARC,A.122 DIAZ,DA 1?g ,.,. , .., . A EI3EfaHAUSERiLMiCHAELA 1471250 .6,,,. 1 1 A - '.66 . . . . I 1.A-I A 4.T. ORYSYAiE.. .4L g ,S m R R YRS.. . - ' ' A EDMQNIDS KEVIN M 147 ff cuMM1NGSfi RA 'E'- '72, ' ' 13: 121 A V. EDQUILANG. DONALD K. 122 1 254-.25gs'g1 . f L. ,.1 ' DGISEQNIAN- 13155395 H1 14713541 251 EDFQNGTONA QEBRA L- 147 .... ,',4 . :gr L- 1221247 .... , I.. '1 - 1 AI1' I .A ' : 5: 5 .1 I7-- III.,, EDWARDS, LAMARR 173 - .11 CUNANAN' RAN CNSIRRYLLIS 172 I77767 A ERWARDS. LEE A. 75 AAAC ggmmggm' 5HBUCH1WENDYL.11-311122 . ' A1.. .7 MICHAEL -L 32' 75- 2361 2581269 CUNNINGHAMI 77 L.I I JOANNE 147 . CUHATCLO- .5 . 11..... PARC- PH'LIP DL 147 , E5 ,123 - 1 . ig CURRY, STEPHANIE 1465535213 DON 173, 202, 203 Cupms, JOHN 171 I T. ,AMLQUANG 121. 201 1 ROY D. 147 IN? TS S CUSHMAN, JANICE 171 A .- ,,.1 i CHRIS 173 , CusIC11k..w1LLIAM . QQQQQNDLIQZ . TAA I 1 CUTSHELL,sEANLC5120,.IS ,..' 5 . I I L 1 I -i 177. A A I TII 25, 7 WH. AI-I'-- . - . I AILLLLL 7 TTS 7... I 12322 11 .21 2 11 ,ET 1 IINDEX 31 S AN ENE : 1 :E NR-3--- -- :ii RSSTSS1-157.2 1-L'.. 1 :'. ' A-SMA? A' 7 'O L '1' ....... ............ - ........ , . 1.1.1 1111 . ' ..... ,.Ll.., 'Y 'I ' ' -su 1 ,, 'ii2 :..1::.::i '.:1 ..... 2 t:.. . , ' . . 1 1 I I , 3 '7 ' ' 1 11: 2 5 . t':':: K . L ,.,. ,' 7 - ' T K, E .. - A1 1 :.-.. I . . . A . IIRR. f E. ,-.-- .... .--- .1 I ..1.-- .- ..- . . .L ..-' ., f 1 11, ,115- 1 .1 1 12 ELLA. MICHELLE M. 23, 146. 147k 1 FINUCAN, enANoQysf,12a GELLEKDANA 1741 , , csmlsgv, 132141555 1.74 , 1 ELUS- EDWARD b 4 4 m 4 4 L GELgge2fMaQHAEL E. 124 4 2, PAMEQAA11-24 4 , E'-US' 451 . 2 . 2 1425 7 EL'-S1 11 g m1 Kihh 11hh GE51A12n1NE 75, 259, 282, 283 himzzh Q, Gu1r1uBA.75PEiQ 222: 1 KTZIEE EU-S1 BRYAN D' 41' 755 269 1 2122' 226.22235 221222 4 122 1 222 GEMHELL, STEPHEN 148, 218 1 2222 .2h1222 GUMBAN, CRISTSETA 267 ELLS. JOCELYN 147 F1TzGg13g1AD,' BREAES. 77 7mL72,, g ' lifiif GENBER, JORDANA 124 GQNTHEF1, JENNY 174 ' Etg?N5V'C39gfX4ggIL?fEDii?D 122 EL 1 AMELFA Q1 ,124 1 CATHERINE 124 1 4 .EEE.1.... 2. '11 .. 2. f ,171 ,.1E 1 EE.. ,1 7 E17 ',44 EE.. EEEZZ QTRISA 2 .... ,1.QQ3F3lCAF4TE 174. 274 5 5 - GUFERREZ. BEATHIZ 5 1 ., EEE I 1 ..2E 7 i -1E1.EE GU 13EFiREZ. FELIPE ENGLA11111g,DEaeK 143-,A 227, 245, 247 f I FLQNNKWSLLIAM 1 QEQSARDT, A,'QLgsgvgQESA eurrermzz, 141211511515 174 ERB, AMY 2123 4 7 FUPPEN, CHRlSTYEj1?3 if 1 GERLQQCH, PAU1lk138 gg - suv, 074111115141 ERB. CHESXL-ME? 7643 F1.1PPEN.41oHN 123315203 seam-ak MARGSSAI124 1-ERB' - 111, F'-009 PAUL. 1,11 1.,1,,,11: 7. 2692 7 FLOOD.. P111u1P1 . Gnmfiramigh, 1 1 1 1 'fffigi1EAKlNS2'112 SEPH 121725 Z2' ' 27 111 F LORENDO, GERRSV7348 Gsa5SI222Nu'CoLEf5i2ii?Si Zi. J 1f.1 ELLISQBQREEN 147 7 2 FLORENDO, LOSALYN 77 GIBSON, JOHN QQ 142, 254 , k,,k7ERB, PETER J. 122 nonzs, Ausom 148 GIBSON, MICHAEL 148 -71- . , 7 w LLLL S, FLORES, LORENA 173 GILBERT, Emo 78 f 7 ,1., sill 11-1 ,,11 ' . .HQQSB-4ULl,E Hifi. 2,,, , ,,,, E ,,17 FLORES, MAFZIBEL c. 148 QLBERT, JENNIFER 174 LII. i 7 FLORES MICHAEL 159, 173, 175. 203 Gmeam, SCOTT 1- SHPE ,,,,,.,,,,, ,12 1 ' 'ZZB - FLORES, OSCAR 148, 200, 226, 227 GILLESPIE, TRAVIS 0000 1 0,-0- , :,,I i-sf'igRfXKQifQilffiE?21, 211 31,125 Eiga? g?g2Lr5O1 1129.213 ga, 200, 201, 226 GILLHAM, PAMELA 78 1. S .... , ,- . . . GILLIAM, DENNIS 148 - -f.1g,,,,-,KlMB--.LY A. FLOURNOY, curms 77 Gm, HOANG 28, 273 . FLOWER, JASON 148. 200 GIOBBI, PAUL 124, soo 125, 243, Tm, 361- Focu. BETHANY JOY 49, 148, 271 GISH, PANJE 124 1 B001 5 Bf,,' , 2 147 Fo1.wA51s,141, Jsnnv E. 123 csasr, CHARLES 79 KARSESEEIZA S, 76 FOLWARSKI, RICHARD 173 GITZ, MICHAEL 129 ,,,,, 1 gggE?E7?23 FONTANILLA, RAQUEL M. 77, 277 elrz, ROBERT 174 5. 545.h 111-T ,4-1, .4111 ,,-, ,,, L , FORBES. RUEL I. 148 GIANANGA, CESAR 78 777,- 2 FORD' BRUCE 143 GALVESON, vv 269 B44 4.77 ' 7 FORD, CHRISTINE J. 148, 263 euasow, c. 254 2 ' ,,,z .-4, B. 30. 122, 209, 273, FOHEMAN, SHANNON D. 77 GLADDEN, ANN MICHELLE 124 114, 7 1 5 FORNACL STEFANE P- 78' 277 GLEN' WCHELLE '48 - I., ,ig1i1AOgDi2. 337 Eg2?EJSTAhl11AlC:-I71?3EL 173 GLENN, SHELLEY c, 148, 274, 275 . H ,,,,- 1,,. - GUTHERO- SEAN 124 - Foam, ELIZABETH 123 c-:Lea JASON 44, Q FOSBENNER, ROBERT 123 eww, STEVEN 124, 196 7611236 FUSE, JOHN 145 GODDARDV AMY 1431 211 BSBI ,.. , Q41 W 1, Egg? 3323312 111753 123 212 254 ggDOY- AIMEE 174 , fB1- 4,44 4-0,, ..7, , . . , 02111, KYLE J. 143 , if 123 GODZIK, SHAWNA 124 1 111215 123 --77 1 5 4 Q55--1 - --:- xy 5212 4.4 --.-:: GOUZU4- TRACY 171 5411 79 54 Nm. R2 B1777. 148 , cows, KIMBERLY 148 7,,1 - ' ' -74- , 174 777441 1, ,BS1 1 1107 173, aaa R. . 1 78 2 19, 256, 320 ggi? 114 2 S 7--1-- -- .1 77',.-: ' 174 113 77774 I W3 4444 , 1 2 : I111 - 1 174 f 12 1, 124 2 vncron 78 148 7: '717 X .,2fsw2, Ex' 2 EQ,-'Vi ' ' 4- 7 . '1 -. ' f 1: ' ' ' - ' 4 . 4 2 U . Lsomfmoo 123, 273 , Gomes, S1-IONDA 149 - 1 Q X ,Q 1114 152444.42 ,,, Y 1 BE -1 11111 KLIN, JULIE 22, 115, 123 GOMEZ, PAOLA 174 ..., ,.,, , X T22 X7 Ew'EP5gQxf51A,173 , 2,2-X5 fx-.zzsf 1-ease:-11 .I--,-1: .. - .,,. . :'7 . ..:1f:4'.S ..1.1 2 - .,.1, 1---,-11 f I I 122 ' LYNETTE 173 , AKHUMLSAM 148 f':I'3gRfg D1 77- 195 -14.. .,,.,-, , ..,,, i LA L NNT22 1111 122 .... . 77 1,541 .5 ..... Nw .L 1iZ?c:E::lv.2:-2,2 . - 2. 5:- FRANKLEN, KELLY 123 FRANKLIN, Lom ANN 148 FHAN141211114. MICHELLE 123, 271 FRANKS, RILEY 148 FRANTZ. CHRISTIAN 148 FREDELUCES, LYNN 67, 78, 112, 263 FREDERICK, KEv1N 123 FREDEFHCK, PETER 148 FREEMAN, JEFFREY M. 123 FRIESS, JOAN 173 FRITZ. DARCI 173 FROIDE, HOLLY 173 .. FRY, TRACY 148, 158, 267 FR AF! TINA 173 . ....,. .Y- . . S. za, 231, 250: gfwf,PuuLERfrON, SUSA-N'-113-: 5 5 GONZALES, MARIO 124 GONZALEZ, GLJSTAVO 149 GONZALEZ, MONICA 174 GONZALEZ, SALVADOR 124 GONZO, CRAIG 149 GOOD, HEATHER 174 GOOD, JESSICA T49 GOODWIN, FRANK 149 GOPEZ, RICHARD 149, 273 GORDON, CHRISTOPHER 149 GORDON, ROBERT 149 GORMAN, KIRK 149 GOFIMLEY, JACQUELINE 174 GORMLEY, JESSICA 124 GORMLEY, HEBEKAH E. 79 GORNER, EDWARD 123, 124 VICT 5 Yv - SEN 205151115365 . 5 ifzii, 5 A' YEEN-14-DAVH35 ,,,1,, , E., ,GARYQSXSU . .. HAEQEN .IAS X igiamy QM ST KN, M12 22011 cur? 5 1-1211325 125 198 203 HANSON DENSE, 125 212 HAC1-:Er JOE 13 1 gg H2253 ?E'2Q, 1 11 HA ADORN X 31.9 2721235 Y 2212 X . E 1,,, 1, ,,,, 3, . .. .wggwf 2 X N 1? X Q4 X X. is X V, X4 X 1 , M NX X 4 YA N15 WS' eg' ax 521 112 25 QX X x 2 N N 4 4 RQ, K X E X k A Nl w N Xi N1 XXY92 Y Q Q1 XKNM XX S W Kiss? xg X 9125333 2 Q Q iz -iw .. E, 15 A . ... X5 1 ... f , ..4 J 2 , .... 4 '.1-1 HA . 77,, , BB47 . . .. W. , 4... N' -5 H, 1 , 4 .' .74. 47. 5 11 76 f 74'f. MARIALUZ 173 5 FUNK, TEMOTHY B. 41411ff GORHELL, KATRINA 79 2 HANSON, fs? f ,,,T l 553325 ' 1 333351 WCHELE R 149- 2801 281 QQQSQLL, T-1 ,.- ITTB -4-- 4. 1.44 - 5 ULD- 'WBERLY 79 1,,, 1177 55 .552 ..77 - . -..T, f ...T 4-. ' I GOWER, TYLA 124 ..... HIS : 2 some. JOAN L. 23, 149, 249 B66 ,,,, 117 5 , ggAc1A, JENNIFER 124, 131, 274, 275, In 'L ..-7 A . 4, ANT. USA174 1484200, 201 5 1 74.4. 1 - ,44... GRANT, Mmmew 124, 212 S- .1,,.,,4 1, caF1As1sss,wENov79 7 7 '11I - ' -- - Q -- 25,5 1,--M-5. ,1-1 1 sv 1111 5 1-A -. .5 ff -:4:::-f' 5 -::: .42 7144-- XX-N. M ,444 444441 wx --4f 4.- S 15145 -.44 sw -444 5.1.1.2-5252 f1f--4 ,,,. .2 fm- 44444. 512 44444 ROSE ., .15-A ,,,,.. . 2 -21 Q R.-.M 5.1 . 45.5 ..,,,, . 1--uw --1.1 Ximv-f 1117 5 143 178551 .111 A ..1. 1111 71114 4 5 2. 203 4441 FM-122-280-528+ F378 GRANTJSRUCE 174 2252? L' . ERA? JACK 124 1 f - A 441111. 1'1 7'1111 RAXZQKIMBERLY ,174 . II, A ,.71 1 4 41111 5 ,.17. ,,.., 11111 A . 7 2 .111 1 111, .444 GREAR, WENDY 174, 211 1 h 22 T gQEl5rg?iggH551!R1:?ZQS 148 32500, SREISDA 124, 211, I177 239 ::'f 1--' -- 2 ---. -...7 ' 1 EEN, HA 149 .1.1 4-- 1 i ii. 122 1 A --hhi kk,, 271 high- A GREEN, JOEL 124 3 , Vygyh .SX y AL 1,,1 I ,..11 -. 1 A A GREEN,-JCASHUA '11- if 15GAuLAFes3o-fLU1s1T612a - 1 GREEN KLEIGH-ANN'-79 ' 252 I 1 1,,44 4 GALUGBEZI HOWKRD-148, GREENAWALT, TRACE? if .1iii3sih?ii53t1lfisPH1LiFf125. 254' 7'11 , ,,,1-, -:,GAtNggiQfE,GLYNNJ8, 254, 274, 275 GREENE, ALEXANQEBQ174 ll ESANE U51 5 5 ' :NSKE 4.1.. ,'.1 1 ..111,1 11',... QAM 4A,'CHF?fST1'V'fA- 78 GREENE, KEvlN,72gg?1 ' -HN' NS, JOSkgX3Ai-175 ' n .... 7 ..11 CAHOLYN JA 123 .1. 7.1. ' 2, .1.. S 2 GANAN. evvew 148 f 2 1114- 17hh GARANT, 111174115 B, 17, 78, 254 Q1-1Ev1ELL, wEN15y,5:1425 -1.11.. I 111111111 4--44-4-, H Aves, ALAN: - 1,,1 GARc1A, DENNlS R, 123 GnewEN1c-1, M1c151Af1. 174,k2?6 1111. L .,.4. 7 HAYES, CHRISTOPHER 175 ,,, Wmxh 1 1,1,. 11., 1 4 GARo1A, E. KATHERINE 148 , GREY,,,LJ5NN1FER, 159, 174,f19Q, 320 11., HAYES, JOHN 150 4 .rrk :L,, it I-ifggI.EF?qHJ1ig3 4 . 124 5 y MICHESE 150 , 1 .,,..,,,,:.... ,,,.. . , Lk:.ki f:k,, , - X,,, PHER 175j k.:k ' mh1 , gASg QHlCH3gg 4121 . , t Zik 7 2FiIES?If5Eg15WILL5AM 1419 HAZENFGERAYLU , . 2 , . 2 ' .kk 4 , Zm. A AN1, 11111 174 - '-'L F111fsma,AMY 124 11 LLV. 5 1 HEATDN, .cemmssn 150, 252, 254 .KIL 2035226 I -' - GARIBAX, EL1zABErH 148 4 smrmw, BELINDA 4 , Hawes, Kevm 82, 195, 198 - H VGARMAN, KARRON18 A GF11FE111f1, JAMES 124 4 5 , HEDGEs,MELAN1E 175 . 4 11111 4 if 4GRlf3Q5C5T0C'A M5512 11111.1 HEDRICK, DAWD12861 320 1 111 1 -1,, HE1111s,,RQ55rfm,125 111 , 1 1111,1 4 '- rx 11-- gGARRiQ g1M1GHAEL- GFilN.5BUSSELL M2fmfHEw149 11-1 - 5 '1-1 , HElN1TZ,JASON7175 5- . 2 GASCQNQLMAYBECLE 174 GR1NoLE,oAv1o 174, zoo 1 A - HELSQI,-JON 175 . 281 1 GAVINGQANDRE 174 GRISWOLD, SHERBE M, 149 HEMBRADOR, DEANA 125 ,3 1 1. GAWARgN,EDR!OEjiBl123, 282, GRIVA, TANYA 149,i37k1 , HEMMING. PAUL 151. 235 1, 148 111 ..1111 GROECSIK. I HENQERSON- JUSVE.-181 2 GHOGAN- 1 HENQERSON1 1111..- 11.. 1111 111 GEAf331Q,:?iZgfAV!D AI.AJSI::S4C, 78, 29,-90, 212, GHOWT, Hewmnrcxsowgggge 28, 31.32, 227, A. 2 f 252, 254, 273, 277, 286, 287, seo GUANZON, Rom?2 f124, 227 HENon1cKsQm2Qs1oNAL1z151, 217 h mhz, 1,22 GBE, JENNIFER 32, 78, 232, 233, 269, 271, 5 euennsao, GRECSDRY 18 HENIQFQWQHELSEA 151 4. , . .,,-1-' 124 . A 5 7 1-- 'l f 1 ..,1 -.'.-' -.5211-f-, , .. f ,,.,.. 3gNA ., QIZPQW .',- H517 .,.. 77'1 124, 226 ,77- h 4222 ' 'hizzhh m 2545, 1 2 4 2' ,,15 5555 2 'Lk 'k',': 7 :kk ' .,,- 5-: 'ii' .... .. ...,, 4 .. A . 5 '42,42 ,512 2 2 1 f 2 -T 'fiiiifi-E12-i, . 1141.1-.2,M4 . - -- -- ..::. . 51511 -5255555-52252-f.. -55:5-. u 1- 1: 1 1-. X HERNANDEZ, ALVIN B2 56.2 HARA, JERRY 150 HAY, SHARON 267 HARGON, CLINTON 175 HAAS, CHRISTOPHER 175 HAYES, PATRICK 175 HAYWOOD, MICHAEL 199 HEISSEN, BARBARA 151 HENDRICKS, DIANE 151 HEDGE, J, 260 HENTGES, JOHN 151 HEREFORD. SEAN 151 HERMANSQN, SCOTT 82, 263 HERNANDEZ. HERNANDEZ, HERNANDEZ. ARLENE 125 EDGAR 125 FEDERICO B2 HUYNH, HUYNH HUYNH HUYNH HUYNH HUYNH, HUYNH, HUYNH, HUYNH, DAT MINH 126 DIEU 126 DUNG 151 DUONG CAM 126 HIEW 176 THACH HUY 151 THIEN KIM 83 TONG 151 TUYET TRINH 126 JONES, KIMBERLY 152 JONES, LISA 177 JONES, MICHAEL JONES, PAUL S. JONES, SHARON 152 JONES, STEPHANIE 177 JONES, THOMAS 152 JONES, WILLIAM 126 JORDAN, ANGELA 170, 177, 248, 249 JORDAN, GARRY 126 JORGENSEN, ANGIE 177 JOSE, RAYMOND 176, 177 JOSEPH, KIMBERLY 152, 264, 2 JOSETT, NORMAN 122 JOSETT, STEPHANIE 177 IBAN ' NY..-.,--, 11 31 A 2 La- I 11 is X. .. 1, LA 1 S ex L. 65 KOSEK, CHRISTOPHER 127, 196 KOVEZELOVE, KENNETH 152 KOWALSKY, MERVYN 152 KRAGER, DONNA 152 KRAMPF, CRYSTAL 177 KREYLING, REINA 127 KRICKHUHN, DIETKE 177 KRICKHUHN, KARIN 86 KRUEGER, KARL 127 KRUEGER, KRISTINE 127 KUJAWA, KERRY 86 KUJAWA, STEPHEN KUNAVICH, MICHELLE 127 KUYKENDALI., TIM .. .,. ...ALL A , , , A, .,,..KUYPER,,KARYN 152. 171,-217 Ez.coI1INNA 126, 275 -IQYC .C-A.. ..E1121,.1A .,.. IHT- 1 ,,1,,,' ,1,1-H' . HERNANDE2- HELEN 125- 225 IKEDA. KEMI-YN K. as . RERNAEADEZ. REBECCA 175- 269 1LANO. ANNAMARIA 126- . 'fe 152 A AA AAAXAA, X HEHNANDEZ' REDENTOR 175 ILOG. LEONARDO 12625 5511 Ai KNUDSEN ROBERT 238 239 HEHNANDEZ- RONALD0 ILOG- RUBY 176 Q.,f..gL.i11 5.151 ' ' ' HEFINANDEZ- YVONNE 151 .. IMM, HEIDI 126 . . ',,f A NG, ANN 84 A .. ,.1 . ,,'1 ,A 300 JESS- KATHY 152 , ,P....P A ,., ,,.. 1 2,... A' . ,,,-111 1 . 22,, A' X' TAE2 A,1 . 326 .,1., HHII I'T I 5,- :A ,1-- 4 ,1- ' 1771261285 HERYQA I'-I ,,,, ,AAA 127' 235, 235 . . AP. R A AA R .A . . A A E1 '. L A ',-- , 11151451142 LAHHI . HICKMAN. 861 28' I-IICKMAN, HEATHER 1 5'I1 A QS 177 HICKOKA JOEL 175 HIGGS 11,, .BRIAN 151 22222 A ,1,, ALCAR ? A .L . f Q:f,f'TgggffgQ',1,2g2 5 . . 'T A A A.1 HILZER,,ANN MARIE 82.522, - - Q5 A gg, --.- . . . . . ,,, ,.,, . A ,.f w A - I-.- A A 531 5 -Sl ' kh iv: L.. :L E -fl A Ai -'5:' A IKPI A' A A' ' 3155511275551 ,,, HIRNIN1'3g',E L Eg QAA 1 . ' . -- s A-5112 Efriz. 5' I P Rs' 5 1' 1 A 152132.52222 ...A .. .- ' 2 SA ' . QASW1 HLAVKAILAAA f 1 1 .I 2- A A SAE 'A ff 1 I ,,A Ho . A .,..,,, 51 . . .,.. i ,, . A . 3 -. .... 1. 3 1 ,,'- ' ATAAA A TIE b2f1EAA,1 A AAN , L : E-Eiga-I LQ1f11R1?f,AL AAs A5 ..-. ' ,,N. Egg. Ra ises. . ,iw -ERE g. A . . M , .A 11 . 11. A 5-3 2-111,51 A 177 ,y...A , HOANG, 111A 11 29 iii --X,- 27 A , , . HOANGQG L Q A AAAAA AAA ' ,,.. 11, A 5 . A 9- E . .,,, 1. .1 I A I A A1112 . , LE .Is , 1 4,11 331655 .1 ..,, - 1,,.XLX ...., , EM ..... A 227 . 'XL ....., 2 . A I .I 1 'A 111 11-, ' 1 A ---- -,-- A A 1 3 A 24, 152, 206, ,.5 2gQ',j21fkgQgg 1 5215 A,, A AAA A11 A A 'L 86 A 15 .1. KAssEL,NoI1Ge11L ,A 115, 127, 238. 11A . 12 KAULER. TAMMY86 A wus 111, KEANE- TAMERA 1 LAURA 152 v 1-AA, -2AA-'A LA 211.1 ,,. WALTER 17' . A. JAMES 127, 260 11, , . RALPH 121 I S014 as HODUL'?f5RA'G STEVE 121 sm SONG 152 HOERR' MATTHEWS soon as AAAAAA111 JENNIFER 152 ,,1, HOERR- MELANIE 1511 3 11- 1 ,,. RILEY ,Km TINE as EMILIE ae HETRICK, MICHAEL 12 .1 R111 . Q 1 -. -12 1 A 2 . ,,,1 ' 2 1252 A A -.2 L1-E ZA' xg REA AK, 1..B ANANG. LARRY 177 HOANG, CHONG 125 . I AAQLA ,vis 5. 1,-my-.-w- I n L 23.15 511 Nigiig A 1-:::- AAAREEQARGE LAURA 127 HOANG BINH 125 v I SNL AA IA Av AAAAf 5'5AA5 1,A A 1 HOANG' KELLY 151 . 1 ,1 MLAFYIVIEPE- MICHAEL 152 ,MSAW 'RACHELLE ,5, 51315 1 ASQ-fl-ARSON-TODD152 HMS .ED 175 m ,,. , . 127 ,IA A ,,,. V.k-'i,ASHLEY, NANCY 121 1 AA ,11A-5 A' AAAAA A, . A 1 11 RI 5 LAssos, JASON 152 HOFFLAND. TIMOK A -- ---------,-1- A V, ,A ,,,. ., 1-11, A A ,,11 .. L..1. N. ,- A . ,., ,TAMMY 85, 113 , ,,,A..,.11,,,,.A,,..LASSOS, TAMRA 177 . HOFEMPsIi11EQ.E 3 5 1 A A ' . A gg rs - ...NAA --- A 1 1A 1111 - 1 IA . kkA1 ' ,..1k: .. - -' ,, AA R. KWANSENE ff,1 f,,, 1 TROY 127- 212. 259 ,,A NNESEMLEWA 55225226 121 8 I A-'l VAAA'AA 1 1 :I1 -D NALD 6 ,'j35? 5P2N A 1 A,A BRYAN 115. 225 A A A SUZANNE 177. 2-16. 247 . JAMES ss, 212, 252 . AAA,1 A 1 A vERoN1KA 123 1,,,A 11 52? ACL L KYLE 21. - ,151 .2 25 N,.. A1L.Af ' ENRIQUE 152. 280 II 1 3 TODD 128 . 1 PV IIRRZ' ' ' 1 . , AA'11 ' ILAWLOF1- ADELE 111 .A sg Q5 5 5 I 1-1... --1- , K 1..1. 1 ,1-1 i ---- . 1 3 A , . , LXXAQ . 1 A ,A A'... ETCH1 M'C Ef: 152 A er . AA .LAWRENCE MICHAEL ' FEE I LAWSON' RONALD A 11T1 'A'-1 55'-3'21X1'5E2S3 ,,. A 12011 127 R22 'LE 11111 111111111 HONG 'CHAN IIYEN 151 .51ljlr3D1ENggE117152. 235 LE. NGOC H3116 P 131 24 273 11 1 ,.-, 1 , .,.2. . . 1 LE, NGOC Q-OC 1s ,'.2 H3'?1'2'A1KE3'NTHAN'E,l?5 ,.,. MNH NGOC ,P',. QQQPQAROBQSPB ..,- KESER- SHERVI- 55 . .g .A.,. HQPK! JEANWE L 83 .,hk , 5 ,g K . KIKUCHI, DIANA 127 A, TUYET?-Il . HOpKlNS.JuUE175. ,-,., ., 3. KILLIAN, DAWN 55, 271, 289 ALEAHY, M101-IAELELA HOPPE AIQPISTEN 125 AAA11 . KILLPACK- CHRISTY 152- 270- 280 LEAKE, .112NNIEERi1152.A275. 280 HORN LAURA 27 as 272 I 1 .,.1 3227 LAGG- ME'-'NDA5127 . . A A ' ', ...11 E21 A5 A2 .LAI1 ANH 127 A N 5 267 149. .1....1. . AAA1 11.R .041 11.85. 221 152 AARR111 'P 152 QAVEEARY, MARK 2a,fAa1.AA2s4i A 1 AA.AA T . .AAALCAMFCHAEL 117 :EEE CHANNELLE87 A HOUG'1:E21siEll30NL91,A64a-AA183, 1131..2Q1 I2ING' PAMELA 121 'AEEE' CHRISTOPHER 128 260 i Y 51155 51511 RAE ' KING, PAUL 152 IP1A QLEEV DAVID 128 220 ' . SES KINGS'-EY. DAVID 111 ELIZAEETEQQAE2 AA.,2A 111A 1 ,.,,,. KINGS'-EY' DAYNA 121 HOUA , S Q . 11 ,KINGSTON c. ERIC as ,A.A . LEE, JAMES A AA 1 KIRK- ANNMARIE 35 ,,,. LEE- LISA .-AA . EEE' Sf21iI21?1NDD87' 260 ,1.. ,HU 1 ' Ei , 1 11 ..1- LEE1 R,CHARg.DEgf,8RIN 177. '1A Z 1 as . 5 1 25 ' 5 LEE, SHU-FENSB7' 51. A LEEK. KEN11E1R.111 - 12 -2 . .1, V LEPEVPE-BAUQEIZRD. 152 'AIA LAGASPI1 226 ' 5 5 I 1 236 LEMAY. ALVI A I LEMAY, BRI 1 .112 ,,.. f ii ,I AIRII LEMAY, 15 1, LEMAY-MICH 7 3132611151135-2051232 I A 1 I Ex 125 LEMIEUX- CRA A S 2-.f EEHQSEIJQL . 1 ' IA ARRRRA A ' 1 A 1 2 LENZ-TERAH177 ..A2 1 , A.. .AA 252 254 EXSQALQDBEJINA 1 1 AI': ..A. , 1 1 1 A 152- 12551 1 A . Av . . AA.. AEI-152 LEW. DEBORA 122. A 2041 205- 2111 LEWIS. BENNY 111 I . ,,,. A 131 12 15512 ,,'1 ' AQ AADIFQA AA, LEWIS, EFIIK 153, 200 . .1 A' LEWIS, JASON A A ..., , I 86 LEWIS, JEFFREY187, A A A ' AA. .... . 1.22 1 1 1... 211111 .. . 1 ' Ig AEQAEA .. , ,. A ' -:: AAf.. , , ' ' ' ,A AA... 2-A.A 4 A 7 1.. I X A ... ,,AA , , ...... A A T .,. ..... . .... ..... .... ........ .......... -- .-.. J A A . K '..2 . A 1 I AAA- . '11 21 ........ A: A .'TA T--. A A x y V' 1 5 5 . , A A A . 1 ... . I 5 5 I AAA AA A mm A1 ELA .1111 X . 111. ,A REA: N NGIJYEN, BINH THI 157 NGUYEN, CAM T. 131 NGUYEN, CHIJC 180, 227 NGUYEN, DOANH NGIJYEN, DONG 131 NGUYEN, DUC MINI-I 94 NGUYEN, DUOC VAN 157 NGUYEN, GIANG 180 NGUYEN, GIANG THI 157 NGUYEN, HOANG 180 NGUYEN, HUE 157 NGUYEN, HUNG MANH 157 NGUYEN, HUNG THANH 157 NGUYEN, I-IUONG T. 94 NGUYEN, HUY 94, 235 NGUYEN, HUYEN 131 NGUYEN, HUYEN LE 180 NGUYEN, JOE 180 NGUYEN, KHANH V. 157 NGUYEN, KHOI 157 NGUYEN, KY NGUYEN, LAN-HUONG 131 NGUYEN, LINH T. 131, 263 NGIJYEN, LINH THUY 131 NGUYEN LINH TUONG 94 NGUYENI LINH-HA 180 NGUYEN, LOI VAN 157 NGUYEN, LONG DUO 157 NGUYEN, LONG TUONG 131 NGUYEN, MINH 180 NGUYEN, MINH-PHUONG 157 NGUYEN, NHUNG NGOC NGUYEN, PHUOC 131, 235, 284 NGUYEN, PHUOC THI NGUYEN, TAM 131 NGUYEN, THANH NGA 131 NGUYEN, THANH T. 180 NGUYEN, THUY THANH 181 NGUYEN, NGUYEN. NGUYEN, NGUYEN, NGUYEN, TI-IUY'TIEN 180 TIEN HUNG. 180 TRI M, 180 TRI VAN 180 TRINHN 180 OUELLETTE, LAURA 132 OVERLV, SHANTELLE-JE 157, 223 OWEN, SHAWN 132, 198, 219 OWEN, TODD 157 OWEN, TYLER 132, 282, 285 OWENS, WENDY 157, 206. 207, 223 OZAKI, MINETTE 95 PABARCUS, MICHAEL 95, 254 PAEELICO, JOEL 157, 203 PABLO, MICHAEL 151 PACK, CAROL 181 PACKWOOD, DALE 191 PADERANGA, NANCY 181 PADERANGA, PRIMO 132 PADGETT, ALISON 181, 284 PADGETT. JAYE 157, 254 PADUA, DIANE 93, 95,-286, 520 PADUA, .IO5 95 . . A PAGADUAN, RUBY 53, 132, 275 - PAGANO, RHONDA 132 PAGANO, ROBERT PAIXAO, JOSE 181 PALAOIOS, PECK 1,57 PALLARES, INE5 151 PALLARES, JESS1KfXi1g95111.2ao ,,, PALLARE5, JOSE 11325 . I - PALMA, ALEXANDER3181 PALMA, SOILA 157' PALMER. JENNIFER 181 PALMER, JOHN 132 PALMER, JOYCELYNN 14, 28, 95 PALMER. NEIL 5, 95, 257 , PALMER, SUNNY 1325 275 I - PAMOLERAS, SAMUEL 132, 134, 247, 273 PAMPO, ERNESTO 132 PALACIOS, DANNY 181 PAMPO, EIDENCIO 28, 95, 250, 256. 264 PFEFFER, WILLIAM 158 PHABMIXAY, NOI 158 PHAKONEKHAM, DETH 181 PI-IAKONEKHAM, KHANE 181 PI-IAM, ANH PHAM, DUY 181 PI'-IAM, LOAN MAI PHAM, MAITHO 132 PI-IAM, NGA YEN PHAM, PHONG HUY 132 PHAM, THAO THANH 158 PHAM, TRANG 96 PI-IAM, TUNG THANH 158 PI-IAM, UYEN PHAM, YEN PI-IAN, CO PHUNG 158 PHAN, SINH THI PHAN, VU PHELPS, CRYSTAL 181, 249 PHETDARA, BOUNNAM 158 PHETDARA, VAYKI-IAM PHILLIPS, CRAIG 181, 203 PHILLIPS. DEENA 158 PHILLIPS, TERRY 158 RHILYAW, BENJAMIN 132 PHAM, BETH 96 PERRY, GRANT 158 P1-IAM, PHUONG 158 PHIMMACHACK, SOUVATH 181 . PHUNG, CO VAN 132 HAO OA-I 159 .lg THANH 151 TFKEKSQTTE, MICHAEL 181 PIERCE. MICHAEL 133, 200, 247 PIGHTLING, ARTHUR 132 P1LON, JASON 132 -PSQYENTEL, LEONARD 96 PIMENTEL. LIEZI., 132 . PIMERTEL, L-YN.1,59- , PINNEY, DAVIDQ-f 7 PINZON, YURI 957,21 PIPER, CAREY 159 PIROL0, DARLENE 96, 284 PISCKDTTA, VINCENT 159 ' RAMIREZ, GERARDO 182 RAMIREZ, JOCELYN 235, 274, 275 RAMIREZ, JOSEPH 97 RAMOS, SHERRY 159 RAMOS, TITO 97, 196 RAMSEY, SHANNON 159 RANDALL, MARIANNE 159 RANDAZZO, GEORGE 182, 226 RAOUINO, FRANCIS 182, 205 RAOUINO, VINCENT RASGAITIS, SANDRA 270 RASMUSSEN, ANDREA 274, 275 RASMUSSEN, JEFFREY 159 RASOUL, SAMEK 159 RATAJ, HEIDI 85, 97 RATAJ-ROSS, AKIKO 159, 206, 207, RATLIFF, REBECCA 97 REA, JENNIFER REDONDO, ELEENA REDONDO, HECTOR 182 REED, CHRISTY 182 REEH, CLIFF 159 REEVES, ANDREA 97 REEVES, BARAK REEVES, KELLY 182 REGESKI, JENNIFER REGISTER, TANYA 182 REICHENBACH, ERIC 182, 200 REICHERT, THOMAS REID, MICHELLE ,, ,gREILY. PHILIP 152 . QREISIG, JOHN-97, 212, 252 - IREISSNER. GARY 159 REITER, ROBERT 20, 201 RENISON, DAVID 182 RENISON, ROBERT 98, 271 RENSBERRY, SAM 159 RENTER, LUIS 98 REPSHER,f'.JQk:1N,, , ZRESZ, RAC!-IEIQIQE 98 ' IREVAK, SHANNON 159 REVOREDO, RQNNIE 159 REYES, DEXTER 182 REYES, MICHAEL 98. 196 .XX - 11.--.191 .. .12 PAMPO, MANUEL 95, 281 , l3QS1Sf1Q1'1If1' PANQES, MARIAM 151' PITTMAN, LA SHQNLA 181, 225.241 REYES, ROBERT 98 NGUYEN, JULIE 94 :iff PAB4S3 E1411CHELLE 181, ' SARAH itii - - f ,...I1 FEYNONI MABNIET ...' . ,Y NGUYEN MARY 94 I PAEZSEIMIBABIEL 151711284 . QPIQWNTZ. MARjl'fI'QTE 141 P- I . 77 111 Q1FIEYN0SOi'BEME8LY 152 F NGUYEN: JENNY 151 ,pAg,5g.l,1AIRALYNN 1577 PtNTT, MIcHELE gf159 A 5- I I ,REYNOSOQ ,GALE195 , A I NGUYEN SCOTT 180 PARAEQ, M101-QAEL 95, 196 PLOTKIN, MARC 159 RHEW, MIC!-SELE 98 I 1 f NGUYEN' VAN 1-1 131 277 232 PARAQSO1 VAL 132 PLUNK. MICHAEL 181 RHODES. STEPHEN 159 NGUYENI VAN TUONG I I PARISI,,,Ti-QUY 132 PLUTA, SANDRA 132 1R1'CI'-IARD, SEAN-182 N,C11O1,5 JASON 131 - pApg1g,,..,5wES 157 POBLETE, JOCELYN 132, 206, 207, 273, 277, ,1r15R1OHARD5ON1,iiOANA 182 NICHOLS1 KENNETH ROY 94 1 . 132 11 '. I 111.4 1330 I - - l ..1 . 11.I1 15912363 NICOLAYSEN, LISA 15, 151, 263, 318 1.5.1f.e f11P 5I?QGUGLAS11i5?2- PQDSIADLY- 95451395 1591 - NIEDERSCHMIDT, HERMAP150 riii 144- iPifX . i5i!ANEEN 15771 PQEHLMAN- CATHERINE 115.1 11' T,T'. Q A NIESPODZIANY SHANNON 52 157 259 , I IZJ ' ' IPRRKEREQIKEITH 157 I PUSH'-MAN1HEPST':!EFi-:181 5 ' 8ICIfMAN11.,STEYE1187-991' I NMNEJAU AUI150 I I PARIESEBQILINDA 1321 , 1 PGLANGCUS, RICO. VICTEBRQQQBG, 269 I NIXON' JAMES 1571 203 PARKEBQ, LISA 95 7 - ' -- POLEN, STEVEN95 ,,,. 1, - RIDER, ROBYNQ7 NOBLE' 1115115 131 ,PARKSSZ-.NLLY 151 g, 1 AI, . POLITANO, DO.NISi955--'159 I ,, RIDGE, DAvID,,159 NOBLE, REGINALD 94 -.,PA8!S95if?A8R'E 3511115711 2051. A-PRL'-ARD' 1ii1:5'f . - . NOBLE, RONALD 157 1-1 I I JFIDING1 1.1-I 1571 159' 267 NOBLE TRACY 180 IA411 . RIDINGY NOON 'JOSEPH 94 'RAI319, . g1RAUL -I1I- .- - '7POPA, ELAINE IRIKANSRUIZEZKIMIZY, 98, 272, 277 NQORIS NORMAN 157 V CHRISTINEIQTSS, 281 PORCIONCULA2' 132, 275 RILEY, ADAM 1259, 250 NQRLING JENNIFER 18U PARIRQDGE, GINA 158 ' ' PORTER, DIANE 182 RIOPEL, JENNY 159 NORMAN' DAWNE Q4 PASOQA, JUAN 158 I PORTER, STACY, , RIOS, ALEX NORR'S ANNE MARIE 131 MARIA 132 POSTELL, RICHARD7132 RISING, ALLENH759 NORRTS' REGINALD 94 . PASMZQEJED 158 . POTKONJAK- STEVEN 182 .R'TCH'E1S'1l555?f..981271 NOF1TO,1,4,,,CHAD 180. PAT EggICATHERIN,E 13.32, 155, 249. 259, PQWELL, ANTON,-182. 203, 218 I NQRTONICQHR'STOPHER 'Q?1'31 .- ' POWELL, DERRICKQP182, 238 - RIZZO, THONIASW59 NORTON. GREGORY 151- pAm1gSIL,.MATTHEw 1:12, 196 POWELL, JESSICA '96 ROACHE, KERI182, 254 I NOVILLO CHELLE 181 PATAYLKATHERINE 132 POWELL. KAREN 159, 204, 205 Rosa, COURTENAY 159 NOVOTNC, DANA 157 PATERSDN, ERIN 95, 232, 233 POWELL, SHANNEN 182 Rosa, JAROD 159, 203, 227 NOWADLEYEQKERRY 151 PATERSON, HEATHER 158, 289 POWER, MICHAEL 132 , - RINGO, SHEILA 159 NULL ANDREA A PA7f3IE559fNDREA 158 I POWER' SC07T...5?1f5.2..1 ' BIOS. MAT?511..1559f'7238 NUSOO,fK1MBERLY 1595,i11?511,.A..254 PA153fiF15C711I,1.QA.I2ilE1Ei3132 A I I AHBEHUSI A 7 IT' I 1 IIPI A - A ' PA1TERSON,JEFF1?EE11SE-T581 A I - I 411' ' . 9-ROBBINS, DEBORAH 152 I PATTKDNV LEQNAg:g13I.gg5 5 : , 'PREFGIEIARDQ 'BAISIIEILLE 97 , 5,9 ROBBINS, LESLIE 182 PAUEj,g..CHRISTOPHERf?96 I ' Pfmto ANA 192 14. ROBBINS, ROBERT 98 PAUL1 RHDNDA 181,-7232 f?Q3ETEF1,- GWENDQEYN' 159 I I ROBERSON- DANIEL , PAULQSTACEY 132.224, 275 7'f?QWEE1,.,,PAUL ' ROBERTS, LARRY L. . . . UOUINN, BELINDA 157 A i 9fW3E?ii11...1HUSSELIRsE1l?!2.f1 A . I . ,.I, - ROBERTS, LARRY W' OAKRYQDANIELLE 94. 279375. 297- 154 1 ,iiz1153QBE8TS- WIWAM 1591 2034- OBERLEf IDAVID 131 I PAYQMQQ ERIC.1158L1i?122?ii'250.. . .,.,- '1.1 . j .QROEERTSHAWRMIOHAEL 159' - P I OBILLE..MYLEN 157 -I PE,E51GELBERT 797, 263 .ROBERTSON,DHF1lSTOPHER 159 O-RRIEN, MICHELLE 95, 2831 PEARCE, JENNIFER 5159, 254 TPQUDO, VICTOR 97 ROBERTSON, KIMBERLY 99 Q-CAMp0v B1TUlN 131 PEARQE, KENNETH 133 PULOPOT, JACQUENETTE 129, 257, 286, 287, ROBERTSON, STEVEN 182 OOAMPO, KERRIE 157, 275 PEARSALL, GIDEON . 1320. ROBINSONDANIELLE159 OCHOA, SHANNON 181 I , FEABSON, JEFFREY IH' 1325 . PIQIIQOPOT, SUZANNE 7, 24, 90, 97, 98, 286, . ROBINSON. JENNSFER 99 0'CONNOI3.f AMBER . .Q '111, . 311:21 .1ADEN1sfn15S3iaf4 ...,.P14 28262941 320. 1, I 7,I5O3IN30N1THQMA5132 I ODOM .... JASON 157 I'4 PURCELL, MARJORIE 182 I I 111,55 - If 11111 sg111g1g1iQBLES.1TERESA 182 I OGRODOWSK1, .IEANNET151 PEESQESTACY 158' .111 1'1 - I - I' FOBSON, KEVIN182 OHARA, KEVIN 157 PANBES1 PATRICK 9517? A -FQOCHA. REBECCA 159 OHARROW, WADE 131 PAYNE, LESLIE 96 9 ROOGERS, CYNTHIA 32 OLAES, ALEXANDER 157, 280 PARK, KELLY 157 - RODR, TAMERA 11 OLLISON. FELTON 151 , PAYISTE, C, 254 . , A , .,,gRODRIcK, JOHN 99 OI-SEN. ANNEMARIE 131, 267 PEAQUCK- M. 2121- 711- ' I ,.1- . .. 159 OLSEN, ERIC 236 A A -PAT1ggi0N.4.ROB.ER1:2f32 . A YHHAAH 1 1ilPiQDF1'GUEE 4g9 .1 OLSEN, ,IANELLE 181, 205, PEAK 5OAYLE.277ea5f1gI1A .j1'Z11212FiN,1 1JYENT.fI:H1,3132',gT5 II1,1 ,,,,, ., 1, ,3ROORIGUEZ..1' OLSEN, SVEN ARNE 131 I PEELERQ KERRY 132, 235 A 'QIQFIETTL JAMES. I f,fRODR1GUEz, 954141525 OLSON, SHANNON 157 PEISS, AMY 132 . OLAGG, MATHEW 182 . . RODRIGUEZ, RE1NA.,159, 205, 242 OLVERA, EVA 181 PELAIQ, HEIDI 158, 217 OUINEZ. KRISTINEI157, 159, 182 I I RODRIGUEZ, ROBERT 99 O'NEIL, MARTIN 132 .,.V , 96, 1951, 1 QUINN, ELIZABETH 359 ,1.- , RODZACH, TIFFANY 99 , ONG, MINI-i KHAI 132 ,- -11:-. QBEIQEKIS, ALICIA 1322227 1. QLFINN, KHRISTA-.1-59, 239, 249, ., ,, FIODZACH, ,183.,.- . ONG. NGAN T, 181 . PELLEBITO1MAF1LE1SiEQi11115112711' 1NEL'SSA.21i?321. .1 41-'I 1!W0EBUCfS11.?91FR1?E?3!1!1?Nff111027995,-Iein OKAMOTQE KELLY 131 ..T' 1,QQ?fg. PELUSQ PATRIOIA.1s1S21.,Qf254.5. ..1H...P71' -GIf4YI5ff?1785'55l159 I PTIYT 77555 1 159 1'5'- O'BRIEN,'SEAN157 PELUSO, PAUL 96 ,,51 1.1 Q OO1N1'Os. YESENIA-182, 249 I A-ROHR,1TCIi5R1fs15551f.4. ' QLADES1 kC:.2D3 ' 515',,,, I IITTI . PENAELOR, AMANDA155 OUTTANIA, JOEY 182 ROHRBAOH,..gQRRIsToPHER 183.7200 ONG, TUONG 37,5 f PEREIRA, VIRGINIA 192 . I QHOMAN-PPALDQMSS. 226' ' -- I ORDONEZLPPAMELA 31,95,,,257, 277,,28Qf PEREZ, DOROTHY 957 , , ,5P,i,,j,BQMANSfDANT1EL , I 2H7,.1,2994fi220.. PIIYA .H4551 ,,,5 1.PE fHANC'SCO1ff87. . . AAAA 1J0R'5ip ' 17.., 1 1. .... . .,.f5 .- . ,'71 ,,,'- 5 . -71593 I Y.. I ,,,,, TAHA . I 75.. A ..,. . I .1 ,,-- C I... 77 .. .1iI7f9M'9N15113914f52799TT''ff 5 ORNELI5lSQ5EANI1'81 ,T1' 4,I'I 12 '1'., T1 ' 77 7P vi 5.H'f.11'4 .1 PPP A -'1i5fi30NCALw505YiEF?HQ1-199 Q 0RNELAss1.1HI5IA 9, 1132571 72151, I 1 17445 1 A PE3K1!93-1.8iCHA8Df3555203I 1,,P v A IAPR A R81CAL'5OM2159'2501 OROPILLA5 Evlc 181, 226: PEBNSRDl,1GEoRGE.,152,T I J ,,,, REYMUN12i5..,.qff I A , H DAEL, FIQNA 183 ' ORs1NELL1q:.sEEE 95 .--4 1 4 .,,. 1.,. . PER0MQ4.'M1CHAEEi'1Y5B4531271 1,.P, , 11 1...11 ,,,' 121ONDERO,A11BR1N-99. 271 95.1 :., 1 xkik k:.- K'-: L..: .,.. I lg . I.. Q 1... . . .,,' 77.. . ,.-I, ......' .,,.1-, .,4'E 11. T1 ,.. -,,, 1 . ., IAYY -..5 -I.1. i A ,,1,, 'Y1.. i 'I.. ,,.,,,, ,,,. ...,,.,, .OT1 011112. KKTEHERINE 95:12 1,.5 A . 4. T14 RET1155XE0T539,. P1., f ,,55 1:1201 ARTHUFP99f2S3+2H2 . OscARSOSi.'!13EBRAA1132 ,.'1 11'. '.7,7 5 PFEEEEE8-11iANNE. T111 a 4809051 ANN?--5193 A T I - ---1' ' - -ff' A 1 .IIY . 1'-7- I P5 I ,-1- . --.,.. . - I I - . . -, 1 ,T..7 TTT5 f 1'.. ' .5..,1 1P ',7.. 11.J I ,.-- 1... ' . ---7' 11- l 1-1- '--. , 1--,7, I -' -1-.1 ,.P' 115 .1.. 51' I .- 4-.- ,,'. ,,,,- 1,11 --5--1 , ---, ,'. 1 1,1,11Ig11IIII7' ,,.. ,-'- .. ... A ..A ....... .11 ...., 1..,........ , ..... ---, ,,4 4 ,.... ,..1, , AE5E11A11. ..k,, If Y ..VV.V kkhk A kiii usp ykkkiiik S :KV kikkkbiiih K il, xkkV7: kkhi in k,,..,..,,,,,,,,,,,,k Xiih qkiii kkk: E i .1 A kikrrr 0 urrr E, 1.1,-,gr I I , 1'-1: 1117 - y S ii -771 7171 Zi -771 11 IPI I :77 T' III. 7 15351 1-111 - I - - . . . K . .. YLL. 1 ,L: A K - -- Q.ii.,,5:g5-S - - X .1 - .. , T - - - A I I I T 771 i I I . - ' 5 1 .P7'1-5 I.11 T 1,.. 1 . -I . .,. ,.-,. , ....-- --,1 . -. 1 gpf. I' ,M LLLLOL 4111- ,,,: . , 316 lNnEx A 161 99 286 4 257 273 100 111, 263, 300 101 R, 134 134 134, 282, 283 . 289 227. 229 7, 24, 98, 100, 259, 203, 226 -1, 135, 259, 27 102 , 217, 24 135, 260 205, 249, 263 136, 238 20 249 104 249 STETTER 203, 238 STEVENS, 3, 277 STEVENS, STEVENS, STEVENS, STEVENSON, 2 STEWART, DARCINA 104 STEWART, LINDSAY 184, 254 STEWART, LYLE 10, 104, 246, 247, 254 ,,, ,,,x TAT, TAT, TAT. TAT, 284, 273 CUQNG , 235 , 1 TAVARES, SUZANNE- 184' TAYLOR. AARON 184 , , E E, 2 I TAYLOR. ANGELA D, '162 TAYLOR, ERIKA 130, , ,g TAYLOR, TAYLOR EPIN 1845-113i TAYLOR, JOSEPH! TAYLOR RODNEY2? TAYLOR,TR1CIA L.f152 I21 Zii TECSON SANDRA 184- -- TEISAN, 'SY TELLES, SANDRA 223 TENEN, JEFFREY 184 . A TENEN, MICHELLE f--- - TENORIO, LYSLEY 1845 A 5 TTIT TEYEPAUGH, TAMMYL-1.'5-A L, Sf THAOKABERRY, L'l11 THIEL, BRIAN 106, 2o3'i '--111 THIELE, TIMONTHY 106,-2203 . THOELKE, CHRIS 196 LLIT T - V THOENNES, ROBERT D. ,106 THOMAS, CHRISTOPHER. TAAL ' ' ' THOMAS, DAVID M. THOMAS, J. C. 106 THOMAS, MICHAEL S. LOZA THOMAS, TREVIS R. THOMASON, THOMASON THOMPSON THOMPSON. THOMPSON, THOMPSON , CELILIA , ANTOINETTEx3184::i:iffj5QQf'i BERN I E ffl DAVID 162 7 , DEBRA 106 Qfgg.1-J THAO, BEE 184 WEBB111iJ5ihiM5EES'113811gi1 THOMPSON, JAMES W. THOMPSON, KIMBERLEY 32, 106, 259 THOMPSON, LAURA K, 106 1 1 . THOMPSONQMAUREEN 162 ' ' 1 . THOMPS0NJ7i,I?1L1SSELL L4 1H0MPSoN.Q1sfruAn1 0. r g THONGRWONG. L SENSABA 1' THONGRIVONG, SOMSANO THORNTON. DAVID 106 THORNTON, JOHN 184 TIANGSON. MELVIN J, 162 TIANGSON, SHEILA 184 . T'ERNAN'1LP1N55EW 106 L A L. z 162 . 184 TiJlU1UR11'59l?filA 1,-- V ' 71M1aEaLA1ea:ueNN1FEn 1s4,' L19i5EX20e T1MMERMANSp1'A1LExANnEn 10611 . 11111011-av, STEVEN 162 1 TINKER, SHAWN 162 11001, FLORIDA 57. 106, 232 TIQUI, v1v1ENNE 184, 271 To,Pu1AK 106 , . Tocco, QHA1a'LA1NE 164, 289, 111. THANH:'KHUi?i1L162. - , -:--L Iy- 1HETS.v,1SP1iQ1NEv1LAY 162, 111f'- TAI.HONC3'lSi3 A ' 1 TEXTON, S1285 1 1 Tomo. DAVID B, . A A TODHUNTER, KATHERINE 184 . Tozvvs, TAMMY 106 1111 , TURNBULL, DANQEL 107 TURNER, JEREMY , K TURNER, MARISA -TURNER, P'EF?RE 1 HTDIBNERQ TOM 153 1 1 1 TUBPSNL JASON 21251 K-IURHN. ROGER 185, 212, 226, 254 ' i-TUGULLOLS, GILDARDO TYLER, DANIEL 163,'203. 238 TYLER, NICOLE 185 TBKDKEY, RICHARDKJBS THOLAN. PATH1c1AL,11as 1,,.11Lr3QpNQ,, JENNY . 1,g51g.4g1g,1,1 . :.V2 A,RLENEk1jg85i.E,. . 1 gmemr, LAURA 2T7f12fiD1 ' -TSONCOLT. T. 228 f TWITCHELL, DANIELLE 163 TYNDALE, ADAM 163, 200 ' ' TYNER, KENNETH 144 307, 190, 286. 297 K - 1L1frT.ANNA1311 ' ' ULJTQ ANTONIO 163 UNDERHILL. DAWN 107, 271, 289 1TosoNoN, BARTOLOME L. ,1oe1g,g A 'L1N13ER. PAUL 1631, jf 7 h A A TOLEDO.REG1NALD B- ,17 , - L.5le!EfIQN.1CHR'STfE,.241:?3G?, I , ' TOLER. JQleENE1D1L145f1205 '2,7 E I GFWG ERIC TOM, CONRUYF1 ' - ' - TOM, HARMON1 184 TOMASULO, GRANT 106 TOMCHECKQDAVID P. 106 'K TONEY, LOB! A. 10. 97, 106 Toon, HABDERSINGH 162 TQBATN1,1NiG5f1iiT52 I ,1 A 131121 . '?T32il il ' 1 TORRENCEgfiAgIiiI3lE'18S 1 1 11 21' TORRENCEii:tQgI ' ' Tomas, MICHELLE 21, 273, Tomas, P10000 VNLNV, TOUSLEY, ,HEATHER 105 , 1 rousLEY.1 M1Q1fsELLE 1 1 1 TQWNSEND,11iBiEHY JL 162. 1 IOWNSENDs1EC3?5AB1i.L11,B5e ,,-,N ..'1 3 '7 A .-THAN? YTFQAJANQQ EQRES 'Yr 11 1 1nAM1mEtL. 151fm1eENLv UE THAN, THAN. THAN. THAN, THAN, TRAN, . FFIANQ :TRAN THAN,- THAN, TRAN. TRAN, THAN. THAN, ANH 111111061 SAG 195- 1 w 7- BICHV NGOC THuo 273 CHINPQ111-235 A A DAU:T554?7z - - - A ,-': 1 f ' L1 fl HONGLNL1 J 1 V LAI TU462- K' MAI PHUONG MQNH 1169, 185 NGA'Tf7LL1591.185 11 NGifflifz.1QfL ,1 i K.. 1-Q11 .L L1, WAN THAN THQFP ,-.7 .1.- 11 7 1 1--1 -TRANS TUAN LQUCCL185 A THAN. TRAN TUONG' 1 j HUNGTHANH165 A 'TRANS uuvl MINH, - TYONES. M1011E2L51a45 . 3 THAN. Skip 1 A VVTT TRAN, PHLiGiP1Ef2 .'k-, f if TRAN, -ROSACYNQXEQ 1 1oML1NsoN, JQHN 185 TOTI, MICHELLE T85 - TRANG,THEfEHUAN1 , TF1ANG.TRAN'?B80. A 1 451. 301 TF?A9iNO1 Q W TF?ENTOL?'EUW:l5QPEil363,: 226' 3 11 QII TREN1-Q' pyhnig. .fgy 1 .. K1 ikil Tmzprow, Saocx 14, 107, 200,20 msprow, eumnevr 163 f mos, Bn1AN71o7 mucus, sc:o11g1e3, 203 111150, Numa ,107 141 TR!EU 112111202 TRIEU mxeuf TRIEU IRIN:-1', 1n1NH, TH!NH TRINHI K PH.UCjIgIQE1'fgEQ1E3 LQ: h THANHgg11a5 L1 Tm.: A .. ANN NGOC 93 HUONG 185 KQEN A1 107, L xuAN YSNHV . TRIPPLET, -f,. 11 L, . TWT? Pfi '0-- 1 : 1111. 1n0xLfsn,. 121119231151 153 1 A L. TRUE, MICHAELFIBS 1 TRUONG,GlANG 185 A TRUONG, HIENWVAN 163 TRUONG, N110 CHAN 163 TRUONG, 1H1N1y,1,1o7 1 111 TRUONG.TUAliPii'2HNHf .. -. 77-7- TRUONG v1NH 11115163 -I-' TscHEuScHNER,'1?fi1iGF51gAEL, 107 0--' Tsun, TERESA 1e9,1'11a5f11117111g111 1717- 11 Tu. DONG THAN11 L. 1 ' TU, JOANNE 185, 284' - ,- my ,S ,Q-,fzlxiiivi M KBHAEL L K' oAv1f3E1'163 1 1 L ,',..,. QLQYHPENCE- -HSZUDI, BELA ' 1 uzEL,1ReNEE 163 1 uSgg1AN,,1E1-1sEEN 11111, , , ,,--,f,,1:.:m. L.. .L L ,,. .. .. L.:-,.. A I:-, EEADEZ1 ANIoN1Gi1251 ' NIALDEZ, AILEEN 10711 LVALDEZ, SHIELA 185.4 1vALo1v1A, JUSTIN 1645 -QZALECRUZ, JOYCE h THOMAS 211, 100 1 ERNA A 1 JOHN 1 112:11- . 1 ,---: 1 'SSA A - ----- 1 OI0-' 2697 -:. Qif A 5 4'11vALEQo,'ER1c 164,f l'.k 1 1 , VALERQ, JILL 185' ,,O,T 1 ,,-' ? VALLEFKOY. CHRSSTOPSEQ 185' I1VA4f553191-ENN 1 L 1- QEQSIALVEEEDE, 'k1- 5- za .- 11112: -:L-1 11 15' EH: LAN, TmEui1e5eL 11 . 1 1 1 11 1 AIANQKFVINH 'rmeu 1 FKZANARD, GREGORY 1186, 200 vANDEK1EFr, DENFSE 164, 271 LVANQEL, STEVEN 1 - 1VANDEF?HElDEN, BRANDY 164 . . SZANQEWIELE, PAuL,,1c3g,1g, 164 .71- ifil KIMBERLYBS L, ROBERT 16451212 254' 1 11121vANSuAMsRouCK, NICHO - L VANVHANKEN, KHARA'1L0B - . VARGAS, CARLOS ,' ' ' VAQGAS, CHRIST-fNA' 186' L VNJGHAN- ANGELA154 1.. ff A 1.-'- ' UAW-A Da 225- 1 '--7-: 1 u0NAs1 i. 11 DAVID O,.7 ,vAN13oL11EN, KIMBERLY 11100 1 VAISLGQYANG 108 iff 1' 'VAEU'ES. CHRISTINE 108 VAYKNAN1, PHUDARA 108 W4f9f!Si25943RiNK. RAY- 154 A L, .,,1 ,,1, PATFUGK, 227 ' 1+ 1 A JOANNE 1sLL,11'5441i12ae, 320 1 VELEIQLAQ Jose C, an 1259.1 277 vENru1?1A, VENTURA. . VENTLLRA, 1VE??iWH8, DELlAL.A SJ .169 GINA 166, gj'I86 , LEE M, h I-E'LAF'Tf3?5ei1555L11 A ' -, S1s11ffs1i1 4, 1 'OI' L A 1 11 A fi 1 11 A . L. A . EVENGARA fcHARLSS1EE1S3113eg 228 A 1 VE,NAi186 1 - v1,vAN 164 7-77 A , v1ADQ: ROMMEL T38.1jEQi1Q'. VKKQAMES 109 , V'ERAiilKEBRY' A, ?5.a1'230S1iif267, 269 . 1 1 A A SiS A 11 7 1 12.51 kk.' VWSLLIAMS .. VOGELMIENNIFER 164 VON DERAHE, CARRIE 138 L VONGPHAKDY, SOMVANG 1861 L VOSSENKEMPER. BNET 7'111 2 A vR0MANg11SQ011 nous LAS' T097 ' A vu, 1c1,uAN,G?11s4 A vu, THAO THANH 164, 282 vu, TUAN we vue, Beams vue, KAI use vue, vANGg1ae vuKov,.1?51ea1111ae 1 . WADE, PAUL Q, sz, 109, 236, 283 wAfs.E1,1AN1,1.1o1-1N we 1 A WAGNEFLL 1:1oN,JoSEP1-1 !E4'jgE'1i1fk. - A wAHA13,1L1LffaYQ.111,S,-134, ' wA1f11Lgg513EN1SE111ae, 211, 24935, .wA113EL,-PENNY 185 ' A . . WALDENJCHRISTOPHER 186 WALKER, JAMES R. 164 WALKER, P5-ULLIP D. 157. 164. 203, 218 wAL1JAo12,9LAon1ENNE 104 WALLAGESQBERANN138 A 1W5Ll-'Q?5+11313V15..J- 109 , 3.55: 1 T31 ,WAISFEBYSEQZSPEUREN E. 13821 1-1 WALIEGQSQSBKZ1-1'AF1D T. 1611, ,200 f WALTHERSSCOTT 135, 2641 1 . WALTON, SHELLEY 109 ' WARD. BENTLEY G, CSAMV 28, 231, WARD, MEUSSA A. 109 , WASFE, SHARON . A 11 WARNER, STAGYL. 138 WARNERQIIMOTHY ' .186 ' ' '1111wAnREN,1'3aENN1FEn 164 L1 WASHINGTON, MONIQUE 186 WATEFIFORD, KIMBERLY 164, 235 WATERHOUSE, CYNTHIA 164 WATKINS, MICHAEL 165, 227 WATZEK, ALICIA 186 WEAVER, BRIAN 138 WEAVERUJENNIFER 138, 260. V 273 WEAVE51-QEQMNETH ,138 L 2035? 11 i WEBER,'11CiiiESY15i86 L L WEBER, JENNIFER wEB'En,.,rgR,1s11N 186' wsem SEQSCCA 13a wEBER41Sk11ANe. 165 wEupLf5,ggL1g1ggN1Ss1aa 7 7 A WEl331 q1 1: ' ., . 111 L,,155-Lx,,,1E13g.L,3,. 318 . ,, -1 1. , ,,fgii1 wE1ss1ENB3f3f?g1s.E14,11fm1cHAELiiiifsz 277, 278 WEISZ, L165. 270' 1 vversz, HAFELAND 109 WELCH, JAY TTU, 250 wELcH. KERRY 110, 165 WELCH, PATRICIA WELLBORN, DEANNA 110 WELLBORN, DEBRA 138 WELLBORN. THERESA 186, 205 WALKER, ,51oNE ,138 .... wATTERs,,G1NA 138, 280 WATTERSRONALD138 , wALLAcE, JOEY 164 WANNEF1, JENNIFER 164 A WEBER, Cunns 165 wALLAc:E,,1gEm-1 186 . wEsSEL,,fi4fENN1FER 110 WESTQik-AAEQN 146, 165 1,, WEST, QQESQPAH 138 A 11.. ..1-1 W ESVKUERSTEN T95 211 WRNBEPG, MICHAEL WILENSKY, MELISSA 138 -WILDEY, PILAR 165 -WILBORN, JENNIFER 186 WETTEL, J. 277 WINES, MATT 165 WING, JANEL 31. 141, 165, 215, 232 'WINTER CHRISTINE 31, 41, 165 WiNTEFi, GERALD 165 WINTEFQFIELD, MARY 165 WISEMAN, DONNA 186, 289 'W.lTKA, MEREDWH 186 WOLDEN, SEAN 138 238 1 QEWOLSKE, CAMMY 110 WONG, MICHELLE 165 WOO, ERNIE 165 WOOD, CHRISTA WOOD, CHRISTOPHER 165 WOOD, KIMBERLEE 21, 22, 138 WOOD, MICHAEL 186 WOODS, EDMUND 186 1' QWOODS, PAUL 138 fwooos, RUSSELH 1165 WNOODS, 11111 -155,263 wooos, VALERKE 130 wooowmo, AMANDA 100 WOODWARD. NATALIE 16, 110, WOOLDRHDGE, P1-11LL1P 138 WOOTEN, vALENc1A 165 WORKMAN, KEv1N 203 ESNORTHEN, KIM r 1 SHAW 53.5 f 111i2wiJS1eR41LM1KE1 131911 igwasfsng TAMNw1i1as '11WFZAASE, JAN 10611 KWRENCH, DEAN ses wmeuv, comzv 165 lWR!GHT, CYNTHIA 110, 271 1yyL1mELE, RENEE 1105 WYSH. CHRIS 1675, . CARQQEEL 138 ff II-I 2 .0000 12131-LJA, LENA 110, 273 YASUMA. KANA 11951281 YANQQ arse 186, 1 YAN1120v1c:H, EDWARD111ss YAPLIJNDALOU i185 YATES. NOAH JAcoB'1aa, 260 Yoo, DIANE 165, 223 YORBA, LAURA 186 vosuvco, sHe1LA 187 YOUNG. ERIC YOUNG, FELICIA 11.1 YOUNG, GEORGE 111, YQUNS, 1MA11HEvqa1,e5 YOUNG, MELIA 67,1 11,1111 YSSEL, PAUL 138 'L - WURRALDE, ANDREA 21, 130. YUISKA, SENSE ' ZACCHEO. G1NA 187 ZAMORA, Jesus 187 ZAMORA, JOEY 130, 203 ZARRINKELK. KATAYOUN 187 ZARUK. JENNIFER 1111 ZAZAS. -KF11sr1,1a7, 7, 1 . 215, 232 278, 286, 320 274. 275 z1snR,11g0ANx3A1.feS,1g1S?gL1g20e, 207, 223, 242 111- -- Q? 1, - 1 15 TWESTERHAUS, SUMONE ,T35fi213U' 5? WHALEYLEJQQSON 165 3 A ' wHEELeR.1:SHoNoA we A A 1 wHeELEn,'s7EP1-1AN1E WP-HTAKER, 1212111 138, 254 wma, ANQELA 110 WHiTE,fBBl?iNi28, 110, zas wNrTE,11S11AwN 130, 218 WHITEHEAD, BRADLEY 110 A L. AWHITEMAN,:BERNADETTE 138. 267 WHITESELL.,-WENDY 138 . vv1EDMANN,-,STACY 186 A w1ENoLD,1xAF1eN 165 w1GANn, ARTHUR 165, 271 WIGAND, LISA 110 WIGGINS, JULIE 110 1 WILBOHN, SUSAN 138, 242, WQLBURN, KARR1 138 L . vv1Lcox, CHARITY 186 , 1 1, WILCOXQFAQTH me A .1 wzuzv, 111013131117 138 WILHELM. SEAN 105 WILHITE. mov 1ss WILKINS. MASTQSHA 165 WQLLIAMSSCALVIN 138 W!LLlAMS,','J:AM1E 165 WlLL1AMSz1JQSEPH110 1 1 WLILKIAMSLEAYGNNE 110 1. A WiLLIAMS5'AE!iEiREL:IE 110 5 1 A MTQHAEL 165 K K K vfmxamaos,.',M1QH6Eki1?15841 . , 1 vv1LL1AMs,'M1cHELLE 26, 138, 150. vxnnqeggsr-ANDomosesxfggizfse, 185, 273 WILLIAMS, NOEL 110 , VIQQQSNUEVA, EFKNESISQQWQS, 227 1 WILLCAMS, RANDAL 114, 165 g1qSgA1aEAL, M1cHAE1,g,1g5,1111y , 1 , w1LL1AMs. RANDOLPH 138 ANNA M,1Xl3Qg3Q?Q:1i,Q:..- 1 WILLIAMS, RAN-uv 130, 196 g 10111 f,,fN,,JENNlFE9 , 1 1,111 gg- W1LLlAMS,flfRISTAN 110 D1 284, 1'00 1 1', . 12 1'1 1w1LL1AMS,A!1fADEL1S6 Q K S 'N x 1. fjil L. ,,,, QUDYK 154. '11, 165,11 V11 .',.-1. g 1 w1Ls0N.51S5mJKE me WOLSON, :GMA 138 W!LSON.' .1ENN1FEn 217 'W'LSON, Jw: ,135 270, 271 ZEEG LEE: MAR5Q1iii2K1i:213a, 219 ZIEGLEFL VON 138.13203 1 ZIMMERLEE, ROBERT 138, 283 DMMERMAN, NICOLE 111, 205 ZOLDAK, ScoTT 111 ZONKEL, ALAN 107 ZORNOW, HEATHER 138, 275 ZUERCHER, KATHERVN 9, 6431 287,gk300. 319. SZQ, ZQLENSNI, ANoREw1139 111, 112, 286, Tu. MICHAEL 163g 235 FS 154231213 WILSON, ROBERT 271 7 7,5 V TUCKER, scovr 163 1 WILSON, SALLY 186 , 1 - TUFF'Nf'-'SA981107 L W'MBERLXvafN3QBEW,113S..2?Z,3l3ifl 1111f. - A TULLY1 A LLLL A 111 LLL LLL1 1 1 1111 A A A 1 1 A 111 A 7 LLLLLL ,1,, 'l. Craig says goodbye as he gets caught mooning a crowd. 2. Aileen Arning. Flay Dively, and Tracy Greenawah: sit around for summer to come. 3. Lisa Nicolaysen, Mark Stogsdiii, Tim Kaike, Sam Ward. and Vinny Lopez show us their enthusiasm for being in school. 4 A group of friends say goodbye to the iong year. P f . I Mia' f ,gmt rebm in QNQMOOWB . , pda? ?e,0g,BLddj. , ed me . Qui-ure a CLOSING I ,, , W Z 6-E! W Landon Cunningham. Leah Hartness-Stahl. Ingrid Stabb, Brandon,Lillard, Cheri Anderson, Craig ,Loggfi,Q.Vigatheryrisluercher,land Seangljdeii show W , . ! . . . v ,Av , g. hatthey wantlto do afterghigh school. l s the sun sets beyond the dormant stadium, the lonely campus becomes a place of quiet and solitude. A single Marauder feels secure among the familiar classroom buildings and ponders his time spent at Mira Mesa High. A great epoch of his life has passed and he feels a great void within himself. The security and comfort he felt during his high school years has suddenly been destroyed. He wishes he could somehow recapture that lost feeling .... But then, he realizes that his departure from Mira Mesa High is not necessarily and end, but rather, a new beginning. Memories of Mira Mesa will remain with him always, not as something lost, but as something gained--something to be of lifelong value. He looks ahead to the future, a future filled with promise. He is pursuing a goal, using the momentum gained at Mira Mesa to propel him into the outside world. He will learn the thrill of victory and the agony of defeat. His friends, too, will pursue their individual goals, and hopefully they will also find happiness. And then. feelino fulfilled. the vnuno Marauder turns and leaves the deserted campus. While the sun sinks below the horizon, and the light of dusk grows dim, his heart is lifted and the triumphant fire in his mind burns with strong determination. Hasfa la Visfa- Baby!!! EDITORS Eeoa Maruszak Jackie Puiopot Katheryn Zueroher PHOTOGRAPHERS Kenny Tyner-Photo Editor Edward Allison Kristin Anderson Leilani Anduillano Jenette Deru Jennifer Grey David Hedrick Ken Nelson LAYOUT Peter Aguinaldo Trixie Aquino Maritess Esteban Jennifer Graoia Julie Henderson Sara Kashima Rich Matthews Jenn IVloEIIiott Vicki Nleintjes Jason Mendez Padua Pulopot Jul ORTRAITS estor Studios ER CLASS PORTRAIT' eyman Photography IVE , G7dpfr0,f0' I 40- gk Wbf1fOfsZVblNfEfffj'AO95SFG2YQgx www M39 W ,J OTP O 00 Oh ' ' I Vl ,1A ' XXCQW 400 DY 0539? Q , f , f,, f ,af 1 'NW Q? 5? BXQUWJJ Us Tb X, X90 ef' of 57 wp if - ',gLifn1'1Nf ? 2fYfCL fl QgLQE?ELYL4QuQgQ fx ai L,,9,fL, f W . ' L kj !f9L'LTl:'l, Clif? 6L'f?'fL Lafd WEYVE Stag. , H ' 6 ip MKLOHV4 JCUWQ 421519 VDEEVL Vial' I ,bf ,VLQ3P:ixk 'VLH X3 MEL? DEEH JILQVQLL ibnbfgfiww A ml mi YQWL c LC VL Q Wfmlcfh 1 My ff K, rfh. I LEL JH4, gif Uflfwf V116 XWN A ,W-mv JWLIL . F AML it uw eau Q, ww wviifsi A5351 be V, xlfvftevf Q f NV: i .J HW I gig. 1 ,'X,LL K 3 XX's,..fi