E-Yearbook Home Quick Search Advanced Search Quick Browse

Medical Officers Training Camp - Yearbook (Fort Riley, KS)

- Class of 1918

Page 1 of 224

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Cover

Cover

Pages 6 - 7	Pages 10 - 11	Pages 14 - 15
Pages 8 - 9	Pages 12 - 13	Pages 16 - 17

ShowHide text for 1918 volume (OCR)

Text from Pages 1 - 224 of the 1918 volume:

“

, -f 41, mnA'v-,pw-4 Qt, A , ' V ' ,VVVV g f. ' 5 f,'.r W 1,,,f',V, ' ' ' ' V5 N ' f?V4 4k,,fV ' ' L TH' 33 0 555 .QV 1r ' u ' k 1v l15 KUUW f., -.., Snr ' 'PN Y '7 1J'g5.x 44 3-41 -.-ur' w eg flff J 'Wuxi 'Q ' W 1. ': :..- -V' V?'l',. 'f -'43 V E' VT V' I 11,7 vs? , 7:49 V FLY' K if , , . F. l'h,'.f,1-5:'. l i'1'- .V V 'V Q 'wl' 4- 'UA''f '..-. ?'1'!.V'V i 3.1:','- if .-V.v f'M ':f 'fL V' .L '1': f v' V if! VE -'V 4 , l.f.S 'VV ' CWV' -Q ' 'f- KT-V N13 V3 JV.. 'P: 'V11 5Vf!,iA'.Vl f-1. fw:'7:'7Q1 A7 Y' V' 'X' .V f.- I'. .5 : r.: 'r wyfli .--,,1 f ? ' . Hn. fir' 'VW' w 4'-4 f M . L 'fi 'fs7 P.114V2, VV 'H- .ff - -f 71,5 V -..,,,-1,4 ya Mff' Vw J' ' ,,'7Y?,,,wf, V 'V ,V ', V ge,-.-: Vw 1. ' .ffbb 'pg VM, 1. :J-' ' 1'- V .ny!f 'V'-.'. rf ma-V9f'f ',VlA .I.fZVVV V'13,VV,V WL . wg Q, +V w ' V. V Ph dak -. V 53 A 12 . 1. VW. V1-. 4 Vft J'.+S'1L 1- Ii' W . fi nw PV-rw vff9','- 1 ji .. MJ:-+1 pf' V Jn Vw 'F 2 pm -15551 5fV i.,',, 'F vw 'W 'm h Jggaafg rJ's'VVff , L :V,Mj:::.qV45g'.wi. i-' if V7 'J . V: 9 fi: .Nr- VV v. V'c , we w ..' 1, ,.,- .- '.. .,VQi.. ...N 4 Q1 13. .- .Q . ,, .. Vsff-nf, M, F VV i... ...,.. ..,,. V,,',.. ,x,.ff.,41fgVgV S ...S awww' ,ff .'r'1i'j,..Q..f,..,,mV-. ,xp 1 fp. , 5-v, ,QM V, , . , V . ,KH 7V ',M,.,4,fV 5,,V.,Lq: V, Vysyn ,p.5,f' .-. ,, , . 11?-1ai?,'.+VV'.5X2 ' '- QfgJ:V s, !f,'Q3,.Hi2 V.1 V VV V V2 V V ng. ' .f5: '. - VV,.pVV' .- 5 Q1g+.VjVg,.W5,' .. nw. izr '. ' 5 , VIVVV ' :VVV. ,V ,Vg my .,,.g,i1g1,9,VV. 1- V. -Q., VVVVV'VV j,VViq', Q +1 f3, m-V' 5: 15537 'V 25, -V V 'V 'QI l:,,, lil Mb' iv-V:,V 152,-1v'1:.'lfE , z-fw11r- V . s , Vw- ' .Nf!f?M'. ' 'M2'ff!-vi--V- 'Y'.'F n . ' 'fZ7'W- 'Va 'V.'rwfmVf:1f' .HV -.lffftf-m1'..f:V1'tH . V..afwf3',' VV' f- V-ff'VfV.1 'w3V'1?i4'VQ1Vf-22' Vwfxw.-' fy ' . .AVV 'ak-val .5f4f.-,VV -sgfai' 'X 4Vv,11VVViV: f!4'VV gr ,V Vgyxfly . Af V,VV WMV, wifi ,NVQ :tn-.Jfu vlff ,V,VV Vi fwag, ai' ,, L V 'WNV ,Vp:?.51f,'H, .V, VV :AFM V Ly, A ' lv, f,, ' fl f N . 1 if, V N ' Wd u eV V :Va .V Vw V :w V VJ , ,1 Mn' wx ,R ,,:YFVL?,g4qV N T Vw A 0 VV I VV fx ,.- , Q lying- V 15: VV if vfVVfVV r-hlxfh A ,H 4wgJVFmVV,VVf VV vig I Rig, 4'fI?f3'VV Q.. '33 AE: ' 49173 fnaslyx 4 Qvw M V,?..V MXL ff if ' 7'1 .iV ' ' 1- .1'-V-P1 ' .Vi - ' .1 . f V1-., Q' - I 'Ha' 1' rs - '-,vw L 'V f JV- 'Vi' '-'ck V 'V .- 'Jw -51' - VV-V-, ':'-'V ?1f- .-- -1' ' 'V'. 1 lr V-f LH ' ' V ' V.. an 1., V' -J V .-:V.:.z..,y IVLf 1-VV. V fV1'1-?'- ,iff-5 ,,..- .mm- Ju '- VY' i1 am.'eff.'1.:'-'NV4..VV44.- V'f-1,V'QfVy235.gW?f2fHp'V'-x2?,M..u wiv 'V-'31-w--ffwa -pa-i:'..g.'vf..'-.V.V1.152-'EVN-fgQ.'VgV+VV.ww,V.-g Vnam-1-i?aV.V+La-' fV27v'.Ff f ffQVgLf V-VV-?wf5V?Vy1'f 1a . ,g ,. .V ' V' mmVV'PW5 'V 'VV' 'Vg J ww mr- H 'VW ' p? w -Q: fi' ' f' 2 iff' ' 'rv 'f farsA1Vf-we 3..,VjeV,51r',c.,' -V .5 QV. V- ,Vgw V- V4 5 5 ' , V . x .Vf!g.:L.'-Q .f ,,V-Vyzfyvfwg. inf. ,V VE ,1.,-fag ' f.y..,.-'f,.,-.yVy.V'.V5V 1 .W-mgs.1, mi' V, 134' ' .g., V A'.f1V-'gV,f,ex.-.y1,f.VV-1. w My ' '- IEYTSNV- 2' ,V M. ze.:-',Vwwtw,4 ,, vw-Wi' wfqy, ...ab f'v':rw,- V4-f,wr'fV,'f.'4fg.'- '.f Qk5 '.-f1'.-.LJ cngf.. , f-iw.: 'f ,'TffQ JQ,., N115-gwV'V.',1V'.:r-M V . .MQW 'lfQ.'F'.VfV',1f2'1Yfwa.f1 ' :.',v': .f !,f:.'.f:?'5 cmzlwf .H 'V 'f' 'fri . s.,f '55 3,V13l'i'5Ef4vrV ' , VV ,g-Vfl-Wg39-.f'l,V,g .-55 5-5 I f21 '1 f 11 V. W- if VV -guy! -.5'fy,,'- VVsfH'rvY,fs,gl,,,VV.?x,-tw. V-af' '-'59 .J.-if 'VV 3, VV' 4- gyevf ',Li.f-1Aff''Jr3Z1:'f1-l4., yV'3 s::Rini XJQMAIZ-V ' 44 FP' V' 5-fi' -IMFY.-'. -' Vie , ' 'V 'ff M f i' -4' V 'V' 3 m ' 5 ' f W1 5''b22f?V5',fsV'fff.wffsf V , . V ., ,.,--H V-LF 1 :f1'f'-,157 H .-, 'PA t1.Vg-ar 44' f XM ' ,. 5 5 ' Vf 'ff' 9' ,wwgv .V 3' Q'1'!,5 l,x'?':.'?'V V, vb ffl 'w113'1f,Vf Hp 5 Mg, , LiYH3VV1,,,.i g1:V3'3Q?,1,:VV'5 gpg 4 4 . . , 1' 1' . z, V' fi VV' ,N :sw .,, ,wwf 4-,V VW. My .. r .+ f V. . , 'VV 'V V. Na -:L -n' . -V- '1 1 V V 1 3-- -'VV 1 .V-' 1..V'5,v-.,- .-V.r-V11-A.,r-A V . qw. . '-. V - . V - A. yy . ..,....V-V W- ... ....V. , .J .-V . ., .. V Viral, wa 'kf-'. '1 'Of Q fl .- fl-,. , 195- G . V f 'V,,. , v. ,.fVQf - 1 . , V Mr. af..'ft-VV95., Vg- -. ,- 'V ' VVJ 1: Vgkhyg -V v' . VV ' VVVV :V ,, 'VV.uV-V,g. 5' 1V fV :Q VV , 355 cs Q? K-1, - .'V'V3,vwVg'-'QI'-'-LV' ,Vi '7 V, ' . 5 ,V Vgzfw. . ji V. .V 'z in U Q ' 'A f ' - WV- - WV-4 A rw ' ifgfffilfxif-V VVV V-f:fVQWf'.1 'mwigidi.Wi-?f.tfi.,:V 'af-V.?V V3f32 -Ti FW we f 4 -'T' T ' 3- 'MFT-1 ',v.3 . ' if ' hr: .. .'V -5 V- V rjluii'- .f 'V1V 3L'1 Lv? if -V5 .4 Vk'.4: F ff C21 Jiwfrx ' -H -MT' V , -Q'V f- -Ti I' 21 -WV .'AV'! A. 5774 :,'f 7 ' Hr ' 'li F51 V' Q- X' 7? . ' ffl' 5' '92, 732' ' Vl! .2 ..'9f'i - -V. , N 'W VS.. VV, 5 - ' Ur Vp,-ff! 'F ff'- '3p'ir 4 VVV- r in - J , J' ,Q UH' ,VA V -9 G r A- q-WV VVS -q95VVQ'VV ' Eff xiVhsi1V,,VV..,V' 13,21 'ilrg V44-I-Y. -whim guy- 'V J, .VD :r :WV fq-qi ,Vi1'1'I'zVpgwi3Vf'Vf?fjV,Vg zVHiLnf' M f Vifxm VV1.. V V VV V V . V V .1,tV V-., . V'figQ91,VL, . V. V..V ,Q me 'Sw Q-'fiaid 'Wi ' .VV 7.13 Wifi- ww 5, b V- .VrV5.VV,:V5gy . V V Vf. .., 'V' V: r 1' TV.'V'i.,,..-.,.V. . .' '- W 'sw 4 V I iv Q 4. f w. . -V ,4- Q- w ,V , QVVVV,-5 V '1ir ':'lVQV ,V :Ki n 'UV' ,. 'W' gn-,.4m: H+- a V1 -' X 0 r. 4 5 ff' ' 'N- f rm H 'x fx. M A W Sign f 'M'Vf I 1' Waffgh mq .1,,,.,w ling , Vw ,ytwfyy VVV ,V al-r,VV.-,,, WV .,,!k2ffi ,f.Vj'11g-4, Wg. ,..V.V3Vg-g,,.V.V ,134 QNVEEVV ,V,,,jVaVV'fV,VVgE V. VVMIN.. ,, my V Wa VV V . VV VVV V -V',.1ifi l -Za' Q9 :V 11.44 V jnfjh. V V 'fiM5'f?:3f. ?'f7V, fl7Vi'. . . 'ff 4' ' ' I -V v .' . f . y , . - V 1 g,1V.- VA,-1 .- . F .gym-V V-3 VV V- V.,,V ,V 1'-,-f,5 G 1'w:V2 'V Q02-1:EP.' LM I 1 .f .1 -' 'V ' . 1 ,,!k f 'fm wt N' 1':.V A ' V 'ff J'-.-.'V: 5 ' Veg.,V3.V-':VVlVi:3V,. V-. V 4 V nf- ::'1V!3.V'g'g u Vfq 1341+ .V V ' 'mriafai-rn f V V F ' 3 E., 'KTA ,g 5 ' fr V' '. V '1' '- --4 U ...LTA-,Nyi-i' . . Vx - , . V- :V 1- 4 VA .Nm ,V-,J-ru ft., V ,,..,..,,. .V VVV . ' '1 -VI' F5-VR.r -.+Vf..-' 'xv 'X f 4 ' 1 p 2 iv... .-,Q V..5V Vw, V f V- .f1,V. V -.-. Vf,.z.V ., .1 wg' V QV Vw' E ., ff., . T?-., 9-V .V ' . -VJ. . . 9... V Af .. ,K '15 ,. .WVV.f,'..Q. ' vim? ... xi9 . . H43 V ' J ' -V16 - V' V- ,. .V . J' , f . 'V . 7? , V .1,fsV.'.. ,. ,-.35 . . a. , f.V :2vf.V'F?. ,. if 5, . .. ff8.?wf,,fVM. .. ,1f, , , , rw gwlwr. 'm5:.a,V,,,..,.1 . 'LHS1'4'J ,m'm,'Y','53?fZi M ff 'f3'V3V?V '1f f53r'LV'H4 3'w4 'fffiliwf I'L i'5Vs'zS3gl infix -fwif i :WN V-WMV'Wai f5'5?v1v3?wfW'f'y:?a'Qisrih' 2w:'f. :'iW55' 4 v V. 4, U s ,val 1. , -QL W ,,V Vw V.. wwf J ky. 551 AL 5.5. 3,9 , 1 ,V ,h if fm ? jig! V , ,-nk ' . wir? ,nh-,V-1 VV1+aV.Vz,V.Vr-,QV V. V5V'.q1'-4.- VV: Q gf 31Q '71-- 4 V--.- '-Wifi' -WHQJYSJ wa- 2 f QTVR-fV.V Vgefi.f,. -wi-.1 -'. .fy 2: mP'f !':'wf.TV-'fr'911-VM'-Vi' 21 Q - V-'V- '.1V !i fff V gt AT4'?'fkM 47, 0 'V'ff V ? ff' V H W .'4-T V' 'T' f3i?I2fViF377-'?1+:fV5:?hifi1 7 - x:5ifVi55'ff if . . . V . ,gig .4 , Ml' r V55 gwif, 'M ' ggi .. NEW.. ,W Q -AV ,..3,,f.1V , VV. ,x .VggV,Q,,7 -5. ,Pav gg Vg-U, V., gin :pus-V .ff ,T-VV'fVlAg L.VmL 'V., .y 1 .s nw., .V n . .Af ff- 'MV ' '.f 5 'V -g V-a.V':R'rJ- -.-ini. mv, .1- P .'. .: . .. .V'-V.1VV.V VV?:Va',?.V.-,-,,V, -. V. Vg .... V -V .V -- VV .3 . VVJV. . ,, 4 , V5 V5tV.VAg,:V:V, .V:X.,Yf2,1VMV,.., 4:55 VMVVV IVF 1 WS, pw v WV V 3- .. 3 AVL .yi VVVVVVIV VVVZ93 V VA 1 . 1, V V MV V-fix fr . fa., .-.rw 1- . M' 'WA I 'E 'x.'z+?f:Ai,.i 1'4l!1fi'35- ,nf V ,V .., ,-,.. -V . . ... f1'f.V:.V.V .752 V V V V A 'lv 5 ' V ...in .!9vMire' iq, ' 2. K fg ,-,VJ V B in rf ,, Vi' ,, V 1' ,f qw 'a 'H' Wk QC? 'N' -. ' x A W 7 -ff gf Q ff , 1 ,gl 59 M x' Ai' -.Vj2i'fAjgVg1, :w?:.g :gVv,-'QE V'Q7fQJ--,'KV- v x ha, Nil-M . '11 V' ,, . V f 'V-nw. .5 V- VV L ff Jw-I MV. '.i1fDfa--.mf V .VV VVV,,,.V.,.V er . .uw ' V, ,-. ,. . . .. - ' V ,' ' -N-a' . v: 8 .,-gf 7' V1-, rfii' ,Q ?! 5f',I':,.:-,Ll 'Ji' - VJ Y 'E ,5V,, ,Vip ' -VV1 VV'-V V V '. ' 6:2111 '.ffL'fQ,,f-3-.--L V!-.vw-3l'5g: 3'521'?.f1fVf,4f,g,, -V. -.5i!'s-aww? 'ifvggigg-:'f?-gKe!s'1'7,,FL .f.!.l5Wi'E '15-af ff-','Af.'I71'i- Qi53334222 .haf 'V 'M ' - W -'- ', ,W-1:4V .klaff-JW. . .V -.fV-.wi-11-.M ,V f. mQz,as:.-'-Q4w3??..V 'Fix .Pr'?ve 5,-V-.nf 1-:.,4f fVff 'Vt it wat . ' INN V'- f4KV4f'h V .Vt VL,.Vfj 'L 'h',4g,gM': .. 'fa E I-v L, 0 n 4 VV ' 'hw' 1' ' 'WG . ,. hi . 'Q f'5f5,'f.-' . . +V, V, VV . . V, .F,g1.,', 'ga KJ-HV' QM ' V , Vi ,VZ X Q My Q' N., V gp-,V,'1f .'N? 7 Vg-J fg VV ,?'-fq?:.,VV-jQV- M i 'mfkm.:ilfL.'2'?k4V1f 5ffif-g13:47'2?::ig: .z:i.ifV,r'1'f5?vf3sf '2 3' Qfiiifii:-'TZMZTg1FL?1if'42f VM! .?TF.5-.M2?3'-V'?3if?fI:g.Vf3?f-.VV' 'T4fr-M1 Size ml. Wi ' P'-'.-+L. 54:4 '- V.--L: .3 -9. ' 'T' V fi1-w 5-12'- 1 R DV' :JV-f.3z!'. '5vVV'.. .m' -.wviuy ' JA 'Vxfqfff' H7 . .. . . 1. M -V..1 I-,.q,.',g?,5 J., 3 A up , .1VV.,. . .0 - .,x 'V w:VQp,tQ,.g-09, -.4354-.ip.VgV. wg., V .V .u,:f'b,'w 41'!'1VV., .. ,iJy.,.-yN:r-T i IibfXn-'. 'V Mfg. ,,,.V'f+ ' ,-4 ' ,. j.'v-ai 'M :irc .aww 5':2 g,,,4Gf'.': 34,yv4-6-Jgamf, VLTV, V' .,,,g3f. 4-4 VV. f J .V.5favV-,f-fm iV,4f.V9?'p:f,UVa 1, 34 .V ..L,.':V V x vxlrk- ,V- grtfm-'5V-.-,.'fqg, V. qi-fg,w,'1fqVV'-' VV -4 i . .V , L- V , -J .V V. M. fn ,. . L .. . .. V-rf Vf',4,1w Eg V . .f,,f , WM .V . V-VfVVVv.VV,1:.,,.nWV V .3-,gV?'Q,V....e,V.-fb.. . VV J' 5 -L -'-:,, h,: .v Vai' Q Jigs, , . f',a2,N,wQ '- .MQW AV.-V 'A QV. V, iw cu .5 5 Q Lf' ' - -,V 'ln Fy.r9f5, F4 , if-V ., 'gl g I . 'Z-.U ,Fi-.,f' 5, 'LCM' : .,' N' '- Z. 4. V ' ,-Lf' 3-V V V.VV?V.,,5...,.V.,...VVk MV .VV . V,,V. . V35 ,VE M Q . .,,4Qt,V.V, 4- VV ,VVQVVLVV V. V,V,,.,V V., L -.J-' -i?'VV-.1521 .aQQxfyf'5 VV Q A V .. V . -V . . hip 1f'iV'i i7 .f EP- VV,1wfV ----Vf .rw'-fV..VVVw'V,r,VvVVVp,111 'VV SVA -f w gf :.VdVV3eV3C,, -V Vg? 1 vw W-VM --xx -.ff ,af '1- yn.. VVVQWVF .H V. 1' ,-:51','.':f ,V VVQQ 'V1.g:QLgfgfV1jV VV,,Vv1'vA'V?-. 5' 5 iisff- ffliu WYVA- V f 'tg-5-f. 1 I 4.-2 Q.-1 -.FFF w V -. V,-VVV, ..-,V V- mf .My , V.,-. ., , ..s,.,V,... ,V.. . .. nfl., ffVV:2?fwg.Vf'Ss ff? . iyrwibwfff V4 f fffw :Sf ,. : ..., . .. - V' ffri' ' MV .- -.b.1b...: . - 5.- . ' Q-fVVVV,' Vi' -V... 'X ' 1' ,T '- . V.- 225' 'Y' . V V5 V-V ,.Vj' Y V V, ,-Vfqfg. VV V -VVJQ-'V V' 1. , VNV 1 ,V jf. V.51 -V V V .- V VV 51.5. . 1 ' ' V ,qVg'f'z,- -.Wg-j 'VVAM-.VV.,JgV-.-V - in VV ,V V-L V .. ' V V .V .NV -.1 ,-1 +V,1V V,,V :V ,f, -Vw, V95 VV, -. . VV, 1 2 V .-K ,VVVV-Q ,. ,V.-. V . V-4 A AA VMVVVHV. +V .,,,. .VNV ,,VV..V v ,V.- ,,V,V,V j' T5 Vf . ' i5'nqJt 2- V -.a'+fV'V.i'fiufV:,',V3Qgf1f'412Jfftf,,a.'x1+. Vnmwg V mg. fi-gm V if ,nk-W. 4, M ,a:f2gf.'swig:1VgwSf' 1vV 4:5 V? 4 x A ' 1' ' . V ' if' F ' ' ' ' , 'V iw' yn: , V- JV!!! VV .. V QVyVVv:VVV'Vf'VV-an . fQ43'VV'fVkPf,' VL, ' '.f.V jA,91h'.Vi2: +5Vr . ,V V' VV,s,fV .ml VVtfxvgf',VgfV,,5.f5,g,hVV,.. . V, H., V gf if -. v, 3 I ! A -V , .. 4 in :aa ,ff Q- L J.-V A Af, , Q ire.V1-QV.LVV:?g3?,,.f,.,,gf,,QQFV,,g5V2,.p1.VVVg,.gV,5g,v.VVV V45 V,VQV'3,VWg1f? ,3V,yMVV13!fQV,,VV,.VV,.VVVVLVQLQ fl4'Q,g,'j-.1'fQ,w.+A -?V.r V3:Af fi2f'1-WnQ.f'?!V2Yif'w1,Vi'K 'V9i'4fFVQVW-v5. v -fu'.VLy!'5i-Vi? V.. ww: QV5:21mi-'Ef.?gVg5wu?iFf:ga,,.1,. V V:'fis ' JfV'fgw'z.f,..Mf.12iug22s,.5 ..-Q ',,,. mV xy V Af .V. V .. VV . 31 , gg' .nw .V ., . .V,V-,fg.gV4,V, V,V,.,,, ,C ,m ,,V.,.., .nr ,VV VM Vrfp. VV., 353, V erg,gQfVQ-5,5'iVs.': j.?-g:fVFg'7gg:V-Vf'lV.,V 5,5341 .FV Q 444, :Vi Cgffgfglk 451 gVVfVVVV.i V1,q,.. .lf M.. ,A,,Vw, .. VT . i:'g,'x'w1if:f!lz i E? :.-,V f.'fT.ilV,4.. ,SMI JWf,i'1y Vn5V , MAJ ,V 1324121 ,P-X 'V . VV ' vm, tu:vV3V'V-.-K.. Vffe- iv. MV-'1-V V. UV. :M-:Vw-V 41. ,-.p:!,.dVV. . -mf . W 21 f .wtf-. V ,V :V Vw mV Qu, -J. . 2 ...W-.y.g,.r. ...tl .QVWQV :gVfVV.9f5g,.VgQ'g,g14?.Vf.VVgggg,H , V. V- .1 , ,.V. VV:w..- 4 - 1 ,. V WV 3.-.g.V ,. 1': 'YVf4x VV1v?ifQLf?5 41VF .,4-pfkkffir 57? .A ,5 , 4. ,, V,,,r .,, ,,g. V VVv, ...V - ,f1i. l7'1-'7V'VV,i3j:5V1If?11 3W-'.fg2.i. VV.,.f.n9', '- A 54. .,V..V.?f:Vx 1. .., 1... ,, VF -YH Q fwi EV' ... ,VNV J ' V 4- ,11V.Vu..'.,.VV- sf J may ' f , 98,77 ld!! JAN rv. 'W ,fa Z M . -f.. -VV.V,5. x '1' V'Vzmf.'VH,5. J fx , . f.. , ,, 'V A F W, V 5. V .5 34 , 1 br. if ,-wffzl.-'-vj-j-wil Ar. .,V'VV,V.-.V - -QV !4H.V'jfmg.. ,Q .5-1-V:-,gfyf . J? - ,rl 'f N, . . 31. ,. Wg. ,J ,, r 1 . we ,.y, 1 ,V 5 'nk V151 34 W., 'rj .px , ,Vt .V,V ,j,,'g.,- V VVV,VH,?,wyh:V1Vl.,VVV VV1' V ..V-V. VV V . V IVV, .NVQ-5q,iV,ggi' VJVV ,W-'V.f.Vqf,47'4 V uf. -N , wg Vp 2:51, .yy . rzvvil'.-i'1:1x.7-!f'fVf'53r 6345? ' +V? VHkfiifj..fVx.2?TH0 14'Rfg3'aQ, V VV....V. .. VVVVVWVQ Vi1gVVV.,.V ,.. G VVVVVVVVVVM. ,VV VVVV.,VV .M .xg E. Ag ?,,M'9,15?' Hawk 'bi B 844:35 y ,Y-',:eVz.. t'u?-'V' 1... 13- ,-L J '1' QV? VV-A-f. 2' 3 JV 'Ml-V. V -:. ' V VV V V V J ,Wa VV f2f.,. .V, ,., .-V91-WV 'Lf ig YQ H Evafggbfa M, ,--94VV.15f5...' . .,,.r,.'I'A1!V, ' V ,V . Vyq, V f., 3. a VJ ' M, ,QM A f ' , f VVVV.,V.y.i 'M V .V 53 .fmiw 'WML -.f.5?w,Vq uf? ' fuk' 'fi VH r :hr fi' ' 4' 'V' 3 1' i..'Vs 4kfPf f IE .JV uf' L - .1151-I 1V7:-- 'i , ' .V-ffi., 3 -.V ' V' ff ' f 2 . . : QV 4- N V-T f 'J7 - V 2- - P 'J' ' WV '- V 15 ig.. ,-Vr,.iifEflQ,5.. VV V. A- iff..-,:. ,V 429' w wk V. . . V-if . 1- Hw..V.lV 31:15-ff .' A ,5f?:,5fg? .?,.,,V.5.2. M, 1 7, .V-V1.---. V.- 'V ' r' L .,.V. V. Q, ,..Vfr 'V -9-Q.: -V Vf f - ... ' V4 VV V . 'I . . . '..' ,-V-V - -- 74 VVNVV. 5 qw V- 1. -ff X 441 1' 'P 'V f 5643. F3 H114 ' 'Fi ,, nf If 1-H HJ' if f I 'k 54N1 if 1' 'S' 5 lm 311' '54 Mil, fem -fV'f 'y9'f9fl IQQZQJJ F ang .'. V ,'i--54.3. .-19 V V 51,90 :.::VJ- 4?fff1'Q 'V r ,Q ,V,,4.. VN. ...V Y i'1f'T1. ggbwei ' N Vaxgfg' '42 .' ',f ' 'gf' ' 44, gag' Q-.,g,4j1j5'3V 'xV VV5 '54-S. 'C 1'-if NYU .1 mr, -'UN 533. g 4 4 .K Jygzym fy. 1 V fzpfv 1 :V gy'-,ag JN H 'Juv' -WV,WUN.',VVV g'-,wr V:'f5r, Vw V4 1: ' g H' U EGM' 'gt Q, ' 1 R341 M ' :ui 'ff iam 5 D K 'H.o's'1' v. N55 P M ' R' 'VJ 131'-VE W' 'Vw' V,f.V 2-V . ' V V .V. ii, V -.V V V -V..':V. .fVVVV:3ViVVV':VV ' Vey . '. ' Aa ' LJ' ' rV . 1 4V.VVVV,'i fp. ' .' A eg ,, . VV..f3V. fV',-i1 j, ':g,V1?:'-f-s.V?u'- Qi. '?'5?fi ..?i'ffw1nwVV LVZi+? f1'f74' ...T- .T,Tf. 45? fW raff1fiPf?ife-V..,WV fa -.j'V ? MV 'F X252-zf':f' zkfiliivnff- 'fff' 5 -M 'vr'-5'ff'??1', i 5V-MPV'k'5Z'Y?wA-4'e Hu V V V f'f+' .- gig. I' R X' fx ix' WMEKW' ' 'W' r P 57 wwf 'Jar Wy' ,.,,,. HQ 'V f '.x N 'NM f Uffims 3' 9' U ff: M' na 5 ..,Vw- fm--. W -,,,.a VV, V.V Q.-W . '. ..,.-nw ..' MV .. . . A V. 1:4 . ,V V V f ,mf fqr - A- V- 4-V' V:.V V . f. fu- g- .3 , .V V. 1' V , -..1Vf ., - V . -.1 V V ., g., ,.: fr,...,- V V my 7 - ,.,, , , . M., V- V ,. VV , ,,,V..V. . . as . . . 1 ., . . . . u. . V . , V . .. 'VV-V .P V VM.. .V 'L' V ' M f 'VV f + fb' ' Vi' 'H V. 'fd' A 'V-F' :A-:YM V: 5 fw f -95 . if M iff. W J'-1 'F VV f-V VV- V 1. Wfi' iff.. . V574 tr' 'Pr'2iir?'L',:t5f ,gh , 4 -r ' sp. ww ,V inf, My V1 n ysrizy nm.,v. if FEW J ,p 1 f , f ,V VVYVI J. J7x'v.fJ'g'1 'K 4 4 x'??a 'i v ,Aw VNWI1-QI Nr IW? lip-gfflfayi I F 4? W 'sg V A 'K ? ', T ha v' r'fY this 4'-its V WVU' 'LL A vw IJ is 'ff IQ' Q 7' 1 N H 'f Mx N 31 , V LV ,S ig wh . V ja a 1' A J- 124 A ,.V 1 'ff '63 , M ,F g. .. '53, V 'V ,V -. mia V -1 if .-.1 .zM'.4V'f H' F:-ffwk' ' N +6304 4 if f w':q HgAV Af' V 'N 1 'Mp H-' ' Y ' Q V' 'V' 'W' ' ' W :V 5 x mW :ffl-tl Ur 'Vt' 'f AY '91 mf' .Vi gf 1 1 ,V w 'A M .-W. V3 Vff.. . AV ... Ve. r 'WM if M ' 1 M 3 3 W. w af' -A VV-3 'M da, 1W,w 1,y94'f.f f'-ng ,410 ay , ' !.,1VV '11 TRJCVQLV ' A Vw Qiflfwy ' 2-'gLg. :I-lV .. . . , ' me. V-5 J , 3,59 , -. 1.x-,Vw A- . , 'Q W'-V .V ...Q VVV LQVVVVV V- VV,.a..V..V WV '5 5 V VV ..V,-,MV ,:V VV:-...fi-4-VV. V-1 'V VSV-gy .V V- .QV-:V,VV,'g95w. V ,VVVV 1, .V14 . VW A V V jVVi VV'fVV!f5.,VVV V-:.VV,j A N' f . 1 J W 1 . N , Vfa 1. -L w VW? 'QM 4'-2' wg if if W .r: 1gf:'Vf Jr . -'4'5.'3-,7'-P435 ifjf,Zg'Vfa.wt'1'.i15?'Tqu2?i f'f:J:'4 ,ff J V-.f'fgM' fffZff2:V5'35 ffKffW' -d732?L'ev1s?,,.::g,?'Z. '1p .gh ,ig -'7?,,.3V,iE.V -gf - ff ?.kj4,,5.2 A - 47, . A u. -1 uf Vip a fmr 1 ? .. 1 f . nfl. WA 4,3 .1 Y., Vjv g , 415, . 1 ., Vg, 1,1 ,L , x ,..,.., .,,, 4 :bg-V'-. VV,-::VVwi4,w, 1 Vg. -own-gL:V:V VV ,J f VVVV15,V,5VVV V1 ngffgc 4, ' ld ,VV,,5,1g 'X , v' VV V f A- Vu QVVVVVVMVVVVVVS vs W f M ,,i..VZ5Jy9-LV .AJ 14VVVcL VV N 155,12 VVJVVV Vs V ,VV new .VV E4 BMV ,V ,Vai -jg 1-' H665 ,fi U Q -c 4 ,M , .IVV VVVVV N44 J 5g.f,f,.. 5?-,VV f WJ V gm, 1 K V+ V h 5 ,V V' V Y f' - Jilw'-V13 Tl my W ' ff'-. Vt' i ' Vi '- U:Q.ZFik.,.f77 V4 V' l'-' 'Sf 3- 7 V 'r -'L if Vi'-:99 I.V '51W4 ' ,w-l-1 ltr' L-A 'Q' 7 ', ' 7 I 5' .rf 75.3 ' 'I 'VV . E' .F 1' .f'?'! 'I V'.- :V ' VIL- PM V-,V ,, , . , ,H .V V V.. .,5,g5VV,V, .,,4 VV? V ,V. .,,, ,, ,gh , VV, V A ,V , AV V ., V., V4 ,VV,VVVV,. ., IV. V. Uma, V ,VV ,,, VV . VV 1 ...V . .. . V, . lk: .VV VVV V, . diy MV V! . ,V VVWVV, ,V VV . V T , .ii gsm VVV+yV4qrVl E ? dmx,J:7'5rVV, x f WL? fx. JV xh,a.Vn, g gif An 'f V VA Ai yzgslldi ,,- W 11 ig, , ,V fe VV VI ,Uv 1 V' 33- -Vg: 's,'J,V if Jf V V W W :un -v TP' fx N 95: V1 Ivmlff Ui UM 1 Q' ffmk' vw L 5 'M ' 1 ! , H -1' -Mug Mg' 'rn 'F jf' 1'-.V ,' ' W'a .H 2...-1-. La' . S75 ' V 'M . A '1' 16 'ff -' V. : iv -. V wi.-. -V .9 , .af V V V. 1-VV .Q '-..V -4. 'vo V .i V . f .Vw ,A QV .. -' V '. V V ' z .. 1 ' . V. - 5.5-' J V V V- V ,wifi ,fw-:.V,V:,VV KV V.'-' ,VLH YV 1.53: VL .lwff-v fffjg' , 'V VV:V V VV V ' V V. V.,V-V V V3V. V VV: .,: V ' .1V:f'1' V, V1.5 ,.1,, V, V V, V V V VV'-z V,V,VV V V 4, .1 457. V5VV:.,V. V. ' .1 5 V V VV4 .- V V W gwy-VV .- V ,gVVV,,4'u., V 'V -V ' 4. -fir '.--y . 'V-': '-kv: 'H QV L. .V 'Vgrffr V. :,1L,:.V ,Vg VV V .,V- V ,Q - ,, ag- -, ,yy ,-kggsyr71g':V,,V ,, rf-fu1Vg5.af,ff'4q .-...wh ffm ,-L4 -My ,-1V '- .w,:?4V,g.y,V,f.V 1 M- ,z , V .F V V V. V lg:-'ffkd lj :wif 5j53'7 'f -'?f1f5 .. Yff .-HM 314 ,4 W? F'f+35'I5 'V.,:-VVJP' ff 'V' . ,Q.f'V fl ' 51 - V'?'V3f' VJV'f?'9 32- W' F-LU5'??aif .?f f1N?'40ilV 13-fi 'V 'P 'mi' ' N472.1'llS'..'w5L?', TV N If . HQVHEX if? '1 'Fl ii , H V T . 'MZ' 'Va' . M ., Vg- NVQ-3V'5.',p'-. 9.1---n..VV, VV3.. Via 'V .' -V '- 33 ' 'Vfg5'fPf?-'f-f'V- ' -V ,-iv, jnQ'9V '., 'nl' 'V 3 Wg' V, .4-V'V7V6Vf if, 5 V. 4 31 .S '? V f5f'LVV,VV.-,,w' ',. 3: as ... : 1 ' V V 4 ,M-fx V , V WAV :V x , VN s ' .5 ' PM W' 70 ,4-Zi W1 war fy 2 3 ' r' ivan? -517' f M V651 W1V'gHh,f5J4D.fq' vi- SQi W 5 530W QMVV VW V wV Vf ., ,.VViVg!VV.,. 45 IQ'.-.V'a,3i.1.V,',.Vj,VVVVVV .,..5iV:VV1- ,Vgfv-,NVg..5 V,V2VlaVVw , - W. 'Vw 5 .. . V VV VVV,.VVVVVV3VV. VV,',.f . ,VV 'V-VV-5,VV-,gVVV5iVfVV, .,s V. -we V . ..: VA ,-VV,-fg3ViVVy5VV,? 1 , , V. V VV V...1iVJ' . fm- -f' .V '-I ' . V' V. .PFW L.:-V.. . ' ' 'HW VH: , ' .1 Vw V. Sp , A VJ.. -V V .V ' 13 1 ' N 'VV VV jg wr. VLA g.4'?-6.153-rV452'fif1m ' V -,..gG! f 'fff .fZf-5: -.ff , VV 'AV42iw-li '... rgf. 4- 4 V'. ','e'.2'.X+. -1-A-V'1 f- ':--W ,f-5,-VVQ'-hS'eN4 ' w,m,,V3a . YU :'rf ,fix N51 'X 'mf 91' '. .ff ' .V .- if-4.5 VV V-, . gy. V 4' +, V 4. ,V .,VVq...fv:3- mp. a V5iVV4,V,-Q-V ,.,,--,V..V,VVVVVf1,v,.,?Vf.V,1Vi V3 ,., .3 V- V - f,fV.zg.5:v, 4, . 31- V ?,iz4-v f,VS,.+'f-,1V- V -:V V VV!VVVV'VhV5'1iV.tag5.VV,-q.j'- 1 P .My , iv V ' EV V54 J V fi fp 1 -A . t.V-Mn -97V . 5 wi f4'5 --V T rgvf. 'if VLH. 1'1rfyf'!f4- V 453' V V F5 '71 gf 0 .. 4 V 41 V Msg' V ' if W 'ff W Jf.ffV'.'1 V ., '23, ' ff' I 'W 2 fr' gg: ,vm Wafg ,VY 'v ,jk wi 'W-7' MVT? HHH '53-1 13.5 !,,VVV V VV .1 V JV. V, .57V.V. V VV, .. V-.V -iVVV,..VL.,.. , V. , V V.V i V V,V ,V, ., .. V V VVVVXV, VVVVTV . . V9?2VVViVV2.aVVVV.V x VVVVVVVVVVVVVV., . V .v V . V ' rgni ,V VL V V', w.VVj.aV, V V: VV ' 'V V.. V, V JV-f-Vi. ,Q 3 V1 . -, aff. VV .9 y, , V 5 V .EV . 24... ,.. Vf 2 g V, VV VV ,V :-V 'VV .VV 5 Vbj. -fVVV:V..VV-V - . 5- . ,5' vVgez.'-'ffV- ,V V V -A.-ww., .. - -21' 1 V . 'A ' V- 'f V ' ' V x - ' Vf- Vf?+nawV', ' VVVV V , 1 .gg , 31, 4, EW? if N57 f Q 3' L6VK,4i'i3iIm,f5Vyw4 m ' ' 'F ,,, WV J W 444 In f' VvV4.,v A Vw.-gr. I f6,2gf,-,VWQV . . - .N .-A VV . V A - ., ., . ' -. ,. . , --X V- .. V yi - V - .H 1.1 - . .V V 3 V w- .- V' V, ,. ,, 11, V+ .V.aV,. v... Mt 'f' vru V VA ' 5 ' V VV, V - 4' MV 2 -, . V- V .5 rx.. ., ,V V, ,,W'V 4. V . - -V VV V V V V Gb-1 r ' A 1 Vg , QV jl -' -'I-,Ji ' 2' 1 ' M L 5 Q 1 -fl Vs ef V. V V VV ..VV,. . VV ,VV .VV V .VM .VV ,V ,GV VV V VV .. . -.fn V. V. r. T ' gr 1 ' . ' ' V, 553 Jr r if 'F 3 uf ' 5,334 V' PY Pl 306 '-1.1 1? x- M 3 . ' r g . if , il- -?gf5'a IfQ V'f',f' L V I VT' ' L ,, Vg'15?5'ff . y . . .. .,. .- , ,. V J-4 V ,V V, .V V .,, V V. V Ts . f 411. ,VJ W 3 . .ff alfa 3 1 .- 4 ,15 A L .. Saw . '. v Q. -VV wi .www Q . .V gum wa ' A V: V V .. V' f AV rug, .1595 ' , Ulm-ffp,aifd V? gg V, 1... V VVV wt?-. NEW ,r ff 415 ' asf Q .1 'TZ ,l,,iw ff: VVVVVAQV. iw wif 25155154 W-?V??'f ' +- , . 1.1-fl - V 15443 3 f'- h' ' ' nf 1? - 'V ' J' ll.: I ' 4- 'V ' 7 V,k. V- EV: V,V .. -4 4. V w: MV, V V ., Vf, .V , swam LUV V ,, ' 11- 5' 'F' . V-1 ' ' V 1. '5'-VT -:V-1' X fl' if T., , U ff , 'V ' 4 . , ' V' !VZf ' 5: .- .-V . . - V V. - 4 M- V .- - - , , . V,. .-A V .. 1 - ' '4 M'-L if 1 N 1 al' ' gh r 14- Vi f' 195 'F I ' ,,f?9xx,'i'4 H 'nail' A ' V- , V ,iv ag v f ,- VV, Wrq, 1' 4g VVVVVww 1 V . Q' f . ,f V fb . 1 VV . A - V . Vp, ,V iw f ,, 4- '?' FLM 451324. fa-VHS V- V4 my WV, f ' Q, 'E f VV 1 V ., 1' H. V -V I ,V. A-f'QwV,. V.'5x'1V. v 'Q' mn 1- rw 4 I' .9 wg Zi' wifi' 1- V' wr M -as 4. Vx.. VVVV Vg. 'T 1 3 v V3 V Vigfkg 121.1 Pffaw '1zV.V:VVVfVx.VVVVV ey WV 54 VVVVVV . V5 'jg VVVV ,V ii Vf .ff EQEVVVQ A WV, . 'V .9 .,' J ,r . if .' - 1 'ra ' V1 ' ' 'L',,'g V ,. , -, - .-V VM, 'T V- V ,., v , .- -I' V' JH ' .-V 'i 'f - Vfjw .V 4. ..,Vf2jV V . f5VV.,,g., V V. 2 ,VX V V w., V V VW ,JV 1. ' if ' 'f Ev ' - 4- V' '1' f.. i, V V V A 25, ,MV ,A gy ,W V ,hr VV V .g V V , 1 ,fa , V V V ,.1Vg,aV . ,- .V 4 .' 433- ., M ' mx . 'Q V V wfu , Hain, R., . Ln VV f . -E35 f , . W ' , , '51-L, .QW , X .- VVV VV, A 'Vx 1 V? 124- V M, V , qw? 5 if A 15 Q: W A 33,50 .3' fi V as 3' ' Qui, , , . L , . 4 i 1 4 'A 1. '49 F , A25 'x, r 7 9 'FA w 44 - I w -f pw iii: V, 4. 1 . 'YJ 'fv- .. VVV A..,w5g.Vw ,gy . iw 'fy www iff fr .,V1gu .-hw,- ' , . V V. rw, 5 Q. V'?'f 'I'-' 13 . 7' iQ H33 5 i -Qi' - fG':f , 4451 ' V59 . -V: VM ...Vp VV :wi hr- ' - i ' ivilfiff JVV , 4V - V .- , VV. , ff' Q ff ffl' . .af 4 EQUFG 'I I . . . .- . ,. . 4 .gm , hgh VV' , V g. fa ,, n . ,H fi ' fm wh , ,SV . V ,V . ,aw . V V V V Vf Av . ,X 1 an LV, VV f .ffm ' VU u mgf 'J fp 1 M- ak f I s ,I A 'V4 -N nw i f -Ms W' ' 4 ,Q f Yf,3V,,- L 'I .'., 'V' 4'u'f'V' ' K , ' V-.V,. . ' , ' , --, 1 'Q-V Q V V fV4'n.' 'fl ' U f ' .7 2' '- , u Vd.b p' 3,1 1-'F- , Q, JMX: V' 3'E 'V 'pri' .1 1 ' , :. lv 0 : . 'T V 'W AwV V.,lPvV 1 , . 4 1 , V - 1 .,. 'V V .VV -VV V , VVV ' X, 1 '- V V 5, VV .V 11. 1 V . - f 2 V' '. V , f V. ',,9gAj., 5, IVVV . Vg-Vw'-. ,V 5. .VV fy . ,V V, , , V VrVe,,f, VV3,g W V115 :V .V V 1 -hw 1 V V wwf VV , 'wif K ' . .. V 4 1 H3395 . ' film. ff35,.. ff V .1 Q.. 4+ VV ' .. sv VV - ' a -'Yf :V--V gm ., .J iw. . T L' V-1111-i 'Tnr4g-' V g f' gg., ' 9 . ff 5 VV f fZ1G3'3?: '7V'W75 ' 3 i f v :VJ rif. if-1 .ef V' 4 2 if K' K 1 1: V' ' 'M riff 'M ' '4!??vy iif fiwfqxffgf ' 'VW P KN . . :ff 4' W Vw V:-f wi. 'JVM ' 2 .1 ,V nf.: ' G N 5. -QV . -r pg-BVV ,f4,zVf V ' 'V aw- Vy ' . V. .-:fp .'VV'4V.,z.1-A-V,V.'.-V z2Eg:f,-Vmpg .V V' Y' in ' .fb 'VA' iwffwfvffhmw W Vi 9+ ?'34'?'9u.... 3 ' , J V ' '-'f ?fiS.f3'-?'.V 5+Sf5f :V .V - , 2. A' a w w' P - :fiF'5' V1.9?!Z QPF H . -:Q V . - 1 ' Q . . QV . V, . V V -.Q - ' A ' g.g,j7Vf if gm A 1 vw, - 5V1:,',V:,'V V, , . 'if' ,yi Lg : V . 4. V. 5 , VV ' Q14 , ,MV ,,,,:4,q. . ', V . V- W. Vw. 5.,.VfV.g'5QV V.V' 3 rs, 'glmlagaib 4 way! ., . VVVVV5VV.VVV,f.i,iVf V'V, 1,VV, VV'5fggt'V'V.xVV ,FQVV V 2 J, V . VVVVVV ,VLV V V VV V VVEVM. -3 V. fm ,, Q . ffl VW ., ,. V -1 V V- W . . V VSVEHVV V . V. ,V VQVV VVVV V... . Y? . . . , , , .Vf VV an LT.: I ' VV . gg: Cz. A .- V, :Fa Q. W ' f - .4:!wf?f1Vi. '5-V 1 ' Wi? fffffpekggyffry' wTf'- V- ? ., 'VV U' .g f e-wi .- 1.1 'VZ 'L f'y':-V-'fx-gal Af '?'1.-' ff' '+ifi'4V:'f-am . V 'r f 4' .V .'?f.:W' -. V- ,. .. - MV. ,. . .qw ,W .. W'MuVa, '-',..'1 f -,V vim .V fi. ,V fm' 'fr 4 :V,V V ' .Agni ' Ia' I - W' V J w. V' . Awe. 1 A- V ., Vx .V Vw . . ,xf 'ES' ,, :V . V 23 54 'L Q, ,Mn .V. ,.f... ,. 49 WW 4 V H-gi. WAV 3. 4, lg WV VN 2.51 VVVVV VEVVH . F 32 35 ' . -, 3 VVV. 1 -wi '..,.-.f?f 7.f55i'M 5 , V 41,5 W W , ,,Vif'V' gQaf.f: V Hfw1,,eff.' v1a1i,1.g5f,. VVVV . ' j V fr I 4 si V -Vg . g1qgfQ fi WV-V1 'L.VVVf. .N .a'V,,.g.v.V, VVVVVQV,--.4a4V.1V3,: yg..q:1VVVV-V r-.V VV: V .V f , 3'6 54 1 Ep. .QQ .-, V .QVV,3r4r'...,.V.e?.,,,:fV,gg9VffVV .V V- : fm .. 51-M V . V4 v 4 ' ,za M ,VV VS, '33, 1.1 ami 4VVVV',V3VVV Nev. H ' .V 1' . - . , VV ,. -4 ' -V. f pa -fy +V V '7-w s, '- WI-...gigW':g,. nz, VS.r?'.'wf'V.qE fi? ' f 4 4 vw Ju ly w Q' 'Flaw ,. . +gV?,VVV5iVf,w.1V if VV .4 ' V ff5V?iV .f-'.QQ.,iV'ff . MJ- if , pf WW ' w V. qu , V .en I -VV,g, V.p.,'!V.VV, ...EV . V V. V- V. . , V . V, V V -. V VV ,..-mv .Va ff..55'.V '- N275- . if ,. , ' 152, Q , V wg. i!?iw??sC.ifV'iTa'gf2fVV: , j . MV. 3 'V 953,51 VV-3, J. y. -'f gfiq- .V V-21 'gy ikf rf, V141-,, ,w 3, rg.. 14+ Vw .V .. V- Q PSV ,VW' f1.V-VF-gigs, .- HV-'Vw-1' Vt, ' . ' my .-r5,1'V-'., ,V , ' - 2 -V',.'iVW V wr : V. 5 Vf' w'1 if . . : F'-V0?'!,g W5,ge.I'5,W-'v4?':f-.-1f 1'f? . Q V .V V- W.. -. V V VV +V' V VV V -Q. V- V V . V Vw - . V QV. VV sm S WV ... .af 'asf ' . ,. . Vf ifyi. ...QV 'Y 'Eur M at I ,Y ' :A L ,V V V - V :-v1 f V 5544 Wx' 7 :'VQ 5'Ey-gVV1'qV,'vf'4 ' ft 3 - V.. V' ' ' AV - fr: wh' , 'XAHQM V ' JF Q lh 3' wr: 1. lf' 311: ' Vx ' .V .VV., ,,,,. .VV -.V V - , W- ,VV V- . , . V A V ,V V . V, M VV -,, . V1 W, V, , VV VVV. Vv V,',V-V VVVV M, ,V .Vi QV -V 'Q f:' 3i:EV,V . V -: .w yj j I V . . Vf'v'Vi.gVg'.:'-' V.VV5VVV JV.. ,. 2.. 'si ..1 V., ,VV ' -Q1 .. , , V V . .VV .V V . V. . V - Vw , VWVQ:-3.V. V, V .f.VVVVV V VVQVVVVV V315 VV V -A - 'v V V . V 'fu -fWf'Yf 1fV?Q5P11A if Vw. 4 - wx E ,vVM1, fmw QV AVN 58 ,wx 4, H if if sqgggrnfa wan a L 4- ,. .gi ,A yafdpglk V95 vh V-5V,WqiVgVg'VVVV.f. ,V '47 V VMVVVVVVVVVVVV VV, V., V , ,V VjiVV,.VV,.VVVVT, . V VV .V . VVVm.,,VV.Vi ,i'M:.V . V :-VV .- . . V.,...V ,VVVV . V V,..,VV,. 455' V 3154.5 .VVi VVV5a.gg,,g .qg:VV:VVVVg2V.,,v,VVVVV '. ,V,,gViiTf3 Hi'5iVg r.4f: VE1VV' , V?,r.l',1j'1K'-733, V' 'fiQ,iV:YVfff 'H' .-1, V ' -' 1 ' -kv?-gV V. '- 'ly , Vf551ff'W' 'QQ.P2if.V'.:'fi5' T5 V ' ' M' V4-...IZ .5520-.g.'--2..xf,'4,Vf WJVFV-VQV4 j-4.,V -1111-bdi'V 'f:V712V Vw,3V. 1 , - V4'W.b:V:j ds -g' - 119111,-Y gig-v .. 'YH VF- V-Maxx Fw a zu nf V I . 'L Igggjh VVQQ :i '1i-dw' ,:V'.-f.'9ff,..V.v7'f5-ff' fygr' V. 95 L -1: , 1. J 'W . Mai' '. V' E'f iI4 ' V 1 f r - 15 , W ,,.. 3 ?.Vf VV . 'V' r' .V:f+Vi'V . -: V QV VwE1ww V'Qf'-V , ' ' , 1 ,s - VV. Va, fi g. , .W ,. . . . ,. U ,. . . ,, ,, , , . , ,.,. . V . , .. ,,.. .. . . . ,. ,, .,.. , ,.. , . . . , . ... .V ,.1 ,,, ., ., W. .. . . V . M-,P f.. .. V ., .. . ., . 1 V VN, .,,w.,. 4, .. V Vp, 'fs w ' ' W V fa W ' 'A ' W V- ' WL V..u.V UV VwV'i? '.f W f'fV'f'f. f'12if2'?' nf w i if Ve ,. ,. V I 2. .V,.1 - . J V'VV1',ifg- 111 A-Vf .1-411' . ..1 ff.-.. . .,, 4. . . -V V.. V 1 J V , ',1, P.-,if J. w L'w'g...-1 ' ,V --fs ' : T? .-1: - V ' . ,Q n.V . V V L. dw - , V- fr. Ffa-1-.V ' -WA-V-H '-M Vf' vt. . V Km fp 1 'ff V ft :rf1-Vf.1fVif-. p'f1gfff'VffVfer ,mv em , f ,. ma, f -A V ?1 fl!,,., f Hy.: f , -ggi! 'W X Q L' quiz? u 'p5u V' ,- :I ' J Q? ,Q v W' Q., 4? VVgV.y. 'Z' Vx, IV If? A as ,gb VV,?VVEVug'L-QVVVVQV Za, 1 I V JV Q4 . V 1 VV 9!VV,VV,ZgVVV,W5 V V 1 J' VV V ,yxv I Vp I x 5 H fs' ,ff VVVQX 'MQ V399 4' QV 4 f f .1 V m H V .4 f. V., 9: V . .. k af,-K ' V+ 4.24 , V' ftp' eg, f 1 B X. C HW. A x'g,,'3f ,,, , VV 'fi A 53 H, ks- ' .'9 ' iw' 3 'H ' aw- 4' ,J h A VA 'A t l fm 44 ' 'PEL V , ,VJ KV win 'wiki i ! j 1' me V' ' 5 A' H v P' 'W 1 'fn' yr f ' U, tw 0.15 5' H W- Vg. QV, .V V VV P, V , rx 4 V ' r 1,, v w Y , r 67' f f. Vji .iw W ' 1.1 .X MP8 1 wg. X ff' + KU is 1f J V '4 '-rw M .,'f5fW ' ,1 4'0'i. 5' it Vg: in ,Q VVVVLVVVFQ tw V Vw VV JV, V VV -:agp V Vg.g:V.fQVVVVVVV.V?qVV,f 4 H PM 1 4 Anim' d a .L .4 ', ,E , Q' ' if x, 4,3 'E +V 152 ,V,V,4, Q' A... ' 'EQ-5,4 ., jg wtf S,,..L..VVV, W my s3. ,Yi 'V ,V .Q KVVVVV mr :VV .ang gud.. ,Vs A V Vg V ni LV V: .H V, VVVV 3,.,,Iv, 4 5 VV VVVL gl ,,, 1 1 Q' N 4 ' A Q fu V Jw, ft, 5, VV.. ,V ', V V w WM ,V Q .AV ,-1. 1- V V W 'EV' 'V Kr if -v , .,- V f ' 1' A V 'L 'Q 1 ' aw , W V.. , V. , .A .. , ., . 1 . V Q -, V , ,' VV. N '.-gg? V wiki A Q Qi-Vi . V mi Wi' H , J rye: 'M .- if ,V 4,40 -,. Q ff V.V. . . ., Q fu.. Q? QQ' xg' U1 ' if .fr HIM., A ' V, 3: ,N 1 ,ag rf. 3 .-L . vi, EEK-V V VVV. 'Wi REV 1 qg P 'V-QV? ' M I IN V 5 f:VV .. ww 4V My ,, V .W 'Ku V,n,VfTf. .,3g,aV. , ..V5,-af . V V.. .fEg2Qg?fm,,'E-V. V'.'f MV 5 V WM, , in V-if VV . ,.rfV , .f f. ,M ,,m,,V..V .VV 57 V 'H+-g..VxVVbe1feV. A1Vw2'5. ff'9 fT3.1?.?if4s4wFgsfV14:' we f.,,2J' wg V ' . VM 3: wfgwv 5?f.r:fV viV::V ,- WLM 'Y W ' is - av. . 'VY ' .- 'Qs 4,-.V.'3egVVV. 'lf 'KH 'L s: 59TVLwfXV 4- '5iiVW'1:V44'.,qg'-' -.9 5215! :km ..-.TN1-' 1 W 'f' flff' ..f5 ',-',fjVg 4 'hip 'iz-',?L,,,. ., .. .fr f-' A V4 V.,V L' -. ' V 'Vfw M ,,kf.Lh -:M - 'wa V4?f+1f' , 'if'V.wV. f :Vw i iVFf ff?f:'51. ,1fc'Vf f- V. V: 'f 5 V ' ' 'V VV V xg. .f V' .ag ll A . , , fwv , x..VV....WH , +V.- wfjQ,.fW.ia.. V . 12.4-,...V. my ju? .W V., if fur .V .V - V ,M . fxjshix 'V1V,VlJV1EVVVy VVVGVVVVVV JV:.,lV,VV,k. . .. Vggfaxu.. . E QV' we f 1. . - igggw , Ami. A KV an gr? FG ,Mi JV FJ- V f 1- ww-.V . ,'V'..V.- 'v:+:Vfg-Vi V. vi fa.-uf . ,QV -A , ' .V. .VU ,,:V. , f NV.. Q.. . .V1 . . . H .V VV , 1. . -1 ... ff' f ' V 1?V jW'V -V-' ,yr A ':,- . 4:3 Vw.. . QJ31' -fy, J lgE VV. 'JVIJV' igggi Z' Af 'J'-bf 'E if. , ..- fw: . . VV? V :V 5.-3:9 ,115--i: 'Lg'l ' fQ V VP ' '. V '- .V ff - 'f V W? V 5-M5111 11 .. . ' VX V 9 VV' 7 vw J .. V-Q V V 1VbQVi ? V 5: .ff-.5 B., ' . V- V WU 'fhffr FR' V. V.-.-+3 . . 551 A-. M ,. V- . . .V If . .-.31 ... .. .. ' . VV . 4' V V V' .fx w:.21ffVV:Vsgff fV+.f?f?e5-- ..fw'f:W'iiSVM 'V-' Wi? V+' ff A V. W W W -Kfi: F 5 L gf: .nf ' V Q V I M-if V 'K 'W 1' 1' Sf' 'Aff f W Q? W 'ff ' A f .. fml. ' V..2 :Viv 51: . 15,1 A 3'l.g,.4,-A ,.V,4.. ' g.5fq L- '- I g ' -'UI' V,.,. VL? , -f ' V. Q V :1' 'VV ,gif .' -V Tw ,J '? . ' V. :.VVV, 2'f1Vf 3a V..m:VV-l.,V:V :uv VMMQTNS 'ww' , T P- '-'E-i n . V '-'VV A Ken .V 23.1-f',nk'Vf::i'f4V? ' . .V -V-V' -V 4 Jaw-F 1- . -f4w:,,qg,:. .413 LV MV: V. V Vxf' Hg. -f', V-V: - V 1 ,. M-, VH wpkf , f V,,. 'Z,gVV.V1a.V'L: xi' fy 'QVQTE ' .,,.!'1. .5 ,mg ::.,- QV1. :!! ,1V.fV..a5,,gfi+ 3:3-' V.. e'5,.,kVj:wV,1,g'fV , wavy - 1: 0 '-V1- .ff ' V V- 1' .: w-M9 nlfijwx Y V'-5-2-Vg ' 45 41 35' VT-f7lV 'A -1.7. VVV1V.V.-'QV ., Vf. .'VV'V:V:g V: V2-j Vw. 'V NV V Vf :,, V V V ' fx' : !'Vi,V, V ' ,VVLVVVVVVVV VV., , 3 . Vg' I 1 U4 VV .Sgt a 'ir w- , . Q v v,,.wq f U- ' A . V , V. I ,V ., V , , -VNV, VV . .. VVV.. , VNV VV 6 . Wxxvq an V '5 'iii'- 'YV V V f e- .-.. .VV J V H :V35'.?'vff up 4? W. ' .,2,.f'7, ...-. 51313 , V. qv. . wi -Jaw. ff4V:Vp!?'1f.'..fTw- 'sz- L. . 5122933 1'--fV w f . ,-g,V,Myw- ,, .. ,, . Mfg ... .1 g. KVM, .vu V V- .---we .'?'P?' -A V 3532 nfl HZ' ww f .V 'VV .'ff 'WZ' 4 ' .. . V ,fn-I-7'-'MV' ,l'11'T,?'J1.14.514V:R W1' f ' 'iw .fri -f'..V':. 2 1 31- vw' J V.V1-VVJ. 'W' -f ,.. ,. iw 14' 1V f ?'VFQf?.f.Lf.'V' W . QV -'Vf , 3'-V,'f:1i'1w5?:Jf' f'fiLe-Af?Tp-g,Zf,if2.'f3?K3'25ffV. kg? ' 7:V4S5f ii 1. V . gf.. NZ' V'i':7.L.'w5S,.YQVrA5? ?1'V5?fff:,-mgikaf-M Y W 'L fl f '5Z 1 'f V A .5 fa ' V L51 363. -.'46'i4.4m1 41ng,g1VfLg9V'p1.-1 X' - :f. . HA.-rV-'-mf' V V' 15+ Vw' VW:'?2.V1 fvV VV, .,' ,., - Q., V-, fV.VVV Vff . W4 .V , VV V.V,,V,4. J.-V . V v . Arr VJ, fviwri V.ihv'M41-'.4Vi:.1?ifff,T I 2,5 wwf -.f,'r5-. V :v?'Bfiw:'m,'11e'f PLQM1 'Fig ,. V -.V,.- V.,,V,-.VrV--Va-,.-wg ,V .. -, f .1 VV -V , '- Vp.. :V. iv V -V Qu' ,fuiy pe, 51 g gg, VV-4 V r Q 1:1 W VV VVVV VV, V V .V'i?Vr MI' 5'.f .y.'f2i' V ' .. , Vg ,V .Z VV , V ,,wVV4VV11, V ,VV .. V ff F ii ' . 3312.2 V! M V. .51 VV.. e.. V., 1 Q Vfagimf i. ' VW: L 1 :. MB. il! V Vi1V :F -. ?fA3kgffE'fEfElj56- Hghd' ,- ' Vg: 1-' ggi -V ,QV VM ikff-1:fV MiA f,V . V V. . :V Vvr'VVfs.eifff ff V' f' . 1 Vf-sf VV fi'T?5.xfV2ar'N ww. ' Rf fm- Qi, W' 3' ' rw- zw iif:' A 'W . X fm... aa ' me , 351 -Emi 'N , ,V,4V1 , - : -C 'NZQQ5'-..Q'fA'M.f. in V M 'Vie-,VVV N f A 1 L', J' -, Wil wr gf- -f.V'::-fm mg.. VJ-.ag , M .. . . Qfffg. .. ...www - gf., Vs -'V V.l V ir M. , V - :V jg, -K, :, ,. mg VV., .V V yi ', - VA ., may--f 44-11. - M535 ' XV. V1 unit: Vr..,u. fir' V' wr - ' ,ig Y n. 'I .4 ,KQV ', 2 , fe' . . ... . .. ' . 1 .M . . , Y, . VA, . MVT V '.'5'-r-W5-'V,V,'.fav ' Jw-Vnf'-V'-,xi gk- .3 'W-' 'ff ,,.-., 'WV ,. . .' A V: .f ,V-1 Vmw.45VP,f3'fw'?Z IV W 5: ggi, VVVV ,af 4 '11 , ,V M.. ,MQVVVVVVV 1 Ar 311553, fin Ni VV, P VVVVVVVV 'WW 'f H.. ff :L ff . f - Vw 5 490 . Qflspf -Nm 1, 'VMC ' A, :MV V V16 VA-,VV fig, VVVM. ,,,9,,Vfg ,VV 1 Va 1 X gr V' VVV .1 V M, V.. V ,, , , . ,.,, . MJ... . .Vw .,, H. . .wi W .v H , .gn .. .. . V . . M 1. .pg-fi .. .. . , A. Y fi V ..-.V V. Vw -, L 3 ..'- - .Q ff- V, ..1 , ., Vfwlg-V , .wV..a31p V -QV, -. ,LV-, V, V: M-.-Vw., V' VP' -xr CV-1.5. V. V V-if., - ini Vg- , We A- .1 4 ,-.' , V. ,. ,a ..f-,V-1. , Y, ., V f 6-V. V .V fV.VV 51'-9' iw, V mn, V' V V195 VVQVMHVM 9 Yi W2 . M A'AVV'YMVi of wmv F .ip f?? f .wi -V9 WV -WP.: Vp' wa? VVW4 m?V21TiWw1:a5?H +V V 'gi f VM? 'S '- -.f 1'.A','3'Mw Aff ,AV .59 A Q VM, ,W ,f O,,V,wn, 1. .K 'yx' r 5 gi!-'?'gVi,f!'?Q'ih'!zQ,,.3WVx . 'Wm' ,VV ,WH ' M, V, ,L.. .J5 4-'q V M ,rp qfwfwgdvma, UW, ie ,?fq ff-J' fijgf., 'V .:4VL?VgVg5-Vgtggg'.':,,f.,V3,V1 , 'VV VVV .V ' V VVVV., Q.. V V, ,VT in . -'wg ' ' ' ,f ,. Q -f 'V Q, V1 V VV V VgVVVVVV.V,VVVVViVVV.gV.. V,.'Ua'f. 'QVVVWVV QVVVVVV ' Q V, vu V M? ' .,. .VVVVV , 'g J' fi ' WW A H ,E 5 'M' ,fry irzi' ' A 5 wh. ' fl 'P A' x S AY 4 1 AF' M .- AP 'V -ya '42'K1.s. 'Y 9, U ' ix'-' .Vg ' 1' Q ' - W' ,gf W-Q4 , .1 .J Jil? ,V VQQ- .CV-:f.1Qf'V f'?3,:f '15-1 13?-g-rf, up ,Ag .,,V5s.. .V . ,VV' , '-1-Vg, 15 V' Q :aw V, fx,g,g,V --45. W . V5, '12, Vw. vim '-- . - xg . V , V V -1 VV. V V V VV V: V V -V., -V,V. gf V.. , ,..V ,,. . 5 V.,V.fV-.V, -V V -A VV.. V -.3 .,7. :V. , V VV V V,,fV:g, V A ' V ,VV .V . ,VV-Md -'V Vg, V' - V' V V AL 1 V., f,VVV.V . . .. 1 VV WP,-.gnqf V -. A VV . :Vg,,,--VV,,. ,-'VVVf 5 'ghd M v' ' 5' Rf :im F ?'i ff . iflggf- MVff1f Vffiww V: 54e'r2fY fffi'1 V .e ?Tz.+ L' V' 2+ fi'-WW?77ff: t f Y' V 1 V ,QV , in V.. Va V .Vw ,.4,. V ,--, v., H ,M -3' V f5g,....,V,:f'f'?'g,:fig,-i,2?if' ' ,,w,g3,,,.3v . 1'V,'fg--. 3- Wxif'-on , V., V wV..?SgV5Va:VVi- Jg. AVL, V,,V,V M. -. gg V V+iiVV.554'? 'gfTVwVg.+':...fQ f SNVQQT- '-52: ' 11-Qi? -my ftg:..V.2:lV-V-' ' VV V V V V. VV,,Vf.,V-w3gVV- ,V,V,,V, ty-,T-.qw .VVV,V.,:,w.,.V V: M-1.1.4 'rf' V V.-Vp.f,.V-wwf - RW 4.13 f uw iC.V4444V,4 fy . ' Wiiygffi gfgh fl.. Ty-2-chi 'V 'L'if Q- ' 1 -fi Tn' :'V '. CV? vVV:3.jQf:,!. V'f1'x'. Mn- 1- QE , V, A Q, ,Vg 411 :QM ' ,7 W5 5 ' QV, mf- 2 .,ff?. f 15 , -5,35-'-f-f,1' L-V 1.3 H-1 ., 1 1w :, V 'TV A ' , V , V' , V V ' .. 'V.w.':,..V'V.f'W-tv F V ::,Vw' T- ' v fm- QM. 2. QE-fSI.:'. wig-331f3?X1'fV'l'VVVg,g5ffa's,VVV-7.-,5:5w:V1:'5:Vy,J1 -VV V V,iVgfi.V3j4ggL'VV '.,g1i.QgVwspVg.VQ'k, V: VV ., .'-, Vp Vawqf fig? f.?S '313',wV'i1V1 Veggff' V'.?2'T93,,'fgM T 4,19 1 . 4 , M rx QV VTr1?iV4'V,.i'5f..w52V S'5'QVJo VV V 35413 SQ 'ff Wfiqyffgiqijng 1 gt! Qing! a ,QVVV LV V .1 463-nh D Mt 5 W ,fVaVf?a:5,V swung gVV,,Vm41TfgEq4?,fVVnggfJJ,VV V y V. A . 1 Va Q. . . iff 1-2,2 V . vw ' 1 f-ffl, aff ' .- . mm' V We . . hr . VAT 3' -'s.. V' - , ff.. U -A ' HI ' f.fv.g.'1f 1VV-- Vf2 V1 ', Vgttfxib, ,. . ' .Vgw - Vg. .. K '-. Hg' '01 u, ,rf' - 1.3 . by My ' f'-.,:,1.-,-V, '1. 'r , A 4 . , V-1.' is Qwa w x ,Sb fx I .4-V, .mv gf ff. rug? QM Q vw: md .V V A mf' 'iff-V-5. -. .. - :rw If . 2. . . , Q' VV' .Y-HL.-. T.,-'nmivi . Ji. -if-fL.'..vf, .- .x.-.Ava-2 -uw ' .LV ' f W - . Y! V. ...V-,V V'V'. V-QV: S. W :V V' 4 Vu:VV,,4.vx1gfV.Q.QV'... .V . -w .VL ,.f..... ,. .hy-c-'7.-.Vf ..q,..,,V . ,fV.,..! 4 ,ggng Vt:-VV, ,A fig. aw M VV. VV , , V! . -, w.,,,,,..,,,V,V.Jr ,V,VV-j VV,-...haf .R wg . , V V V- . - - V V ... .- -'.. 4 Q., . . .W .. V. . .7-. VM- .. .. V ,. Vf -V V. ...f V .Q .V ..V , , . ... ,fy VV-V.,. , wg, VW.. it -J VVV ww f I uw H 1 v ,M F' 1 ,MJ Vgfkg PFS? :vg4'VL3V?g'g,.VwfM5! VVHVFV V V. vfxfq, VM may MJ WW ir V ,V-XIWW 5 iff: ff ,.i,1,vVVif: A 4 W' 5 ' 395 ,. V423 . , 5? 55 f- J q5Q .H3.iH X 'ZA ' W0 3 f'?4Q,...15 . 5 fff 'f.Gkf ','2, .- W7 1-QAVLVVQV'-'1 HV., .3-5' ' nh... AV' lf5'7'I':17Lf7x ' '3X'A'T-+V' . 'R C Vfwu- .' -U' af: if' ' .117 ' I V' .i '. K V V' ' VTV' . .il ' Tic- A51--L 3 WL? JW..-mV,, V .V V71 1..,:V,.g','1,VgV,fr?VV:V M i 'iVVQVr',, T.: if ' -qV1.,,v., ,VVV ., VM, -k.Y,..,V Vw, 3 YW Jaw. VVVV,VVgV ,V .V,VV,.,Vf.,,VVVVV VVVV V.+QV,VVw-7. ,- - - eh' . ,VVV,.VV.?-3j,:V:JV5wVf,. VM.-mV V-W. VV? Q , V FW ' t 1 '-rr 14 gn N 3' 57 ' dv ' ' P Jn' F Q r MWA' W5 , Q mn .uff'VJ 'X 'I LM .1 V A- ..j'f':!54J.. ' -.1 . iq ',. ff, jgpeap . 5-a.rVg -V zz V ,Q .f'V,.? wx. V .V ': -5 V- : -. .mf .,ff,V,-Wa . L V ,V .. -V ..V,VVV.VV5--I. VV'-Jfivg V.,f .Vai ,5 f1qVsf?s Vlm EP. V.V,V w VV 3:-.y:V1,e4 Qi., yqwlm ' 'M' ,U VV, C? V VV VVV MVVVVVV V VVVV VVVVVVVVVVV VVV V VVVVFVVVVV V VVQV VVV VV 42 V VV V Vit VVVVV VJIVVVVVV faqs V ,V VV ,V V V JM 5L'f.,:fgVV 'ufwyfwriv V - .V 'V - Www VV .E 52'?V9x3rVV3VV ,JVHJV 'VVV3' gi VV lV1iVV4' S 412' 'kjw f,V,1V5 ..- QVVqVf wif- MQMQQAQV-'L.fV ,'5i:'AykHw?g,g?f g1gf 'VV i f V . 1 .- 1 4 1 V ,Q I ,, 1 1 4 7 Q . ' E A - . V . .- VV - -W' 9 'i fV1 1' re 1 a 1 Aa! 'ffl 'fm 12 Jig. A 3g3,,4.:j1V1v.1f7f3t2'2 .'.51JE'V -. . W'2w--5, ,z'w.'3f 'ff.7'QV.ig4'gQVVf4g 4,f'1V - fu , .ffyvfu ,V.:'yf,w.fgV -5. . ., gift --WV-'Q N, 7.542-W 5'-A?-, if- .g .:f:if f' V. V -uf., ..- ,V ,em '7'5f'1. Vu.,, VV :Q ' .. IW 'f- 1- f5':1VffP Vw .2 . lhlgwe' -?fM W- ..f7...-...iv if-5 zq'i, Q. 2' 7.:.,1i154' -mi, WW. 'FEV 3' il 5.4, : ':2'.3ff. W'2ff': U1 ig-xi 'V:V-,fp V V-V VY-S:1:.':Vm?QYK'?fT1 Hifi fr '5.fW 's'zl ,. 3 ' W , ,,. ,,V. . . f-'-www: -. ...Vw na-2-. '.l?f.VV.w.ffT.-ff,,V' ' . ,:1?fgt7'2.y1.V--5 g4V:3V2aV'5 L-:f2VV:fV?' fT..'i1'L- '.-m:V,n'1,V'vVVV', 1 ' VV ' M ' ' , V,-,W 'VMI' Vw.. 1-, 'V JV, .V 'V,Vr V Vu: . nVV+..:,5,f Q, . f 1 3Tm'?'7A .V v ,, 1- ff. Biff. ff- 9 V 41:1 +2-ffi ,. 'gif Lv- LLL. V -V-VV .- ,Vf Vfsffwi , . ,MV . u.V5f gfhf-H. 1 1. ' 5g1?f?iw5-zfaf V:V 2v5fV ?if4:QQ1? fix? 'F' V -':'k?.n51. VV ?.IgJfs7f',V1' V .. . , fu. . .V - if V...- -my s1,Vf 'f'fV'V',1gI'.-.1 'Z 4' - .fu -: '- V 3.3.5. .,4,...-V-.H '. ,g .1--w... . . , W-, , VVVV , 1 ,,, ,V V f . mf- VV 'QF -VV V.VVV,lJ. :VV V'- '7V'.NV ' ,. V V ' -, dw , My , N.-fm V V. ,, JV. ,V , .e V.VV. V,,V, .w,.. VV,,. V, , V VV V V .V1,,..JV . . A ' . V V ,V ' V' .V ' ,Jnf.'iV'fg1 VV V aff- ,J-,V. ,V . . VV. .V-VV VV .VV gs, V, V: ,L 1. XV ,. ' f rr' f V V: , V . f 'f ,.:VYf-. . V 'Vey fr- .. ' fvf., '. un Q V. ,.v ,.-.Vj f,,V . QV, . , , ' 5 mmf.. -...ul-A .Lf - ,V eV,rw.- 1 gVg11'y..:w,gQl' V,.'g,f'f'J 1- V,,.VVV,nk 314 V 1 in 1 '1' Y '49-1 1 ,- M ,A Iiff:,5jV' , ,. :. .-ffm' V V, -V -?'V V,-1 ,':5'?a'?- .V-,gf 4 .,7,Vis- 'L ff dig VV, .sip-5V .V 1,575 VV:q,hVe V' p'1'f.iaz2.:V'VFa?V.f1rr-3?'i1f,ggj3V,gV5VVV: 1.1 V'.,'.'.-4' , V .L ..... ,,,..,. . , , A A . 'V A' V .' - , 'yy V wig., .V-QV w,,.w4.,VVf 31-V-5 qv WV .V,. V V. ., QV 1' 5:4 , ' .- , fV V-Y QVf71??'j.Vf'1','im:,..VZfV.w',gf1V fic-V 5fV:4.3.s3V.,V.'VV.VV if ' 4 W 'W ' 1' ' ' V' . .V,V,:. .V -. VV'V.-f'Vj'-VVSX' ' 1,3'VV-V LVVV . ,,-,, V , .,VK:...,,a,V- V R :.V,'-WV V ug. ,Vw-.V,'3'.., ff? Wfjf' 42321-bVP'Y'r'3'..?'9',-,'jg'f'.-, x W ' f L 33,-rV1y ' 'ws-1,i,VQq r:ge2l' fi ' 5 : ft-gif' .aT.VVf 14.,xJ' 'Fw'- - V ' V' .-L. funn-. A jf-:z '-1 ,-Vin-nf? 7 la ,f sm VH' V V VVVVVVV fy. vf fbgf ,V ,' ' lj 6.4 w 7 1 V . gV, ,a .y.H,i-'E-..Lr'gV '?'+',4. -,.-V ,, f J , VVV ., Q. .Vf,,VVV.,. 1,V - M- ' VH' 'zff-' 'FQ!-iff'zi?: V ' Qf1:3.Z'g!5ggg '12'F5FVf'. , - 1 V5 452' f ' , l Q, -. -mi ,'1gefg4V Z, V-'f'i'i1:'-.,!'V iQV,VV': VQ-B'f'w1':!.? . 1.1 ,'Lf3jgj2:Q 2 V - JV, gwxp-5,3 V., , VVV V., ,V V V V , ,Pr iV,xV.,3:Vaff.,VV., ..Q.V.3,,.fV:,V,,..VVV5. .V V-.VM .V.V.V, , , VV1. 1 , Vu' 'FQ 'S :M'4'.v'I1 -..-- 4 QV J-,.. .agfgfiq-,VVV.?,.-5.15 g.VV- H . V .' '. HI, '.L.V j J. ,w -2 ,f.v1.y': .-,LT4'54g'f.V En: JWV,-kirw ,.x ',' 'i, '. ' , .Q - V.f ' ,V -H: V 3:4 -1. if 434. - fggijg-V.3:r. wL--.,'H V 2!',x'VVw-uf '44 411.-f4ffc3yV . . A-x. 1 K .V V fVVV.V,.V?.V .VV VV-- ,.VVfVV .VVEV 5VifV,.VVV ya' 52. LV1VV:VV,,3IV .52 gk,-rVV,1.,VVVh,3VQ LVJVZLV , ,Lk VV. ,VVT V VTVL V 5 .VV . V. V V V: ,ff -V 1. V,,-fvgugg ..VV,1..NVV Q-.V 'V A . :V VVL-V ,V V 5VVV,V5VVJVJjqg'fVj'!,f.,,V. VVV VEVVVV li, V VV . .VvV,fV V VV- V VV-V , 1 , 1. .V-V-VV3 . M.. - . , V.. -V ,.,,. , .,, my. V, .VV...n.-VVV.VVVV,,:.i+5.e.j,VVVNVV,VVVrV,: VAVVVV .V VZ ,,V,VvVVVV . V . V, . V VVVV V .VV V VV . -fV.V V V3.3 V,VV ,V V. ,....VVVVVVV,,.L .y,s,VV,vV .K ,.w.VVV,-5 ...V V V.-.1 V.VV...V,,, V V V 1,V,.,.-. . g.VV.V ,- V g. V V.. . Mr: ...u5,.jgVJ,' V' Q Qa:V V-Q . .V f.V..V , . Vs' V . ,.-vmwfg V. V- ,- --Vy' ---yi'-ef..-f V ,, f' --4 4 , . ..,V.VV,0,. .,V V V , ,V , .fy .- -., . V VVV,..VV V.,VV V..,V:,.VV.. , 31.1, ,. 1 VV V. z, -7111 f.'cw,zf11- .' Hu .fm ' T 1.'Lf'Q 1VV'.,s,V . VV .V V . V V, V. ..V ,'.,v-' ,,V.-. V ,Q -S, 'V nh. ,:.:f'!J.h'- 'fb' . , Lf z' V .R . P - MV- wi' fun. V- , . . VN ' , . --nz,-.V VVJL V gg V4' f, 'V'.,. lV vf x,q,V7'V::'?-.45 - 3 V. g.24,g1flf,V,,VgV4V-j f1 . J QV . -,N VV V V V, +- -. . ...'5'B,. ,, -V. V . .1 . V. V' 4 ,.,'.KA- .V bw- ng .' ,ww M.. ,, ,.VfJ1w.'y. v.':,1- Vt. u. .-.- Exif' ' 3'?w..V A Vf vlfzif W f2'Lf'f'HJ'V1E9i . L? 1 , . Vi-gg QQ? ' x L .A I ' ,X 21 Q , nn! , M WE' V .V ' 4:3 , V .- '.,,',,' :V1'.'f.3VV3,,5M.7fjV AVA VJ- .f 4, 1VV,,:,. ...V-. VVVVV -E -113 5. VV Vw- V ,V , V ',- . , '.-, 'V ,V ,,V, :w ,r' V1 . . -V .H.5gf..-,V . .nfE,,V9.f,!b3.1..,.V.LV1,,V .- V, 4 .-Y J ,4Vgf1VYvV4'f, , V ,.M,..5fs,'K 2-,,V.,.,'f rf . V, ,W .,,W,3ff-g,.V.V,V,93..VV-,,-,V. ,-,..g3V5Vwrmh -V.. ,,,..V .. 37. 1, -my ,n,. ,,V X' MK ' -. iw f.V f ' Y Wav' M af W 4 9.-fm H. Vdgavylf' 4g'Q fw' HU-n -3' r M 'B' :gpg . .-,VV-Q, 4,1 .. .y 'f V4.' ,H--:.2V u. .:. 1- -5 V. r ' f . V .V , -. V! .' V. pm .- . -. V V,V,,VV1? ,, V, V' V, -fu. :V . 1421, ' , ' V' - .M,,. ., ,f, ,. .ww 351 V . -Vw.-.ff.V. V- .V ffiiafffw. .fx . .M .... V. .if .VQVfVig'? . . ff .V V' V f,5VVvV,V ,V VV NAV,-VVV' V-V VA- .V V, .VV - VV , u: .VVr, N- -,VVe,-7,6 , VV-:.V5.,,VVf V3V,fV-V-.V,:.fVV.V V. .-.VV..V .V VVV5VV.V., -V VV V V 5 :.V ,-V VV - -,V '3V,,-...VdV- . ,-VV .W wp- q ,V1.., 1.9, KF:-mV' ' V- f1J.4kV.- 'F' 5,nV.f.. . V VV V i -G7?U3f9iV?1' 'H-r. -:f,, V -xii? :V-' . Vieuffg- Vw fun V Ge,'f'-1,--,Vw-'H 'X RH- - V- V 'VV': 59. V ' ' -if . V ,Vg V. V Vf V, Vw-.VAV JV rg, V 7,,1.9v...V5 VV QWVQVVV. . VSV-Y VVVVVV VVVfg:'3,nUEVV.aVVVfVVVVVV V Jin V VVYAQ V? Viiif BL .. -, V.,.,,V.waf'L- x,-'71-V yr 51442 rk M-it-'E W V.'fx'rV.1.V:v.,V,,,.g, 3V'..?,u ,., r, 'V V, - V! va:'+'WV V wmff-gwf Vw VV W w'2Vwrw M,3'5ai. ww.. m n' :QQ ,. . ..-..:?'W 4 Prg5',?'w-1 Var: n,2VizimrMf 6 WV? 1. 1- . VV V V: :'f....9 9' V43-L+ 4-V.t9w'ifiV'VVJ WV,-wi, .+-'QV-24.-.isgf-V':--hV' if -on V. E. QFLYZ7-ii I 9' t 2' 'QV I 1Fs:':V'uiFf rg-'Af H 1 Q k-.V1'mVV,,eh ' 't' ggg ' we QQ V.m.1,, ' 1+-nf V V ny V-.V I '.4,q,.!5r QV. VV.'ff'Li-'QV' Lf '31 ' --4 .,, ' A LVE' ':' 'gi 'ii fl' -- 'vis 'T Qu. ' '71 . Vx . fi:'.1 ,V-5'-54:44 V323 JVJY' ' w'1..'!!1' . '.V'V'mf?5-rf'ff3e'M?j'f.m3Vielw.-'ff-.V,sV'A'e!fi'ff+5:-fV'mw'f,fi:5-ifV 'F'- .?fv'f.'f wif.:-V 'lb mmf . fn ' V4 V ' ...: .V'VV.V?2wJ P if ,t 'riff-V2' Ng V- raw is 2? ' -1 .1-V 'J .4 i.V -Ay? 'j'Y '4'..911 v.. gm., L' ' -V .V 1-m ., -. 1n'w.l'v:n-V JV V-pw-5-f5p3V1,tMnpfiVVQ-?3q,yg4VxlE4,-, wV',.w!,,'--. VKQVV, 1 V ... .7f'.,'V- 1V,.,p,... . V M,...V.V.NV VQQVVVVVVVVQ Q gf-',-,..:,,A,..,,f,,,f.'fv-Vxdf .1-Wf'.g.,.V' 4. 5 ,f .W-.VL-.,5Vm.,,.,wf.. w., ,H M.. NV, ,mV 1. wb 'If -- .n.x, ,,.f,v.. .-.f,.,..V. '-f-'V,',V'-1.'.V.VVV .M .QP .. ,Aff .... . TM, V15 ,Mg ,,. -, 1 if -. as Y, 'V3V VV5:Vff 'ff, Q 'llfigf-' '1.t7J-Va' . . I - . -U. V - .4 'f' .pan .- :xv -.. - , ,if ,Q 'VJ m ,au-.,.,. 71 Vw- - QV.-'-1 ., . 4.1 'V V .- 'V..V,v-'af w. .1 .. ..1?fV I1?t1f,a 4 -' ,-f .V,VV,,.,V, V VV ,, V ffmzl - ,f.-22-'T' .H V. 1, ,V w . is F' 1.'1lf3'1 -GENE V , .3m'f a5VV XV--ifliiwiv. V' . .5 21? :V.'? 5-'Q V5.5 4? V q,,5,a5Vf3V, ,V,.VVV 'Ni' fv r M Var . A V V.-V!','1Vy 1' .NNW ' 'wI.:. 1 V , .l V.. AV:' i ' 4 Vx. uf 4 ,,:V.,VmV,p.V,VVV,,.V, .'fag..2'1' I' Aa A .- '. .,uvf. U. U IINIKIIHVIIIIVIIIIUKIIIHilllliIIIIUKIIINilllliilllllillllillllliilllllilllllilllllUKIIIUIIIUilllllHIIIIHIIIIMill!illlllilllliilllllillllliIIIIIilllllillllNIIIIIillllliillllillllliillllilllllilllllHlIll'VIIlI4illIlHIIl Wi Designed, Printed and Bound By Union Bank Note Company Kansas City, Missouri IIIIIIIIIlIllIIIllllllllIIllllllIIIIIIIIIIIIIHIIIIIIIIIIIIIIIIIIIIIII Engravings By Teachcnor- Bartberger Engraving Co. Kansas City, Missouri iliIlllliIlIlllHiIiIlllilililVHIilil!llllililiIiIlllIlIlllillliIIIIVIllilVlillllllllliVIYI4lilil!I1llllllilillllllllllllllIlilillllIIIIVIYIIKIIIIIIIIYIYHIIIIIIIIIIIIllililillIIIlllIlllllHillllllllilllllllllllllllll Year Book Medical Gffieers' Training Camp Fort Riley, Kansas 1917-1918 lEBE!lHEIi!HGi!I!H3iI WF-Wiiifilil WWWIIHMIME MIM ' HWIIEMIHZK ZIEIEKHFWHI 52 ml' E LJ .LI HHHIIIIIHIIIIIIIIIIIHIIHIilllllllllIlIIVIHNINIIIIVINIIIIIIIIIIVINHIIIIllNINHIIIIKIlIiHIlI1IIIIIIVHIQIIINIIIIIININHIIIIIIKIIIVINIllllIVINI1llIIIIVININIIIIIIIININIIIIIIIIHIHIIIIIllllllllllIIIIIIVIIIIIIIIHNIIIJIIIIIIIIIINMIQIIKlllllml!I1IIIIHLINIIIiI1IIIIIIIIllNI1IlIlIlililililHillIllllllllllllllllllllllllll JIIHHIIIHHIIHIIIIHIIIIHNIIIIHHIII1VIIIIINIIIIIIIIIIINVIIIHNIllliNIIIIINVIIIHWIIIIINIIIIINlllllNIIIIINIIII!NVIIIHNIIIHNlllllNNIIIINNLIIIINWIIIINWIIIHNIIIIHIlII4NIIIIINNKIIINNIIIIHKIIIINIIIIINllllllNillliNIIII1NPIII!NNIII!NNIIIINbllllNNIII4NVIIIINHII1NIIII1NNIHNNIMUIIINNIIIIINilllNNiIIllHIII1HIII1HIIIl1 U.l:IJf5 Book is hehicatrh tu Maier General .fltmurgas who ahuhe all others has been responsible for the high stanhing of the Smnnieal Qtorps nf the Uniteh itates Qllrmp ann who :min repref sents to the peupie nf the vtuuntrp the Qfheai uf an Qbffieer ann a 4BentIeman. 5. mn l1llIlIIIYIlIIl!IIIIllIIIIIIilllliHIIIYilllllIIIIINIIIIIIVlllllHIIIIIIIIIIIIllllillllllllllllllllllIIIIHllllllVIIIIINIIIII1VIIIIIllllllVlllllfllllllVIIIIIillllllllllllllllllllllllIlllliIIIII1llllllIIIIIIilllllIIIIIIIIIIHNIIIIIIIIIIIVIIIIINIIIII1IIIIIIIIIIIIHIIIIHIIIIIHIII1NllliVIIIIIUIIIINIIIIINlIIII4lIlIlHIlII4VIlII4 .f.Q . KQV' - 'mx iw N. - X itixz. , , LMA my .' 1N'IA.l01:-GEN!-:l:Al. W. C. Gomms Tms PAGE is IJEDICATIQD TO Col.. E. L. MUNSEN, M.C., U.S.A THE FATHER OF THE MEDICAL TRAINING CAMP IDEA. WQMMJ MEDICAL OFFlClil2Sg'liI2AlNlNC CAMP '1 '9 'llO3l:'o in T oioioioioioioqhoioioioioio ITD ITT Dil .l7,Y, KAN SAS g Toreworo T 5 T the outbreak of the present war, the expansion of the Regular Medi- . I cal Corps, which consisted of approximately 500 medical officers . A l iid 13000 Enlisted men, to a number sufiicient to properly officer ,ummm ,S Segojgger Bree t?hat. this Ceountry was to. raise, brought up a very p o em or imme iate consideration. X It has been frequentl stated b ersons 0 ' I that a doctor needs no furifher trainlhgg than hii l edge to immediately step into the work of a military medical officer. wg., This 1S a fallacy that has caused.this country much sorrow and . A-f trouble. and a reference to the medical history of the Civil War and Y' the war with Spain tells many sad stories of suffering in the armies of this country, due to this lack of militar instruction a '- cal officers. This was thoroughly understood in the Surgeon Generals' Office at the otlifblfgakheolfwtclife present war and immediate steps were taken to organize training camps to prepare the medical Officers for their duties with the troops in the field. This department was put under the control of Colonel E L Munson, M. C., who, by training and his profound knowledge of the problems presented, was eminentl l fitted for the work which, to say the least, was monumental in character. y The plan as developed consisted of the establishment of training camps at Fort Riley Kansas Fort Oglethorpe, Georgia, and Fort Benjamin I-larrison, Indiana, with the smaller camp for coldred Officqers at Fort Des Moines, Iowa. To these camps were to be sent all officers of the Reserve 'Corps who were called into active service, except those whose services as examiners of recruits were needed for immediate duty. A course of three -months' intensive instruction was outlined. This course was only intended to give ground work upon which was to be built the thorough instruction of the officers before the went to the battle front, it being recognized by the authorities that three months of even intensive i y struction was not sufficient to make of them finished products. H' In the organization of these camps for this purpose, the following plan was pursued A Commanda t and a staff of regular medical officers who by their previous training and study were especiall u fied, were selected to instruct in the different branches of the work. In addition to this it vga? aal 1- provided that the training of the enlisted men of the Medical Department was to be carried out To these camps. This was done for a double purposeg not only to train the men themselves but also bn their presence, to provide organizations for the training of the medical officer in his special' duties l y The camp at Fort Riley, Kansas, was established on june lst, 1917, the staff of instructors h ' - arrived shortly before this date. Temporary barracks and, stables were constructed and seventavfing officers started in to receive their training. Shortly after this, other officers arrived but unfortu y- ie the full capacity of the camp was notyreached until about the last of August whenq 1100 officersnatey in training. Shortly after the first officers arrived, enlisted recruits were sent fo the camp and s were organized working force was present and the camp took on an appearance of actual war conditionsooqfan training for the first officers and enlisted men continued until August 25th, when officers and men I ' S for the five National Army Cantonments in this district were sent to their divisions These require ments were Camp Funston, Kansasg Camp Dodge, Iowa: Camp Lewis, Washingtong Camp 9122335- Texas and Camp Pike, Arkansas. , By this time a large number of officers and men were sent to the camp and itswfull ca 't reached. From that time until the present. intensive instruction of these men has continued wlfhci y was ing ,success, and officers from this camp have been sent, not only to the divisions in this countr fo mcreis' and special details but also an appreciable number have been sent abroad. y F regu ar In addition to the basic course, it was early recognized that the training of officers in s e ' 1 1' of work must be attempted, and special instruction in camp sanitation, and the duties of a sanitarp entles was inaugurated. From this beginning, a number of special departments have been built lh adI?:l'f'Or to the training of officers for regimental and sanitary train duties, they have also been specially: 152 9 yi A --X - Y . , . .. .V -. . ' -. v v,,f .-,..g...illiiZl..':i:f?l.f, Qig.ii.l.255N'5-..l.W?t,l,IlllHi.:s.l1!3Nll cultivarUIIIIINWIOO'ISD''JUDOllwllw'www0nllwnnmmoolmvwdlliwnillvsqunomzuwwfmluvoluanodqnoxuwommlvnilioqllvniamlb! l Ui. i I-'ll VY I-QANSAH ,,, X . structed in epidemiology, the handling of 'evacuation hospitals, hospital trains, evacuation ambulance companies and all other units of a special character with a division and also along the lines of communi- cation. ' In November it was decided that the professional instruction of officers of the Medical Department would be better carried out at these camps, and, acting upon this decision, schools for the intensive instruction in Orthopedics, X-Ray, Surgery, and Internal Medicine were inaugurated. At the present time this instruction is of extreme importance: its expansion is noted daily. In addition to the instruc- tion of the officers in special lines, it was also found necessary to give special instruction to the enlisted men, therefore, not only thoroughly training them in the duties of the soldier, per se, but also these men are receiving instruction in the duties of clerks, chauffeurs, automobile mechanics, drivers, nurses, cooks and all other special details for which enlisted men of the Medical Department are available. In a summary of this character, attention should be called to the fact that on the expansion of this camp to its full capacity, and by the relief of five of our regular officers who were instructors in lthe early days of the camp, the major portion of the instruction came upon the shoulders of the Reserve OfHcers. Most of these officers knew nothing of army service except in an academic way before june lst, 1917, and it is with a great deal of pleasure that the statement can be made that these officers hagze acquitted themselves in a most thorough manner and that their instruction has been of the highest or er. In conclusion, it must be stated that both ofhcers and enlisted men who have been on duty at this camp have shown the greatest desire to learn their duties and also to become as thoroughly instructed as the time of training would permit. All officers and men sent from this camp for detail elsewhere have given excellent service, and it has been recognized by those in authority that these men were not only well grounded in the principles of sanitary service, but also carried with them an esprit and desire to give their full ability and services to their country. qmlmn.-Q-. -WQQWQHUWHQQQDDQOQCQOHQQ mvu qgq 1 . 10 , A ' W MEDICAI, L9I l ICIiI25 'l'I2AlNINfi7 QAIVII3 A V W W Q1010330ioioioioioQd:oLoonDoiuioioioioioQingxiodiwioii I-'Ol2'1' l21l.lf.Y, IOXNSAS .444 A 4. 4 ' ILLIAM N. Bispham was born May 22nd, 1875,at Warenton, Virginia. He was educated in the public schools of Baltimore and the Baltimore City College, Balt'more, Maryland. Later he attended the University of Maryland and was graduated from there in 1897, receiving the degree of Doctor of Medicine. For some , time previous he had been a member of the Fifth Regiment, Maryland National Guard. He entered the Service of the United States on April 22nd, 1898. During the Spanish-American War, Lieutenant Bispham had service at Chickamauga Park, Georgia, Tampa, Florida and Huntsville, Alabama. All of this service at that time was as Assistant Regimental Surgeon. In December, 1898, he went to Cuba with the Eighth U. S. Infantry as Assistant Surgeon. This regiment on disembarking at Havana, Cuba, was camped at first at Buena Vista, about seven miles west of the city. On the surrender of the city of Havana to the American Troops on January lst, 1899, this regiment was brought into the city and became a part of the acting police force of the city. Lieutenant Bispham was on duty in Havana with this regiment and in February, '99, was placed on duty as assistant to the officer in charge of Cuban Relief-who was the now Major General Greble. Later in the same year he was put on special duty with the Headquarters Department of Havana. In April, 1899, he was placed in charge of the yellow fever preventive work carried out with the troops quartered in the city of Havana. In july, 1899, he was detailed as inspector in the Department of Charities and Hospitals in the city of Havana under Surgeon Ross of the U. S. Navy retired. His duties in this detail were principally the inspection of the hospitals and several charitable institutions in the city of Havana. In january, 1900, he was detailed as Assistant to the Chief Sanitary Officer of Havana under General W. C Gorgas. He continued in that detail until June of that year when he was ordered to Cabana Barracks, Cuba, where he remained as Assistant Surgeon and Surgeon of that station until December of that year, when he was ordered to Columbia Barracks, Cuba, as Assistant Surgeon. He remained there until February, 1901, when he returned to Cabana Barracks as the Surgeon of that station. In April, 1902, he returned to the United States and was detailed as Assistant Surgeon at Fort Totten, Long Island, which had only recently been established as the Torpedo School for the Coast Artillery. He remained there until November of the same year, when he was ordered to Fort McHenry, Maryland, as the Surgeon of that station. While there he took a special course in clinical medicine under Doctor Charles E. Simon. In December, 1903, he was ordered to Fort Logan, Colorado, and remained there as Assistant Surgeon until February, 1907. During that time he attended the maneuvers held on the Pole Mountain Reservation in Wyoming and there commanded Field Hospital No. 4. He also served temporarily as Surgeon at Fort D. A. Russell, Wyoming, for two months in 1906. In March, 1907, he went to the Phillippine Islands and served successively as Surgeon at Camp Connell, Samar, Borongan, Samar, and Warwick Barracks, Cebu, returning to the United States in 1909 when he was detailed as Surgeon for the Military Prison at Fort Leavenworth, Kansas. While on this detail he attended the first session of the Field Service School for Medical Officers at Fort Leavenworth. In 1912, he was detailed as Director of the Field Service School for Medi- cal Officers at Fort Leavenworth, succeeding Colonel E. L. Munson-who was the first incumbent of that position. In 1915, he was detailed for duty with troops on the Mexican Border and reported at Texas City, Texas, in August of that year. He was assigned to duty with the 28th Infantry, then camped in Galveston. From there he went to Mission Texas, with the 28th Infantry in October of the same year and served as the Surgeon of the 2nd Infantry Patrol District, In june, 1916, he was detailed as District Surgeon of the Brownville District with heaclquarrers at Brownsville, Texasl In july, 1916, he was detailed as General Sanitary Inspector, covering that part of the Border from Laredo to Browns- ville. Included in this district was the New York Division, the llth Provisional Division and troops in and about the city of Brownsville. In August of the same year, he was sent as General Sanitary Inspector for the Western Texas Dis- trict extending from Laredo to El Paso, with headquarters at Eagle Pass. The troops in this district consisted of a divi- sion at Eagle Pass and several separate brigades guarding the Texas Border. In February, 1917, he was ordered to Chicago, Illinois, as Lecturer on Military Hygiene and Army Administration at the University of Chicago, the University of Illinois, Northwestern University, the Chicago College of Medicine, Loyola University and the Hahnemann School of Medicine. In May, 1917, he was ordered to Fort Sheridan, Illinois, as Surgeon for the Reserve Officers Training Camp esrab- shed at that Post. ln the same month, he was relieved from duty at that station and was ordered to Fort Riley Kansas as the Commandant of the Medical Officers Training Camp estalished, at this place. ' ' He is a member of the Association of Military Surgeons and a Fellow of the American College of Surgeons, ' tiioioioiOioiOioaioioeuuoloioloivoaunnensoauswwb . I'1J Vf?'l.N- ' ll MLDICAI- oi4Hcf1rzs1i2A1NirgQ,QAMrJ A 4A , i eininsnnoiocnioiioiioQSoiiioioioiougoiiocnoioioioioioioilioio ' FORT RILEY, KANSAS Ebc Cbject of the mcbical Eraining Clamp im I-IEN, in the spring of 1917, the United States decided to cast its lot, for the sake of humanit , with the v wa -fm v . . Y . gf21T'bQg Allied Forces strug ling against the tyrannies of Prussianism, this countr was almost totally unprepared g ' y ' f Q 2,24 1 to render any great assistance beyond furnishing of funds and supplies to replace the waning stores of its allies. Our man-power, although theoretically enormous, was, as far as immediate usefulness is con- if ,335 tl cerned almost to be disregarded. It became evident, at once, that measures must be taken to classify and w fi -call into the military service of the country such able-'bodied males as were not essential to the various gl -I . . economic and industrial pursuits of the country, in order to furnish ourselves with a fighting force , sufficient properly to render assistance in replacing the already greatly depleted military forces of our allies. This consideration, as is well-known, lead to the Selective Service Act of May, 1917. While, in time of war, a large fighting force is indispensable, yet it is of prime importance that a sufficient number of properly trained and experienced officers be available. From such a small military organization as existed at the time of our entry into the war, we could expect to obtain only a mere handful of trained officers, far too few to lead and command tne vast hoards of untrained men to be called into active service. For this reason Officers Training Camps were es- tablished in variousparts of the country to which selected men of good physical and mental qualifications were sent for a course of intensive military training under specially trained instructors from our regular military organization. This idea of training o?i:ers for military service is, of course, not new as the Military Academy at West Point and the Naval Academy at Annapolis have been carrying out this procedure for many years. However, the number of men available for such duty has always been small, as compared with the vast number needed during the present emergency. It is true that a few training camps, such as that at Plattsburrg, have been conducted with this end in view, but nothing like a general concerted plan had been attempted prior to this time. lWith the Medical Department, however, little had been done in the way of training civilian physicians in the duties and functions of the military organizations, beyond an occasional training course of two weeks at a camp, to which vol- unteers from the Medical Reserve Corps might report for duty, and the attempt to interest the members of the Medical Reserve Corps in the Correspondence Course for Officers of the M.R.C. at Fort Leavenworth. For this reason Medical Training Camps were established at Fort Riley, Kansas, Fort Ogelthorpe,,Georgia, and Fort Benjamin Harrison, Indiana, the idea of such general training camps for officers of the Medical Department being entirely new. It is surprising that this plan was not adopted sooner, in view'of the lessons of the Spanish-American War, but the reason may probably be found in the misconceptions of the functions of the Medical Department, as held by the public in general as well as by the medical profession at large and even by the line of the Army. It is no doubt true that the true function and importance of the Medical Department were not appreciated until the Russo-japanese War, which was the first great war in which the deaths from wounds exceeded those from disease in- curred in camps and in consequen e of unsanitary conditions. It is, perhaps, unnecessary to point out that the duties of a medical officer are, first, administsative and advisory, second, those dealing with sanitary problems, and lastly those of a purely professional nature. While, of course, the medical officer deals with the sick and wounded, yet his primary duties i01l1OlO1OlOi,O1OlClillllili Cl 12 . ' MEDICAL oi+'Fit:iires 'ri2AiN1Nt: CAMP , Biminio1030isisioioioioioioioioioioioioi0101oioioio FORT RILEY, KANSAS are, for the most part directed, in time of war, to the preservation of the strength of the Army in the field by CID the neces- sary sanitary measures, C23 the retention of effectives at the front, and the movement Cevacuationj of non-effectives to the rear without obstructing military operations, and C31 the prompt succor of the wounded on the battle field and their removal to the rear thus preventing the unnecessary withdrawal of combatants from the firing line to accompany the wounded and promoting the general morale of the troops. Beyond the above duties, and of great importance, the medical oncerns itself with the care and treatment of the sick and injured in the zone of the advance, on the line of department c communications, and in the home territory. While the civilian physician is, or should be, thoroughly skilled in his professional duties, under conditions which prevail in his routine work, yet his military functions are so different, the conditions under which he works are so varied, the means at hand for remedying defects so meager, and his knowledge of military procedure so lacking that he can not be expected to know, intuitively, what to do or how to proceed to obtain the material with which he must work. Further, his utter lack of discipline makes it very difficult for him to exercise the power of command or to be commanded without a thorough course in drill procedure and methods of handling men under such conditions as he may be forced to conduct his military duties. While the knowledge or medicine, in itself, has increased greatly during the time in which we have been engaged in various wars as a nation, yet it was not till the Civil War, when Letterman introduced his ambulance service, that any system-atized method of handling wounded was followed. ln our Spanish American War, the doctors were untrained volunteers, for the most part, many of them skilled in the practice of medicine but lacking the knowledge of applying the practice of medicine to the care of large bodies of men and of the system necessary to secure hospital and military supplies. These conditions were, of course, not the fault of their medical training but were due to the lack of experience in things military. All this chaotic condition has now changed. The Government has realized the value of having men inthe Medical Department, who are thoroughly trained, not only in their truly professional lines, but in military ways as far as they affect the work of the Medical Department of the Army in ts relations to the other departments. Under the present method of training the civilian doctor is taught his drill regulations, so that he may know how to handle his men in formation and on the march, is given opportunity to learn discipline and the methods of enforcing discipline, is schooled in his paper work, so that he may know how to render his reports and obtain his supplies, is instructed in the methods of handling and evacuating the wounded, is imbued with the idea that proper sanitary measures are necessary for the main- tenance of the health of the Army, is trained in sanitary tactics and maneuvers, so that he may properly correlate his establishment of aid stations and his system of evacuation of wounded with the movements of the line organizations' and is quizzed and examined on Army Regulations, Manual of Courts-Martial, Manual for the Medical Department' and other military works, a knowledge of which is deemed esesential to a proper understanding of his duties as a medical officer in a military organization. With all of this it must be understood that opportunity is offered in these training camps, and the work is so arranged, that those members of the Medical Department, who are to be attached to such units as deal mainly with the care and treatment of the sick and wounded are given special work in post, base and cantonment hospitals properly to fit them to conduct their work under such conditions as prevail in military organizations, In brief, the Object of the Medical Training Camp is so to train and instruct the civilian physician, who has become a part of the military establishment, that he may naturally fit into his cog of the military wheel and render such effective and efficient service to the Army as a whole that the fighting force is capable of exerting its maximum efficiency whenever called upon so to do. QCQCQOQOQOM liilllliiiiii ' 13 I Mfe3DIc:AL orl-fIfIc:EI25 'IDAINING CAMP N k I Oiiil1llOllilii10iOiOlOQlQOiDaOiO1liO2liOalQOilil'C FORT RILEY, KANSAS I 1 U EBSQ - E3 H Q A, QW M .. I I -1 9 f M In ,ffffx II I l I I M I O 'CHIQIZ-.5 ,',' N -. L S III f' N I 49 5 'Q ' L Q Q Q 5 ,?IIf 'T Q A I A I I M I Q Q f I:I I3 5 . X I QJ15? I E EI E 3 ' X, A ELF! ,- N ,'5?:'7,, I I XA X ' f'gf:qi-31,fFE 1150, fy I Sbsflfffx 3 -nw XI' 'I Iffffifl XQX Ill, II If If :A I A A ' 'I XIII' I I I ASQEILASJE3 II' XIII 9 I II ,f Q I II U4 ,fff 'IM' IQQ111 ZH ,Q-:Ig X Q JI UIQ X,,4f Q xxx :fr 1 Q U U .5 1 A IU H I 5 Wk ' Iam, 'A' I I f-- TO JUNCTION CITY .Q III , IIII I MAP UF I C NEIQIIIQAI. LII I ILEHEI THAININE IIANII' :wit .+I FORT RILEY KANSAS. N I DRAWN AT THE DIRECTION or ,Nr E g LT IIULW.N.I3I5PHAIVI,CCIIE1IVIANDINE.' f'PwIS,,N SURVEY BY ' CAPTAIN I'I.E.EI3I3ERS.I'I.RC., CAPTAIN D BERI'iMAN,I'IRC. P'l.O,T I: URALIF3?-Ix'I:l!lgI7F5UOM.F'T RILEY Kms SCALE I--I--J loo FEET I DRAWING BY LIEUT. Rf: BRINTNALL., MRC 1Qll1llO1QiOiOiOlOiO1O lliflililllilli ' 14 I I . I I I MEDICAL OFFICERS TRAINING CAMP I I V L, 'ii 1'i'?'i'3'i0i0iomE:5FmgKo1oioioi qboioioioiqqgn Q 6 O O- 9 fu , Q X I WU X 00 W ' IJ IEI 5 G I I Sim? E I I I 6 I mln I U 'W 5' l,lIlI: Ili Ii J Ig-.I cz.: I 1 ' :Q :EU U Q 'FQ ' U EI lg I.-L.-I 1- Iii Ii U' Z3 :I , U I ii ll :I l-.I IL.I I -I l U 'U 1:3 1 IZI D -----.N , I r:.:::i1U rirzlw, Fibfl IEE: :X I I IJ are-:MI I I 'M II X III ' XD. Ill :zu U I I - I I::::::::1 Af IIN WI I I II' I I W mmm mn I I I I I I I I I I g 1 E I I I I I I -I I I I I I I I I I I Igis I I I +I I I gi lim E....'il-.I :lil lil I I-----I i I 1-5 , . I V I H Qotoioioioioitioioioiloio1agp3.1,g,g I ' I5 I I . , ,ri I V ,X ', Xi? ,z Xi 3 ' 725:-ear-Qbi lflf, lx u x .- - . w 1 ' r HEADQUARTERS STAFF Koster COL. W. N. BISPHAM, M.C., U. S. Army Commanding Officer Sgt. lst Class Hans R. Gilbertson Sgt. lst Class Harry F. Ormsloy Sgt. lst Class Harry F. Maledy Sergeant Elmer L. Lawson Sergeant Elrie E. Turner Sergeant Lloyd I. Wallace MAJOR W. H. RICHARDSON, M.C., U. S. Army Adjutant MAJOR FREDERICK R. GREEN, M.R.C., Chicago, Ill. Assistant Adjutant LIEUT. R. E. WERLIOH, MC., Chicago, Ill. Assistant Adjutant Emil Asebrook Bernard C. Carlson james H. Elkin William L. Henry james QI. McCoy Milton B. Norman Edwin H. Schmitz LIEUT. LEROY -I. WPIEELER, M.R.C., Wakeeney, Kans. Assistant Adjutant NON-COMMISSIONED OFFICERS Sgt. lst Class Thomas Calvin Cleveland, O. Sgt. lst Class Rolla Hagmeyer Fowler, Ill. FRIVATES FIRST. Ada, Minn. Toledo, O. Salem, Mo. Tulare, Calif. National City, Ronan, Mont. Calif CLASS South Omaha, Nebr Clay Center, Kans. Waynesboro, Pa. Somers, Mont. Lincoln, Nebr. independence, Ia. Kansas City, Mo. . . ' I . ' ' I ' A YEAR BOOK EDITORIAL I STAFF 16 I MEDICAL OFFICEIQS TRAINING CAMP A ul. V A -- I 1 l l 'T 1 Fl - - ---- -- 0.80-UQQQQZQQOQO .-QU-.-U-.a.-.C.a.c,a.-Q FCRDT 1211,F,Y, KANSAS ffffisioryl of Tilrerl Uiiley v HILE Fernando DeSoto with his band of followers was struggling along the lower Mississippi in 1541, in an attempt to explore the interior of this country, an expedition from New Spain had made its way lift northward, and at its extreme Northern limit reached what is now the very center of the United States. l 1 .. This well organized army from New Spain was led bv Vasquez de Coronado in search of the m thic 1 lil, S: seven cities of Cibola in the land of Quivera. They were probably the first Europeans to sefl fortah Zig' in what is now Central Kansas, and the Camp of Coronado has been located by one authority at the 'unction of the Republican and Smok Hill Rivers. J Y Shortly after the Lewis and Clarke expedition had viewed Kansas from the Missouri River, an expedition under the command of Lieutenant Z. M. Pike, United States Army, was started through Kansas. He arrived at Pawnee Village September 25th, 1806, where he found the Spanish flag at the Council Lodge. He lowered it, and in its place raised the American flag. In june, 1842, Lieutenant C. Fremont camped for several days on the present site of junction City, which is four miles south of Fort Riley. lhe Santa Fe trail opened in 1824, stretched 400 miles of its way in Kansas territory and was for 40 years a great aid in the advance of civilization in this country. Authorities do not agree as to the exact date when Fort Riley was founded, though it was some tince in 1852. A circular issued by the United States Surgeon Generals ofhce in 1875 says it was established in the spring of 1852, and was at hrst known as Camp Center, it being very near the geographical center of the United States. Percival G. Love who was First Sergeant of Troop B, First Dragoons, at the time, says it was established late in the fall of 1852, and this would be indicated by the fact that on july 31st, 1852, Colonel T. T. Fauntleroy, Commanding Ofhcer at Ft. Leavenworth, wrote the Quartermaster General of the United States Army, recon'n'ending the establishntent of a Military Post at or near the junction of the Republican and Snfoky Hill Rivers. Major E. A. Ogden, the Quar- termaster at Ft. Leavenworth, left that post in October, 1852, under orders to select the site for the new post. Major R. l-1. Chilton with Troop B, First Dragoons,escorted Major Ogden from Ft. Leavenworth to the junction of the two rivers where Camp Center was established. On May 17th, 1853, the name was changed to Fort Riley in honor of General Bennett C. Riley of the United States Army, who guarded the Sante Fe Trail and fought in the war with Mexico. ' Temporary quarters were erected during the years 1853 and 1854, and in December, 1854, Congress made appropria- tion for quarters and stables for five troops of cavalry. Buildings were to be built of stone, taken from the quarries in the vicinity. Major Ogden was placed in charge of the work and shipments Of building material were received at Ft. Leaven- worth by boat, and were hauled to Fort Riley by wagon. The post was built around a parallelogram 553 x 606 feet, with six two story buildings. The officers quarters consisted of six two story buildings, each 40 x60 feet. One of these was for the commanding officer and the other five each contained two sets of quarters. As the post grew, other buildings were added, including a stone hospital, ordnance building, five stables, a brick magazine and a two story guard house. lt was just at the beginning of the construction work in August, 1855, that an epidemic of cholera broke out in the Camp, and before its ravages ceased, had exacted a toll of upward of 100 lives, including that of Major Ogden. The epidemic was stamped out and the construction continued. Major Ogden was buried on a hill overlooking the Post but his body was lat.er disinterred, and taken to Unadilla, N. Y. The monument erected on this hill to his memory islsaid to mark the geographical center of the United States. The reservation as at first established included a large tract of land along the left bank of the Kansas and Republican Rivers, extending across the latter to Smoky Hill. On March 2nd, 1867, Congress reduced the size of the reservation by releasing that portion lying between the Republican and Smoky Hill Rivers. This portion was given to the State of Kansas to aid in the construction of a bridge Over the Republican River, on the highway leading to the Fort, with the understanding that the State was to keep the bridge in good repair, and that the United States should have the use of it for all time to come. This reduced size of the reservation about 4,000 acres. The territory of Kansas was organized under date of May 30th, 1854, andthe capitol was located in the town of Pawnee, which is now a part of the Reservation. One acre, on which is located the walls of the old territorial capitol was turned over to the State of Kansas, by the Secretary of War, under authority of act of Congress dated February 26 1908, and the building was repaired for preservation by the Kansas State Historical Society. The first Kansas Legislature met there on july 2nd, 1855, remaining in session only a few days, when it adjourned to Shawnee Mission near Kansas City, Missouri. ' General P. H. Sheridan appointed General-in-Chief of the United States Arm in 1883, recomm - ment of the Post, and in 1886 the Kansas Legislature adopted a resolution requirinig Senators and Reprggglagrltiixs clhlgggg- gress from that State to use their power and influence to secure an appropriation to carry out the ideas of the Gene,-a1-in Chief of the Army. ln 1887 an appropriation was made by Congress for the purpose of establishing a permanent scho 1 of instruction for drill and practice for the cavalry and light artillery service in the Army of the United States and wh' ch shall be the depot to which all recruits for such service shall be sentg and for the purpose of construction of such uart lc barracks and stables as may be required to carry into effect the purposes of this Act. q ers' This appropriation marked the beginning of a series of improvements which amounted ract' 4 - ' - of the Post. Appropriations followed in 1896, 1900 and by the Act of April 23rd, 1904, th? SLl1TlC?3TyS4l-18 1101800 livuagdang propriated for a modern military hospital. The following year, an appropriation was made for a road through the reselfz vation. ' 1 .The Camp of Instruction and M' 'ary Manuevers at Fort Rile in recent ears has iven th ' able reputation in military circles. 'l..c Medical Ofhcers' TrainingyCamp estabblished ingjune, F9lT7n.griwmS?1Elre1S ialacfqrd bounds, quickly outgrowing quarters in the main post, consisting of a school building and barracks, facing the aiftiller parade, and one small room to the left of the main entrance of the one story building directly east ,of the head uarterbg building of the Old Post, which served as headquarters for the Commanding Officer. Upon the expansion of th? Cam newly constructed quarters were taken over north of the Golden Belt Highway and with continued increase in number? the summer quarters of the 16th, 20th and 21st troops of cavalry became a part of the Medical Camp. ' 1616161010 iii Oioioioioioioinioioiod ' 17 , W, g MMEDICAL orlmcglzs'ri2A1N1Nc.s CAMD ,,. . 7 Y -f - Y Y ' ig-' ,- . ' .,., ii.. .TT ilvi. , ,, ,...t.-,guhJI1..r,-- J-Jllllfv ' Dfw 731 OMC MO M0 M I ll iii!MOQOQOHOQHOMOHCQOHIMOQOIMIMIMIMIUIHD 0910 SENIOR INSTRUCTOR : ASS'T INSTRUCTOR: SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: SENIOR INSTRUCTOR : ASS'T INSTRUCTORS: ADJUTANT: ASS'T ADjUTANTS: SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: ASS'T EXAMINERS: SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: SENIOR INSTRUCTOR : ASS'T INSTRUCTORS: SENIOR INSTRUCTOR : ASS'T IN STRUCTORS 1 SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: I 'O IJT IPII .I CY, IQANSAS 'llnstructors' Koster Lieut. Col. H. F. Pipes, MC. Lieut. F. R. Holbrook, MRC. Major H. C. Pillsbury, MC. Major H. W. Stuckey, MRC. Major M. A. Axline, MRC. Captain W. T. Clark, MRC. Captain R .M. Stephenson, MRC. Captain j. D. Peters, MRC. Captain W. A. Howard, MRC. Lieut. A. W. Smith, MC. Lieut. L. P. Bell, MC. Lieut. F. A. Plum, MC. Major Howard MCC. Snyder, MC Major W. N. Kenzie, MRC. Major j. T. McDavid, MRC. Captain F. B. Nather, MRC. Lieut. O. B. Mallow, MRC. Major W. H. Richardson, MC. Major F. R. Cvreen, MRC. Lieut. R. E. Werlich, MC. Lieut. L. j. Wheeler, MRC. Major G. W. Cook, MC. Major W. L. McBride, MRC. Lieut. M. K. Lindsay, MC. Lieut. V. R. Abraham, MRC. Lieut. E. H. Morgan, MRC. Lieut. O. B. Mallow, MRC. Major R. W. Webster, MRC. Major E. K. Kerr, MRC. Major W. L. McBride, MRC. Major L. S. Hughes, MC. Major C. S. Williamson, MRC. Major H. E. Eggers, MRC. Major Paul B. Cook, MRC. Lieut. W. W. Pretts, MRC. Major Tenney Lieut. Schmalhust Major T. j. Flynn, MC. Major R. W. Webster, MRC. Major j. G. Sessions, MRC. Major R. E. Hathaway, MRC. Major M. H. Krebs, MRC. Major F. H. Dammasch, MRC Major J. j. Reddy, MC. Major R. W. Webster, MRC. Major J. M. Downs, MRC. Major F. I-I. Dammasch, MRC Major W. N. Kenzie, MRC. Captain j. R. Wetherbee,MRC Lieut. L. P. Bell, MC. Major K. W. Kinard, MC. Major j. MT Downs, MRC. Captain j. R. Wetherbee, MRC Lieut. Stark Lieut. Parsons Major j. P. Lord, MRC. Major N. P. Breed, MRC. Lieut. C. E. Brain, MRC. Lieut. H. C. Schott SENIOR INSTRUCTOR : ASS'T INSTRUCTORS: SENIOR INSTRUCTOR ASS'T INSTRUCTORS: SENIOR INSTRUCTOR SENIOR INSTRUCTOR ASS'T INSTRUCTORS: SENIOR INSTRUCTOR: CAMP SURCEON: ASS'T SURCEONS: SENIOR INSTRUCTOR. ASS'T INSTRUCTOR: Major E. K. Kerr, MRC. Major H. E. Eggers, MRC. Major j. T. McDavid, MRC. Major F. H. Damrrasch, MRC Captain H. H. Harrington. Lieut. j. E. Boland, MC. Lieut. j. W. Boren, MRC. Lieut. H. H. Culbertson, MRC Lieut. H. R. Reynold, MRC. Lieut. E. S. Knox, MRC. Lieut. M. A. McCarty, MC. Lieut. Webb 1 :Major j. M. Downs, MRC. Major Morrill Captain H. Meredith Lieut. C. A. Meyer Lieut. H. H. Slocumb Lieut. F. j. Woodhead Lieut. W. B. Mayo Lieut. H. G. Mertens Major W. L. McBride, MRC. Major H. C. Parker, MRC. Major j. G. Sessions ,MRC. Lieut. Halley Capt. Clarence Van Epps, MRC Captain A. M. Farrell, MRC. Capt. Clarence Van Epps, MRC Captain Bew Lieut. Morris Lieut. Strauss Captain E. C. Claeren, QMRC Lieut. W. E. Draper, MRC. CAMP QUARTERMASTER: Captain P. B. johnson, QMRC ASS'T QUARTERMASTER: ' SENIOR INSTRUCTOR : ASS'T INSTRUCTORS: SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: SENIOR INSTRUCTOR: ASS'T INSTRUCTORS: SENIOR INSTRUCTOR: ASS'T INSTRUCTOR: Captain B. I. Wyatt, MRC. Lieut. L. A. LaGarde, MC. Lieut. F. j. Whittaker, MRC. Lieut. P. E. Kenyon, MRC. Lieut. Coates Lieut. Hayes Major H. T. Lay, MRC. Major R. W. Webster, MRC. Major F. A. Pittinger, MRC. Major F. H. Dammasch, MRC Major j. G. Sessions, MRC. Captain C. F. Stough, MRC. Lieut. C. j. Ouellette, MRC. Lieut. W. L. Nelson, MRC. Lieut. H. L. Youtz, MRC. Lieut. H. Binet, MRC. Lieut. C. J. johannessen, MRC Lieut. Carl Voss, MRC. Lieut. F. j. Moffatt, MRC. Major E. Eliot, jr., MRC. Major H. E. Eggers, MRC. I Lieut. R. A. Brintnall, MRC. Lieut. Norten. Major F. H. Dammasch, MRC Lieut. D. S. Numbers, MRC. MOQIC-Ojl -lilwliiillilliiiillliiil 79 S v :wfwMzm ,X , .. ', -V xx we H ------ 'wyft , :Q X Q 'X , ,f-gthx ' Xf+ XX f xx,-2' f', - 2 'X 53' 4 21 Mf.ilfJlC.Al. OFYFICZILYZS 'IDAINING CAMP ,f-1-H-f--,:f.,f-,f-4, W, f H r v ,V-W-' y ' -f- ' 'A' ' ' ' ' M ' W 'fi' y ' Dliilllliilllul IiQ llOllQQQlQC1liOQlQOa.ilQCQl-WO l UI2T l2lL.liY, KANSAS MEDICAL OFFICERS' TRAINING CAMP, FORT RILEY, KANSAS Slubent Cfficers X 6 ARLY in June of the memorable year 1917, there began to descend upon a government reser- WWW vation in Kansas, from every point of the compass, a collection of physicians, of which the counterpart has never before been seen: long ones, short ones, thick ones, thin QU 1 ones, some gray and grizzled, some with Van Dykes, some with unused razors. Some had never seen a fort nor heard a mess callg some had never seen a maneuver nor a pay patient. ' i There were doctors from the North with sturdy determination and ear muffs1 doctors from the East with patriotic vocabularies and conceits: doctors from the West with loyal enthusiasm and braggadocio: and doctors from the South whose patriotic personalities actually breathed of strength. Following these, came the enlisted force of the Medical Department, some few veterans, but mostly smooth-faced, bright-eyed boys, eager, curious, responsive, anxious to learn, quick to perceive, always hungry: men from office, farm and factory: college graduate and l. W. W.-all enthusiastic and only asking to be told what to do to show their fidelity to their beloved country, It is to chronicle some of the incidents of the systematic training of this heterogeneous assemblage of masculine humanity, that this little souvenir book is compiled. To some, unacquainted with conditions, it will mean nothing, to some it will recall many joyous reunions and new formed friendships: to some it will cause many bitter regrets. Because here, in this naturally formed defense, this picturesque valley, where the Republican and the Smoky join to form the Kaw, have occurred events of human interest, dear gnlthe memories and to the hearts of every one of all the hundreds who have passed the portals of Rigorous 1 ey. In the perusal of these pages, remember that the training camp had no birthdays. We were all only boys, with a boy's hopes, and love of adventure, from the sixteen year old casual, who crowed over his companions when he had awkwardly and clumsily attached a button to his khaki, to the bewhiskered and dignified University professor, who chuckled with satisfaction and conceit when he discovered and ex- emplified the important fact that the best way to launder underwear was to wash it in situ: from the corps man, whose frequent assignment to sidewalk and trench duty inclined him to the belief that the insigna HM. D. on his uniform meant Mud Digger, to the eminent surgeon who ponderously and pain- fully concluded that soap was the best remedy for the frequent and free loving chigger. As we write, we recall many strong individualities of honest convictions and earnest desires. A few with strange conceptions and frailties, but all imbued with the same patriotic purposes. Musing thus we can but wonder where will be the members of these different organizations in the years to come, when democracy and humanity shall have triumphed over studied and treacherous schreklichkeit and the principles for which we serve are firmly established. The great majority will have returned to their former practices and occupations. Some, in whom a love of fighting has been instilled by their war experiences, will remain in the army, or get married. Some will be famous, some will be divorced, some would like to be. gc -3-1 ix 'ff si: U sf: 6 NNWI AW, H D 4: Y if ' Eiliifllbdillll.-.QQ-.QOlCnOmQQOQm warm i..,.'ma-svqmunwrvlrwlmlliilnn-f 22 ' A ' MEDICAL OFFICERS' TRAINING CAMP, FORT RILEY, KANSAS ' Others there are to whom these pages will be both a greeting and a farewell. for when such a body of men of all.temperaments and trainings was abruptly plunged intoua whirling maelstrom of activities so entirely foreign to all their well conceived ideas of life and education, it was inevitable that some few would never raise their heads above the flood. Thus, when the confusion and uncertainty of the first few weeks clarified, a few from every organization left, some from ill health or constitutional defects, some by per- mission and some by request. Some hesitated between the cruelties of war and the sneers of their wives' relatives. Others vacillated between barbarous brutality and the ' Benzine Board. But of all the hundreds in the entire Department. only a negligible number actually deserted. I Then there will be those. at remembrance of whom, our heads will bow and our visions dim. Alas. already the dark shadow of the grim spectre has touched here and there, and the plaintive tone of the bugle. blending with the mystic music of eternal Taps has beckoned their patriot souls to that mys- terious shore where waits the silent boatman. Their tasks were unfinished, but God knows they tried. Our hopes were theirs and they dreamed our dreams. but for them never one came true. So we send out this little book upon its mission. In years to come may it bring back to us shadows long since but memories. Memories of the Organizations with their eager personnel: of the Reserve, awkward but persistent: of the Instructors, with their carefully concealed ignorance: of the M. C. Regu- lays, impressive and deeply impressed with their knowledge of things military. and of the quiet, de- termined. forceful character whose everywhere presence commanded efficiency. whose consumate grasp on details forbade negligence and whose energetic personality dominated all instruction. At one perigd his persistent faith alone held the location. I-Iis knowledge of human nature. his wisdom. tact, and unfailing optimism, not only made the camp a success and established its supremacy, but won and held the deep admiration and loyal devotion of the men of his command. It is a great game and we love it. Future peoples may see a greater, but none should miss his share in this. Varsity. scrub, or substitute, we have been ready and willing to carry the ball or coach the players. Oh, yes. there has been adverse criticism: castles of gloom have been erected only to be razed by intelligent accomplishment. Let none who may be amused at the lightness of these pages, conclude there may have been any underestimation of the mammoth task allotted. We know that thousands of our strongest and best manhood must unHinchingly face engines of mutilation and destruction, so effective and so terrible that one can well conceive diabolical ingenuity in their construction. The formation of a Medical Department to adequately care for so immense an army as is necessary. might well Stagger the most capable and efficient officers and students of the art of war. But could all see the well formu- lated plans: the carefully drawn calculations: the many times threshed over methods: the massing of resources: the grasping of benefits from allied experiences, then would they realize that the Medical Department is playing the game, hitting the line. and advancing the ball. Adverse criticism. yes, from outsiders, slackers and failures. It is no disgrace to enter the game and fail: the disgrace lies in not entering at all, or, having entered. in blaming the game for the failure. The humiliating part, the dis- couraging part. the pitiful part of it all is that one can enter one of these camps: take the training' be thrown in contact with this splendid spirit of patriotic devotion and sacrifice and yet never coml prehend not grasp the soul of the reason why the stupendous effort is made. l-Ie has lost-no, he has never known, the divine inspiration of the magnificent sacrifice. . 23 g MEDICAL OFFICERS TRAINING CAMP uioxnznioisioxoioioisioisioJoioioiaioioioioioinili' FORT RILEY, KANSAS Major Major Major Major Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut Lieut. Lieut. Lieut. Davis, George G. Webster, R. W. Milne, L. S. Dammasch, F. I-I. Stough, C. F. Abraham, V. R. . Alden, B. F. Clark, W. T. Ffoulkes, B. Harvey, B. C. H. jones, W. A. Kerr, E. K. Nicholl, H. K. Royer, J. E. Southworth, H. T. Von Zelinski, W. F. . Bartlett, J. D. Bell, L. P. . Brown, K. T. Condit, J. D. R STUDENT MEDICAL OFFICERS COMPANY NO. 1 5i:0SlfQI' Chicago, lll. Chicago, Ill. Kansas City, Mo. Portland, Oregon Colorado Spgs., Colo Hood River, Oregon San Francisco, Calif. Ft. Atchison, Wis. San Francisco, Calif. Chicago, lll. Riverside, Calif. Oak Park, Ill. Chicago, Ill. Chicago, Ill. Prescott, Ariz. Chicago, Ill. Grass Range, Mont. Monroe City, Mo. Indianapolis, Ind. Pasadena, Calif. IOlliOlD1Q1OlOiOiO1Qi ll 24 f l MEDICAL OFFICERS TRAINING CAMP ' I Z,fm9i9io1o1oio3q1.lg ' oioioazhoioioioiogoioidi I ' FORT RILEY, KANSAS V K , , . 3 ii . 2 1 i I I Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut , Lieut , Lieut l, Lieut , Lieut Lieut . Lieut I Lieut l Lieut Lieut Lieut Lieut l F 3 r Cook, E. F. . Davies, R. H. Dowdell, R. J. Hecker, R. H. Howell, E. H. Keller, D. H. Lyons, A. J. Parmenter, E. L Roblee, L. H. Sauer, P. K. Smith, A. W. Smith, D. O. Smith, F. J. Sprague, F. Nl. Sprowl, F. G. Steele, J. B. Stoltz, H. R. Wittaker, F. J. Wilking, S. V. Workman, W. G STUDENT MEDICAL OFFICERS, COMPANY No. 1 Koster St. Joseph, Mo. Chicago, Ill. San Francisco, Calif. Kansas City, Mo. San Francisco, Calif. Anna, Ill. Chicago, lll. Mondovi, Wis. Chicago, lll. El Paso, Texas Pasadena, Calif. Kansas City, Mo. San Diego, Calif. Pocatello, Idaho Spokane, Wash. Chattanooga, Tenn. Stanford Univ., Calif Spokane, Wash. I Butte, Mont. Tracy, Minn. , 70101010 fQlQlQO1Ql ug. '25 MEDICAL oiffmcarzs TIZAINING CAMP , A , Major Major Major Major Major Major Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut Lie-ut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. STUDENT MEDICAI. OFFICERS, COMPANY NO. 2 Downs, Jirah M. Farrell, A. M. . Hathaway, Robert E. . . Parker, Harry C. . Pretts, W. W. . Sessions, John C. . Williamson, Charles S. . . Barker, F. M. . Bland, Curtis . Burlew, Jesse H. . Doole, T. P. . Garwood, Harold G. Glyer, R. T. . Moore, H. M. . Neumarker, Wm. R. Sights, W. P. . Staley, J. C. . Thornton, J. W. . Wyatt, B. I.. Atkinson, Curtis . Beall, H. . Blachly, A. T. Bowles, E. W. Bordie, W. D. Broman, O. F. Chilton, L. W. . Copeland, W. C. . Dieckman, W. C. Eaton, C. E. . Gaffney, E. C. . Gatewood, L. C. . Gibson, A. C. . Hall, W. L. . . Hawley, N. J. 'N . Hengster, W. H. . l-Iillis, S. J. . Howard, P. R. Los Angeles, Calif. Two Rivers, Wis. Glendive, Mont. Dubuque, Iowa Platteville, Wis. Minneapolis, Minn. Chicago, Ill. Washington, D. C. Preston, Idaho Santa Anna, Calif. Eagle Lake, Texas Denver, Colo. Brooten, Minn. St. Louis, Mo. Columbus, Nebr. St. Paul, Minn. Ackley, Iowa Chicago, Ill. Fort Collins, Colo. Malden, Mo. Portland, Oregon Ottumwa, Iowa Greeley, Colo. Idaho Falls, Idaho Hotchkiss, Colo. Dexter, Mo. Seattle, Wash. Lincoln, Ill. Chicago, Ill. San Francisco, Calif Greenville, lll. St. Louis, Mo. Minneapolis, Minn. Berthold, N. D. North Bend, Nebr. ml1l,QlllQOiOilillililliiliii 010101 MEDICAL, QIVHCEIQS 'I'I2AlNlNG QAMIJ gggg ZMOMOMUMUMUMi.l0MOMOMOMOMOMO-OMOMOMOMOMOQOMOQOM If O IZT IZILEY, KAN SAS Lieut Lieut Lieut Lieut .Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut S'rUnEN'1' MEDICAI. OFFICERS, COMPANY No. 2 Howard, W. S. Howard, W. A. Jones, W. W. Johnson, J. W. Lewis, W. J.. McClure, W. L. McKeon, J. O. Milne, L. A. Mook, H. M. Newell, R. I. Owens, M. J. Parker, Edward Pennock, W. J. Petter, J. D. Powell, B. V. Proctor, F. L. Puffer, M. L. Redfield, W. J. Reedy, P. G. Richards, C. A. Rider, A. S. Robinson, H. H Sampson, W. A. . Smith, E. H. Smith, W. C. Stephenson, R. M. Snyder, G. W. Swezy, C. E. Thacher, G. I. Van Buren, F. A Van Doren, F. Werlich, R. E., Wheeler, I-I. E. Wilkinson, J. C., . Winter, F. E. Wright, H. W. Young, R. C. Koster Anoka, Minn. Cherokee, Iowa Denver, Colo. Hayti, Mo. Ventura, Calif. ' North Yakima, Wash. Montgomery, Minn. Lawton, Okla. A St. Louis, Mo. Spokane, Wash. Kansas City, Mo. Ida Grove, Iowa Spokane, Wash. Arcadia, Kans. Camden, Ark. Chicago, Ill. Downers Grove, Ill. Grand Island, Nebr. Port Yates, N. D. Rhinelander, Wis. Flandreau, S. D. Creston, Wash. San Francisco, Calif. Seattle, Wash. Salem, Oregon Lexington, Miss. Belle Plaine, Minn. Winnemucca, Nev. Waterville, Kans. Omaha, Nebr. Seaside, Oregon Chicago, Ill. Spokane, Wash. Red Lake Falls, Minn Santa Anna, Calif. Enterprise, Kans. Arkansas City, Kans. 301010101oioioioioiocsuxocnoanousouaonnoanaqn 27 MIiLJlCAl, Olt l lLQll:.iI2S i'l'l2AlNlNLZ CAMP ' M, M OMOMIMOMOMOMOMOMOQ I 5-OSCHOMOMOMIQOMOQOQIQIQOQO Major Major gapt. apt. Capt. gapt. .apt. gapt. ,apt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Cook, Paul B. Herrick, Harold C. Akins, Henry L. Alexander, Robert D. Andrews, Henry S. Butler, John Clements, Stanley C. Fricke, A. A. Lambert, Samuel E. McAllister, F. J. McBride, William L. Meade, Reginald Reynolds, H. B. Rockey, Paul Shewbrooks, D. M. Syman, Louis L. Vankirk, Frank W. Wilhelmy, A. F. Williams, Curtis C. Anderson, Edward T. Adams, Samuel Ayres, Treston R. Abramopoulos, Christ Applewhite, Lee D. Beckemeyer, W. A. Bickford, H. G. FOIYT RILEY. KANSAS Stubent mebical Officers. Company Flo. 3 os A. Blankenship, Elmer P. Borden, F. R. Breuer, W. H. Brown, A. K. Buck, George H. Bundrant, William C. Bancroft, George W. Bremser, Harry L. Berkman, David M. Close, John B. Conley, J. M. Dargan, C. M. Dorset, Bernard C. Daniels, Jared W. Edison, S. M. Eggers, H. E. Ellis, E. K. Ellis, Frank G. Edward, George Everett, Ernest D. Fox, Sylvester D. Frank, W. W. Freeman, Horatio P. Fulliam, Edmond B. Koster St. Paul, Minn. St. Louis, Mo. Omaha, Nebr. St. Louis, Mo. Minden, Mo. Minneapolis, Minn. Neligh, Nebr. Omaha, Nebr. Spokane, Wash. Hawarden, Iowa Kansas City, Mo. Kansas City, Mo. Palo Alto, Calif. Oswego, Oregon I Minneapolis, Minn. Springfield, Ohio Janesville, Wis. Decatur, lll. Niles, Ohio Platte, So. Dak. Lansing, Kans. St. Louis, Mo. Kansas City, Mo. East St. Louis, Ill. Sedalia, Mo. Minnesota Lake, Minn Houston, Mo. Plainfield, Wis. St. James, Mo. Chicago, Ill. Portland, Oregon Lawrenceburg, Tenn. Colorado Springs, Colo. St. Louis, Mo. Rochester, Minn. Mission, Texas Oshkosh, Wis. Pontiac, Ill. Denver, Colo. St. Peter, Minn. Chicago, Ill. Omaha, Nebr. Murphreesboro, Ill. Ellsworth, Kans. Bruce, S. D. Lakeview, Oregon St. Louis, Mo. Glenwood Sprs., Colo. Q Muscatine, Iowa. Lieut Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieur Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Garlinghouse, O. L. Gilbert, G. R. Guittard, Virgil D. Gullion, Wilber T. Gist, Emory H. Gilfillan, Bruce L. , Hendricks, W. W. Hooper, Clifford Hill, William H. Howard, William F. Harney, Louis G. Huene, H. J. Hynes, Joseph C. Irwin, J. H. Janney, James G. Johnson, A. A. Johnson, Czar C. Knox, Thomas B. Keizer, Philip J. Kent, W. C. King, H. E. Koefoot, T. H. Kinnison, Clyde R. King, Emil 'Leuders, A. H. Livingston, Joseph W. . Long, Ross D. Loring, Fred W. Lagarde, Louis,A. Larue, Hosper McCosker, Charles F. McClean, Earl D. McCool, Stanton A. McDavid, J. T. McFaul, W. D. Manson, Frank M. Murrah, F. C. O'Neal, Charles E. Price, Carroll P. Provost, Addison J. Rew, Albert W. Stryker, Ralph H. Smith, Albert S. J. Turner, Dolos A. Strong, Thomas J. Tull, Guy A. Toney, Lee E. Thomas, Gilbert J. Walsh, James L. Walton, James C. MMOMOQOMJCQOMOMMOMOMOI, Iola, Kans. Omaha, Nebr. Cloquet, Minn. Eugene, Oregon Beattie, Kans. Keokuk, Iowa Bardolph, lll. No. Platte, Nebr. Kansas City, Mo. Pocatello, Idaho St. Louis, Mo. Forsythe, Mont. St. Louis, Mo. Great Falls, Mont. Lawton, Okla. Omaha, Nebr. Lincoln, Nebr. Quincy, lll. North Bend, Ore. Denver, Colo. Belgrade, Nebr. Columbus, Nebr. St. Joseph, Mo. Fulda, Minn. Chicago, Ill. Valley City, N. D. Oklahoma City, Okla Butte, Mont. Washington, D. C. Kansas City, IMO. Minneapolis, Minn. Oskaloosa, Iowa Neosho Falls, Kans. Decatur, Ill. Miles, Iowa Worthington, Minn. Herrin, Ill. Hope, Kans. Harrodsburg, Ky. Oshkosh, Wis. Ft. Collins, Colo. Ridgfield, Wash. St. Joseph, Mo. Goldfield, Nev. Williston, N. D. Kansas City, Mo. Piedmont, Mo. Minneapolis, Minn. Iron River, Mich. Isabel, S. D. Major Houck, George Lieut. Erskine, Earl B. Wayne, Nelar. MEDICAL OFFICERS TI2AINING CIAIVIID J 510111010isioloioggiqiojoioimzzioioioioisrioio10 Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Liedloff, Adolph G. Belshe, George W. Blumenthal, Robert W. Byrne, John G. Durrant, James A. Earwood, Edgar R. Gammon, Clarence P. Graebner, Herbert Lewellen, Charles P. Macrae, James G. Schaefer, Samuel Siever, Charles M. Vincil, Frank H. Watkins, William C. Andreas, John H. Alford, Joseph S. Barnes, Ralph E. Beeler, George W. Boyden. Wesley L. Bradfield, Samuel J. Broyles, Glen H. Bryson, Roy D. Capps, John F. Christiansen, James Cruzen, Roy E. Ericksen, Hans C. FO DT TZILEY, 'KAN SAS Slubent mebtcal Officers, Company lilo. 5 Koster Mankato, Minn. Trenton, Mo. Milwaukee, Wis. Spokane, Wash. Snohomish, Wash. Lohrville, Iowa Tacoma, Wash. Milwaukee, Wis. Louisiana, Mo. Creston, Iowa Winona, Minn. Manhattan, Kans. Rosebury, Oregon Oconto, Wis. Bloomsburg, Pa. Independence, Kans. Lawrence, Kans. Seattle, Wash. Seymour, Wis. Bartlesville, Okla. Bethany, Mo. Calloway, Nebr. Tulsa, Okla. Sioux City, Iowa Minneapolis, Minn. Stanley, Wis. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Frear, Charles E. Hanley, W. J. Hawke, Charles C. Hibberd, Delbert L. Hunt, Gerald C. Jansen, Frederick, l. Jellison, Robert T. Jones, Harold H. Kas, Thomas D. Lindsay, Merrill K. Mackedon, Thomas E. Mattison, George, Jr. Mraz, John Z. Noice, Russell R. Parsens, Carroll D. Raiter, Franklin W. S Rosenwald, John P. Reed, Howard L. Sargeant, Harry W. Schirk, Irving E. Schroder, Peter H. Schubert, Frank J. Stuart, Albert B. Swift, Frederick J. Van Scoyoc, Guy Wenger, Oliver C. Sioux City, Iowa Milwaukee, Wis. Winfield, Kans. Kearney, Nebr. Des Moines, Iowa Salt Lake City, Utah Bellville, Kans. Winheld, Kans. Sutherland, Iowa Topeka, Kans. Milwaukee, Wis. Akron, Iowa Oklahoma, City Okla Minneapolis, Minn. Vincent, Iowa Cloquet, Minn. Minneapolis, Minn. Oklahoma City, Okla Wauwatosa, Wis. Rhinelander, Wis. Davenport, Iowa Milwaukee, Wis. Des Moines, Iowa Maquoketa, Iowa Oak Hill, Kans. St. Louis, Mo. MEDICAI Ol4'lfKQ1l:1l3S'l'll?AlNING CAMP , www mn V W W,-W ,V V ,U YW Y J Y Y Y , M- -T-..---me----I'---.L v YY..-Y--ev--e--'--- K: OWOQOQOQCWQQQCQQSQ-OH.-..m.,.Q.-QQ.mm.-O-Qm. l'OlJ'l' Ull .l CY, KANSAS Major Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Ravenel, Mazyck P. White, -Jonas S. Ashcroft, Felix E. Cline, Harry Clark, Chester H. Gossow, August A. lrones, Rutherford B Luckie, Lorenzo F. Noyas, Guy L. Pargen, joseph A. Pontius, Nevin D. Powell, Isaac W. Pratt, Chelsa C. Simpson, Austin A. Sprague, Fred F. Sweeney, john S. Woltman, Henry C. Allen, Lloyd R. Allen, Robert A. Bacon, Harry P. Bane, William M. Barnes, Carlisle L. Bates, Bret V. Beebee, joseph A. Berry, john W. Bjerken, Frederick N. Bogard, Edward Bowers, Albert G. Box, Ernest M. Brimi, Carl L. Brooks, Samuel G. Brown, Leonidas T. Brown, Paul F. Bursheim, Peter J. STUDENT MEDICAL OFFICERS, COMPANY NO. fl Koster Columbia, Mo. St. Paul, Minn. Deadwood, S. D. Burbank, Calif. Duluth, Minn. St. Charles, Mo. San Diego, Calif. Los Angeles, Calif. Columbus, Mo. Portland, Oregon Seattle, Wash. Bellingham, Wash. Mankato, Minn. Seattle, Wash. Los Banos, Calif. Chicago, Ill. jacksonville, Ill. Colorado Spgs., Colo. Tacoma, Wash. Milaca, Minn. Denver, Colo. Chicago, Ill. Wheaton, Minn. Kansas City, Kans. Cape Girardeau, Mo. Red Wing, Minn. Lnflbourne, Mo. Salt Lake City, Utah Springfield, Mo. Cooperstown, N. D. Anacortes, Wash. Spearville, Kans. Minneapolis, Minn. Lake Benton, Minn. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Campbell, Daniel R. Coffey, Grundy Cole, Charles W. Coleman, Harry M. Connell, Evan S. Crank, Alexander C. Davenport, Albert E. Dunn, john E. Edwards, Ernest G. Fields, Albert. Field, Louis M. Fiksdal, Mads J. Filmer, Burnett A. Finnoff, Wm. C. Forsythe, Samuel T. Fowler, Lorin L. Fritchen, Arthur F. Freeman Will L. Furman, Francis S. Gjellum, Arthur B. Glover, Cosmos A. Golden, Thomas V. Gordon, Frank N. Grant, Daniel Grove, Everett F. Green, Thomas S. Griffith, Edgar M. . Narrington, Walter W. Harrison, Alfred W. Heagerty, William B. Heibner, Eugene A. Henman, George W. Hickey, Frederick R. Hiller, Frank B. Thorp, Wash. Platte City, Mo. Norton, Kans. Barron, Wis. Kansas City, Mo. Canton, Mo. Oklahoma City, Okla Groton, S. D. La junta, Colo. Bement, Ill. Aberdeen, S. D. Webster, S. D. Colorado Spgs., Colo. Denver, Colo. Canonsbury, Pa. Marion, Ill. Franksville, Wis. St. Charles, Mo. Shreveport, La. Del Norte, Colo. San Francisco, Calif. Creston, Iowa St. Louis, Mo. Portland, Oregon Minneapolis, Minn. Chicago, Ill. Creighton, Mo. Kansas City, Mo. Warrensburg, Mo. Mazeppa, Minn. Sedalia, Mo. St. Louis, Mo. Chanute, Kans. Kansas City, Mo. Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Hobson, Abraham D. Hoffman, William L. Hopkins, Charles B. Howe, Theodore Cv. Huffman, Kenneth B. Ingram, jesse W. Insley, Herbert W. Irwin, Harry C. -Jacobson, Guy H. jenkins, Charles E. Kane, Edward J. Kenyon, Paul R. King, Oran W. Knox, John F. Lang, Corvus C. Lares, Bert V. Lasche, Percival C. LaVake, Rae T. Laws, Clement E. Leahy, Thomas M. Lewis,'Arthur j. Lewis, Paul j. Leyda, james H. Lower, Frank S. Lumley, Zoda D. Lunt, Lawrence K. Lutman, Harry N. Lynch, john C. McCall, Otis S. McGuire, john W. Middleton, William D. Mielke, Charles H. Miller, George C. STUDENT MEDICAL OFFICERS, COMPANY NO. 4 Koster Richmond, Ohio Cilbert, Iowa Kansas City, Mo. San Francisco, Calif. Bentonville, Ark. Spokane, Wash. Rich Hill, Mo. Adel, Iowa Wayne City, Ill. Brookfield, Mo. Portland, Oregon Wadena, Minn. Montezuma, Iowa Almira, Wash. Altoona, Iowa Delano, Minn. Richland Centre, Wis. Minneapolis, Minn. Chicago, Ill. Chicago, Ill. Council Grove, Kans. Bloomington, Wis. Frederick, Colo. Chicago, Ill. Kampaville, Ill. Colorado Spgs., Colo. Versailles, Mo. Kansas City, Mo. Rocky Comfort, Mo. Chicago, lll. St. Paul, Minn. Alma, Kans. St. Marys ,Kans. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Montgomery, Charles Nachtwey, Aloysius Nather, Frederick B. Newman, Richard J. Norman, William C. Palmer, Dowin L. Palmer, William R. Phares, Williard A. Posey, Ernest L. Powers, Charles E. Powers, james W. Pryse, Roscoe C. Ransom, Mathias L. Rice, William P. Roberts, William H. Rogers, Fordyce B. Salisbury, Walter N. Schmidt, George F. Small, Walter L. Smythe, Hudson Teachenor, Frank R. Thorpe, john N. Thurlow, Ralph M. Tucker, james A. Turner, Floyd C. Valentine, Herbert S. Van Kirk, john A. Van Meter, Eugene R. Wade, john C. Wallingsford, Charles C. Wetherbee, joseph R. Whalen, Walter F.. Whisenant, john R. Clyde, Kans. Dickinson, N. D. Spokane, Wash. Oakland, Calif. Cherryvale, Kans. Portland, Oregon Kansas City, Kans. Wichita, Kans. Magee, Miss. Rockwell, Mo. Kansas City, Mo. Dawson, N. D. Hancock, Minn. Chicago, Ill. Pasadena, Calif. Kansas City, Mo, Ann Arbor, Mich. Pipestone, Minn. Kansas City, Mo. Stockton, Calif. Kansas City, Mo. Chicago, Ill. Stonington, Maine Baton Rouge, La. Winsor Hotel, Lincoln, Kans. Kansas City, Mo. Watseka, Ill. Staunton, Ill. Oconto, Nebr. Ogalla, Nebr. Portland, Oregon Ogden, Utah. San Antonio, Texas Capt. Capt. Capt. Capt Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut ' STUDENT IXIEDICAL OFFICERS, COMPANY NO. G Adkins, Russel E. Buis, john . . Chapman, William E. Desjardins, Arthur U. Fry, Walter F. . McCabe, Fordyce H. Pace, Arthur A. . Smith, j. Herbert Ude, Waldmar . Westcott, LeRoy A. Van Epps . . Avery, Samuel D. Appleby, Clyde E. Adams, john W. Bennett, Louis J. . Bettman, Ralph B. Brunckhorst, Frank Brown, William F. Binford, William S. Converse, George L. Canfield, Harry Em Culbertson, William Clarke, Charles P. Crane, Marli C. . O.. F.. Driessel, Sylvester J. Earngey, Williard P. Engberg, Andrew . Fowler, Paul H. . Farrage, james . Grannis, Irving V. Koster Chicago, Ill. Pender, Nebr. Leland, Ill. Rochester, Minn. St. Louis, Mo. Wellman, Iowa. Toledo, Iowa Kansas City, Mo. St. Louis, Mo. Cherokee, Iowa Iowa City, Iowa. Troy, Mo. Peabody, Kans. Witt, Ill. Ft. Arkinson, Wis. Chicago, Ill. Hortonville, Wis. Keokuk, Iowa Dixon, Iowa Webster, Wis. Willmar, Minn. Kansas City, Mo. janesville, Wis. Osseo, Wis. Barton, Wis. Rockford, Ill. McPherson, Kans. Plain, Wis. Breckenridge, Min Menomonie, Wis. Fl 32 i Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut STUDENT MEDICAL OFFICERS, CONIPANY NO. 6 Greenwood, Thomas M Guernsey, Paul F. Gibbs, Fred L. . George, Abel B. . Hawthorne, Hugh B. ,' Howard, William I-I. Horn, Archie S. . Hazel, john B. . Harrod, Rollen W. Kinsely, Arthur L. McCarthy, Harvey E. McEachern, Walter A. McDonald, Clarence R. Menefee, Buell F. Metheny, Earl . Monroe, Charles W. Meland, Orville W. Purves, George K. Plum, Frank A. . Rose, john T. . Sigler, Glenn V. . Strauss, .Jerome F. Sallander, Frederick Shook, Charles F. Speers, Will F. . Wilson, R. H. . Sallace, Hilen K. . Webb, james A. H. Wehn, Clifford C. Wilson, jesse D. Koster 33 Circleville, Kans. Bloomfield, Iowa Vandalia, Mo. Red Oak, Iowa Palmer, Kans. Chicago, Ill. Tampico, Ill. Staunton, Ill. Avon, Ill. Liberal, Kans. Carbondale, Ill. Superior, Wis. Broken Bow, Okla. Montgomery, Mo. Cairo, Nebr. Arthur, Ill. Grand Forks, N. D Wichita, Kans. Seattle, Wash. Lakefield, Minn. Highmora, S. D. Chicago, Ill. Madison, Iowa Omaha, Nebr. Davenport, Iowa Tampico, Ill. Stafford, Kans. Pennfield, Ill. Ideal, Colo. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Allport, Walter H. Edwards, Francis M. Fox, john S. Landry, Arthur B. McGinnis, Olive S. Meyerding, Edward A. Nickerson, Bernard S. Newell, George W. Osborn, james W. Price, Alfred S. Robertson, john B. Skinner, George C. Clarke, G. W. Aleshire, john L. Adams, Charles S. Akers, William O. Albright, Fred C. Allen, Benjamin G. Allyn, Walter H. Allyn, Paul R. Alderson, Albert L. Alt, Roy C. Armbuster, August C. Androp, Serge Axline, joseph T. Anthony, Walter E. Axley, Albert A. STUDENT MEDICAL OFFICERS, COMPANY No. 7 Koster Chicago, Ill. Centralia, Ill. Chicago, Ill. Hartford, Conn. Sedalia, Mo. St. Paul, Minn. Mandan, N. D. Peru, Ind. Des Moines, Iowa. Des Moines, Iowa. Cottonwood, Minn. Cedar Rapids, Iowa Roseville, Ill. Plainville, Ill. St. john, Kans. Florence, Nebr. Garland, Kans. Henderson, N. C. Waverly, Ill. Wvaiverly, Ill. Pana, Ill. Cedar Rapids, Iowa. Collinsville, Ill. Richey, Mont. St. Louis, Mo. Ottumwa, Iowa Colgate, Wis. Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Brady, Charles S. Bartlett, Clifford L. Bading, Gerhard A. Barnes, Herbert T. Brink, Harlan W. Beesen, Henry B. Boyne, Walter W. Baker, Lester W. Blatchford, Frank W Bridgman, Harry L. Barclay, Charles K. Bernstein, Max Boland, john E. Bredsky, Louis L. Bowman, Norton W. Burns, Harry J. Burket, Walter C. Bernhardt, Harry B. Boone, jesse F. Bedford, Edgar W. Clarke, Geo. W. Crawford, William H. Cline, Edgar Clark, Frederick F. Cornell, john W. Christensen, john W. Coolidge, Walter L. Union, N. J. Indianapolis, Ind. Milwaukee, Wis. Pewaukee, Wis. Hopedale, Ill. Cornell, Wis. East St. Louis, Ill. Herrin, Ill. Winnetka, Ill. Columbia, Iowa New Lenox, Ill. Two Rivers, Wis. Flora, Ill. Hudson, Wis. Kingman, Kans. Chicago, Ill. Chicago, Ill. Sheboygan, Wis. Roseville, Ill. Rushville, Nebr. Auburn, Nebr. New Cousan, Conn Chicago, Ill. Westby, Wis. Louisville, Ky. Lieut. Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Corbin, Sylvanus W. W. Caldwell, j. Willard Colebaugh, Charles W. Dehmel, Richard W. A. Egan, Daniel E. Egen, Lothar F. Elsey, james R. Elvis, Edgar B. Ginsberg, William Hager, Frank j. Heiple, Edward E. Huff, Frederick C. Hughes, Louis D. jared, Vernon M. johnson, john C. joseph, William A. jackson, Arthur D. jenner, Albert G. jones, Robert T. Kaps, Frederick O. Kunz, Frank O. Kouri, Martin F. Kuhn, Leo. C. Leonard, Ward H. Keeman, Harry A. Lamb, Frederick H. S'rUDEN'rIMED1cAL OFFICERS, COMPANY No. 7 Koster Millerton, Iowa. Steamboat Rock Iowa, Chicago, Ill. So. Germantown, Wis. St. Charles, Ill. Omaha, Nebr. Glenwood, Minn. Medford, Wis. St. Paul, Minn. Denmark, Wis. St. Louis, Mo. Sturgeon Bay, Wis. Carbondale, Ill. Chicago, Ill. Ogdensburg, Wis. Hancock, Wis. River Forest, Ill. Milwaukee, Wis. Edgar, Nebr. Brillton, S. D. Beardstown, lll. St. Louis, Mo. Chariton, Iowa. Kansas City, Mo. Stoughton, Wis. Butler, Pa. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Laney, Ronald L. Lewis, Carl F. McHugh, Roderick F. McReynolds, Ralph MacLaughlin, Harry E. Meacham, William C. Merganthaler, Otis P. Morgan, David A. Martin, Albert Morgan, Everett H. Merritt, Frank W. Miller, Howard C. Miller, Earl B. Moffett, Reuben A. Nelson, Norman O. Parker, Garner F. Palmer, judson A. Quinby, Smith A. Rosenbaum, Lambert W. Rodetker, Royal C. Simons, Neal S. Schnaer, Carl H. Snider, Randolph Schudde, Otto N. Tyvand, james C. Williams, Paul R. Wilson, Roy H. Brown Valley, Minn Brussels, Ill. Colerane, Minn. Quincy, Ill. Waupaca, Wis. Oak Park, Ill. Templeton, Iowa. Nilwood, Ill. St. Anne, Ill. St. Paul, Minn. Chicago, Ill. Whiteeater, Wis. Chicago, Ill. Todd, Ill. Madison, Wis. Pocahontas, Iowa Arcadia, Wis. Indianapolis, Ind. Chicago, Ill. Holcombe, Wis. Taylor, Wis. Chicago, Ill. St. Francisville, Ill. Sullivan, Mo. Whitehall, Wis. Cape Girardeau, Mo Tampico, Ill. Capt Capt. Capt. Capt. Capt. gapt. apt. gapt. apt. Capt. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Brown, Herman D. Butler, james C. Clark, Edward H. Combs, Clarendon, J. Dillon, Ira H. Dager, William F. jacks, Robert R. Lunn, William B. Middlebrook, Robert Parker, Sam T. Arnson, Julius O. Boyce, Samuel G. Brenn, Charles P. Boyce, Shirley F. Bartett, William F. Brucker, Edward A. Baker, George R. Bond, Robert G. Baskett. Lindsay W. Chapman, Frank A. Clary, William H. Cummins, Edward W. DeWesse, Clarence Danley, Royal C. Dobbins, Thomas Deem, Frederick S. STUDENT MEDICAL OFFICERS, COMPANY No. s 53.05 jackson, Mich. Stafford, Kans. Kansas City, Mo. Oshkosh, Wis. Auburn, Nebr. Lorain, Ohio. I-Iighwood, Ill. Marquette, Mich. Kansas City, Mo. Somerset, Ky. Bismark, N. D. Little Rock, Ark. Western, Nebr. St. joseph, Mo. Chicago, Ill. Chicago, Ill. Tomahawk, Wis. Harrisburg, Ill. Big'Timber, Mont. Chicago, Ill. Prescott, Iowa Harrisburg, Ill. Fordsville, Ky. Hamburg, Iowa. Humphrey, Ark. Solsberry, Ind. lar Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Dyar, Burt A. Dreher, Henry S. Durnell, Aubert Dewey, Christian H. Dwyer, john G. Donnell, james B. Elder, john W. Engstrom, Frederick A. Englerth, Bennie L. Edmondson, Edward E. Ernest, F. J. Fusen, Carl C. Fusen, Charles M. Fisher, Hart E. Fore, Oliver R. Ferguson, Frederick H. Floreth, Gustav A. Greening, William P. Griffin, Thomas R. Goff, William M. Gartner, Wilhelm A. Gill, Denson, D. Gosin, Donne F. Gosin, Fabian j. Hammer, john E. Harvey, Frederick E. DeSmet, S. D. Waldo, Kans. Strong, Colo. Perry, Iowa. Cullon, Ill. Kinsley, Kans. Des Moines, Iowa. Cannon Falls, Minn Anna, Ohio. Mount Vernon, Ill. Topeka, Kans. Milliken, Colo. Milliken, Colo. Manhattan, Kans. Flora, Miss. Elroy, Wis. Mt. Olive, Ill. Wichita, Kans. Danville, Ky. Marysville, Ohio. Troy, Kans. Gilbert, La. Green Bay, Wis. Green Bay, Wis. Hardtner, Kans. Minneapolis, Kans. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Liuet Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Hartnack, Knud Hood, Tarlton A. Higgs, Dewitt P. Hardeman, Sam Hanson, Martin W. Hanna, Myron Hondorf, James L. Heithans, Aloys S. Fly, Thomas M. Houston, Sam W. I-Iarrris, Urban B. Hoagland, William L. Jones, Zachariah G. Jones, Harry J. Jones, Charles L. Kaasa, Lawrence J. Kober, William H. Kelsey, James H. Kelsey, Lee E. Kirkham, Judd H. Kelsey, Carlton G. Kaozkowski, Joseph Krasa, John M. Layton, Roy W. Legg, Charles E. Lippman, Louis H. C. McCormack, William E. STUDENT MEDICAI. OFFICERS, COMPANY No. s monster Downers Grove, Ill. Garnett, Kans. Fairfield, Idaho Long Pine, Nebr. Easton, Ill. Scott, Ohio. Rochester, N. Y. St. Louis, Mo. Little Rock, Ark. Walcott, N. Y. Chicago, Ill. Kansas City, Mo. Kansas City, Mo. North English, Iowa Gilmore City, Iowa Lake Mills, Iowa Auburn, Cassoplia, Mich. Lake View, Mich. Langdon, N. D. Hinckley, Minn. Chicago, lll. Chicago, Ill. Kansas City, Kans. Champion, Nebr. Chicago, Ill. Louisville, Ky. Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Mclntyre, John A. Mellinger, Herbert V. Mundell, Walter V. Miller, Thomas Miller, Joseph E. Mitchell, Walton I. Moulton, Ellis V. Nyberg, Milton O. Owens, Robert L. O'Mally, William F. Pemberton, Maurice Parsons, Harry C. Powers, George J. Pearce, Franklin B. Quillian, Lawrence J. Robinson, Edward T Ruyevitz, Joseph L. Ryder, Frank D. Rose, Wallace D. Rybolt, Stephen B. Schnell, Benjamin, C. C. Stevens, Harry I. Savage, Francis J. Tinder, John W. Van Alyea, Oliver E. Wright, Eugene P. Walcott, Iowa Wilmetta, Ill. Hutchinson, Kans. Oconomowoc, Wisc Sullivan, Ill. Wichita, Kans. Chicago, Ill. Ashland, Kans. Hamilton, Mont. St. Paul, Minn. Deadwood, S. D. Watertown, S. D, Streator, Ill. Eldorado, Ill. Streator, Ill. Chicago, Ill. Duncombe, Iowa Grand Island, Neb, Little Rock, Ark, Troy Mills, Iowa New Baden, Ill. Ashley, Ill. St. Paul, Minn. Parsons, Kans. Chicago, Ill. Chicago, Ill. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut. Breed, Nathaniel P. Dudley, Gerry B. DeForest, Calvert M. Foat, john S. Garrett, Emmett Green, Frederick R. Haynes, Frederick E. Kenzie, William N. Mark, Ernest G. Poole, William A. Algers, George L. Atherton, jasper L. Bryant, Stanley E. Ballard, Charles S. Brintnall, Roy A. Baker, Edwin A. Bretz, Ross B. Barnes, Van D. Boyle, Cornelius B. Brown, Chas. H. Cowan, Wayne F. Day, Ben H. Doherty, William T. Doudna, john F. Davidson, William P Durand, Albert C. STUDENT MEDICAL CFFICERS, COMPANY NO. 9 Douglaston, N. Y. Charleston, lll. Canastota, N. Y. Ripon, Wis. Peoria, Ill. Chicago, Ill. Minneapolis, Minn. Richland, Mich. Kansas City, Mo. Henderson, Ky. Saginaw, Mich. Springfield, Mo. Dowagiac, Mich. Flint, Mich. Seville, Ohio Clyde, Ohio Evansville, Ind. Morenci, Mich. Washington, D. C. Fairplay, Mo. Stevens Point, Wis Hugoton, Kans. Wichita, Kans. Lake City, Mich. Sullivan, Ill. Ithaca, N. Y. Koster Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut 38 Darby, George S. Dew, Walter A. Duenweg, Rudoplh Egloff, George E. Elliston, Leroy B. Evans, john H. Evers, john W. Eubanks, George W. Edwards, Carl Engh, Sigfred Finley, Walter G. Fitz, George G. Farner, Eli E. Felts, Wylie R. Gutch. Roy C. Getelson, joseph Goodwin, Andrew J. Goodloe, Hart Gillis, Hudson McB Harris, Leon B. Hollis, Forney K. Hodge, Russell, L. Harman, Leo D. Holmes, Benjamin H. Hensley, Charles Hennessy, Maurice C. Brodhead, Wis. Belleville, Ill. Terre Haute, Ind. Wichita, Kans. De Pue, lll. Chicago, lll. Flint, Mich. Wabash, Ark. New Matamoras, Ohio White Rock, S. D. Mondamin, Iowa Richfield, Idaho Dockery, Miss. judsonia, Ark. Chariton, Iowa Kansas City, Mo. Wheeling, W. Va. Canyon City, Colo. Mount Pleasant, Iowa Saginaw, Mich. Gattman, Miss. Kansas City, Mo. Table Rock, Nebr. Deleware, Wis. Topeka, Kans. Council Bluffs, Iowa Lieut. Lieut Lieut. Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieuf Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Harmon, Dean Henderson, Walter F . Howell, Ernest C. Hickman, john S. Hedges, Frank Hogan, john H. Hodson, Herman O. Hutchinson, Alex F. Holmquist, Arthur j. Hirsch, Edwin W. Henderson, Ralph C. Irby, joseph T. Ideson, Robert S. johnston, Frank A. johnston, David E. jones, Carl F. jones, Daniel D. jefferson, Wade H. james, William A. D. Kuhn, Leslie A. Keech, Roy K. Kramer, julius C. Kern, Max Kittridge, Martin R. Konigmacher, Adam H. Kraft, Sigurd H. STUDENT MEDICAL OFFICERS, COMPANY No. 9 Koster Readlyn, Iowa Belcher, La. Fennimore, Wis. South Bend, Ind. Pattensburg, Mo. Racine, Wis. Washington, C.H., Ohio Durango, Colo. Denver, Colo. Chicago, Ill. Erie, Kans. Enterprise, Miss. Ann Arbor, Mich. Kingston, N. Y. Moores Hill, Incl. Sparta, Wis. Berne, Ind. Cadiz, Ky. Midnight, Miss. Wyatt, Ind. Cedar Rapids, Iowa Elyria, Ohio Chicago, Ill. Evansport, Ohio Missouri Valley, Iowa Chicago, Ill. 39 Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Mitchell, Ezra j Maiden, Snyder D. Murphy, Robert C. Morris, Robert B. Phillips, james E. Pardee, Azro j. Pratt, George P. Parker, Prentiss E. Penrose, james B. Pope, Frank W. Postlethwaite, Frank M. Rowe, Leo B. Richardson, Edmon E. Raynale, George P. Rawles, Lyman T. Rankin, William Robertson, George A. Rodgers, Edwin C. Rawley, Charles C. Snyder, Karl A. Schreitter, joseph B. Schopelor, Cortlandt, Saltzstein, Harry C. Siberts, Paul R. Steely, George W. Schott, Harry j. Brodhead, Wis. Council Bluffs, Iowa Greenwood, Ill. Beech Creek, Ky. Eureka Springs, Ark Ashtabula, Ohio Omaha, Nebr. Bourg, La. Marietta, Ohio Racine, Wis. Kansas City, Mo, Broadhead, Wis. Mattoon, Ill. Birmingham, Mich, Ft. Wayne, Ind. Keokuk, Iowa Louisville, Ky. Wapello, Iowa Savanna, Ill. Milwaukee, Wis. Cooperton, Okla. Louisville, Ill. Sioux City, Iowa ' Major Capt. gapt. apt. Capt. gapt. 3 IZ. Cast. Capt. Capt. Capt. gapt. apt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Cutter, Irving T. Chandler, Orville B. Cludas, Arthur L. Daly, William T. Davis, Homer Detwiller, Albert K. Gardner, Wilfred H. Hopkins, Odos A. McCarthy, Robert G. Mclntosh, john S. McLean, George D. Marcum, Earl H. Plummer, George A. Reed, Hiram M. Snitkay, Carl J. Walker, .Iohn Riley Aiird, Andrew Al. Alexander, William A. Baker, David A. Benjamin, Edward L. Bergfeld, Arthur W. C. Bishop, Vernon L. Berman, Harry S. Brown, john C. Brown, Polk S. Butts, james W. Caplinger, Theophilus Darnell, William T. DeGregori, Prosper H. Dewey, Edward L. Diedling, Rudolph F. Dieter, Charles A. Di Palma, Salvatore Douthitt, Clarence N. Earle, R. Horatio Eaton, Frederick G. STUDENT MEDICAL OFFICERS, COMPANY NO. 10 Koster Charleston, Mass. Poughkeepsie, N. Y. Minneapolis, Kans. Cresco, Iowa. Genoa, Nebr. Easton, Pa. Bloomington, Ill. Middlefield, Ohio Chicago, Ill. Mt. Olive, Miss. Oklahoma City, Okla. Bernidji, Minn. Cresco, Iowa. Seattle, Wash. Belleplaine, Iowa Ft. Madison, Iowa Carterville, Ill. Forsyth, Mich. Jordon, Mont. New York, N. Y. Sequinn, Texas Livonia, N. Y. Detroit, Mich. Albany, N. Y. San Antonio, Texas Wlena, Ark. allace, Ind. Xenia, Ohio. Brooklyn, N. Y. Whiting, Ind. Saugerties, Ind. Hope, Kans. New York, N. Y. Athens, Ohio Wayne, Mich. Saratoga Springs, N. Y. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Eberhard, Fred G. Effler, Louis j. R. Eisman, Clarence H. Elliott, john R. Elliott, james R. Evans, Glenn S. Evers, William P. V. Eyestone, Albert G. , Faucett, Samuel T. Fitzgerald, Edward T. Fitzgerald, George M. Fitzgibbon, Henry M. Fly, Thomas M. Fochtman, Lloyd H. Funk, Neil E. Fleischhauer, David S. Fleming, Thomas S. Foerster, Harry R. Frosh, Henry B. Gilchrist, Ralph T. Gillette, Harry E. Godfrey, Edwin B. Greene, Claud C. Greenshields Robert , M. Greig, Thomas O. Gausepohl, Lawrence E. Goodman, Arthur O. Hall, Stanley M. Hall, Walter D. Halsey, Henry A. Harrison, Uen S. Harrod, Charles P. Harvey, Clarence C. Hebron, Raymond A. Hendrickson, Clihford W. House, Oscar South Whitley, Ind. Toledo, Ohiojj Detroit, Mich. Clarksdale, Mo. Kansas City, Mo. Forest, lllfi Pedrow, Ohio Gibsonburg, Ohio Bonner Ferry, Idaho Morris, Minn. Fon du Lac, Wis. Omaha, Nebr. Little Rock, Ark. Cozard, Nebr. Valparaiso, Ind. Wabaska, Minn. Moberly, Mo. Milwaukee, Wis. Lincoln, Nebr. Milwaukee, Wis. Packwauke, Wis. Springfield, Ill. Holly Springs, Miss. Romeo, Mich. West Chicago, Ill. St. Elizabeth, Mo. Louisville, Ky. Clarence, Mo. Clay City, Ill. Hiles, Wisc. Collinsville, Ill. South Park, N. Y. Emporia, Kans. ' Cateract, Wis. New Rochelle, N. Y. DeSoto, Ill. Lieut. Lieut Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Hargreaves, Oliver C. Hammer, Leroy Haley, Roy R. Herdman, Samuel B. Hertel, Alphons J. Heslin, John F. Hetsler, Orrie L. Hickman, Walter F. Higinbotham, Charle Hilton, Joseph, Jr. Houston, Matt. F Hoyt, Awra A. Hoyt, Daniel J. Houghton, Milton O. Hudson, Harry H. Humphrey, Ray M. Ingalls, Stanley S. Jacobs, William J. Jenkins, Harry Jenson, James L. Johnson, Edwin M. Johnson, Henry A. Jolley, Roy F. Jury, Herbert W. Keen, Littleton O. Keene, Fred F. Keppel, Frederick D. Kneeshaw, Roberl 5- Kraetzer, Arthur F. Kulig, Albert H. Kurek, Leon S. Lay, Harry T. Liston, Odus ' Littlejohn, David McCrory, Harvey B- McCinnis, John E. sJ. S'1'UDEN'1' IVIEIJICAI. OFFICERS, COMPANY No. 10 Koster Chicago, Ill. Ottumwa, Iowa Brookfield, Mo. Taylorville, Ill. New York, N. Y. Saratoga Springs, N. Y. Elkhart, Ind. Indianapolis, Ind. Streator, Ill. Socarro, N. Mex. Clarendon, Ark. Battle Creek, Mich. New York, N. Y. Perry, N. Y. Newton, Kans. Union, N. Y. Parish, N. Y. Carthage, N. Y. Church Point. La. Denton, Mont. New York, N. Y. Tekamah, Nebr. Columbus, Ohio Cliflin, Kans. Burkesville, Ky. Wessington Spgs., S.D. Cazenovia, N. Y. St. Maries, Idaho Brooklyn, N. Y. Independence, Wis. Buffalo, N. Y. Montgomery, Ala. Hudson, Kans. Bridgeman, Mich- Birch Run, Mich. Green Bay. WIS- Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut. Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Mallow, Otis B. Mangum, William R. Martin, Charles A. Meddaugh, William H. Menser, Bert Moats, Virgil H. N. Moore, Cleland Cv. Morris, Robert L. Nichols, William S. Ohage, Justus, Jr. O'Neal, Orvil Painter, Jesse C. Parmley, Lee V. Pease, Herbert Pedigo, Sherman E. C Poe, Chester A. Pentz, Marvin C. Platt, John J. Polk, Phil R. Pumphrey, Josiah Rategan, Edward H. Remer, William H. Rhyne, Arthur W. Rogers, Weaver B. Roller, William C. Rueth, John E. Rush, Weaver A. Sanderson, Anton C. Saylor, Herbert Schoenfeld, Charles J. Senn, Ulrich Singleton, Robert O. Thomson, William Wilson, Edward L. Wolff, Harry D. Zinser, Harley A. Detroit, Mich. Bridgeport, Ill. Chunky, Miss. Sand Creek, Mich. Denver, Colo. Rogers, Minn. Omaha, Nebr. Decatur, Ill. Cleveland, Ohio St. Paul, Minn. Shattuc, Ill. Schyuler, Nebr. Little Rock, Ark. Slater, Iowa New Marshfield, Ohio Fruitland, Mo. Nicholasville, Ky. St. Paul, Minn. Oakvale, Miss. Mt. Vernon, Ohio Chicago, Ill. Chaseburg, Wis. Buelah, Miss. White Sul. Spgs., Mont Reno, Nev. Sun Prairie, Wis. Logan, Utah Minneota, Minn. Merill, Wis. Chicago, Ill. Milwaukee, Wis. Mineral Wells, Texas Belknap, Ill. Marysville, Kans. Chicago, Ill. MEDICAL.. OIn Ii'lCElI4!S TIUXINING CAMP FO QT RILEY, KANSAS Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Darling, Walter H. Cogswell, Charles H. Hahn, Milton Harrington, William E. Holes, Jesse J. Ingraham, Clarence B., Jr. Johnson, George M. Littig, John V. McGee, Charles J. Olson, Ole Pugsley, George W. Smith, Edward S. Stewart, Oliver E. Young, Russell M. Akin, William F. Aull, John Baker, Joseph I-I. Balsley, Clyde M. Battersby, Richard S. Bowden, George S. Beckett, Grover A. Bliss, Charles J. Bone, Merle Boren, John W. Bradgen, George H. Brennan, Joseph T. Buchanan, Frank R. Burke, Alexander W. Button, Meade A. Buvinger, Charles W. Cahill, Charles J. Campbell, Roscoe C. Carey, Harry D. Carpenter, Fred H. Christman, Edgar S. STUDENT MEDICAL OFFICERS, COMPANY No. 11 Koster Minneapolis, Minn. Arkansas City, Kans. I Owatonna, Minn. Denver, Colo. Marshalltown, Iowa. Davenport, Iowa. Leavenworth, Kans. Lincoln, Nebr. Omaha, Nebr. Macon, Mo. Bricelyn, Minn. Red Oak, Iowa. Branch, Ark. Kansas City, Mo. La Crosse, Kans. Joplin, Mo. Shelbina, Mo. Davenport, Iowa. Sunrise, Ky. Mayetta, Kans. Kelliher, Minn. Marinette, Wis. Reeds, Mo. Vichey, Mo. Canton., Okla. Chicago, Ill. Topeka, Kans. East Orange, N. J. Forle-:sg Green, Mo. St. uis, Mo. Denver, Colo. Spring Green, Wis. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Clark, Isaac F. Cleaves, Prentiss B. Cleland, Winfield S. Clint, Morgan L. Culbertson, Hayes H. Cummings, Clements A. Doane, William E. Dodge, Charles H. Draper, Walter E. Eagan, Robert E. Earnest, Albert N. Egan, William J. Engl, Robert A First, Francis R. Fortney, Alvan M. Fowler, Harmon L. Gardner, Charles C. Gill, Arthur E. - Haggart, Alexander Hallinan, Edward L. Hall, Roy E. Hamilton, Benjamin C., Jr. I-Iartigan, Francis X. Holbrook, Francis R. Hugo, Donald G. Jaslow, Leonard A. Johnson, Daniel S. Krieger, William A. Lehman, Douglas A. Lewis, William B. Lindberg, David O. N. Logan, James A. Loosbrook, John F. Lloyd, Hiram J. Lusk, Charles A. Davant, Okla. Cherokee, Iowa. Denver, Colo. Meadville, Mo. Fairburg, Nebr. Buckingham, Iowa North Bend, Nebr. Darien, Wis. Spring Hill. Kans. Muskogee, Okla. Hurley, Wis. New York, N. Y. Cashion, Okla. DeSota, Kans. Denver, Colo. Ashland, Okla. Sopris, Colo. Ottawa, Kans. Clinton, Iowa. Fullerton, Kans. Jefferson, Iowa. Des Moines, Iowa. Oshkosh, Wis. New York, N. Y. Houston, Miss. Bell View, Ky. Harrisburg, Ill. Denver, Colo. Quincy, Mass. Warsaw, Mo. Des Moines, Iowa. Mankato, Minn. Butler, Mo. illlililliiiiiblOl0lO1liO101010l01C1 w '-Q MEDKQA1, or-'views ITZAININC- QAMD A , , . . :'10iihnoc1dSo1SoLo1oio1 Foil' RILEY, oK?Nggoio:o1oio1010101010'i Lieut. Lieut Lieut Liaut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieutk Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut' Lieut McAllister James McCarthy, Harry C. McCrann, William J. McCullough, William H. McGaughey, Hugh D- McGrew, Oliver W. McLeod, Frederick L. Maercklein, Arthur G. Meriwether, Charles N. Mestmacher, Louis H. Metheny, Harry B. Miller, Donald C. Mills, Roy F. Munger, Irvia Molseed, Clarence Moore, Paul D. Morris, Clyde L- Munford, Raymond H. Murphy, Pat Musser, James F- Needham, Charles T. Newman, Leon Nichols, Roscoe T. Nicolai, Paul Nieweg, George A' O'DonaghuC, James H' Omer, William J. Ouellette, Clifford L. Parks, Rufus F. Parrish, William A- Phillips, Leslie J. Rains Hugh L- STUDENT MEIJICAI. OFFICERS, COMPANY NO. 11 Koster Battle Creek, Iowa. Omaha, Nebr. Manhattan, Kans. Jamestown, Kans. Grand View, Iowa. Lincoln, Nebr. Exeland, Wis. Lincoln, Nebr. Loyal, Wis. Odessa, Mo. Omaha, Nebr. Calhoun, Ky. So. Greenfield, Mo. Dodge City, Kans. Little Rock, Ark. Lockesburg, Ark. Omaha, Nebr. Liberal, Kans. Livermore, Iowa. Vancleve, Mo. Storm Lake, Iowa. ' Thomas, Okla. Oconto, Wis. Bonanza, Ark. Mulberry, Kans. Weyerhause, Mo. Jonesboro, Ark. Ranshaw, Willoughby H.T. Covington, Ky. Ressler, Clarence E. Reynolds, Harry R- 101519 Anthony, Kans. Clinton, Iowa. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut.. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Richeson, Vernon N. Riley, John L. Russell, Frank H. Schwald, Norman A. Seiler, Raymond A. Selman, Ralph J. Shelton, Charles D. Sheehy, Joseph P. Shepard, Robart M. Sims, Harry H. Smith, Jason N. Stansbury, John E. Stewart, James G. Stiers, John W. Streetor, Roderick D. Stuart, Francis I. Swab, Charles M. Swenson, Axel W. Taggart, Henry H. Taylor, Herbert I. Thomas, Philip E., Jr. Thompson, John W. Tomlinson, Louis M. Van Voorhis, Clyde R. Verne, Victor E. Webb, Floyd Wegener, Karl E. E. Wells, Francis A. Wanzlick, George J. Westervelt, Alfred E. Whitcomb, Glenn D. Wilson, Constant, Jr. Wood, R. Wickliffe Young, Justin J. Oak Grove, Mich. Henryetta, Okla. Neena, Wis. Cole Kamp, Mo. Blairstown, Iowa. Blakesburg, Iowa. Bloomfield, Iowa. Omaha, Nebr. Stigler, Okla. Iowa City, Iowa. Cedar Rapids, Iowa Topeka, Kans. Muscatine, Iowa. Moberly, Mo. Independence, Mo. Haddam, Kans. Bisbee, N. D. Wichita, Kans. St. Louis, Mo. Clarendon, Ark. Pueblo, Colo. Harveyville, Kans. Prairie City, Iowa. Moorhead, Minn. Terrell, Ark. Lincoln, Nebr. Axtell, Nebr. .Iowa City, Iowa. Craig, Nebr. Omaha, Nebr. Fort Smith, Ark. Cythiana, Ky. Kremmling, Colo. W dluiiiillbllili lfiliiilitili Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut . Avery, Jacob F. Egeland, Gustaf, R. Hoy, Clinton L. Kleinman, Erwin W. Lynch, Robert J.. Meredith, Hubert M. Plummer, Herbert W. Rice, Paul F. Sprague, Charles H. Stumberg, Bernhardt K. Swezey, Andrew J. Allen, Charles C. Anderson, George M. Anderson, Nels P. Aplin, Floyd W. Ashley, Hugh V. Athey, John V. Atkin, Edward H. Bach, Luther Baldwin, William P. Barns, Frank M. Bice, Barrett D. Blachly, Charles D. Blakesley, Theodore S. Blankenhorn, Charles E. Bolton, Louis C. Boyer, Ulysses S. Bradley, Calvin E. Brenckle, Jacob F. Britell, Oley A. Brook, Jeffrey J. Cherry, Charles H. Clayton, Emanuel H. Coleman, Fred B. Collins, Robert L. STUDENT MIEDILIAI, OFFICERS, COMPANY NO. 12 Koster Minneapolis, Minn. Sturgeon, Bay Wis. Three Forks, Montp Hailey, Idaho. Des Moines, Iowa. Scottsville, Ky. Lime Springs, Iowa. Solen, N. D. Pocatello, Idaho. St. Charles, Mo. Decorah, Iowa. Austin, 'Minn. Lincoln, Nebr. Sherburn, Minn. Waukesha, Wis. Bloomfield, Mo. Bartlesville, Okla. Hoisington, Kans. Jackson, Ky. Casselton, N. D. Albion, Nebr. Spar ks, Nev. Drumright, Okla. Kansas City, Mo. Milwaukee, Wis. Cedaredge, Colo. Kansas Cit Mo y, . Mountain View, Okla. Kulm, N. D. Belgrade, Nebr. Milwaukee, Wis. Chisholm, Minn. Arkansas City, Kans. Austin, Minn. Hazzard, Ky. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Combs, John W. Cook, Ralph L. Corcoran, Edward A. Cornell, Corwin S. Cox, Walter Davis, Lloyd T. Doggett, Sylvester Drake, Franklin J. Earle, James R. Elliott, Reuben J. Fannin, Frank A. Fulton, Hiram A. Gardner, Pendleton Gay, Ray J. Gibbon, Luther L. Harper, Carl S. Hayes, Edwin P. Henry, Rex V. Irvin, Robert Andrew Jackman, Johnston C Jamieson, George V. Jewell, Milton D. Jones,r.Thomas E. Jump, Clyde W. Kidd, Floyd S. Kinnaird, Virgil G. Knox, Eugene S. Leck, Clifford C. Lee, Clarence E. Lockwood, Charles E. London, Finis Long, William H. McCall, Wheeler McCarey, Arthur J. g McDonald, John T. Brownell, Kans. St. Louis, Mo. Chicago, Ill. Knoxville, Iowa. Lexington, Ky. Wadena, Minn. Bradford, Ark. Webster City, Iowa. Denver, Colo. National Home, Wis. Stigler, Okla. Eau Claire, Wis. Haileyville, Okla. New Hartford, Mo. Lowry, Minn. Madison, Wis. Eau Claire, Wis. Hedrick, Iowa. Clay City, Ky. Minot, N. D. Devils Lake, N. D. Decorah, Iowa. Sioux Falls, S. D. Bozeman, lont. Woonsocket, S. D. Lancaster, Ky. Cleveland, Wis. Austin, Minn. Oklahoma City, Okla Olathe, Colo. Woodburn, Ky. Dickinson, N. D. Blytheville, Ark. Green Bay, Wis. New Castle, Ky. Lieut. Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut McGrath, Benjamin McQuire, Roy A. McPherson, Owen P. Mason, David W. Maresh, George Morton, William G. Morrow, Carl W. Nash, Arthur R. Oechsli, Arthur B. O'Neill, Edward D. Ostrander, Arley J. Page, Willifred Palmer, Thomas J. Paulson, Carl Pearson, Charles M. Peters, John A. Phillebaum, John C. Powell, Joseph P. Prill, John H. Read, Francis T. Reed, Andrew I. Reynolds, Robert L. Richardson, Cleves Robinson, Raymond Rose, Wallace E. Sallee, Theodore Schmaltz, Walter F. Siefert, Otto J. Shafer, Lee E. Shrout, Cecil B. Sigler, Marion T. Smith, Arthur D. Smith, Dwight C. Sory, Jesse B. R. E. S'1'UDEN'1' INIEDICAL Oifificmizs, COMPANY No. 12 Koster Grand Island, Nebr. Brighton, Iowa. Kansas City, Mo. Burlington, Kans. Riverside, Iowa. Iowa Falls, Iowa. Handley, Nebr. Parsons, Kans. Stockton, Kans. Kalistell, Mont. Enderlin, N. D. McCracken, Kans. McAlester, Okla. Seattle, Wash. Ogena, Wis. Springfield, Nebr. St. Joseph, Mo. Vici, Okla. Chetek, Wis. South Shire, S. D. Grand Junction, Iowa. Kalispell, Mont. Louisville, Ky. Walnut, Iowa. Kearney, Nebr. Covington, Ky. Mount Aye, Iowa. New Ulm, Minn. Walcott, Iowa. Bunceton, Mo. Pickrell, Nebr. Gilmantown, Wis. Radley, Kans. Crayne, Ky. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieur Lieut Lieut Lieut Lieut Springer, Ralph W. Stark, Lucien Stoland, Iver Swange, Overton H. Taylor, Roscoe D. Tharaldson, Thorfium Thomas, Irl Thompson, John B. Timbermann, John H. Tucker, Arthur O. Ungles, James B. Vanderlinde, Leslie A. Van Sandt, Guy B. Vernard, Thomas S. Varpahl, Rudolph A. Voss, Carl Walker, Lynn J. Washburn, Lawrence L. Watson, Fred S. Webb, Roey A. Wedge, Athol H. Welborn, Orange E. Whitaker, William J. Williams, David L. Willman, Clarence L. Wilson, Thomas Witt, Nobley C. Wittwer, Edward C. Woodhead, Frederick J. Yates, Charles A. Yoder, Charles A. Yost, Edmond R. Youtz, Hiram L. Zuercher, Arlo R. Pretty Prairie, Kans. Hartington, Nebr. Eau Claire, Wis. Jackson, Ky. Spencer, Iowa I Cottonwood, Minn, Pembroke, Ky. Wittenberg, Wis. Marston, Mo. Maysville, Mo. Arlington, Kans. Wantona, Wis. Wewoka, Ness City, Kans. Cedar Rapids, Iowa. Eau Claire, Wis. Wykoff, Minn. Benton, Ky. Rosboro, Ark. Oklahoma City, Okla Waupun, Wis. Kingston, Okla. Pryor, Okla. Milwaukee, Wis. Okmulgee, Okla. Proctor, Ark. Franklin, Ky. Mountain Grove, Mo Merton, Wis. Bangor, Wis. Elm Creek, Nebr. Greenville, Ky. Willow City, N. D. Cedar Rapids, Iowa. Capt. Capt. Capt. Capt. Capt. Capt. Cat , p . Capt. Lieut. Lieut. Lieut. Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Benedict, Chauncey M. Campbell, Charles H. Conrad Albert E. Knorr, Lawrence R. Lakey, William j. Metcalf, Albert W., jr. Pittinger, Fred A. Say, William j. Alexander, Charles W. Allison, Hugh Q. Armstrong, john H. Adams, joseph R. Abbott, Herbert A. Abshear, Zachary M. Asbury, joseph T. Bock, Lux H. Burkhard, Edwin D. Brown, William E. Barkman, Herman A. Barbour, Walter L. Bartlett, james C. Beard, Eugene E. Busby, Charles D. Burns, Floyd W. Blackstone, Bigelow P Burton, William G. Bruce, Grover C. Byars, Albert G. Brubaker, C. Freeman Bell, Leonard P. Biggs, Harvey L. Biggs, james D. Brain, Charles E. Burton, john W. Clair, jean B. Circe, William j. Cole, Fern M. Clayton, Paul B. Cibelius, Charles A. Chattle, William M. K. Cullum, Arthur B. Cleland, james S. S'1'UD1aN'1' NIEDICAI. OFIFIUICIIS, COMPANY No. 13 Salt Lake City, Utah Columbus, Nebr. Decorah, Iowa Paradise Valley, Nev Great Falls, Mont. Henderson, Calif. Boise, Idaho St. Louis, Mo. Temple, Okla. Ellery, Ill. Kirkwood, Mo. Soldier, Kans. Reno, Nev. Buckhern, Ky. Rochester, Minn. St. Louis, Mo. Trinidad, Colo. Cedar Rapids, Iowa junction City, Kans. Colebrook, N. H. Bruneau, Idaho Bradfordville, Ky. Brooklyn, Iowa St. Paul, Minn. Ames, Iowa Wichita, Kans. Dalark, Ark. Albia, Iowa McPherson, Kans. Indianapolis, Ind. jackson, Ky. Greenup, Ky. Salt Lake City, Utah Alpine, N. Y. Waterville, Maine Carson City, Nev. Caldwell, Idaho Odessa, Mo. Racine, Wis. St. Louis, Mo. Garnett, Kans. Swanwick, Ill. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Clark, Frederick G. Cloward, Ralph E. Cone, Elbert E. Cook, Lawrence C. Crawford, Harry S. Dayton, Neil A. Darracott, Lewis W. DeTunce, Adolph E. Deffenbau h Martin H. 3 , Drake, Emory A. Decker, Clark O. Doster, Wade Evans, Edward P. Ellison, Frank E. Edwards, Charles B. Funsch, Edwin C. Flinn, Homer j. Faulds, Winfield S. Gasser, Fred Garlitz, Arnold W. Grunwald, Frederick Goldman, Emerson W. Hunt, Claude j. Hartman, Perry V. Hawes, Frederick S. Herrick, john C. Hawley, Franklin M. Hoover, Isaac j. Howell, William L. Hubbard, William M. jenkins, Harry j. johnson, W. G. johnson, Roy Knappenberger, George E. Kelly, Benjamin W. Kenny, William L. Kisecker, David E. Knudtson, Herbert M. Keefer, Matthew H. King, Thomas W. Knott, Arthur D. Little, Daniel E. Ogden, Utah Price, Utah Oxford, Nebr. Ouray, Colo. Harrisonville, Mo. Burton, Ohio Hamilton, Miss. Preston, Minn. Fairmount, Nebr. Natoma, Kans. Crandon, Wis. Pasadena, Calif. So. Milwaukee, Wis Monticello, Minn. Overton, Nebr. St. Louis, Mo. Butte, Mont. Roy, Mont. Pierce City, Mo. Wilnette, Ill. Louisville, Ky. Madison, S. D. Liberty, Mo. Chicago. Ill. Russell, Kans. Denver, Colo. Mercer, Wis. Owensboro, Ky. Gardenville, Nev. Rembrandt, Iowa Omaha, Nebr. Princeton, Iowa St. Louis, Mo. Mankato, Kans. Aitkin, Minn. St. Louis, Mo. Caldwell, Kans. Hunter, N. D. Kansas City, Mo. Maloy, Iowa Murray, Utah Eufala, Okla. - i..-1t. - . K . .hL-4-54-.. 154.151-.. A Jak. 4 . Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut: Link, Edward X. Leck, Clifford C. Lukins, Aaron T. McGarty, Matthew A. McKinnon, John C. Martin William W. Myre, Stanley L. Moore, Charles Miller, Irving Mylar, Wilber K. Mason, Kirk P. Mullinax, Clay E. Matson, John A. Mertens, John J. Meyer, Carl A. Maercklein, Edwin H. Mayo, Harry H. Mayo, Woodward Bruce Merrill, Ralph T. Mertens, Herman G. Mintener, John W. Moore, Charles O. Moss, Robert C. Nelson, William L. Newman, Malcomb C. Nyberg, Robert B. Nyvall, Clarence A. O'Brien, Wayne P. Preston, William B. Pickard, Luther J. Peterson, Oscar H. Petty, Wallace S. Patterson, Paul M. Pitts, Donald H. Plant, Joseph H. Plumlee, John L. Porter, Robert W. Purdy, George Reed, Roland R. Robison, Norval W. Rochester, A. S. Ramaley, Louis Redman, Fred E. S'I'UDEN'l' NIEDICAI. OFFICERS. COMPANY No. I3 St. Louis, Mo. Austin, Minn. Tolton, Mont. La Crosse, Wis. Caldwell, Kans. Reynolds Station, Ky. Minneapolis, Minn. Advance, Mo. Volin, S. D. Kimball, Nebr. Gawker City, Kans. Princeton, Mo. Peoria, Ill. Gettysburg, S. D. Newman Grove, Nebr. Ashley, N. D. Smalley, Ky. Salt Lake City, Utah Smithfield, Utah Bayneld, Wis. Minneapolis, Minn. Paris, Idaho Rockfields, Ky. St. Louis, Mo. Toronto, Kans. Harrisburg, Ill. Salt Lake City, Utah Egeland, N. D. Logan, Utah Abilene, Texas Lamonia, Iowa Rutledge, Mo. Kansas City, Kans. Mondamin, Iowa Havre, Mont. Poteau, Okla. Georgetown, Ky. New Liberty, Ky. McCook, Nebr. Bison, Kans. Glendale, Colo. St. Paul, Minn. Mott, N. D. Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Rich, Homer Ruka, Emil A. Schafer, Joseph G. Schwartz, Samuel G. Stockton, Marcellus L. Schermann, Louis W. Schneider, John F. Steinman, Wm. A. H. Smith, Marshall A. Slusser, Carl W. Sherman, John N. Schmalhorst, David L. Seehorn, Newton A. Slocumb, Hugh H. Smiley, Robert B. Smith, Samuel C. Smith, William F. Spangler, Harve B. Stocking, Fred F. Swanson, Carl L. Sweet, Edward A. Swezey, Frank A. Tilton, Welcome B. Tenerowicz, Rudolph G. Thompson, Thomas G. Treichler, Martin J. Tremblay, Julien L. Taylor, Edgar G. Vermillion, Leroy Earl Vandever, Harl F. Wheeler, LeRoy J. Winternitz, David H. Waite, George R, Weisgerber, Arthur L. Williams, Alexander F. West, John F. Wagar, Leonard S. Wilson, Edmond W. Waid, Edward P. Yazel, Herman E. Zimlick, Arthur J. Zugg, Clark Vernal, Utah Boscobel, Wis. St. Louis, Mo. Mumbird, Wis. Gridley, Kans. St. Louis, Mo. Oshkosh, Wis. St. Louis, Mo. Gallatin, Mo. Denver, Colo. Samuels, Ky. St. Louis, Mo. Hutchinson, Kans. Belgrade, Minn. Stevens Point, Wis. Greenup, Ky. Atchinson, Kans. Salt Lake City, Utah West Levanon, Ind. Omaha, Nebr. Helena, Mont. Wakonda, S. D. Grant City, Mo. Chicago, Ill. Sioux Falls, S. D. Hancock, Wis. Butte, Mont. Pretty Prairie, Kans. Tescott, Kans. Lahoma, Okla. Ellwood, Kans. Colorado Springs, Colo Kiowa, Kans. Perry, Kans. Neodesha, Kans. Iroquois, Ill. Florence, Kans. Rolfe, Iowa. Salem, Michigan Bartlesville, Okla. Germantown, Pa. Topeka, Kans. U Q l a . . fir? ,. Q L'.1'7:3. ' - I . i-if T ,, I RZ.. 1- 7. 4 , - 5 Capt. Capt. Capt. Capt. Capt. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Critchlow, C. A. Daly, J. J. Farmer, J. E. Leggat, A. C. West, E. S. Andrews, F. E.-L.C.C. Baker, J. I-I.-L.C.C. Beach, M. Bellinger, I. E. Bowman, I. E. Bradford, D. C.-X.R.C. Bradley, W. C.-L.C.C. Brodie, W. W. Cocchine, A. S.-L.C.C. Clark, W. E. Cleveland, M.-L.C.C. Coffin, E. L. Colsh, L. L.-L.C.C Corn J. A. Crumine, L. B. Davis, C. Dripps, R. C. STUDENT NIEDICAL OFFICERS. COMPANY NO. 14 Koster Mellen, Wis. Decorah, Iowa Russellville, Ky. St. Louis, Mo. No. Yakima, Wash. Cleveland, Ohio Indianola, Okla. Clinton, Kans. Salem Oregon Adon. Ind. Springville, Ala. St. Louis, Mo. Tulsa, Okla. Denver, Colo. Aberdeen, S. D. New York N. Y. Ashland, Maine Maplewood, N. J. Amoret, Mo. Ellsworth, Penn. Mdfgan City, Miss St. Louis, Mo. Lieut. Lieut. Lieut. Lieut. Lieut.' Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Dugay, H. W.-L.C.C. Elders, F. A. Elmer, R. F. Fast, W. R. Forrester, R. E. Geyer, C. W.-X.R.C. I-Iarris, I-I. C. I-Iaughey, L. E.-L.C.C. I-ledge, M. O. I-Iendrickson, A.I-I.-L.C.C. I-Ieuschele, W. I-I. I-liner, B. C. I-Iixson, A. I-I.-L.C.C. Hobart, W. K.-O.C. I-Iockaday, J. A. Holcomb, R. N. Irwin, J. C.-L.C.C. Jenkins, J. G. Kinne, I-I. W.-O.C. Koppenbrink, W. E.-O.C. Larson, A. N. Levin, S. S. Kansas City, Mo. I-Iematite, Mo. Chicago, Ill. Atchison, Kans. Burleson, Texas Aurora, Ill. Wilmot, S. D. Concordia, Kans. Kansas City, Mo. Sioux City, Iowa Agnew, Calif. Evansville, Ark. Columbus, Ohio Topeka, Kans. Pratt, Kans. . Danville, Va. Los Angeles, Calif Hubbard, Texas West Chicago, Ill. Alma, Mo. Jasper, Minn. St. Louis, Mo. ,S . 4 .J A l Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Little, W. S. Low, C. E.-O.C. McAnulty, J. P. McCaffre E. H . yy , McCarty, E. D.-O.C. Maness, C. E. . Matlock, C. W.-X.R.C. Mallier, W. J. Mix, W. S. Morrow, T. M. Neel, W. H. Newlon, M. Percell, C. W. Perring, F. S.-L.C.C. Portman, U. C.-X.R.C. Pullian, M. J.-X.R.C. Richetts, F. B. Riley, C. L.-L.C.C. 'Schoenfeld, O. E.--L.C.C. Schwerttey, J. F. ' STUDENT IVIEDICAL Ob'FICEIIS, COIVIPANY NO. 14 Koster Owensboro, Ky. Coquille, Oregon. San Angelo, Texas. Brooklyn, N. Y. St. Louis, Mo. Stella, Mo. Marion, Kans. St. Louis, Mo. Beardstown, Ill. Medicine Lake, Mont. Bowling Green, Ky. Lincoln, Nebr. Tuscon, Ariz. St. Louis, Mo. Jackson, Minn. St. Louis, Mo. Leslie, Mo. Merna, Nebr. Lathrop, Mo. Earling, Iowa. Lieut Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Shelby, M. H. Smith, M. F. Stone, A. R. Stout, W. Straw, E. E. Strickland, C. G. Sybenga, J. J.-X.R.C. Theis, E. M.-O.C. Thompson, J. C.-X.R.C. . Thompson, P.-L.C.C. Topmoeller, W. J.-L.C.C. Wald, R. H. Wallingsford, C. C. White, E. C. White, W. Cv. Wilhite, G. O. Wipperman, P. W. Wishard, R. S. York, w. B.-O.C. Charleston, Mo. Little Rock, Iowa. Palmyra, Mo. Enid, Okla. Marshfield, Oregon Clarendon, Texas. Pella, Iowa. Granville, Iowa. St. Louis, Mo. Brumley, Mo. Cincinnati, Ohio. Hastings, Minn. Ogalla, Nelor. Springheld, Ill. Lewistown, Mo. St. Louis, Mo. Minneapolis, Minn. Wheeler, Ill. Capt. Capt. Capt. Capt. Capt. Capt. Cat p . Capt. Capt. Capt. Lieut Lieut Lieut Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Brown, William S. Cole, Henry S. Dyer, B. G. Guest, A. W. Marshall, H. L. Nickell, L. O. Pearsell, R. Shields, N. J. Wildman, W. M. Young, G. A. Adkins, E. M. Badeaux, G. I. Bahlman, G. H. Barnett, E. J. Barregy, J. C.-+O.C Becker, W. C. Brandon, W. N. Broman, R. Brown, F. W. Carey, F. S.-I...C.C. Carter, W. Coffin, L. A. Cook, E. D. Cook, J. T. STUDENT MEDICAL OFFICERS, COMPANY No. 15 Elgin, Ill. Whitehall, Mich. Ames, Iowa. Jamestown, N. D. Stronghurst, Ill. Macon, Mo. Aurora, Minn. Wahpeton, N. D. Ft. Dodge, Iowa. Galatia, Kans. Brainerd, Minn. Flint, Mich. Peoria, Ill. Mason City, Iowa. Papillion, Nebr. Axtell, Nebr. Bay City, Mich. Williams, Iowa. Sherman, Texas. Farmington, Iowa. Maquoketa, Iowa. St. Louis, Mo. Koster Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut. SO Cooper, G. F.-L.C.C. Davis, C. F.-O.C. Dodd, C. Q. Erman, J. M.-L.C.C Evans, C. D.-L.C.C. Evans, J. N.-L.C.C. Eye, B. F. Fall, N. B. Ferrell, H. Fillmore, R. S. Finsand, V. Flieschman, A. G. Forbes, D. M. Foster, F. F.-X.R.C. Fox, E. F. Gaffey, F. H.-O.C. Gelpin, G. S. Gilroy, E. W.-L.C.C Hayes, C. F. Hendricks, H. H. Hutchinson, M. L. Jennings, T. V. Johnson, G. C. Kennedy, F. H. Kansas City, Mo. Kansas City, Mo. Newport, Nebr. Minneapolis, Minn. Columbus, Nebr. Columbus, Nebr. Talmage, Kans. Genda Springs, Kans Tyler, Texas. Corwith, Iowa. Aberdeen, S. D. Des Moines, Iowa. Kansas City, Kans. Kansas City, Mo. Chicago, Ill. Bradgate, Iowa. Des Moines, Iowa. Minneapolis, Minn. Arlington, Kans. Dallas, Texas. Dallas, Texas. Winters, Texas. Belle, Mo. Greenwood, Wis. f is .,, v'. ,. gpg ,? I , ix' 41 241, -' D , . A... 1.3- . .. . f' ,,,.- - - - ., r . V, -,. - . - . ,.,, Lieut Lieut. Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Kerrick, C. L. Kresensky, W. A. W. Laws, C. J. Lightner, O. N. Logue, L. j. Lyle C. F. Maples, F. H.-O.C. Mella, Hugo Morse, F. L. Murrell, R. E. Muren, A. L. Owen, R. -J. Peden, j. C.-X.R.C. Pindell, M. L. Price, H. H. Proctor, Carter A. Quiring, Walter C. Ramey, Winston G. ..... ac - STUDENT MEDICAL OFFICERS, COMPANY No. 15 Koster Cboisman, Ill. Creely, Iowa. Princeton, Mo. Benton, Kans. Houston, Texas. Booneville, Mo. Clever, Mo. Bismark, N. D. Lake Odessa, Mich. Kirkwood, Mo. St. Louis, Mo. Mill Springs, Mo. St. Louis, Mo. Macksburg, Iowa. St. Louis, Mo. Doniphan, Mo. Shawnee, Kans. Protection, Kans. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Ramming, Herman Coodwater, Mo. Redington, J. Crescent St. Louis, Mo. . Rendelman, Geo.T.-L.C.C. Anna, Ill. Salzberg, Ben A.-O.C. Saari, john A.-O.C. Sarver, Albert S.-L.C.C. Schreiber, Louis W. Smith, Muldoon-L.C.C. Steel, james A. Urbanowski, Leon V.--O.C. Warsham, Archer B. Weaver, Ross E. Weber, William W. West, Oscar C. Whittaker, .John L. Williams, Robt. S.-L.C.C. Wuttke, Edwin E. L.C.C.-Line of Communication Course. O. C.-Orthopedics Course. X. R. C.-X-Ray Course. Kansas City, Mo. Eneleth, Minn. Greenville, Ohio. Laurel, Md. Roby, Texas Las Cruces, N. Mex Peru, Ill. Brashear, Texas. Concordia, Kans. Hartford, Iowa. El Paso, Texas. Kansas City, Mo. St. Clair, Mo. Summer, Iowa. Major Ruth, C. E. Capt. Capt. Ca t p . Capt. Capt. Lieut Lieut Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Fisher, F. A. Cerrish, W. A. Jones, M. C. O'Malley, T. J. Pond, A. M. Allen, C. J. Anderson, F. A. Anderson, S. H.-L.L.C. Berkheiser, E. J.-O.C. Bernard, L. J. Biezer, S. Blinn, W. C. Bolka, B. J. Brand, G. J. Bridenbaugh, J.H.--X.R.C. Bromberg, C. B. Cabot, V. S.-X.R.C. Chamness, C. J. Chauncey, E. M. Clark, F. M. Clayton. H. C. Cohler, L. Cook, E. C.-L.L.C. STUDENT MEDICAL OFFICERS, COMPANY No. 16 . Koster Des Moines, Iowa. Chicago, Ill. Jamestown, N. D. Boone, Iowa. Chicago, Ill. Dubuque, Iowa. Rich Hill, Mo. Chicago, Ill. Wells, Minn. East St. Louis, Ill. Chicago, Ill. Crete, Ill. Michigan City, Ind La Fayette, Ill. Billings, Mont. Chicago, Ill. Minrfeapolis, Minn. Elkville, Ill. Albion, Mich. Chicago, Ill. Quincy, Ohio. Chicago, Ill. Mendota, Ill. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Cooper, H. E.-O.C. Cristy, R. E.-O.C. Damron, J. E. Dargatz, F. E. DeMoss, Cv. O. Desser, A. L. Dunn, J. N.-L.L.C. Dwyer, H. J. Edwards, F. P. Fordyce, A. W.-O.C. Francis, H. M.-L.L.C. Cates, L. V. C.iger,.U. S. Gunderson, E. A. Hearle, H. H.-L.L.C. Hallev, C. D. Hanson, E. W.-O.C. Hurley, C. I.-O.C. Harms, C. W. W. Harris, L. Cv. Hennessey, R. A. Higgins, R. P. Hole, M. L. Holst, John, Jr. Peoria, Ill. Chicago, Ill. Makanda, Ill. Kansas City, Xflo. Manchester, Iowa. Chicago, Ill. Minneapolis, Minn. Chicago, Ill. Keeta, Mo. Gilman, Ill. Woodstock, Ill. Janesville, Minn. North English, Iowa Chicago, Ill. Niles, Kans. St. Louis, Mo. Three Lakes, Wis. Noguiam, Wash. Omaha, Nebr. Chicago, Ill. Ausley, Nebr. Danville, Ill. Omaha, Nebr. N- Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut.- Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Housel, C. L. Hawes, G. F.-X.R.C. Israelson, William-L.L.C. jenkinson, E. L.-X.R.C. ohannesson C .-X.R.C. J , .j Johnson H. C. Kadlek, F. . Kelley, J. A.-L.L.C. Kleyla, j. R.-L.L.C. Knoll, R. F. Koch, H. C.-O.C. Kostrzewski, M. J.-O.C. Kotalik, F. LaForce, H. A.-L.L.C. MacDonald, E. j.-O.C. Mallison, S. N. Martin, L. W. Meyer, K. T.-X.R.C. Muller, C. j. Miller, F. M.-X.R.C. Myers, H. A. Newhauser, M. Norton, H. S. Oates, J. F.--L.C.C. STUDENT MEDICAL OFFICERS, COMPANY NO. 16 Ansley, Nebr. Arlington, Nebr. Chicago, Ill. Minocqua, Wis. Chicago, Ill. Iola, Wis. Chicago, Ill. Oak Creek, Colo. Omaha, Nebr. Chicago, lll'. Harvard, Ill. Chicago, Ill. Chicago, Ill. jasper, Mo. Chicago, lll. Canton, Kans. Plainwell, Mich. Brillon, Wis. St. Louis, Mo. St. Louis, Mo. Minneapolis, Minn. New Orleans, La. Chicago, Ill. Chicago, Ill. Koster Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Palmer, C. E. Perry, H. S.-O.C. Pitta, C. E. Ramser, H. A. Reuss, H. P.-O.C. Rimmerman, A. D. Robertson, A. P. Rogers, j. C.-O.C. Salberg, J. B.-L.C.C. Sanders, R. H. Schick, F. H.-O.C. Schwartz, F. F.-L.C.C. Shelton, B. Silverstein, W. I. Simms, C. C. Smith, H. A. Staib, H. A. Vehrs, G. R. L. C. C. -Line of Communication X. R. C.-X-Ray Course. O. C.-Orthopedic Course. S3 Daird City, Nebr. Chicago, Ill. Chicago, Ill. Chicago, Ill. Granite City, Ill. Rock Island, lll. Alton, Ill. White Lake, S. D. Boulder, Colo. Kemmerer, Wyo. Chicago, Ill. Chicago, Ill. Long Beach, Calif. Chicago, Ill. Lawton, Okla. Antioch, Ill. Chicago, Ill. LaGrande, Oregon Course. . Y-L . J 4 I ,-.. J, Qi..-l ' x' -r l'5J-.l'11ig5':'.B.,... -10. .- .,.v- ,, 5- .iraq if :- V ,. .',., - . rf- ,gg -1 , -f- va.: ,s ' vu ' sr 5 4.. .,i1w. .. . .. . -1... 1- J---.. .. . . .1 ..1 N- .. .mg-M.:-n N...-.. .M any . . . s B - A : rs.. fd 'li Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Elliott, Charles E. Houghland, Walter L. jones, Robert 'M., jr.- O. Mackenzie, Thomas A.-C Matthews, j. G.-O. Owen, A. K. Rhodes, F. G. Whiteaker, Hall Wood, Frank L. Yerkes, Louis N. Young, Daniel W. Alleger, William E. Allen, L. G. Antony, joseph T. Aulick, R. R. Bevill, S. D. Booth, C. O. Brown, Albert L. Cade, W. H. Cantrell, T. D. Chenoweth, Olen E.-C. Christenson, john R. Christianson, Henry STUDENT MEDICAL OFFICERS, COMPANY No. 17 Koster Victor, Colo. Peoria, Ill. Fresno, Calif. Miles City, Mont. Spokane, Wash. Topeka, Kans. Sioux City, Iowa. Mound City, Ill. Lynden, Wash. Elk Rapids, Mich. Paris, Ill. Pittsford, Mich. Lenexa, Kans. Omaha, Nebr. Carmen, Okla. Poteau, Okla. Denver, Colo. Leavenworth, Kans. San Antonio, Texas Bloomington, Ill. Lima, Ohio. Eagle Grove, Iowa. Chicago, Ill. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. 54 Cleff, Oscar Coleman, O. E. Dangerfield, Virgil S. Devers, W. E. M. Edwards, Alonzo M. Elias, Frank J.-X. Engels, C. F. Etter, R. Fowler, james H. Fox, Raymond H.-C. Fry, C. S. Gardner, C. C. Goss, H. L. Haig, Gwyn F. Hamilton, Ernest H. Hanly, Harry H. Harbour, S. C. Harris, C. P. Hermann, Carl B. Hoagland, B. W.-C. Holtz, Kenneth J.--X Hough, W. j. Howard, George W. Jessup, Nathin J.-C. Chicago, Ill. Ainsworth, Nebr. Luray, Mo. Comles, Nebr. Marion, Ill. Racine, Wis. Seattle, Wash. Hubbard, Texas Lancaster, Wis. Altus. Oklahoma. St. George, Kans. Ashland, Okla. Minneapolis, Min Le Roy, Ill. Kilgore, Texas Peoria, Ill. St. Louis, Mo. Oak Park, Ill. Chicago, Ill. fl Woodbridge, N. j. Trenton, Wash. Tacoma, Wash. Dallas, Texas Detroit, Mich. .'..-. .1 Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Kariher, H. C. Kimball, George W. Kirklin, B. R. Lowe, A. L. Lee, Daniel S.-C. Little, Daniel E. McDowell, ,Joseph E. Mackey, Frank W. Madden, William D. Markham, H. B.--O. Marks, W. R. Moffatt, F. -1. Moore, james M. Moore, William N.-O. Newman, S. H. Overmeyer, George W. Person, Robert C. Peters, Charles E. Pickett, William J.-O. Postlethwaite, F. M. Randall, George B. Rathbun, C. A. Reed, T. B.-C. STUDENT MEDICAL OFFICERS, COMPANY No. 17 Koster Champaign, Ill. La Parti, Ind. Muncie, Ind. Robinson, Ill. Scotland, Ill. Eufaula, Oklahoma. Shamrock, Texas Milwaukee, Wis. Great Falls, ont. Marquette, Mich. Vinita, Okla. Clyde, Kans. Madison, Kans. Appleton, Wis. El Paso, Texas Seattle, Wash. Benson, Nebr. Manou, Ind. Chicago, Ill. Kansas City, Mo. Buhl, Idaho. Rice, Minn. New York, N. Y. Lieut Lieut Lieut Lieut Lieut Leuit Lieut Lieut . Reid, Robert W. . Robertson, J. J. . Rogers, A. E. . Solomon, Harry S. . Stephens, jamie D. . Stevens, N. C. . Stewart, j. D. . Stolper, j. H. Lieut. Strato, L. K.-O. Lieut Lieut Sutton, Robert S.-G. I Swanson, j. T.-X. Lieut. Swanberg, Harold Lieut. Thomas, Charles A. Lieut. Wahl, E. W. Lieut. Weih, Elmer P.-C. Lieut. Wiik, J. C.-O. Lieut. Wilkinson, -John -I. Lieut. Williams, Reuben H. Lieut. Wilson, Ernest E.-X. Lieut. Yeakel, Earl L. O-Orthopedics. C-Lines of Communication. X-X-Ray. Union City, Ind. Kingsville, Texas. Bloomington, Ill. Chicago, Ill. Temple, Texas. Morristown, N. J. Hartford, Mich. Muskogee, Okla. Sutton, Nebr. Bartlett, Texas Kansas City, Mo. Chicago, Ill. Edna, Kans. Sterling, Ill. Clinton, Iowa. Moscow, Idaho. Hales Corners, Wis. St. Clair, Mo. Berkeley, Calif. Oklahoma City, Okla Major Buehler, E. Major Roblee, W. W.-C. Capt. Capt. Capt. Capt. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Brown, R. D. Bortz, J. A.-O. Hamilton, C. B. Ward, M. H.-C. Abbott, J. G. Ammick, L. B.-C. Bell, F. H. Boone, W. H. Baumgarten, R. C. Bonoff, K. M. Bisson, W. C. Boutwell, L. R.-66 Burg, W. A. Butzow, T. F.-6 i. iv mm if STUDENT MEDICAL OFFICERS, COMPANY NO. 18 Koster Indianapolis, Ind. Riverside, Calif. Mobile, Ala. Nauvoo, lll. Oakland, Calif. Sufferin, N. Y. Riverside, Calif. Millersburg, Iowa. Sycamore, Ill. North Yakima, Wash. Seattle, Wash. Los Angeles, Calif. Charleston, Ill. Kirkwood, Mo. Uniontown, Wash. Chicago, Ill. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Bush E. R Clark I. C Coen C. M Conroy G A Copeland, N. Dively, R. L. Downs, A. W Byrnes, J. A. Carter,'R. G Eastman, I-. Eide, A. T. Epperson, P. Evans, W. H. Fisk, R. R.- Given, M. A. Gillis, J. P. S.- C. O. . K. Pittsfield, Mass. Indianapolis, Ind. Los Angeles, Calif. Oconto, Wis. Cornell, Ill. Chicago, Ill. Chicago, Ill. Colorado Spgs., Colo Chicago, lll. Chicago, Ill. Chicago, lll. Biwabik, Minn. Murphysboro, Ill. Brookins, S. D East Chicago, Intl. Deerbrook, Wis. iam iw .wmv Q1 4.31.1-.i 'bf , 41.34. ..,, , ,, J 'ffeyva --' .,- ' 6.. -Q '- 'jf'-. V--?:d.,3'j 5'32'y, .. ,Q 5-U .fpncgf-ftfhix 'A-A - A . . is --.Q-wx' tg, 4 .-.Cif,f'Li'o 'uv pf-' . 1 .i . ua .fn .rn ' yi. 5 yi' A v- v' .Z . ' I 1' ,Alf 1' vi' 'l -.,. N - . '- . '. ,. Lil -.'3,2:.r'vf .- -'55 '- 1'1 fX' oi- ' ' ' .1 -. . In 1 -- R13 H . -w. ,te-.,-,, A 5 .v v,..f,. h, , ,-3 ,, 1 K... x .. ., , .. ax-. r R . . ,..- ....,s- 'Q 5- ','4'.f'-Lf.-5j.u31',? '!'oQ'11'f.f '.,f.3v1f', -- .v 'Rs -Q1 . W. . . ' eu . '- N. f' -' I ' . ' '...- .ff ' . '. .-a 1.' '52.f,fI94.h.Ief ,, .. .,-4 .fm,-mf-4 .. -, ,ax--,.,.,, .1.....i-ILEAC-. as---nm'-'x.-..1 4... . a.-. - . . . - a..'. 4 -. -, 1. Lieut. Lieut. Licut. Lieut Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Guthrie, M. C. I-Ienchen, G. Hurlbut, S. R. Johannes, E. W. Kelly, J. F. Lanier, L. M. Lynch, P. V. Malone, F. lf. Mashhurn, N, C. Matteson, C. W. Merrill, B. ll. Miller, J. L. Mitchell, W. B.-C. Moeller, M. W. Moon, O. B. McGueggan, J. Il. STUDENT Mi-:DICAL OF!-'lox-IRS, COMPANY No. IS Koster Louisville, Ky. Georgetown, Texas Chicago, Ill. Chicago, III. Dawson, Nebr. Nashville, Tenn. Evansville, Ind. Los Angeles, Calif. Boliver, Tenn. Wichita, Kans. Santa Paula, Calif. Los Angeles, Calif. Sumner, Wash. Milwaukee, Wis. Bella Buckle, Tenn. Winnebago, Minn. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut 57 Nlcl-lenry, R. Ii. Paul, B. ll. Pedersen, I-l. C. Peters, C. M. Presnell, U. A. Poley, C. W. Pike, N. Rea, lvl. O. Rood, W. A. Roen, P. B. Shellito, J. C. Shrefiler, A. R. Snider, S. N. Wainscott, C. O. Watt, Geo.-C. Williams, C. W. Georgetown, Texas Tacoma, Wash. Dannebrog, Nebr. Canton, Ohio. Kennett, Mo. Boulder, Colo. Decatur, III. Dallas, Texas Covina, Calif. Los Angeles, Calif. Independence, Iowa St. Louis, Ivlo. Campbell, Mo. I-Iermiston, Oregon Providence, R. I. Laclede, Idaho. w.,..g X-Q 4 .lt , N . - t. .-.1 fl. 15.1. .' Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Cole, Herbert P. Bennett, Robert M. Elliott, R. S. Gist, R. D. Hansen, O. A. Miner, H. R. Schurmeier, H. L. Taylor, C. B. C. W. West Birkelo, Carl C. Collins, Charles David Cook, john O. Cutting, Lloyd D. Davis, M. S. Davies, R. E. Donnelly, L. C. Dye, W. G. STUDENT MEDICAL OFFICERS, COMPANY No. 19 Koster I Mobile, Ala. Mound Valley, Kans. Duplainville, Wis. Amarilla, Texas. Claypool, Ind Falls City, Nebr. St. Paul, Minn. What Gheer, Iowa. Elko, Nevada. Rosholt, Wis. Chicago, Ill. Savannah, Ga. Stevens Point, Wis. Marion Ind. Bement, Ill. Detroit, Mich. Great Falls, Mont. Lieut. Lieut. Lieut Lieut Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut. Lieut. 58 Dingman, N. M. Druet, A. L. Edmonds, William Evans, L.--D.R.C. Fasser, A. O. Fox, C. M. Franklin, J. H. Fleming, W. S. Frankson, B. Gittens, T. R. Green, F. C. Harwell W. R. Hunter, R. M. I-Iusser, A. A. jackson, W. L. Kelsheimer, I. D. Kitterman, P. G. Larchwood, Iowa. Nebraska City, Nebr. jacksonville, Fla. Belle Fourche, S. D. Chicago, Ill. Spring Valle, Ill. Ness City, Kans. Rugby, N. D. Williamsburg, Iowa. Oglesby, Texas Osceola, Ark. Clinton, Ark. Hingham, Mont Muenster, Texas Paxton, Ill. Ottumwa, Iowa. . 1 ' f 4 uf., .Q. , . - ,B - .-f,g'.I.j.:'..I' i f .A . , , J.-3.,:'f -' .,q '.',,.. ' - .-14 4.5, - .--1. n. .- v-as XR- -A Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Konzelman, j. A. Lahners, T. Lawrence, E. K. I..yle, R. C. McDonald, A. C. . Marshall, P. I..-D.R.C. Mason, E. C. Mason, C. H. M. Minahan, P. R. Monteith, C-. Nathanson, D. M. Parker, H. F. Postle, H. V. Prill, H. C. Quinn, R. bl. Ramsdell, E. G. Roberts, C. A. .. ,s,L ,.....L..-:.....-.. STUDENT MEDICAL OFFICERS, COMPANY No. 19 Koster St. Louis, Mo. Belvidere, Nebr. Great Bend, Kans. Bridgeport, Mich. Hannah, N. D. Columbus, Ohio. Quebeck, Tenn. Huffman, Ark. Fon du Lac, Wis. Hazelton, N. D. New York, N. Y. Warrensburg, Mo. Cleveland, Ohio. Burke, S. D. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Sansing, C. Schwartz, H. Seibert, A. W. Shelton, F. W. Shovholt, H. T. Stueck, A. F. Thompson, I-I. B. Thompson, W j. G. D. Townshend Traxler, P. S. Tucker, C. C. Wells, R. L. West, W. E. Willis, T. A. Winslow, G. H. Wumkes, P. G.-D.R.C. Duluth, Minn. Butte, Mont. Wenatchee, Wash. Independence, Kans Mooreton, N. D. Mishicot, Wis. Seattle, Wash. Portage, Wis. Plymouth, Wis. Kansas City, Mo. Nashport, Ohio. Trenton, Mo. Iowa City, Iowa. Grainfield, Kans. Chicago, Ill. sw... . 7 -fs- Major Capt. gapt. .apr Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Burnham, A. C. Hinkle, S. B. Jefferson, H. A. Kraft, F. E Tuffley, F. S. Admas, A. R. Berger, A. J. Bouse, W. G. Brethour, G. E. Baird, J. C. Bachinski, L. J. Brooke, H. C. Cook, S. De Puy, T. L. Davis, P. C. Drace, C. W. Dishmaker, D. B. S'I'UDEN'I' NIEDICAL OFFICERS. COIWPANY NO. 20 Koster New York, N. Y. Little Rock, Ark. Clintonville, Wis. Soldiers Home, Kans. Boscobal, Wis. Easton, Kans. Chilton, Wis. Centralia, Kans. Eau Claire, Wis. Milwaukee, Wis. Plainview, Ark. . Qulin, Mo. Jamestown, N. D. Moberly, Mo. Piggott, Ark. Kewaunee, Wis. 'R tru' W Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut ..rF?iP!i,z2 LIL +31'J.1.:.?'J' VW' Dingus, J. D. Federman, E. H. Flury, J. A. Gore, L. M. Gettinger, A. J. Cwrualtney, B Griot, A. J. Griswold, G. W. Horner, T. E. Hanna, J. F. Holt, S. W. Hughes, J. R. Harvey, J. R. Harrell, M. E. Helm, H. M. Henry, H. B. Heim, R. R. Mound City, Kans Montello, Wis. Toledo, Ohio. Galva, Kans. St. Louis, Mo. Haskell, Ark. St. Louis, Mo. Atchison, Kans. Fargo, N. D. Newark, Mo Doclgeville, Wis. Footville, Wis. Kokomo, Ind. Beloit, Wis. - Little Rock, Ark. Marinette, Wis. ' A an m.sv'9 i' wi fr-mum in .Prism Lieut Lieut. Lieut. Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut Lieut Isenberg, B. A. january, C. C. Kyllo, J. C. Kilpatrick, G. A. Knecht, L. B. Long, L. H. Ludden, I-I. D. McClure, W. B. Murphy, W. T. Maertz, W. F. Moore, O. O. Marrs, E. A. Mabry, P. S. Nelson, O. A. Oftedal, A. Ott, L. S. S. STUDENT MIQIJICAI. OFIPICERS, COMPANY NO. 20 Koster Alton, Kans. Centerville, Mo. Wilburton, Okla. Popular Bluff, Mo. Denver, Mo. Mineral Point, Wis. Hale, Jo. Waukesha, Wis. New Prague, Minn Topeka, Kans. Moline, Kans. Rochepoty, Mo. Park Falls, Wis. Fargo, N. D. Topeka, Kans. Lieut Lieut. Lieut. Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Pence, j. R. Partridge, O. F. Pfeifer, E. C. Rucker, F. T. Riegler, N. W. Slaughter, J. W Sheppard, C. E. Shippy, V. bl. Strauss, A. W. Shearer, F. Smith, C. C. Sample, R. C. Stephens, C. B. Simpson, J. E. Weingart, W. F. Weston, U. C. Minot, N. D. Mattoon, Wis. Sheboygan Falls, Wis Mott, N. D. Little Rock, Ark. Wesson, Ark. Baldwin, Kans. Stevens Point, Wis. Little Rock, Ark. Edgerton, Wis. Stanton, N. D. St. Louis, Mo. Ottawa, Kans. Endeavor, Wis. Milwaukee, Wis. Osgood. Mo. x.... Major Capt. Capt. Capr. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Eliot, E. Andrews, C. W. Beatty, J. R. Smith, C. A. Unsell, j. B. Anderson, H. O. Blair, -I. B. Beaman, C. W. Biddle, P. D. Bing, B. Blizzard, D. M. Boon, E. H. Buckley, W. E. STUDENT MEDICAL OFFICERS, COMPANY No. 21 New York, N. Y. Waupaca, Wis. Butte, Nebr. Osceola, Mo. Louisiana, Mo. Williams ort Tenn. P , Vancouver, Wash. Cmcmiqau, Ohio. Columbia, Tenn. Pomeroy, Ohio. Orrville, Ohio. Nashville, Tenn. Spring Valley, Wis. Koster Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut 62 Buell, H. A. Calvert, L. C. Clifford, P. M. Donohue, W. E. H'Doubler, F. T. Engesather, F. A Fortner, W. H. Graf, C. H. Graham, J. M. Harned, W. B. Harker, H. bl. Havre, S. j. Heimark, A. J. Chippewa, Falls Wis Weston, Mo. Green Bay, Wis. Antigo, Wis. Madison, Wis. Brockett, N. D. Shelbyville, Ind. Portsmouth, Ohio. Frinta, Utah. Chattanooga, Okla. Horton, Kans. Kenmore, Ohio. Finley, N. D. Lieut. Lieut Lieut. Lieut. Lieut. Lieut Lieut.- Lieut Lieut Lieut. Lieut Lieut. Herman, L. R. Holbrook, W. F. Holland, D. A. jarrell, F. Latham, L. L. Lanphier, V. A. Lindsey, E. L. Loughlin, T. F. McCormick, T. F. MCC-rath, E. F. Nauth, W. W. O'Brian, H. N. STUDENT MEDICAL OFFICERS, COMPANY No.121 Koster Conde, S. D. Kansas City, Mo. Cambridge, Kans. Huttig, Ark. Latham, Mo. Omaha, Nebr. Fort Smith, Ark. Manitowoc, Wis. Milwaukee, Wis. Appleton, Wis. Minneiska, Minn. Dorie 1, Wis. Lieut. Lieut Lieut Lieut. Lieut. Lieut Lieut. Lieut Lieut Lieut Lieut. Lieut. Orr, W. E. Olson, A. L. Raber, D. D. Roay, G. R. Rehling, C. F. Schaefer, C. O. Sheehan, J. R. Smith, J. A. Thompkins, C. R. Wheeler, M. W. Winter, W. A. Wolfe, R. C. Girard, Kans Stoughton, Wis. Gridley, Ill. La Crosse, Wis. Fremont, Wis. Racine, Wis. Milwaukee, Wis. Noonan, N. D. Obeson, N. D. St. Paul, Minn. Widner, Ark. Little Rock, Ark Major Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Aves, C. M. Lane, J. W. Brooks, E. R. Caldwell, H. C. Chamberlain, L. H. Countryman, J. E. Dunham, W. H. Fast, L. Hearst, W. L. MacKinnon, A. C. Marshall, W. H. Mitchell, L. E. Roberts, V. Sibley, F. C. Steenberg, H. S. Tukey, W. H. Vessels, F. M. White, J. E. Allen, E. D. Allen, J. S. Ash, R. C. Bachman, N. M. Ballou, J. G. Bausch, R. P. Beach, W. E. Beeby, R. J. Berge, P. L. S'rUDEN'r MICIJICAI. OFFICERS, COMPANY No. 22 Koster Houston, Texas. Dorchester, Mass. Cleveland, Ohio. St. Croix Falls, Wis. Grand Rapids, Mich. Crafton, N. D. Shaftsburg, Mich. Paulding, Ohio. Cedar Falls, Iowa. Lewiston, Mich. Flint, Mich. Cheyenne, Wyo. Cedar Rapids, Iowa. Carmi, Ill. Milwaukee, Wis. Boise, Idaho. Perryville, Mo. Twin Falls, Idaho. Crooksville, Ohio. Norwalk, Wis. Ashland, Ohio. Cleveland, Ohio. Toledo, Ohio. Columbus, Ohio. W. Middletown, Ohio. West Branch, Mich. Brainerd, Minn. Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut. Lieut Lieut. Lieut. Lieut. 64 Beverly, C-. W. B. Baccelato, S. L. Binet, H. E. Boesel, I. H. Bowman, J. C. Boylan, J. D. Burns, H. A. Bush, L. M. Cain, C. L. Carney, J. Cv. Closz, H. T. Cooper, C. A. Cooper, C. H. Cosgrove, J. H. Cowper, W. L. Crawford, J. H. Craven, L. L. Dapp, W. E. Davis, B. P. Deming, I. S. Devine, C. B. Dinsmore, A. J. Doleman, N. F. Doran, W. E. Doughty, J. W. Edgar, J. D. Eterno, J. Alma, Kans. Memphis, Tenn. Coleraine, Minn. New Irvin, Ohio. Upper Sandusky, Ohio Milford Center, Ohio. Hutchinson, Minn. Cournna, Mich. Elmwood, Wis. Parkston, S. D. Webster City, Iowa. Norwalk, Wis. Burley, Idaho. Duluth, Minn. Michigan, N. D. Castlewood, S. D. East Pann, Iowa. Barberton, Ohio. Woodburn, Ky. Marshall, Wis. White Pine, Mich. Colon, Mich. Shaftsburg, Mich. Elroy, Wis. Henry, S. D. Chicago, Ill. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut' Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Gale, L. R. Gallen, F. T. Geib, O. P. Goodwin, E. Gramley, W. Griswold, C. M Hackman, H. C Hadley, A. W. Harrison, A. W. Hawkins, J. S. Hersh, H. E. Huff, L. D. Huston, R. R. James, A. W. Kaminski, T. R Kaminski, Z. L. Kelly, J. T. Kirkham, H. A. Koger, R. G. Kovinsky, A. Lambert, R. H. Law, W. P. Lawrence F. A. Lippold, P. H. Locker, G. E. STUDENT MEDICAL OFFICERS, COMPANY No. 22 Koster Newport, Ohio. Columbus, Ohio. Hubbardston, Mich. Bay City, Mich. Detroit, Mich. Dale, Wis. Flint, Mich. Jasonville, Ind. Detroit, Mich. Palmerton, Pa. Des Moines, Iowa. Cope mish, Mich. Muscoda, Wis. Detroit, Mich. Detroit, Mich. Detroit, Mich. Richmond, Mich. Norwich, Kans. F lint, Mich. Calumet, Mich. Westmoreland, Te Elyria, Ohio. Escanaba, Mich. lantha, Mo. l'1I'l. Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lowe, J. W. Martin, C. A. McComb, E. V. McCrorry, T. J. McLaughlin, N. Mix, D. J. Morrow, C. S. Nelson, J. D. Newby, H. D. Ostrander, F. R. Pinney, L. J. Rohde, P. C. Schlegelmilch, W Siler, J. E. Smeck, A. R. Smith, H. L. Stark, R. P. Stevenson, B. L. Thompson, W. B. VanGund C. L. Y, Vardon, C. C. Wheelock, D. O. White, C. A. Whittaker, B. T. Wilson, F. D. Fairmont, Minn. Mt. Clemens, Mich. Menominee, Mich. Racine, Wis. Lake Odessa, Mich. Chicago, Ill. Nashville, Tenn. Milwaukee, Wis. Parker, S. D. Milan, Mich. Detroit, Mich. Detroit, Mich. Detroit, Mich. Jellico, Tenn. Detroit, Mich. St. Joseph, Mo. Allegan, Mich. Benton Harbor, Mich Los Angeles, Calif.. Rockfield, Ind. Detroit, Mich. Kampeska, S. D. Burnips, Mich. Boone, Iowa. Armour, S. D. Major Major gapt. apt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Aves, Charles M. McGlasson, Irvy L. Asbury, Levi M. Bates, George L. Carter, Francis F . Carver, William F. Clark, Noah W. Fast, LeRoy Lacey, Walter M. Owen, George Bernard Sewall, George M. Sharpe, Novelle Wallace Sibley, Frank C. Steensberg, Herbert S. Vessels, Francis M. Andrew, G. Frank Bagby, Louis Barry, Augustus C. Barry, Howard J. Benson, Adelbert H. Bowman, J. Craig Breakey, James S. Brooks, Henry W. STUDENT MEDICAL OFFICERS, Koster Houston, Texas. Waco, Texas. Marceline, Nevada. Monesville, Vermont. Seneca, Karas. Ft. Dodge, Iowa. Rossville, Ind. Paulding, Ohio. Cheyenne, Wyo. Polson, Mont. Boise, Idaho. St. Louis, Mo. Carmi, lll. Milwaukee, Wis. Perry-ville, Mo. La Crosse, Wis. Vinita, Okla. Maywood, Nebr. Sun Prairie, Wis. Sheridan, Wyo. Upper Sandusky, Ohio. Mason, Ill. Geneva, Ga. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut 66 COMPANY No. 23 Brown, R. Newman Bumpus, Herman C., Jr. Callahan, Herbert W. Cooper, George H. Corbett, Bernard F. Deming, Ralph Dewey, George W. Doleman, Nathan F. Doughty, James W. Dunham, Royal W. Eterno, James , Evans, Raymond Fetter, Earl W. Foster, Miles E. Fraker, Samuel Reed Frisch, Isaac J. Gallatin, Herbert H. Gearhart, Alonzo P. Gearin, John J. Hall, Clarence W. Harrison, Alfred W. Harrison, Ernest F. Hole, Berton W. McGehee, Ark. Rochester, Minn. Collinsvillle ,Okla. Burley, Idaho. Detroit, Mich. Sharon, Conn. Fairmont, Minn. Tintah, Minn. Elroy, Wis. Angola, Ind. Chicago, lll. Terre Haute, lnd. North Platte, Nebr Ft. Smith, Ark. Cass Lake, Minn. Chicago, Ill. Lovington, N. M. Blackwell, Okla. Chicago, Ill. Hutchinson, Kans. Warrensburg, Mo. Kennet, Mo. Ashland, Ill. 5. Lieut. Lleut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Hoffman, John M. Hunt, Arthur Hylend, Clarence M. Jensen, William C. Kennedy, jacob j. Kyes, Sherman M. Lackner, Frank Luger, Lowell L. Logan, Henry V. Martyn, john H. Martin, james H. Moses, joseph McCormack, Grover C. McKibben, Harry E. McConathy, Green Warren McNaughton, Cvuy P McVoy, james R. O'Shea, john W. Olsen, john W. Park, Durwood B. Phillips, Frederick M. Phillips, Warren M. STUDENT MEDICAL OFFICERS, COMPANY No. 23 Campaign, Ill. Howe, Okla. Omaha, Nebr. Worchester, Mass. Frankford, Mo. Owne, Wis. Aurora Ill. Allerton, Iowa. Rushville, Ind. Cuba, Mo. Pilot Knob, Mo. Northfield, Minn. St. Louis, Mo. Webster, S. D. Edes, Tenn. Miami, Ohio. Trenton, Mo. Elmira, N. Y. Spokane, Wash. Laramie, Wyo. Tenia, Ill. Newton, Ill. Koster Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. 67 Powers, Robert A. Prescott, Lee W. Presson, Loren C. Porter, Earl S. Rappaport, Benjamin Reichelderfer, Vest D. Richmond, Charles D Roth, jesse H. Rubel, Harry F. Ryan, Lenies M. Sheafe, Earl V. Shryer, Julius L. Spalding, Lansford M. Strachan, Henry M. Stites, Randolph O. Thomson, john C. Thomas, john C. Tomlin, Russell R. Vincent, Leonhard H. Waldo, Elmer E. Williams, David C. Williams, john W. Oroville, Calif. Slivan, Iowa. Collinsville, Okla Moore, Mont. Ottawa, Ohio. Amanda, Ohio. jefferson, Minn. Kankakee, Ill. Ft. Dodge, Iowa. St. Louis, Mo. Portland, Oregon Durant, Iowa. Olean, Mo. St. Louis, Mo. Hindsboro, Ill. Taylor, Texas. Rogers ,Texas Easton, Ill. Crave, Oregon. Hamilton, Mo. Luther, Okla. Nashville, Mo. 68 Photographs by courtesy of Newspaper Enterprise Association, . Cleveland, Ohio. 69 wwnw if m-www -msn .,.i. -i,.,y. xxiv ly. fl -,M .1--,PQ ,.,,E.N:W,,N1i,XxgxR .X L1 ,. l'i'.,.,-' .. ii, L.. Vffiwi ..L.. ii .. .. it 5 t g' '.'-,Lvwriw .v ua-:Qin -- -'-' --s-1-I -- --'-- b - --a- -- I- 1- -X., -Y .N-.,.......... ..,..,.... .... . . . .....,... ....,.... .u................. .... N. ....,.... ,. -.............,..-..,..-.......................-.,...--..,.-......-...-...................... i, ,,,.,,,,m , ,Y-.mp If 'WVU' 41153197 I-'MHi!d'HHi'mM 0-w'l,81NR-lnlliilikl 'I-Hifirikmvmlmiiv !S'UK'i!iirv6fiW'k0 'USED 0 IIHUK11 0 Qiiillyrlliffl NUMB 'BOY Nik? 1,5 ,gm 5,fH,..- ,svn IIEADQUARTERS BASE HOSPITAL LIST OF OFFICERS ASSIGNED TO BASE Col. lst Lt Major Major Major Major Major Major Major Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. HOSPITAL Schreiner, E. R., MC. Duenweg, Rudolph, MC. Phillips, Bruce Cv., MRC. McNaughton, Peter D., MRC. Ridell, john D., MRC. Tinker, Martin B., MRC. Allport, Walter H., MRC. Alden, Betram F., MRC. Stone, Willard j., MRC. Atkins, Herbert, MRC. Wilmoth, William L., MRC. johnson, Erik j., MRC. Osborn, james W., MRC. Butler, james C., MRC. Nickerson, Bernard S., MRC. Marcum, Earl H., MRC. Cummings, Edson S., MRC. Negus, Alvah, MRC. Harding, john C., MRC. Matassarin, Leon, MRC. jackson, Henry C., MRC. Scales, Herbert L., MRC. Williams, K-ant E., MRC. Christmann, Paul, MRC. Barker, Oliver D., MRC. Napheys, William D., MRC. Carlyle, William L., MRC. Koller Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. lsr Lt. lst Lt. Ist L' Ist Lt lst Lt Scott, john R., MRC. King, Robert, MRC. Sippy, Alvin H., MRC. Benson, Robert L., MRC. Wintersteen, jeremiah B., MRC. Truitt, Ralph C. P., MRC. Dagg, Thomas L., MRC. Broman, Oscar F., MRC. Hissem, Ralph W., MRC. Carr, Mathew L., MRC. Merritt, Frank W., MRC. Bliss, Walter, MRC. Hayes, Henry j., MRC. Cattell, Henry W., MRC. Chadwick, Ira B., MRC. Luedtke, Gustav H., MRC. Benjamin, julien E., MRC. Engberg, Andrew, MRC. Stout, Walter M., MRC. Abbott, Charles S., MRC. Binford, William S., MRC. Lamb, Samuel H., SCNA. Greene, Earl F., SCNA. Beard, john j., MRC. Lardner, john C., MRC. Richardson, Russell, MRC. Finney, Guy A., MRC. Posey, Ernest L., MRC. jared, Vernon M., MRC. -nmaqufannmo-nwnmmav w animodlnnunmrmlwumutunmunwauuosnmonnnoaunnoallhuunnneuurnqqg . . .-1 . ..1'ff A .... V . -.... . ...........-,.,...a-aaCf....,.., W-, .,.,.,,,,- .,-W, ,,,, ,,,,,,,,,,,,,,,,,,,,,,,w,, QW,-, ,mn-M 1 uvv' H Mijn W -mm. 70 fl S 'l'l'fXlNl'Nld i'XP'll7 ll ll.fl Fil I.-Xl. Lfll 'llili il.. 3x - l ' -' , mum, ,.,.,.,-, .. 1-puu1ounn1nou-pQ,-,,' T',,,,,,, AA ,:'u,', .'Q:f'l'u l''gl ::.i-TQ'-'h,,T ''fi' ,qgnitgpnfvnnnzr o1oluQsoq1q.q1o1a al! ann Q1 l-lll l'l ll W l .,4 E1 ', .N,.AlNl.xs,-Xlw lst Lt lst Lt. lst Lt. lst Lt lst Lt lst Lt lst Lt. lst Lt lst Lt. lst Lt lst Lt. lst Lt lst Lt. lst Lt. lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt HEADQUARTEIXS BASE HOSPITAL Koster McEachern, Walter A., MRC. jackson, Arthur D., MRC. Purves, George M., MRC. Greenwood, Thomas M., MRC. Robertson, George A., MRC. Schoenfeld, Charles J., MRC. Belknap, Clarence H., MRC. Maercklein, Arthur G., MRC. O'Neil, Edward D., MRC. Bawden, George S., MRC. Yates, Charles A., MRC. Marshall, Roy J., MRC. Woods, Arthur R., MRC. Morris, Clyde L., MRC. Welch, james, MRC. Cleland, james S., MRC. Robinson, Lewis F., MRC. Tilton, Welcome B., MRC. Haynes, Solon E., MRC. Zugg, Clark W., MRC. Raines, Thomas H., MRC. Shanklin, Robert C., MRC. Barker, james C., MRC. Smith, Geo H., MRC. Bartlett, William C., MRC. Swift, George W., MRC. Kirklin, Byrl R., MRC. lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt. lst Lt. lst Lt. lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt Ist Lt lst Lt lst Lt lst Lt lst Lt lst Lt lst Lt Blanco, Pio, MRC. Sanford, james R., MRC. Callen, Russell, MRC. Douglas, Henry E., MRC. Becker, Wesley C., MRC. Murphy, Patrick S., MRC. Schwartz, Abraham B., MRC Mundy, Carl S., MRC. Way, Charles W., MRC. . Ousley, james W., MRC. Michael, joseph C., MRC. Frost, Carl G., MRC. Henry, Charles A., MRC. Sharpe, Frank A., MRC. Bruce, john R., MRC. Aud, Francis G., MRC. McClory, Anthony, MRC. Bartlett, Frank K., MRC. Curtin, john F., MRC. Nicholson, Samuel T., MRC. Rhode, Samuel J., MRC. Dickson, Ross O., DRC. Grannick, Theodore D., DRC Kelly, Oather A., DRC. Tiesse, Fred jr., DRC. Levin, William, SCNA. Freebourn, William j., SCNA Breuer, Louis H., QMCNA. WUQIMQAUQ ,, . f:-.. ..... ,,.-.l..-y lvllil JlCAl., Olrlli Qlilifi 'l'l2AlNlNf..l Cl..fXii'll7 -----f-1-M Y H Y -:fe f--xr: 4 1-Q: --f - - v-- -- - f-.:1:....-A...-.a:::.:L .Whaw-. ' ' '-:.::'f--1--A '--z W. f-f+ee----.-- 1. ---A-' 1--.f...-..f--T - - v .--we-.aa-----2: ik ll8hv'3li'Ui! U'dm5-P9 493355'U44-lilhvfifiiti'l1U0lfOlOil'1iDUliDld110 l'l'i9l' O'8UD01Kli4dll9ll'il6H9D0Dilil U 'D S -..l'l.fl lfll lffi, lx.-Xl -l EAT, Q13 ARMY NURSE CORPS Harding, Elizabeth, Chief Nurse Anderson, Anna J. Anderson, Della Barnett, Effie , Cedergren, Lovilla Dahl, Ethel S. Freed, Elsie M Fredstrom, Ruth Gates, Marie F. Graham, Kathryn A. Griffin, Myrtle E. Hayden, Helen T. Hedgal, Dora C. Holmes, Margaret Jacobson, Ruth C. Johnson, Frida, M. Johnson, Almeda M. Johnson, Signe T. Kammerer, Martha E. King, Edith M. Lahr, Victoria S. Olsen, Anna I. Porter, Lillian H. M. Reno, Margaret C. Shannon, Elizabeth M. Slorah, Anne M. Speller, Frances E. Stephenson, Hazel Vink, Honora Vlcek, Julia NURSES' CORPS, BASE YIOSPITAI. Koster DIETIANSQ MEDICAL DEPT. U.S. ARMY Clark, Ruth A. Karns, Lillian E. Mercer, Marjorie Rolls, Mary P. Stevens, Rita l. ARMY RESERVE NURSE CORPS Altman, Marie Aten, Katheriene Barclay, Helen E. Barker, Mabel V. Barrow, Alice A. Becklen, Alice A. Biggs, Nell L. Bill, Agnes E. Blankvoort, Margaretha Bonnstetter, Antoinette Brady Ann E. Brady, Valeta Breakey, Blanche B. Brewington, Frances R. Britton, Banche Brown, Dale A. Burns, Elizabeth G. Callahan, Mary A. Callan, Catherine H. Campbell, Margaret E Carlsson, Victoria Carney, Margaret E. Casperson, Alice Christensen, Anna C. H Clough, Ruth M. Cole, Anna Constantine, Helen R. Corcoran, Anne L. Cox, Adaline L. Cox, Nellie G. Craig, Cora V. Cranker, Frances J. Creelman, Margaret E Darlington, Eva Davis, Hazel Davis, Lyda W. Daivs, Theodora Dennis, Ella P. Doud, Sarah L. Drogseth, Maja Dundas, Mae R. Edstrom, Anna Erickson, Laura A. Farrell, Kathryn T. Fennie, Carie C. Fitzgerald, Eva J. Fitzpatrick, Agnes K. Fontaine, Cornelia Fowler, Effie L. Franklin, Ruth A. Frey, Annabelle D. iilblilillulllifvlliQlQlO liOil'il1lili M ww .-,..,:sff,,f--,........-em..,f,,,,:a-ff-A -f---1-asf:-2 --- r- ----- -- - M- --,M-3,--a 1-- . -fe.:----f iff:-.:.-M .. W -- -- f.w....-.ymznanvwua-uuuzu-wu. i 72 .,,... ly., -, .'il'1.'li ,w.,l, L -1'1'll l'1.N l l-.-XllNl!Nl. I l .-X. .l gpg 1: IM in Uzllidifi Q-mobs: w -mwlr 1 Ollli sci c alum Av amen 4 :mum-0 uwnaiv u awww L. Mug. wi - :P Gerkin, Engle C. Coney, Emeline Granburg, Maud E. Greisen, Eva C. Graube, Adele M. Guthrie, Sara E. Haley, Sara A. Hanson, Edith A. Harris, Margaret E. Hassett, May Alice Heidenreich, Elsie B. Hickman, Hallie J. Hillstrom, Cecelia Hugley, Bird B. johanssen, Nora S. Keaton, Martha E. Kemmer, Ethel B. Klock, Emma F. Klose, Helen A. Knauer, Louise A. Knowlton, Katherine Kolarik, Carrie Krueger, Bertha D. L. Kutzleb, Winona B. L. Leamer, Mildred K. Lehman, Estella O. Lindeberg, Louise A. Loftus, Genevieve K. Lord, Mary Lowry, Annie M. Lucks, Qlga Lund, Alma T. Nultsl-Qs' CURPS, BASE 1'l0SPl'l'Al. Koster Macauley, Margaret M. Matson, Caroline B. McCarthy, Mildred Mclntyre, Regina McLean, Estelle L. McClan, Sadie A. McManes, Estella M. McNair, Margaret Mecklenburg, Dora Merkel, Kathryn Messall, Elsie Millard, Nellie D. Morgan, Mary M. Morrow, Hazel M. 0'Day, Harriet O'Grady, Catherine A Olsson, I. Minnie Onsted, Hazel P. Owens, Nellie F. Pedersen, Thyra E. Phillips, Anna C. Pope, Elnora Price, Helen G. Rackliffe, Cora C. Randall, Helen F. Rasmussen, Agnes Roberts, Anna G. Roberts, Blodwyn L. Roberts, Minnie L. Robinson, Mary B. Roche, Katherine Roche, Mary Ruff, Clara M. L. Ryser, Roase A. Sabo, Bergit Sager, Inez H. Sandager, Pauline Sandelius, Elizabeth Sauerbier, Mary L. Schou, Karen Marie Schmitz, Caroline Schulte, Wilhelmina Sharpe, Alice M. Shellabarger, M. Elizabeth Silverthorne, Isabelle W. Simpson, jean H. Small, Mary E. Smith, Sarah Smith, Sarah A. Stansbury, Lillian A. Talty, Violet C. Urban, Lucy Ure, Mary Urquhart, Miriam Vinyard, Henrietta Watson, Margaret M. Welker, Lillian N. Wells, Edna C. West, Harriet M. White, Rose White, Rose E. Winkler, justina M. Winther, Abelone igxggigjpgqghbi iflllillhilbinisavxbltsoinlxvnabdih yamaha-nb!-sua a......,..-.........., .... --.,.:A................-.......-..-.......................... ...... .,....,.--.... .... .....-... .-.....-. f........s-h..... .- .i... ,..-. ...,.,.-..... . 73 V ,I K.. 11 y.,,, lc 8 Q-marina W- mmwsm xr' M:-MM M Mvvfv' 1 'WH-'r'-1 on '1'w1r4h Q' '4'i fV fY'-V'?135bN H minwdv hiiduizif -h w 1 'fu--vt -4:'hw '1-nu -I-w'f'rW-fvb -M wayifw rl IJ- :'Li1- 1 vu-01-12. 2 -asain 11 mv:-ith nv -QW!!! 'P Aimmrfv 2 -QZQNM -R W vmwzffvv N 'A'l1k 2' ? wa ,'w 1.2, RIDING PATHS l HAUNTS OF THE HORSEMAN Cure'-sam-s-nnvmnnsalnleoasumalluahounnmannmnnumuw-mnhqennounqnnnn-muanheauananouu .wmv .a...-umm-M -.4-vm-vnnyumw-ww! v-.fmuxmmu-an Luv-mm-xnlv-mmm..-1-.munwmm:,-na. -.::::'. 1 -1 :::ara-:ae-Q :--r: ' ' 1fr--f'e-Me-::.:::sg.1- '1 ' 2,..:.g.....-,:,:,11j.,, , ,,,, ...au l i i :J iviv ui xaiffflsli 'f' v Ebe Tvacuakion fflfospilal A' HE term Medical Department covers a wide scope in the service of the United States 'G' Army and it is not the object of this article to go into all the details of its duties, but X Z more to specialize in one of the important units in the field, i. e., The Evacuation Hospital. The primary object of the Medical Department is particularly applicable to the Evacuation Hospitals, more so than to any other branch of the department. i. e.. the re- turning of S. 82 W. to the front with least possible delay and of rapid and efficient trans- y portation to the rear of those who are seriously wounded and who will be unable to be returned' to the front for an extended period of time. The Field is technically known asthe Theatre of Operation and is divided into sections-The zone of the Advance and the zone of the Line of Communication. The zone of the Advance is that part of the Field that is actively engaged and of course includes the trenches. The zone of Line of Communi- cation is that portion lying immediately behind zone of Advance and usually consists of railroads and waterways. It is in this latter zone that the Evacuation Hospital is located, usually at the railhead. There are usually two EvacuationfHospitals to each Division of 36,000 men. In fact. it is the first Medical Department unit behind the firing line, which is practically stationary in this war. and lies from 6 to 10 miles behind the lst line trenches. Because it is practically stationary it is possible to occupy quarters more adapted to the comforts of the patients than the others farther to the front. It is the first unit back of the trenches where cots or beds are provided and where extended Medical and Surgical treatment is provided, usually the buildings occupied are specially constructed for its use. The Evacuation Hospital is equipped to care for all classes of patients. It has several up-to-date operating rooms. X-ray. laboratories, etc. It is the first point where wounds can be treated under conditions of asepsis. The most modern equipment and modern methods of treatment under carefully picked Surgeons of repute. make this unit one of the most efficient in the service. When you consider the amount of work that. during activity, is performed at the Evacuation Hospital. you can well imagine that it must be a well balanced and well trained organization. During one of the recent battles one Evacuation Hospital. Cor Casualty C.S. as it is called in the British Armyj during five days battle cared for more than 20,000 patients and did more than 4.000 operations. Naturally most of these patients were either sent back to the front within a short time, or are transported to the Base Hospitals farther back. But when you consider the small personnel connected with the Hospital you can well say that they did wonders. The commissioned personnel consists of one Lt. Col., Commanding. one Major, Operating and four- teen Captains and Lieutenants, in addition a Dental Surgeon and a Quarter Master Corps Officer may be assigned. The enlisted personnel consists of eight Sergeants lst Class, twenty Sergeants, ten cooks and one hundred and forty-one Privates. lst Class and Privates. During activity on the front the operating rooms are all working. at times from ten to fifteen being in operation at the same time, but the Surgeons usually work in tours of eight hours each and then look after dressings and other necessary work and although supposed to get eight hours sleep, actually get much less. But the term of intense activity may last for several days and then that sector may be quiet for weeks. They must all be absolutely prepared for any emergency at all times. It is not the purpose of an Evacuation Hospital to keep a patient for more than a few days. He is given the best Medical and Surgical treatment, and if it is found that it will take some time for con- valescence, he is transferred. to the Base Hospital by Hospital train or Ship. In extreme cases where a man is unable to be transferred because of the nature of his desease or injury, he is kept at the Evacuation Hospital until he recovers sufficiently to be transferred to the Base. . It is not the purpose of this article to go at length into the detail of an Evacuation Hospital and its workings. but just to give an idea of what it is. The varying circumstances may necessitate changes and where today it may accommodate 500 patients, tomorrow it may be necessary to combine two or more Evacuation Hospitals until their capacity may be from 1,500 to 4.000, and again it may be necessary to combine several and each unit have its own specialty, one for abdominal Surgery, another head cases, another fractures, another cases of shock, etc. Could we only look into the future, how easy it would be to describe more definitely. GJTM f ight! ls'-'ml E ' Thi! ,m,.,,,,,,,,,n...,,,M,,,,,,1, mmmgimglsu wlllllwmf-lmlhvlminillwu Annie- M fumes-Q ierwwm.g..wwxm.-ggugwm -af w-mam ip wwe- pwmvmprm awww--warm wmv ...W-,....,,,,i. ..,.. .W-...........H,. .... -,.....,..v.w.-..1...................r...-.c.s.... .. -.... . ....',... . T ,..... ...- . . .,...A,. ,f.. .-.,. .. . ....i. ,. .. .- ... ,Mia 4.-. ,. I I I l I I I l I I OFFICERS Major Davis, George G. Capt. Dudley, Gerry B. Lieut. Goodloe, I-lart Lieut. Jones, Carl F. Lieut. Pratt, Geo. P. Lieut. Penrose, J. B. Lieut. Schreiter, J. B. Lieut. Hickman, W. F. Lieut. Patterson, Paul M. Lieut. Schneider, John F. Lieut. Burket, Walter S. Lieut. Lockwood, I. H. Lieut. Shafer, Lee E. Licut. Stoland, Iver Licut. Rochester, A. S. SERGEANTS FIRST-CLASS Supple, J. E. Trittle, Glenn W. Urner, John A. . SERGEANTS: Lally, Frank E. Pederson, Eugene W. Little, Leon G. EVACUATION IIOSPITAL NO. 1 Koster CORPORALS 1 Clarke, Ernest G. Estes, Ernest Gower, Gerald R. Gustafson, Bror O. Koenig, Oscar E. Lewis, Joseph R. Nelson, James R. Rodgers, Harry C. Sparkman, Neil J. Salisbury, Robert C. Stanley, Charles G. Warner, Elmer T. PRIVATES FIRST-CLASS: Packard, Raymond P. Sypher, Roy A. LANCE CORPORA LS 1 Campbell, Robert L. Engstrom, Richard E. Helm, MacKinley Mullarky, Robert E. Mullins, Reverdy L. Riddle, Glen L. Selby, Chas. C. 'WHO Btliildl 'U Qlifwib 14' IWLRFXG Hb 'iiiwrflii 11 CMBZFW W 'If' 4J5 'i4-IU' 'Q . lllwlilvl Kb vilbllfmfi Li Mi' --L1 L-A ',,- 44N1A1f'i4-'7 Yi 'VW' 11 Spear, Donald D. Taylor, Chas. Y. PR I VATES: Starr, Fred R. Stoll, Wm. J. Stoner, Oliver C. Stusser, Julius J. Taylor, Warren D. Thedorf, Gustav E. DISPENSARY ATT' Baxter, Wilbur D. Bruce, Charles E. Herzog, Clarence L. l-lorstkotte, Arthur E. Jordan, Frank E. Martin, Wiley A. Perrenot, Preston R. Pruett, Everett W. Tibbles, William K. Walker, I-Ienry T. Young, Frank P. CLERKS: Beeman, R. E. 76 DTS in 4h'J'7QaC....y..:- . ?!'ff'.'..w-gE'e'3'. .I .Q A, A f.. ,, . H ,, U . ,,-,., . A I-. .. ,gw...,- fa mf-f:s,., M' ,. -. -I ff 4-17 ',f.- i ',. P' -I ..f-.f,f.'4-- .- 13 .ff fe'-...31ll?QlE5e5'1t-'..'5':.,1?. KL 5' 57,5-.:...' Davis, Jerome Feistel, Paul P. Grabow, Harry G. Hill, Ernest G. Holland, Jos. A. Huston, Edwin H. Little, Fred B. Lowenstein, Matthew Minson, William G. Nuckols, Wm. R. Olson, Harry N. Pampel, Harold K. Pray, Stuart E. Ritchie, Clarence E. Stephens, Raymond E. Wilson, john T. CHAUF F EURS: Bauer, Louis W. Ellis, Daniel W. Erbe, Ralph R. Foster, Frank E. Grace, Roy E. Hallowell, Kenneth johnson, Fred W. Lawrence, 'George M5 McLaughlin, Earnest R. Nichols, Raymond E. EVACUATION IIOSPITAL NO. l Koster Pearson, Carl L. Perkins, john T. Salyer, George D. Seller, Ralph Smith, Merritt O. PR I VATES: Adkins, Edward E. Akers, Richard S. Ames, Lewis W. Ames, Oliver F. Armstrong, Wm. A. Askew, William H. Athey, Paul G. Ball, Chas F. Baltin, jay F. Blaiotta, Battist Burke, jacob W. Burris, Rex A. Carpenter, Claude E. Carter, Willard H. Coxby, Ivor C. Demaris, Alvah Envey, Benj. R. Fields, john Forbes, Chas .D. Foss, Theodore French, Robert R. A-Q' J. N, WA DU mx-:Nr .' -..... ...,... . .-.-..- ...H ..... .. ..-... 77 Gregorson, Lawrence Holmes, Edwin W. Houle Raymond L. Jacobson, jacob D. Langman, Chas. R. Lorch, Allen E. Marlton, George C. Marwell, john F. McEwen, Albert C. Maclver, john McCormick, Lloyd C MacLean, justin F. Millard, Herbert E. Miller, Clarence G. Miller, Clarence C. Miller, William M. Olson, Stephen W. Ortman, Walter E. Palmer, Henry Perier, Robert E. Reinhert, Walter Richardson, Paul N. Rimbey, Carl W. Rounsevell, Nelson Simmers, jules A. Smith, William M. Wise, Herman M. Wright, George P. Lt. Col. Tefft, W. H., Commanding Major Peters, Don P. . . Major Babcock, Archer D. . Major DeForest, Calvert M. . Capt. O'Reilly, Thomas W. . Lieut. Matson, J. A. . Lieut. Braden, A. V. . Lieut. Sherman, D. O. A . Lieut. Bragg, Vincent IL. D. . Lieut. MeI,ain, I.. C. . Lieut. Hirsch, E. W. . Lieut. Vetter, J. H. . Lieut. McGowan, R. P. . Lieut. Miller, RAJ. Lieut. Parsons, I . H. . Lieut. Langworth , G. I.. l.ieut. Barber, A. . . ENLI SleRoi2AN'i's Fiizsi' Ci.Ass: Crottier, Charles J. . . I-lill, Ernest G. . . Kitchin, Joseph H. . Lally, Frank E. . Langford, Archihold R. Rasmussen, Orrill . SiznoiiAN1's: Beard, John C. Boland, Earl M. Davis, Malcom C. . Dolman, Arthur I'l. . Dunn, Halbert L. Fontaine, Paul I-I. Green, Marquis J. I3ror O. Gustafson . I linkle, Homer I-. Lake, Charles I-. Mark, Edward L. Moore, I-Iarlan W. . MeCafferty, Frank . Nelson, Clarence IL. . O'Grady, Harry R. . Reed, Earl L. . . Rountree, Charles A. . Sterns, Fred . . Swanson, Paul J. Zuber, Carl J. . Cooks: Greg, Ernest S. . Mc larean, Duncan . Harry F. Parnell . Lazaresen. Virgiliu . T1 ' al Ji- a-' STED PERSONNEL EVACUATIUN IIOsP1'1'Ai. No. 7 Koster . Belmont, N. Y. Govans,, Md. Syracuse, N. Y. Canastota, N. Y. Los Angeles, Calif. Mediapolis, Iowa Paconian Springs, Va, . Teargue, Fexas. . Bray ord, Conn. Bakersfield, Calif. . Chicago, Ill. . Aberdeen, S. D. Cross Hill, S. C. . Topeka, Kans. . Missoula, Mont. Oklahoma City, Okla. . Jop in, Mo. . Eveleth, Minn, . Seattle, Wash. Cedar Rapids, Iowa . Baker, Ore. . St. Louis, Mo. I-Iennessey, Okla. . Oxford, Iowa Milwaukee, Wis. . Pawnee, Okla. . Ardmore, Okla. Minneapolis, Minn, . Ordway, Colo. . Helena, Okla. Billings, Mont. . Anna, Ill. . Texarkana, Ark. . Wichita, Kans. Des Moines, Iowa Colorado Springs, Colo. . I-Iildreth, Nebr. Fort Dodge, Iowa . Oilton, Okln. Nashville, Ill. Moline Ill. Topeka, Kans. . Dubuque, Iowa . Kansas City, Mo. . Hobart, Okla. Perry, Kans. Chicagohlll. PRIVATES Fmsr Culss: Barr, William L. . Funk Glenn C. . GoeIz', Frederick C., Jr. I Illohnston, George O. . ance, Reece D. . Martinez. Fred . Price, Floyd . . Rountrec, Milo B. . Swunay, Leslie C. . Warwick, Charles S. . Piuvmrzsz Agnew, Samuel F. . Austin, Edward T. . Anderson, Carl A. . Anderson, Emmet J. Alpaugh, Robert S. . Alward, Fred S. . Bailey, Halford . Barton, Lewis M. . Bell, Leonard H. Benjamin, Arthur . Behan, Charles D. . Berndt, Otto H. . Bingham, Albert N. . Blaske, Vincent W. . Blauer, John F. . Blowers, Arlie . Bloch, David M. . Bode, Walter E. . Bolejack, Clinton W. Booth, Floyd B. . Briggs, Walter W. . Brown, Edward . Camm, Edward . . Carnahan, Joseph E. Carroll, Charles I-I. . Christensen, Chris J. . Clark, Adelbert N. . Clos, Victor R. Cullen, James T. Coutts, Alfred C. . Curran, Eugene G. . Dahl, Alfred S. Dart, Horatio B. Davis, William B. . Elliott, Charley V. . Envey, Bergfamin . Erikson, E gar W. . Farrens, Guy H. . Altoona, Pa. . Manchester, Ill. . Kansas City, Mo. Drumright, Okla. . Bradley, Okla. . Del Norte, Colo. . Jennings, Kans. Nashville, Ill. . Garner, Iowa . Spokane, Wash. . Burlington, Wis. . Manitou, Okla. . Windorn. Kans. . Kingston, Ill. Twin Falls, Idaho . Pebble, Idaho . Waterloo, Iowa . Hurley, Okla. . Hays City, Kans. San Francisco, Calif. g 7 M Q I ,,.,.?,, ,W ,......,.... ,-, ,ray-Sqn, .,. . --V-. ,K f-ff. ,. ,.,. ,S mv., A ,mv-fem .-.-.Ce .5 ,7-ff. f 4, . Stigler. Okla. . Lancaster, Wis. . Emporia, Kans. . Bowbells, N. D. . Lund, Idaho . Brooklyln, Mich. . Oma a, Nebr. . Newkirk, Okla. . Ncmaha, Nebr. Wichita, Kans, . Upton, Wyo. . Denver, Colo. . Ludlow, Ky. Clay Center, Kans. Mason City, Iowa . Spencer Iowa . Bufraiof oiau. , Knoxville, Iowa . Vallejo, Calif. San Francisco, Calif. Redwood City, Calif. San Francisco, Calif. Hutchinson, Kans. . Ruleville, Miss. . Shawnee, Okla. Mabel, Minn. . Rexburg, Idaho Stanton. Nebr. :Lal 1 ,. ...Q ii X ii., .t. i. -fszev,-w -1-mum -v www rf mamma if was.-.ww f- :www ,,, ,.m,.:.,.- J- .ifcin Q....'.:uns 'f 11 - Y 4 K N ' W 1 'W' '--MVN ' it 5-I .':.-I 4 .WV 'YW I' i 'E we . Fenton erry'I-I. . Fields, Fled C. . . France, Thomas M. . Fuller, James C. . George, Merle E. Garden, Philip A. . Goven, Merton A. . Graves, Charles W. . Greene. Earl G. . Grishaber, Harvey A. Guffin, Glenn C. . Guenther, John W. . Hajck, James J. . Harding, William J. . Hanson, Albin S. . Hawkins, Chester . I-less, Robert O. . I-lewitt, Lawrence W.. Hoffman, George H. . Hopkins, Walter B. . Howard, James R. . Iles, Theodore L. . Ingham, Ralph S. . Istad. Christ P. Jensen. Otto L. . Jiibb, James L. . eenan, William W. . Kieffer, I-lcnry L. . Kindy, Albert C. . LaFo lette, Cather H. Laycock, John . . Leeright 'rank E. . Lethcm, Jlames J. . Lewallcn -Iobart . Irafngqdal, Bernie M. . ar . Frank B. . Marrison, Will . . Massic, Marvin L. . Masters, Wilson H. . Maston, William H. Mehlberg, Frederick W, . Miller, Maurice R. . Morgan, Walter R. . Morin, Clifford H. . Mushik, Ignatius C. . Myers. Alva . . MeArdle, Rwnh P. . McCallum, illiam H. MeGolriek ames C. Mauman, I-Ilarry A., Jr. YDUMNIUQ-lit' MWHMI IU 'iili5ilXF'l9 -igiviwfi EVACUATION IIosP1'1'AI.f,No. 7 Kesler . Omaha. Nebr. Collinsville. Okla. . La Grange, Ill. Marshalltown, Iowa. . , Madison, S. D. , Chicago, Ill. Turtle Lake, N. D. . Inman, Kans. . Sander, Utah . Buh , Idaho . Concordia, Kans. . Lake City, Iowa . Chicago, Ill. . St. Louis, Mo. Forest City, Iowa . Brownwood, Mo. . Kansas City, Mo. . Bristow, Nebr. . Sheridan, Wyo. . Atchison, Kans. . Keokuk, Iowa . Hcnryctta, Okla. . Wayne, Ncbr. Minneapolis. Minn. . Rexburg, Idaho . Baltimore, Md. . St. Paul, Minn. . Portage. Wis. White Pidgcon, Mich. . Russell, Iowa Salt Lake City, Utah . Burley, Idaho . Hill City, Kans. Lovilla, Iowa . Whitehall. Wis. . Wichita, Kans. . Craig. Okla. Turners Station, Ky. Ca e Girardeau, Mo. Rflonroe Citi, Mo. . St. Josep . Mo. . Denver, Colo. Elgin, Ill. Chicago, Ill. . Mandan, N. D. . St. Louis, Mo. San Francisco, Calif. . Memphis, Tenn. , Janesville, Wis. . Sacramento. Calif. 19 xi 'za mem if mesa? , N.-. We., .. .,,.,.,,.,.,.,,.mnvs-rv-iw-'wua-- f-a-.,.,.v---,--- . frqnnmrnnwwimnnw-vhwmw--v.nwv--w M Nelson, Earl C. Newton, Philip F. Oakeson, Lorenzo A. Pacheco, Belarmino Paschall, Dale H. Perkins, lkmes H. Perkins, al h B. Petersen, Esgcrn N. Petersen, Nels E. Reeder, William J. Reilly,dlames I.. Richar S, Elmer T. Rimbey, Carl W. llgobisoa Dain R. uPP. ar . . Russ, Glenn A. Russell, Harry . Sanders, Marvin L. Schultz, Edwin W. Schultz, George E. Seikel, Leo J. . Sellers, James I-. Shudak, Frank . Siegel, Nathan . Smith. William E. Sowerbg Clifton C. Steele, onald C. Stultz, Joseph . Tafel, Leonard E. Thatcher, Preston Tippett, George W. Tobias, oscph G. lower, ess . Trass, eter . Upheber, Izrnest Valdez Pedro C. Van Cleve, William J.. Veenker, Flohn S. Walsh, T omasvl. Warn, Harold . Webb, Fred G. . Welter, Rufus C. Wendt. Herman H. Wescl, Ernest E. West, Amos O. . Wise, William A. Wilde, Willardcf, WilliamsL Floy H. Wilson, hdwin L. Zimmerman, George G- iilfllvi' Q fv:-wiv Aa- F: fmrvrr . , .,...,..t,.,.,,., ..,............., .,,. TQWWW 'S' 5754-73 T' 5371 '? i.'l4fS iC.'f. I-f ....... ....... -.. ..... .. ...wi-.., ..-. ,.,.-. ., . 1 Racine, Wis. . Ifairbuigr, Nebr. . San y, Utah Monte Viste, Colo. . Osceola, Iowa White Rock, Utah Montgclier, Idaho Sylvan Irovc, Kans. . Malmo, Sweeden . Beatrice, Ncbr. . Chicago, Ill. . Downey, Idaho Buttingville, Calif. . Anita, Iowa Denver, Colo. Carlotta, Calif. . Upton, Wyo. . Okmulgee, Okla. . Oak Park, Ill. . Le Sucur, Minn. . McI,outl, Okla. . Lawrence, Kans. . Omaha, Ncbr. Sun Francisco, Calif. . Dennison, Iowa Norridgcwoek, Me. Knoxville, Iowa . Allston, Mass. . Butlimore, Md. Idaho Falls, Idaho Sacramento, Calif. . Oakland, Calif. Plattsmouth, Ncbr. N. Sheboygan. Wis. 'Sylvan Grove, Kans. . Del Norte, Colo. Garden City. Kans. . Whiltmore, Iowa . Wichita, Kans. Min Ccupolis, Nlinn. . Lay, Colo. . ,Wesley, Iowa . 5utton, Ncb r. . Chicago, Ill. Little iCfLCk, Nebr. . 'I' tonka, Iowa . Coalville, Utah. . Fresno, Calif. . Kansas City, Mo . . Toledo, Ohio may Diiffkl, RQfll i'i'1 xi,-'mos lz'iM.ifwirj5.g c .bmw A ,A min-WMMaw-. ' m1T'mmT'2hmmT '1mq-.w' ZTQQT' ...J S fn-:pu ZT..u. ml'qm Lum'T .mp 1mum 'I'qm - Yowunvmnx Imam 2-amp' Wlqnoqgpuupaqn-aqua lk tI.'l llill 'i', l1,..KT'J'w.i.'f 'X A , f I . EVACUATION HOSPITAI. No. 9 Major S. jay Turnbull, C.O., M.C. Major Peer P. johnson . . Captain Charles M. Remsen, . Captain Malcom D, Crimes . lst Lieut. Claude A. Frazier . lst Lieut. Louis R. Wiley lst Lieut. john R. Boling lst Lieut. Clifford R. I-loy lst Lieut. Martin L. Sowers . lst Lieut. Norman McL. Dingman lst Lieut. james F. Faulkner, M.C. lst Lieut. Charles L. jennings . lst Lieut. Verne T. Cabot . lst Lieut. Francis S. Carey . lst Lieut. Benjamin Robinson . lst Lieut. Grafton D. Townsend. lst Lieut. Sam I-lardeman, M.C. lst Lieut. Nathaniel Lief . . Beverly, Mass 2407 N. 8th St., Kansas City, Kans South Knoxville, Tennessee . ' . . Philadelphia, Pa 202 Gadsen St., Columbia, S. C . . Syracuse, lnd . Pocahontas, Va Spring Valley, N. Y . . A . New Briton, Conn 211 Lomax St., jacksonville, Fla 3719 lst Ave., Minneapolis, Minn . . . Williams, Iowa 4228 Parkside Ave., Philadelphia, Pa Nashville, Tennessee New York, N. Y lncnpuaunuonnnnsnua0ulnollmaslpo-myxwanmnaxuqunnnuuumnuunocxvaimquoanlall 7 77 f' - ' ' ' ' ' lDvw5wdn1 1-as 1--w..a.aa.:fA::s-.5-W, Ya. .. ,.. ..........f...,:- -mai-a.....-...Y - - R X , , .LJ .nu . .. W -i .ft Major Worthington, joseph A. MC. Major Cole, Herbert P., MRC. Major Burnham, A. C., MRC. Major Kaysen, Ralph, MRC. Capt. Stewart,iOliver E., MRC. Capt. Kelley, jacob S., MRC. Capt. Newman, john C., QMRC. Lieut. Gosin, F. ,I., MRC. Lieut. Hoffman, Wallace N., MRC. EVACUATION I-IOSBITAL No. 10 Koster New York, N. Y. Milwaukee, Wis. Milwaukee, Wis. Bricelyn, Minn. Providence, R. I. Hutchinson, Kans. . Green Bay, Wis. Torrington, Conn. Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Cook, john C., MRC. Postle, H. V., MRC. William S. Watson, MRC. Edwards, C. B., MRC. Cook, Edgar O., MRC. Devine, Cornelius T., MRC. Cleveland, Nather, MRC. Edward Kick, MRC. Evans, Lynwood, MRC. Savannah, Ga. Columbus, Ohio. Philadelphia, Pa. Overton, Nebr. Mendota, Ill. Oakland, Calif. New York, N. Y jacksonville, Fla Capt. Ramsdell, E. Cv. Capt. Bailey, L. j. C. Capt. jordan, j. M. Lieut. Col. Morse, A. Lieut. Dunn, J. M. W.-MC. EVACUATION HOSPITAL NO. 11 Koster Lieut. FunSCl'1 Lieut. Marshall, P. L.-DRC. Lieut. Watt, Geo. Lieut. Walker, W. D. Lieut. LaGrade, L. A.-MC. Lieut. Fox, R. H. Lieut.-Styers, Robert - Lieut. Colsh, L. L. Lieut- Baftelt, W. F. 2nd Lieut. Moritz, Max-QMRC Lt. Col. Bloombergh. H. D. Major Lane, John W. . Major Holmes, Ralph W. Capt. Barton, Francis W. Capt. Bennett, Robert M. Lieut. Earle, R. Horatio . Lieut. Andrews, Fred Lee Lieut. Clayton, Herman C. Lieut. Elmer, Raymond F. Lieut. Fletcher, Arthur Lieut. Gittens, Thomas . Lieut. Hersh, Harold E. . Lieut. lbissup, Nathaniel J. Licut. acC.ordy, Earl C. Lieut. Redington, James C. Licut. Rice, Grover C. . Licut. Wumkes, Peter J. 1nd Lt. Brown, Gillhert S. SERGEANTS Flastr CLASS: Smith. Talmage Bristow, John W. Srsacam-rrs: Jinhnson, Leo P. uth, Martin L. Cooper. David C. Durand, Charles A. Ruse, Gilbert P. Schoheld, James B. Shook, Lucian O. . Cooxs 1 Barker, Ollie V. . Forgy. Floyd T. . PRIVATE Fuzsr Ctfxssz Pitchford, Fred A. . Paivxrizs: Adams, Geo. M. Albo, Paul . Alton, Walter N. . Anderson, Carl .R . Anderson, Harry B. . Anderson, Fletc er D. Ashland, Lewis E. . Baile ,Christian C. . Baird? Lyle C. . . OFFICERS ENLISTED PERSONNEL EVACUATION IIOSPITAI. No. 12 Koster Atchison, Kans. Dorchester, Mass. . Chillicothe, Ohio . Danville, Ill. Mound Valley, Kans. . Walyne, Mich. . Oa land, Me. Quincy, Ohio hicago, Ill. Fostoria, Ohio. . Palmetron, Pa. . Detroit, Mich. Amsterdam, N. Y. . Galcsburg, Ill. Bayard, Nebr. Chicago, Ill. Lincoln, Nebr. Grand Island, Nebr. Oregon House, Calif. Cleveland, Ohio Hutchinson, Kans. Sacramento, Calif. Burlington, Iowa . Humbolt, Iowa Kansas City, Mo. . Omaha, Nebr. Browning. Mo. Detroit. Mich. Tiahominge, Okla. . Sanslosc, Calif. Little ioux. Iowa . Oxford, Nebr. Jamestown, N. D. . Clear Lake, Iowa . Denver, Colo. Council Bluffs, Iowa Barger, Arthur G. . Bateman, Charles G. Beekman, Theo. P. . Belmont, Harry I. . Bergman, Frank R. . Biehle, Herman O. . Bigelow, Finis H. . Bjork, Harold I. Boyd, Wm. T. . . Brewington, Boyd . Brennen, Frank W. . Brown, Floyd H. . Brown, los. L. . . Brown, Loyal C. . Brown, Patrick F. V. Broyles, Roy . . Brox,IJohn P. . Buri, 'dw. E. . . Burkman, Earl R. . Burns, Frank L. . Bustettcr, Aloysius J. Campbell, Jos E. . Chamberlain, Glenn W. Carlker, Abc M. . Carl, Paul H. . . Carpenter, Elmer A. . Casey, Murray . . Cavcn, Ira E. . . Christiansen, Henry N. Christensen. Miller . Clanahan, Harrington Clarkson, Grover . Cohen, Reuben R. . Cox, Leonard . Craft, Harry P. Croan, Floyd M. . Croft, Hubert L. . Cronin, Cornelius P. . Cunningham, Clarence Cushing, Ed. W. . Dagger, Ralgh J. . Dagger, Wil ur E. . Dague, Ralph M. Dean, Lynn B. . . Durkin, Peter E. . Edwards, Charles M. ltggen, Milton F. . Eic inger, Wm. . Ferguson, Orrie IL. . Fischer, Walter F. Foy, Leslie T. . IL. . Beloit, Kans. Monarch, Wyo. Charles City, Iowa . Omaha, Nebr. Sacramento, Cal. . Belden, Nebr. Maricopa, Callf. . Wcskan, Kans. Omaha, Nebr. Savannah, Ill. Winchester, Ind. Sidney, Mont. San Francisco, Calif. . Greeley, Nebr. Hartville, Mo. . Scotia, Nebr. Minneapolis, Minn. . I acinc, Wis. Los Angeles, Calif. Colorado Snrings, Colo. P oenix, Ariz. Des Moines Iowa Bennington: Ol-cla. Chcrryvalc, Kans. . Winona, Minn. . Denver, Colo. . Salina, Kans. . Freemont, Nebr. Cedar Falls, Iowa. . Norfolk, Nebr. Greensberg, Kans. Los Angeles, Cal. Englewood, Kans. . Fowler, Kans. La Junta, Colo. Winterset, Iowa San Francisco, Calif. . Armour, S. D. Rushville, Nebr. Alta, Iowa Alta, Iowa . - Perry, Okla. . Denver, Colo. Mason City, Iowa . Gillette, Wyo. . Omaha, Nebr. . Wichita, Kans. Dallas Center, Iowa . Omaha, Nebr. . Moab, Utah. W. v6 A ,215-nut:- Ax hu.. L... y- .. ,, , Fuehrer, Lester W. Gendron, Geo. N. Qillooly, Thomas S. Cladish, Alva M. Qosorn. Clinton M. Griffith, Robert I. Qross, W. Glenn ' Grove, Charles E. Cuerola, Dan . Hanson, Anton . Harris, Franklin A. Harris, George A. Hartz, Delbert C. Hawes, Charles Ii. Hays, Noah B. . Hazledine, Earl L. Huston, Hubert S. Hutchens, Huluert L. Hutchison, Wm. E. Hyatt, Grady l.. Kirtland, Dixie R. Larkin, John J. Larson, Arthur G. Lessetter, Grady M. Lessetter, Granville B. Latorre, Frank . Lcmkc, Alvin G. Link, Vernon C. Lo Russo, Angelo Ipyon, Frank B. aire Edmo . Marshall, Hobart M. I Martin, Earl C. Martin, Jos. G. Mclnerricy, John J. Merriman, Leo M. Miller, Huxley A. Miller, Ralph A. Mitchell, Lorenzo B. . Moore Cla M Morrissey, Bernard Nagel, Arthur J. Niehaus, Stanlc Nielson, Henry . Nielson, Peter M. Niemi, Freddj. . . Olson, Thad cus C. Parks, John L. . Peterson, Edward W. Preston, Clyde A. Proper, Chester M. EVACUATION HOSPITAL NO. 12 Koster Grand Island, Nebr. Los Angeles, Calif. . Patton, Calif. Lutesville, Mo. . Denver. Colo. Springfield, Ohio. Sweet Springs, Mo. . Florence, Colo. San Francisco, Calif. . Greeley, Colo. . Palisade, Colo. Junction, Okla. . Corning, Calif. . Bucklin, Kans. Star, Okla. Lead, S. D. Carthage, Ill. Hobart, Okla. . Truro, Iowa . Patton, Calif. Nashville, Tenn. . Omaha, Nebr. . Manson, Iowa . Shawnee, Okla. . Shawnee, Okla. San Francisco, Calif. . Sioux City, Iowa . Maxwell, Iowa . Chicago. Ill. . Denver, Colo. Marshalltown, Iowa . Genola, Kans. . Concordia, Kans. - San Jose, Calif. National, Mont. . Keota, Okla. Clear Lake, Iowa Council Bluffs, Iowa . Chico, Calif. . Sutherland, Iowa Sacramento, Calif. . Adams, Minn. Grand Island, Nebr. , Fresno, Calif. McPhearson, Kans. , Reno, Nev. , Alta, Iowa Richmond, Calif. , Viborg, S. D. Rexford Kans. ' Nebraska City: Nebr. Ralston, Angus W. . Reincrs, John R. . Richeson, Arthur A. . Rowbotham, Allen B. Rust, Edward C. . Sabini, Leo . . Savoie, War en L. . Schaeffer, Orle L. . Schlotterback, Horace F. Sherboudjf, James R. Shimmer a, Fred . Signal, Albert . Si er, James C. . Slater, Wayne W. Smith, Hugh W. Smith, Paul R. Strahan, Hubert Sullivan, Don . Swanson, Adolph I3. . Temple, Chas. II. . 'l'crrill, Edward I3. . 1l'errill, Iilmer R. . folly, John . . Townsend, David D. Treadwell, Thurman K. Triplett, Clare A. . Turner, Claude E. . Ury, George E. . Van'Der Aue, Charles L. Vanderhur, Ben E. . Van Dyke, Lloyd Cv. . Vanscoy, I-Iomer L. . Venning, I-Iarrv Isl. Vickers, Ben F. Vitamus, ohn M. . Warner, ohn B. . Weller, Clarence B. . Wheatcroft, Walter M. Wheeler, Richard . Whittenberger, Claude Wilkens, Grover F. . Willhour, Ralph M. . Willmott, Erwin . Williams, Arthur R. Wilson, Jessie M. . Wilson, Wilber W. . Winkle, Fred W. . Zenan, Richard O. . Warren. Herbert H. . R.- Chamberlain, Glenn W. Oklahoma City, . Lennox Okla. , S D . Hastings, Nebr. . Denver Colo. . Glidden: Iowa San Francisco, . Concordia, Calif. Kans. . Carter, S. D. . Movillc, Iowa Arkansas City, . Wilbcr, Karas. Nebr. . . Gray, Iowa . Corning, . Oilton. . Goodridge, . Havelock, Shady Point, . Sioux City . Boone Calif. Okla. Minn. Nebr. Okla. , Iowa Iowa . Kiefer: ous. Fort Morgan, Colo. Fort Morgan, Colo. San Francisco, Calif. . Vacaville, Calif. . Ada, Okla. . Sutherland, Iowa. . Normal, Nebr. . West Side, Iowa Algonquin, Ill. Russell, Kans. Buffalo, Wyo. Creston, Iowa . . Allen ,Kans. .' . Enid, Okla. Silver Creek, Nebr. . . Ira, Iowa . Jackson, Mich. . Utica, Kans. San Bruno, Calif. . Sidney, Nebr. ' Charter Oak, Iowa . Tulsa, Okla. . Bakersheld, Calif. . Golden ,Colo. . Douglas, Kans. . Heela, S. D. . Beatrice, Nebr. . Wilson, Kans. . Nelson, Nebr. Des Moines, Iowa UNION PACIFIC STATION, FORT RILEY 'NW' 3. eww 21' J 'r ' - 'f1n1.', I - ,Mp 4 J GRAND AVENUE .Ls ,..w-I, M- -4 W- -ru, am. . . 1- -nw w vw-' .a 84 ll'll 'll iii Tal. t k,,4 il flfll il :.l35 Ml lxffxllxlllxlfvf Qxlxlli gf g WM My W g m P'4'0 WWWH-efifznifiucaigabldnnllrniigdsduinygdinnolibounnuuuuuunoumuuwannsnsuaumqnnnauunoquiwn-rmmmwuhmdulammimo ix fi.-if mi my iwwf4.'is - ' 'f 1 Elie Jfielb Tl ospila HF. Field Hospital Company, wherever it exists, means a mobile hospital. It is the only hospital complete in the zone of advance. The personnel of a Field Hospital Company are able to properly take care of all- medical and surgical cases referred to them as well as to take care of the camp sanitation for it and such fxgfffw other organizations as nfay be in its vicinity. Because of the ease and rapidity of its mobility, and its 'gint fa-5 l efhciency to take care of the sick and wounded it is a useful organization to accompany the fighting troops. The object of the Field Hospital, wherever consistent with safety to personnel and patients is to get L M' 4 'iff I as near the front as possible and do its work there. The location of a Field Hospital is usually in some d l sheltered area when on the veldt, and in buildings of small towns where the Hghting is done over ense y populated country. U . A Field Hospital Company is self'-supporting. lt rrust care foroofficers, 83.enlisted men as personnel, and Zlopatients. When filled with the wounded who are referred to it, who nfust be sent to the line of communications, it can take care of thousands of patients if such as must be sent to the rear are evacuated at once. lt has with it at all times its own transpor- tation, equipment, and personnel for the complete operation in friendly or hostile country. It performs its guard duty. The Field Hospital must care for all cases referred to it. The Ofhcers must be experienced men. They must be able to make quick and accurate decisions in types of cases necessary to be evacuated to the rear. They must be able to pick Th d h out these cases from the great mass that need immediate attention and have them taken care of. ey m.ust etain suc wounded as are so seriously injured that a long journey to an evacuation or base hospital would prove fatal. This necessitates having in a Field Hospital Company only the most experienced, capable and versatile types of ofhcers' and enlisted. rrfen as are absolutely essential to render it efficient. Versatility is necessary for the officers, particularly because -with a Field Hospital Company any officer should be able to do the work of his colleague, whatever that may be. It may be necessary for any officer to drill and handle and mess enlisted men, or to have classes in equitation, understand and teach the proper methods of grooming and taking care of horses and mulesg or to investigate broken down motor trucks or cars, find the cause of the trouble and be able to repair them. It may be necessary for him to requisition for supplies and make the pro- er ex enditure and returns for the same at certain periods Finally he may be called upon to do some problems in sani- P P - tation with its many intricacies, he must know something about map reading, map making and sanitary tactics, during manuevers or campaign. Consequently it can be seen that the doctor from civilian life must have special training to be efficient in the military service along medico-military lines. In civilian life he has had exceptional advantages. He has had at least seven years of training in colleges and medical schools in addition to his high school education. Most of this tra-ining has been along scientific lines. Consequently he is a versatile man, many sided, experienced and deals ,efficiently with his patients by that subtle understanding of human nature which his profession has given to him. But he has had no military experience and all his training has been the reverse of what is considereducommandingf' So for him to understand and work in- telligently in the service, it is necessary that he shall have a thorough military training to give him that confidence in himself and his work which is necessary to deal with his colleagues of the line. We so often hear said of the medical officer that he is more military than professional. That is not true. The medical officer has essentially his life work before him which is to treat the sick and wounded first and offer his services wherever they are needed. But in order to do this efficiehtly in the military service, it is necessary that he understand the military game as now played. He needs a certain self-satisfied bearing and confidence which only association with the military can give him. In the Army he no longer humors the family of the patient, but treats the patient and does what is best for him. He does it quickly and answers questions only to the higher officers-on paper. When his work is unsatisfactory he soon must hear of it make his explanation or stand the consequences. In the service, because he did not know, is no excuse. So, we reiterate, that the civilian doctor must come to these camps to be properly trained. His military appearance and knowledge of the game as played, do not detract from his ability as a professional man in the least, as many officers of the line would have eo le think' but this versatility makes doctors efhcient as medical officers. They are a part of the mobile army, and we P P i have learned from the Allies-an important pai t. They are officers of the Army-and are essential. So where such expressions derogatory to the professional willingness of medical ofhcers occur, whatever the rank whether from the line or staff, they are made through prejudice or ignorance. And it is when we consider the work ac- complished by the camps that we wish to take some of the credit for the training they received with Field Hospital Com- panies. We believe the Field Hospital Company to be an ideal system in which to train officers or enlisted men for any future duties they may be required to perform, anywhere, in the military service. The training is adequate for officers who are interested in the work of adjutant, receiving officer, supply officer, trans- portation officer, operating surgeon, specialists in laboratory, surgery and medicine, or any of the allied branches. The Field Hospital plays the whole game ithin itself as it should be played. So we believe that each sutdent officer should have a few weeks with such an organization before assigned to his final billet. This enables him to see the outht Working from beginning to end, in its various departments. The company records for months past are at his disposal. Here he may be taught from actual contact with the company paper work as supplementary to the course of didactic lectures which, at the time he received them, were invaluable. The cost of organizing and equipping completely a Field Hospital is small when compared to the ultimate value to those who have had their instruction. lf only as a finishing course, with such an organization, it is infinitesimal. And the more teaching that is done in any organization, the more efficient, with added experience, is rendered such teaching, and the better the organization becomes. lt is a retroactive state of affairs. 1And finally the greatest advantage lies in the fact that when the Field Hospital Company is ordered away, no'waste hassoccurred. No buildings have been necessary b 't h d its own tentage complete. No transportation is necessary because it is a mobile command and has used ecause 1 a its own transportation with which to get away. And the advantage gained has been mutual to both the teaching staff and students. ' Hlilill Ul I W i QA?-Ah-:.Hk1?C'lQi' Ol Oibilliiikll ' ' ' ' ' ' ' 'W' ' '-f fi f'ffr'11 .r.:.:..4::-a-e-v:.z-.uf ::.Af:.1:t4t.... L.: 1--.44--v--Y... -W.:-1 . 'A if- 1-LL-40' g W N V- x .'. 'J' I f I. I 1 ,N - VV W -A MM- rd Nl ll .lillf .fklir Lil ll .fl ..l.'5f,AlAlf5'xl,lX1llSlC. l,1XMVl5 f W H ww M V acozzoomnoannocnaniuuusyoicioycxuociuoosigooquiozleioinioisioiolioioioioio l 'L 'lfl Hli ,l'f Q KAN 5-Jkfp FI ELD II OSPITA L, I-I EADQITA RT ER S D ETACII M ENT Koster OFFICERS Maj. Kinard, Kerwin W. .... Major Lancaster, Pa.. Capt. Wetherbee, J. R. .... . Captain Portland, Oregon ENLISTED L MEN ' Layton, Leon R. . .... . Sergeant First-class West Union, Iowa Clifton, Oscar L. . .... Sergeant A Sharpsville, Ind. Elliot, Harold C. .... I Private First-class Detioit, Mich. Glazier, john B. . .... . Private First-class Mangan, Okla. Bullman, Von J. S. . ..... Private First-class . ' Siloam Springs, Ark. L , P L .Atl aunauucunununeamc iocxgfrurgy O1010lQiOiOlOQ .mm-..-....:.--., -,.- --f-- -.a....-4-:.af.-,4, - f , 1 ,L ,.:r , A: - -. T- . . JI- ' ., 3+ .' 86 I 'ff' ' pg W, A V ' Lolo, f-WSF. I - 5--.H 1 ir' . w f1'fL,,'h.g l. 4-. .',.f1'x, I vu -4 ..' - FIELD HOSPITAL No. 18 Koster COMMISSIONED OFFICERS Capt. Alderson, A. Lee VCFH, Ill- Commanding Officer lst Lieut. Rose, W. E. Kearney, NCIUV- ' Supply Ofhrer . lst Lieut. Williams, D. L. Milwaukee, WIS- lst Lieut. Nelson, W. L. St. Louis. M0- ' ENLISTED MEN SERGEANTS FIRST CLAS Couch, Fred A. DeLapp, Leslie Montgomery, Albert R. SERGEANTS DeWitt, Harry T. Muntjanoff, Nicholas T. Nielson, Alfred C. Cooks Hansen, Herbert M. Lynch, Joseph M. FARRIER Coley, Luther E. WAGONER Reynolds, Clarence W. PRIVATES FIRST CLASS S Bismark, D. Minneapolis, Minn. Bloomington, Ill. Grandview, Ind. Aurora, Ill. Dannebrog, Nebr. Thief River Falls, Minn. Ruthven, Iowa. Spencer, Ind. West Lebanon, Ind. Ainsworth, Spaford H. Berendt, Henry F. Berendt, Otto QA. Carraher, Charles F. Davis, Hiotte A. C-ood, Allen T. Hansen, Van A. Kregness, Wilfred A. Lea, Owen D. Loew, Clemence J. Montgomery, Oscar A. Pronette, Joseph J. Sherlock, William E. Stewart, Hanley J. Strayer, Edward V. Watkins, Henry B. Weimers, Nicholas PRIVATES Barnett, Everett J. Clayton, Harry S. Custer, Raymond M. Ham, Arthur W. Harris, Thomas H. Lawrence, Conrad Payne, Willie T. Pruett, Robert L. Witt, McKinley Big Moose, N. Y. Sioux City, Iowa. Sioux City, Iowa. Whiting, Iowa. Lynchburg, Va. Manitou, Colo. Titonka, Iowa. Minneapolis, Minn. Paris, Ill. Denver, Colo. Bloomington, Ill. Springfield, Ill. Emmetsburg, Iowa. Normal, Ill. Waterloo, Iowa. Kansas City, Kans. Moline, Ill. Minneapolis, Minn. Oklahoma City, Okla Bakersfield, Calif. San Francisco, Calif Grass Valley, Calif. Lanesboro, Iowa. Quinton, Okla. Randsburg, Calif. Randsburg, Calif. Memphis, Tenn. MEDICAL- oi'-'i-'ittifiies'i'i2AiNiNc1 CAMID soo10130ililioioiuioioioioloioqnoaxoioioioioioioilioil lui IIHIYIXNJ X ei f 'V ' Lf K ' XI i .if .J Lieut Lieut ' FIELD IIOSPITAL COMPANY NO. 19 OFFICERS McReynolds, Ralph Kinnaird, Virgil . Lieut. Maresh, George Lieut. Flinn, I-Iomer j. Lieut Preston, William B. Lieut Abshear, Z. M. Quincy, Ill. Lancaster, Ky. Iowa City, Iowa. Butte, viont. Logan, Utah. Buck I-Iorn, Ky. ENLISTED PERSONNEL Baxley, Neil D. Kuiken, Cornelius C. Mapes, Albert O. Oglesby, Richard J. Sullivan, Adolph M. Scott, james R. Luper, Elmer C. Hirsch, Harry Bunnell, Burl T. Brice, Harry C. Eddy, George A. I-Iolmberg, Evar Holmberg, Hjalmer C. Lee, Robert Porter, Samuel J. Rogers, Otis A. Shriwise, Frank A. Andersen, Thanning W . Armour, Edward L. Best, joseph L. Bingeman, Roy Christy, Patrick F. Edwards, joseph A. Estep, Forest C. Evans, Lawrence C. Geister, Charles E. Gillholy, Duncan H. Gorski, Walter Hall, Joseph D. Iliff, Ray S. Iverson, Keider Kelleam, Fannin Q. Killion, Frank E. Krusinski, Stanley K. Lusk, Charles G. Shelby, Iowa. Choctaw, Okla. Bartlett, Tenn. Muncie ,Ind. Ada, Okla. Stites, Idaho. Memphis, Tenn. Piniele, Mont. Ferndale, Calif. Fowler, Colo. I Virgil, Ill. Virgil, Ill. Omro, Wis. . Joplin, Mof Rocky,'Okla. 'I Wichita, Kans. ' Blair, Nebrf ' A E. St. Louis. ' Mof Afton,fTe'xas, ' ' Chicago, Illf' ' Mason City,. Ill. ' Skiatook, Oklaf Hayden, Colo. ' jangville, Wis. Kansas City, Mo. Kansas City, Mo. Chicago, Ill. Koster Appleton City, Mo. Rozet, Wyo. Kansas City, Mo. Sallisaw, Okla. Sioux City, Iowa. Cleveland, Ohio. Chickasha, Okla. Martin, George Miller, Thomas G. Molle, Edward C. Moore, Clyde W. Moore, Lloyd V. Patchin, Fred L. Pratt, Eugene LJ Plack, William D. Reames, Harry J. Rogers, james W. Sanderson, Robert W. Schapp, Dick j. Scott, Hobart M. Siler, Murd B. Spencer, jesse M. Smith, Otis E. Tandy, Mark H. Weed, Carmon F. Morawski, Charles Allard, Indkenois Bader, Martin Bailey, Lloyd W. Bittencurt, Charles W Clanin, Thomas -I. Cook, jesse E. Duncan Paul'C., ' Gurn0w,' Hector Gilliland, .ICsse E. Harris, Earle j. Leclerc, Romeo I Laloli, Frank , Roblyer, Calvin L. Smith, Stani Williams, William B. Barger, Ray W. Bradley, Thomas L. Chambers, Ralph D. Gordon, james C. Hudspeth, Henry J. Hudspeth, William A Liberty, Hector V. Lomis, George P. Reitzel, Henry W. Thompson, Buford O. Owsley, Sharman Milton, Iowa. Strington, Okla. Paris, Ill. Sioux City, Iowa. Modesto, Calif. Fort Towson, Okla. Dover, Maine Baltimore, Md. Rockwell City, Iowa. Decaturville, Tenn. Colorado Spgs., Colo. Grand Rapids, Mich. Hobart, Ill. Henderson, Tenn. Lake Benton, Minn. Lafayette, Ind. . Adams, Ill. Charter Oak, Iowa. Chicago, Ill. Paducah, Ky. Hightland, Ill. Louisville, Ky. Bulwinkle, Calif. Deepwater, Mo. Stanton, Tenn. Enid, Okla., East Rochester, N. Y OPal.,',CQlQ- , San jose, Calif. ' San Monica, Calif. San Jose, Calif. Weeping'Water, Neb Cedar Point, Ill. Freeport, N. Y. Laurens, Iowa. St. Louis, Mo. Indianapolis, Ind. St. Louis, Mo. Lander, Wyo. Casper, Wyo. Watsonville, Calif. LaCross, Wis. Tacoma, Wash. Greenway, Ark. Chickasha, Okla. MOQCMOMOQ0-0QIQOMOllilllilliliiliilli ..a- . MA f.-- - f - -Y , 88 ' I' MHIJICIAI, OlV'I lCTIiI3S 'IIPAINING CAMP J J DQ!-OQOMOMOMOMCMOMOMOQUQUQ FO III' I2 I I .l2Y, KANSAS FIELD HOSPITAL COMPANY NO. 21 Koster COMMISSIONED OFFICERS Capt. CCmndg. Hoy, Clinton LJ Three Forks, Mont. Lieut. Ashley, Hugh V. Bloomfield, Mo. Lieut. Steinmann, William A. H. St. Louis, Mo. Lieut. Thompson, Thomas G. Dell Rapids, S., D. Lieut. Morrow, Carl W. Hendley, Nebr. ENLISTED MEN SERGEANTS: Moore, John P. Gorman, James E. McDonald, Harry F. Kinney, Ludie E. Babcock, Rolland D. Bourne, Donald E. Peters, Fred C. H. Adams, Charles C. WAGONERS : ' Evans, Earnest C. Haggerty, Jenings B. Hensel, William Hickok, Roswell R. Lafkowitz, Leo Rogerson, Eugene V. Wilson, David A. MECHANIC: Davidson, Robert P. COOK : Raymond, Leonard W. PRIVATES lsr CLASS: Bachoritch, Frank C. Bahr, William Baker, Ibert H. Blaine, Louis F. Bourne, Willard S. Coats, Herman Coward, Arthur Crane, Charles N. Denny, Elza E. Dickson, John Everts, Adam G. Faulk, Marvin C. Gunderson, Leonard O. Hancock, Arthur L. Howden, James M. St. Louis, Mo. Carbon, Texas. Chicago, lll. Mill Creek, Okla. Tulsa, Okla. Berkeley, Calif. ffhicago, Ill. Oakland, Calif. Verden, Okla. Lincoln, Nebr. Indianapolis, Ind. Indianapolis, Ind. Columbus, Georgia. Eldon, Iowa. Chicago, Ill. Trenton, Tenn. La Crosse, Wis. F airbury, Nebr. Watertown, Wis. Stratford, Okla. Washington, Ind. Berkeley, Calif. Lockesburg, Ark. Marshalltown, Iowa. Orleans, Ind. Maysville, Mo. Aguilar, Colo. Miller, S. D. Davenport, Wash. Spring Grove, Minn. Loup City, Nebr. Fresno, Calif. Hras, Sam N. Kizer, John W. Jacobson, Samuel Jordan, George E. Knight, Clyde S. Landes, John M. Manning, Lloyde A. Miller, Clarence J. Mitchell, Glenn H. Morris, John W. Myers, PurleQ Overman, David R. Peake, Thomas F. Prestley, Donald H. Quail, Vere C. Ralston, Joe W. Redburn, Oscar Regusci, Edward C. Roux, Arthur H. D. Sloan, Clarence L. Sorensen, Jens M. Stibal, Joe J. Tate, Walter L. Thomson, Rollan J. Wilburn, Henry L. Wilhite, Rodney E. Wood, John L. PRIVATESI Atkinson, Jake H. Berry, John L. Butts, Baron Eubank. Raymond Godfrey, Abe Irish, Leonard Kroll, George A. Lakin, Joseph J. Lucas, Lonzo O. McCrary, Jack W. Matthews, Frank D. Morris, John Parker, William E. Riddles, Samuel A. Starr, Joseph M. Tremmel, Ervin E. Walker, William W. Wiggerman, Frank Wood, Walter I-I, Yost, George C. Camino, Calif. Asherville, Kans. Miller, S. D.'-rr Berkeley, Calif. Hildreth, Nebr. Reynolds, Nebr. Agenda, Kans. Wahpeton, N. D. Garner, Iowa. Memphis, Tenn. Mason, City, Iowa St. Louis, Mo. Virginia, Minn. Decatur, Ill. Omaha, Nebr. Clarksburg, Mo. Koshkonong, Mo. Glen Ellen, Calif. La Plane, France. Orosi, Calif. Lake Crystal, Minn. Lidgerwood, N. D. River Falls, Wis. Vacaville, Calif. Kansas City, Mo. Bakersfield, Calif. Cedarville, Calif. East St. Louis, Ill. Willow Springs, Mo. Omaha, Neb. Bakersfield, Calif. St. Louis, Mo. San Francisco, Calif Chicago, Ill. Oakland, Calif. Des Moines, Iowa. Spavinaw, Okla. Mulhall, Okla. Cleveland, Ohio Stamford, Nebr. McAlester, Okla. Wichita, Kans. Minneapolis, Minn. Memphis, Tenn. Rock Valley, Iowa. Attica, Ind. Scotia, Nebr. sialic1oioioioioqsoqsaioannonsousoqpocooauu i ' ' '1 ' ' W ' Y M in fs' y 'Q '--' A-f-MH g. FIELD 1'IOSPlTAl. COMPANY NO. 37 Koster OFFICERS Capt. Parsons, H. C. . . . . lst Lt. Deffenbaugh, M. H. . lst Lt. Ellison, F. E. . lst Lt. Palmer, T. J. lst Lt. Schafer, j. C. lst Lt. Smith, W. F. . . . . ENLISTED MEN Sergeant lst Class Milner, Frank D .... Sergeant Backman, Grover C. . . Sergeant Jacobson, Palmer Sergeant Alosher, William W. . Watertown, S. D Fairmount, Nebr Monticello, Minn McAlester, Gkla St. Louis, Mo Atchison, Kans . Cuba, Mo Rushford, Minn . Chicago, Ill Kankakee, Ill Sergeant Custaf H. Pherson . San Francisco, Calif Private Morris, Ray B. . Benkleman, Nebr ' ' A ' ' ..- Fl .ul l 90 Lieut. Lieut. Lieut. Lieut. Lieut Stark, Lucien Seifert, Otto J. Cole, F. M. Rich, H. E. . Yazel, H. E. Cudworth, George W. Goebert, Phillip H. Frazer, Ralph L. . Leimbacher, Edward J. . Reynolds, William R. McBride, Edward P. Roberts, Don H. . Schnellbacher, Leslie A Robinson, -Judson L. Hartington, Nebr. New Ulm, Minn. Caldwell, Idaho . Vernal, Utah Bartlesville, Okla. . Selma, Iowa Atkinson, Ill. Mt. Carroll, Ill. Latimer, Iowa Algood, Tenn. . Missouri Valley, Iowa . Clinton, Ind. Quincy, Ill. Ada, Okla. I FIELD IIOSPITAL COMPANY NO. Koster OFFICERS Capt. Morganthaler, Otis P. . . . . . Omaha, Nebr. Lieut. Youtz, H. L. . . Moline, Ill. Lieut. Henry, Rex V. .... Hedrick, Iowa Lieut. Reed, R. R. .... McCook, Nebr. Sgt. Sgt. Sgt. Sgt. Clk Clk Pvt Pvt Pvt Pvt Pvt Pvt. Pvt Pvt Pvt. Pvt ENLISTED MEN . . . . Memphis, Tenn. . Trinidad, Colo. . Union City, Tenn. Wagner, S. D. . Indianapolis, Ind. . . . Chicago, Ill. Boveck, Bob . Kelly, james H. . Maga, Daniel M. . McMichael, Horace . Thompson, Clark W. Barkman, William . Caska, Martin W. . lst, class . Worchester, Mass. Ist class Chancellor, joe B. . . Lawton, Okla. lst c1ass'Chaney, Mklton . . Dallas Center, Iowa lstclass Hansen, Halfdan M. . Rockwell City, Iowa lstclass Hicks, Bennett . . . Blossom, Texas lst class johnson, Edward . Albert Lee, Minn. lst class Julius, George A. . . . ' Kiaton, Greece lst class Klopfenstein, Cortland A. . . Mound City, Kans. lstvclass Shepherd, john V. . . . Gary, S. D. Ist class North, Lester F. . Salt Lake City, Utah gf.. , ts ' I 1.1 - M A -.I-5. i v . 92 Fil rua 'pki Nik if i 133 l'i.'AlNZ?'Jil 4. ,-AP FWHM 'M W'2f1 if-WYVWHWINMWWH1-ivlwe-Gmwaw-wiritmravmnoxmguvvvizama-vwwmwunwsmnnavmmeduvuutw awMam0mn:lnnmmwaqm1PvQwbd0MmMam4s'mwv vi ummm! if .alilwii wwiwai f.i:il viii' '- N'--J?HX'- Major Lieut. Lieut Lieut Lieut Sgt. Sgt. Sgt. Sgt. Sgt. Sgt. Sgt. Sgt. FIELD HOSPITAL COMPANY NO. 111 Meyerding, Edward A. . Goldman, Emerson W Hubbard, William M. Spangler, Harve B. Wager, Leonard S. Brown, Herbert F. Carswell, Chas. l-I. MacLiver, Donald Neely, Fernay . Patterson, jesse J. Smith, Hubert M. Thulin, john F. . Tranaas, Tor L. . .l.L.L . nn. Koster St. Paul, Minn . Madison, VS. D .V Clark, Mio . Clinton, Mo Florence, Kans Blue Springs, Mo Kansas City, Mo Trinidad, Colo Blue Springs, Mo . Centry, Ark Blue Springs, Mo Kearney, Nebr Virginia, Minn. l l '!llUlN!4 09!ElR0 WlQl ' W NWFP OUHIYG '5-P 'lR1f!3 WWW? 0 NJN-W in fF57WZi4i'N41Rl'iU URWVUHC' 211' MPN' si zmsxv- fp agkaggqgqg-,.:g -vu-my-a ,I ,,, ,,,,,,,,,,.,,... ...,.,,..-.,-.,...-,-.vw-.Q-....,i-..-.m,w,,-w..1w-vu-annum-.nm-.-mav'-.1-.N... W--,...,.,. pm.. .........., ..,,-vu-...--.Q--..,,-,.,,.-p..-.,...,, -NV-. .,,tf.M....a......-...,.... ... M-....,......,...,.,. . ., 'lun . ... 4... . M . , . lIICAlJQUAR'l'lCRS DE'rAClIMlcN'i' AMBUIANGIC COIWPANIICS Koster Major Cook, Ceo. W., Medical Corps USA. Major McBride, W. L., Medical Reserve Corps Capt. Abraham, V. R., Medical Reserve Corps Capt. Morgan, E. l-l., Medical Reserve Corps . Lieut. Lindsay, M. K., Medical Corps USA. . Sgt. Bertman, A. W., Medical Department USA. . Pvt. lst class Van Riper, E: B., Medical Department USA. . Erie, Pa. Kansas City, Mo. Hood River, Oregon Calipolis, Ohio Topeka, Kans. Alton, Ill. Kirkwood, Ill. 94 Ml 'll ilk Wil. Ql l lf1lflJS l!.?!XlNlNKl f1Af'1l' ' -, . ,W . W 'W ws- -3 -f ---vw--U-----..........-1. YNY, sig., .F W 7-1: WY, ,i,, . -- vom' . ...--,.f. .-- We--1 -- Y .- V ---- W-' 1 r-2-aff-1----W-Y'--'-' qgovioqxroulnpnsxnouanounusavuoqnusqgqsgggqggggoqupofnpoiocuvouroioqmboionilooxnoioloio liiij E' Ifll 'l 'i lofi?-lf-,W fi Ebc Yixmbulance Company A Brief outline of its makeup and work N an article such as this, dealing with the duties of the Ambulance Company. it may not be amiss to point out the reason for the existence of this organization as a part of the general scheme for thc relief.of the wounded of armies in the Field. P ,QA lt is conceded without argument that those injured on the field of battle must be cared for at the earliest possible moment. With ' this in view we have what may be termed our First Aid Corps or Regimental Medical Detachment serving directly with the com- ' batant troops in the open field or in the trench. These Sanitary Soldiers are expected to render what emergency treatment is possible. often under the direct fire of the enemy, and practically as soon as the soldier is hurt. Since it falls to their duty to advance with successful troops, or since additional casualties may at any moment claim their attention. and further, since it is contrary to our conception of the performance of Battle-field relief to permit the wounded soldier, for any length of time. to pass from the charge and care ofthe Medical Department, it is apparent that some agency not only to relieve the Regimental Detachment of the care of these wounded. but to give additional care of the field to these unfortunates and. as soon as' possible, to remove them from the held is necessary. This is the work ofthe Ambulance Company. lt is organized for, and charged with the performance of a triple duty. First: to remove the wounded from the vicinity of the combatant organizations as early as possible. thus preventing an overwhelming amount of work being thrust upon the Regimental Detachment and also to a certain extent the lowering of the morale of the fighting troops which inevitably will occur if they find that their wounded are not promptly cared for. Secondly: the Ambulance Company is prepared to and does give these wounded additional care, and further medical attention at some comparatively safe place on the Held, if there can be said to be such a place on the modern battle- Held, until it is possible for them to be removed entirely from the danger area and to be transported to a quieter anzl safer place in the rear where their needs can be fully met until they have recovered. . The third part of their duty is, of course, the transportation of the wounded collected in their particular sector of the battle-Held. to the rear. These Companies in our service are organized as Units of the Division. Four of them are assigned to each division of Infantry. which is taken as the standard. According to our present allowances. three of them are motorized and one is animal-drawn. lt is not necessarv to enter into a de- tailed statement of the composition of these units, or to show the differences in composition of the two varieties, but should be sufficient to say. that, except for the necessary differences in personel required by the varieties of motive power. these organizations are identical. Each company is commanded by a Captain of the Medical or Medical Reserve Cor s who has with him as assistants four other Commissioned Ofhcers and an enlisted personnel including all grades of the Medical Department from Sergeant first class down to and including Privates, num- bering one hundred and twenty-two in the motor-drawn company and one hundred and fifty-three in the animal-drawn. The Company com- mander is responsible to the Division Commander for the proper equipment, upkeep. and instruction of his company exactly as is the Colonel of the lnfantry regiment next door. Of course. as Medical Department Units all of these organizations come within the purview of the Division Surgeon and their general supervision, and to a certain extent their tactical handling of the Field are entrusted by him largely to his assistant. the Director of Ambulance Companies. These organizations, together with the Field Hospitals and the Camp lnfirmaries when combined form the Divisional Sanitary Train commanded by a Lieutenant Colonel of the Medical Corps. This list of Officers superior in rank to the Compan Commander may seem contradictory to the statement made of direct responsibility to the Division Commander, but the l!'J.l1CCl'.S authority is. in fact absolutely direct, and all authority over these organizations is delegated and not surrendered by the higher command to the Senior Staff officers named. For the proper erformance of their duties the companies are organized within themselves into three principal groups: the Bearer Section, charged with the removalnof the wounded from the Regimental Aid Station, the Dressing Station Section, charged with the duty of establishing at some com- paratively safe place on the field a refuge for these wounded where they can be cared for and protected until such time as it becomes possible to remove them entirely from the danger zone, and lastly, the Transportation Section which takes them to the rear and turns them over to another Sanitary unit. usually the Field Hospital. The bearer section is variable in size, its numbers dependin entirely upon the necessities of the occa- sion. Although equipped according to our present allowances with only twenty litters it may be expandied by using the Ambulance litters of the organization and the personnel not aetivel engaged in other work to a total of about one hundred men. This group in charge of one of the Ofhcers of the Company, aided by several of the Sler eants and all of the Corporals, the last acting especially as dressers, starting forward from the Dressing Station of the Company, endeavors to estabish by the safest possible routes, lines of advance and retirement to and from the various Regimental Aid Stations or collecting points for wounded in the sector in which the Company is operating. These men, often exposed to hostile fire, endeavor not only to remove to the rear those wounded found at the collecting points, but also to gather and care for those who have fallen but have not yet been seen and cared for by other sanitary troops. lt is necessary that this group which has the most exposed and arduous duty to perform be com- posed of men who are not only physically qualified for their heavy work. but who are thoroughly competent to render Hrst aid treatment to the injured. Operating as it does in such advanced and exposed portions of the field, this section must select with the greatest care its lines of advance not only for its own protection but for the protection of those already wounded. The latter are removed as rapidly as possible to the Dressing Station. As soon as the Company has gone into action the Commander having selected a suitable location for his station, one having at least shelter against directly aimed enemy fire. accessible to the front, having a good route of evacuation to the rear, and water at or near at hand. directs its establishment. This is about as quickly done as said, for all that is necessaig is to unload and open the boxes of surgical dressings, other medical and surgical supplies and food chests and he is ready to receive patients. rdinarily- hc remains at this station for here he can best observe the work of his various sections and aid where needed. A small amount of tentage and a number of blankets are furnished for. sheltering and covering the more seriously wounded cases. Since the work of this group is largely that of emergency surgery. a considerable number of surgical dressings, splints, etc., form the larger part ofthe equipment of this station. A small surgical operating case is also provided but few other conveniences since it is desired to limit surgical work in the field to those operations immediately necessary in order to save life, such as the ligation of torn and freely bleeding large blood vessels. All of this work is done by two ofthe officers of' the company assisted of course by the enlisted personnel on duty here. Mention has been made of food chests. These contain a variety of easily prepared, light but stimulant nourishments such as con- densed soups, chocolate, malted milk, etc. lt is doubtful if there is anything more appreciated by exhausted, wounded soldiers, often chilled from prolongued exposure, than a cupful of this same hot food, together with a warm blanket or two, and a place to rest: and if there is any other aid which can be rendered at or near the battlefield that will do as much to ensure a safe comfortable trip to the rear and a speedy convalescence. When it becomes possible to do so, either during a lull in the firing or when nightfall comes to obscure all targets, or in exceptional cases when the nature ofthe terrain ermits during action as well as when emergency requires, the Company Commander summons his train of twelve ambu- lances which have probably been left until this time at some safer place in the rear and proceeds to evacuate his patients. These ambulances with a ca acity of forty-eight recumbent patients or of Seventy-tWO with one-third lying down are immediately loaded and started to the rear under charge ofpthe remaining officer of the Company to deliver the patients to the Field Hospital. lt is the duty of this officer to deliver his human cargo as quickly and as safely as possible and therefore he must exercise the best of judgment, not only in the selectionpf a safe and speedy route but in, so handling his train that the trip is made as comfortable as possible for his patients. For this latter he must depend very largely upon the skill and training of his drivers who by careful driving can greatly lessen the suffering of the wounded, and also upon the skill and attentiveness of the ambulance orderly or nurse who is in direct charge of the patients in each ambulance. The distinctly military character of these organizations in contrast to the more highly developed medical units farther in the rear as well as the close association with line troops and the somewhat hazardous nature of their duties appears to greatly attract the young. live-wire type of medical officer who prefers this position as a leader and trainer and organizer of his own command to the quieter, and safer, and more purely pro- fessional station in the rear. lt is doubtful if there is any unit of our Department which affords greater opportunity for the relief of suffering among the wounded or whose work when properly done will be more appreciated by the Line troops with which we are associated. Officers and men ofthese organizations alike in these companies must derive a large part of the compensation for their difficult and dangerous duty from that particular and most valuable spirit which animates that active, adventurous type of man, the typical field soldier. MOMIMQMIQOMOMFQIMQMOMQMCMOMOMO 1 rn v,,.,-...,. .--V--'W V 95 Lieut. Lieut. Lieut. . Plumlee, john L. Lieut Hawke, Charles C. . Yoder, Charles A. Robinson, R. E. SERGEANTS FIRST CLASS Lien, Harold L. . Meyer, Raymond A. . Seizoemsirsz Ayres, Franklin B. . Brown, Earl R. Crooks, Ross . Crane, Carl F. . Hinton, Harry . . Hurmence, Lloyd . Davis, Frank C. . Lundry, Leo L. . Zellhoefer, Glenn F. . CoRPonALs: Kelso, William P. . Kennedy, john F. . Stubbs, Thomas . Tingstad, Harold S. . Cooks: Colvill, Charlesvj. . Lucas, Albert . . Honsesuoaasz Anderson, Henry OFFICERS llNl.lS'l'liD l'liRSONNliL AMBULANGE COMPANY No. 18 Koster . Winfield. Kans. Elm Creek, Nebr. . Walnut, lowa Maneehster, lowa . Oelwein, Iowa Des Moines, lowa North Springfield, Pa. . Carbon, Ind. . Denver, Colo. Loogootec, lnd Sumner, lowa . Alma, Nebr. . Versailles, Ohio Le Roy, lll. . Tabor, lowa . lsmay, Mont. Minneapolis, Minn. . Virginia, Minn. . Rcinbeck, lowa Champlain, Minn. Mclntosh, S. D. Werner, Ralph H. FARRIER! Paige, Oscar F. MECHANIC! Wade, Everett E. WAGGONERSI Cox, Leo H. . . Dahlke,!August C. Gutheil, Charles D. Hall, Alva: . Solomon. Judd . . Pitcher, Lewis A. , Shultz, Benjamin A. . Umphres, Lewie G. . Watkins, Ragh H. . Warren. lra . . . Piuvfnizs FIRST CLASS rlimhnson, Martin . ichols, John H. . Skordahl, Julius A. . PRIVATESZ Anderson, Clarence B. Filer, Lloyd . . Jensen, Arnold D. . Fee, john M. . . Grigoncic, Alex . McMahon, Chester F. Milbourn, Henry J. Smith, Herman Middle River, Minn. Minneapolis, Minn. lndian Springs, Ind. . Farry, Okla. Oklahoma City Okla. . Men 0, Iowa . Greenfield, lowa Sidney, Okla Nievah, lnd. . Hubbard, lowa . Lexington, Okla . Muskogee, Okla. . Glcnrock, Wyo. . Chicago, Ill. Minneapolis, Minn. . Vermillion, S. D. Duluth, Minn. Knowles, Okla. . Audubon, lowa . Woodruff, Kans. . Shenandoah, Pa. Minneapolis, Minn. . St. Joseph, Mo. Petersburg, lll. COMMISSIONED OFFICERS Lieut. McCarey, A. J.. MRC. . . . . . Lieut. Westervelt, A. E. Lieut. Cloward, R. E. Lieut. Chattle, W. M. K. ..... . SERGEANT Fmsr Ci.Ass: Kaufman, George B. . SERGEANTSI McCain, Roe D. . Chapman,' Robert L. . genes! Lester P. . 'aton, Clarence R. . lgennings, Dane C. . ropheter, Hilbert J. Conklin! Edward I... . Dipert, Hubert L. . Pearl, Jean H. . . Coapoimtsr Chapple, Lawrence . Hartman, Melvin R. . Huntin ton, Herbert A. Mills, Cgharles A. . Stratton. Avery N. . Collins. Patrick Cook: Stringer, Grover C. . MECHANIC! Cochran. James F. . WAccoNizns: Snf:1erson,JEme!st-IW. a oun, ose . . Davis, Harry . Johnson, Oscar B. . undquist. Oliver W. Orser, Rolf . . Poor, William E. . Prescott, Clarence J. . Scovill, Donald S. . Piuvzmss Fmsr Ci..xss: Abce, Harry . . Allen, Norman K. . Brandt, Martin H. . Brewton, William L. . Brown, Lawrence R. . Corder, Rayburn E. Crouch, Fred G' . Cuda, Felice G. . Delay, Clair N. Devin. Henry H. Eaton, Arthur C. Georges flohn . . Grant, C ifford D. . Griffith, Bert Guion, Aaron G. Hanna, John H. . Hawkins. Albert B. . Hill, William R. . Hosadas, Ijohn N. . How, Wil red F. . Larson. Axel E. . Laugihlin, Harold D. . Law on, John O. . Marlene, Jerolamo ENLISTED PERSONNEL AMBULANCE COMPANY NO. 19 Koster Green Bay, Wis. . Omaha, Nebr. . Price, Utah. . St. Louis, Mo. . Chicago, lll. Baldwin Cit , Kans. . Batesville, Miss. . Kansas City, Mo. . Deeth, Nev. Scotland, Ill. . Indianapolis, Ind. Delano, Calif. . South Bend, lnd. . Mound, N. D. . . Hixton, Wis. . . Ely, Nev. Long Beach, Calif. . . Ely, Nev' Memphis, Tenn. San Jose, Calif. . . New Ross, Ind. . Vienna, Ind. . Kin man Ariz . Pitttsliurg, 'Kansl . . Farrell. Pa. . Eveleth, Minn. . San Francisco, Calif. . . Colgate, N. D. . . Madison, Ind. . Kansas City, Mo. . Marshalltown, Iowa Kenmare, N. D. Madera, Calif, St. Joseph, Mo. . . Bauxite. Ark. . Lincoln, Nebr. . Flemington, W. Va. . Indianapolis, Ind. Reading Pa. I I Jailed. in. Mountain Park, Okla. . Oakland. Calif. . Camino, Calif. . Paola, Kans. Melboume, Mo. Lafayette, Ind. Rivera, Calif. . Aurora, Iowa . Princeton, Ind. . San Francisco, Calif. . Shannon City, Iowa Chicago, Heights lll. . Chicago, Ill. . Mannsville, Okla. . Butler, Pa. Marshall, George L. . McDonald, Georgie . McGuire, Henri '. . McMaude, Her ert G. Michelsen, Harry , Miller, Edward A. . Mooney, James T. . Morrissey, William A. Neel. George F. . Ormonde, Manuel F. Serre, Adelore H. . Sommers, Nathaniel F. Stulkem, Henry C. . Teichmann, Herbert B. Teichmann, Reuben R. Torlp, Emil . . Wa vatne, Richard A. Watson, James C. . Watts, Virgil A. PiuvA1'rzs: Anderson, Arvil W. . Bachelder, Samuel G. Biddle, Jesse M. . Bokanovecz, Alex . Chapman, Willie O. . Devine, Charles L. . Ditto. Frank S. Englebert, Willie . English, Chester E. . Fariell, Maryon F. . Ferrenbach, Otto H. . Ford, William G. . Gage, Wilson O. Hyde, Teddy W. kms, Mike . iefer, Walter C. Land, William D. . Leonard, Victor O. . Lilley, George . Live y, Charles A. Iglons, Joseph B. anning, Leo Martin Henry W. Matlock, Charles Mattalia, Antonio . Mazzuca, Antonio . Moshovos, Nick G. . McClelland, William T. McGuire, Arthur L. . McKim, Harr . . Meyers, Llo cl'A. . Nordstrom, lseter M. Nyari, Frank I. . Ohlrich, Charles . Olezniczak, Stanley J. Porter, Charles L. . Psaltis, Emmanuel . Rees, GeorgleIA. . Richmond, erman C. Riley, John L. . . Ryan. Jcohn J. . . Roddic , Howard R. Sartor, William J. . Scott, Ezra . . Steele, Lester A. . Van Ryt, Henry . Van Ryt, Leonard . Weatherman, Clemul O. . wiemexg, Frgnll-E C. . ood, noe . . Youst, Frank Standard,' Calif. ' -Q Basin,'Wyo. . Rock Rapids, Iowa . Al ona, Iowa Cordova, Nebr. . Stratford, Calif. . Deerfield, Kans. San Francisco, Calif. . Cedar Rapids, Iowa San Luis Obispo, Calif. . I Cloquet, Minn. . Minnesgpolis, Minn. avanna, Ill. . Fargo, N. D. . Fargo, N. D. . Britte, Mont. . Trail City, S. D. . Winona, Minn. Mountain View, Okla. . Oakland, Calif. . Santa Cruz. Calif. . Amos, Nev. . Harmony. Pa. Okmulgqee, Okla. . Wal er, Iowa San Jose, Calif. Wasioia, Calif. . Sidney, Nebr. . Quinton. Okal. San Francisco, Calif. . Wichita Kans. Oakland, cam. Newarden, Iowa . Butler, Pa. Wausau. Wis. Marshfield, Ind. Chambers, Nebr. Kansas City, Mo. Beltrami, Minn. Coalinga, Calif. . Butler Pa. Ponervnie, Calif. . Y t Oh' ounhs own, io. avre, Mont. Cowansville Pa. Camino, Calif. Tucson. Ariz. Saratoga, Calif. Lamoni, Iowa . . Ely, Nev. . Los Angeles, Calif. . . Aurora, Ill. East Bakersfield, Calif. Oklahoma, City, Okla. . El Centro, Calif. . Salina, Calif. San Francisco, Calif. Smiths Grove, Ky. . Los Angeles, Calif. I Tyndall, S. D. . Highland, Calif. . Des Moines, Iowa. Davidson, Okla. Indianapolis, Incl. Rushville, Nebr. Rushville, Nebr. Springfield, Mo. Manson, Iowa Tucson, Ariz. Morgan, Pa. ll l'TPlPlYWi0'D , ., .i,. . I ,.f,, ,,, 4 MA., ,, Miz.: VK fx, fu, ' f, 1 'I .4 1..f ..l. l-,jf Q 'IRQ .ww , 41. . . . ,. ..........,..--M--. ..., -.. .. .......,.r.....-.., ,..,, ...-.......,,, .,,,. ........,--.... ,.., ,....,,,.-.......-............,.,.... ..,..,W...- ,,., , ,.,. . ..-. ..,4 .....1f.. . W. ,K,-. .,..-., -... . . .. . ....,.,,W--.. . .-...V-,,...,..., .-....l-aw. .. .- akin-1 Q-,Masai-Ummm-wwiwhl iaqyswu v-oe'-than-W -WM!-Q x 4 wa :aw-1:4-93 all ummm A '-UMM wfenniwvr wi Aiualwimllllihta lffwSNl'D'N1MUl04'lllil , i 'fa NLR I I YN' , wr, X ,N 5. 1,5 fu? V.. f1m:,ii.fr,i F A . Q- wi 1 .-'if tl! 591' . 2. . l . xl - .. 1-1. I l Lieut. Dobbins, Thos. Lieut. Battersby, Richard S. Lieut. Wiesgerber, A. J. SERGEANTS: Mahood, Cecil H. Verbiscar, Anthony McVay, Glenn H. Anderson, Harry L. Day, Frank Howell, Will E. Jensen, Harold J. Johnson, Virgil M. Kopecky, Joseph F. Malloy, Thomas A. McKenny, Patrick L. Olsen, Aksel G. Scott, Shirley C. CoRPoRALs: Johnson, William D. Lofgren, Maurice J. McMehen, James H. Scarlett, Earl G. Shultz, Guy M. Cooks : Davis, Odean O. Stafford, Waldo E. Vincke, Jules MECHANIC : Sheridan, Daniel AMBULANCE COMPANY NO. 21 Koster Pine Bluff, Ark. Shelbina, Mo. Perry, Kans. Sioux City, Iowa. Chicago, Ill. Le Roy, Ill. Shenandoah, Iowa. Hollis, Okla. Worland, Wyo. Council Bluffs, Iowa. Washington, Ind. So. Omaha, Nebr. Chicago, Ill. San Francisco, Calif. Washington, Nebr. Colfax, Ill. Newport, Ky. Erskine, Minn. Mountain View, Okl Fairfax, Mo. Scribner, Nebr. Medford, Okla. Beloit, Kans. Detroit, Mich. 'Q Indianapolis, Ind. 3. WAGONNERS : Brawley, Arlie Busha, Claude J. Garrity, William L. Hoefle, Milton L. Holloway, Ralph H. Ingersoll, Hugo E. Koranda, John J. Kraker, Anthony A. Lokken, Oscar S. Melrose, Marshall S. Rick, Charlie F. Shortal, Joseph A. Smith, James E. Spracher, Clyde W. Tyler, Kenneth L. Wintermute, Silas Worden, Robert L. PRIVATES FIRST Ci.Ass: Bonillas, Eugene Cameron, Pliny Campbell, Robert L. Colacicchi, Tony Curtis, Henry W. Douglass, Raymond Duehring, Charles W. Foster, Joe B. Grissom, Clarence E. Hammersmith, Robert H. Hawes, Glenn Cheney, Kans. Virginia, Minn. Milan, Ill. Highland, Ill. Kansas City, Mo. Waynetown, Ind. Chicago, lll. Virginia, Minn. Irene, S. D. Plano, Ill. Waterloo, Ill. Jxerseyville, Ill. est Alton, Mo. Sibley, Iowa. Sterling, Nebr. Terre Haute, Ind. Wichita, Kans. Los Banos, Calif. Colfax, Louisiana. Freemont, Nebr. St. Paul, Minn. Independence Io a w Mount Vernon, Ind. Fort Dodge, Iowa. Crowder, Okla. Hutchinson, Kans. So. Bethlehem, Pa. Sreward, Minn. 'RD'0M1P1UHB OMOMl '5mm3 W33 '3M 'MWRTD WVHHDQ flWWiMfUH5'hQ 'WWlD vw-iw-V. W- ---, W - W- -H--V --f--1----Vw ,---- M---w- --w-- ------1-mf-m .----Y..-W--,--...-....T-... nw. .....-W-.W-Mvunnal. w--.v-............f.-,5i---.----nn.-.....lun-n Mi-11 salma. Oi lfil,ilj.l.3S 'i12A1N1Ni,n Lfxgltllgf 44---1 -- V '-------f1:- -ff W..- Y.v. -. ..., . -H-I ...... .........-in- ---- 1.-f..,,, ....... . 'm9'.iFUX1-lli0ilMlM0MI Vi 'PI lil! VY I-IAN HA!- H9-i9'M'li0MllllMlMCMlMUM I. . . . .. .. .1 M1-. 41 -.M ... -. .... ...pn-..-.. Junge, Felix Kuck Lawrence A Lackey Edward E Lay Fred Lindemann Harry R Maple Archie C McBride Ray E Murphy Thomas N Noble William S Pace John Phifer Tom Plimpton Lyman Poole Carl Powell Wilbur C Reese, Charles H. Sharp, George W. Shultz, George D. Sinex Arthur C. Slinker, Bernard Tate, William H. Taylor, James L. Teuscher, Joseph Tolbert, Paden E. Vogelpohl, Harry P. Wilson, F. F. Wilson, M. M. Worden, Austin J. Zimmerman, Walter Jereczek, Michael Lyon, Charles G. I ' ' , G. W PRIVATESZ Abraham, Abe Arnold, Alonzo AMBULANCE COMPANY NO. 21 Koster Homer, Minn. Glenview, Ill. Corona, L. I., N. Y. Louisville, Ill. St. Louis, Mo. Glenville, Nebr. Des Moines, Iowa. Paris, lll. Columbus, Kans. Norwood, N. Y. Highland, Kans. Kansas City, Mo. Big Sand, Tenn. Dell Rapids, S. D. Kearney, Nebr. Guthrie, Okla. Johnson, Nebr. Tahlequah, Okla. Scribner, Nebr. Bloomington, Ind. Titonka, Iowa. Independence, Iowa. Garden Grove, Iowa. Melford, Nebr. Vinita, Okla. St. Louis, Mo. Hanford, Calif. Tulsa, Okla. Wichita, Kans. Beaver Crossing, Nebr. Ainsworth, N ebr. Cozad, N ebr. Baker, Willie S. Boatman, Gail W. Capron, Dwight R. Colloton, Emmet J. Dack, William J. Draper, Frank D. Fuzzell, William L. Galli, Peter Goodwin, Henry B. Hamm, Oscar H. Helmer, Herman H. Hespen, F. C. Hill, Dixie M. ohnson enr L J , H y . Kendall, Johnnie M. Kling, Ervin Knox, Robert N. Lobato, Adolfo D. Mayo, Tom B. McCarty, Carl Morgan, Earl L. Morter, George R. Murray, William Paget, Russell W. Pederson, Hans Peters, Charles B. Ross, Edward S. Rostek, John G. Shaver, Harry A. Steen, Finley W. Stone, Estel B. Tyrell, Clarence N. Worden, Kenneth R. Zimmerman, Walter Memphis, Tenn. Gravity, Iowa. Melbourne, Iowa. Mason City, Iowa. Le Mars, Iowa. Denver, Colo. Laverne, Okla. Reno, Nevada. Caldwell, Kans. Harvard, Ill. Jefferson City, Mo. Bolivar, Mo. Tecumseh, Okla. Buffalo, Gap Texas. Hepburne, Iowa. Corrine, Utah. Roggen, Colo. Turley, N. M. Dresden, Tenn. Collinsville, Okla. Tribune, Kans. Lyons, Nebr. Elk Lick, Pa. St. Louis, Mo. Council Bluffs, Iowa Lexington, Okla. Sparta, Ill. Decautr, Ill. Sioux City, Iowa. Stafford, Texas. Rolla, Mo. Beaver Crossing, Nebr Wichita, Kans. Lodi, Calif. Qwimimloxo10130301nunonlno-xnqlnaannonuumvsuummurnmnsnm 'W ' -- -- 'f---Y'- -----'Q --,--- v --'ww--'--v-V V v S-V-lv.--.-.f.-....u-1-q1ugy.,.i-Y fj AMBULANCE COMPANY NO. 37 Lieut. Speers, W. F. Koster OFFICERS Lieut. Maercklein, E. I-I. SERGEANTS : johnson, O. G. McCoskey, Leslie V. Thompson, I-I. C. Wright, T. F. I-lesser, L. D. CORPORALS: Calrson, D. E. Chase, R. G. Sullivan, P. V. Grinnelli, A. MECHANIC: Rudd, C. E. PRIVATE FIRST CLASSZ Nivison, Dick PRIVATES: Hassett, P. J. Linduski, O. I-I. Neasham, D. J. Underwood, M. K. Davenport, Iowa Ashley, N. D. Irene, S. D. Scottsburg, Ind. Bemis, Tenn. Fayetteville, Ark. Illiapolis, Ill. Wichita, Kans. La Crosse, Wis. City Point, Wis. Chicago, Ill. Cedar Rapids, Iowa I-Iennessey, Okla. Brooklyn, N. Y. Sioux City, Iowa Ottumwa, Iowa Rolla, Mo. N. 'ian 100 ln. - ski-I .. 1. AMBULANGE COMPANY No. 38 Koster OFFICERS Lieut. Needham, Chas. T., Lieut. Miller, Irving Lieut. Mintener, ,John W. SERGEANTS FIRST CLASS: Fleugel, Howard M. SERGEANTS: Halmos, Fred C. Polley, Eglvert M. True, Fred W. Hennigan, Carl Lowdermilk, Herschell j. Eldridge, john H. CoRPoRAI-: Scott, Lawrence A. Omaha, Nebr. Violin, S. D. Minneapolis, Minn. Chicago, lll. Los Angeles, Cal. Ladysmith, Wis.' Raton, N. lvl. Valejo, Calif. Denver, Colo. Shawnee, Okla. MECHANIC: Sargent, Edward B. WAGGONERS: Lindsey, Frank R. McConnell, Chas. A. PRIVATES FIRST CLASS: Corham, George L. jeans, Robert H, Rimnac, jerry j. PRIVATES: Edwards, Marion lrludson, james j. Bakersfield, Calif. San Francisco, Calif. East Bakersfield, Calif East Hampton, Mass. San Francisco, Calif. Veseli, Minn. Altus, Okla. Oakland, Calif. AMBULANCE COMPANY No. 40 fliloster OFFICERS Lieut. Whitcomb, G. D., MRC. Omaha, Nebr. Lieut. Reed, A. I., MRC. COn detached service to Pittsburgh, Pal ENLISTED PERSONNEL SERGEANT: Law, R. R. Stover, Mo. hlorman, Louis G. MCC-regor, Minn. jefferson, Geo. Chicago, Ill. Los Angeles, Calif. Pei ry, Oklahoma. Rock Island, Ill. Vincent, I-Iarold R. Ringler, A. J. McClaran, Geo. W. Munson, R. V. Isle, Minn. CORPORALS : Shank, Leon C. St. johns, Kans. V... ... .- McAuIiffe, F. M. Sanders, Fritz Templeton, William E. Newland, Leon L. MECHANIC: Ingraham, Roy C. Cooks: Rompel, Chas. Virden, Christopher PRIVATE FIRST CLASS Shadduck, L. K. PRIVATES : Goerling, Nichols Stammer, Herbert Rawlings, Wiley Trenton, Mo. Chicago, Ill. Transfer, Pa. Mitchell, Ind. Omaha, Nebr. Belleville, Ill. Moweaqua, Ill. Charter Oak, Iowa. I-Iausan, Wis. San Francisco, Calif Rochester, Texas. . .4 r uv,-ei 1 ,a . . ,i.-w N .I 3 lim-. fil,.'x,4gfr.,:'w,,i ,f .X Xi-ll - -rg . ,am .-11, .i.. 1, r ,,, .L . . . .. - -..i .. ,. vm.-W,..f-.v...'.-.m,.,.i...-... ....-..i...--- ......., ......-........ .... . .,..........,...,. ...-,...... ..,. ........--.....................,....,...,,...................,. f 'WW 'f' ' WW? 'fl W' mf mm s 1.wsa.'-1 iwwawvweaa 1' www -fl-mms w ww-f.: w www e wwnn s 'mmm' Q -mmap 1 1-www an awww, e wr-ML 1 aww sr mmm s X' AMBULANCE COMPANY NO. 41 Koster ' OFFICERS johnson, Regert L. E. Lieut. Sheehy, nj. P. Omaha, Nebr. Cole, Francis L. Lieut. Mullinax, C. E. Princeton, Mo. CORPORAI.: Lieut. Vorpahl, R. A. Cedar Rapids, Iowa. Vogel, Otto H. B. Lieut. Doster, Wade Coldwater, Kans. ERIVAIQE Fliizsr CLASS A enne y, a mond A. SERGEANTS: ENLISTED MEN PRIVATES: y Reel, joseph L. Marion, N. C. Opfergelt, Raymond ,I Kennedy, Frank E. Arion, Ill. Albright, john R. Howard, john Hartsdale, N. Y. Neel, George B. Rockford, Ill. Virnon Hill, Virginia Memphis, Tenn. Aurora, lll. Woodstock, Ill. Kokomo, Ind. St. joseph, Mo. Madame fsmvkh wlemmw miami! MMM wtdmw il 0 'Milk Ovfiuww .wi wan-m-an -mmm wma ueunnmwn-an womb: mmuwnwvlum ur- -f---,,.w-....-.,.v.p.u...-,f,..,,.,,,, ,,,.,,,,, ,,,,.u,f.a. -..-M-1.1, ----fw vw 4 - - W ' 'f 1-'M' -'41---' M-1 '- - V- 11. .---.f ..-- -. V- .- v,-, .- 4. 4... .Vi 1.-..-nun, ,,.-.... -n..---v,..,,-L. .. .,,-.,,, f. if, -.N ,g -. - 103 r i-.,.--.- , 15 i..'Lt 'l., K 1 YKKRZ lr HWJPLQI in NWI 'I 2 -1 'lfrfllfhl 9 l7ll i.c' lowmn To L -1- . .51 lk'fi'i:.s fc-02221565 'L'1LI2'i, '. 'ci i' KA in-L '12 xi' .. -197,5 J sz xg'-.' ..'a --'- 'Hawk iv iw .Y . 6':4AQ'fHv 0 ' - ...ng 1... ,. -' ' Ha.. . . ' .' --1,1 ' -Y-I -9.-r I W,-fr -,pqq ,v-t ,ar OFFICERS Capt. Ashley, Harmon H., MRC. Lieut. Culver, George J., MRC. SERoEANTg FiRS'r CLASS : Campbell, Charles G. SERGEANTS: Brown, Wade H. Hoganson, Victor L. Snay, Ora E. Rose, Ernest K. CoRPoRALs: Patterson, Paul R. Amburgey, John W. McCullah, Robert L. Cook: McAdams, Roy R. MECHANIC: Durkin, George L. Pi11vATEsg FIRST CLASS: Arnold, lrvin G. Aveni, Charles Cummings, Roy L. Davis, Ewing W. Dennis, Amos C. Donoho, Glen B. Green, Yates Hart, William B. Kelly, James EVACUATION AMBULANCE COMPANY NO. 1 Koster Buffalo, N. Y. Au Sable Forks, N. Y. Chicago, lll. Seymour, Mo. Livermore, Iowa. Grand Rapids, Mich. Rice, Ky. Chambersburg, Pa. Jenkins, Ky. Greenville, lll. St. Paul, Minn. Cleveland, Ohio. Danville, lnd. Johnstown, Pa. Fulton, Ky. Calvin, Ky. Mason City, Iowa. Fulton, Ky. Statesburg, Ga. Duncannon, Pa. Johnstown, Pa. Lamb, Otis R. Leaser, John E. Lyon, Clyde R. Monfort, Walter R. Pedersen, Marius Runyan, Albert Snow, Jack R. Walton, Julian M. Wing, Lyman H. PiuvATEs : Albright, Charles D. Barnes, Almer G. Belfi, Mathew Bidus, Anton Boyd, Carl Byrns, Vernie W. Davis, Herbert W. Hafer, Howard F. Hartman, Clarence A Hoffman, Jerome Johnson, Albert Keck, Harry F. Lakeman, Dirk Mayo, William McDonald, Arthur L. Noell, James B. Rushmyer, William A. Shiner, Leo Spears, Ashby C. Springborn, Eugene Treat, Homer Watts, Glenn W. Charlottesville, Va Decatur, Ill. Fayette, Ohio. Hartford City, Ind Louisville, Ky. Indianapolis, lnd. Fulton, Ky. Morganton, N. C. Detroit, Mich. Coatesville, Pa. Southport, lnd. Cleveland, Ohio. Chicago, lll. Milton, lowa. Sheridan, Mo. St. Clair, Pa. Allentown, Pa. Leganon, Pa. Maplehill, Pa. Akron, Ohio. Cincinnati, Ohio. Perley, Minn. Toledo, Ohio. Willisville, lll. Timberlake, N. C. Durham, Mo. Chicago, lll. Rio Vista, Va. Cleveland, Ohio. Marshall, Ark. Seymour, lnd. M,,,,,,,,,,,,,,,,,,,,,w,m.u,m,w .tum-ubnmvm 44:1-.un-Umemufanuumu:M-numwnzbmuwwawmunumu-ucvaua -was-1 ................-.,... ,... ...,,,,.,.,,,.,,,,,,,,,,.,.,,....t..,... ..... ....,...........,........-...,M.....-.0 -IMWOAPJ ...-.1,..,............-.p..-.-..v-.. 1 i 1 .,.. , , .: . ,..-,, S ...NNW , ,i gi in, 91,3 , iii ri 'ii 1 .Jn i ..fXliNfw1, i .Si li na..-nv.--...., ........i.......s-A-0 - -----n-'-A-m.--.a.n.-,-.-p----v..n--v--w.v.- -1.-nw, 0... I --1. .M.,....,- .. .. W.,, .......-........-.04-.---4x-ni-.e .-v.4n..nau..uun.q-m.muunun-v-uovu-naf-- --'w-iM4--I--f--w--v-- -- - -I r- --v - -M-r--- --f-11-4-F-'---i 4- I-4- ' -+'- 4 - gp :gpm 4: llvmlll +0 wwlm 1 mmm' in Umm 9 WMD 6' Mwfivm ln qwfms- I., mwzgi 5, ,,-,f,i,p,,,i,v, .y, 43535 Q MEMNMQC HXSSDW II HMWUA if HH!H'5!c fi 'IBEW ,J VWAHPUD -si frfmfkv fJRWB 1:1 QSXEWN in NNW!! -1- 13112259-I 7 , . - -X I .. -L . ,. ,,,. ,X if. g.f..i :Miz i. i-...fX.-X if . . , EVACUATION AMBULANGE COMPANY NO. 2 Koster Capt. Wiersen, Theo. M., MRC Chicago, Ill. CCom'ndg Co.J Capt. Spencer, Frederick H., MRC. Waverly, N. Y. SERGEANT FIRST CLASS: Roof, David C. SERGEANTS: . I-larris, James H. Ward, Lester J. CoRPoizA1.: Afflerbaugh, Earl M. MEcHAN1c: Goodan, Ray A. , PRWATES FIRST CLASS: Butler, Edward J. Bernstein, Max Berry, Arthur W. Buhrman, John C. Everett, Frank H. Fitzgibbon, Michael Freeman, J. W. Freudenberger, Sherlcy Friese, Herbert B. Grannis, Charles Cleveland, Ohio. Townville, S. C. Canistota, S. D. Grand Island, Nebr. Kansas City, Mo. Indianapolis, Ind. Richmond, Va. Dayton, Ohio. Rouzerville, Pa. Jackson, Mich. Bay City, Mich. Pittsburgh, Pa. Louisville, Ky. Davenport, N. D. Green Bay, Wis. Graham, Gilbert N. Grimm, Homer D. Hughey, John C. Kilgore, Earl L. Northrop, William N. Pellish, Stephen J. Rhodes, Gilbert Smith, Mark C. Wahlstrom, Elmer PMVATES: Blais, Eugene J. Brandon, David D. Caldwell, Spurgeon M Elders, Geo. C. Giltner, Howard O. Havens, Claud Judy, Frank Keith, Archie Keith, James T. Kcncaly, Jerry Meacham, William S. Litchheld, Edgar C. Ross, Sherman Smith, Ralph L. Stewart, Ambrose D. Tibbets, Clifford C. Wahlund, Henry A. White, Clifford B. Canistota, S. D. Mt. Carroll, lll. Melwood, Ark. Ottawa, lll. Kansas City, Mo. Ohio Pyle, Pa. Windsor, N. C. Muncie, Ind. Fergus Falls, Minn. Day-ton, Minn. St. Louis, Mo. St. Albans, W. Va Brookford, N. C. Gtto, Ind. Arnold, Ky. Wesleyby, Ind. Sioux Fall, S. D. Hendersonville, Tenn Chicago, Ill. Petersburg, Va. Des Moines, Iowa. Winifleld, Tenn. Hudson, Iowa. A Perry ,Mo. Lincoln, Nebr. Madison, Wis. Cincinnati, Ohio. 0 uqmmxwsmwuiamun iQQ!QDOlMQMhllBkBll!1 womb onwnwsnb-milkkwvlhvta-manmonliiw nf-cwmsvnmamea nmmw N 'mu' .,.,,........-f.-.................n....,,......-..............- ..-..,- .... ...... ..,. W .... ..,........,...........,...--...................,..........-.m....,....... ....,... ... -N... ..........,. ......v....... B... ',i-1-maui. .,- - Ambulance Company Photographs by courtesy Newspaper Enterprise Association Cleveland, Ohio 107 Second 'liberty 'loan T1Drive In M. O. T. C., Ft. Riley, Kansas On the morning of Cctober l4th, 1917, two officers were assigned the task of making a ten day Liberty Loan Campaign. At this time, we had 836 officers and 2202 enlisted men in our camp. Each company was trying to cutclo its rival with the result that the officers and men purchased bonds amounting to 3211000.00 'lhe avcrage for ofhcers per capita was 511358. for enlisted men 35361. While the Campaign was at its height, it was discovered that no organized effort to sell Liberty Ecnds was being made in the nearby towns. Acting on the results in our Camp, a second Campaign was started, covering the Cities of Manhattan and junction City, with the result of a sale of 3550000.00 in addition to those sold in the Medical Camp, making a grand total of over three-quarters of a million dollars. LIBERTY LOAN COMMITTEE. V ii.sL4MLIl'L AX . COYOTE CANYON ' lair! J 5.0 1'-NHT 571 375 'T 'W H3 P93835 'ii 6T5'f'J'93'F 'QT I 301114 'DA f3i98Yl W6 WSIIISJ' Ol- 7-Ki 0' 65192020 43' 'JIHMND' 0 IQUWBI 5f llWf7+ 0 UNSW Q 'Nl 19 IHWKDK . . ,. .... , .... cw... V. ,,...-.-i..-.-V.-M, ,..,. ,.. ..,. .',. Y ..,,. ,....,,. .,..v. ,...'.. i.....,...,., . .,.. .. ....,,,.........,.-... ..,f..ci..-.,...,... .....-VV ..,... .....f....- ..-v..,.....-A...-..........-.,.,.-,...1.-c---.....-.-.N-.ff 108 1 KQVIA 1' Q 1'-'Z fflfospilal Grain v. ,vM,v ERETOFORE, transportation of the wounded by rail, has been accomplished by means of , , improvised railroad equipment, using the standard box-car, day-coach and Pullman. 5 ' which. at best, has been a very unsatisfactory method of handling this important matter l l of transport. ' f, Qlhq N I . The first Hospital Train to be organized and equlpped as such for use by the Medical Department, was the one used in 1916 for the purpose of transporting the sick from the various Camp Hospitals on the Border to Base Hospitals, and consisted of ten Pullman cars. The present organization of Trains for duty abroad has been changed somewhat from that in use in the home country, necessitated by the changed conditions in France: the personnel consists of three C35 Medical Officers and 31 enlisted, the latter distributed as follows: three C35 Sgtsg three C35 Cooks and twenty-five C255 Pvts, First Class and Pvts., Medical Dept.: the internal administration is that of a Post Hospital, and, as the organization belongs to the Line of Communications, will be under the Surgeon, Base Group. These Trains are to be of English manufacture and are to conform to the standard English equip- ment, which is quite different from that seen in this country. Each Train consists of 16 coaches, arranged from front to rear as follows: C15 Brake and store car, C25 Personnel car, C35 Kitchen and personnel mess- room car, C45 Car for sitting-up cases, C5 to 85 4 Ward cars, C95 Pharmacy car, C10 to 135 4 Ward cars, C145 Kitchen and stores car, C155 Staff car, C165 Brake and Infectious car, is 884 feet in length and has a capacity for 320 recumbent and 56 sitting-up cases, in addition to the staff and personnel: the ward cars are 54 feet in length with the beds arranged in a separate compartment, with the lavatory and toilet walled off at the end, the beds being arranged on each side of the car in three tiers, affording accommodations for 36 men recumbent: this number can be increased to 48 sitting-up, by means of using the middle bed for back of seat and swinging the top bed out of the wayg ample room is left between the beds for the stretcher-bearers and the bunks when not in use can be swung out of the way for purpose of cleaning or disinfection: the ward, as well as the other cars, are well ventilated by torpedo ventilaters, in addition to sliding panels placed over each side window: two portable electric fans are provided for use in treatment of cases of gas poisoning, the whole of the ward being painted white and the floor covered with linoleum giving a light and clean appearance and the whole Train is steam-heated and electrically lighted throughout: the Phar- macy car is 50 feet in length, arranged with pharmacy, treatment-room, office, stores for clean linen and soldiers equipment: the pharmacy is fitted with cupboards and racks for medicines, next to the pharmacy is the treatment room, with table, sterilizers, etc.: the office contains tables, chairs, and safe: the car for sitting-up cases is similar to the ordinary 50 foot compartment car with seven compartment, each of which is fitted with two bent-wood seats while above each is a folding bed so that 8 sitting-up and 2 recumbent can be accommodated in each compartment. The kitchen cars are alike except that the space utilized for the personnel mess room in one is used for a store room in the other: they are fitted with cooking range, sink and drain-board. The staff car is divided in half for use of the Medical Officers and nurses, the number of the latter having not been determinedg they are equipped with dining room in each end, shower baths, etc. On account of the limited personnel, the loading of the Train will necessarily have to be done by the organization from which the patients are received and the unloading done at the Base or other Hospital. Owing to military necessities the former will have to be accomplished in a minimum amount of time in order that the lines may not be blocked: the Trains on returning from the front to rear, either at railroad terminals or Bases will undoubtedly have sufficient time to clean, and possibly disinfect, and receive sup- plies and equipment. lH'iS':m'f.Q 59431381114 Jr vdlvuilfmu' N481-lW'9 IW WMUMN' 65- WDMRNY 13' ' li 'HN' ,,..,.,-m.....M,...,..,,...., fY.....,.,,1n-.ml.....-.,..-....-. .... .1-1-Q-.M ..l.,....,....-f-Aw-i.u.,.,.,-.. . ,......'.. M,.- 1 ....- , 109 , wfgyy a mnrwluva 40 'ur i-:fm 1. .,. .-. .-iqv-W , .. N, , ,w ,-545351, ix Whii 2-Wi IJOSPITAL TRAIN NO. 24 b OFFICERS Capt. Goodwin, Andrew J. Lieut. McCormack, William E. Lieut. Eubanks, George W. SERGEANTS: Witty, Lee H. Hatch, Vernon V. Scroggin, Guy T. Cooks: Bauer, George C. Bishop, Arch A. Sam, Yee PRIVATES FIRST CLASS: Clouse, William O. Gossett, Clyde jones, Lawrence D. Kolpin, Alfred LI. Koontz, Victor E. Wheeling, W. Va. Louisville, Ky. Wabash, Ark. Memphis, Mo. Eau Claire, Wis. Mt. Pulaski, Ill. Anderson, Ind. Lockwood, Mo. Santa Rita, N. M. Cheney, Kans. Republic, Kans. Malad, Idaho. Kenosha, Wis. Mound City, Ill. Koster Rogers, D. W. Smith, Claude S. Tovey, Morgan W. PRIVATESZ Bennett, Carmen D. Helmick, Earle D. johnson, Charles H. Kreutz, Richard H. Loisel, Frank P. McKinney, Collin W. Moreland, jerry C. Patterson, Joseph W. Payne, Gordon W. Peterson, Willard A. Robson, Andrew C. Russell, Pemberton E. Schaaf, Arthur C. E. Stebbins, Charles F. Thomas, Guy O. Thompson, Gilbert T. Randolph, Mo. Salt Lake City, Utah Malad, Idaho. Los Angeles, Calif. Buchanan, Mich. Hollis, Okla. Richmond, Ill. Deer River, Minn. Elkhart, Texas. Vichy, Mo. Ottawa, Ill. Weiner, Ark. Castle Dale, Utah. Mayetta, Kans. St. Louis, Mo. Detroit, Ill. Sioux City, Iowa. Malad, Idaho. Cloquet, Minn. St. Louis, Mo. S. 'fi Voelker, Elmer R. gig .44 ' 1 A6395-9,..4fp1guiiLz, vamwsisw fwpm- W wwmm FP Wiilfm 'E fiwliw mecmvgzxi 0 Q?--v !R1'?r' s.-fif,-.wi ew -v I -- v-fw e- f-::f.-ie.1f.- '-f- I-.u 2,.i.-.4.u:z- . 'rut 1.4.1-ms::':m:':' .:g..,:. I .-,.:r- 'v- W - 5- : z ' .Cm .-f- -.W -':.-:..::f' ' ,,.' 1. .zu . - .:1u-4... :4g1:.1:'1L -4 u.'f:4s.:.u.:.:.z:1:.' :. ' 1 -A L 4 t . ,YR A X V . I -Q... X 45 5 v' I r.. A I H Jn. ' '. .1 1. , , ' A I HOSPI'FALiTRAIN No. 25 Koster OFFICERS Lieut. Seifert, Otto J., Comd'g Of. Lieut. Clint, Morgan L. Lieut. Loosbrock, john F. SERGEANTS: Martin, james A. Eastman, Denton H. Gaines, junius H. Cooks: Hays, Henry K. Haug, Benjamin Hurst, Lawrence D. PRIVATES FIRST CLASS: Crellin, William R. Hogan, William P. McDonald, William A. Warwick, Albert Zimmermann, Edward F. New Ulm, Minn. Meadville, Mo. Des Moines, Iowa. Lamar, Mo. Abingdon, Ill. Chilowee, Mo. Oxford ,Neb. St. Louis, Mo. Salt Lake City, Utah. Salt Lake City, Utah. Troy, Mont. Briley Brook, Antigo- nish, Novia Scotia, Can. Salt Lake City, Utah. Clayton, Mo. PRIVATES : Crosby, jesse C. Day, Perry A. Palknor, Allen W. Pagrell, Harold -J. Cvrant, Francis M. Harman, Clifford Jansen, Aloysous L. Lewton, Verne E. Mabeus, Lester j. Neilsen, Leslie M. Northerner, William F. Pace, Earl Pasternacki, john Peck, Gordon D. Potter, Elmer S. Reikat, Robert R. Ricks, Lewis C. Rogers, Isaac C. Stoddard, Raymond T. Wells, john L. Bountiful, Utah. Castle Dale, Utah. Fort Cobb, Okla. Storfors, Warmland, Sweden. Fairmount, Nebr. Granger, Utah. Colorado Spgs., Colo Laddonia, Miss. Randolph, Ncbr. Blackfoot, Idaho. Cannelton, Ind. Palisade, Nevada. Chicago, lll. Sandy, Utah. Ignatius, Mont. Paxton, Nebraska. Pocatello, Idaho. McPherson, Kans. Coldburg, Idaho. Eureka, Utah. 2 Q fi. Lieut. Kidd, F. S. . . Sgt. Sgt. Sgt. Pvt. Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Burger, Herbert H. Day, joseph A. . Richardson, Benjamin Burger, Noah E. Banta, Roscoe IVI. Bennett, Richard R. George V. Cochran Eidam, Clarence . Ensign, William A. Finley, Emmett L. Gardner, ,James P. Hamilton, William H. Hill, Torres -J. . Hunter, Robert A. Knowlton, Rudelphus C. Lasnier, Edmund J. Lowe, Zearl E. . Martelle, Andrew R. Murphy, Rex . Preston, George St. Clair Ritter, Paul D. . Ross, Turner A. . Seely, Edgar T. . Spencer, Ernest E. Tipping, Herbert . Williams, ,John R. Woonsocket,fS.fD . Conway, Ark Chickasha, Okla. Stockton, Manhattan, Denver, Freemont, . Omaha, Cambridge Sacramento, Concordia, Beatrice, 'Nl 390- i ' 0 '! .- -4' S' 'N' u'F '5T1?lYZY'4' Calif Kans Colo Nebr Nebr Iowa Calif Kans Nebr 1-T' we ggggg ww -gg Mm ?li,fAl, nitric -isiara li'i.mmmj ,gmii TW :.:..,,., e .e......,.e 1-.......Kt:e......er ':.m.:.'.r....' :....... i'1......Me........' ..... e.e.........,.................,.... l UL' I' l3'll l 'i. !x 'iN'w.X1- . 'imiw Lieut. Kidd, F. S. . Sgt. - Sgt. ' Sgt. Pvt Pvt Pvt. Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt Pvt. Pvt. Pvt. Bingemer, Charles T. Lowther, Alexander C. Steensland, Theodore A. Battersby, Edmund A. Becker, Casper W. Brandewiede, Richard Cochran, Clarence F. Cottingham, Vergil E. Crabtree, Early C. Eiberger, Edward H. Hughes, Howard J. Huhfman, Everitte M. Lindgren, Lawrence F. McBride, Charles gl. Nichols, joseph C. Orloff, Carl . . Paxton, Edwin . Phinney, Wilber H. Reid, Clyde j. . Scheinost, Fred . Watts, Loyd . Wilson, Leander W SANITARY DETACHMENT NO. 4 Koster OFFICERS ENLISTED PERSONNEL . Woonsocket, S. D. Oklahoma City, Okla. Atlanta, Ga. l Maxwell, Iowa l St. Louis, Mo. Denver, Colo. Stonewall, Okla. Stockton, Calif. San Francisco, Calif. Wichita, Kans. I Omaha, Nebr. Freemont, Nebr. Pocahontas, Iowa ymanosxmxnoauuoioqboiouunQfnuuuuuffenvouuqmunownuocmmq-mpuqpqnm - M, ----- - V----- - H-.--..V-.....v. .... ..-.. . . -c........ . ... , , ,,,,,, 1... , 113 114 Pit Al 1lC'fXl Ol 'lfli 'lil W 'll'lU'xlNlNi .1 KfffX lll ' ' 'lf - . -4 . , ' ' X n P 1 l P W.-M---, . Wim-.W . .,, . . ...W ., ........e--.......,..-.. .- .. .....,.,..,.............,g.............................-,.,.- . . . l- 1P W9 1 U'?O'lllllllbmlpm1muwmq3wfnllln01lmlwwwUnwiKwndnDQQlMtnsl0wClv1n1uuoqi41-wclsID0Ilnlr0v7vum29diAllI0Q3G lillfl IJll l i' lx Ri -1'-'X' Casuals emo T rovisional Companies I tc li partment. ii ',1f.R liek 5 'A5'-fl Q51 i Efjigl ' n-,I Vg-1-3 1 HE Casual and Provisional companies under the command of Major Pillsbury and his corps of able assistants is the melting pot for the enlisted personnel of the Medical Department, upon their arrival at the Training Camp. Here in a few short weeks. the new arrivals receive their first taste of Army life. and through successive steps in training are brought to the point where they can be assigned to permanent organizations of the Medical De- These recruits represent many different types of individuality: a man from the city. the ranchman direct from his life of open air and freedom, the man from school or college. each one bearing the mark of his civil surroundings and char- acteristics incident to his station in life. Coming from so varied surroundings and conditions these men make up a body upon their arrival which seems to have no uniformity in general. Many cannot understand or speak the English language and an equal number are unable to read or write. This difficulty must be over- come. and schooling in these essentials is instituted. These men, because of their close association with others are apt students, and in a short time are able to understand what is wanted and what is expected of them. I When the recruit leaves the train at the station. they are met by officers of the Medical Department whose duty it is to see that they are properly located in barracks previously prepared for them. Clothing is issued for the time being. If overcoats are needed. they are immediately supplied and mess kits are their passports to their first meal in the army. Cots, or iron beds as now furnished by the Quartermaster have been receipted for, and bed sacks are filled. When taps sounds the new recruit's first day of army life is at an end. After their first day or two in camp, they are conducted before a board of Medical examiners where a thorough physical examination is made of each recruit to determine whether his physical condition will enable him to become an able bodied soldier. Some are found unfit, and returned home: some are sent to the hospital for medical or surgical attention. but the greater portion are found fit for immediate service which they seem anxious to begin. After the physical examination each man is issued military clothing, and the civilian apparel in which he arrived at camp disappears. In the next few days each man receives his vaccination for small pox, and a immunizing dose of typhoid vaccine is administered. The men are grouped in temporary companies and placed under the charge of trained Medical officers who begin their instruction in the elements of military life and duty. The school of the soldier seems to be the quickest and most satis- factory manner Of acquainting these men with the duties they are to perform and in making soldeirs out of them. Within a very few days after the drill end in- struction has commenced one can see a most astonishing change in the individual man, and can see a great step towards the making of an organization which is to fit smoothly into its place in the larger organization known as the Medical Department. These men are kept in the Casual and Provisional companies for a variable length of time and are constantly under the charge of competent officers who are daily teaching and instructing them in all of the duties which they may be called upon to perform. After they have attained a suitable proficiency in military duties, they are assigned from the casual detachment to one of the various organizations of the Medical Department which may be an Ambulance Company, Field Hospital Company, Evacuation Hospital, Base Hospital or one of the many other organizations, here to receive advanced instructions in their duties, andy here to become a unit by itself, a part of the great sanitary force of our army. teclonuwxpoioQlimllwoawncswaacqna-mnqnunonlnuoqponnaaaumuaapopm '----Y Y - V ....- Y - - -Y ,..,:..... z1..-...,Y.-.1 rfff'ff1:nnl1--vY- . .... ,3uu.. ...... ,. . .,.:,..,.,3-5. .,.,,.,w,,,,f:l7,-1--:vw- m D' 115 IYIIEIIJICAI., Ol l lCIlI2fw 'IJZAININC CMZAMIV g gg OMOMUMOMOMOM QBOMIMOMOQOMOMCMOMOMCMOHOQCMMOQO-.af IUO IJI lJlI,l-LY, KANSAS PROVISIONAL COMPANY A Koster OFF I CERS Lieut. Bell, Leo P , MC. Monroe City, Mo. ENLISTED PERSONNEL SERGEANTS: Frame, Geo. I. Klumpe, H. J. Brockway, Fred Richardson, B. E. Steensland, T. E. PRWATES: ' Bales, Walter Barber, Charley H. Barth, Frank J. Baycroft, J. A. Becker, C. W. Brady, Herold J. Bretnall, G. S. Burger, N. E. Chapin, Charley Chapin, Raymond Cundiff, Alfred Curtis, E. R. Donald, A. S. Engler, Ernest A. Ferguson, P. H. France, Merle M. Fox, Edward Gillogly, Clyde E. Gillogly, Leo R. Hancock, A. W. Heagy, H. E. Hergott, Victor Hurlbert Keefe, DeWitt Keller, John Linville, Joseph Lund, Arthur Midland City, Ill. Lafayette, Ind. Chicago, Ill. Chickasha, Okla. ' Beresford, S. D. Martin City, Mo. Aline, Okla. Potter, Nebr. Phoenix, Ariz. ' Garnavillo, Iowa Ashland, Wis. DEdgewood, Iowa Swan, Mo. Fairmont, Nebr. Fairmont, Nebr. Poplar Bluff, Mo. Goodman, Miss. Dyersville, Iowa Indianapolis, Ind. Lawton, Okla. Chicago, lll. Omaha, Nebr. Omaha, Nebr. Aurora, Ind. Butte, Mont. York, Nebr. Milwaukee, Wis. Butte City, Calif. Flaxton, N. D. McDermit, Lee E. Mackey, Charles Mattie, Charles C. Matuska, J. F. Miller, R. S. Mitchell, C. E. Murphy, P. B. Mutchmore, O. E. Nolle, William Olmstead, R. G. Peck, F. H. Peyreigne, J. M. Phillips, Phinney, W. H. Primm, D. M. Prince, A. J. Raub, L. J. Reece, W. H. Reeland, L. J. Robeson, H. C. Sampson, E. F. Schulze, R. G. Sellers, Martin Shaubell, John Smith, E. B. Smith, Lorenz L. Stoner, E. E. Strothers, Richard Strothers, Woodford Studer, Frederick Townsley, J. H. Tucker, Frank Uhyreck, F. W. Van Leer, John Weber, M. J. Williams, Fred Woody, Frank Olsen, A. S. Denver, Colo. Rossal Rogart, Scot Harwood, Mo. Cleveland, Ohio. Bridgeport, Nebr. Shawnee, Okla. Pittsburg, Ind. Golden Eagle, Ill. Summerfield, Kans. Pierce, S. D. Santa Barba, Wash. Best, Nebr. Frankland, Nebr. Ashland City, Tenn Kankakee, Ill. Charter Oak, Iowa Troy Mills, Iowa Reliance, Wyo. Yakima, Wash. Leavenworth, Kans. Detroit, Mich. ' San Jose, Ill. Pauls Valley, Okla. Fowler, Colo. Chicago, Ill. Earl, Ark. Olustee, Okla. Mangum, Okla. Alta Homa, Calif. Omaha, Nebr. Cicero, Ind. White Water, Colo. Fullerton, Nebr. Oakland, Calif. Vancouver, B. C. Glendale, Ariz. Moline, Ill. MIMCMIQIMOQQ-OQCMOMOMOMGIOMOMOMQMOMM 4- ..- MEIDICAI, OIe IfICIiI2S 'I'I2AININC CAMI? . 0l9i.i.l'i.i'i.ill0llilCOMOlOMOlOM0MQMOiiililjlalfl IJUIJT RILEY, KANSAS PROVISIONAL COMPANY B r Koster OFFICERS Lieut. Plum, Frank A., MC. Com. Seattle, Wash. Lieut. Fechtman, Lloyd H., MRC. Cozad, Nebr. ENLISTED PERSONNEL SERGEANTS: Auxier, Paul J. Barnes, Floyd C. Crandall, Howard E. Frazier, Leon A. Galen, Sherley Kildew, Benjamin F. Petersburg, Johnnie H. Phillips, Albert Newman, Herbert S. Weelums, Albert B. CORPORALS: Bass, William T. Kenneth, Paul Marinius, Petersen Wolf, Walter A. Young, Milton PRIVATES FIRST CLASS Barthiaume, Walter Ml Belish, Steve Courtier, Harris Crocker, John T. DeFerce, Ray Erwin, Gifford N. Friedheim, Monroe Kelly, Mike Kevelesky, Standley McGenniS, john L. McGrievy, Joseph A. O Brien, Martin Reid, William A. Rieke, Clifford O. Omaha, Nebr. Anderson, Ind. Lexington, Nebr. Detroit, Mich. Alliance, Ohio Oakland, Md. joice, Iowa Wilkesbarre, Pa. Los Angeles, Calif. Gillette, Wyo. Hickman, Ky. Fort Scott, Kans. Cleveland, Ohio. Oakland, Md. Macomb, Mo. Bruce, Wis. Mount Harris, Colo. Mount Harris, Colo. St. Austell, Cornwall, England Sioux City, Iowa Porterville, Calif. New York, N. Y. Butte, Mont. Wolf Run, Ohio McAllister, Okla. St. Louis, Mo. San Francisco, Calif. Muskegon, Mich. Mount Pleasant, Iowa Schiverki, Andrew Sugg, Arthur G. Tallett, Martin V. Thurman, Asa B. Ylvisaker, ,Johan F. PRIVATES: Barrows, Maurice D. Calvin, Charles B. Cardwell, Day G. Diehl, Leslie R. Earll, Donald M. Gilliland, Harold C. Grady, Oscar Hall, Earll R. Hasell, Milton L. Housman, Howard B. Houston, Lee jenkins, Cleo johnson, joseph V. Kerlin, Walter R. Langlois, Harold W. Leach, Ralph W. McMullin, Robert H. Mitchell, Roy Moe, Lief H. Myrick, Arthur Olson, Alfred C. Olson, joseph S. Pierce, Floyd H. Puffer, Carl L. Reed, Lee W. Richardson, Herbert W. Sage, Clyde E. Shainholtz, .John I-I. Thompson, Walter E. Toomey, john R. Walker, Earl F. Wilson, Clarence C. Minersville, Pa. Blaengarw, S.W., G.B Shenandoah, Penn. O'Keene, Okla. ' Zumbroto, Minn. Maquoketa, Iowa Shawnee, Okla. Millington, Mich. McPherson, Kans. Augusta, Kans. Hill City, Kans. Blanco, Okla. Valley, Nebr. Springfield, Mo. Alsace-Lorraine, Fr. Millington, Mich. Kaw City, Okla. Bachus, Minn. Mason City, Iowa San Francisco, Calif. Bloomfield, Iowa Inglewood, Calif. Inglewood, Calif. Sioux City, Iowa Terre Haute, Ind. Russell, Kans. Clearbrook, Minn. Humboldt, Nebr. Missouri Valley, Iowa Shawnee, Okla. Storm Lake, Iowa Mystic, Iowa South Omaha, Nebr. Monument, Colo. St. Joseph, M01 Denver, Mo. Kansas City, Mo. . 101.1010101010101oioianxoioioqpoinq-pounce: . ' ' , S M SERGEANTS: MHDICAI.. DI'fI9'lijI,?I3S TIPAININCI CAMP Iznnui-nnuBsA1nuQh'Quoinsoqinuinseiuoiodboioqnsmhnnvoranuoseioianocnoiouioaposuunocan10101 VUIJI Illl I . K, lx.fkT-INXS PROVISIONAL COMPANY C y Kesler OFFICERS Lieut. Grannis, Irving V., MRC., Commanding Officer, Menomonie, Wis. Lieut. Hennessy, R. A. ENLISTED PERSONNEL Hawley, james P. Meier, Lambert H. Harrison, james L. Amis, Cecil S. Beatty, George W. Fikkan, Amos H. Henderson, Elmer R. Hopkins, Robert H. North, Lorren E. Smith, Gordon L. Wiebe, john D. Webster, Guy W. PRIVATES FIRST CLASS: Baitsell, Karl M. Bordeau, Francis D. Browning, Ora Cahill, Roy M. Eustace, Everett W. Ewert, Eldo T. Hagar, Albert W. Henry, Glenn A. Kolena. Charles Lyon, Harold A. Parker, Albert C. Warneke, Otto J. Wyatt, Fred PRIVATES: Ashen, Claude E. Bloomquist, George W. Blanchard, Alfred B. Mason, Mich. Lowden, Iowa Shelbyville, Tenn. Lebanon, Kans. Denver, Colo. Elbow Lake, Minn. Kansas City, Mo. Portland, Ore. Bridgeport, Nebr. Kearney, Nebr. Altona, Man. Canada Mountain Grove, Mo Fremont, Iowa Cadillac, Mich. Lanieree, Ark. Lafayette, Ind. Wakefield, Kans. Placerville, Calif. Konawa, Okla. Wingate, Ind. Chicago, lll. Lakeport, Calif. Fremont, Nebr. Readlyn, Iowa Wdltz, Ky. Denver, Colo. Alvwood, Minn. Denver, Colo. Branaeman, Perry W. Brashar, Clarence K. Brazill, William J. Cottingham, Charles W. Cutler, Leland E. Davidson, john Davis, Ralph K. Garver, Isaac H. Dittmer, William H. Harrison, Thomas F. Herrick,, Thomas L. Hector, Louis H. Harris, Elmer R. Hutchinson, William D. Henrich, Harold Hill, Marcus Holter, Albert N. Keller, Edward Koehler, William M. Knappenberger, Clarence Lester, Alfred L. McAllister, Walter L. Michela, john Mortensen, Hjalmar Proffitt, Bruce F. Robinson, Guy A. Rogers, Elbert M. Samwell, Leo M. Silva, Louis L. St. Clair, Milton Neal Streets, Lloyd V. Stevens, Alexander B. Tate, James D. Viets, Leonard W. Wagner, Willys P. White, Stephen Concord, Nebr. Milan, Ill. Fresno, Calif. Stonewall, Okla. Zamora, Calif. Odanah, Wis. Aldrich, Mo. Mansfield, Ohio Lacona, Iowa Chicago, Ill. Frederickburg, Iowa So. Auburn, Nebr. Afton, Okla. Rubicon, Wis. Fonda, Iowa. San Luis Obispo, Calif Wildrose, N. D. St. Louis, Mo. Momence, Ill. Shawnee, Okla. Claremore, Okla. Eau Claire, Wis. Chicago, Ill. Sparks, Nev. White, Nebr. Marshalltown, Iowa Kirksville, Mo. San Francisco, Calif. San Leandro, Calif. Rochester, Ill. Maquoketa, Iowa Oakland, Calif. Galatia, Ill. Culm, N. D. Terre Haute, Ind. Waterford, Conn. MMUMOQOMO MOMlMO1010i010lliOiOiCiOlOl j,..4 M T- '-T 'l ..,. -. -v I 1 V ti, A-. mm- .- hq fi-is Kali .xy iw., H 15 i lf'15llwiw.+. 1 Aww .. .. .I .. A 1 1 .x.... -x -. I-MJ WW- MW , , ,M ,, W M' Ylllr t1::Lw-BAN-wmgnwmWummmumnmnlwu- 'W MMM-'.MMN,h,,',,,,,,. N,,.,,,. ,.,,,,,,..,,,.,,.-,.. i..,...,.. .s x---- vmw-va -.---4...-..-A-.A -r----M-0 -'A --T -M--1-M -f-'-A e-r--'---- '-f e:+--f- -'-- -- -f- H--W- giinuxosnunoaboauvam-unuaannemnu -mm' -pumnpemues-at-maui lfJ?MVB'WJAUi-ll mmm :crown wiiam- wmwwwwnm a mime iv new Mnlbwsw +2 -i awww? SWG' 1' 'MW ' T.. r'i Ai My vii- PROVISIONAL COMPANY D Koster OFFICERS Pickard, L. J. fCommanding Co.j SERGEANTS: Sanders, Rolla L. Brown, Lisle, R. Hauser, Harold L. Oswald, Raymond A. Stewart, Charles E. Wallace, Marion E. Connelly, Jerry L Clearman, Dewitt L. ' Davidson, Frank H. Adams, Calvert B. Eisenbeis, Frederick H. LANCE CoRPoRALs: Clapham, Samuel J. Cookson, Ellis W. Dorward, Herman A. Kabler, Jesse D. Poore, Earl Y. Wilson, William P. Young, Ernest J. Zimmerman, Walter D. Darrah, Justin S. PRIVATES Fmsr CLASS: Hansen, Henry A. Hollingshead, George W. Knore, James D. Larrison, Herchel Poulsom, Thomas Starr, Fred R. Stiff, Roy R. PRIVATES: Adams, Wolcott, G. Beck, Fred R. Blair, Charles W. Brown, Tallie C. Bartuccelli, Carlo Brey, Herman A. Caler, John O. Conahan, Perry A. Abilene, Texas Alto Pass, Ill. Decatur, Ill. Union, Iowa St. Louis, Mo. Oakdale, Pa. Vinton, Iowa Tacoma, Wash. Minden, Nebr. Mt. Pleasant, Mich. San Diego, Calif. Ashly, N. D. Chicago, Ill. Wichita, Kans. Los Angeles, Calif. Cleveland, Kans. Humphreys, Mo. Coal City, Ill. Los Angeles, Calif. Lander, Wyo. Medora, Ill. Colorado Spgs., Colo. Merma, Nebr. Klammath, Falls Ore. Mooleyville, Ky. San Diego, Calif. Lehi City, Utah Red Wing, Minn. Eolia, Mo. Scotia, Calif. Chicago, Ill. Leoia, s. D. ' Donahoe, Elmer J. Doaust, Vernon J. Dennison, Andrew Dugger, Clyde E. Dunphy, Robert P. Denton, Frank E. Drennon, Clem Eschenbach, William Decker, 'Albert J. Fletcher, Louis M. Franklin, Alex R. Grimm, Guy A. Gould, Joseph Hancock, Orvel Hopkins, Roy R. Hobart, Henry Hopkins, Arthur L. Johnson, Howard E. Jakobvoich, Victor Jensen, Lloyd B. Kline, Charles W. Kistler, Bert M. Melton, John W. Martin, Arthur A. Matthews, LeRoy J. Murphy, John J. Murphy, Claude McCall, William Musson, Sam C. McConkey, Mack Norman, Lee R. Niemi, Peter O'Brien, Edward J. Patterson, Ray D. Smith, Walter A. Smith, Earl H. Stackiewicz, Henry Temple, Lewis Till, Rex Watson, William H. Ahern, Richard F. Lee, Frank W. Offerle, Kans. Mokelumne Hill, Calif St. Louis, Mo. Scottsvillle, lll. Campbell, Calif. San Diego, Calif. Edwardsville, Kans. St. Louis, Mo. Sioux City, Iowa River Rouge, Mich. Carterville, Mo. Cozad, Nebr. Oakland, Calif. Terre Haute, Ind. Rockford, Ill. Benton Harbor, Mich. Fulton, Mo. Alta, Iowa Lincoln, Nebr. Denver, Colo. East St. Louis, Ill. Weir City, Kans. Dennybrook, N. D. Collyer, Kans. Sayre, Okla. Florence, Colo. Shawnee, Okla. Shawnee, Okla. Halley, Ark. Dodgeville, Mich. New York, N. Y. Des Moines, Iowa Longmont, Colo. Genoa, Nebr. Pittsburgh, Pa. Independence, Mo. Freemont, Nebr. Pacific Grove, Calif. Sacremento, Calif. Luray, Kans. 0 W Q , . .... ..'-M--1 -'K-lammplh-1 ' ' FvI3hlIn11Jf1nl:'v'dA!4v1AlD-uullunix,palm-'-Ant-h1V1silQrl1nQh41l' 'nP?wVMMJHAWOQ0'MlW3NAliiylQ B16-K WY. W S ...,.e-L-am-an-annum-. -- it .. 1,Y.:?... -,, 1--:mam ..- ..-. . -., v IYIIIIQICAI. OI I !Q iI iI2S 'I'1eA U-qlwqz c':AMI1 1-ni:sicioxqicioioiou1ois1soanoioinou:sqnQioisisloioioio VO Nil' l3ll,IF,Y, KAN SAS, I ' ,,,f51Qif2l1'7fT l 'K QOQQQQQ?QQAQQQAQVQQl1OQO1Q1OlOiO1liOiO1 .120 ,' ' MIi1.JlCA1. Ols FlCIiI2S 'TRAINING CAMP pp A p Rini:1oisioiuis1oicioioioioioioinioiuioinioioioioio FO IIT IZII .IiY. KANSAS , ..ox.N . A A v Photographs by courtesy of the Newspaper Enterprise Association, Cleveland, Ohio. -CHU-ml-.-Owl-CQlQOll1liOlOiOlO1ll -, Y ir' ' r A- ' 121 Nt: Major Lieut. Lieut Lieut Lieut Sgt. Sgt. Sgt. Corp. Pvt. Pvt. Parker, Harry C. . Pamley, Lee Vallett Thompson, J. B. . Burt, Roy A. . Halley, Claude D. Christian Edward Crabb, Edward F. Boyd, Oscar E. . Beck, Carl . Wones, Edward M. Wright, George W. Dubuque, Iowa Little Rock, Ark. . Racine, Wis. Downers Grove, lll. St. Louis, Mo. Lynchburg, Va. Rosedale, Ind. Wilmington, Ohio . Omaha, Nebr. . Girard, Ill. Lakeland, Minn. .. ..., . fl. ...Wal ',Q,'r . r,,' -Kwan My -- -. . ,. - ,ggi L: 2. , .. , F .,-..-..-f' .. . , . .wvat...a.......f. - . . .. , .......,f...., - ......4..., . . . ........mg.:1-.41,' m...,--,,g- -...L-4... 'uve'-Y . ' .--- 1 iirli ii1iV'ri Nl fl li ilfl-PM l'iR.fX1ii-iiihlil 6 fxitlli' as A 7 7 - 7 A 7-- - 77 - -7 7 7 - 7 --PV 7 7- --rf.. ........,,.,,-,,,,,, ,Q ,,,W,,,j,,,g,Q,,,,,,,, ,,,, ,,,,, ,,.,,.,.,,..,,..,i...i.a ...M-N.1-M.--W--t-M47-J---aw-ww -a----- - ---7 ---Q-----A-----Vww-1-sf'---M--9-A--M-----------r------M-'W 0i0iD00llll1019301milieumwfmwo-muwmmmwgpwqbiwmuihntwiwwwidnihwwunmvwullwlwmmwundwwrmuwmambmmmwn-wnnmmmmmvmvlullmt 1iill0i8llKl9 in gnsfi viii i, Gas 'IDQ erase HE present war has presented to the world a new combination of so many various elements of destruction of human life, that we accept with only momentary surprise any new method of destroying the EHectives of the enemy. This conHict is unlike any previous war in that the old and accepted ideas of campaign with armies Hghting battles and moving over large areas of territory, while true in Belgium and France for the Hrst few weeks, quickly resolved itself into a Community proposition, at least on the Western Front. The majority of the troops engaged on this sector have settled down to a more or less permanent location and have continued more or less Hxed in position for more than three years while they carry on their daily and nightly tasks of combat in what is known as trench warfare. This Community which has an almost exclusively male population, most condensely concentrated into housings of the most primitive structure, without any of the modern facilities for sanitation, for ordinary cleanliness or for house- keeping needs of the poorest dwellers in modern cities. The inhabitants of these Communities are absolutely non-sup- Dorting and chiefiy employed in killing with rifies, bombs and machine guns their nearest neighbors, or in protecting thenc- selves from the like desire of their neighbors to do them first. Such a community has developed new problems and has exaggerated some older ones already well known to the army medical departments of all nations. The modern weapons with their high explosives and rapid fire and the inhumanities Of asphyxiating gases and liquid fire have produced medical and surgical conditions which are extremely infrequent as Complications of the accidents of civil life. Up to the present time the medical department has controlled the defensive side of the ravages in the allied troops which the German military staff expected to gain from the illegitimate use of large quantities of poisonous and irritating gases. This military advantage has been greatly negatived by the furnishing to troops and all others concerned in the Theatre Of Operations, and by the application of properly constructed and fitting masks. These masks as first furnished by the Women of France to their soldiers within a few hours following the frightful Chlorine Gas Cloud attack perpetrated at Ypres in April, 1915 were woefully inadequate and failed utterly in affording a practicable protection. Immediately however, British and French chemists took the matter in hand, and with surprising speed the saturation mask made its appearance, shortly followed by the Box Respirator type of mask, which has been rapidly improved and amplified, until today, when properly applied, it affords practically perfect protection to those exposed, at least, so far as the respira- tory apparatus is concerned. y The determination of the United States'Government that no American soldier shall go into the trenches without full anti-gas equipment, will' prevent the harrowing experiences suffered by the Canadians at Ypres in April, 1915, when the Germans Hrst called to their aid- the weapon outlawed by all civilized nations subscribing to the Hague Convention. It is unnecessary at this time to go into the details of the construction of the American gas mask, or to repeat the system of anti-gas training that has been in vogue at this camp since September 1, 1917 But it is an interesting fact to know, and it is with great pride that we can state that Riley was the first of the Medical Officers' Training Camps to have'its Anti-Cas School thoroughly equipped and installed, and that since that date, every Officer and enlisted man leaving this station has had thorough and efficient training in Gas Defense. n iggggqggqggygiiqibdbolldbuinoumnano-uuuacnluwulvomueaiuuoauo-na M ... .- 5 F44 A ,, Y W i S- --L-3 ,.,,,,1.:,,.,.-6, Jigga!gs,ip,i.nme-alwri-fa----1-Q-ge---f-,-.1-wmui.,i..w...1.ae.-fin ::annamutualzzfgs---1-wggqpmmimg.-342--wisgawwgaag 123 Ebe Tort Kiley Sanitary ' alvoratory MAJOR CHARLES SPENCER WILLIAMSON, MRC., DIRECTOR A HIS laboratory is essentially a practical field laboratory, and serves two ncain purposes. First, to construct all apparatus and investigate all field sanitation, and to determine their merits and demerits, as well as the sphere of their applicability. Second, to give practical instruction in the science and art of field sanitation. The conditions under which the war is being fought have sent much of the sanitary apparatus formerly used to the scrap heap, and new methods and appliances n'ust be devised and tested. To give a practical example, we have had many incinera- tors which were excellent, where fuel was so plentiful as to render its consumption a negligible quantity, but in this war, these must be discarded because of the scarcity of fuel. New types must be designed, efficient and practical, yet with a minimum fuel consumption. While the laboratory has built and investigated quite a large number of appliances, only those are reproduced here which are entirely original, or else constitute important improvements on existing types. T 'r' . 1 A Y , A T.. l I -K.'xi.-Q.ZifLifzUif2I-if,iaa.. .A Af 124 li il 'PS TIQAININC' l'ANll' iVllil.llC.fAl. Ulflf i ' K - it A M gg- Qiuiirili'ilUllbilllo671323:sreiioruauvomigoauxoiiiyodniaswoioqhcinematic-nunannonxaezrolu iff -iii' mi iw itixwvxr- THE FORT RILEY-MCMUNN INCINERATOR HIS represents the type of table which is be- lieved to be best adapted to camp and can- tonment use. As in other tables, the boards forming the top of the table are 10059 that is, are not nailed in position. One source of difficulty in such a table is that the boards fre- Clllently become displaced, to obviate which, two loose end pieces were designed which hold the boards together in such a way as to prevent this. At the Fame time, one end serves as an excellent holder T912 largelknives, forks, and other kitchen utensils. e top is surmounted by a' frame, which is knock down and which serves as a very convenient place to hang kitchen utensils, which are needed about the table.. The arrangement of the lower part of the table is such that there are practically no parts hidden, which is a fundamental point in construction if the table is to kept scrupulously clean. I-IE original of this appliance is a standard type used in the British service. It con- sists essentially of a shallow pan for the evaporation of liquid excreta, arranged on top, and a heavy iron plate for the incinera- tion of the solids, which are fed onto it by a ehute just in front of the pan. lt is particularly designed to destroy the highly infectious material from hospitals. its fuel consumption is quite great, because the heat 'passes in at one end and directly out of the other. ln the Fort Riley modification, the heat passes around the iron plate, and back under the pan to the chimney, which is at the sarre end as the fire door. In this way, a much better utilization of the heat is had since it passes over and under the plate, and at the same time con'es in con- tact with the evaporating pan for its entire length. The modification is just as simple to build as the original, and its efficiency is fully double the ori- ginal. . MODEL KITCHEN' TABLE ioioloiliq 10101011oioioioiocnnqpciacuoiox i THE DUNN-WAGNER IMPROVED CLAY OVEN HIS consists essentially of a brick stack equipped with a simple grate above which are arranged a series of iron plates over- lapping each other alternately. The purpose of the apparatus is to incinerate solid garbage, manure, or similar material. It is operated by first loading each of the shelves with a layer of garbage, building the fire on the grate until the garbage on the lowest shelf is sufficiently dry to burn readily when pushed onto the grate bars. After it has reached this state, practically no more fuel is required, since the heat developed by the burning garbage is quite sufficient to dry out the remaining wet garbgge. It is believed to be the most simple and economical method of incinera- tion of garbage yet devised. The apparatus will take care of the garbage of approximately five thousand men when run continuously. The gar- bage is introduced at the top, and pushed down from one shelf to the next lower through the small doors on the side. A larger model has just been finished, designed to take care of the garbage of a brigade. '31 HE photograph of this very ingenious appara- tus devised by Captains Dunne and Wag- ner at Fort Riley gives very little idea of its construction. lt consists of a trench in the ground for a fire box as shown in the illustration, above which is built, over a suitable frarre, the clay oven, having its door at the opposite end of the Ere box. The common difhculty with such ovens is that only the floor receives the heat from the fire, to obviate which, a series of flues are arranged con- necting the fire box below the oven with a large horizontal flue above the oven. This arrangement permits the entire oven to be encircled by the heat. These flues are made of old tin cans with the top and bottom cut out. Absolutely nothing is re- quired for its construction but clay, old tin cans, a small amount of wood for the temporary frame work and willing hands. The baking qualities are of the first order. THE MULTIPLE SHELF INCINERATOR -,. ,Y---Y- l . . . Ni ii .1 ii :mi . oi f 1 -' at :i J IS ii lli-5 llfillili 4 ,igiil .. M... ,,.,q -. ....n.A ...,n.......,,.. .. :Firm-w viii' W W FQPQCHUWFQZWQLTJISYAQRZF F5 gym: Awrrfnqqwpmnkgimqgm- mmap' Y v W:-:his 0 in 4 can 0 www ' in mwah sb amp fm maui I ummm of l'.'l.'Z' l.'ll,l Y, li.'l?w9.X?w A 1 X .li, SUMMARY COURT I'IEADQUAR'1'ERS Uioster Major Flynn, Thomas j., MC. SENIOR INSTRUCTCRS OFFICE Lt. Col. Pipes, Henry F., MC. Major Flynn, Thomas J., MC. Hospital Sergeant Winkler, Hugo Sgt. Beermann, Robert H. Pvt. First Class Welty, George Pvt. Walters, Charles O. Pvt. Flynn, Everett W. Qmcuoulnoiaioioioallofiuxomnonuncmqlnomnmosnfoaummpfqpoam A Y- sr: W '-' ' :wr ---2 ' rn' ' ' ' Jun- flw Y V V Q 57 YYYYY YV W- YVVY W.,,,,, ,,.....v. . Y . ----V --Y---W--..W...... .1-..-..,W..-.-.... , , vw... .1,,,,,Y,q,,mv Y,,,,,,-,,, h 127 Mlil JICAI. Ol I lQllil2S 'IIQAININU CQAMIP A :bikeSoiuzzdgzzunc:mioioioioicibioxncioliroioiochozpoioihioilii ' l'lUl.' l' I-'II .l7,Y, liAN5fXb ., gn D EPARTM ENT 01 EPIDl'1MICOI.0G Y 53.osler MAJOR KERR. ELLIS K., MRC. Lieut. Wishard, R. S. . Co Senior Inspector for Communicable Diseases gg iNs1'RucToRs Lieut Stone, A. R. . go M ' E i H, E, Lieut Adkins. E. M. . o Caggr Higflsgton, Wm, E, Lieut Coffin, L. A. . C0 Lieut Boren' J' W' Lieut Hlnef. B. . Co Lieut. Boland, J, E, Lieut Ricketts, E. P. . Co Lieut. Webb' R, A, Lieut Kennedy,'F. I-I. . . . Co Lieut Reynolds, H, K, Lieut johnson. G. C. . Co Lieut. Cu bertson, H. H. STUDENTS CU'-TURE5 Lieut Whittaker. john L. . . Co Lieut. Gasser. Fred - . . . Co. IZ Lieut Washam, Archer B. . . Co Lieut. Clarke. F. C. . . . Co. I3 ' Lieut. Silverstein, W. I. . . Co kieut gnogtiq A. F . . go. Lieut Traxler, P. S. . . Co ieut ru a er ,... . o. Lieut. Fortney, A. M. . . Co. ll . ISOLATION CAMP Lieut. shawn, C. D. . . co. Il Lieut- Byars. A- G- - . C0 Lieut Voss. Carl . . . Co. 12 Lieut- 5l'1l'0Ut' C- B- - C0 Lieut McKennon,Ig. C. .... Co. I3 I-SCI-'ll Moore. Chas- - C0 Lieut. Allison. H. . .... Co. 13 I-ICUT5 llfwell. M- D- - Lieut amal . I... . . Co ON TEMPORARY ASSIGNMENT Capt. Reed. M. ' Co Licut Christianson, Henry . . . Co. 17 Lieut Crawford, H. S. . . Co i Department of 'inspection o Communicable 'Diseases ARLY in October a group of recruits were sent to this camp from a recruit depot, bringing cases of Measles, Scarlet Fever, and Diphtheria with them. It was seen that the handling of contagious diseases was going to be a problem. To meet it a permanent quarantine camp was established, to which all communicable diseases N not needing hospital care, and all contacts and suspects have been sent. A detention camp was also estab- I lished in which all newlyarrived men are kept for two weeks after their arrival. Inspections of these camps B s ' and of those organizations from which cases of communicable diseases have been taken have been made twice daily. To make these inspections student officers have been detailed, at first temporarily, then when they have proven their efficiency, permanently. Opportunity has been taken also of demonstrating to all the student officers the methods of handling these cases. When Meningitis broke out at Funston men from this department were detailed to assist Colonel Weed, the sanitary inspector at that camp. These men made all the cultures, over 120,000 in number, made an epidemological study of tha, cases, and followed up the treatment as given by regimental men to contacts and carriers. When on November 15th a quarantinecamp was established for Camp Funston this department took over the inspection of that camp. When two cases of Meningitis occurred among the student officers a quarantine and deten- tion camp was established just north of the original four barracks for officers to which are sent all officers on their arrival and all showing a positive culture for Meningitis as well as any other communicable disease that may develop. An oppor- tunity has been given men from this department to qualify for sanitary work in addition to their work in communicable diseases under Major Paul Cook at Camp Funston. The men at present serving in this capacity are: Captain W. E. Harrington, Captain G. B. Van Sandt, Lieut. H. K. Reynolds, Lieut. L. C. Bolton, Lieut. E. A. Drake, Lieut. W.-F. Sch- maltz, Lieut. R. M. Porter. The work of the department was so spread out that a weekly conference was held as a sort of clearing house for information. This is known unofficially as the prayer meeting and this sufficiently describes it. A report of the contagious disease situation at the M.O.T.C. and Camp Funston is being compiled by Major Eggers that analyzes the facts and presents our conclusions. The results of the department work have been most satisfactory. Qli01.-.-.-.Q.i.QliOiC1CiOlI10illlili -1 - Him., L , , ,,Y, ,,,w, , WY, .,,, N, v,., W, . . - .. .. WW... b 128 - '-I .w .I I la . ...r ., -, ...,,. upl i. g,,.., , . . X-. ...-M, . -1, g, -, ,,,, .,..,,.....r ,. ...m..,,....,..,,. .,v, ... ....,..-,,. ,.,..,....,.,.-......,x.... .. ...-.. . .. .... .,- .,,.., l......, ,.. . .... .. 'MM-M-'V' 'JIIIIMP 'U MIM! 'U WMWG vlwlw I awww 4. --.--,r .t svmw ,. Qwma. 1. mmm In uvugw-1e-.1gieugp- 1- mann- 4- :wma e- -mum a- .awww v- army u- mam.: n -iuzawav ef rr.rm.5.u - - is'-aah n Imran- r in . . :IW- I r::,' '. INFIRMARY Koster OFFICER DEPARTMENT OF INSTRUCTION IN INTERNAL CAMP SURGEON AND SENIOR INSTRUCTOR MEDICINE Major Farrell, A. M., MRC. .'wo Rivers, Wis. Major Farrell. A- Ma I tr Ct F TWO RIVCFS- WIS- ior ns u o ASSISTANT SURCEON Capt. Bew, R., MRC. Atlantic City, N. J. Licut. McCarty, M. A., MC., U.S. Army LaCrosse, Wis. C t V EEX2Heinirl Instructor in Tuberfiulosisc I ap . an pps, ., . owa ity, owa ASSISTANTS , u Examiner and Instructor in Mental and Nervous Diseases Lieut. Culbertson, H. H. MRC. Fairbury, Nebr. LICUU IVl0fFiS. R- E- Q Milmcapolis- Minn- Lieut, Funsch, E, Cu MRC, St, Lguisx MQ, Contract Surgeon,-U. S. Army, Examiner and Instruc- lileut. gueletg gconto, tor in Cardio-Vascular Diseases ICUIZ. l.ggS, . ., . 1'3ySO1'1, y. I-EWU Nlcweg- G- A- MRC- Vichy- MO- Lawn. shaby, M. H., MRC. Charleston, Mo. Lieut. Shelby, M. H., MRC. Charleston, Mo. Licut Pittc C E MRC chica O In Lieut. Pitte, C. E., MRC. Chicago, lll. ' ' ' ' OFFICERS ii ' ' Lieut. Lieut. Lieut. Lieut. Sgt. 1 Triechler. M. H., MRC. Halst, john. MRC. Redman. T. E., MRC. Hodge, R. L., MRC. st Class Munday, john P. Sgt. Bull, Adam D. Hancock. Wis. Omaha, Nebr. M tt N. D o , . Kansas City, Mo. Roanoke, Va. Chicago, Ill. Union City, Ind. junction City, Kans Wheatland, Ind. Flanagan, Ill. Lieut. Beaty, Fred A., DRC. Lieut. Barkmann, Herman A., DRC. Lieut. Sechrest, Wallace C., DRC. Lieut. Daniels, Leo V., DRC. ENLISTED PERSONNEL Corp. Martin, Russell H. Stdjoseph, Mo. Billings. Herbert F. Lisboon, N. D. Corp. Knutson, Clarence A. Ba ger, Iowa Siegel. Fred L. Bloomington, Nebr. Private lst Class West, Clarence Ada, Okla. Carse, Geo. H. Des Moines. Iowa Pvt. lst Class Brown, Ralph G. Fayette, Iowa Royse, Edward E. Newport, Ky. ffnfirmary anc 'Dcfartmcnl of 'llnslruclion in filntcrnal meeicinc HE Infirmary, Medical Officers Training Camp, Fort Riley, Kansas, was organized in june, 1917, with one Medical Officer in charge and two enlisted men, two Ofhcersglbeing assigned daily from Student Companies to take care of thc sick. and were on duty for the 24 hour period. Under this working condition it continued until about August 15, 1917, at which time the force was organized to three permanent Officers 5 and who Student Officers. Their duty consisted in giving treatment necessaryfor the Student Officers and enl sted men of the camp, the aflrjfiinistratipn of Typhoid and Para-typhoid Vaccine and of Smallpox Vaccine, and of physical examination of Student Officers. X - In October, 1917. the lrlfirmary became the refuge for un-assigned Officers and Officers who had not met the military re- quirements and was nicknamed The Canncry. i As a great many unassigned Officers who were assigned for duty and instruction at the Infirmary proved to be able men, this institution gradually grew into a Clearing Station to which Officers were assigned, and from which they were re-assigned to various positions at different stations, and has gradually out grown its reputation as The Cannery, and came to be known of better repute. , A great many Officers passed through this source of instruction during October, November, December and january. A great many of whom were assigned to stations in this country and in foreign service, and all men are making good. Some few met their fate before the famous Benzine Board and were sent back to civil life with the knowledge that they would never make a soldier, and to tell their friends of the hardships and restrictions of army life. - The reputation of the Infirmary continued to grow when in january, 1918 the Department of Instructions in Internal Medicine was added and with this was added two renowned expertsi A Captain Richard Bew, who under the guidance of Colonel Bushnell of the United States Army became one of the recognized experts in the diagnosis of Tuberculosis. Lieutenant R. E. Morris, of the University of Minnesota. our Cardio-Vascular Expert, a man noted for murmurs, and who has become the dread of every Student Officer that may arpgear before him for he surely will find something wrong with the heart that he listens to. Special eases of Eye, Ear, Nose and roat conditions are referred to Major Parker. ' ' The Skin and Venereal conditions are carefully cred for by our genial Major McBride. who not only makes the necessary diagnosis but adminis- ters a bit of fatherly advice and tells each one so afflicted how fortunate he is to be in the army. 'To Captain C. Van Epps our Nueromental Expert are referred the.cases of Psychopath. and Moron, the Mentally Deficient and all those who do not come up to the standard of 75 per cent normal man, and after exhaustive study by him, becmes classified. So the original Infir'mary organized to take care of the sick and wounded in june, 1917, has gradually grown through various changes until now it is a place where the sick and wounded are carefully cared for and every method of diagnosis known to Medical Science is utilized for their benefit and in addition it has become the center of the Medical Learning of Medical Officers' Training Camp. 514-ii ' UUlflii1li'W0imWi'viIVlm9'i'lH-ihlib0lhi6dL4l!sqnhi xfgqggi-ggggqyw-mpyqgrqi. 9,419 ,,.4fm..5.qmp.pg ff--e-::-an f, ,. ::C '-1---1'---ve: .z 4. -'-Y. .. .. ... . sehr. 21--: QL..-. -: .:::.1::-aa -.- :::-vi Y--.xr-te.-,,-,:, .1 -,. .-1,-:Q--T?::1e1:.i--..-7--1---U., -1 Lwcsgaa- ' 129 I ' 0 qw-qinlrrv whsle? mmf.:-H, -lf uawfio A wind-we - virus-1 b savwuw- -if u sub'--1:1 n.-.-tr-. L rv.. 1- ,W , wg. - .. . S f .'.3Nn.u-if Gbwr. if iW3ilNWxE5i,r'4d' wif'-SPST-1 S QUARTERMA STER DEPA RTM ENT 5i.oster OFFICER Capt. Crimes, Malcolm D., QMR. Kansas City, Kans. ENLISTED PERSONNEL Mas. Hos. Sgt. Stevenson, E., U. S. Army SERGEANTS FIRST CLASS: Scott. Earl C. Skeoch, Dan N. Stolz, Ellis H. Tiffany, Harry I. SERoEAN'rs: Boucher, Justus bl. Brooks, LeRoy A. Terre Haute. Ind. Stewa rton. Ayrs.. Scot. Louisville. Ky. Chicago, Ill. Stephenson. Mich. Chicago, Ill. Hyman, john H. Lutes, Harold B. CORPORALS: Addleman, Chas. R. Ricketts, Percy K. Seymour, Lester R. PRIVATES FIRST CLASS: Jones. Carl P. Taylor, Glenn E. PRIVATES: Galletine, Claud V. Maxwell, james E. Putnam, William H. i Chicago, lll. Cedar Rapids. Iowa Wyoming. Ill. Chicago, Ill. Bloomington. Ill. Freemont. Nebr. Boise, Idaho Ojai, Calif. S ringfield, S. D. Elgparto, Calif. Quartermaster Department j .P ,'.. HE history of the Q. M. Department of the Medical Officers' Training Camp is a history of practically all of the activities of the Q -.i A- s Camp, other than military. from the organization ofthe Camp, until today. The order establishing the Camp provided for a 5 K I Quartermaster and Captain T. J. Flynn. M.C., armed with the title, set about to fill the wants of hundreds of Officers and enlisted :SQ lhyv J .1. Q? men with nothing to work with but a vacant room for an ofhcc and a Hospital Sergeant to transact the Quartermaster work. f ' In due course of time the Fuller Construction Companys force having erected what were to be the main buildings. mere shells :H .',. .fl if '.-,'f7, of green lumber, passed on leaving much finishing up to the ingenuity of the Quartermaster, whose accomplismhents laid the foundation for future successes. June 13th Captains Paul B. johnson and Edward L. Claeren, of the Quartermaster Reserve Corps, reported for duty and were assigned as assistants to the Camp Quartermaster, Captain johnson being placed in charge of clothing and Captain Claeren in charge of messes. these departments being carried on independelnty under the supervision of the Quartermaster. From early june on, the Camp grew rapidly, each day new detachments of recruits and many new Medical Officers arrived for training. Housing. clothing, feeding and supplying these hundreds of men entailed long hours of work for the Quartermaster and clerks, for each man added also added to the planning, transportation and clerical work. In just recognition Captain Flynn was promoted to Major and soon moved on to a place on the Instruction Staff and was succeeded on August 20th as Supply Officer by Captain Paul B. Johnson. Meantime the ever increaling work of the office made a move from the old Headquarters Building necessary and a new ofhce was established in a separate building near the storehouse. Captain johnson immediately set about organizing the work of the Quartermaster into departments under competent non-commissioned officers and the following departments were established: Office Management, requisitions and property accounting under Master Hospital Sergeant E. P. Stevenson, Storchouse under Sergeant First Class Ellis H. Stoltz, Transportation, Sergeant john H. Hyman, Fuel Corporal Martin L. Hughes 'R 2 . fe - , ..1 V I -. f-Ffh., v E ?'4h4?1a- ,AM a - i n P xbrria .w av A L 2' I - f 1 ' I1-if - ' 1 ' Y P-I -I f V 1' I. ..TAQ1iib': Fal'fl,x ' l' F ' ' llll ,Q ' H R 1 ' I ,Q yililnmb 4: ,A-1 . UV , il -4 A l I 'I I- - 'Ft' - 3 ' as ' wa. -If atm, ' sf. W ' .N K s -u 1 1 F - -. , - - . ' ss' 3 TIUOQNQQWIF- ll Shri A lv' -Fliiif' fu'-4391555 'J 'Ellie 52 Q 35 'J' Q 'WEB QHWIWEI--QI ' '?-17913173.62 'f-n-frzzumnw w 1'---e----fu,-vb -lm. 41- avY..Q-faxrre..-..i-.f.r,:..-n-:azz --1--v--1. -U.. ,Wnnwv .- .-11-.. .. ...Nas-w ...-...:m.munLv -,.,f-:.w,.v-.Q-.ey-,t Win. ....-.-1:2 N--.-...V :rn 130 I i - lvllilill Thi, Lfil l ll,Tl-il8S 'l'l2AlNlNil CYAINUP gg :.....e '.....'t 4. . ...' ffi'...... 'a:......t 'imc i....iTa......i t -T.....'r 'L....i l Olfl l.'ll VY. l'-f.'Nl l'3'A-5 Succeeded by C0FDOral joseph H. Hampton. Mechanical Construction Sergeant Ralph H. Riggs. Baggage and Express under Private First Class Dale Creek. On September 9th, l9l7 First Lieut. B. l. Wyatt, M.R.C. was detailed as assistant to the Quartermaster in charge of clothing and made Casual Supply Officer for clothing to succeed Captain johnson, who had been carrying this work. and Sergeant Charles P. Suman placed at the head of the clerical force. The clothing department being treated in a separate chapter will be passed. merely by stating it has demonstrated its efficiency and the training of the clerical force by completely equipping several thousand men in a most satisfactory manner. The cold. raw days of early fall soon brought the heating and fuel question into prominence and enough stoves were secured through especial authority to assure a moderate equipment for the original Medical Camp and the fuel department was systematized for prompt service. As the cold weather drew near the 13th. 20th and Zlst Cavalry Cantonments were abandoned by the Cavalry and the Medical Camp expanded into them. The meager heating arrangements were thus expanded to a point where it became imperative to afford further protection from the elements and the fuel dis- tribution highly increased. About l50 cars of coal have been handled and used and by ample foresight the Camp never lacked for the best of fuel. A further precaution was taken by employing a detail for several weeks gathering drift and fallen wood from the river and a reserve of 200 cords was secured at no cost to the Government. August 3lst, First Lieut. Louis A. LaGarde jr., M.C.. was detailed as assistant to the Quartermaster in charge of corrals and this department having the care of l50 horses and mules improved its standard and was able to draw a special commendation from Col. Wm. Lusk, Veterinary ln- spcctor. Northerly exposed sheds where the horses were stabled were protected by canvas curtains made from worn cot covers. paddocks were extended into the wooded ravines where the animals could seek shelter. inspections by the Veterinarians were carefully made and the animals brought through a severe winter in fine condition. january l2th, 1918. First Lieut. R. W. Wood. M.R.C., succeeded Lieut. l..aGarde in charge of corrals and continues the same high standard with Sergeants Edward S. Betz and Percy D. Seybold in charge. Every addition to the Camp brought added work for the transportation Department and 28 IM ton White Trucks are now daily engaged in hauling forage for the corrals, commissary supplies, for the kitchens apd messes. baggage and express for the Student Ofhcers. Camp supplies of every description to the storehouses. buliding materials for construction work and innumerable jobs. The truck drivers and mechanics have been organized into a Supply Company under the Command of First Lieut. E. P. Hays. M.R.C. and a garage maintained in charge of Sergeant Rudolph H. Gucffroy for the upkeep of the motor vehicles. The storehouse management and the care ofthe Camp property of various descriptions constitutes an important part of the Quartermaster work, and this branch, under Sergeant First Class Ellis H. Stolz. ably assisted by Sergeants Tiffany and Boucher. has met every requirement. Start- ing in june l9l7 with one storehouse 20 x 105 feet it now requires more than Hve times this space to handle the property and the storehouse clerks not only have to keep records and receipts but must be subject to call day and night to equip incoming men with beds. blankets, overcoats. sliekers and Ordnance or eating utensils. By early fall the green wooden cantonmcnt buildings had assumed the condition of lattice work. No assistance for winter preparation had come from Washington and it may be here chronicled that one of the services done for the Government by some of the daily papers from nearby cities was the lining they afforded for thc sides of the buildings secured in place by tacks. nailes and pieces of packing boxes. The personal credit of the Commanding Ofhcer and the Quartermaster was used to secure a ear load of tar paper and other material which was rapidly put in place by enlisted men just before the hard freeze in December and thousands of dollars worth of valuable plumbing saved and the sanitary arrangements of the Camp maintained unimpaired. h To further meet the requirements of the enlarged camp the mechanical department was sub-divided. Sergeant Ralph H. Riggs. taking charge of the Carpenters. Sergeant Alfred G. Gilbert the electricians, Sergeant T. B. Maupin the plumbers and tinners and Corporal Herschel Wheeler the sign painting. january 10th authority came from Washington for the expenditure of money for the purchase of material and the preparation of the Camp for winter occupancy. Within twenty-four hours fifty thousand dollars worth of material was purchased and shipping started, from estimates previously prepared by the Quartermaster and his estimate clerk, Sergeant Earl C. Scott. A Construction Company was formed under Command of First Lieut. A. Coates. M.E.. who had been detailed to the Q.M. office. with Sergeant John B. Doerrin charge of the military discipline and Sergeant R. H. Riggs Constructing Foreman which completed the lining of two hundred buildings of the camp with wainscoating and wall board. ceiling of the interior of 98 bath houses, flooring and siding 250 large tents, converting Z0 Cavalry stables into barrael-'s for men and remodeling into more barracks five large artillery gun sheds and three large double artillery stables where 2,000 draft men were comfortably housed on arriving in Camp the first week in March 1918. Almost an equal amount with the cost of material has been saved the Government in mechanical labor performed by the Medical enlisted men and the material purchased at First hand from reliable mills at the lowest competitive prices and consequent saving from that source. February 20th Captain Malcolm D. Grimes, Quartermaster Reserve Corps. was detailed with the Quartermaster and brings to this department valuable experience in tthc payment of troops. construction work and management. Financial arrangements and banking facilities for so large a Camp becoming more and more needed. Captain Johnson took up negotiations to secure them with the result that the Medical Bank was installed through the First National Bank of junction City. Kans.. and it has grown steadily since. Every opportunity for securing desirable features for the Camp has been sought and through the efforts of the Quartermaster, funds were raised by private subscriptions and dnoation from the Camp Exchange for the purchase of insturments for a 30 piece band which has the unique distinction of being the only band composed entirely of Medical enlisted men. The numerous activities of the Camp Quartermaster are centered in an efficient omce force in charge of Master Hospital Sergeant E. P. Steven- Son with thirty years of Army Service, Sergeant Daniel N. Skeoch. Sergeant Earl C. Scott, Sergeant Harold B. Lutes and Privates First Class Putnam and Gallentine under the general direction ofthe Quartermaster. Captain Paul B. johnson of the Quartermaster Reserve Corps, who brings to the work thirty years of business experience. The enlarged office now occupies the original Headquarters Building. 301010310101010imiownioioltioauvoauuouxosumxnas ' T T 131 , 'M .i . ,fi 5 .- - .l Dil. ,,-ki... Ut :if l Q-'fi f-4 tml ii wx- 1 .ml sl' . ,...... -. ..,. . , ...,. .....zc.-.,...-..,,z ..... c.-i,...,z.-..,......,..,,....-...............,.-..,. u..,. --A......-.. ..M. ... ..,. W.. ,.., ..--...c,,....,........,,....., V... ...... mguhixjl- 0 JMBWII 0451009 9 89131 O UMW! 0 MBR! QIDPRHQI lf 0UJ4lQOlQUl!l'0ill!?Wli'U'?l!l!lW N' iJ:h.Yv:U5!1Pb'B!!lIlL!QlH ll Wi1hlV' CWIPFKYYK 0 'HCQEND N fl?-?'H:'M' 'I' illxikulfb 471 'L BNIB QWZVQIW 'il QClSiW'.L lx'i.'!1.'l V 1. l'- '- If -s Ho I iv' app.- Ql. rw 49 , f. 3 .aggji-,fu I, 1 ' ' and 94bfFL'. -,-' ' ..... , .-, CLOTHING OFFICE Casual Supply Office NT? 'N this office the Casuals are equipped with their clothing. 1 I , ,, P21 V xii-'Q Casual is the term applied to new men arriving in Camp who have not been regu- larly assigned to a definite organization. They are put into the Casual Detachment for preliminary training, for observation and at this time are furnished their clothing through this office. , ln many instances men are placed in the Casual Detachment, taken out and assigned to some Company, found to be unfit for that particular kind of service, reassigned to the Casual Detachment, assigned to some other organization and possibly sent to some other Post all within a short space of time. In most instances they have some equipment in their possession when they arrive at this Camp which was issued to them at a Recruit Depot or possibly at a former Post. All this must be accurately recorded here. The men must be measured for every article of clothing and records kept of that. It is the function of this office to keep the equipment of the men in the Casual Detachment up to the standard set by regulation. To change it according to the seasons. To replace worn out articles. To adjust losses, and finally to make regular Returns to the Quartermaster General and the local Quartermaster. . The fact that this is a Casual Organization with men continually moving in and out from Civil life through this office to some definite organization or from one organization through this office to another necessitates an elaborate system and a wide-a-wake office force, both of which it boasts of. Men transferred from the Casual Detachment at this place carry with them an Invoice of the goods in their possession to the Commanding Officer of the Organization to which they are going. This is an accomplishment that can only be appreciated by those that have had to wait weeks for the arrival of an Invoice for equipment that probably has already passed through their hands. 45 ,Wei by Z N MEDIA-QIl'B4'HalDllKWlr 'Ul QiD0WQ0HW0'TlilHiGMllHQ1OT'fil'FHfifKQi:fiiW'i0ilil1lBiA4e5 Hdiiwfli when- ,...,..,..4:-ala - .---A-f--s-ff, H, .. ,- Y ,V ,W V-.. c . , , , ,, , , 132 U Fnuc Dl'Il Ali'l'MlCN'l' Dl'I'l'AUlIMICN'l' OFFICERS Lieut. Moeller ........ Cincinnati, Ohio Sgt. Cerscoline, Frank ....... Trinidad, Colo. , ENLISTED PERSONNEL Vanons, joe . Morkowitz, Ben Stolinski, Frank Hayes, joe . Dorsell, W. O. Mann, Perry . Meyers, jack Litch, Herman . Omaha, Nebr. Springheld, Mo. . Omaha, Nebr. St. Joseph, Mo. St. joseph, Mo. St. joseph, Mo. rf Wucea, Ariz. Sterling, Colo. Sgt. Carroll, john A. ....... Freemont, Nebr. Sgt. Wilder, Codon B. ...... . Winslow, Ind. Pvt. Bailey, Willard A. . San Francisco, Calif. Pvt. Knight, Arthur H. . . Chapman, Kans. Pvt Thompson, Chas. O. . . Centralia, lll. Pvt Gravenslund, Wilnfot R. . Kennewick, Wash. Pvt Mitchell, Scott A. . . . Miles City, Mont. Pvt Hughes, Dudley Plankintan, S. D. Postal Cl. Klase, Harry W. . Pratt, Kans. Postal Cl. Ogden, Arthur G Kansas City, Mo. iw-nmuwii-awww amid-sm mf. --N i ' X , i', 'S !,N.'fNY,'.F'N 1' -iifx was .i.,flm,...'l.i . wil 4 i. , ,L ' 5 i Y. A-nlxw, v X ,. 'i.fX'iz-' q asanuggnrw Mmw 'aww lv '- RNMIPU- -it Mums as fm-Aww wwmnwvm-mlm-Jw iihmlmf-mv A-'mlinHlMfAuxhSt41l'3i1b'K Awww' lr'fd.wif.1i1'ii v -ff4,mMw df 'Hymn if-rMaDHil':w1 GHFHW wluwiw-0-'M'l,mlMf wllmkih' ,,4.i,,.,f . I' ,'lJv , ,:, ,1 'ui 'r psi' , .....,,. .v,,. ,..,,..u.-...W-M. .- - fi f .'? Y ?-3 1 A f3T'l55tff'7- F ' ' -A 5' 45 ' CASUAL MIESS menu SAMPLE MENU OFFICERS' MESS BREAKFAST , Fruit Dry Cereal Wheat Tone Fried I-lam and Eggs Cottage Fried Potatoes Hot Apple Sauce I-lot Biscuits Butter Syrup Coffee and Cream DINNER Soup Puree Navy Bean Sliced Onions - Pickels Roast Lion Pork and Dressing Gravy Mashed Potatoes Fried Parsnips Stewed Tomatoes Hot Corn Bread Butter Syrup Apple Pie Cheese I-lot Coffee and Cream SUPPER I-lot Chilie Con Carne Liver Cheese Colel Corned Beef Baked Potatoes Scalloped Lima Beans and Corn Pineapple Fritters Syrup Bread Alberta Peach Sauce Cake Hot Tea 6UllbdW DUiNblvdC-Aiiihahlllbi 0 Q13 4153 U1iWQ'IlOMlM'lQllMU-51iiQ'laiOrvIlD1lib 'Qf016'il'bal r:r':szru-'::v.f:.v4r1r::wvwa'vn:i:vuzr wwLvf1uwm umwmmdWw ,,,,,.k ,,,,L,,,v1-:ww-'m-'-1-r Arm'---- rr-:'-ww m-A -- ',,. f. '- -mn. ..1-,invrwmr-'zwx-nm-,, --,gr-iw-1-ifrrz.-rr::m':H, 134 p I 59' Qs CASUAL MESS HE Medical Ofhcers' Training Camp mess is run as a general mess, and is composed of seven kitchens with mess hall to each kitchen that will accommodate one hundred thirty men each, so that the number can be seated and served at once. A flat rate of one dollar per day is charged. Ofhcers having an official . leave are entitled to a rebate during time of leave. Mess bills are due the Hrst of each month. From this one dollar is purchased all tha food supplies, cooks' and waiters' pay, cooks' and waiters' 5 f2'Fi,4v,fg:y 5 linen and laundry of the same, sweeping compound for the student ofhcers' barracks, subsistence of A ' cooks and waiters, toilet paper for student officers' latrine, brooms, mops and mop heads, and many other articles too numerous to mention. One retired sergeant from the U. S. Army purchases all supplies under the supervision of the mess ofncer, has charge of the store room, and attends to hiring colored chefs and pot washers. Two or three chefs are used as second cooks so they can take charge of a kitchen at any time a vacancy occurs. One sergeant is in charge of the truck and superintends transportation from the Commissary and depot to the store roomy also the supplying of each kitchen every morning with supplies issued from the store house and commissary. The ofnce work is in charge of one sergeant Hrst class, Medical Detachment, who collects the money due for board and is in charge of the cash book. Money collected each day is placed in the Camp Bank each day. One sergeant Hrst class is in charge of the bookkeeping, one sergeant as stenographer. One sergeant first class is in charge of student cooks and waitersg keeps their morning reportg supervises all their workg one private as property clerkg keeps check on all mess and kitchen furniture, cooks' and waiters' clothing, sees that the linen is laundered and properly issued to the cooks and waiters. A colored chef is in charge of each kitchen with one colored assistant and two white student cooks Csoldiersl being trained as cooks, and one colored pot washer. The chefs are paid 8100.005 second cooks S75.00g pot washers 3540.003 student. cooks and waiters 2510.00 per month extra compensation. In general the bills of fare are furnished the chefs by the purchasing sergeant who is an experienced mess sergeant. The.chef orders such amounts as required for the kitchen. A separate account is kept of each kitchen. All food left over and not taken on plates is utilized. Garbage cans are inspected twice daily by the Assistant Mess Officer. Wastage on the part of the cooks is kept at the minimum. Each mess hall is in charge of one head waiter with Hve waiters. The sanitations of kitchens and mess halls is kept at the highest standard possible. Inspection by the Assistant Mess Officer is made daily. v The mess officer is assisted by lst Lieutenant W. E. Draper, Medical Reserve Corps, to whom great credit is due in keeping the officers' messes to a standard of efhciency and in sanitary condition. ednip'-rfA1i1'nh.i.!v,'.r. 0 ,-:grime A WMM! -w .A+'w-In mvsrwfa -5- -lzlfrw. is- -an-L... ws ':---a 1. ' i 'M ef 'HZ-' ...i..-. ..4.. - ,. .-. .. .. . - - ' - 135 .. .l.PiI ,.-Xl. if! . ib..ffif .mlm o aurswx- no Brown-w I -www.: Q ar- new-in ,I.:.w- -I Wuhan 1: 4K1Mv'.1Ji bmxwa-rin me sw.4.I.v. I. I.-Hawks J whiz- Iv fx:aA.v,:.o u um' nv Af 'Miriam iv um-fAm'w nuexgsh il 0 S' APAMP EXCHANGE n.o.1.c, . CAMP EXCHANGE Koster OFFICERS Capt. johnson, Paul B., QMR. Ofhcer in Charge Capt. Kenyon, Paul E., MRC. Ass't Exchange Ofhcer Capt. Wyatt, Bert I., MRC. Charge Clothing Dept. Sgt. Lennon, jefferson F. Steward Sgt. Stinson, Lawrence B. Bookkeeper Corp. johnson, Vivian Cashier CLERKS IN EXCHANGE: Corp. Edsall, Claude L. Pvt. Pvt. Pvt. Pvt Pvt Pvt Pvt Pvt Pvt Brown, blames F. Cates, Jesse Conner, Elmer Duncan, Rolla R. Gibson, Thomas H. ljeatley, Robert A. Lynn, Ernest Sibley, Charles Young, Philip CLERKS IN CLOTHING DEPT Sgt. Cody, Opie E. Corp. Merriman, john J. Pvt. Malone, Andrew P. BARBERS: Pvt. Perea, Alexander Pvt. Zabel, Theo. H. Pvt. Zuhl, Robert .Gsm-vannanuosnmngnunalihn-nanopnluunbaurtbonunqmnaoisnuravanumcicnvnaofnrmvnmluroaaluupasnm umm png D . . I ....,,., , ..,.,r,., 1, W, Www 0 -unann- Y N X Q Q5 llffl Post Of0cc as W .: if'.'sA ':1'- .V f .fi.:wn in ni' A Ebe Camp 'Exchange HE history of the Camp Exchange begins with the organization of the Training Camp. Special Order No. 3 dated june lst, 1917 detailed Major William W. Reno, Major jacob M. CoHin and Captain Felix R. Hill to compose the Exchange Council. At a meeting of the council held the next day, june 2nd, the purchase of stock and fixtures was authorized and Capt. F. R. Hill was placed in charge as Camp Ex- change Officer. The Exchange was opened for business june l9th,- 1917, in the building now occupied by the Post Ofnce and Quartermaster. One snrall room, 12 x 2-l ft., which was one half of the room now used by the their sorting room was given over for the Exchange. Captain Hill had two enlisted men, j. li. Lennon and Vivian johnson to assist him as clerks. Both of these n en are still in the Exchange, the former acting as steward and the latter as cashier. Tlze Exchange was a success from the start, the sales the first day amounting to 524200. iThe greatest difhculty ex- perienced at the outset was in keeping enough stock on hand with which to do business. lt was sometimes necessary to close the Exchange temporarily until the stock could be re-plenishecl. The men would form in line waiting for their turn at the counters and at times it was necessary to serve customers from the windows as the crowd was too great to gain admission to the building. Soon it was found that larger quarters must be secured and within three weeks from the time it was opened for business the Exchange was moved to the old Ambulance Headquarters just north of the Y. M. C. A. building. This building was more than twice the size of the old quarters but still was not large enough and a tent had to put up along side of this building for the serving of soft drinks. On july 12th, a three chair barber shop was opened in connection with the Exchange and located in a building near by. While acting as Exchange Officer Captain Hill was promoted to Major and relieved from duty at the Exchange and Captain Paul B. johnson Q. M. R. was appointed as his successor on August 4th, 1917. The business of the Exchange continued to increase and it was soon apparent that still larger quarters must be secured. The council authorized the Exchange Officer to proceed with the construction of a new building, the material being purchased with Exchange funds and the construction done by enlisted men of the camp. A site was selected near the entrance to the camp on the road connecting Fort Riley and Camp Funston. Here a new building 20x98 ft., was erected to house both the Exchange and the Barber Shop. This building was occupied August 3lst. As the business increased it was found necessary to give the Exchange Officer an assistant and on September 10th, Lieut. Paul E. Keynon, M.R.C. was detailed as Assistant Exchange Officer. Early in October it was considered advisable to open a clothing department to supply the officers and men with clothing which could not be secured through the Quartermaster Department. As no room was available in the Exchange building an addition, 15 Camp. The room thus 15th, with Lieut. Bert I. The Exchange now Exchange has granted a with james H. x 20 ft., was built to the Exchange and the barber shop removed to quarters in the old Cavalry vacated and the new addition was stocked with clothing and this department was opened October Wyatt in charge. consists of the Exchange proper, the clothing department and a barber shop. In addition the concession to H. P. Ripley of Leavenworth. Kans. to conduct a Kodak department in the building Barry in charge and a concession to F. T. Davis of Kansas City for a news stand. The Exchange now carries a stock of 512,000 to 515,000 and the business averages about 525,000 per month. The total business since the opening june 19, 1917 to March lst, 1918 amounted to 5163,000. The Camp Exchange is operated under the direction of a Camp Exchange Council consisting of the officer in charge and the commanding officer of each organization participating in the Exchange. All actions of the council are subject to the approval of the commanding officer of the camp. The profits of the Exchange go to the company funds of the Organizations, to the support of athletics and such other purposes as provided in the Post Exchange Regulations issued by the War Department. . The Exchange has paid out in dividends to the organizations in camp 514,9l7.89, besides redeeming stock owned by Organizations leaving camp to the amount of 54,036.00 In addition it has appropriated 5800.00 for athletic purposes and 515500.00 for the Camp Band. The Exchange also provides the moving picture films which are used by the Camp Y. M. C. A., paying all charges for rental, transportation, etc. It has been the policy of the Exchange to provide as far as possible all the necessities and most of the conveniences for the men in camp at a price as cheap or cheaper than they can be obtained elsewhere, aiming to reduce the margin Of profit in order to give the soldiers as much for their money as possible without loosing sight of its duty to the or- ganizations to provide them with suitable company funds. ' There are now three officers and nineteen enlisted men detailed for duty at the Camp Exchange. who-vnu fn minus mmm sawn arura :www 4 new as -was-an m- wma mam- 1. ww as mf.. in -wav. v W.. 1-. www -if t.-c-.,-tN.......--.,,...........,.,..--.-W ..... ...,.. . .... , ...... ... . .. .. .,... ....,.. . . . . . .. 137 .Q.W!.il .5 1. .L-4: , .lv l '79 Shouse, J. B. . Weatherway, L. T. Vincent, P. M. Marsh, R. H. Warren, M. H. Roper, F. L. . Markley, R. L. Baird, -I. V. . Hill, Ned Q ,.,,,..,,..,w .,.,,,..,,,,.-,ruff-,.. .,,.,, .,.-,.., .,1..,,,.,,.,,,.,.,, Y. M. C. A. Koster SECRETARIES Y. M. C. A. No. 2 SI5.CRE'l'Al-NES Y. M. C. A. No. 3 Vermillion, S. D. Cedar Rapids, Iowa Appleton, Wis. Canyon City, Colo. Lawrence, Kans. Lincoln, Nebr. Belleplaine, Kans. Winona Lake, Ind. St. joseph, Mo. 5?lk'd1'!MIHll'lv M M19-'IP Hf'Il!!lP5'M' 'H Wdillliltll HI K1UHW5D'lKlffN9v 8 'wfihlkfbf NNMAWB if QHQMN if 'lliwwl MMHQ-A-:iff 'PQLWB -'Gi' 'Q ND-flimmil-1R13-Yffiihlil ww.-W-ww.i..f. fi-' if 'L wi -:A -, . m..va,m:- M wiaf, - .. iw- rw- --'Maur . in-a..v.g.wm i-Ji A-.vmV.:-wv.mn:v:.:w..ixu1..:-1-.:.fx::.4ar-cr....nfxuw-x..u.m 138 Ufmfm W '?!'9i 4 Tube 'Army . C. TA. Work in the mebical Camp HE Y. M. C. A. with its large green building opened in the Medical Camp the first of August 1917, and the folks back home began to get more letters. Four thousand went out of the camp on Red K Triangle stationery the f1rst'Sunday. u PS6 R241 And Mac -short for McFarland-the big red headed Scotchman, who was social secretary, 57551 7961? began telling stories to the boys out in the airdome on the hillside and introducing entertainers Egg? whom the Y sent to the camp to give the boys a little fun. Qi' W' T There was something doing on the hill every night during the week-movies twice, and educa- tional lecture, boxing and wrestling one evening, a good religious service Sunday evenings and entertain- ments, some of them home talent stunts, the other evenings. The first team of Y men headed by Hal CoHman as building secretary started a strong program of work. Ver- non, red headed mate to McFarland, had charge of religious work, Nelson recreation and Piper ofhce secretary. After six weeks service they were transferred to Y hut No. 9 at 'Funston where they could be of assistance in teaching the secretaries of the other eight Y huts of the cantonment some of the things they had learned. During those six weeks the men of the camp came to know Y. M. C. A. as an organization that sincerely wanted to make camp life more bearable for them and to supply some of the things desirable but not provided in the army schedule. When M. H. Warren and his team of secretaries were sent to take charge of the Y the middle of September they found a hearty welcome and a very desirable place to work. For two months the team stayed atogether but when the last day for enlistment came in sight, the four secretaries besides Warren entered the military service, as did hundreds of other secretaries throughout the camps. Q D. S. Skoglund and E. W. North, one from Emporia, Kansas and the other from Independence, Missouri, enlisted in the Evacuation Hospital Company No. 1 and have been across since january. Guy Weakley of Clinton, Missouri, enlisted in the Radio service. R. H. Peters went to the marines. Thos. Crawford who had taken North's place also went into the Radio service. Mr. Warren has been with the building continually and with the help of men who were sent in temporarily kept the stationery and stamps going over the desk, the movies and entertainments in operation and the religious services provided for until the team has again been built up. Wayne Randall was with the building for several weeks and J. V. Baird for two and a half months. Randall went to hut No. 6 as educational Secretary and Mr. Baird, to No. 3 as social work director and mass singing leader for Fort Riley. So many secretaries have assisted at No. 2 and usually On first entering the work, that it has been called the training school for the camp. These are the present secretaries and their lines of work: J. B. Shouse who left his work as professor of secondary education of the University of South Dakota, has come to help the boys in their educational work-French, English, Arithmetic, typewriting, whatever they need. . Tom Weatherwax, one of the Weatherwax Quartette who has toui ed the country for eight years, is social secretary and director of music. The officers of the M.O.T.C. know Tom as the chap who entertains them part of the evening of the Thursday night lectures. Paul Vincent, of Appleton, Wisconsin, has charge of the recreation and athletic equipment. He works with the Camp Director of athletics and the companies in organizing teams and making schedules. R. H. Marsh has the hospital work, serving sections K and L of the base hospital, in all, nearly 600 men. He provides them with stationery, stamps, reading matter, musical and social entertainment, and works with Chaplain Grey of the base hospital in religious work. D. B.. Reed is acting as office secretary, in charge of all property and doing the bulk of the desk work. M. H. Warren is building secretary and handling the religious work until a man comes to take that department of Sunday School, Church and Endeavor services which is one of the very important phases of the Army Y work. Y No. 3 in the cavalry camp was reopened at Christmas to serve the medical men who for some time had occupied that camp. C. C. Chalmers acted as building secretary for some time until L. H. Luas who had been secretary during the summer and fall was returned in his old capacity. The work is practically the same type as that done in No. 2 with the exception of the smaller group of officers. F. L. Roper, a pastor from Lincoln, Nebraska, is secretary of religious work, j. V. Baird directs the social activities R. L. Markley has charge of recreation and Ned Hill the ofhce work. No. 3 serves the large majority of the enlisted men of the M. O. T. C. including all the casuals and the detention Camp. Much of their work 'is done out among the men who cannot leave their barracks. A few figures carefully compiled to show the work of an Army Y hut from August 1917 to February 1918 in- clusive: No. 2 records an attendance at the building of 270,000 or more than 1300 per day, 315,800 letters written or 1,500 daily. Quite a per cent of these were written in the hospital sections K and Lg 109,650 men at the entertainment and movies, 26,925 at educational lectures, 29,300 at 80 religious services, 1,700 at Bible classes, 9,500 books read out of the library, money orders issued for 334,524.13 . Once a week No. 2 is used by the Medical officers for a mass lecture. Both No. 2 and No. 3 have been used often to show war moving pictures to the whole camp. Dozens of women come to the Y huts to see husbands, brothers, sweethearts. The Y secretaries help them out in every way possible. One secretary said at the end of a day: A fellow here has a few t.hings to dog I helped sweep out this morning, made fires, straightened out library books and magazines, kept desk four hours, ran down one husband and three sweet- hearts, fixed the phonograph, answered 1400 questions from 433 people, gave out eight testaments, wrote one letter for a chap, pinned a Caduceus on a Captain, led a prayer meeting, called two fellows down for cussing, sympathized with 19 boys tired of camp, ate three squares out of my mess kit-now I'm ready for bed. This page contributed by White Motor Co., Cleveland, Ohio. dll!-Ouasmhwquwci Mn!!!-ll-frfnlnluf evfsqwedsrfitrmudoirav-11613440 'URW 4 www -wmv nmqemrnww-4 niwswrrimm- -ex M 'Q 1-'fue-v 'YMPWY m,W,,,wW,,m,,g,, ,Vg ,,,,,,,,,-,.,..,..,,.,.,...W.f.farm--.. V mf- ---,- -vff - -, r-'. - 1. H V 1. 9. --f- -. -- ' -fr'-E '- ' - ' 139 I QI A' E5 if - Y f A i Q , .9 M ALL WVORK AND No PLAY f?xll work 'line no jfllay, makes 'Black a ' ull Boy ' Exggims HE tremendous value. and power for good of properly conducted athletics and clean recreation have been long recognized in X. the United States Army. But not until the present war have these subjects been given careful attention by experts. When the final history of the war shall have been written. it will show the victory to him who shall have the best physical and moral condition, for of what value the most powerful rifle. the heaviest artillery. the most perfect intelligence system, if in the final test the men themselves have not the spirit and strength to drive home the blow. Visa!!! F5 W QV' f Gif-U jlxVQt v 4' -W As a people, generally speaking, we Americans have sadly neglected the matter of systematic physical exercise. Ours. Q 'l rather has been the practice of letting others do the exercising for us. while we derive only such physical benefits as accrue - -'JL . from cheering a man. or team of men to victory. We have a star athlete, or a team of stars to represent our school. or college, the few men a highly specialized machine. while the rank and file indulge not a bit in even the most elementary physical exercise, Ivlanifestly. such conditions applied to the Army would jeopardize victory. Each man must be trained and guarded. by properly conducted athletic exercise and clean supervised recreation. so that when the hnal KCSIZ comes. he shall be found physically and morally ht to do his full duty. club or city. each of Col. Bispham, lVl.C.. USA.. our Commanding Omcer, cognizant of these truths. established. very early in our Camp history. a department of athletics and recreation, in charge of lvlajor F, l-l. Dammasch. lVl.R.C. A resume of the work of this department will be of interest to show what was done for our men and our Student Ofhcers. Who of the early companies trained at Fort Riley. does not remember the Wednesday night performances in the open air theatre in the hill- side? Or the ivlonday and Saturday movie nights out under the stars? A more ideal site could not be wished for, and it proved a boon for men and officers alike. after their strenuous days work. The Wednesday night boxing and wrestling shows were especially valuable. As many as two thousand young Americans were early on hand. keen for the Gghts. for boxing and wrestling is like a second nature to them. Seldom were the bouts previously arranged for, but never a dull night was our lot. A youngster. anxious to show his ability would step forth. He was introduced to .M f f f , -.- , ff f - Wl N 'W ' V A . . MW... .. , f1-...a..- , W 1 -, , .,. sf ---- -Q-..,y,-- W.. i 4 vi' f., :wmv Q1 saw-N :ia '8'fLM,- .Y1'iW'!N- 91 'iiieriviik 'f bw- L51 FP iutulm Zi Wiitiw Ha fuazisrin u stir-Wm Au MEEZJITQ' QNHYIJIN his 'wif-hr-U G fvvwvlv 421 Qlllwevv 10 amd!! 0 EPMAIIPWP www ,, W , ,, . ., , ,. ., , , . ..,, N .. ,,,, . ., ....,. A ,.,,,, ,, , NW ...,... ,.,, ,,,., .,.-..... .. ,..,..,..,...,,,...,.....,.,,.,.,.,..,.,,...., '140 ' 'wi iii, Ui l'lll'i lfb li.HXi'i--,Wifi 4 fa mann: wma sa vw-iw cttw in amen cf wma-sl os eau-mavv -.mm-Q f: easimru is 'wav Q- vmawxva- vwuaanwwavnm-m mmm ff mime a i:.v.ua'n- Q warm: euivmra n M .u c -mmzw L laura zu.: 1. 1'.'w-HH rhe crowd by the referee, Lieut. Andy Smith, of football fame, who after announcing the lads weight would shout, Who wants him? ' lt requires Courage and a stout heart thus to hurl a challenge at an assembled multitude, not knowing who would accept. Many a young man here learned one of the greatest lessons of life where he perhaps for the first time attempted to take his place as a man among men. Soon some one would answer, I'll take him. The crowd cheered and the fight was on. And mighty goocl fights they were. for sad was thc lot of the lad who would not give the best that was in him when performing for his fellows on the hillside. During the summer and fall months, baseball and track athletics were the principal out door sports. Competition was provided for. first between the individual companies within a group, that is, between the various Ambulance Companies, and likewise between Field Hospitals, and Provisional Companies, and hnally by larger meets to determine the championship of the camp, which contrary to the prediction of Col. Reno, the Director of Field Hospitals, rested with the Ambulance Companies. An athletic field. in Magazine Canyon. containing a regulation football Held, basketball court, a six lap track, standard jumping pits. and SOme gymnastic apparatus, served for the instruction and amusement ofthe men in these events. lt was the policy ofthe Department to require each man of the organization to participate in these sports. Each man was required to do the routine work. after which the men could indulge their individual tastes. And to further carry out the plan, each man could enter at most two events, thus preventing one or two stars performer winning the meet for his company, and correspondingly increasing the interest among the men in the various sports. The value of this system soon became apparent to the various Commanding Officers ofthe units in training here, and they became as much interested in the events as were the men, The effect was a marked improvement in the morale of the men. With the approach of Fall, and its accompanying cold weather, precluding regular outdoor work. the Department prepared for the winter course. Football for a time provided sport and exercise. A camp team, coached by Licut. Andy W. Smith was organized and gave an exceedingly good account of itself, its crowning feat being the holding of the powerful Camp Funston team to a 9 to 0 score. The Department of athletics was given a single barrack building in the old 20th Cav. Camp. for use as a Camp Gymnasium. No apparatus of any kind was to be had, so some had to be made. As an example of what can be done in ease of necessity. a few of our results may be mentioned, Boarding up the sides of each end of the barrack gave us two very lively hand ball courts. Some discarded water pipe was transformed into a hori- zontal bar. A twenty foot tree, cut in an adjoining grove, trimmed to suit, and adorned by three sets of home made handles, became a very serviceable horse for class instruction. Punching bags and fifty pairs of boxing gloves, purchased with Camp Exchange funds, provided exercise and sport for the men. About this time. the work of the Department having greatly increased, Lieut. Don, S. Numbers, M.R.C. was detailed as Assistant Instructor, and took charge of the boxing and gym work. Finally the use of the Post gym was secured. during certain afternoon hours, thus permitting of a schedule whereby each organization was given one hour instruction twice weekly. Meanwhile boxing and wrestling were encouraged and occasional smokers arranged, always a welcome diversion for the men. With the approach of spring, plans are complete for the coming out door work. Baseball, both inter-company. and by a Camp team, will provide plenty of exercise and sport. The track work will replace the gym course. The physical instruction of our Student Ofncers was divided into three groups. Firstly, the department of morning exercise, setting up, and drill under command of Col. Reno, and after his leaving conducted by Major Downs, M.R.C. All student ofncers no doubt will remember those exciting strenuous exercises indulged in, in front of our barracks. Side Straddle exercise, a poem of motion, the leaning rest exercise an example of grace, and the finger exercise. so essential in the proper use of chop sticks. Secondly. that special form of equitation, designed for the use of student Medical Officers by Lieut. Col. J. Coffin, and so faithfully carried on by his successors as Hike masters Major McBride, Captains Abraham and Nather. The term equitation will always call to our minds our course at Fort Riley. Thirdly, the weekly hour assigned to each student company for instruction in Physical Instruction at the Camp Gymnasium. when most men for a time at least imagined themselves boys again, only to suffer next day the twinge of pain and stiffness, the protest of a long unused muscle at being thus strangely overworked. One more branch of our endeavor is worthy of mention. That is the plan used in properly preparing the older men of our Corps for the physical demands to be made upon them. All officers of the age of forty years or over, were put into a special class, called for afternoon work upon comple- tion of the days lectures. The plan proved successful, in that the men were more gradually hardened to physical work, and as a result none were damaged by over enthusiastically attempting to follow their younger colleagues at double time, over the hill and far away. They were examined by our Cardio Vascular expert at regular intervals, and when found able to stand the strain. were detailed back to their respective organizations without fear of physical consequences. In conclusion we must add that whatever success the Department of Athletics has had was due to the whole hearted support at all times ac- corded to it by our Commanding Omcer, Col. Bispham for whom it has been a privilege to have labored. ,.4..g,,.,,!VVr v .iw -Sug- L ' '.s- l Silllidlllwdlltiviilnlvulliwiwldlhilwibiibwlilltwdlillnzwmiiaii-Wwvemamwetwwnmwminmmawaw ssrnawmr 4sT m'l9'l'iMi'7lk'W:LW -----A-f ',:::..::.'f-P-e.- '-,:1, wg... cc, .',::,:::.:-rf-, ..........,..v.-V. .. ,.,. ..,--..-...frm -21?-M--f. . ,- -1 ,ma -,.-. . we-rm: ,afar-mf-f,f-1 W. 1-iq..- ...M-...--....l.....-,.,.....,-v----w-----N-m-W---.v--w 141 m5p2fm,- .Vf Q-1: Vw,-.,, 'a iwmamuv mmswfr ,H uwwrfuiv ii' wzluau If swfwniv fx WN-um-cr mm-iv 1. wgygam- y .,,1,g,gy,1 L, ,M,g,m, ,,- .WW .,, Q- ,,,, ,Y A.. :Nw -uw -' mm: - , :,- .1-Q. 1 f.w,..,. .,. MVA:--u uf -pygnvzqvf 3 qggnmw tlnwfulh if MLM--k.b 2? 2k7M?5DfD Fdffdkik ii' -fb-NISE W- I 1 L 1. 1 I-, ny- W, -Qgp1Qqgg.glg,, g-Q r'h v05f5Qf' 'WW '9fllW 9DEM'9'!W3Q'! 4E'Gl F0KK'0' 0 Ol v M- ' '1xf:1ur'fm2rYf'u1:::x':z1:m1w:umsum:r:anzm:rr1nmnbnxnr ummm :yawn 1,-v-4 remmuwr:-v-Mr-11rr.uwm'e.-vvmmuaum'mv wg:-w .. .mrzza-xr:'.z:-.m.:1m,-zzrww -r-:mmf '.-'mmuazmrsnx : at .vn.::::::1.1'::-'rr. z'.::1- 1 . ,- il lf? iii.-'Rff'-s.i.' I 4. .I - 4 V-,...i4.,.., ..,-.I ., .,. . 1 -- ,, . . ..,ia, c- ,..,.,-. -3 .mrs-'fx v darewxai mv- ini!!! fl' SADMM I in-de ' ' Mmm' A-'sham vi uiwmw of IFEX if .,- -'42 io. '.4 I :I .i- . Tepartment of -jlbysical TiDrill arab 'Drill ,K vfs N the beginning the SCO created a mob and the mob was without f ri? form and void. CThe SCO also created the training campy WJ? V MOB. Def .-n, a crowdg a disorderly assembly. f .fr .. X. M X' The Commanding Officer of this Training Camp created the various and several Departments which comprise the teaching 1' staff and assigned to them a definite mission, i. e.- Make over the medicos into medical officers. From this source originally mentioned fthe SCOD this camp has received from time to time its proper quota of the before-mentioned mob. A certain number of individuals are arbitrarily designated by the C.O., in the order of their arrival. as companies and are turned over to the tender ministrations of this and the several other departments. to be transmuted. After carefully estimating the situation, this department issued its first Combat Orders. The paragraph referring to the detailed tactical methods em- ployed has been changed slightly from time to time but the general plan remains practically the same. SPECIMEN PARAGRAPI-IS : Paragraph l.-What we know about the I-ley Docks. Most of them settled in character and habits. Absolute rulers of destiny in their own home towns. I-Iave had their own way so long that it has become second nature. A scientific man's scorn of what appears as non-essentials. And last but not least a collossal Ccon- scious or unconsciousj ECO. To off-set this we have the patriotism and willing- ness C75 to conform to rules and regulations. CQuestion mark after willingness only.j Paragraph 2.-General Plan: This department aims to submerge the ego, to develop proper carriage, and to create an officer who is courteous, considerate and well disciplined. QSome job.D It would seem that military authorities are unanimous in stating that Close Order Drill is one of the first and best methods of teaching the essential lessons of detail, implicit obedience. morale. and discipline. the essentials that make an organization out of a mob, a machine out of material, but with this advantage over the mechanical machine i. e.-The operation of trained and intelligent in- dividuality. Each individual trained to recognize the sector of his activities and the resultant intelligent co-operation and co-ordination developing into a Kaiser defeating AMERICAN FIGHTING MACI-IINE. Exit Mob. Viva SCO -I. M. DOWNS. Q.E.D. Senior Drill Instructor. Wlmgjmriwilllhllwmhli 8 WlH61F'ElIIDC9wm5iK5'9GiElR QGWWQ-Wwomnmrfqfmmmmmwv rmanvevrmwmmmw- wrmm-mm ,,-,Z,,,.,i:,:xn . . L, , , ,,,,, .,,.,,,,:,,,,f W. . -- . T. . .M ..- ..-.c..-.EW . aa .::fa,....W,..m...,a ...V am, W., v.-- -.....a.1QFa,T-1'-mf V N... W. , -m-fm-.'f-f,-,.1-.- ,,,.,iW- 143 School of Bakers emo Cooks URSUANT to General Order No. 6 from I-Ieadquarters, Medical Officers' Training Camp. Fort Riley. Kansas, February 28th, 1918. A School for Cooks and Bakers is formed for this camp whith if 1 Captain Edward L. Claeren, Q.M.R.C., in command. . 4. .xx a. The course of this school will be two months, but en- listed men of previous experience or of marked ability may, when deemed proficient by the officer in charge. be graduated after four weeks instruction. Enlisted men who are unable to qualify within two months, but who have nevertheless demonstrated their fitness for the work may be retained for an additional instruction for a period not to exceed one month. b. Text-books: Manual for Army Cooks to be used daily in connection with practical workin the kitchen. Mess Sergeant's I-land Book. MessOff1cers' Assistant. Practical instruction given as follows: Student cooks, upon reporting, are assigned to duty as Assistants to First and Second Cooks in the organization kitchens Qin number of six to eightj which are under full control of the school. So far as their work warrants it. student cooks are advanced to the position of Second Cook, First Cook. and Mess Sergeant, during the last ten days of the School. Kitchen police are supplied by the organizations, and cooks, if on duty. per- form the duties as assistants to the advanced cooks who are in all cases respons- ible for all the work done in their respective kitchens. All kitchens are under the general supervision of the instructor. INSTRUCTION IN FIELD COOKING IS ALSO GIVEN Instruction in baking is given during the last ten days of the course. In- struction will be confined to the needs of pastry work and making of ice cream. A pastry and ice cream kitchen is established here for this purpose. Upon completion of the school course, certificates of proficiency will be awarded to men who successfully pass a satisfactory theoretical and practical examina- tion Degrees of proficiency will be noted thereon as follows: Second cook- A competent organization cook. First cook-Same as above, and simple ac- counts. Mess Sergeant-A first cook who has demonstrated for at least one month his ablity to supervise and control all details and accounts of an organiza- tion mess. 'R , V I-.. sr., N, ii-.Wi pu W. . . iz 'nmwsr cr-mnrmw we swam . mmm-aw . , ..- ,...... .. ........, . .,.. .. ..... .,.. . , ........,.,..,,...,. .... ...,,.,...,,,,,,. - 144 . MEDICAL OFFICERS 'ITJAININCJ CAMP 'i'1 l'51-P'CDOClltiidlloiviaioioioioioioioioioioioqnoioioio IIOIPT IYII ,lf,Y, KANSAS Koster ASSIGNMENTS TO MEDICAL OFFICERS' TRAINING CAMP Fort Riley, Kansas Lieut Lieut Lieut Lieut Lieut Major Mills, William P. Columbia, Mo. Lieut. Capt. Arnold, Samuel F. Billings, Mont. Lieut. Capt. Augustine, Grant Minden, Iowa Lieut' Capt. Ayres, Edward C. Lorimor, Iowa Lieut. Capt. Dudley, Clifton R. St. Louis, Mo. Lieut- Capt. Ford, Charles Wagoner, Ill. - Lieut- Capt. Gallagher, Michael L. Chicago, Ill. Lieut. Capt. Hamilton, Geo. McClellan Coffmann, Mo. Lieut. Capt. Harbaugh, Chas. C. Sedro-Woolley, Wash. Lieut. Capt. High, Charles V. - Coleman, Mich. Lieut. Capt. McAllaster, Benjamin R. Carthage, Mo. Lieut' Capt. McLaws, Raymond B. Tampa, Fla. ' Lieut. Capt. Phillips, Albin, B. Clear Lake, Iowa Lieut. Capt. Richards, Thos. C. Fayette, Mo. Lieut. Capt. Sawyer, Prince E. Sioux City, Iowa Lieut Capt. Sellers, Harry H. Minneapolis, Minn. Lieut' Capt. Wilkowske, Conrad W. Chippewa Falls, Wis. Lieut' Lieut Bailihf, Jesse O. Dudley, Mo. Lieut' Lieut. Bolton, Harry H., Jr. Chicago, Ill. Lieut' Lieut Bowen, Ray B. Toledo, Ohio. Lieut' Lieut Breuer, Miles J. Lincoln, Nebr. Lieut. Lieut Butler, Frank E. Portland, Ore. Lieut- Lieut Calhoun, Robert E. Hallett, Okla. Lieut: Lieut Carter, Noah D. , Robstown, Texas Lieut Lieut Cochrane, Wayne A. East Lansing, Mich. Lieut. Lieut Cole, Bid Cooper Stigler, Okla. Lieut. Lieut Conger, Sidney B. Arcadia, La. Lieut. Lieut Conn, Hugh L. Metcalf, Ill. Lieut: Lieut Cossey, William A. L. Prague, Okla. Lieut Lieut Cozby, V. Bascom Grand Saline, Texas Lieut. Lieut Crouch, Elmer L. Jacksonville, Ill. Lieut: Lieut Currie, Reese F. Austin, Texas. Lieut. Lieut Currie, James D. Hico, Texas. Lieut. Lieut Curtis, Joseph M. Tacumseh, Nebr. Lieut. Lieut Dowey, Lorenzo S. Okanogan, Wash. Lieut. Lieut Dourmashkin, Ralph L. New York, N. Y. Lieut' Lieut Eads, Leandor J. Hamilton, Mo. Lieut, Lieut Eberhard, Fred G. So. Whitley, Ind. Lieut. Lieut Eslick, Louis D. Rockwell City, Iowa Lieut. Lieut Fischer, Edward H. Louisville, Ky. Lieut. Lieut Franchore, Chotwynd M. Mason City, Iowa Lieut' Lieut Francisco, Frank G. Enid, Okla. Lieut- Lieut Frost, Earl J. Wichita, Wis. Guthrie, Austin L. lleron Walter H Ha , . Hamilton, George L. A. Hancock, Edward C. Hauber, Arthur H. Herod, Philip F. Hutton, Joseph L. Johnston, Joseph A. Kail, Carl Keene, Linwood M. Kelliher, John L. Kergan, Jonh T. King, William J. Kitchen, John C. Klein, Hobert G. Landrea, James C. Ledbettor, Llewellyn H. Leonard, Lawrence J. Linn, John L. McFarland, Samuel B. Mahoney, Dan L. Matuska, Ignatus W. Melencamp, Noble E. Miller, Eugene A. Montgomery, Kenneth E. Morrison, William Paxton Murphy, Francis P. Nelson, Ralph G. Odegaard, Bernt Pennington, George R. Pittock, Harry J. I Pritchard, Jacob LeRoy Puffett, George Frederick Rolls, Loren B. Reynolds, James B. Saylin, Joseph Sheetz, Robert Shields, William T., Jr. Simms, John S. Smith, Jacob S. Smith, R. Earle Sutton, Fred R. Sweeney, Edward E. Tarr, Gough H. Taylor, F. W. Howard Threlkeld, Waller C. Wichman, Frederick W. Oklahoma City, Okla. St. Paul, Minn. Washington, D. C. Caviness, Texas Chicago, Ill. EI Reno, Okla. St. Louis, Mo. Evanston, Ill. Hartford, Iowa Alexandria, Minn. Calumet, Mich. Branch, Ark. Mina, Nev. Montrose, Colo. St. Louis, Mo. Alexandria City, Iowa Jordan, Minn. Omaha, Nebr. Longmont, Colo. Virginia, Minn. Cleveland, Ohio Anadarke, Okla. Lucas, Kans. Lawrenceville, Ill. El Reno, Okla. I Omaha, Nebr. Glen Elder, Kans. Elgin, N. D. St. Charles, Mo. Fall City, Nebr. Springerville, Ariz. Ames, Iowa Herrin, Ill. St. Joseph, Mo. EI Monte, Calif. Orrick, Mo. Troy, N. Y. North Platte, Nebr. Bellingham, Wash. Oklahoma City, Okla. Bartlesville, Okla. Sutton, Nebr. Charleston, Mo. Los Angeles, Calif. Ada, Okla. Tenino, Wash. 301010110 0i01010i0101010cpo103014101 145 MEDICAL OIVFICEEIPZS 'IIQAINING CAMP sau' OQOB ld DWQIQOQCQQQOQ OHCIBM.-'Obi Y OQOQCQIQOQY 'lm' W mf- 3.7 W I Major I-lull, Charles A. Capt. Capt. Capt. Capt. Capt. Capt. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut. Lieut Lieut. Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut: Lieut Lieut. Lieut. Lieut. Lieut Aspray, joseph Bland, Warren W. Ganaway, Alfred M. Hawk, Benj. F. Prince, Norman C. Rauschenbach, Charles W. Adams, Earl V. Atchison, Cadwallader H. Blakemore, joseph M. Booth, Herbert R. Bouldin, Thomas j. Brookhart, Harry H. Brooks, john T. Brown, Louis G. Bruce, john R. Charles, Hugh L. Combest, Georgia M. Dudgeon, Lamartine O. Eghert, Thos. H. Emerson, Burr H. Ferguson, William j. Finney, William O. Ford, Edward Gardner, Edgar L. Garlington, Elmer F. Garnjobst, julius H. Goggin, john G. Grace, Thos. A. Griot, Arthur j. Kleppel, Bernhardt W. Knotts, Roy R. Leonard, jerome M. Logan, Vonanclo, G. Long, Levi G. Lupton, Earl L. A Meyers, Henry A. Newell, Quitman U. Nornlsty, Percy C. Newland, Dan H. Nieweg, julieus W. Platte, Richard B. Presnell, George W. H. Prather, Robt. M. Regan, john H. Renshaw, Kinsley Robinson, Evertt Edward Rowe, Paul H. Scott, Allen G. Shalett, Benj. j. Shelton, William j. Smith, George H. Webb, Byford H. Welch, james Whiteside, Edwin E. Whiting, Spencer D. Wilkin, Thos. j. Wine, jacob W. Witten, Henry O. FU VI' IJII ,I iY, K AN SAS Koster Omaha, Nebr. Moscow, Idaho Vandalia, Mo. Albany, Mo. Anthony, Kans. Omaha, Nebr. Baltimore, Md. Topeka, Kans. Waldron, Mo. St. Louis, Mo. Hamilton, Mo. St. john, Ariz. Columbus, Kans. Minona, Wis. Colorado Spgs., Colo. Marshfield, Mo. Atchison, Kans. Lamar, Okla. Sweetwater, Texas Kennett, Mo. Stockton, Mo. Milbank, S. D. Chaffee, Mo. Bloomfield, Mo. Rushville, Mo. ' Blair, Okla. Salem, Ore. Rochester, Minn. Excelsior Springs, Mo. Long Pine, Nebr. St. Louis, Mo. Yuma, Ariz. Douglas, Ariz. Rockland, Idaho. St. joseph, Mo. Los Angeles, Calif. Bingham, Ill. Whistler, Ala. Logan, Ill. Center Point, Iowa Duncan, Okla. Kansas City, Mo. Sikeston, Mo. Waco, Texas. Grand Island, Nebr. McGregor, Iowa Adrin, Mo. Casselton, N. D. Cardwell, Mo. Minneapolis, Minn. DeKalb, Mo. Kansas City, Kans. West Frankfort, Ill. Tampa, Texas Elvins, Mo. Phoenix, Ariz. Saline, Mo. Chicago, Ill. Coffee, Mo. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Capt. Lieut. Lieut. Lieut. Lieut. Lieut Lieur Lieut. Lieut Lieut Lieut. Lieut. Lieut. Lieut. Lieut. Lieut. Lieut Lieut. Lieut. Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut Lieut 1OIOlOl0QOlOlOlOiOl0iC 146 Brown, Albert E. Bushee, G. B. Carpenter, Geo. A. Conklin, Geo. H. Gassow, August A. Kelly, Alfred Harris Koll, Irwin S. Lynn, William joseph Mullarky, Hugh Osborn, George R. Pelletier, Dyer H. Powell, Charles H. Winslow, Keneln Akers, William O. Alexander, Duncan L. Bailey, I-Iowson C. Baird, Burton A. Becker, Myron G. Bernstein, Alick Berry, Washington X. Billick, Elmer j. Brown, Frederick H. Brown, Leonidas T. Bryant, james H. Carter, Herman T. Chapman, Lyman H. Clair, jean B. Conley, Chas. C. Cross, Roland R. Davis, Carl H. Dewey, Albert W. Graham, james C. Happel, janes Hutchin Hoffman, j. Gregory Hogan, Wm G. Huffman, james W. Keppel, Frederick D. McKay, james C. McReynolds, Alva E. Metcalf, Dorsey D. Miller, Byron Y. Miller, Charles M. Murray, Robert O. Myers, Sam Panton, Henry H. Pare, Elijah Y. S011 Pierzynski, Thaddeus S. Riley, Robert S. Rogers, john C. Rohrer, Pius A. Sheldon, Francis B. Strong, jesse F. Tallman, Maurice H. Turner, Luther L. Way, C. W. West, Frederic B. Whitley, Wm. R. Worthington, William C. Wright, Oscar R. Webster, S. D. Normal, Ill. Fargo, N. D. Superior, Wis. St. Charles, Mo. Louisville, Ky. Chicago, Ill. Kansas City, Mo. Ft. Dodge, Iowa ' La Porte, Ind. New Hartford, Iowa Pocahontas, Ill. Seat.tle, Wash. Florence, Nebr. Twin Falls, Idaho Sulphur, Okla. Prairie City, Iowa Benton Harbor, Mich Chicago, Ill. Washington, Ky. Murphy, Oregon Billings, Mo. Spearsville, Kans. Clayton, Ill. Gilbertville, Ky. Memphis, Tenn. Waterville, Me. Fredrick, Okla. Dahlgren, Ill. Chicago, Ill. Denver, Colo. Webbs, Ky. Cleburne, Texas Hartford, Wis. Neck City, Mo. St. Louis, Mo. Cazenovia, N. Y. Kennett, Mo. Stanford, Ill. Auburn, Ind. San Louis Obispo, Calif Oakley, Kans. Austin, Texas Potter, Kans. Ponca City, Okla. Leeton, Mo. Chicago, Ill. Hartshorne, Okla. Louisville, Ky. Spokane, Wash. McDonald, Kans. Barada, Nebr. Boise, Idaho Chicago, Ill. Wahoo, Nebr. Los Angeles, Calif. Chicago, lll. Clintonville, Ky. Huron, S. D. MEDICAL. OFFICHIQS TIZAINING CAMP Browning King 82 Company Barton Hat Company Maxwell McClure Dry Goods C Burham, Munger 82 Root Bernheimer Brothers 82 Co. Robert Keith Helmar Manufacturing Co. Gille Manufacturing Co. Goodlet 82 Dolles jaccard jewelry Co. Robinson Studebaker Co. Fidelity Savings Trust Co. Beekman Lumber Co. C. C. Chenoweth's Bakery Durbon Furniture Co. Philip Hay Book Store I. M . Platt VUL' T I3 ll .I TY, KAN SAS Contributors to Yaanb ?un6 O. Indianapolis Tent 82 Awning Co. DeArmond 82 Root Big Four Taxi 82 Livery Co. The Hallmark Store A. H. King, Druggist Shide 82 Riddleberg Soldiers 82 Sailors Com. Club The White Company I Columbia Theatre Burks Restaurant Flower Contractors Rohr Real Estate Carl Breyman H. K. Mulford Co. Campbell Electric Corporation The Long-Bell Lumber Co. Ridenour-Baker Grocery Co. The H. D. Lee Mercantile Co. The jones Store Co. Woolf Brothers Co. Whitmore Hotel Co. CHotel Muehlebachj First National Bank F. H. Velie Kansas City Kansas City Kansas City Kansas City Kansas City , Mo. , Mo. , Mo. , Mo. Mo. Kansas City: Mo. Kansas City Kansas City Kansas City Kansas City Kansas City Kansas City , Mo. , Mo. , Mo. , Mo. , Mo. , Mo. john Deere Plow Co. Parlin 82 Orendorff Plow Co. Armour 82 Co. The McPike Drug Co. Richards 82 Conover Hdwe. Co. Sweeney Auto Tractor School Kansas Kansas Kansas Kansas Kansas Kansas Rahes Automobile 82 Tractor School Kansas Evans Smith Drug Co. Central Shoe Company Hotel Savoy Co. Emery Bird Thayer Dry Goods Co. john Taylor Dry Goods Co. Kansas City, Mo. Geo. B. Peck Dry Goods Co. junction City, Kans McElwain Barton Shoe Co. junction City, Kans Fred Haney junction City, Kans Forrester-Nace Box Co. Junction City, Kans. Abernathy Furniture Co. Indianapolis, Ind. W. S. Dickey Clay Mfg. Co. Manhattan, Kans. Hotel Baltimore Manahttan, Kans. Carnie-Goudie Mfg. Co. Manhattan, Kans. Kansas City Star Manhattan, Kans. Fidelity Trust Co. Manhattan, Kans. Kansas City Wholesale Gro. Co. Kansas City, Mo. Cleveland, Ohio. junction Cit junction Cir junction Cit Manhattan, Manhattan, Townley Metal 82 Hdwe. Co. New England National Bank y, Kans. Commonwealth National Bank y, Kans. Rothschilds 82 Sons y, Kans. Campbell Paint 82 Glass Co. Kans. Kansas City Post Kans. Merry Optical Co. Philadelphia, Pa. Lynn, Mass. v- Kansas City, Mo. Kansas City, Mo. Kansas City, Mo. Kansas City, Mo. Kansas City, Mo. Kansas City, Mo. Kansas City, Mo. Kansas City, Mo. Dierks Lumber 82 Coal Co. Consumers' Bread Co. Campbell Baking Co. Buschow Lumber Co. Ingham Lumber Co. L. V. Graham Caddo River Lumber Co. ' The Cudahy Packing Co. S. H. Anderson Kansas Moline Plow Co. Faxon Gallagher Drug Co. Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Knasas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas Kansas 147 City City City gity ity City gity ity City City City City City gity ity City City: City City City City City Cityl gity .ity City City City City City City City City City City City ,ity City City City City 1 y Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo Mo. Mo Mo Mo Mo Mo Mo Mo Mo NEW ARRIVALS AN AVENUE IN THE POST THEIR FIRST MESS 148 MEDICAL orfmcpxires 112A1N1NG CAMP FORT IQIULY, KANSAS ,MTML . - - ' BUILDINGS IN THE OLD POST 101010101010iOlO10iOi01liliOlOi0i0ll1 .149 MEDICAL OFFICERS Tr2A1N1Nc QAMD V , V Y V W , , ' 11:11, -q V O10iliCiI1OQOilQCQliOQ0-Cal-OQOQCQOU-IQ.-if FODII' RILEY, KANSAS TAn Obe to fAli6a6e Oh Alidade, My Alidade. ' ' I-low oft I've taken thee on those long walks upon the hill. The gentle winds of Kansas blowing my leggings off. Casting a golden cloud of dust that fills my eye, I-low oft I've gazed at you with vision dim, My eyes following down thy slender form. I-Iow singularly angular thou art. But Heaven knows you're straight. -E. L. K. vu Qosoicioio1o1o1o3o3o1o1oioanog01q1o1pg' I50 ' l F if F F i l lt F Fi FF s-fszttswf ATTENTION! - if-mst DAY. STUDE CO ll2S N the beginning the Army created the Field Hospital and it was without form and void and darkness reigned 'nul.t...3.?-X65 on the minds of the Commanding Officers. And a voice appeared unto Col. Reno and said, Let there be light on this subject that there shall be no naore groping after knowledge and things shall appear to If 'Nl the minds of the Commanding Officers even as they now appear unto me. Thereat the Col. called .5 unto himself all the wise men within his domain and said unto them, Let us devise a s stem whereb a Qra' 3 f .trfx - , , . , y , , y '-fly A'e 1i lrield Hos vital can be erected ra idly and without confusion that attended the erection of the lower of l P Babel. The wise nfen agreed and then and there did appear unto Col. Reno a vision and as it took form and substance it developed itself into the Right Front Corner Wall Pin. Shortly after as the Col. was resting from his labors a second vision appeared and as it took form it resolved itself into a circlet which, when tried, Htted perfectly over the Right Front Corner Wall Pin and the Col. in his might declared that from that day on, it should be designated as the Right Front Corner Wall Loop. Then he said unto all the faithful, Heed ye, at the erection of all Field Hospitals from this day on, it shall ever be that the thing l have this day designated as the Right Front Corner Wall Loop shall be fitted to the vision that hrst appeared which I have named the Right Front Corner Wall Pin. Then he gathered unto himself all the faithful and their man servants and told them his great discovery and bade them abide bv future developments. Whereupon he set forth to try out his scheme and behold it fitted amazingly and all was well. But upon trying to place another pin such as he saw in his vision he found it exceeding difficult and he cried aloud and lamented the fact that he could not place another of the pins so as it would be of value to him. But suddenly a great light dawned upon him and crying to one of his Disciples, Hast thou then not seen my extremity and been of' no assist- ance. Co to the Ant, thou sluggard and see great things. Tie the door. And behold when the door was tied the second vision fitted as well as the hrst. There came to him now another vision and he saw again a great light and he said, Let us stretch this piece of cloth so that it will cover a space certain cubits in length and certain cubits in width, and then and there he did so and Lo! the right rear corner wall pin fitted even as perfectly as the other two. Then when all the cloth was stretched the other pin fell naturally into its place and behold the cloth was held to the ground by all its four corners. l..-, Y Y , as av- vas J ll . ATTl'fQNTlOfXll -SECGND WEEK. .K-.N .- i.. M. ' , ,sv gf, 5 L, . v -r . -. -,A ' 151 I-.-...... -., 3 i 1, ... , . . ,. i.. 4' .f ,. ,.,, ,, ,,, .. yr, l, i g,,,,,,s,i ,,,,,i iw. l 1, r'-.:, '1.S i ' i-.x '--4 H. Kilim' -......,...-.. N.. .M . ..- ,. .,,. .. ..,..,... ..,.- .... . .. ..,.,. ..-.,...., ....,,...-...-,.-.. .a...,..., .....-..,....,.,,.M.......,........,...,.a,.,...M-.,....,..,..-...,.,.,....,..,...,. .........M....,.-.....,......,.............,.-...,.i..,-.,..a-i.-. .-.. --4 mmipm .1 nmamnw ummm Militaria mayb 641172 1- In-mu: vu Bmw Q-:gamma-gpggmqmfm-4 f-ai'.miiQ.-mf-L13-iiillborsfaarlsf-2 .A '!1b1ll49!5i42bw9I4l1lW0AliinFM211V1iHKK9Y1A?Af I-!HvHbh'0uxQh0 !'5 'NlNwll -Pffvmwnwz . ,vi lv is Z.: l x , .511-'fp 1 ,... . 2'-1' ' -'.',:i:'Zf: 5.15 TU- .....,- . - 'll'- ll -' Ei- 2:51-:fE.r'.53 --:-5: ' 'ff' 1? Qi- X.. .-.ff : : f.?:f- Q ' - Z 312'. , ' iillii-'IiQfi3'g . .. 5 jj 5-A 12.55 If-Z C'k 0 :EI.':.1'. N ., 3-2'-5' N - -rzf'-229'-2' .... .1125--. . .- .. Q ' Ms,--x ' g:f.1I ' :,- - ' :az-:a L -1-Efifr fgzli. . . i .. .. . . --if .E ,ax 1 , H ,5: .ll - it---1-iiiiiilliiullll lllllIi1ll ' Thus, my brethren, was formed the first direct method of lying out upon the ground what we in this day term the Pyramidal Tent. And the Col. looked upon his handiwork and saw that it was good. Then he said unto his disciples, Go thou forth and do likewise. And it came to pass that one forgot to tie the door and the cloth was spread wide at the front whereupon the Col. rent his robes from top to bottom and cried in a loud voice, Perink. After having corrected and mildly reproved them he had a vision of this being a habitation where humans might live so he called together all of the wise men of his realm and said unto the faithful, This shall be called after the pyramids of Egypt and I designate that from this time forth it shall bear the name of The Pyramidal Tent. And it was even so. Then turning to one of the faithful, he directed him to go and gather together quantities of cloth made from a plant known as cotton and another to get long pieces of the material known as hemp and therefrom he would construct a cloth house Htted for human occupancy. To another he directed to go into the Cedars of Lebanon and hew therefrom a pole eleven cubits in height and of the bigness of his arm and in one end of which he must put a spike or iron of the length of a span and the thickness of his finger. This to bear up the weight of the structure. And it came to pass that when he directed this to be erected that Lo! there were no pins to tie the ropes upon. So he sent others to hew from the forests, pins of oak, some one and one half cubits in length and some of the length of two cubits. These he caused to be driven at various places and positions around the square that he had laid out, beginning with the Right Front Corner Wall Pin. He then said: Cast forth the ropes of hemp and place them over these pins in their appointed places. This having been done he said Raise the tent. But behold, though the pole was under the tent and many of the faithful were attempting to raise it to a perpenducilar, the tent could not be raised. Upon casting about him for some reason he saw the guys were tight. Then he rent his mantle again from top to bottom and cried out in a loud voice, Perink, Perink, O Ye of Little Wisdom, have l not often told you to always skin 'em back, and LO! when I look about me at this edifice, l Hnd that not one has been skinned back. Whereupon his Disciples became affrighted and they fell upon their faces in the sands of Kansas and cried, O, Most Wonderful One, though having often been told to skin 'em back, we have, because of undue excitation at this time, forgot your oft repeated abjuration and did not so do. Q9 Ni, 2, , wviffx QEVEILLE uuulruluo-qmsviunwalnra ufdavoalisb-:wha-nun aounnwunmamnnpqumownvuonunouqi kwin 'vm rw,,u:,c,,,,,,,,,,,,,:,,.-:,.,,,,,,:,. ..,,N,,f-: ,L , Q.. gf- :L-L., ,L-cu..-A-1-..4e::.nuw......-awww.-aa.-aaa:-.va-aw.f .siren---efg::.:-':: -1 ef- fu:-if -' :-:prwaus--1A:lan1:f--:e'-..L-.slpldZlNvuo- A 122 - M. fH'l1likIi1l-- Ql.fE,i'lfQl.'l-'S.fll9fHg'Il'Efj,.iQ.-'.B2lll.. .-.-.----.t- . .. s-. .. Qiibiih-C H I l'lQ4l01! '9'iUlllil'N'lIllRD0i'llDU1Hl4i916-AXh0Cl0llM:O bK3l11v4li0i0iU' ,3, -,,-it ixflv i Ll l. l i-il V i,1N. i,N.'i.'X.w S 57 ' l ' H Q' if -' 1 .. ...if-2.-11122-'1' i 2-J.. Z - :im lill. ' -ZZ' Z I , ..- T:-.::.i-E'. . 4 . , ,.- . ... 12.-3'.:?. .-:..EE:.'-,r. I . A .. . ' - . ' u w ' X ,- ' 'ig ' ll , I , '-If -S .-::,-f0 ' ' ' ', 2 9,1 ll-3,4 u- I . ' .' Q . iiiiiiuiiuww sl -. X' .- .' fllllX 1 .. s ' YH, 3. '. '. . 3 311: .125 v - I f:5 '. '- .' -' - -f1i1:' .E . ' 'I. l.. .1-I-..:':': . : E ZF- A +4 I In - l iimiimlmiiiiiiglilggglglw .. i i i i n lllmuu-,,u,,iiiii, ,mmm '- mllllllllllllllllllllll lllllllllllui.. Whereupon, though sorely vexed, he told unto them to skin 'em back and the tent was raised amidst great rejoicing among the multitude. The tent having been raised the Col. then out in a loud voice, Skin 'em up, and the ropes were all skinned up according to his command, and Lo! there appeared the eclihce that was named and erected at that time and even unto this day Pyramidal Tents are erected after the manner and fashion which was given unto them at that time. lhereupon he called unto himself all his Disciples, all the wise men, their man-servants, and in fact all the people of his realm and spake unto them: l. Thou shalt erect a pyramidal tent in no other manner than the one given by me unto you. 2. Thou shalt always place the Right Front Corner Wall Pin in position as thy hrst act.' . Thou shalt seek out and place over the Right Front Corner Wall Pin, the right front corner wall loop. 3 4. Thou shalt not forget to tie the door. 5 6. 'Thou shalt drive all thy pins in a straight line.' . 7. Thou shalt place all the guys over the guy pins, Skinned Back. 8. Thou shalt ever tighten the guys with one hand only.' 9. Thou shalt ever see that thou remainest on the side allotted to you. IO. Thou shalt always erect this tent in the shortest possible time and without confusion. . Thou shalt stretch thy canvas tight to all corners and then move in the pins to a distance of four inches. From these commands there shall be nothing added to or taken away for this is the Law and the prophets. And it came to pass that he waxed great in the land, many of the wise came to sit at his feet and learn and he was taken awa from s t h' ' ' ' ' y u , pu upon a ugh place and we saw him no nfoic. Q ' r i . QD- , g ft -J Q9 I ' 0 Q' ' L l X Qxfi Q Q MESS 153 EVEN JUNCTION CITY HAS ITS BALD HEAD mow 154' L!!! !:nr E.,:Ls Qlllw: sails iiinl :Elm :EE E' IGH RSI? FEE! tin: iff, ,:::' nul IIE' lz:! ES!! x:-- 5::: E552 S5552 gaiii llll 11:21 . .... !E:E: -1.7 iaazs . .... IZ' II tiki!! .... iii!! H2555 Iiiil: .. .... If . EHS. l5E'E? HEEL Ill I nun I m mul lllll mu nun: mn n n nu u um mn n ull lllll llm n ln an lllll lun: lllll mm If 4 . 2 xrmw' .1.- 4. X l , .,,..--M.,,.....,... ,. ,, ' X ' ' v 'l f E4 ' , H 5 if , Km -WN , 4 : X ,, WUI-Hifiwvvsbmwrrrmf-wk-rvmgnwNmu1q.nfmgm1f ww f ', f ' M ' 'W' ' ' 'N M 'f' 'WH ' -- N . ., . ,NV , 1 , .uv . mr . Q Q W W D. mam. qx,,3uyn,1w- ,wvawmawnw-1: KWH-1+ 4' www. walawmt fa -wmv., 1 mn-aw .1----was-'Q-:H 1-N-magna-M ' ' - - k 1. . 1 . M' 1, , 'uw ,N ,, .5 3 n?1n-uuu--.-- --llw- n ---HM'-::::::: -----mu-...-. f' mn .-.mm - fEEEEiim15EE!E:: 'fEEE::: 5inaEW::fH!!!!'2525552222155-:21!9!!!4!:e:vu:EmEi:::: ....::::::uqf55g ,,,,,,figE5m1,,,,....-...---.m,,, -an V K 111: -------::u:::lm:::aa,--ml!,.!!!e---gggg,,,mgu1H1E '':: - -I--III!-e::::::.ummmii..----.......':::: :::2!l----1E!:::miiiii'':::iuumm----- -----m,..,................. , , , ------- -'------- -----me:-1..:::'a:::-2:-:gemmm1mmaaiiiliieeaef-f12uiiiaiaiiiiiEzakaeeeueuteanettt:ES12f 2i5535555555?5H21:-i::!t::E:E1E1EEEEE:!!!:ziiifi:i'2'fEE:::zw1::.: .--..--.......-...,,--:zamy..-u525292255:::::::3m::m55l!Eg,-EEE53:5E:n::Z55gg:::E 52.551 :..., ..... 55253 mfr QQ TQ rg il ,-.1-.-. v.-- I Illanfl xx- u X 1 . 3 XT: 1 I .. ,Q ' If ' 1 , . z m' 'QW 1 N ff IW, fini!! V X 11,1 l 'F f J X f s x X 1 X-A .:::: , Q lun nu un nun I nn all nu un un Illll nm ull nn' ......f--- 'I fl ff If 1 Wx! 4? ' Wcccacvf !77iWL '4 ' Ne ,Ill A lllllllillllllf fu IM lflllllduuf 111 If f ' w..... , . , .,..,,1,m:.,,,,,,,,,I5I I ,- ... ll fum Il ll lllill ll I 11 I llllllllllllll x lrfzrnlullnunulll A j ,,, ,,,, ununllfllflllul 1 ,,,, f ful I . H7 uilllflmlmf gm Zu, N r i 'UHUWAWIIM ,, l H141 'll ml - 11-24f44cc4e:Lz,,,,,W,,. 5' f up-nun:-1 nu, In hllluwyllllllllfll fwm Mr ff .-fuumuif I .I I Ill: 'ynm :nu 1 75- , H., Y I 1 , ,,, fmilfuunwm 41, f' f ,1a':,u::a. , .vu , ... -1 filun If! fmnilh 11111111 '1C'2Z5Z7 Hy 'ff mu W I ' ' umm ...JMU 1, . ur ll fill!!-'lfIIVl H, 11 :nu ufulw u num nn mlm nun 1 ' ' 5 11 1 1591111111 :UW I llzlI1'Ill' II :II ff .1211 un mnnlx um :www . 1 f. nun um 'Agn up fun I nmllfjl' a I I ff .vfl A 'fffcr' f 11 0 1 11 ' 1- 5' , 15,1 '7 il w Inn, nf, fl. ll If I 01 f 'lf I LAN un uf 1 vlnmf I I I I 1 fmnlf f I If ' rn 1 ' 1 I ff -VI!! , mffuu I 0 'f I rf! I 11 I .-,..-f ,.,,,.....-f- ..,,.... vb- v. tg., W u ivlators Jvo rx 'ht of us H A wore lcoleft of us, villa :ggi Eaeii -v A .-I-I ...- --.-.- .. ..- .. ..- ':I'! I--in -..- ..-I --..- :Ill E!!! :SEI B a'ors1n1fronf of us, wg: un: ,,-n .---. fu.- nu .un nn --Q 0 G G Jchun ere ,.-.- .,---f- 1,- -4 ,-..f-f- Z ,..,- 1 47 ,, f if f g A 'Sk f x I 4 X x I 'G, fl' mm fllll I I My f nf 1 nw l ll I mv!! 0x LCWA46 I nn pu' l ...... 4115? 1 x If , ' ,Mug M Mn' ,,2:W.' ,I -1--n I an 5 . n I n nu Inu nu B in I I llll .mu nll ll i llll nun nu nm nun llllu num IA llll nun mn: nn n mu nu nn un lmll In -I ' vm :urn n .u ns- un- I Ill: n u I nun un mn nun N :ln l Ill ' ll...- us: fell' ASN .XXX Y 1 ullyn f alll n 11 , , , m:l X EIL! D 11 ff.: X fu XQX 'l7'lf fa X R ,,, , X, K7 9 'I' . :Y r X .1 W4 N f f X XZ! Lu v g ,9163- If J4 1, , E I W X f ff , I f ,M f, lm.-ff ,dia A.. X. ff s L KCLLEY nn-nmnlllllll nn nu-my-un-I --,-n'm,,,,,, Q ,-, ,,,, Inn: - an--n--iuuun - - nun nu! nlllnlnnununu., nu::.--E --H-gn--un.-Emigngg I-nun .::.::::!E nn:-n lin.-I I ll , . -ulllll I -B-nliur llllll : I . 1 --nu I lgpl:..u--un.. -.1 , J L -4 nu .. 'f lf mwn vufnuz :Lf 2157 rin :nv , , ll I JC1,5'57f,9L5GClQZWCf ff 1 ur an u liflfllf 1 f ,,':',,,, ,,,,,,,,:'y I X 4 nfffrfm I fl! 5 14 f ., ff ,uvnrfvf f- 571 J Y f Nazi I' , fffffd 1 . vu fn, 4 ,M I, 0 'lf ' ,-.. Q' Q nf x fuk Q in' ll'- Clit I 4 iw! Q'Lf'E!nn- , I.. fl yfld' ll 'guna UA Hun X, 'lmm Z1 - :i If Q 5'-1 E mn- f ' I mn llll fd ::a:g 'Q n-un-n-nu I e:::u -H !:::: .. . . f- I.. essia N V F N ' ' TVH A Cl . 5.55 I ..... . ..- , C1 Egg EEEE: v --- -,. -255. r i A . , . 5 U ' E:::' : 'l ' - . - - ' Q - a- -- :::-! i---- t X wx f - -- Q EEEEE X ' '. f X ' -.. --- 1 ' ' 'MJ' - - EERE -. ' ' N IM., N - ' 'H - 1. -- fl f - f -- -f' I 1 . 1 P L w 1::::: ' X , K aff' ' if, , . ' A J 15551 E55 f ff' I -'.'f'Ff-- f -'-r-r ' . fi? .:!' ' I4 ' , 'GQ i - W ?:::i g If f , ' R X f asses! sf I 1 1 N 1 I 1255 .,..-n , , ' , 1 14' ,, ' ., 1'i-il,-':'::::--:ZA : : - ,.:h:-.L--ag: I 33:53 , . v KX X . , 4 v N J N , , 4' ' V 5 -, V . L' 55.13 W I WX by f' 1 X 1 A :FE- ..:. -4 ,. l -ff' p 9 1 ' : Q- 1 'gggg J I A X 'HQ' Z V 1 ,W X V ' 5 E ' ' . 4 X , ,A ,fx lx g...e geese! ' -' -7 , X ' 'F M W f I Q Q uiff'..L,f11W-72 4 if l ,. Q 'ff' 'L , ' , ,f , ' .L :' X g f , -..L lm ,f If M, M771 K qi' J 'f - ..-.n ,. I , nf 1 f I 1 l:i::i - A , I If . V 1 1151, f ', W .,, I ,fi Y X V I .. 51-5 f A - 'WNW f ft!! g x I: X V-hx f T P :...: j f , X: ' L , f - jj- .1:::'i A AQ1527..- I , V iff, 1 I 7 W X J agar f V' W ::::'T7 5, 1. . M, Y 4' V f 'Mi 'uri X f vf 'I' ' 'If-'11----4..'...f,J X W f ' - In l.: ' 2555 , 'ull J ,,,- A ' -z'f,,:14Fr, N . , : 1 ,gx mmf M .EjM,,,Vf'9 3 lm ' X f f I ...E-2'---- ' ,fy ' ' i-. ' l ,1 A If --' 53'l.M.'. Qi., , ' uf ' I nttlil 33' X '7ffQ7..,:A,. i' X IQ' ' ' iff H 7' ' ,...' 5- -I fl ' ,N . ..::':'gg1:aQf.,L,1 ' W- 'f jig u , il '1 -:ua 'xx , fha-sggsfgyg,-ffQf1. 7 ', ' - - ',-.,N ' ! , ffffyg f b iii! I N Ei5W5fMf:i:fliii,. - N - X' .-if 'X Q 1 ' ,Q '.f',: I I 1 r- 'I' ,,,m.... My X V X N I 4' ,, , , I !EEEEil . 'j A ZZ , ',.,fj1g,gfzz41?! x - L X yr , ff 5 X Q l If'7'7',!' 2 X iffffl 'EEEES :,,. 2 f' P 'F A ix, ,lf W ' ,-. EEEEE: 7 .1173 ' 4-f--Wfrizzg:71:Tgz:z'1'gvq1?3, X . 3 M' fffgfyml fx 3 ....! -um' fm,-I I ffhyfl,-1.,,v.ff5gI::ZA:,0f X , -ef x , Nw . ..: .nn , I ln- QEQIQ: 1 .f' -,ic 1' A ' T , 1 HQ 71 3 ' , 5 .Af 7' Mm: fig:-.. - ,F '1 ' iw 3 X if f QW. IlAZ444MMn'. ' , fiiggi, -. ylgx, .1 ' , - ' -fQEQ'f117Lfr7'5! 'N ' .H lx ,.-,Q-'1n:::w,'::aLl1?'LL f- x 11:::? :N5:x 4- -K5 RE W . ' I T f ' rl 'I g,,-2 ' 65.2.4 , 'ee lN'f2-fzfififff: fl2!Mnff'21i5i:f ?Q', r ' A ' ' ff fi , ! -: X W5 'fr- 2-ifliiiiff -- V- V ,, f- ' R X' WZ'-27 l ' rf ' 1 ' f.'.7'l'3' : El!!! ' ' - Q. xx! ff, V ' We ,f'l4,:::'fgfLAf ,::::::L-, , F v- -N-,:,,,.-,,L W, ' ., zf53,55:'x:' , N449 iz: 5'-7:5-L-' ' I Ty, ,J ,IZ 5:24 5::::i W X lgaggzjf if-' !:Z1i:Z,,15f,f M-nd--M4 'h-ww: V I ,ZL?i,g : . 'Xlzvgg ' fgpgjgi f. iui'in ' X'-, '-'Q' yu' .1 fffnxfgpf ,,- -G , 5 f ve fum .- . ,Ly 1'T'a5ff'4 ' ,EZEGZL - 'EEEES : I FF- - Q 1 ,-,1 V.-ff fa, W A-VA - -A, W VX XIX-, ' A I B, -A Um I, yy lg- JE IE,-5131:-.-.I ,A W. 7 , EEE! ' '. ,Q 4-1'1 , ' V' 2 ' , ,,' V f' ' If ,, 3522 .3,g,L:af, ,Lf ---. :zzz- ii- d - Q-xt! if T- oif, A 1 1 ff q -'M . ... ..V f--' - e , 4222555 IX' E. . , M 'S ' ' ' ' - :ff-1 -.-- X 'lfflif 1- ' , 4-, :::::: :i2:2Iu....,.-.. 1' ' -'-1--:::r ,,s:':-,135 .-..-. - f ' ,,,, ---- V ,, ,,,,,,,,,, ----M .. L'::3:'ui i5miEi-iEEEEQLEEEEEEE5E5!!2!E5-- '-5':::-:iiieiiiiiiiiiiiiiic-.-.1l1l1l'.111'.1111!?a::' ' 22212: K- ' :r---f-ii----- --- -- ...,.., -.,, ., 7225 .-........ ..l- ggggggggggggggggggu-gg'ggggiig-5i:: ----E:5:EisQWHIWEE::zzzemiriini..!:25.IIliiiiiiiiiiifiifiiiiiiiiiiiliil'!::a'ih ::g 142222 V- -. L--mmeE-355555g5:::-:see-ee!! my username-anim qi Q Qmlwmdmslnmhn-effnblraannum-newxc,wamu4nwnamunamaump,g4gpp,mg,,,,,,,,.,,,,,,,,, as-un--W-w--Q-fn-1-x-:ww-vi. . - -- -Y... . , ,Y Wm , ,W Y .,.. .,... vw, ......v ,...- - . W -f--,--.v..m-own, .,,,3,,,,,.,..,,. W , , M I I W 4 A -ew-vw K v J,-. .ww-nm-f --mn-M-uw--v-up wp-r1nr4,,..w-.n V ,,.-gun muuvw.:-mvur .muaqwm...pwn..., 155 MI'il.Ji6.D'Xl. Ol -'EVN liiL1?fw 'Ei-JfXiNli'NIiL llAMl9 - - - - -- - - -- ..---J-v ----:-7-p-:Lge-.-.:.1.:111-.mai---,TQ:.-..i-1--11 -Lal - :-f--A--- A A --- - -- - -- --- -acl -- - :--Q -- UililliltlilikO15010l10 U 910i01i4liKfO 0EiOl0iO Ol0all'l Ci1lUlK4CDO 5 K WUI PFI' I .'1', lf..-U-J I-Lfxf-. ,7l- 1' ,. . - i ww -- I I1 4, p 4:- .-.-------, TI- x i 1 fXTi.1-1--- 1 I I -I f - . I 1I , - 77 - 4-f---' ,, g I- ' , -'W ,...., f--- +I. gf- 'X Z ,. 5 Zmv, f---W -' ' A N I,. 1, - K., - f 1. 5 , - Z ,f .,f- '- Q- Q . g . I 1 I . I . -I. I' n 0 ' X ' I . ' ' 1 I - 1 '1 511- ' ' 1. .'. 1 , ' . .I I' II 'I 'I ' In LII.. 4.' . I I II II III . . -II IKLIQQ-if, I I,-I . I III 1 I.-.- I I--.II ' 1 - n. . ' - --,if ' -.Ix -' .-I. - .1 -. .-uf. I. II I 1- I- . r- ..1,. ' .. I,.1 .:.? .1.-rw ' II I .. -. .. ',1- -' -'I 1 .- . I I I ,-f I ,I If'-I-' 1 - . -I A - ,I ', .1I - 1I .I g.I.I.1I:I'-.QI I. I, 1 ' 1 . - 0- '. 1 I'I if' .. ' 1. '. L',- .' -'-':'-1- '--' ' I, 1 1 ,--- ' ., - -' ,I 1 I .I 1 - 1 '- II '- I, , ' 1-:.Z '1 -1 .-I'1-'-I ' 1I 1. ,..,-. II,...f--- -' - -- ' 1' 1 -1 . , '-'I ' .' : 1 I ' J' 1 ' I: :-.11 .' - I, 1 ,,-.III I . 1 ' I4 1' -I N- I -X. . . 1' a ... 1. '4 1 I -1 3. , I1'-, 1' I' - I' I-.+I-III J . .. -. -- J::,f' 'fx-' '. - ' , 'L' I -. -. -2- '1 7 -1'.'.'l - - 1 . 1 1' ..- -1 1,1 - - . 1- ---' .1 1--,4: I- - X' ' . I . ' ' .' - I' 1 I ' . I ..fZ', ., If'.g. I' IHJII I'1,-.,II. ' , 1 ' ' ' ' . 'I ' . ' a-' f?'5.'f'1f. . 'fl'-',I1F5, if 5 Qi .f'ff'- ' ' ' ' ' -1 : f' 4 1 -' :--1- 1f '1 ' ' ff -.--- ' 1 ' ,I -1-I - .- '-f'4..g'- I-- ',, '.'.-if5I!.'.-T:-Z.,-,gff..Q :Z-.F--. - I - fx- ' 1 -7 .TQf ' ' . 4-':.-ui' 4- .--Q-I'ig..fi-i-.1'-.-3-1:1f-.1.Q.1-.412--7.f-I. 1 .1 ' ' ' ' ' -' I .H ' BZ-:' ' 1 ' ' 4':-- J if-U :..--:L 'f,'--- 4 1 .-1T:','fr,'-.4'T'f?'1'3.f '-',': 'f3Qjf1---: I . o ,. - III I I I III ...II II fl III IIIII IIII II III IIIII III:I5 III-III1III IIII .If.I-IFIIEI2IIII--.'I-gII.IIQ:II I ' t ' ' ' ' V' . 3' -1 ' 4, .- .'4 .' '- - '24 1L .'2--'.-'. 1. :- ', . -1: 1'.'T1.. 1 -' 1 . 1 I . I 1 1 - ' 1 4:'.I5.' .I II- .fI.-,gg .I.:-.g:f-r1,--1g..i1g'- -f-III.g3I1-.- I V ' I - , 5 QI . .-- '.-I ' -I2 I II I- ,I:1i.I.- i ', J -'15 Af.-I , IMI-'-i'.1,'--'-1. -16 . - - - '- 1 1 : 1 .- ' . I.', ' -1 ,' PI.-I. 1 1II- -' --II '-.1 yi ' ' . ' ' - ' ' X -1 .l l - 1 '- If iff' 25T1f,-'- - '.3Z.A.ff. .j-Yi''25-5 I . I -1 ' I I' I 1 4 . I 1 'a1 .- 5 ,1Ig..-L-'-j-'A '-I.-GX I- I K ' X4 I - I .I IQ? .1I.,.g1'1-.:If.I11,4-Ir- ii -.. .:'f,'. '-.451 1'I.Q.'.-31-I 1,111 ' - . - - . 1 'I-11 - ' 1 I Iff 1' 1 J ' 1 I. 2.'fg1: - 5 'ID' I I1fI--!--f'1'-7,-:II .I I X I - 1 ' ' K -. 1 -' L'-1f . 9 U 3764 ' .' X- .I V. .-'Z-u' -I-'1.1 '-4':f':. 7'i 1' ' . ' 1 1. 1 1 .. - f 4. 1- I ,gm 1, -1, .4 - - 1- 1- . . .. 1I ' 1 - , . '. .X .. 4 I1 .I .I - ,igqg -, ,-.9 5911! 45-5- M1 gII..1I1?yI 1 -1: - l 1 -X ' I..... f -- ,J ff-I f f? ... 1. . .A4'..---LA1'.-1--2:--3? ---effxf 135.-'-51,-'.1' . 1 Lf-'e-..1, ' ' 'f - - ' Y-X ,- X1 'If IZ 1- -U. S- .- Std!7.1ff1?-'-Q'-'1:I--.W-9:-L'f?'--'14-5-'QF-.f'I1.-1 .-- f 'lN': ' - - I I ' 1 , . ' , 'H' I .' ' 'Vl H2-.-.gip .' 11 ' ' ' 1- ' - -1 .4 f '-if . X 2- max -4: xl 1 .1-:fu-.1f1---,V '-- -f3.-.fz,f--1-1,..i: ...:..I X- 11 I, - I. I1. -I -ff, II1. . -4 . 4- -. 34 I I .L I N f-1 ,L -I -Y., 1 -1- 1 Q .I . .. -. . I I I .- -1 f ., 5 .iw I Y 1--,-.. f- fs Iliff- .,, -1-11.1 .-.Q . I '3 I 1' 4 ' I ,, ' '. - - QI . . - QQ., ww :.-Ivy' '.-ff-,I-Q, , ...IlII.1g. 1. 1. -1. 1 -..- ., :x11.'v' ' N' I - 1 - .i K ---. --Ag-' ,x - ' . M ' 7 4 of Q:-YN ' - W -'Viv 'ff-7 H: N .+I-H w3i3.1-35'-kj ' --. :51.'l ' 1 -1 -ff 1- -. 1 I -. .1 1 4...,- : I , .I-- 1 3.1.1 .1 H' . .. . 2 .ESQ x QI XI . iii 1 -4 f-f-f .1 'Sf' -'-J -..Q1-33J,Qf1I-I1I:-- ' I-125513 . .EI-13.Wifi-Q-IPl?.J11 1 . 1 1 - X X- I . I, --v-'-- 1 5 M! Lf. .4 '.I X ..,.-'- --fa ui-' f' 4'I'L,-fg,i.'-7119 I ,I-' -ILIn',11'j.I5q3-g,I-,Q-I5:..j,'Iy:'-.Ie - I . ' x - 1 - ' U1 '- 1. 1. yy 'lf - - X3-.N . 1 1. . 'WK 5' ' -f'1 '.'-3'-ff-ii-1.:: 1- ff'i11'. .1'-:-.v1.1-'.1- ff - I . --... .I .. - -1 Q .. . 1 1: .mf - QI -.. - X5 X- 1 1' 1 . . - . . .-.-.:1'-.:1--- -4 .1p..1,m L-:-rw.f1,a--,--e,.I-.- ' ' QI- a ,I I I II .1 1 1 :: ff W N, -A 9' f'f ' 1' 4-1-1-4-1 141.-T11-.2--1-ax-.4f::'1--' --Y-12-r'... --.-'--'--i-11: ' .:. - . - I: I - -1 :I 'N '1 N1 s -- f N . -'11, - 2'-'M- I.' ,x wg-I,,.II,'I-5I1.Ig311--f ' 1,.g,7'1I-1.IgII--.3-'1'1.- 1 1 s - . I I II 1 .4 1-'- . .. '11 ff . - ' AX ' lx?-93. 4, --G1 AK.-.F-g1'7?:1'-1.-ge. X -4 I I .aI I :II 3- I1 1 I I 4 1 I --I ,-IH, ,I I-I JI! I ,IQ III1. I1I1II -I, II,:g.I!,:i.III I -1.I1 II II.:-1I1:IE,I5,II.II I -I I 1 :I1I.I. II v. ' - . . ' ' . ' I J- - I '- .,. I 1 -J ,fur .-za ' 'J1g5 :-159.111-1.v'.54-'51-L--' X -,I-I:f:51'544.,'I .I I 1 . I in - I . . ,. .- 1, I I I. lr v-4 I ..-I1IIsI I-II..-1-1I.1.4I-I..g---4-.-I I '. .. ..1,.1 'fp - ' ' . - 'X' - - ----1. - 1 4'-if ' . -we-+7'T7f'+ :ff X.W5m:215 f 115 .fQ 1f.'x2if71.Ti41z'1,1:?. 71.9-.. , L1'6'-'-Wnfd I1 'IN I 'III 1- I ' ' .. ' I ' ' I Q 4 'IJ1 QI IIII-I-I1' . - I'.'g'av ' ' Zi? I 15LI I' -'11 ivy' I.,gf.1-CLIF.-TI'---Tj5:-I-I:4I5gfil:-5:'15g'P,fIIfLQ:I ?QIfII5Ifn:ff-III. 'Q'g',f - - .- I - ' ' . I 1 1 . - . , '.' -1 - ,.q,1 I . :.-4:- .---I1--1.1g4..-.4.--.IZ1:--1-,...-1I.LI-,..1 .I :,I.-:..I.-.I, - - 5, I- ' - 1 I .' It-'I ' jI..,II I ' I ., 1 .5 -3 I' , 1- -1 .. , f , .Q ' .-.LJ '.f,'fI-'gI,:,':.-1- 5.21 '1'I'.r--1-1.-.I - 1-if 1 ' i ' 'a.4 : . . 4 if - 1 -. ' .--1--1.5..'7.:f.- 1- X11 In Y1-:-'-2-f.1- 22-f1C43:fH 1. . 1' . ' - .. X - 'Y51- ' .5-'f. If-:1- inf- .4 '1 F: --':7. H :f--:p.-- : 'iff '- --I----'- -' . 1- '., IQ. I 1 ' I --Q , --1 I..I-: 'I-' - 1' :-I ' .,I.II.-.I-Ii H-r1'II,- ' - I- 11-.i.I'- I1gfQ':I'I'IIIx?I.- ,' ggi' if I1f:.I-I,--I,t'5IgIi,,' gffgsi I . - .- - I' .. .F ,-1 :I1fh.-1, ,I I. .I -4 .' :.-- .' I'.gI:-1,11 f- 12.0, '-.Af '-'h1x:- -.1'?'.':f -11 E ' 1- I1'1'v1-I --1'I'- .-I.1:.. I , I IIIIII . II .1 .IIMIIIIIIII II II II II IMI.: II I II III., .IDI I..Iz:!I ,fl I I..gI.I.I1 1.5. ,II I YI I.I..I 1 -' s' ' - 1 -' -1 X ' ..-ffwi-:11-.2 '. '..'- ' 1 -4 : .f:'1-'-.111I':2 -' -.15-..-'. '2':v---1'-I-.-- -1 .' - F- 4 , 4-Sf ,--W -. f .I I 1- -', III I- Ig -.gI1 'v I . LA--Ig 14,13-.-.-.I 119.I-: 11. I.r '3- I f4s...I-1-I---1 ',- .- . - .4 O I--Sv-'.,:lI'qIg-IwfI:'pI-I1 I: .EW gif '- -1.11 - ,'Z',1Z ' . 1 -.TQ-C.g1I: ,.I ,1 I I 1- - J.. '. .y1-- .-. - -1 1,I '-.-J-I.,,11--... ' -I .. ' '. ,!:.g':- .-1--E' 1 .33-I-1 .' .,.-.f,Ig--I .-.v,.1 :I-I1:: --. -' V - .2--:gh -f el--.Lv u 1 -1 '.: 'w' '.-.. is . . . 1 '- - .1 ' . '-155.-1 -.1,r I- 11- I 3 1-11 .1 . 5.-Ir..-,1'--,1I,-:.: - 'zz 1.-'--I1-L ' I 1 .' -J 1: . 1- -iz:.p1'f11.1f-,'1:I-g:----.1'.1g.1f- I II 'I I1I :II.I' IIIII II I -I -II --I'IIfv-I-1 I 1II --I5 ng. -1 -. I. .'.'.4..A- , II-I , .T-5.1:.I1 I I!I1I-5, --y I. - ..'g1'.1 ,wi-ff.- '.-' I .I .--L 'II-v. r- 1 ' J' Im' J 1 ' ' ..,.. .I.,I .,- ,. . '1-F-ZX if 1. ' ....- .. . .. 1 ---U - ------ 7 'FTE J. ' -1 --IF ---- - - .'-!!:: ::l1lIslli . ' Q' . I'j'TfYIff.. ' -1 QII - ' I'.I '- v II Q Q' ' ' is 1 ' 1' - -1 ' ' ' .-1.-1.--Ziggggjgg-glggliulgirzzzaz:::: :viz 2553- -- ---waiuw .: ' -- -f..... E.?.!'5'fv':.t'r.':.::.:'a:iiE5Ei::iE2l'.E'l'.:::::.:a:i.::a: '----2-:iEEEEE5 - .1 - . .' - psi- ' nhmlmnngmulml! . -H---Q. ----.....p:,-.-........-I--Er:'::f:p1cunnnHlAl4E-..'.!-..-.,,.....-...,..-....I.:f---....-Jllllllllv:-::::.:ii,:f 24 1 '1 ,II . ..I: II I I . I . ,-.-.gnslullllllggellll 4Ml!?l'llIlllr1un5.3:,:2IIIl::...131-nuuluEE2i:Z:..........::I:I-:::I5-:Zz551:25I,-,,,,I,,:::gI-I:-Ig::gunz--Illiqfggmg:gi-,,,-,u----IK . T 1122231--:.i:i5:z:::u:::--Hiiellsia--:::::f-ff-----:F4-----iii--fee: ' 1. .S 1 1- 1 --1 -::'::T.1Z'12I-..1....aa..:::::::::1::7:-'FN---f'5'i112ZL2::'::EE?4-.-L? -----t,iQ ':-----------IT-Z1:-:i- --:'l: 'fEEE5:':'4:3'-12: T 1-------.....J ' . 1' 11 ,1-- - ,..-..1- .. 1 .., .-.-..- . -...-..-.-. --,.- -.-- -1.3:-.--1 ----........-----m ' ' uri 'I-1 ' ' I.. --f.I.'Z..:1:L2'l'g-.....-.p:.-.gg:4.n...........-- Jag.- .... .....- L.,. fir' -- --' ---- ,I . 'f7 --1 --,Lu --..i-:...- 1-f -'J ' ,TI-If..IIl'-,AIIII1 fl' - W I ' f ' ,',.IT'?IfI..'fSAk3.'f,11:7Iif'A-'if-: ,. -5--. L1F'1-T-Q' :AI-II-,xg ' I' I I 'P I:-:I . 'W .yy .ji 'II 'IQ -. f.--QI ' 'Vg-'Xf'h'.-1 1 Q'-7'-: W 1, ' . - ' ' -....L 7- .flfirf f1 r'F1Il' ?-'1': 7Ms.i'l'1':' WL I - T' ' 35 II - -'i .' -r . III . .. . II ,....-....g,y1IQ :II .. I- . I- -. .. .. 2, -'-4-I,. I. ,III -I I . i - , 1 .1 . . - at- 7,f1'f' x ' 4'-,' 'I I- ' -- 3. ' ' - .tif-' - ' : 1 -'-- 1 ' 1 ---H . .-- 1 'f' f,-f 'iklgxn . ..-.I - I-1 II .- . . .I -. .1 . . 1 .- '1 , '-f:-- .-'I I 1-.-.I--I' -- 1 9-, - --.- I xx -- . - .-.. - . - - .111 -- -I -1 I . - is-i T .3 In I. Z,- , X x, . .. .. I . -P I . . -1...f.. ..-- ,II,1rI ...-.-.- ,,. 1, - xx- X - -,- . . ... .. . I,C w-L 4,5 4-3 -I . .I I lII::: ffm- II II.. I. ,. III-751: ,IIII X III I .I II . I E-175-I I -II II I . II I I lr iiiiiifsfif. f II. -. - - A 1. 1 X-X. - . gr 1 -- -4 -Cf 114 1- 41': '-1 -ff. 1 1 - Y. ' . ..- Q 1.1r.-1 .:I'I21-.-.-.'-,,3jn1-1-1-. Ju.-'g.f ,f ' ' - .- . .-- - - N. N A . -- - I - - 1- - -faf. . - - S11-1 .....,,,,q, I I . .1 . , 71. .' -I . 4- '!1.- -' 1 - 1 --nf. . -1 . .- - . I .I Af 3' if-373::::::,f - 1 ' -- '- 'if 1' -' NRE' A 'J .' 4' l I I t ' ' A V' ,Q Y rw -. g:.31.IIf-.1 V515-Li-.I1,-T.'I1'24.I'1'-F-1' E21-Iggy! -- . .'fgv '. 2.1: Lf ZI, I,-. .S . ' 1 WIS!! I' I .E '.5, 1- '-'1' .f . ' ' ' .'1 ...'I.4I.:cI.ZIIfI- ..j.15f'1f25f'??':-II-Q '1 ':::1!.Ef1' 1' I. I 4 215.1 IQIQ51-,.QqI- I ' j -' I I . I-FI. ' .' '7:r'f . ' FP 1-5-1-.I-ef-.'.:-.-pr: . -' 1 1' -1 -3112 . i111 Wage 5 -I .- I- - 1 f- I 1 . I I 1 . - -1.1, ,I - . . . nr . I I----a, 1. I .-- Ia, .1 - . I I .. ii. PRIVATE JENSEN ' lQlO1laOQOQO10lU'lliO10i Gila !9!!-45.51-11.-.JfI.TRlAI1, ' ' lr ..,',Dit'j ' ' 1.112174 W . --3311 ' I, ' -ij' N757 ' Q ' 156 Af, rg - ,-..- -- 5. -- 'A ew' li.. Lyla ,A-Xl. k,'i'l'l1 i new lm-'Xln-il'-.-f L wrfii' . ..,, ,,,..,. W...-V..-.Y -.-....,...,.,w.vW...... ....-M.. -.--' --.5--.......,,......,......'..-... ..1-,.-,.--e.- .-.-....-V--MQ. .....-B..-M--.--.vu-m...A.....-1-IK.-.u-v1.v...,1.r-..-W-...,........ -l..,.... - .. Mr, r -V .... .,.. .. , .. ., ...N ., 'whim-Mwmliw'qtidiiliidl'4Wflli'h0.iiE'l b'0'3l9Ull02!Pf0-UMS3if'lUl9l.b'XUv?9l!yJ'iP96Cnrif05310XBllE1I'l'9iWf'11' I' M: 1,52 i i r 'Q , r A 1 s '-Q N '1-..-- Q 'i in ' ' U Gfa ur masks ' Amd hold your breullig h:A ' Sure, if you dorilfcis cerlain dealli. Illdm engl chloride, bromide, loo, Yearns to blind wilh 'nears like glue. og. .. allglieres 'Llie Sreemsli, yellow Cloud o XW, ' qll'll urgfin ' lowcird you like A sliroud lliveri c lorme, Fhoaosene 'ooo - C loses loromfbtbf Cdftllbl View - l'i' i 0h you 'as mask, work of arl, f in fic 1 ol of my im: f N e'er from you kid will l Part T has shouts lvlajor Hairy Dark' rlil 'l'uQ , i l l .1 ,QF ., Q :-r ,-rr me- ,.,. 1f.-' lllrlrl -rlrri:-r F5 53:1 ' -' 4 l ' 'P ' Y fliftfgiuflif ieri ll l Qfril. ,lirl i l 1nel1ms1l:Qqmufap0?e1loofgsfgnylgiawiomuumwwsmma-fmmwmmowmna. .qgglwg-ln ,, v ,Y ,,, ,,. ,, , ,. ., .... ..,n--up-w. ,,., ..,. . .....v....--v. - 1-1 -www-W---V--fzzzapawv-uw.-v-.erm-.V .-we--W r-:via-' ...gg .,a. ..,:.--,-a'.Q,a-.fww-M 157 fi'ivA'i2!blJllT'Y KELLEQF I' AT HLETlcs -il? XC, K tn 1, F.-2 ,, ,nf ' L f ! ,X Q4 N .V , 'Vxii S 'TK X T W ,-., ..,f-1-:aff-.fr--v lSb Fii.M..,i,',-' 1y:, - ' f f is 'sr i ln? .l wi dal. KW! 'VH .l'l.JFw l l-l15alOlli1X-H w 1. .fhfll 7 --Y-,yn ,.f,- . .w,. .. 7 . ........ ....... ,.... ...V -....W..,,.,....a.,.... ,... wt...-., f,.. ,,,.,..,.......-...........,..... ..-1- .. -,.. ,,,,. .,........,..,.....,. ..-, . ,......f......m..,...,-...1.,......- W, ..,. .,,.. ....-.-,....-,....u.-.-......... wfuwnau-sawivvmwwwnaman-vfeuuuw'amwaa-msnwuunwierwiniawuna-ioeumomelim:-Minus-'nails'whenuamuolanuuw-naman-amnesia-nwQ-nw-we-annum-esrllviawvlwlviflbb ftiifl 'i fl n li l'v'XfXf':.l'xli A Q l - oo 0 MT, E+ ' QETQEAT Growing 'Ilains o a 'Tielb fflfospilal man RRIVINC on August 4th, after three days on a stuffy train, we cast our eyes about for a Fort with port fy holes and glistening cannon, for what else could a green civilian expect? Alas! no fortress was in sight, A instead, an ambulance marked with strange characters, Cadueeus, Red Cross, U. S. and M. O. T. C., whatever that might mean! li -iff fs.. lf. '77 le will Doc's seemed to be everywhere, and in all stages of unpreparedness. Some with service hats, ,QS-.ITMLLJ some caps, some with sabers, boot spurs, saddles and valets, others in civilian attire. A motley throng, -Me-A and we were at Fort Riley. Loaded in ambulance away we went uphill past beautiful green lawns, stone houses with wide porches, barrack buildings facing green open squares, and at once we felt 'iour lot had been cast in pleasant places. Anticipation ran high as we could see ourselves assigned to three rooms and a bath in one of the houses facing on the Square, and what a luxury, a bath in the tub after the dirty trip in a stuffy train for three days, but alas, the end of the rainbow. These were not for such Rooks as we, it was the old Fort and quarters of peace times, and as the car sped on we were projected from this Oasis into the real O. D. country which was to be our future home for some time. What a contrast as our hopes vanished in the presence of wind, vaporized real estate and low, long shacks of upright boards with Openings for windows and doors in all stages of construction. With downcast hearts we alighted in front of the baggage tent. Good cheer was soon to be ours however, for we were discovered and found the veterans of a week most sociable. Hello, Doc and hearty hand shakes everywhere. We were well received. Everybody was so sociable and welcomed us with open arms, tried to help us get our butter checks, Issued invitations to badger hghrs, etc., and the dark clouds disappeared for a time, 'till we were shown our quarters in Barracks No. 4, just the bare building inhabited by real estate and flies. Since Uncle Sam provides for all his boys thro the Q. M., we were told that everything could be purchased at the Post, so we came naked and without bed or blanket. We soon found out that little could be had and that we had to go to nearby towns, to be robbed. In the early hours, about six of us had gathered in the barracks the forerunners of that band of 142, when suddenly thru the door appeared a slight stern individual in boots related to the seven league variety, slouch hat of many campaigns iilllilfllii1OiOKl O1i' '9'iQ4i9'l l 1'-l4WR 4UDf'9 . , , . vr:.::L.,, , ,.fa, . -. 1:4-f-iw:-.-...t,....... .-.- '::::mtw-aw ...W Y-arfzffvf---1:-ii -... -'. Q.-.a-xr:-:4:...a11 f:xr--f-nw..-1:-.:w-iv- .ivmim::f'nbfu:m:.: W.. -Q-.::g4.a,.: i-in-rf' 159 ,.v 'H wt . f it Y'1k m 1 at JR AM 'mr hlrhwrw mwrw if 'afwimw H eawa'A'-- M vw uf 'ff iwnwwh va 'meme-1 v virmlwlw 'S' if -nmfmiai vt vruwtvmk frd'L.1r1em'v rx-wlwmit fm ifrwwvf- 'K wi I mi n 11 41wi'lM'f1l-1 1n,maw we 1-'vmwaiv--w uewiewwv va wfiriisiavlv ia I 152 fidfli-Wiki-' MAWN' 'D l.llN :1I,'...- bow split bent to earth and stern high in air, peaked to centre in a rakish manner, much after the present Down's model, dark glasses thru which sharp eyes peered, but thru which we could not get vision. Then began the era of Fear of Cod in you. Who are you, and What are you doing here, trembling explanations, and we were told to report to the Adjutant, and that he, Col. Bill, would see to it Class No. 4 would set an example for all future time. Wishing to show due appreciation of this attention from one high up in the military firmament, one bold Doc ventured to enlarge upon his own prowess and endurance on the march, etc., thus inviting the Colonel to oral combat over pep and kindred army qualities. ln a few short seconds we gathered up the fragments of our comrade and paid our compliments to the ever victorious Colonel. One of the six ventured to offer his services, having arrived two days earlier and already considering himself in the veteran class. The Colonel rising to full stature in a loud voice exclaimed, You, LaV-, are appointed First Sergeant of this Company. Not wishing to be left in the rear, another humbly volunteered to do anything to help the cause along, when with a sudden left face in louder voice even came, You are appointed Supply Ofhcer and Q. M. Sergeant. Cet this place cleaned up, go to the Q. lvl., draw cots, blankets and mattresses on memo receipt, issue to the men. You pay for all losses, etc., and like a flash the spirit vanished. This was the beginning of responsibilities which weighed heavily on ourinexperienced shoulders, then followed all the anguish that goes with property accountability and responsibility, dreams of furlough and court martial, wondering whether we were not continually liable under the 96th Article, hikes, mess, taps, reveille, all came so close one after the other till Mondays were followed by Saturdays in quick succession. Then assignment to Field Hospital as Supply Officer, more responsibility, more accountability, more to do, no excuses from classes, just one damn thing after another. Then the Commanding Ofhcer ordered away and his duties assumed without being relieved of the property accountability. No junior officers to help, company on guard, fatigue, competative tent and hospital erection, during lecture hours, but no excuses received or made, and when the question asked, how can two places be filled at once, the same answer given in a stern and loud voice, Do It. Time sped on and the three months ends. You are now at liberty to develop your company and show the world what a real Field Hospital Company organization should be. You kid yourself along with the help of other well developed kid- ders, and just as you are beginning to feel that you are arriving, here comes an order and you are no longer in command, but are given a new task with new responsibilities. And so the preparation goes on, old friends to new helds, and when stock is taken you are glad that you were so fortunate as to have been ordered to R iley, lvl. O. T. C., and you agree with one accord that Sherman was right. 5 I--i iii.. in fl. f S we S TAD5 ?uiv'ifii' DxfD!MMD1Mf2EflIl9Q2 ? l'l'W'lW'9'W3illh9 mmwmfmmmammmimmwmwwn-iwmmfamwmqwlvlli' ,,,,,,,,,.,,,,V,,,,.,.,,,,. ,,,,,,.,.,,.,,,,,,,,.,,.,,,,,,,,,,,.,,,,,,,.,,,,,,.,,,qM',,,,,m.,.,,. ,,,,,.,i,i,.., .mn -W vi -- my -,-sri-ie ..a-,- ..,.,.1..--.,-.,,,.,.-....L,,,,,. 1 ,,,,. 5.,a.v,.,,w'.v mme-fn'r..wi--fxmnfnx-uae..mafudiii-U1am.K.ll-muzmw-wWm.Jl W 160 LI -LQ f LJ L-j I l L.J 1.3 LJ LJ W-J 13 'M' 5 5 ,Nr W nm Q I, 1 fm mu J -1m'W1II 'L umm IIE an 1 1 nlllm HHH' rr 3 ,:f 'i r ww QQ' : ' Q in , , ,- ::-iii 4 ' gl.: ,:'iQ'fq'5:3:1'ffQ-EQ. :,:gE'Q5':'2vl ' ' - , , j':'fffisE'.5 P' 1 ' 1' 55, iii - . -. 'U . 'Q .. ' 4 ? :3 f5-: ,H 1 3Z'f:Q -3 P- lllll gm-, I ' 3- 1 ' V' V L. -15--5 O 'lm 9 uni nm.. 'Hlllllllllllll' h.- -F u',ia41lli' , III-Hrilfllcg ELKELLEY ,gaHS Pax ff-i . 'rv I- , ll: I ,X l Y S 4 f. v 2 X? Q sw X ' NN X 61 x f.w'x 4 r 3 I 1 M 5 1 1' 9 2 k , u wx, 1, if ' v Ez f Q f x PM xxbiu x AI X -g xy , 'iblsx f. 4 W 4 s ,AZV .Q I I. N m' ,M 5 XX 3 X - mf I 0, f 5' K M KELLET N A-.7 He A l.6ovZs TO Pnosufg Ma? us 7' - UT- ' , W YI JS' X . HM .SQ 1.1 H, x ' ' , '1'W'3 , ,. ' F i 'A xxvmbb f ,JQJ H' if J 75:27, Hf x W Y' W - ' fu lv I lj, 'D L ffl . , 'I .' lug ,f f UN W, w f M ffm if f - r X ' V Q f M W' 'W W W 1 Y Y 1 f!' 15 XX y - ff W f J ix ,X n I K X E ' 2 2 ' l 5 1 Wm, ' M u p gy Vg if M.x.t.' , Q., X-J I ' 1 ' 'Q A' j, I ,Q X m x X '-QI. ', f J if xv w m f f' Q y I ,N I, Q N, X fly tn? W fl' a!a.'ll!!IllIf':ngmgin , Mig NR 1 X REQ ' XX--,X 1 Z m E. 'V 'I uf N N I ' 'f 'ki' ' ' X 2 X1 'N i I-- .. X4 'jg - F X-I V 41,5 'fai l . A ----ff f ,g : 5 X 4,'fQ!f1f4 1'f'4 i f . .ififii 1 11,1 e.L.n4eu.L6-.4 A' ' 'A'A U , Tx-ff 'im-' h,f f2 - ' 5? ! '7 15. n SOCII IY IOR I lil VI NIION OF VICE 1-,,,, ,. ,,,, A .- , . --R .,, -.55-v 3,11 . we 'AD ERTISEMENTSI ITH a heart full of appreciation of the generous support given us by the adver- tisers herein, and with a great deal of confidence in their reliability, we take pleasure in recom- mending them to the readers of the Year Book 5 Z-fllfll.l2l41I',fml... Olililf. 'f'fi.l7i 'i'ill.'lXlT f-JQNRil i .f'fi,l 'lll ....-..,. ...--...H -www-, .i.-W ...-.- .i .M-, ...wav-M.---...-........-.......w.v. Q..-....w...m.. ,..,.. , .. A ... M..-4 . .V . W... .1-.. ....-R. .4-. .J ..M,.mu.. V. if-..f...,-, M nm-0.1 L- mm.---W-nfnv v-...-.,..,.,. f...,..,.........,..-. - -,fn ---an-an-up-swnmuwr' can qnwmuuum anusmuuawuwmwwuwnwwJ.w.r.wxonm,mmMvwnmmwwmiwmaww-s-wmnmumwouivvaalw' uulnwalio I I l l N .lk7lJf 'iii xv ?'3'L, 'f-'. Dba 'last Worb ii P iliifis -OW that the last copy has been forwarded to our publisher and the last plate finished by our engraver, and we have had a glorious rain, so that we are not disturbed by the Oklahoma farms pas- sing by in dust storms, we take this page to thank the contributing Editors for their earnest and loyal co-operation, in the prepara- tion of this book l5 i 'R nk l RP:B,rll,. if , 7' ' lla 'Q Il. 'd '- il IFN, 'Q To Mr Teachenor, of the Teachenor-Bartberger Engraving Co., Kan- sas City, Mo., and the entire force of the Union Bank Note Co., Kansas City. Mo., we owe a debt of gratitude for the speed and efficiency with which this book has gone to press. To those photographers who have co-operated with the Editorial Staff, we are indebted for the photographs in this book. The Williams Commercial Photo- graph Co., Kansas City, Mo., Anderson Photographers, Kansas City, Mo., Holt 82 I-Iolt, Manhattan, Kans., Pennell Photographer, junction City, Kans., Win- stead Photographer, Kansas City, Mo., The Association of Military Surgeons. Washington, D. C., and to those members of the Medical Department who have contributed kodak pictures we are also indebted. To those contributing Editors I wish to express my appreciation for their encouraging attitude and willingness to contribute the articles in this book. Their advice has been helpful and readily given, whenever needed. 'Ciba Teller. CONTRIBUTINC EDITORS Colonel Bispham, W. N., MC. Major Kerr, E. K., MRC. Major Richardson, W. I-I., MC. Major Farrell, A. E., MRC. Major Cook, G. W., MC. Capt. Claeren, E. C., QMRC. Major Kinard, K. W., MC. Capt. johnson, P. B, QMRC Major Dammasch, F. I-I., M.C Major Eggers, N. E., MRC. Q Major wethefbee, j. R., MRC. Capt. Kenyan, R E., MRC. Major Webster, R. W., MRC. lst. Lt. Stark. Lucien, MRC. Major Sessions, j. G., MRC. Major Hathaway, R. E., MRC Nlajor Parker, I-I. C., MRC. Major Flynn, T. j., MC. Major Howard MCC Snyder, MC. Lt.Col. Pipes, I-l. F., MC. Major Pillsbury, I-I. C., MC. Major l-Iughes, L. S., MRC. Major Williamson, C. S., MRC. Major Reddy, j. J., MRC. Major Downs, j. M., MRC. Major McBride, W. L., MRC. iilbilllii MIMfPMQl9MOM0!lOQ8M0iOMOl0iOK fr'T'-2ln!nl::a:1:,..-..g.-..4...1...-.v ...,......x....w-.m-.-m.. .,... .......-- H gf --.. . .. ..,.:.-.-,....f,1-:awww --,ann-,. Vw Our National Army at Ft. Riley and Camp Funston Some of the things ELECTRICITY is doing toward preparing our National Army for War with Germany Crushing rock for miles of macadam road. Lighting the ground and streets. Lighting buildings where our soldiers are quartered. F urnishes current for telephone, telegraph, and wireless telegraphy. Pumps water used for drinking, bathing and sanitary purposes. Furnishes power for devices in medical laboratories. Drives drills and various instruments in dental department. H Runs printing presses and linotypes. Drives laundry machinery, bread mixers, coffee grinders, heating irons, running horse clippers. Furnishes amusements through picture shows, electric pianos and lighting cigars. Also moves trolley cars that convey soldiers to the near-by towns. Our Best Wishes and Implicit Faith Go With You, Our Representatives, in this War of the World. UNION LIGHT AND POWER CO. Junction City, Kansas Bayer-Tablets AND Bayer-Capsules or coNTA1N THE ORIGINAL PRoDUcT Made in the United States since 1904 The trademark Aspirin CReg. U. S. Pat. Officej is a guarantee that the monoaceticacidester of salicylicacid in these tablets and capsules is of the reliable Bayer manufacture. CAMPETRODI fTrade Marky For denuded surfaces and Wounds, it is ANCDYN E, ASTRINGENT, DETERGENT, ANTISEPTIC, GER- MICIDAL and promotes rapid granulation. Relieves promptly the acute pain of a severe burn. Dressings may be kept saturated without fear of irrita- tation or vesication and may be removed Without tearing newly formed cells if kept saturated. A CAMPETRODIN is adapted for use wherever Cam- phor or Iodine is indicated externally or Where they might be employed in association with advantage as in Neuralgia, N euritis, Myalgia, Rheumatic Joints, Enlarged and Indurated Glands and Inflammatory conditions. Marketed in one, three and eight-ounce bottles through the drug trade for dispensing on prescription. Hospital size supplied only to physicians and hospitals direct. ' Liberal sample will be cheerfully furnished on request. A. H. ROBINS COMPANY, Richmond, Va., U. S. A We Supply to the United States Government AVIATION GOGGLES LOOK-OUT GOGGLES OPTICAL PRESCRIPTION WORK SURGICAL INSTRUMENTS OPI-ITI-IALIVIOLOG ICAL SUPPLIES We have a branch of our business so located that we can and do give a twenty-four hour service to any point within the United States F. A. HARDY 82 CO. JoHN H. HARDIN, Pres. Wholesale and Manufacturing Opticians CHICAGO NEW YORK ATLANTA DENVER DALLAS SAN FRANCISCO ST. PAUL The Military Surgeon Q The Journal of The Association of Military Surgeons, U. S., representing the Medical Department of the Army, Navy, Public Health and State Forces, and their Reserves, together with former members of these organi- zations. The Association was organized in 1891 and chartered by Congress in 1903. The Military Surgeon has a large and rapidly increasing circulation, not only in the United States, but in foreign countries as well, it is the only Journal in our Country devoted wholly to medico-military matters, in which it is a recognized authority. The Military Surgeon is published monthly, constituting two quarto volumes annually, each of 775 pages, its subscription price to members of The Association is 32.00 per annum, to others 33.50, and 34.00 in foreign countries. Application for membership or subscrip- tions should be sent to the Secretary, A. M. S. U. S., Army Medical Museum, Washington, D. C. WM Win 1 wi' my l XX 50x Befternww Prevention Defense 1. 2. 3. 4. 5. G. 7. 8. 9 10 Indemni All claims or suits for alleged ' ror or mi:- civil malpractice, er take, for which our contract holder, 's sued whether Or his estate 1 , the act or omission was his own Or that of any other person fnot necessarily un assistant or agentl All such claims arising in suits involving the collection of pro- fessional fees, All claims arising in autopsies, inquests and in the prescribing and handling of drugs and medicines. Defense through the court of nd until all legal last resort a remedies are exhaustsd. Without limit as to amount ex- pended. You have a voice in the selec- tion of local counsel. If we lose, we pay to amount specified, in addition to the unlimited defense. The only contract containing 'ove features and all the an which is protection per sc. A Sample Upon Request We Lead Q-ecause We Specialize Cnly organization its contract who enter Federal Service, a giving holders litary Extension Mi rm of their to the te professional pro- tective contract for heir the period of t military service. ORIGINA T ORS lle I KAIPROTKTIVI COMP 7 ft.Wayne,h1diana. 'X IMPROVERS V i,i ' Professional Mm! I Protechonbcclusivel V e f'W ' '-'fi ll ' 'I' DEVELOPERS IXQI 1 Perfect Ci are K X Ivlade A 52 Sizes Cn Sale at Camp Exchange IVIQTC. American Bead Co. INC. Manufacturers Chlorinated Lime in Glass Tubes and other Medical Essentials American Bead Co., Inc Fifth Ave. at 41st, New York Opposite New York Library I uriel Cigars Bedding Rolls, Folding Cots, Folding Chairs, Collapsible Buckets and Pans, Mirrors and like Furniture suited for the Comfort of Military Men PHONE 106 MANHATTAN, KANSAS 304 PoYNTz AVE. Mild and Fragrant David Chalmers Tobacco Co. 724 Main Street KANSAS CITY, MO. SOLE AGENTS Columbia Overgaiter 81 Legging Co. 800 So. Sibley St., CI-IICAGO, ILLINOIS Makers of Leggings ALL KINDS TO Ri:cuPERAr1a- Roswell, New Mexico I-las The Climate and Altitude 3600 Feet High Address HEALTH COMMITTEE Roswell, New Mexico J. Sklar Manufacturing Company MANUFACTURERS OF Surgical Instruments WHOLESALE ONLY OYD STREET BROOKLYN. N. Y. T 4 1 3 Q5- THE IKAISER ST. L S WICHITA FT. SCOTT GREENFIELD CLOTHING COMPANY ON THE. ZONE CAMP F UNSTON KANSAS l Compliments of l ITE BISCUIT CC. Snow White Bakeries l::l Guaranteed Quality Products: Crackers, Biscuit, Wafers Cakes and Cookies l Clinton - Oklahoma City - Omaha A Policy Patriotic-H We believe the war is the first job for us all to do. Win this war. The strong and sturdy are necessary at the front. Their tasks at home must be cared for by the weaker ones. Oar endeavor is to teach the weaker ones how to get stronger that they may do their bit at home. The Diabetic would, if allowed, live on nothing but the cereal foods and sugars, thus robbing his comrades at the front fighting his battle. Oar endeavor is to teach the Diabetic to eat what is best for him and sacrifice for those noble boys in the battle storm. I We are having success. The war will be won by the true American Spirit. , X WILL - TO - WIN ,f Save, Substitute, Sacrifice ,X WE A RE FOR THA T ,X X !f Sign and X TCIUFII Manufacturers of X for generous Hepw HEALTH PRODUCTS CQ. f Sample Helm Flour Diabetic Flour , isis SPRING AVENUE ' ' WIS., U. S. X Nami! .........,,,,..........,............,.. . Approved by A. M. A. f f Address ,,...... Greetings M.O.T. C. THE S. E. LUX, JR., IVIERCANTILE COMPANY WHOLESALE JUNCTION CITY, KANSAS ARMY CITY, KANSAS -- Are Leaders in -i- High Grade Groceri Oranges, Lemons, Grape Fruit, Bananas, Apples. Peaches, Pears, Plums, Grapes. All Fruits in Season Fresh Vegetables for tempting clinners always In stock. We are car lot buyers of Potatoes, Cabbage and all root Vegetables. COURTEOUS TREATMENT - QUICK SERVICE - BEST PRICES OFFICE AND WAREHOUSE. JUNCTION ,CITY - - - KANSAS Phone 218-324 WAREHOUSE ARMY CITY - - - KANSAS Phone 344-Funston Exchange Q .-4l' '-I l li. 'mil , PET re E VA P O R AT E D flu on I MILK Satisfies Consum ers MANUFACTURED BY THE HELVETIA MILK CONDENSING COMPANY HIGHLAND, ILL. CLINICAL ANALYTICAL CHICAGO LABORATORY 25 E. WASHINGTON STREET CHICAGO Organized in 1904 to assist physicians in making their diagnoses. Accuracy and promptness are its chief aims. Equipped to perform all types of laboratory work for physicians. In every Wassermann Test both the Wassermann and Noguchi systems are employed. In the preparation of autogenous vaccines both aerobic and anaerobic cultures are prepared. Urinalyses are both chemical and micro- scopical. Upon request of the physician we furnish mounted sec- tions of tissues upon which our reports are made. Upon application sterlized containers for specimens and Fee Table of examinations will be forwarded by mail. Reports are sent by mail, telegraph or telephone, as requested. Ralph W. Webster, M.D., Ph.D., M.R.C., Director Chemical Dept. Thomas L. Dagg, M.D., M.R.C., Director Pathological Dept. C. Churchill Croy, M.D., Director Bacteriological Dept. We BARTELL HOUSE . Coryell G? Ransdell Rates 32.75 to 53.50 per Day Telephone Connections in Every Room HEADQUARTERS FOR MEDICAL OFFICERS JUNCTION CITY KANSAS K 'L x I sis lb 1927 aw. '57 J S X ., 9 2 A Q9 : xi .x ---mmul' 'qw' f ' 'llIlllllwlnuwluliq 1 luIullIlIl' THE FIRST SHOT OF THE XXIAIQ, Details of Militar Medical dministration A compendium of information gathered from many sources, both at home and abroad, and bringing together in one book Valuable information scattered through many official pub- lications of the Army, Navy and Public Health Service. It includes illustrative copies of blank forms properly filled out, which will be found of great and immediate service. The regulations, orders, etc., illustrate the mechanism of adminis- tration, the methods of ofiicial procedure and the ends they seek to obtain. By JOSEPH H. FORD, B.S., A.M., M.D., Colonel, Medical Corps, U. S. Army Published with Approval of Surgeon General, U. S. Army With 30 Text Figures, Appendix, Many Specimen Forms and h Reference Tables. Cloth, 55.00 Other Medical Officer Helps SURGERY IN WAR. By MAJOR A. J. HULL, R.A.M.C. Surgeon, British Expeditionary Forces. Preface by Sir Alfred Keogh, K.C.B., M.D. Illustrated. Cloth . 54.00 sAN1TA'r1oN IN WAR. By MAJOR P. s. LELEAN.gl 1 R.A.M.C. Introduction by Sir Alfred Keogh. 2d edition. I 'rel Illustrated. Cloth ....... 2.00 A SHORT ACCOUNT OF EXPLOSIVES. By A. MAR- SHALL, A.C.G.I., Chemical Inspector British Ordnance. Illustrated. Cloth ....... 1.50 SURGICAL NURSING IN WAR. By ELIZABETH R. BUNDY, M.D. Illustrated. Cloth .... .75 PULMONARY TUBERCULOSIS. By W. M. CROFTON, M.D., Temp. Capt., R.A.M.C. Illustrated. Cloth . 1.50 NAVAL HYGIENE. By JAMES D. GATEWOOD, U. S. Naval Medical School. Illustrated. Cloth . . 6.00 WAR-SI-IOCK. By M. D. EDER, Temp. Capt., R.A.M.C. Cloth ......... 1.75 EPITOME OF MENTAL DISORDERS. By E. F. BAL- LARD, Capt., R.A.M.C. Cloth .... 2.25 MEDICAL SERVICE IN CAMPAIGN. By MAJOR PAUL E. STRAUB, Medical Corps, General Staff, U. S. Army. 2d edition. Illustrated. Flexible leather . . . 1.50 FIELD I-IYGIENE AND SANITATION. By COLONEL JOSEPH H. FORD, A.M., M.D. Illustrated. Cloth . 1.50 DIAGOSTIIC METHODS. By RALPH W. WEBSTER, M.D. 5th Edition. 208 Illustrations. 37 Colored Plates. Cloth 5.00 P. Blakiston's Son 85 Co., Publishers 1012 Walnut Street, PHILADELPHIA THE WARRING WORLD WANTS OIL I-Ie who adds a single barrel to the World's daily production strengthens the arm of Democracy against the Powers of Vandalism and Oppression We MAKE the machines that DRILL the wells That PRODUCE the oil that the WORLD needs OIL WELL SUPPLY CO. General Offices-PITTSBURGH, U. S. A. N Y k L Agl s F T p L cl STORY STUDIO -'- I POST OFFICE BUILDING JUNCTION CITY, KANSAS ,F J B sure and visit our Studio I 'X' ' C our work- Investigate our Service HA B 4 U-By M I Go To C I Before Buying J. M. Cooper Jack Thomas K ' 'yr-. 'Q X fi XXX, iQQQ,Xw I SX Xkgsx N x iff, -I X ' , X C D. D. Tailors oozd and Silver X 1 A.,.. ,,,.,,. xxjxx N 21 1 N s I G N 1 A X, wi For Ladies q?Z3'I'2M59 97 RB Dr Cleanin . -.X-SQA, xx if 'pix-4 7' 'fy-,E -- J- i5,TQiIf'Mf2Zr' ' y g ,. N, Ns, ak.. I yn J, ,f I. . 'I f I f 319' X' w, Pressing MILITARY WRIST 3.5.gvi X T . . WATCHES XXX kg ailoring DIA M 0 N D s f ,szgfzk A N N is X xt 'UA gf XX ,L , , X, ,nf wx ,X X Q, NNW X Experience has taught us Call and be convinced 'Qte-tghxm 1 how to do tailoring P P X4 'I , g correctly EXPERT WATCH WORK 'k g gt:-,- Nt'QV ' '4L?'sF-5 ,wi I-ge t H, :A ,,,, f W.--M, ,YW ef--We WW I is of ,lf-A .. iles . gl VLH- as .f v-'Qlilil gl !!- I in J ,f' 2 align f ij X 1 ill! L, 'A .4 5 ff l,1 ,j,'4,,, ff alter Starcke f 1 Q2 if 114 W. 7th Sr. Phone 227 Established 34 Years -7 ,pf J I K Junction City, Kansas .12iil'1'ie took Mothers advice Unctlon IW ' 39533 MILITARY BOOKS, MILITARY SUPPLIES Text Books for Military Students, Fine Stationery, Fountain Pens Office Supplies Special atte ' ' ntlon given to filling orders for Rubber Stamps of all kinds, Fine Engravl ing for Officers, Calling Cards and Nice Stationery. BOOKS MAGAZINES LOOSE LEAF BOOKS SPALDING ATHLETIC SUPPLIES HEADQUARTERS FOR MILITARY MEN I TROTTS BOOK STORE, Junction City, Kansas The B. Rockwell Mdse. CH, Grain Co. JUNCTION CITY, KANSAS ur Spring Exposition Emphasizing the Supremacy in Style of This Store A Showing of Authentic Styles in Apparel and Dress Accessories Women's Suits, Coats, Skirts, Blouses, Lingerie, Footwear, Furs, Silks, Wash Goods, Neckwear, T Gloves, Hosiery, Dress Goods. Style in dress is as essential to women as business is to man. It is an instinct that has as its base a love for the beautiful in color and form. It refines, and reveals character and personality. Our display meets every requirement of the lover of the good and beautiful in women's apparel. Quality and Service have Their Home in This Store Our Basement Department is a busy place. If it's an article for the kitchen, dining room or parlor. Our Basement Has lt. The B. Rockwell Mdse. CS, Grain Co Variety of Flavors and Prices ' There are times in one's life when only the best is good enough. a Those are the times when ou should bu Vassar Chocolates De I V, 9 q y y ' Luxe-'exquisite confections of indescribable goodness in pack- Sgga ' ages of rare beauty and refinement. ti 'n 'z' n to 'hai . SA 560 aolaTes - 5 Ioo GDM FfA NY P-ff l K? fl. . at C . 3 Q 4'JI, , W7 I ., ,fs .I P N! X g '31, ,AW19 0 0 ,v0.:': blow . N ' V 9 A I , 'lie' J Wifg' ai' S l colnws h w e tfishesmg.efiieg252211244e33jiyZ2?5jf3ff-za: -. t ' 'mi P'P'T'e1- s fair E7 ' 1 fflii A weaffh of unuua to ef flavorsxnelted to Q sfr4Qf',L if , P1 -E , 'l f WaL4'fi5?lill'l,9xb l vl ' 5: ,... ...., mil' Ankuilm-F CfQymNl?'Qq?'y s- tl I 7.-,J 1 :'l' S 1 ile P i1i,:1 .t - f -eaiiefli evaae '- i tt A3 -an it l 14 f k lllllll V llllllllllllllllllllllllllllllllllllll lllllll llllllllllllllll . li A POPULAR PLACE TO EAT IS . The Universal Store ' 818 North Washington St. Junction City, Kans. ThGld BlCf G fff'f fh 9 0 en 3 t 51 9 503323 Iggy? 3.521 355.-ufifllifi DRESS for civilians. Up-to-the-minute line of 132 West Seventh Street Gent's Furnishings- A full line of Dlry Goods and Ladies' phone 402 Furnishings--strictly up-to-date. We treat you courteous and give you full value for your money. Give us a trial Owned and Managed and be convinced. Exclusively by Women JUNcT1oN c1rY,KA1vs. E. C. FERREE, Manager Peter Kachavos Telephone 513 The Palace Barber Shop J. 'N Qffers you all the latest Sanitary Scien- tific Methods, and bears Government Inspection. Shining Parlor Eight Chairs---Eight Expert Workmen- Clean Hot and Cold Cloths on each and every customer. Hats Cleaned and Blocked V Best Service in City-Professional Manicurist-Shining Parlor. A ll Work Guaranteed 603 North Washington St. Junction City, Kans. A. R. SOHNS, Prop. Junction City, K ans Garage AMBUILAN CCE for Largest in QC 'UMDAN UE S i f rf, Soldiers the State it ' Chevrolet and L I .-l Oakland Automobiles It - I-I X g 4 If x. Everything for the an s 41592 Auto ' I r X f ' - '- I it T it , , , AMO Llvefy ln f N .. . , f- - . --'. V - ll I Abe Levy ish-f!ififf.e11fifp,i.f.'f'17'i'?f1-'nf f: lxlu' E 1:1'- 'T 'E .- ' '14 --TT . -. , , gt ,-.4 I 1 108 W. oth Sf. f .2711-, Q. 5 'Y'-:won . . H. H. WETZIG, Owner E T Q , Nia' f 2'Q 'ff, HOW JUNCTION CITY, KANSAS unc lon I y, ansas DR. ES SA ITARI so MINUTES FROM NEW YORK CITY STAMFORD, CONN. TELEPHONE 1867 A Private Sanitarium for Mental and Nervous Diseases. Also Cases of General Invalidism. Separate Department for Cases of Inebriety. The buildings are modern, situated in spacious and attractive grounds, commanding superb views of Long Island .Sound and the surrounding hill country. The accommodations, table, attendance, nursing and all appointments are first-class in every respect. The purpose of the institution is to give proper med- ical care and the special attention neededgfinifeach lindividual case. For terms and illustrated booklet, address F. H . BAR N ES, M. D., Medical Superintendent, Stamford, Connecticut E T CRACKER JACK he Famous Foo onfection There are many reasons for eating Cracker Jack, but none is more vital from the medical man's standpoint than the fact that it has REAL FOOD VALUE. In actual calories Cracker Jack has five times the food value of potatoes and IM as much as sirloin steak. Cracker Jack is a well-balanced food, and its consumption should be greatly increased, not only because it contains important food constituents but also because its use saves sugar and wheat. Cracker Jack is made Caccording to the formula given belowj from selected popcorn and roasted peanuts covered with delicious molasses candy, untouched by human hands in the process of manu- facture. It is high in protein and carbohydrates and easily digested. Graeker Jack THE FAMOUS FOOD CONFECTION The More You Eat--The More You Xvantii Because Cracker Jack contains the entire kernel of corn, it furnishes the rougl1age doctors recognize to be essential to health. Soldiers in cantonments and in the trenches, children at home and at school, busy men and women in factories, offices and homes all enjoy Cracker Jack because it is delicious, satisfying and wholesome. Be sure to get the genuine Cracker Jack. Look for the blue and red circles and the name Cracker Jack printed diagonally across front of package. Cracker Jack is put up in patented wax-sealed packages which keep its contents clean, crisp and Wholesome. Price now six cents per package. RUECKHEIM BROS. Ed ECKSTEIN ESTABLISHED, CHICAGO. 1872 originators and Exclusive Makers of Cracker Jack The Famous Food Confection Cracker Jack is made accord- n . Be sure to get the genuine ing to this average yearly for- mula: El Cracker Jack. Look for the 'kgane Sugar . , 18,7 347 1-Q3-'l blue and red circles and the 1VFCfE1Si2,,5L?1B,152i:inuD' Pi name Cracker Jack printed Popcorn . . . 25. 498 K'-Q Peanuts . . 12.4 376 Cornn Oil . .9 46 age. Cracker Jack is put up Moisture ' ' -,- in patented wax-sealed pack- wow? ages which keep its contents F I . c l clean, crisp, and wholesome. exe? Winter' More In Sum- H n Price now six cents per package. Price N ow Ge Eb!-E1 5 'Q 5 me ' n at . '4 O ,A E A 9 5 Q x ZZ X PS Q 4 4,1 O , fi iw i. P we i 2: 1 - X sh Z i Zr: , wx. . E K U . 1' fffC i?.v,, faq? . X w R . 1492334 1 1, ii W ' 9: ,D -O ,X h . EZ w 0 ,' s--Hifiiss 'li O f diffs.. f - . i Q S ' X '- , .. ,Vg at l ' - 2 ga f Q Xi, E a sp-Fw ' wnmmxxlxsms iX RYLKXYXR umunemmmf Q De E.: . Sl-1 UQ Q v-J 2 K? SD Q 6 CD CD C' Q r-J f-f O v-+1 'O SD 0 F 0 1 dl 5 PI'iCSi Now 6c Made to Measure UHILOTHIS and Regulatlon Equlpfnent Manufacturers of the new Liberty Belts. Service Caps. Campaign Hats. Puttee Leggings. Rank ancl Departmental Insignia, Trunlc Loclcers, and all Regulation Equipments for Fielcl Service CATALOG ON REQUEST OF FAMOUS LILLEY GOODS Visit our store in charge oi Mr. Earl E. Fawcett, the ARCADE, Camp Fungtgn Mr. Fawcett has hacl ten years' experience in Military worlc ancl can take care of your requirementg WESTERN OFFICE AND SALESROOMS - 319 WEST 9TH STREET. KANSAS CITY. MISSOURI Wie M. C. Lilley Ee? Co. The C3'.1ff,fff, f-1Zffl55'a'y omfort From eaci to oot Shave with Williams' A iff e COLUMBUS. OHIO X V Smooth clown the rub of rough A Q.-. garments and .. . IIE Vfllidw Shaving 'hoe' with sw!- L i55iifi5' 55f?iei:5?iEEs 5 Williams' f p ill if Shaving fgfrealx Cream Tale powder H ol d e r top :jg is 'N Lili :.. ,.,.a ,pa-mf. Powder I.g,,,,. ...J Shaving Sticlc ' Q H ' Brush your teeth with tWilliams Dental Cream. ALL ARE PUT UP IN CONVENIENT FORM FOR CAMP SERVICE Williams' Toilet Soaps and.. after shaving. a touch of English Lilac Toilet Water or Aqua Velva. the clelightiul aft lx ' l ' ' ' er s avmg otion, will remind you of the luxu PREPARED BY THE 1.13. WILLI GLASTONBURY, coNN., U. s. A. riesofhome. A M S' C OM PA N Y illiam Wood QQ Company Publishers of Standard Medical Books Including many used by the United States Army and Navy Medical Departments The Medical Publishing House of William Wood 8: Co. was founded in 1804 by Samuel Wood, and through several generations of the same family lit has been conserva- tively managed, always keeping in View the best interests of the medical profession. As might be expected of a house that has grown up with the country, ever alive to changing conditions, the supplying of the needs of Army Medical men at this time has been a matter of careful study and extensive elimination of more or less superfluous literature. The following titles are offered for the consideration of those interested in the Medical Services as embodying the latest knowledge based on practical experience. MANUAL OF MILITARY HYGIENE. For the Military Services of the United States. By Colonel Valery Havard, U. S. Army Medical Corps, retired. Third Revised Edition. Octavo, 833 pages, illustrated by seven full page plates and 245 engravings. Flex. Muslin. Net ......................,................................,..........,... 35.00 GUNSHOT INJURIES. How They are Inflicted, Their Complications and Treat- ment. By Col. Louis A. LaGarde, U. S. Army Med. Corps, retired. Second Edition, Revised. Octavo, 469 pages, illustrated by 160 engravings, charts and tables. Extra Muslin. Net ..............,......................,....,................................................. 4.00 A COMPLETE HANDBOOK for The Sanitary Troops of the U. S. Army and Navy and National Guard and Naval Militia. By Colonel Charles Field Mason, U. S. Army Med. Corps. .Fourth Edition, Revised. Octavo, 513 pages, profusely illus- trated. Flex. Muslin. Net ........,...,.............................,..,......................................,....... 4.00 INJURIES OF THE FACE AND JAW and Their Repair, and The Treatment of Fractured Jaws. By P. Martinier and Dr. G. Lemerle. Translated by H. Lawson.Whale, F.R.C.S., Capt. R.A.M.C. 12 mo. 365 pages with 168 illustrations. Muslin. Net ............,................,.............................,.,.............................. 1 .75 NERVE WOUNDS. Symptomatology of Peripheral Nerve Lesions Caused by War Wounds. By J. Tinel. Translated by Fred Rothwell, Lond. Revised and edited .by Cecil A. Joll, F.R.C.S. Post Octave, 329 pages, illustrated by 323 engravings. Muslin. Net ..........,.....,.,.............,......,...........................,.......................... 4.50 FIELD SERVICE NOTES FOR THE R.A.M.C. By General T. H. Goodwin, R.A. M.C. Board covers. Net ....,.,.,.,.,,,,..,,,,.,,,,,,,,,,,.,..,.,,,,,,,,,,,,,,,,,,.,,,,,,,,,.,.,,,,,,,,,,,,,,,,,,.,,,, 1,00 WOUND INFECTIONS and Some New Methods for the Study of the Various Factors which come into consideration in Their Treatment. By Col. Sir Almroth E. Wright, M.D., F.R.S. 12 mo. illustrated. Muslin. Net ..........,.................,..... 1.00 FIRST AID TO THE INJURED AND SICK. An Advanced Ambulance Hand- book. By J. Warwick, M.B., M.R.C.S., and A. C. Tunstall, M.D., F.R.C.S. Tenth Edition, 140th Thousand, 16 mo. 260 pages, illustrated by 300 engravings. Board covers. Net .................................................,.,,........,......,.............,.....,..........,., 80 cents PHYSICAL REMEDIES FOR DISABLED SOLDIERS. By R. Fortescue Fox, 12 mo. 293 pages, with numerous illustrations and 2 colored plates. Muslin. 9 ..-.---.-...---..... ......................................................................,.........,................................................... 2 .75 THE FUTURE OF Tl-IE DISABLED SOLDIER. ByC.W. Hutt, M.A., M.D., D.P.H. Temporary Lieut. R.A.M.C. 12 mo. 211 pages, illustrated. Muslin. Net ............ 2.00 The Publishers will be pleased to mail catalogues and circulars of these and books on allied topics. Correspondence solicited. William Wood and Company 51 Fifth Avenue, NEW YORK The Soldier Needs Powder-Besides Gunpowder EXIGENCIES of camp life produce many minor discomforts such as skin irritation, chafing, blisters, saddle galls, sore feet, burns, insect bites, cuts, abrasions, hives, etc., for which the right kind of dusting or dressing powder is needed. KORA-KONIA fills the bill and is dependable. KORA-KON IA is Comfort Insurance. KORA-KONIA is soothing, healing, protective, made for doctors' use and consequently better than a mere toilet powder. Tell the folks back home to send you a package of KORA- KONIA-ask for it at the camp canteen, or Write for a sample to NEwARK,N.J. THE HOUSE OF MENNEN NEwARK,N.J. l enum. um-on :enum TRUCKS Over There the GMC Trucks go faithfully back and forth on their errand of mercy, manned by our I if ' brave boys. In .America GMC Trucks are performing good service in helping to Win the war by aiding greatly 1n solvmg the transportatlon problems. For commercial purposes they are made in all practical SIZCS -from M to 5 ton capacity. General Motors Truck Company PONTIAC, MICH. Knostman Clothing Compan 2 STORES Manhattan, Kan.-Junction City, Kan. GREATEST OUTFITTERS IN CENTRAL KANSAS Kuppenheimer and Society Brand U IFORNIS In Stock or Made to Measure SELLING UNIFORMS AT POPULAR PRICES Every Medical Officer Should Know of O R O T O And its Value in Neurasthenia Resulting from SHELL SHOCK An oiiicer of the British Royal Army Medical Corps reports: I have had five cases on Hormo- tone. They were all neurasthenics who had been at the front and returned wounded. Their wounds were all healed but the effects of the shock were still very prominent. All suifered from tachy- cardia, muscular tremor, depression and insomnia. Two of these cases were discharged within a fortnight, 'fit for service.' The others are im- proving more slowly, but on the whole I con- sider Hormotone a most valuable addition to our armamentarium, especially in View of the fact that all these cases had been in hospital for weeks-some of them for months-without any perceptible improvement. Other reports from army physicians are equally favorable. Literature on Request G. W. CARNRICK CO. 23-27 Sullivan St. NEW YORK WE ARE WHOLESALERS, EXPORTERS, IMPORTERS AND MANUFACTURERS Laboratory Apparatus and Supplies Our stock represents a complete assortment of these goods and also Glassware, Microscopzfcal Dry Stains and Solutions, as well as Chemicals and Rzagents. Special facilities enable us to offer prompt and reliable service under experts' supervision. From the following List, please designate the literature you desire to receive. BACTERIOLOGICAL CATALOG SUPPLEMENTS : 80-Coagulometer Biffi Brooks 81-Micro Lam Radio 97-Znd. Ed.-lglei Centrifu e, Model 15 98-Micro Saccharimeter, A. A. Epstein 103-Paraffine, Purified and Filtered. in Pound Cakes 104-Universal Micro Colorimeter, Kuttner-L.citz 105a-Haemometer, Sahli-Leitz, with Permanent Color Standard N 108-E1eiStrainin Support, ''Rabinowitsch-Kempncru 120-Znd Ed.-Laliuoratory Porcelain Ware 122-Thelco Electric Ineubators 123-Colorimeter, Myers-Leitz 126-Stokes Water Stills 127-Ineubators for Low Temperature 128-Electric Dr ing Ovens -Leitz BloodyCounting Apparatus and Accessories -Colorimeter. Duboscq-Leitz 131 133 141-Chicago Surgical and Electrical Company's Catalog 142 143 144 145 - Pyrex Glassware 134 134a- Record Syringes 135 - Luer Syringes 136-Micro Slides. Cover Glasses and Slide Boxes 137-Autoclaves. Sterilizers and Wassermann Water Baths 138-Diagnostic and Clinical Microtomes for Paraffine and Frozen Sections, of Hand-Feed and Automatic-Feed Pattern. 139- Parlodion, Substitute for Celloidin 140- C. S. 82 E. Products-Electric Ineubators, Sterilizers etc. -Elei Filter Paper and Others - Victor Laboratory Centrifuges -Oil-Heated Ineubators -Microscopical Dry Stains New York 30 East 18th st. McCaskey Doctors' System A Business Method Applied to a Professional Requirement THE MASTER SECRETARY COne of the several different styles and designsj CASE RECORDS ONE WRITING ACCOUNT KEEPING The McCaskey System of Account and Case Record Keeping is a ONE WRITING METHOD, that replaces the Old Round-abouti' way of doing things with short cuts, and to overcome many of the problems in the business and professional side of the busy Doctor's life, at a saving of time, money and labor. CASE RECORDS V The system is a series of forms and charts for recording the results of the examina- tion, treatment and the charge for each service, with ONE WRITING, whether the patient is seen at the office, bedside or hospital. It is a better and easier method of Record and Account Keeping than is practiced by the Doctor today. It brings himiingcloser touch with his patients. ACCESSIBILITY TO RECORDS Each cabinet is equipped with one or more sections of Metal Visible Files, alphabeti- cally indexed, assembled on a pivot in a balanced position. When pyramided, the name of the patient and the total amount he owes is brought into view for instant reference. Each patient has a separate filing compartment in the Metal Visible Files, which is an ex- clusive feature of the McCaskey System. ONE WRITING The record is completed at the time the patient is seen, doing away entirely with books and book-keeping,-accounts always posted to date-no forgotten charges-no forgotten calls-stops the danger of trusting to memory-secures better fees-increases collections. Write for full information regarding a McCaskey System for your individual practice. THE MCCASKEY REGISTER COMPANY Professional Division ALLIANCE, OHIO r. Soldier Man! There is nothing like a good meal---real service and a little music to cheer you up when you are blue. You can get all of these at The Arbor Cafe Everything from a Soda to a j u i ey S t e a k When in junction City pay us a vis't W. C. Dumm Furniture Company JUNCTION CITY :-: KANSAS Headquarters for Cold Medal Camp Furniture. Bed Roll. Mattresses in Many Grades. Edison, Columbia and Sonora Phonographs. Visit our store. 709 and 711 Wash. St. The Quality Store Has your uniform ready to put on. We have a complete stock of Nlilitary Uniforms and accessories. We have scoured the eastern markets for the best military merchandise to be had and believe we have found same. And while we give you first class mer- chandise, yet We do not charge high prices. We make Military Boots to order. The Quality Bootrie and Clothes Shop VAN LEEUWEN BROS., Prop., Junction City, Kans. OUR TAILOR ING Our sort of tailoring is the sort that makes friends. If we make you a uniform once, we're sure to do it a second time. Our cutter and tailors are the most skillful military workmen. NO GUESS WORK HERE Our customers are our best advertisement. Our prices are as low as the class of work we turn out will permit. We have a full stock of Serges, Whipcords, Gabardine and khaki on hand from which to make a selection. Ask the best dressed Officers you meet at Riley Where they have their uniforms made, then come Where they direct you to Le Fils SZ Anderson U Military Tailor At the Quality Bootrie and Clothes Shop junction City, Kansas l0I1T l:0R 0lD GLURY Ridenour-Baker Grocery Co. KANSAS CITY, MO. 'GWB CENTRAL NATION AL BANK JUNCTION CITY, KANSAS TI-IE LARGEST BANK ADJOINING PORT RILEY AND CAMP FUNSTON Resources over 3S1,750,000.00 A. D. JELLISON, President I-I. W. JACOBS, V1cE-PRES. If. A. DURAND, CASIIIER M. S. COOLBAUCI-I, VICE-PRES. W. S. PI-IILLIPS, Asst. CASHIE WALLIS D. WILSON, VICE-PRES. Ii. W. ROLFS, Assn: CASIIIEI Accounts of Army Officers and Privates Appreciated 812 N. WASHINGTON ST. J ti Cit r. em. . az ey WON' 3- GABLES SANA TOR I UM Telephone SHHIIHTY Complete in tlme cletails of Location, Equipment, Departmental Methods Cash ancl Professional Management. Market LINCOLN - - - NEBRASKA Quality , QOUYMOUO AHPBELL FOR SERVICE CAPITAL : A IC E WALTEROWEQCKWELL ALWAYS COMMAND ATTENT1oN H. The boys at Fort Riley Mlllllel' Eat ancl Enjoy tlmem . I All Telephones in Post JUNCTION CITY. KANSAS THE CAMPBELL BAKING COMPANY KANSAS crrv Connected I A RTI FICIAL LIM S Pomeroy Service To advise what foot and socket will suit the requirements-we make every style, so can give unpreJud1ced advice. To use tested and seasoned materials so that the durability of a POMEROY can be depended upon. To render expert personal fittings, designing, and building up each leg for the individual so that it is perfected for his own use and service. To continue our interest and service after the limb has been finished and delivered. It is essential to us as Well as to you that the result should give complete and permanent satisfaction. Trusses, Corsets, Elastic Stockings, Supporting Belts Orthopedic Appliances, Artificial Limbs POMEROY COMPANY 16 East 42nd Street NEW YORK CITY SHOPS AND FITTING ROOMS IN TI-IE FOLLOWING CITIES: 25 E. Washington St., CHICAGO 208 Livingston St., BROOKLYN 41 West St., BOSTON 825 Broad St., NEWARK 340 Bridge St., SPRINGFIELD 38 Adams Ave., W. DETROIT Loruzeng CHLORAZENE, Dakin's New Synthetic Antiseptic, has met with remarkable success in hospital work, in war surgery and in general practice. The physician or surgeon who has not yet used CHLORAZENE should avail himself at once of this remarkable product which is replacing with splendid results other less powerful and far more toxic and caustic antiseptics. CHLORAZENE can be used in greater strength than the hypochlorite solu- tions and is far less irritating. Its convenience in tablet form for immediate use is a great advantage. . PARRESINE, the improved wax dressing for burns, is very similar to the famous French product which has been used so successfully in the war hospitals of Europe and is making many friends among hospital and industrial surgeons in this country. The remarkable facility with which extensive burns heal under this dressing and the prompt relief from pain which it affords, has put PARRESINE in the front rank of emergency remedies. Both CHLORAZENE and PARRESINE have been passed by the Council on Phar- macy and Chemistry of the American Medical Association and have been ordered by the United States Navy to be placed on every ship. DICHLORAMINE-T, Dakin's oil soluble antiseptic, is usable in concentrations twenty to forty times as strong as hypochlorite solutions. Twelve hundred cases of war wounds treated in France with DICHLORAIVIINE-T, with 99.572, recoveries and no secon- dary hemorrhages, were reported at the recent Clinical Congress of Surgeons. CHLORCOSANE, Dakinis single solvent for DICHLORAIVIINE-T, is now ready. HALAZONE, the new Dakin-Dunham water sterilization tablet, is admirably suited for Army use. Send for literature and prices on these useful war products. THE ABBOTT LABORATORIES Home Office and Laboratories, CHICAGO, ILL. NEW YORK SEATTLE SAN FRANCISCO LOS ANGELES TORONTO BOMBAY HEA UART REST COTTAGE College Hill, Cincinnati, Ohio For Purely Nervous Cases, Nutritional Errors and Conval- esccnts. A homelike building of stone and concrete, with delightful surroundings. Rooms single or ensuite Private Bnthe-Solaria. Completely equipped for Hydfmlhfmpy. Massage, etc. Cuisine to meet individual needs. F. W. Langdon, M. D., Medical Director. Chas. B. Rogers, M. D., Resident Physician. For information address, REST COTTAGE, H. P. Collins, Business Mgr. COLLEGE HILL - - CINCINNATI, OHIO BRIGHAM HALL CANANDAIGUA, N. Y. Established in 1855 A Hospital for Mental and Nervous Diseases Licensed by the New York State Hospital Commission Voluntary Patients Received ROBERT G. COOK, M. D., Physician in Charge Enclosed and Open Cars Day and Night Service Donmyer Taxi and Livery Service MEET ALL TRAINS We Can Furnish Cars When Other People Cannot Funerals, Parties and Weddings a Specialty Phone 30 JUNCTION CITY Opposite the Park DICK FOIL'S GOOD EATS CAFE Rooms, Hot and Cold Running Water -81.00 607 Washington St. Junction City, Kansas Miller Bros. fThe Accommodating Druggistsj Old and Reliable at this business with everything up-to-the-minute GIVE US A TRIAL Corner 7th 8: Washington Street JUNCTION CITY. KANSAS Visit The Busy Bee Candy Kitchen for , Home Made Candies and Ice Cream JUNCTION CITY, KANSAS The S. E. Lux, Jr., Mercantile Company Junction City, Kansas Army City, Kansas WHCLESALE GROCERS Fruits, Vegetables and Produce Quick Service Deliveries made all through the day J to any point in the Camp We are Straight Car Lot Buyers, and handle only Groceries and Fruits of Quality Phones 218 and 324 Junction City Office 344 Funston Exchange, Army City, Warehouse When you want good Shoe Repairing call at the U. S. Shoe Shop I served lo years in the U. S. Army and will ap- preciate the ofhcers and enlisted men's patronage. I collect and deliver at Funston, Fort Riley and all parts of junction City. l2l W, 7th Street Phone 795 JAMES COUNTS, Prop. junction City, Kan. Horne- Made Candy Fresh Every Day ICE CREAM m as wi I1 PURE CREAM Orders for Parties a Specialty TELEPHONE YOUR ORDERS AND LET US DELIVER IT A. A. ai M. J. FLOWER junction City, Kan. Tel. 125. f I1 V :X X 1 nb M Thompsons' Smoke House junction City, Kan. 5 - IN-ONE 6 Chair Sanitary Barber Shop. Pool and Billiard Parlor. Cigars, Pipes, Tobacco s and Smokers' articles. Shoe Shining Parlor. Soda Fountain and Dolly Varden Chocolates on Ice. 703 N, Washington Street Phone No. 742 f ,SI S Z 5 sr af : ? 4'3- Z Z? r I 2 f M 111 ,,.Q ggxeii JJ . 2' FZ F How mach do ou Wei II? GERALD L. KERR - SELLS AND REPAIRS AUTOMOBILE TIRES ZI6 W. 7th Phone 608 Junction City, Kansas SYLVESTER 82 NORTH FORD REPAIRINC- A SPECIALTY 216 W. 7th Phone 655 Junction City, Kansas BARTELL H O T E L BARBER S H O P and B A T H ROOMS Turkish, Tulo and Shower Service O. E. Schlatter Open Day and Night junction City - Kansas We invite you to make our store your Headquarters El CI LI For Fancy Fruit and Fancy Groceries III I I EI Kansas Cash Stores Co. junction City, Kan. Opp. Bartell House Phone 618 MISS Iillillmer SOPHIA BRQWN THE HOTEL RECENT L. VAN CUREN, Owner and Prop. SPOTS ON THE . . WESTERN High Class Goods at Popular PTICSS HEMISPHERE 114 W- Stl- Street Hotel I Regent Hotel Commercial Junction City, Kansas Clay Center, Kansas European Plan American Plan PHONE 123 81.00 Up 52.25 Up Freeman'S Restaurant 807 North Washington Street Opposite Central National Bank JUNCTION CITY, KAN. The Place to Eazv I . P . D U R B O N SOLDIERS' SUPPLIES Painting ancl Paper Hanging Wall Paper, Slxacles, ' Sth and Washington St. JUNCTION CITY, KANSAS of- wwf S124 wid aw QNX New Slay qiixow QBVIWQEVEO 'Wilmrnarnlllmmlllllrlnlr ullummmll III iwlllllllllzislrllllllitfnllll, p dbyth fthbt theUtd Sta f A T TUR Fon sau: BY LEAD1No PHARMACIBTS VLJHlllllIIIlllllllllgllllllllllwllllIUllI,.JlIllHllIlIlllllllIl..Jm'l K K ' 0 ' 31 I f Ano - - - - , I HIV llle Intravenous Products Company , ll W MANUFACTURING CHlU'1lS1s 'Every star in the Intravenous Coat-of-Arms represents a product that A A has been a prove ousands o e es physl 1 s 1 ni e 'c'an 'n I tes 0 mencalwm E Fon DESCRIPTIVE LITERA E 'I llllllllllllf Wi Gzahfe fo 111011 amor 1 F0 ODS At Your Grocer's TRADE MARK Gee ! It's great to get back to Home-and- X7 Fe JFFEE Mother and a cup of regular Coffee! ENSATION COFFEE 5 S is sold under a LEE guarantee 3 C in clean cans and cartons . . a Pound Ask Your Grocer. 80133 Illustration Actual Size Y 1 ' :fb ' No. 1540, 1 c. c. Complete in metal case, with two needles, ,..... 33.75 I I Q I P I I A L No. 1510, 1 c. c. Syringe only .................................,............................ 2.50 Real RECORD Syringes Made in U. S. A. by Tagliabue M X f i f You Benefit Yourseb' THE 1918 MODEL STANDARD 4 Tag-Roesch Sphygmo-Manometer War an Ask for a copy of our I ,ff if!!! Y . ' . A J 7 vf In I n M ' M- U A Mmm. A R X' up uw -2 -g 1, ' 45.0 r-t Y i , QA W, I it V v f . I Y bkb Ji., X ,. ' irv ' I , A , 4, - ,V 4, 0 if x ll A., l i U ff ff' fff, , , ' -, Z 1 X . . My , . f ' 'g k in H' I fffihvi' I Q 56 L f ' 1 . l 2 'ff - 3 ful Tas 111-vfrumenfs Of - in.. , . it' X . 'QM' 1 'Q , P.: I .X u v , oh f - 7 so q M on I' 4 0 X 'A . 1, A j J, 1 x 5' 0 ' 1 of Q ,C 1, Y f 'f W-ff: ' :if ' 1 , 2' , 'CSF ?lf2 f ' lg-35, 2 5 Elin -f ' .Surgical Catalogs on Clin- :,i:,LZ2,':i'z':.: 2:f,::,?5zz: A U 5 0 4 3 unusual merit. ff , C. J. Tagliabue Mfg. Co. Largest Independent Manufacturers 1- of Hypodermic Syringes, Tbermom- ' eten and Kindred Instruments. 18 to 88 Thirty-Third Street BROOKLYN, - NEW YORK CITY LQILLEY H. Smith Furniture Exchange P E N N E L L Russ. STOVES. ETC. MAKER OF New and Second Hanci 1' . 1 BeSfQualiw jlorlirads Lowest Prices Auction Goocls a Specialty The Furniture Man 914 N. Washington Street JUNCTION CITY, KANSAS Years of experiences with Military Men. See Our Portraits in this Book and See Us. D 'E take this opportunity oflbanking the mebical I-L1-I 'Granting Camp for past favors ano solicit your future patronage. - PENNELL'S STUDIO WATERS HARDWARE COMPANY SOIM N- Washington Sfmt Phone 34 Junetion City, Kansas JUNCTION CITY- KANSAS The C. E. Chase Electrical CO. ELECTRICAL SUPPLIES o Q1 I :af -I Af I 717 North JHUWSOH St- iv-'ZI,In1iE-Z cilfffl JUNCTION CITY, IQANSAS -:- PIIONE 433 Extension Cords, Shades, Reading Lamps Electric I-Ieaters, Flat Irons, Curling Irons Electric Stoves, Percolators, Mazda Lamps IAII Sizesj Wires and Fittings C. W. Flower, Jeweler Watches Diamonds Jewelry JUNCTION CITY. KANSAS 1 Ii 'E.L.KELLEY Corsage Bouquets-Designs Cut Flowers for all Occasions 4 If not convenient to call in person, telephone I44-your Order will re- ceive Our personal attention. Junction City Floral Company REEDS DRUG STORE for EASTIVIAN KODAKS AND SUPPLIES A Complete Stock Of Drugs and Druggists Sundries You'II enjoy a Refreshing Drink from our New Fountain BURT SI-IUEIVIAKER, Manager JUNCTION CITY, IQANSAS Right on the Car Line Phone I6 O22 North Washington sn-een Eat- Where do you eat? I eat at the Purity Bakery Good Cojee, Good Service, Clean The very best of all kinds of Bakery Coodsfor sale Rooms to Rent 822 N. Washington Street W. H. TOLLES, Prop. -:- Phone 381 SEE FRANK TRDTT For Choice Laundry Work Omcers' Work a Specialty The C. Frank Trott Laundry JUNCTION CITY, IQANSAS I I3 East Sixth Street V Telephone NO, 6 CENTRAL NATIONAL BANK THE LARGEST BANK ADJOINING FORT RILEY AND CAMP EUNSTON Resources over flbl 750 000.00 A D JELLISON President H W JACOBS V1cEI RLS F. A. DURAND, CASHIER lvl S COOLBAUGH Vlcl: PRES W. S. PHILLIPS, Assr. CAS!-IIER WALLIS D WILSON VICE PRES E. W. ROLFS, Ass'r.CAsH1ER Accounts of Army Officers and Privates Appreciated iiiiiiiiiilziiifilzi I I I I MW M ,Qi which is a pleasing and deciding innovation, is the fact that our 5 patrons can see all the food cooked and prepared ready for serving right before them. I HE chief feature of the Rotisserie. This method is superior and cleaner than all present ways of restaurant usage. Try a meal with us today and convince your- self of the superior quality of our food and cooking, and especially the appetizing way we prepare and serve sameg and we are assured of adding you as a customer to our many satisfied patrons. '1L JL JI VAL ,ILVULQIL JLWJL' ERVICE 1S Dominant today Service for the Country and for the Flag Service for the Individual The demands of Service upon the Hospital and the Surgeon were never more strenuous the probabilities of the future show even greater demands The lesson of Equipment better more complete Equipment is clearly Written To the Manufacturer as well has come the call of Service Never has there been greater need of Betz Equipment by nation, hospital or individualg there has never been better Betz Equipment. With highly standardized qualityg with an organization which is capable of the highest form of cofoperation, we answer the call for SERVICE. The prices are attractively low -. The quality is uniformly hzgh. Frank S. Be-'lzz Co., Ham moncllncliana Chi oago Sales Dept. 50 Sast 9?andoQvlz St. fb GLGR sf SER ICB First National Bank United States Depository Junction City, Kansas Capital and Surplus S225,000.00 For the convenience of the Army we maintain I an office in the Q. M. Bldg., Medical Officers' Training Camp, Fort Riley, Kansas. This Bank has had over thirty years' experience ' with the Army People. Let us serfve you OFFICERS THOS. B. KENNEDY, President O. O. CLARK, Vice-Pres. J. V. HUMPHREY, VicelPres' W. F. MILLER, Cashier VASSAR DURBON, Asst. Cashier OTGHSCI1 Tankless Air Compressors Adopted lay the U. S. Government for use in the Army and Navy. ffv-me . A 1' l I A Ml El A :Q l l 1 nv. . ll u 1 1 . Dr. S. Yanlcauei-'s Combination Pressure and Suction Outfit 5 i .Y For Tonsil and Adenoid Work ! A 'E l l r' d,v 5- ' f ' mf W!S.1-'g' on P' A . . . V fill! ., . ll I l . ' V 'Q ,lr me il V WH! 4 -rs ., fl ku A logevlfi W lt - xl Lmiliiiil 'limmwt' ., ' 'n,,,Q+1 i : ' ' W 'vi -N 31 4 .15330 A . 1 i No. 50 Air Compressor R ' 'Qu Ile. it .. .1 . Dr. L. H. CoFlin's Sinus Outfit C' M' CO Inc' 177 E. 87th New York, N. Y. No' Air Compressor Write for particulars and Catalog! ee Stuclm JUNCTION CITY. KANSAS' Maker of Photos that Please OVER COZY THEATRE . -5. IF YOU ACTUALLY 0WNED MUDLAVIA Your patients could not have more individual care or better service, Mudlavia co- operates with the home hysician to the minutest detail. Fccl free to consult with DR. GEORGE F. BUTEER, Medical Director, either in person or by correspondence. We are always pleased to entertain physicians at Mudlavia and to furnish opportunity for fullest investigation as to methods and success of treatment. For physicians' in- vitation card address, W. C. KRAMER, Gen. Mgr. Mudlavla, box 15, Kramer, Ind. Our Railroad Station ia Attica, lnd. Have you a copy of our Blue Book for Physicians? HE BOON'S M LECTRIEJ ST C. E. KOENTZ, PHo1'ooizAPHER PHOTOS BY DAY OR NIGHT Kodak Finishing, View Work and En- largcments. All Work Will Receive Prompt and Careful Attention, Over ARKET. AT 706K WASHINGTON JUNCTION CITY, KANSAS UDIO STREET, GRACE M. GUN DRY OPTOMETRIST .JUNCTION CITY, KANSAS Our Motto- Accuracy Quality . Promptness Service We are fully abreast of the most advanced methods in optics. You will know all about your eyes after visiting our refracting room where the superb equipment and our successful experience are at your service. While Beck's Around . ff ' ' N' Community E u Shop House h d - A ED. BICKENHEUSER, In Proprietor BHIUHIOTC Sanitary Methods Employed Oyster Q Our Service Guar- HUUSC anteed to be and Try Waffles t High Class 'A C - . We Welcome the IRWIN, P1'Op- Patronage of All Soldiers Junction City' 820 North Washington Sr. Kansas Junction City, Kans HOME STATE BANK 4ifIIliiiillillllllliiillillPIIPIiIil!liiiHiIliIIIIII141HIIIIHlllliiiilllliHHlPPHiiiIPVIIiII!IIi1I1111IHiiIIIIiNNIIIIIIIiH1lillllllliilllilliiiii11E!IIIIiElIlI111HlHiiiIIIIIIIliII11WiNIHNIIIIINIINI!IllHHI1HIHIHHHINWW1VHilillllil1illiiiiiilliiiilllilHHlliiiiililliliiIIIllllllliiliiilliiilillHM1WWIIIIVIIIIII1111111111ilililllliilllIIIIIIYWIIVVIVVIVIIN Deposits Guaranteed by the Guarantee Fund of the State of Kansas Q Q Q Q Q Q SERVICE : : SAFETY : : SILENCE PHONE 415 H144IIIFlIiIIIIlllllllllliiiillilliiiillllllllliliHHlilllilllilllllilliiilIIllliililillllilllii1iiPiilliiiiilllllililiiiilIHPHHHIHIHHIHiIIIIIIIiIIIIIIIIIWilHIIPiIIIiNIIliIiiiHIIIIIININIlilliiliiililllllilillIUWIIIIIIIIHIIHDiHHHHEMHINHHIWiiiiNIH1HIliilllillllliililiiiililIHHHIIIINHWIIIJ1IiiH1UHVIiliillllilillllliiHIIIllllillillllllliiiililH JUNCTION CITY, KANSAS Smoke Blue Ribbon Five Cent Cigar F or Sale at Post Exchange and All Dealers. Fitzgibbons 82 Stokes, Manufacturers Wentworth jewelry and Sporting Tornlinsonss Cafe Goods Co. Most Interesting Store in junction City U C1 U ORTING GOODS ATHLETIC GOODS . . SP JEWELRY WATCH REPAIRING Where the Guest is Always Right MILITARY GOODS CIGARS AND TOBACCO . El U D You will always be a welcome visitor 707 North Washington Phone 64 114 and IMM East 7th Street GO to I Q 6 ' S for Drugs, Stationery, Inks, Eastman Kodaks and Supplies. Parker y Fountain Pens. Real Ice Cream and Good Cold Drinks. JUNCTION CITY, KANSAS ALL TOILET ARTICLES - - - - WHITMAN CANDIES Modern Surg1cal L ff' V.MUELLERECD H' -1,'t A ,ff M X ' it il TGCIHWIQUC 'W' 'I A' A ' L , ,, . V WWWWI WIWWI W demands the selection of instruments of proper design and workmanship. Mueller made Surgeons' Instruments are recognized as among the best. PARHAM AND MARTIN BONE BAND w - - in-Q II I km The Mueller Surgical Engine is Electrically 1 giigii:,3I5,5 Operated and designed so that it may be -' TTI -TIC IfQ.Ne--f 'K'I 7 'ii RT g I used for all cases where mechanically driven : ' ,lllilMVmlllmlmmnnfw-- attachments are of service. Bone trans- MAJ-P'-UL MAGNUSONIS BONBQC'-AMP plants, ivory inlays, skull trephining, mas- toid or sinus operations, etc., of all methods, .., I may be done with this engine. We carry in I y --r , 1 - stock for prompt delivery all types of bone i I I M 7 A , ,.tl X 'LII-M, engines, such as Albee, I-Ioglund, Geiger, etc. ef, f , I 'I' N F' M J - .Q , Q' ld I y f I SH lv Q We direct attention to the completeness of il' M H' up Ig our stock of all surgical equipment for sur- E I ig J gy .J - geons or hospitals. I 5: fic. Q9-Friif i t I f - If I l fbi: ,H ltllgfx I l ft H I F ' I I I I lIi:II ll il I I ll ll a .I 1 , ,,,,,, ,.., .,..... , . v v. Mueller at oo. 'lima Muiztuzp. Suacicm. ENGINE AND EQUIPMENT 1771-81 Ogden Ave., Chicago Telephone 787X COWEN SI-ICE CG. Exclusive Agency for The EDW N CLAPP rmy Boots and Fine Puttees OfflC6fS Shoes, Canes and Crops Spurs and Straps Please Investigate our Prices ' . , ff ff fig! ff .---- ' -' ' - ' . .files , - 1 'f :'5 Xi135RN e he X 7 X Qliffffb I ?1', f1':? ' K - X ' 'I A1656 I - jf,-s sl-,QW X . .V A 1? 'Q K-'lgug' Q x j N 415: I gb ' 6 ,Q-'34 f-' 'R ' -2 :ZW :Q ff it' , .JL ? , LEE' XX:'-.ff.'3f5-'5'!f- z 'i'11gL5e,-G' H 14 '-C' -X , '--,- - x ' '!3:'5,5f?25W I h J 'I 51 XXH . : .'f ' ' V X J.---Y... K4 'ii S h ' 4 M r ' - ffffmffnf vw, A ' - - gif, I 1, Llul Q .. - ' - ,aawvf 5 'V Q2-'fig' ' ,f 4 , - 'L h , .'l22X'C, ' ' ,ff . - -- - - -. , JV f, , - ' 9 '72 -. E' '- . . ,A .. ,uw - I' Il n ,242 in 7' L: i -11... Q , . 7, ,f ,e. ' vt X , .'. gi I, ff4jWjg n . U , -4- ,i A. '- -.- Y I.. 3. fl I . 2 l.. ' I ' 1 . , -. ' '. . A47 M . , .,.-111.32-: ' fa.. 1 1 l ': .-4 - -2 . . .f ss.- 1f ff'w -:ff--H' ' ff! w - -f- -. . .f - . ffllv' ,f fy .-- --,. - -deign .15-:53,,.?' T ,Z k . 7 f 9 . I eff I ff ,f, X , A 7 ef 5' 4' If XZ 53' 1,0924 -Q: '7P'!f!! ' ' I -1 74 23 ,ff . A, . , 1 f ff, ' ' ' 194 - 'I CQ' ' Y ' If If an +:.t'l- ff he ' ' ' Kel? Locatln an vcr CI'1Jlf1Cd,1 oint. i' S Il l y I Keep Your Truck y S - I-larry Pierce Running 1 We Sell United States Solid Truck Tires and make the change free. Takes but a Ie W minutes We are Truck and M o t o r C a r Surgeons Ideal Machine Works M. SCI-IMIDT, Prop. 120 East oth St, junction City, Kansas Best Equipped Machine Shop in the West Lands, Loans, Abstracts and Insurance Q.L,MELLQY y junction City, Kansas Tl-IE WAV I-IE I-IODQQ IT WILL QE IN EDAWCQ Groceries, Fruits and Vegetables ARMY PROVISIONS HUQUUDUUEUUUHUQUUUUUUUUUUUUUUUUUUUUUHUUUEDUU HUUUUUUUUUUDNUUDDDUUUUUUHUUUUDHUUUUDUNDUUUUU DELIVERIES TO ALL PARTS OF FORT RILEY AND CAMP FUNSTON EEDDUDUUDDDDUUUUUUUHUUUUHHUUQDUUDUUDUUUUUUUU UUUUUUUUUDUUHUUUDUUUUDUDUUUUUDHUUUUUUUUUUDUU O. I C A S T L E M A N - junction City, Kansas IIIIIIlllllllllllllllllllllllIIIIIIIIlllllllllllllllllllllllllIIIIIIIIllllllilllllillllllllllIllllllllllllllll IIIll mInImmllllllllllllllll ..... illlllliilllllllllllliIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllllllliilillllllllllllIIIIIIlllllllllllllllll !lll 'lllIlll mill' mHHII IIIIIIIIIIIIIIIIIIIIIIIIIlIIIIIIIIIIIIIIIIllllllllllllllllllllIlllIIIIIIllllllllllllllllllIIIIlIIllllIIIllllllllllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIIIIm lllIll II mnnnm lllllllllllll llllll IIIIIIIIIIII mnmmnnn llllll lllllmgl IIIIIIIIII muuuu mm IIIIIIIIIII III nuunmmnmn numnnumuummnln mIlIIIII'l IIlll :umm lm 'llllll 'IIIII I l IIIIIIIIIIII r In ClCfiO77. J' No oHicer can really know what this little machine can do until he has seen it in action, unti- he has examined it for himself. In the armies and navies, here and abroad, it is an indispensable mechanism for speeding up efficiency and eliminating mistakes. It I prints quickly and cheaply all kinds of letters, orders, l forms, instructions, bulletins, etc. And, by simply tracing or drawing them, illustrations may be included on the same sheet. No cuts to make-no type to be set-and almost no expense. Quick, clean, the Mimeograph delivers five thou- sand finely printed duplicates an hour. It saves precious time and labor. It systematizes and speeds up routine. You don't know the Mimeograph unless you know the new Mimeograph. Ask those in charge of other departments, where thousands of Mimeographs are now in constant service. A. B. Dick Company, Chicago-and New York. 0 Caution: The Mimeograph, and our supplies for ' it, are made to work together. Upset that relationship, the work sufers, valuable time and materials are lost, and our responsibility for' quality and output ceases. ' llttillllillQQlii1Ei11an1lI llllululiiaullfjllffauliis .... illlill-. 1 lllllllllllllIIIIIIIIIIIIIIIIIIIIIIIIllllllllllllllllIlllllllllllllllllllllllIIIIIIIIIIIIlllllllllllllllIIllIIIIIIIllllllllllllllllllllllllIIIIIIIIIIIIIIIllllllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlllllllllllllIIIIIIllllllllllllllIlllllllllllllllllllllIIIIlllllllllllllllIlllllllllllllllllllllIIIIIllIllllllllllllllllllllllllIIIIIIIIIIIIIIIIIIIllllllllllllllllllllllllIIIIIllIIIIIIIIIIIIllIIIIlIIllllllllllllllllllllllllIIIlllllllllllllllllllllllllllllll nlnlmn111uunnrnlmuluunnlnnmmmulnnmnnununumnIIIrIIIIIrIIIIIIIIIII1111iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiinmmlilllluIumInInInInInInnnlmluIuu1lIllulllllll r. BIG STOCK QUICK DELIVERY Telephone 69 L MBER GEARY COUNTY LUMBER CO. Junction City, Kansas Special Notice To Omega Military Strap Watch Customers in France Omega is the bes t known and most popular of any Swiss watch in use throughout France and all Europe. The purchaser of an Omega Military Wrist Watch here may take his watch to any 'eweler over there -in event oflbreak- age-with p e rf ee t confidence that thejewcler knows Omega, has Omega Material a n d knows how to restore the dam- age. ln addition to this, the Omega Watch Company's head offices are located at Z0 Rue Richer. Paris, where they will always bc pleased to meet you. Ask us to show you these The Commercial National Bank KANSAS CITY, KANSAS Capital, Surplus and Undivided Profits - - S 825,000.00 Deposits, - - S38,000,000.00 Banking by mail a specialty, Write for particulars. P. W. GOEBEL, - - - President Watches S-' y U 'fy' C. L. BROKAW, Vice-Pres.and Cashier G. J. BISHOP, - Assitant Cashicr W. .' I H. L. LARSON, - Assistant Cashier JUNCTION CITY, KANSAS A E. w. sritwett, Assistant cashier -l-K-Ill WQV UQ Cl'WDQ lT ' ' For I-IARDWARC, H I R E S Pocket Cutlery, Razors, Padlocks, is ,he genuine Locker Specialties, Kitchenware, Etc., R 0 0 T B E E R See Us, Hires is made from the actual juices of roots, barks, herbs and berries. Demand Hires and insist upon getting Hires, for it costs you no more than the cheap imitations. sl. J. 81 W. F. Muenzenmaycr West 7th Street junction City. Kansas f Quality Always I The Taylor Dry Goods Co. Junction City, Kansas Wishes to thank the oflicers and men at Fort Riley and the Camp for the very liberal business they have seen fit to give to our store. We certainly appreciate it. We have never come in contact or done business with a finer lot of men. Also to the Wives of the men of the M.O.T.C., do We wish to express our appreciation. Our service has, perhaps, suffered some from the greatly increased business in this city, and there have been times when we have not rendered as prompt or efficient service as we should. We are trying to remedy that. We have now in stock for the Officers and M0112 Khaki and Gaberdine uniforms at 81250, O. D. Wool Uniforms for 552850, Serge all wool uniforms for 535.00 and 34000. We can make you a suit to order in the Khaki cloth for 51400, Serge Uniforms from 327.50 each to 54000. You Will find our Milita1'y Department in our basement. Full lines of Suits, Hats, Underwear, Socks, etc. If you don't know us, come in and get acquainted. You are Welcome to make our store your headquarters. Meet your wife here. It may save you time and your time is sometimes so short. 26.04-7-QQ Junction City, Kansas PIANOS PLAYER PIANOS VICTROLAS VIOLINS RECORDS VOIZ Drug CO. The Rexall S tore ' ' ' ' LOOK EOR THE WIHIRLING SIGN 707 N. WASI'IINCI'l'ON ST. EARTELL HOTEL BLOCK PHONE 64 JUNCTION CITY. KANS. ,JUNCTION CITY, KANSAS PHONE 1040 MANDOLI NS GUITARS BANJOS STRINGS SI-IEET MUSIC UKULELES MOTOR BUS AND TRUCK TAXICAB AND TO AI,.I- TRAINS STORAGE FOx's Barber Shop d T f C and Bath ROOm an O' UNDER UNION STATE BANK A. V. MICKEY, PROP. jUNCTION CITY, KANSAS sHAvE 1sc HAIR cm' ssc PHONE zz PROMPT 118 W. OTH ST. BAGGAGE SERVICE ,P 'XM fi! ,f ' ' 4 if - I 5 I llll .k . J x V' ' yy 2 P3135 e..f1f9.e5ffgi'5f.vii-fIf-. . ,I ' - .f 1- f -E,I f -mr.:-I mf 4. '- ' JI A K sa4gf2iIJ15Qe.iPfff f I If'Q? 'ig1:p I,fs3:1l,i-'-Mirtblfw 1 5? I'4'- I ip . ,fx -A .sax I I I I I.s1.Ew:m2 if .'-ew. W ' l 'rw ' f'I'.:fr'sffu1:fff -Iwffif-f a ' ' ..I3',c'.'3' H-fg.:,1545,-:-5:.1f-',.i-ww -441,141-'f:E' '-1 'gw1,'.5 'I' . 'W' Ii, ff' ffffffeiiyzgfi3.iIg,j'frfs' IYLQLEIES ...Qi-Q.lgj5,m ,4. .Ii SE M EIEIEOEN j 'jg 5I..:,,-25. may I L jf -1'-wr 1- .. so I 1 ,igffff N gf? I .. ' - - '-'T -,. - IQ .SEL K .:1,..:. i Ah ' 'A SQAVIQI LQ 5:72, 1 ? E Su The new Docs dream Of M91 Ve. ' The ,stern reaw, V V .7 D1sTR1BUToRs FoR Edelweiss---Muscadine Punch---Red Wing Beverages THE SYMNS GRQCER C0 Wholesale Grocers 523 North Washington, junction City PHONE zoo Daily Truck Delivery to Camps 'fQ WJ's Qyoo WE HAVE IN sToCK y Cigars and Tobaecos---Cigarettes for Government Exchanges ,S THAT 'Tmprv INCH STEP -.Xun1lllllllllllllllll Immun 1 2-'fill Ty he W l, 614:-s il ,v-v,,1-wg'fj 2 jj,Qv-ev ,'J 1 fef:-ifmfs'-f.!rz -an 1.1 L f f1 ,?.:z.'s'- 51.5-12-, FQ .fl wr-.1f ' fvjlig-V., ' O e O us. . i-or 1 -wif f..-11 gli-f f'f',q.'f- rea. .3 .. V 9 V V97 , ,Q ,l,7 :Y:- ?Pf:1'gfe:':g Tl I ' ,' -f2lQ1':.'W f' I 114.335'qZ.E-jzfrtisi f:l'1Yf 1: 22,11 'Em-'3jg5Lr, ,JP I - ?:f,fzEsQ22w 1 a1i.':f1'f.K, .--,-'. 4'je-M.-,3, t .- vw. -1 I-. ifII2?:l v'.' 53- Vu y - lg--4,1+.'f1-:lg ui, 411515 if 5. 4:54, wi .L: .1I-QgiZ,iu?.fi? :' l Q Qfkgis Z X6 . -,I .. f11. if1+:,. 5 L-,.i'S'T I H7 'I :lf-ig:-,::.' Pu, 9 311.34-' 'Rial f :FSF I 'fi-'T , 'y. .4'f' 'L MUN . fl ,,.fv:,. W - 1, Sm x1f5'41'-TI' . f2'f??'-' 1 - - 'nggif . ' 1 ,1,,:v' ' ISS 44.- uunnmunnnmumunu u1unullIlullllIllIllIllIllIllllllllllllllllllllllllllllllllmulumm ----- ------um I IllllllllllllllllllllQ----- I I YOUR FAVORITE STORE In your home town specializes on the same lines as you flnd here Hart, Schaffner 82 Marx and Globe Tailoring Co. Uniforms Knox and Stetson Hats h I Munsing and Superior Unions xl fl Hartman and Luce Lockers l T firm- TV, . .' I - I 3 if 'fx I A I ,fl E. 82 W. Shirts and all standard lines A l KHAKI UNIFORMS MADE TO MEASURE IN OUR OWN SHOP The Bingham ClothingiCo I jUNoT1oNC1TY,KANsAs I A HAVE YOU . Muenzenmayer Q VOHKIIIQIIII TRIED ONE LATELY7 successors to 5 Muenzenmayer Sheet Metal Works URNS Manufacturers of WARM AIR TANKS HEATING llilllc mmicdl 2 lair 254: and Sheet Metal and Metal Work Remember that Little Bobbie is a small Products for Buildings edition of Robert Burns ten cent cigar. BEST E43 RUSSELL. Branch Distributors JUNCTION CITY, KANSAS , KANSAS CITY. MO. US. Arm Gfficers' Uniforms Equipment Place your order direct with an Established Military House where regulations are known and followed. You are assured of a perfect fit and the most serviceable garments possible at the price. Catalog and Cloth Samples await Your Request We have served the Army and National Guard Officers over 25 years and have an established reputation to maintain. T1-IE I-IENDERsoN-AMES Co. KAg.erg?OO, Not the Result of Chance GRETN ER 3 SON The Home Breadmaker measures by cups sometimes by guess. l FOrd Cars We take no chances, everything is weighed to the fraction-our proof rooms have an even temperature-our modern ovens are , , so perfect the heat can be regulated to a line Of Auto ACCCSSOTICS degree-OUR BREAD IS ALWAYS JUST RIGHT. U ii'- 4 Phone 153 M U R R S B A K E R Y 125 East Yeh Street Junction City. Kansas 1865 -The B. Rockwell Mdse. 8: Grain Co.--1913 JUNCTION CITY, KANSAS WE ARE HERE TO PLEASE YOU This store has been Headquarters for Soldiers and Officers for over 50 years. It's the oldest store in Central Kansas, located in the same place as 50 years ago. Also a remarkable thing is that it's under the same management. The name RockWell's is a household name in every Geary County Home. Our Aim-4' Yhe Fuhfllmen! of Your Desires Headquarters for all Military Supplies. We carry nearly everything an Officer or Soldier Wants. The quality is right and our prices are always the lowest. Our Grocery Dept.-One of the largest in the State. Buy Groceries where you can get them fresh. We will give you prompt service. YOU AND YOURS ARE ALWAYS WELCOME AT THIS STORE The B. Rockwell Mdse. 8: Grain Co TI-IE I-IOGA MILLI O CO. .jIx'Llf.,I1.,j,1 Q - ' f' f ' A ,-,-., A ,g 'f?!StIg.1f-Ears -. I I ' 'fIa g ,I' 4' L d L' d f , ,, ?,fE.T giiffqf 'gif N 62 Cf I ea er .3 U: I 74.-:A-,,.,.:I 1 ., ., I A 'I-, ' ' .iff I L 3 f-IQII I W I fw f- - I' -I 1,. I. ' g 5 ' ' ?A': -LWEJJI ,, :',q. - -I' L L , 5 EEST-YET I ,Ir nn , .I o,:,. VG IL. Q: IN TIME OF PEACE A I 'N - IN TIME OF WAR OPERATED BY ELECTRICITY MEMBER OF FOOD ADMINISTRATION junction City, Kansas SIFWQGQBIFWYFWQFWYWSQFWYPSQFWIFWIFWYF Newman 82 Baum I f x AILORING ' ,M K f H! and CLEANING ESTABLISHMENT 'I 115 Wes: fm sweet I f- I I .. WA W ,-Tera N QQ' '1:'?5:.' -QIXQ Q f' 5 'E unction City, Kans HQ . ZW.. QE Q I-1 In I I 1: , S :M vt 'I 'Nf' f .3 SZ if , I, ff , I iff' ' f I . - XV CI-IAMBERLIN S I 25' X ,I l I:-'I-Jaw.: y Q55 3 IN af CIGAR STORE 5 I . C1gars-Tobacco-Pipes Q and 'Il W I I A I 'I Smokers' Articles SS , f -II X: .J Xxff A A ,.,-,g f . . N ji lg . NiW 628 Wash St Juncuorm C1ty, Kans. ,Q ITTQHIIIII IIA E-3 - 1, t ,Z ICI' I I j l gf?-' I x I . I I U 7? ,I . ' , I ' I I 1' 1 -1 I- Iwi up f at . 2 - I it I, I. II I II - III, II II II I III . II lx 41 IGI X I I. I I . I . I I.IIIII.I, ,I . -- .--L . 1.-if-,IIIQTI-4. - I' I.I5-' :' ' 1:- II,,I Q - I '1:- ., -' Q .r i I.I, II, II ,Ia 3 1 1. C .. LIU.: WAN ,IIIIIx , f. I II II II f I-I I I . I j' I 2: Ii'I'II' :II fI'T. .I - If' I I II 3- ' I I'5, -'-I4 . .I . II I I I II . ,I , . ,,, 1ff'.If f I ..I . I ,I, .. .-I.: If ,....I I.1' ..,A 'Iv .I ' , I ,lf ,- - I I' .:I-. I. . I I I f J' . J. TT . .. Q -, I --,I II .,I1III,I.,.II, II III II III I I-I.I I , .. .II .IIIIII I . - III'yl1iI - I III -+ . ,I. I,II . I II I -' - . 4f-I r 1-f-Il. , f . 1 - if I - 7 - f .f I 'T - . ' ' ' , V I If Ii I I I I S- I . .' II 'QI 1' f I g 1' ll: -I 'II ' . I -' ','- , - ,. ,. fvg, 55 I 1314 I 191 ' A1 i-fs . ,gf 'IT 5. . I I If Ifg . I .- I ffisrfgj 1. ig, I -I ' iv' ,I ,I . gash 3 :I I I -II ,.-1 ,. .I, ,. II-h!I. II 4 ,fI.'. - II . I .I ,,I, -IZII If -If, .II ... II- .ff I II ,'. I - I , .I. I f no III I. ,-Q I .. ,IfI- I' II I . .I,.I, 1 If III! III I I I '.. . I ' 1 -. '. .I IL :LI IN. I :III III 'IIIIJI' III: I I .I'1.'lI , . . . '-'fl' .' E' v. ' if I II' z' J 'I ' -. I', '51 . , . IIII I.,I II-II I II I., 'X xIIII I I1 II I I If I: I I I-II'..-,:I IIII-I: I '- .I 'I .1' . 'J I' . Ili , .f'. ' ' .I Il' I- 'I 'I -I 'LES 55fgf 1I: Ig'IIJl:-yI -ji II . -I I. -I ,I., -I - f i.. 'ff ' i1..f'?I.f li I .I IASL .' 'I I I-..III II I I. I II 'III I I, II.'I'l,,I IIII A . III I,II .l,. .I I I II I' ,I . 7,I XI I-QIQII: In :z II ,I I Ir' vI I.I'l f If - 'A' - nfl ffl: ' 'f4fff7 ,-. f l ' '- ' If .'l'f I N H ff. I . - - 'III IIII 'i A , ..I,I IIHIIII2:f!'f:LI'.7-,.Ja- v -D Ix,'i?ftI:TTI -:II 0 ' .C f I ' - II I. i ., ' ,Q -'I,,, .3 : :fx 'Ss ' I' X To-51 l: .3?g,, .- : -zftri ff?-iz -..-fffff 1, mi t I ' I ff .. 2:45442 . A- -, . C725 . 'ifT ' ff, 'If'-Ei? Wrfff- Igixxxs T . -,-' ' :' -'l?5 '-1 --'J . : ' : ' I . I' ,'.- L'.'f 'Ii'.15I'? f . . Q7 . 'I .. 'Ting--3 7. ng! ' .- 'I ' - A2 -- T! ' ',If'?Q55f AI1TI,'.jI..-,5f elI'' 'I I .II. I!'Ifj!, .3 jf-f'.g-3 ' 35155 Il' :Qi'il'4L J-- A '-'I4 Iii Il 'L LU ,IIII - A I.-I :,IIg,j II I 4.I. If I,I.I-.1 :I.,II' I. -12.5, -'-I.-- '..- I-IIIQM' I' I I- I.: . QI. .5I'5'. MII..-1 -- . Q PII'-.I f' I. .' 1 a-'Id ua- ' 9.1 '- J -1..': M' .-1 I I ,- '.-- L-. -' 1:11-'. -4 'I '-f,-.- -,-fhf' 2' ' .5 ,I 1' --Ilii.-Ill '- .:'i..g. '. f',95' I.-'-.-rl 'f.'.g:-:1F'?'a,'7:F.' -IL'-Iv-'I - .' '4I'Ii'17 'ig'-.:f1'-' 'V' -.'f1f':'. ' 3'-.i,:.-iff 1 -'I'-A -'. W-'T I'. 'ill-fs .rl'.lf'.-,..'J'! '1- JI - ieI'.'-1'.i.,fl,-:'il'-xii-llff.:-3.-3li,'f'1.I.'fff-MTI' 5f'I.i.I--fI ' ' 'viii ' 'I ' I' I ' I ' . 'ff 'I '-..'.'a-13,-'.'yg.I-Q..'i. .,-. QQ zip. -f ' ' -ff '+ 'I -' -'-I junction City Amusement Co. ATTRACTIONS Opera House for High Class Vaudeville CORNER OF 7TI-I AND JEFFERSON Western Vaudeville Circuit. Changes Mondays and Thursdays. Five Acts. A good show at popular prices Cozy Theatre for Pictures Big Features Only. Changing Daily. Continuous Shows. 5 and ISC l Airdome EAST 6TH STREET 1 Block East of Postoffice A First Class Show. Change Daily ATTENTION! For Private Parties or Single Trip, Day or Night-Try My New Sedan, 7-Passenger. BEST SERVICE IN TOWN L JUNCTEISN Ci?Y KAN Meals Short Ord s Interurlnan Cafe E J. c. HOYT, Prop. Half BloekN li fA dP Bll B d JUNCTION CITY. KANSAS he Union State Savings an Save ano Tl'fave Go the Boys at Camp Tunslon ano Tort Kiley: We wish you gooo luck o bope to see you ova ver there anb r bare before you go. e JUNCTION CITY, KANSAS We Are --The New lce Cream Company Maxwe Our Claim is, the Most Sanitary AND and Up-to-clate Ice Cream Plant in the State of Kansas. Our Ice Cream is riclm in Butter Fat and a very low bacteria count. Tires and Supplies PHONE 376 V The Junction City Produce Co ' Phone 292 Auto 8z Cycle Supply Co. The Durland-Sawtell Furniture Co. Invites inspection of their lines of Artistic Furniture, Rugs and Draperies Camp Equipment, including Folding Cots, Tables, Bedding Rolls Suit Rolls, Cot Pads, Comforts, Blankets, etc., etc. LOCAL REPRESENTATIVES OF THE Peerless VictorVictrola Talking Machine and Records A PIANOS The Durland-Sawtell Furniture Co. Established in 1883 117-1 IQ West 7th St., JUNCTION CITY, KANSAS WE WELD- Cast lron, Wrought Iron, Malleable Iron, Steel, Cast Steel, Brass, ,Cast Brass, A Bronze, Aluminum And anything under the sun except a broken heart and the break of day NO JOB TOO LARGE All Work Guaranteed by t F ogelstrom Carriage Shop PHONE 109 A 302 West 7th L a S H E I . L E S EXCLUSIVE DEALERS IN I-IIGI-I GRADE MILITARY FOOTWEAR Sole Agents for I Samples of Leathers and Prices Taitzai Military Boots and sent on request. Also instruc- Puttees. tions and blanks for tak- Walk-Over Officers' Dress Shoes. I 'I ing Own measurements' Herman and Brown Munson Last Satisfaction Guaranteed- Army Shoes. We fit em All AAA to EE in Stock- e serve the best people, because Fox Spiral Puttees we serve the people best. A complete line of Full Lace Boots Q ,, in stock with Outside Counter Best known Boots Here Of Over . and Dry Foot Soles. There. DELIVERY CHARGES PAID ANYWHERE IN TI-IE WORLD L a S I-I E L L E S --Asia THE MAN WHo WEARs A PAIR 712 North Washington Street, JUNCTION CITY, KANSA S, U. S. A. E, tiuflri .fi ff ',ty T, I 5 ami Jolinblou have deceived mexyou 'cold mebyou were 4 .soldier Singer 699 Co. Look OVC 367-375 West Adams Street CHICAGO. ILLINOIS Military Tailors I' OIJI' line at the Camp Exchange Before Replenislming Your Wardrobe The Big Man in the Regiment Got there through knowledge Knowledge is largely obtained from books. We sell Books and all goods usually found in a Book Store Brewergs Book Store 321 Poyntz Ave. Manhattan. Kans. Attention! When in Manhattan follow the crowd to the Colsonqs College Inn Cafe The Headquarters of good Things to Eat Confectioners and Fruits Soda Fountain Service The Best Music and Entertainment every Evening TYCO RLQUR Situated in the heart of the Hara' Turkey Wheat Dz'slrz'c! of Kansas enables us to produce a Dis- tinctz'-ve Flour. ONCE YOU TRY FOREVER YOU'LL BUY Tyler Con. JUNCTHEXNEEE Union National Bank MANHATTAN, KANSAS C.E,FLoERscH,CIsH.ER J. E. FLoERscH. CAPITAL AND SURPLUS 375,000.00 Special Service to Soldiers Instruct the War Department to mail your pay check each month to the Union National Bank. You can then pay your bills or draw cash for current expenses by check. Many men in the service follow this plan, and a great many others would if they realized how safe and convenient it is. It also helps you to save.. Now is a good time to accumulate a reserve or investment fund while Uncle Sam is paying most of your living expenses. Member Federal Reserfve Bank' ASKREU, jeweler--Optician MANHATTAN EXPERT WATCH AND JEWELRY SPECIAL ATTENTION GIVEN TO THE REPAIRING FITTING OF GLASSES STORE OPEN EVERY EVENING H A R D W IQ. E I Perry Brothers We are The People for High Class PACKERS OF EGGS 31'1Cl PQULTRY Manhattan, Kansas Staple and Fancy HARDWARE QUALITY SERVICE THE PALACE DRUG COMPANY I' B I'ORR1ISTER,MANAGEII A 4 N Step off the car and into The Palace Drug Store for The Best Sodas in t0W11 .r a -.vV ' Also DRUGS and SUNDRIES 'i MANHATTAN, KANSAS W. M. Stingley 82 Go. --Lau,-.Q.U..h A , I, . r..-,yu ...ie .. .. 4 ,.' f I Hardware, Plumbing, Heating A Full Line of Up-to-date Goods B. R. HULL Ave. Phone 49 Manhatta as The Manhattan Furniture and Undertaking Company 1.1.1 F ID' s dEbl H sF 'l1dC l WE SOLICIT YOUR PATRONAGE - - SAS 4 h . ,L , . V 6 BQHQBYFSYQWQGWYFWQFWYFWQFWQFWQFWQFWYQ :mlliiiil lilililil THE MARSHALL THEATRE Home of Vaudevillen MANHA TTAN, KANSAS Nothing Special to Advertise This Time. Wham Ygu Visit Manhattan A good Word for Stop at the Busiest Corner in the City Mid- uin Who. Gro. C . . Q O We are exclusive Agents for Whitmans is always appreciated' and jacob's Chocolates. Fine Imported I ' . Perfumes and Toilet Goods, Beautiful Our best wishes and friendship for the Stationery, Eastman Kodak Supplies. boys in Khaki. We have the largest Soda Fountain trade in the city. Mid-Quin Who. Gro. Co. McLaren Drug CO. Manhattan, Ka1'1SaS At the end ofthe Interurban carline 1866 We Sell Everything 1918 Groceries, Dry Goods, Ladies' Ready-to-Wear, Men's Womens and Childrens Shoes I-lardware, Wagons, Farm Implements, Trucks, Manufacturers Agents Grain, Feed, l-lay, Coal, Wood I' 'J' ' . , 'Z.2',11lw!Z! f 1 M g, DEALERS IN EVERYTHINGYQ, MANHATTAN, KANSAS Quality First Service Always QUALITY SERVICE 'The Best Soda Water on Earth Made by Manhattan Bottling Works The Army Inn SPECIALTIES--COCA COLA AND GAS FOR SODA FOUNTAINS T Truck Loads or Car Loads - BARNEY YOUNGCAMP, Prop. Manhattan, Kansas 320 Poymz Avenue Manhattan, Kansas SPOT CASH STORES . All the Latest Styles and Material in Ladies Ready-to-Wear Millinery, Shoes, Dry Goods, Groceries, Notions, Carpets, Draperies Better Goods for Same Money Same Goods for Less Money lX4anhattan's Shopping Center Kipp's Music Store ' Complimentary Everything in Music and to M ' l l . uma nstrumems The Medical Officers of MANHATTAN, KANSAS Phone 444 411 Poyntz CLINICAL ANALYTICAL CHICAGO LABORATORIES 25 E. WASHINGTON SIREET CHICAGO Organized in 1904 to assist physicians in making their diagnoses. Accuracy and promptness are its chief aims. Equipped to perform all types of laboratory work for physicians. In every Wassermann Test both the Wassermann and Noguchi systems are employed. In the preparation of autogenous vaccines both aerobic and anaerobic cultures are prepared. Urinalyses are both chemical and micro- scopical. Upon request of the physician we furnish mounted sec- tions of tissues upon which our reports are made. Upon application sterilized containers for specimens and Fee Table of examinations will be forwarded by mail. Reports are sent by mail, telegraph or telephone, as requested. Ralph W. Webster, M.D., Ph.D., M.R.C., Director Chemical Dept. Thomas L. Dagg, M.D., M.R.C., Director Pathological Dept. C. Churchill Croy, M.D., Director Bacteriological Dept. The United States Military Forces The Long-Bell Lumber Company Kansas City. Mo. A Tr1bute N those possessed of unusual talent ln the conceptlon and accompl1shment of thmgs not ordmary It IS becoming that no secret be made of the respect they bear themselves and no d1Sg'l1lS6 of the fact that they are COHSCIOUS of extraordinary power There are many however who would not accept th1S ph1los ophy Among them are the men who have been responslble for the reahzatlon of a certa1n 1dea THIS BOOK In 1tS physlcal form It seems to be the offspring of the graver and the prlntlng press Actually these were agencles sh1p were the men Vlflth the v1s1on the courage and the resource fulness necessary to brlng the Work to a successful conclusion THE EDITORS So We the artlsans take th1s means of glvlng recognltlon to them recognltlon which they would not g1V8 themselves The associatlon has been exceedlngly pleasant and beneficlal as are all relations With real men Wlth their ldeals for guldance It would have been remarkable 1f the final result were of any less merlt than you see It to be THE TEACHENOR BARTBERGER ENGRAVING CO UNION BANK NOTE COMPANY Kansas Clty Mlssourl . l l , . . , , . . - . . . . , ' , . y . . ' ! functioning in a more co-operatlve sense. Back of all artisan- . , - J , . , . . . . . ' 7 . I !

”

Suggestions in the Medical Officers Training Camp - Yearbook (Fort Riley, KS) collection:

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Page 193

1918, pg 193

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Page 154

1918, pg 154

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Page 98

1918, pg 98

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Page 120

1918, pg 120

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Page 53

1918, pg 53

Medical Officers Training Camp - Yearbook (Fort Riley, KS) online collection, 1918 Edition, Page 134

1918, pg 134

Searching for more yearbooks in Kansas?
Try looking in the e-Yearbook.com online Kansas yearbook catalog.

Find and Search Yearbooks Online Today!

Online Yearbooks

1985 Edition online

1970 Edition online

1972 Edition online

1965 Edition online

1983 Edition online

1983 Edition online

FIND FRIENDS AND CLASMATES	GENEALOGY ARCHIVE	REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!	Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!	Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.

E-Yearbook Home Quick Search Advanced Search Quick Browse