E-Yearbook Home  Quick Search  Advanced Search  Quick Browse

Logansport High School - Tattler Yearbook (Logansport, IN)

 - Class of 1925

Page 1 of 192

 

Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1925 Edition, Cover
Cover
Page 6, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collectionPage 7, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collection
Pages 6 - 7

Page 10, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collectionPage 11, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collection
Pages 10 - 11

Page 14, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collectionPage 15, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collection
Pages 14 - 15
Page 8, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collectionPage 9, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collection
Pages 8 - 9		Page 12, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collectionPage 13, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collection
Pages 12 - 13		Page 16, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collectionPage 17, 1925 Edition, Logansport High School - Tattler Yearbook (Logansport, IN) online collection
Pages 16 - 17

Text from Pages 1 - 192 of the 1925 volume:

“

A . ,,A Z, . . - my., , my , 5 , jg, ,, '- -'xi - ' sf-,Q ' jj, Hn, ,Q .gf . .J . I A. v. In Y 4 V, fi ' f' V- K1 J fs 31 1'-211.91-d kj?-95, - .f- W4. 1' 'A-:L 'f if 6-'a'r fa 9'3-Jf k , L-oxgf Cvfyffaaf-75 X01 A . I' 3 Q 127: I I-if Q I f. fy fi? ,Vx 5- X 252 ,f , xx' g ,J 4 ff I X Auxv H aw I f .f W , 1 Wim 4 jfzf X V ' , f I k N ' Q V ff 4, X X Qi ca if 'N f S ff K ' Q A A CC V ' . ,J L E if 1439- F 4 x 1. U 'I 111. -, if 1, 'Fl 'f -:WUI lx: iff' 'A . 1 1 1 Tiff 'fx . !1 . ft.. ai 53.4.9 . , 1 .. 1' . ' .1vV3 f 1: 11 1 1 1 1 , 1 a 1, g, 1-'- A -1 I , ,11.. ., 3 1111 - 1, 1 1 1,1 1 11,, , -1 N 1 A ,, :1e'V ,.. , ff , . -,V ., . .xjl ' 1.4 V 415 , Q fi -' 419+ '133 1,9 91' 1 ..,' ' ' '1' ' 1 I . .. U f 3 . 1,4-1-TL I' , . ., -- 41 1 ,. T I 5.1 i ' ', 1-1 'WIT 1f1.W,'j.!11 1, Am , 4 W, 'VH X , , 1 , N q . ',,'1 J . ,. ' y. . .9 H 1. I, . nr, '- - n 5 v L : ' - . .. - . . -9 - ' . 0 A , .9 , , ' ' Q - 1 . ,Q 1.1 . ,va.,, M , ' V 11:-. -s fig. - 1.5: N ' I.-gviilh if . ' Jv- ,M ' -I , JM, ,1 - 11, , 1 gps, 1 11 , ,.1., -,, 410' k ' iww SAM, 1 . this ,I ll fl' nw ,., 4 , A 1 13 .1 f Ja auf, K 41 Q 'il . llxx UL U '-.-K v...Vd V 116. 11? - , vw., WW'. 'K LN km '1 n MW! bmgw 11 ' 14111 . .1 T. 1, 1, MJ- V, , ,X 1: ,, .L My W . -15 11 I :Q .r . z-4. 1 5 H115 , 1- .11 1.1 . 4-1 . rl! 'A'-Q' 2.1! 11111 '1 - v '11 'v 1 W, M119 . -1, 4. 1 g 518,24 yi ' .,1..,1 J . 'a m 115' ,ya Wx-1' 4 -0. 4 'V :MW A fxa FHL A x .QW M if W 1, 4 ,, w H l..il1ln.?s2r I 1:4 , .- V uzzgzisuril lllniklf Blix 1 ' ' E! ft-81. - ni 2 ' 1 xx QM 2 W , , ! f lf 4, w , N , H 3 i s E J E ,I :X ,Q 11 unmwlnllllllmmlw, M Im4LWMM1lM2,1,rwwxn-L,'25 14 4' wmmmmm DAVID M. HUDSON Editor-in-Chief EUGENE W. NELSON Business Manager if Z. 'ss 5 E. THE TATTLER Qiiviii'iiiiiiiiiiliibiiiwii:iniiiiiviiiwiiiriiuii1nhuwwwiiiuwwwiiiwwiwwwnuwwwwnihwwiwwui:wwwwwFfhwwwwwmwwwwwwr1w1wwwwmwwwwwnwiwwwwwiiiwwwwwillwww1w1likwuuwuinwwwwwwiiiqwuwww-'wwwwuwiiiuwwiG111w11SkiwiiMil1ii1ii:wwwwwiiiiiiwwwwiiiiiwwwuiiiwwwxiiiifiwLiiiiiwwwwuiifwwww:iiwwwwwwwiiRwiwiEhwwwwwiiwwwwwwnwwwwuwuwwwwwwviuwuuwwuwwiwww.wwwwwumm-mmivmw1wwwwwwwI1uuwww-wwuwwww11w11wInww1ww1Iww1ww1W11X11HX1XX1Xnf1111li11i11X111XX1umiillliwmmwww E Our School Cfhis Pholoqraph and En- qrauinq Donated bu O. L. Harrin ion wumwwnunwwnmwwmmwwwwnnwwwinnwwwwmiwrwwnuwwwwnuwwwwwruwwwwwniiiwwmNilwwmwsnwwwwwuvwwwwwinwwwwwvvwwwwwwnu?wwwwwnuwwwwnmwwwwluwwwwnuwwwwnilwQwwwrwwwwwwhwwwwuvwwwwxi:wwwwumwwnimwwwinwwwillwwwmuwwwluiiiimil4xlunxxxuniiQxnuxxxxw:iwxxuxlil1wwxrihwuwuruxxxxxnzxxxxx1uxxuxxAluxxxxnlwxxxruxxxxxruxxxxxnxxxxuu1uuxxxMxxxxuuxxxxuxxxxwmulvmummwuuuxxxuuxxxxxuvxxxxmvxuwwuuxxxxxnmxxxnnxxxxumwxxu1xxxrrxxxxxulxxxrfywg umm - -' 1 ,YY-' A r-.r wfgu- 1-1:-H ' kay' 'F' . ' -4'-,:.,..' v H' ' !!!!lI!!!!!!!!I!!!!!!!1!!!!!!!41!!!!!!f1!!!!!!!!l!!!!!!!!?!!!!!!?!!!!!!!1!!!!!!!1!!!!!!!ll!!!!!!l9F!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!U!!!!!!'!!!!!!'!!!?!!!!!!!1!!!!!!!!f!!!!!!!4?!!!'!!l!'!! Cl' C: Cfalt er of 1925 ansporl Hi h School Published Honorarily by the School Nommally by the Senlor Clas Actually by the Tattler Staff 7 - I X . . g l ' S' ' i g , ! ' ! o . ! E . , , Z S .- .... ..,.l. - ...,.l,,...ll 0 .... , ...N .u-,,.,- ,.....,,.., ....,-..- ,,.. W ..... , ,....,,. ,H ..... A .....M. N ...,l...,, , ...... . ....l.. ....l ....l,, ,.... ,., ..,., ,,lm,..,,m,,,m, i i . '1lM 'EEx THE TATTLER Dedicated To COACH CLIFFORD WELLS The Man Who Makes Men mwwmwwwwmmwwwwwwmmwwwwww 1 'SJI5, wan- 18? av' - 'fe' -' , '- ' ' 5, TF ' 'I' H E T A T 1' L E R W' ',, i 'T'f,,'I ff M ' ' M'f'i 'w QIlf'vnlvv1HMWllM'u fw f MMMMHHHW Foreword Each year a new graduating class goes out of this High School, taking with them the memories of four years spent among classmates and teachers. Among the many who leave each year, probably no two retain the same impressions of High School life, but each one has his own particular experiences, the mem- ories of which he will always cherish. In compiling this Tat- tler of 1925. we have endeavored to record the activities which were pursued by our classmates, so that these may be recalled, if once forgotten. If by represent- ing the scenes of school life, we bring anyone pleasure in days to come, we will feel that We have been successful in our efforts. THE ATFFLER pf Backs JQDHINISTRATION CLASSES ACTIVITIES ATHLETICS WIT AND HUMOR w if. gl f Pllisfm EIGHT 7 ' ' sf ,iiin-JNL. 3 s F , 1 K 1. xf F M. -U V. 4 A Fw E 11 1 ,X u X ,K 1 Q 9 .. AI W 13 ,gk ff 14 i E N, 'La 5 'A u E E F1 . ,W W A v A Lisa 1-QNFMJ4---A 'w1s. ,x.':-ls-.X 11'.4,n'r:.2-ulxlinw':r:':sra'?u rnttllf :di!aisif 1 . 4e B lmillirrxll xl-Lm':1.1s'Jr,1.'AA 'I-.v.-, , - ,E . ' -'nz x V THE TATTLER gvnmwmumummwwwnu1W1wwww-1wwwwwmww11wwax,1wwwuAXuuu1,A,1w1wH11uumwwm.w,wwW. U,,,,,,,1,W , ,M ,..m,,,, E 1 E! gs gr irnlmwlmmmummummrnuwmmuwwrwnmwwmuNwmuwwmwnuwwwwnmuuunmuwwwnwwwwuwwuxuuru-11ww1uN-1uuxuuW1uwuunw1wwuww1-1mmmmmnuwm wumuuwmww uw, www W 1, xw ,wh-,ww-1 H 1 ww Ww,,,,,1,,,,, ,WX,H,-,,,,,11wx-1wmm.1,WWumA1WW,Wymm4mg,WmQ,MW,,mxQ,,M,m,,,,m,,,mm,1mW,m,,,W,,,m Q w f 1 v PAGE LLRXLN. umnn -E: N ' 1 T H lu T 1 L E R 2f''uwwnumiiruuwiinuuiihwwww1uumh-wmhJiiwiwwufwuw,wwynwiwiyywwwwmmmww-N, ,Wmhi.idlv,im-,5,9w-N,lm W.,:,If,i 'wif IE fun ' E , , , , - , , , ww,-1: :me zwwmvumfuvvruwfmn:umm1::xru1ln4,lnwiwm:wrmuulmmumwv:wmwu4nunuummrvf41u,v.m1 :wwwzm,rumunu,ww fu 1: ,w, ,WIS QQMfff9QIiEv,lmuIw-viifffxfuiE3ii1HilnnHinllnSuTHl1f Ellmivifwmivminiiiiiwiiiiiixwwiiiiiwlriii1wiiwiiiiii11riinmliiifXw1W1ww1.,wiNHLiiINFU11iii!1ll1hi1fiimFi?1w1XWH-WX1X11-51ww1hii111iiiiilfliiiiivdllT31mi1FFF'1wiiiiffX'1'11F12EIESiuiiff5iQQ1iifiQ5H1iiSiiiiI5IEiiI5EiiiiiiiI1SM1I,MH!Iiiiiiiiniiiiiiliiiiiiuiiiiiiiiiiiifiiiiiii?mffiii,ui'JIESJIIMErfiiiiff?'EfiiiiI'l5if f'liJihMIL -iiiiiiiliiiiiiiliildllimiiiliif PAGE TVVELVE Eg umm THE .'1 rLE mmumm ww ww ww uw H w H 1 n X11wwmvwwwwrwwwwmrmwwwmw1rv1w1w11w1vm11wwnunwwmwwuuwvmmvmum,muwww-wwu',mum111u,wux'1wuuumuummmwww'wuuwww'wwwmu ww m ww w w w wmlmwvvmw mmwuuumumuuwuwumuwwm , H W, ,,,, ,, ,,,, ,M ,M ,, ,,,1,W,,,,,,,,,,.,, S mmmmnumMummm-1www-ww-ww wwmw.mwMw ww- mmwmwww--ww'wuwuw wwwwmuwww my 1- , Nw' ,M ,, U W1 m1m.wWmuu www mu www w mmm uw Hu um m mm w H m w l' A G PI 'I' H I R 'l' IC IC N . THE TATTLER E'EHSiqifiiiiiiiiiiiIIIiiEFfsiiiiilrriiiiiiiirnnwliiiillzaifizmieriuilrmunumwiiisiuwiiuuuanwuumuuumuu1.wwuumuuuIwxmmuuwwm.uuwww,,mwv-ww ,mu-.W mmm , wHu.,,mnnmw..mu- mu n,WHu1.11Uumdhmmmwirih,WdilwNhmffhuuSimuI1mu-vwiifiuliEiili'WurxWiruifiixnuriumuuiumilmmixmiiluuuiiuliiivuuhmwlniiuwiiuuiiiiiixliuiiiliiiiiiuliuiwsHiIiiiiiMiiiuiliiiiMiiiMiiMiE: E! Ei gi Ei 55' '21 EEE S 5 1:1 -1, EEE IEA I , 1 i EE: 1 E E Ei Q 1 if 5 Ei 2 I I E2 I 3 1 E. EEE ig? :gn Ei ,Q FI Ez . I .55 i :ea -, Q :ie 1 !5s , I 5 5 i I F1 3 : E! iii I 5 4 , .. ,, ., . ., . . , ,, .. ,,.. .. . ,, . . . , . . ..... .. ,, ., 5 fEmunuuumnmnnmwnunmumwnumwmumwrIIu114smumvmnnnuxuumuunmuuunuuvmXwnumunmuuuuwuwnxmuwur1 wmmmw umm u mu uw U 1nmnmH:sm:mmvmumummnmruwmmwwnnwwmmuwnnwusmwwHwunwHnnwmuumwmmwnumullwmlmxmlmvllllmlllmrIIII1rrIIIvvsIIII1nrvIIlv1InIwnlllnnnlmulmllnmnnmmnllrnmllnnllnql PAGE FOURTEEN. 'I wh xl, 'O 4 gn Ill lf' J' ai 0 .14 J -1' .- Q 21.125, ..4l12,g. 1- mfw,,. 1, I 11- 5-Tv.:-11,1 '-P1151 . 1. -f-14151, .9-111. :EE 1 'ff':1,g1-' 1 wg. ' sh 4 fwf' - 1 gs '!-g.If..- 4 ' , ' w. xi '- 111g Liv-:gd we--.gf -, 1-1.1- ,r A 1,.f-v'1:a1- Q1-2' 'HqgS7'E1n1.. 1 f. -15, QQQ11-43 .:,':.g--13m--,g,,'- ,,.,'5L,,,3,. 1g ' 1py.f.-'-gffgig-M35 W , 1 S , 1 f'5'g,f:!,'Qj. -, A'-' ffQb.11.'1.' Wigg- if il W '7'f1 l,'F-'f1:.g-519 35?f!3i5i'fp, -f'?f?f4EMC-5-, 'l- WigJ1'1i?- C, 'A if'-iij1?H 'Q-A , 1 F-g,,,g,sM gb-,.13.-lfgix,'i:,f.,-9-'WM ,fit '-i:ggSkf,,.-,f.gY, Mia W3 TSf'P1a,'v3f3g'--:,g ,q'1Sf.1.QJ'i5M2q5.,, ' df 52 ff' 'LM-gI.,fg f'f1E1.?' - ,Q-,Ig -.Q , l f ,r'-.-2, 4' ,115 5- -',+11g....1Q.:'.-J KM .f-,,,' 'A-q.,,, 1 ,'...'15g - 51512 W ,. . fla. Y ?w'd 1,. 7 I ., '22, it ' fri .ap 7554? ,f1if,mW,f g'- '51 ii ,ig g', T,-' QTY?-511 . .. 1' X51 YW., .W -5- lj .5 'T 1,,.f'l.,c h,':f1,:f-inns 'ff-. XE' ' -lf ',- t ! ,1'v' 4i'1f'g,111' , Li:-1-f' ff' A H. 1' 1 F- .-'11,-. 1 , --. rw - 0 1. ff. U 5- 11-11.0 -fn 9-111 1 .-H. - .- ..1.1 1 - . 1. - - 2 'i'-' 1'1f,f 'h11'Lp ', 'j 1Y4g11'7' 'wtf' Vi 11Sf'1F3?1g,,G'f hx '5 .-1'11 ,.55, .ff' 1 ja, 1, 1. N ,Y1,r.'i .g , 5 11, , . 1, 311.11 -M: M i.. .9 qv- f s 1 ' ', - 'f' -. 5-141: 2-2.41. 2- 155,04 f,,' '., '.-1vfr,- ,gg -:-. -ff- , 11' i- Q N S W -:-:Q ,11'xr '1Wv H+ - -1. .. . J .2-'.-H1 IF? 41,1 .1 -- ':' Mig. 4'0 W, Rv'--,-'A . 'J 'f ff: ff--Sf 1- 2 'fs' f-.pf 1 - -iv' 1, 'fgffiffil-'-lui-.16 g'E:,,32i,'.- 1- .1,..,31,,,' ,. , .pgg4, ,a n i V, lik, , 51,1.!V,g4n A 1519, , b l-5 ,LEGS ii g-JA. .X-, f an - - -1 :-'Q .- -. '- - '11 1 -. 11 - 7 2' - .' ' -11 - gg, -' f1t'if -- jj 'i'i' :.?.1js ' .1,1-EW -W 1.-53QQ'E5w:i.' WA., 'Li-1+ - fgf.-,xwmsfc -- li 4' 1 -- -ff-M--Q. 'r' 1.2. '. 1:.:5. . f - '- iz 1-1'-:jfff ' I 'FM 5' Iii' 1 1 g' f , Q, , 4 -gg! m,-1 - J V 3-12.-4 1,-,,,, g-:DA ., ,, :-1 - . .,, -,ra L, ,1-,f .Q 11A-.,.-15, ,-',,3L- .gi mg 1' r, , ,, V -' ' . - '1..,.Q!l.i1 QL in J MS- 3, -'iv 11V 1,i'1 , E45 . gf.. -.N,2j11f,L7' gf4.gM , .,:LvA.1?.f,: 11 .iv A U .if .Ei,,,1.4i1w5N1:f. 1 W . .x 3:i:f'Qua?fs5.- -5:4555 51 ' jg-, ,5 ,igiLi -1, I -Qqiagfgf gag. V55 , . .Mb-M.4gja,afB?h, 11:39-H, ,f ...V F55-2 E.. 4 , 1551 A -, -5.37-QL-f35,Q:j.A'.5QQ,. iwxjggiik- 1-tg' ' 1: '.-1-Q-1131-ri 11 . Q - -:gg 1111 1,-. 1. F -- 11-L l . ., : 3, 'CTQ 'n :.- ,Q ' .rf 14 : -. 1, -M, ,f wp f.-4 - , ,F 1 1, .- 1- 3-., .ff . --.-5 Ju- -, ff, - 1u1L,,-WF.: . .,. 1-,H . -,, F,g5.gg.g.:!,,jf?. 1Fi',,3 nfl,-1 31. 5. f' 1 ,,Q1g.3,. ..-17n'2'5:1,1--. 4 51 -1 1, -1- .-.1 1.1 -.,.L'.Q1 --,.- ' ' , .' ,,L1:-.1.,- Q-111-- ,ki ' -' -- ' - z, . aff.-.:. . , 913. --' -4, .' ,. 3 - ,' -1-1-' - J. . 1' 41-:.L3f'..j51 M '-LI, ' - um - ' 1, ',,:.2,,.E,,,gY1g?1M1f4'-gfg-1'Ltgvrz ' 1 ' .if,Q?. 4'1Py-11w'+4vip ,I -. fgif 5 ' fg.i F1, 5'.-P77 3 fi-,-F'-'iE1Rf?'1-fa '- , :1,11.1 - W , 1 11.10. yi, 1.1 .-...., N-, 1 1r S.,...11 1 ,J1 ,JA if, , ., .r-,..,., ,11 , inf 1 1, , f,.i,f...r., ,Q 11111 , ,. ,JN , ,Q , 11 . JW, .,.,, ,R-r.. ,. ,V a.1,.31 .1 , .5,,.M.,.1 . .1 , 5 -, 5,.,, . ,,, .,., 5-194 , .I ,1, 1 '--f ,gwi 'J 'F '3'!'f1'5'-f :L 7-1 s L51--. 'f -J-2-2-1 ' .41 Ter '?.:ff-. 1. 5 -2, ., , , .1111.,,mf1, ., A1111,.1,,1,..1,1 , ..,,,3.,1 Q...-,4, 5 ,1.--vm. ,rf . ,.L.1, .1 -,M .I , pf - 1311 114 '. .E - ,-. vt-'xv G. ,-in .-1 L 'y:,,1 K- .fp,,11-,.. y 11- , - ' ' ,- 3,4 5-25,53 15?.H,..f? W ,. ' g1.j,.5, g,.. L i gi. .! 535:'H,-jig 'g g, -L, X 3 if e g? .- y,'.,1qg,1s:'F'W--.J 1.5f ,,.. F',41.p9g- fd- -- 115,--f- 1, 3 n flffgna mf 5..1-1J!,...- ,- 191. : fm -, ' 1 -fa.gQg f.g-.5- '.-.' 1,...144:1: , . -. m .glw.3.1 f f 1E'Jyf5f3,jV?1?ii,- -M fjgg'.5ffa1:gf'f' .1 '1. , ??1i,-i gg flgsiligfiijgg ,L . gh 111 ,-y fmf Zfj -v,- g'Qi!2SF. ' 'gf ' -'- M - ' 'T 11 -514 1 1551: Rfk?-L'.1:g 3 - -2 1 'ji' 'f -'HQ -i., 'law '- -.rw 1? ' ff- ' ':1.'L.1'1y, 'jf '31, UM -.-7 ' 5:'NZ-'11fT13',- g 1- I ,T-15 4 ,121-I -, 1 99 1 - 'Ai,f, r .3 .1 .QZQW 1 124-5.1 ,f.f2? W ff?-e1 ,. 1 'L ' -1 - 'ihffffl ggf 2:15311- Jia' 5 jf' Y. ,if '1'- , - rf- -.N-, 1 - 5. .1 J 11- Pg, . I ,Lf 6 -4,1- q-4 -4 ,-L1 . ...M ,lgm ga 1 , .31 . 14.4,--:gf 1 Q. -,f:- 1+ -. g ' 1 -1, ff' ...W -2'-1? G-'12, 3-. 1' 5' 9?-3-' ,. 11:? '-N1 g.-1-TSM -'1r'f 1,1 f-E'-:J ' LI' 1.5-if-ff:-'-'Z-i '-Wi ' ff- it- X 'f 'ff' 1'..1 . ' ' 21 1 1 ' 11-' . -gs , 'l 1-1 ,35 I .fl ,, , -..,.-,gfg.,,, . l ' L ' A .113 ,.-q11.i, . 151 - .- -,g,,,,1 .1 -5- -1W4.4i,fg'1 -1mgi 1, '.11.5 any it , ,hy--131 1 jg., 5? gg.,- . - 'E 'f1l5ig.+,.f, 1.i.yg5g ,,g2: p.... '?g +'fQi j1, iq, 1 -- fQ fi3't5' 'ffQ,i:,1' ,Q , '-,Z '. 2- 5, :1g,3?. -g.,g .m' ,1 3?, g t 1, . tf iw -Q fihlggu ' ,Qi .3 E1v g,'f.- 15, -?? .. ' SV I -. 'C 'if fy ' 1fg111'- 54 915, 15-4, . . E23 1.211 -11 - ., 1'-e5..,g,Q,,e g4:1r' - 'L --if -Q' f-.gg-. 19- ,, 9- ' 1,55 -1-1'--1. ' 'V M P. -'gf5f3ff4 '53.'-5.-'-.af '1-5-rw. -- f. 1. '-:-,1e.f.,,,' 11h-,z g: . :1a.g?Jg f 5 ,Af f-, g-'s.fi,'if -f5M5,.f -5 .31.1-, 1 ...ga 322: -s-A 1 ', ' ,Q 1 1.1.1. -11 -.g,'1w1-2,51 1...-a , ,..+21.- . Y fr P1 1--4-1 314-'Q :ef f. -.w-1.,51 :g.,1f ' --5 111-1 -P 1.1--. BY, :mdk-11. .. j . , . .1 f. -1 -.1 -Q11 --! -. 5 .....1.S,g-1. , -1 -, Q-4... f. f -1 -1- fr 9 .r'- Y -,Q -. i- '1 M QV1 '-'-?1 q,.f , Q '.'gg1- f -f. 'gq1- - iff' 1 M' ' 33.4.5 --- V ' I-1J Qg1?.-E - - 6-91111 se. 2fe-Q, -.Wi -fri-I '- -gse'11'-VTP- '?12'eFL- 744. -1 15,3 M mm, K, -315AeM,,igqEfax ,i,:'2 , - Y 53,3 , ,kiwi V , 'Ii l A 5gU,-',1 i37!11E1- I 5. - , A .1.1.Q,,,: Hail. ,,1g?gj? .ji M5 J .-5, 1xg?S..,3 5. 1... ..11-:.-f.fwi-1fm- -,.-1s-ur 1 -:- .-111-4-.if-.15-1-1,5-'ff - 1-e 621 '-' fy 1 -- -'Q-asf. .1- rx .: 4-51 mp..-Q 51 Mr?-:?f1:-'151f-1 -ff-M345 11 -'-f1'r.1 ?-'-51 -- Vs- ef, 15211-f , . f '-55.659-Q' 1'5f41g2b -'? f'-J.'9f3,f4'ffS1.. -- if 5 ., 1' 43,6gf-,311M.ifyt? W .'--.iii Q-'3'FAQ5gg-ggf' E15 . 5541 Af, 5 ',.lF1jAj 55 , Qligjggg. -,L-w-21-,- ,g r , ',i..i5- --3--Q5-,2f,f1 1 .jf L, K , 'ggaf ili'-E-' Q'f'PF-5:53391-Qgzaigii 5 '-f5f'-'M 5-.Q A ' - 2' ' PM 452' 'ws' ig...-If-SM' -1 'i'5f'i5f3 '9- ' 5? f'?f ' W-' '11 QT! -' .. 1r .JJ,,Q5i7jggi1 -i,aW ' 31 ' FEW .fgilgvi 'fF.L?'! - j' .'-' ' -'dig' 'ff-Fug . 1 -. '-ES -' . 5-11.1 142,51 .E+ 'ff ,'1. 'g4', ,j- .,-1Wgg,'fy.:'- 2:1,'v711l- inf.-.Q 4-fi , J,,Q5'1,',,.'.1- g:15:1,,-5.k.x.'- :gg 1 , ,,-32.55, '.y.g,-531-f 'gjf.1'-,g..,f.- V gffg l., 'f' .gb-311, 51.53-411 1'g up .1-A .Ed E, . 155 ' -NFL. , .11 . - -V9w.,1fpg'j .-911+ QQ! 4,513 935 I - 515.3 V.- 1. 'PEM-A' 2, ,jf-155.- -'f ,Q Q -f,:f',s ' f.-.-'1L32, ,f-Q,- -1 f: 1 ig? .jg ' gy. 1, '1 -' 1 111112'-'ga-5-1ym'.'Q,+, -'f',f:-f-g::1'gf,- 9...1'1ff 55.11 11.5. 31.3,-1 ,gs , ' g if.-3. 2' ' f' -. -jg 2, .mr-r. , '1-'3gi,f-51 gQ.,',: z1,5- -' --',1g'-- 1Q1J'-1- ..fv,1- W W-?111'1q,11.w .Q-'QE-i..-L. -'m,.,'.ff- 1 - 4 . 'wr -ri 1 , F 1- 4 ,- - f-ff . ' ,ir-Rag 1 , .ui ,qi .phi ' .1 '-.- f - .. K -1.1541 gf .1 H r.2ff1m,,g1-1,',:3'9.z.- ,311-5, ,sig-fs f 1,3 ,iw-.1, , J- -'--1,1- 'fig 1 iiifi- fl:-:iff?L'1g,ggI', 'i1g4 3 .2-5 1:5511 f,-.Q-12-.'.'1-ff,,2,51I41f1 -T !'Qg ii 15.v,dE .P -'ff 'Lf'- -'17-1..' if l . - ' Wil- 5 ,Q- gf '-'5-1' wa.. ,' v-f!'wi1'j55-5 ,- -Mg-T572jff':.W',2,iwS.-'3'.i 75--31i-- '- 3JW:11,. '- ,, '4Jf...f-ng Wi R i41'.,- 1 'W If f',-5 -ggi --fr:f. 'e ,j 'f,:9fi1-'f'g1'1f.-i-if 4, f-'QV' U51 1. f Fw, lag- MQ ufyrv. TJMQ Y. 'ff:1'.1m1i:..,,i'4g'11WL:1'-.-'3 1- -',1at Q31 ', y 1+,L,g.36 f 1 4-A' ,Q- '.1f : fir -' grad' -,W 'x-- - -,f+n1.l,.-5-fy, 1 gg ,.1. u '7fg1,gqfjv., 5W1fg23:,1gi fm1.F,.-,uri-1:, mT: gf 15311: 3.5j1 :g., ---. ,,Ti1 ,.--T 1 --gji12,g2, Ek :Eg--E1 -fl 'W' u.. 1, .,, !,.. 11, P ,. , ..!.,yJ?hR. .1 .51 ,,. ..f,.., ,, , . y.1--.4 1, ,.. q 15 -' - 1' -1 1' ' , 1 5- 1 '- 'F 3' +I-P-e1'1'k-Q Q -' -I 5 '- 5' ,Sf -I .-ig, -'g'.-wg--' ' y:'3.wgg3'1 f -. 'F' ' - 1 ' - 1' - -1 '1.. Z, 'f 3' ' . '.g .':f ' 'H f -.'f- ,. ,.3-21-'-, 2' 'H f '13, , gr- , Z , ' Q 'Q' 43,111 gMLmNj:41m-1.,.,!,.,,,f 1,-3,-A li W5 ,ji-12 1 ..,q,,.,, 5,1 115 my I- gi -.,:U,! ii 1. ,,.A,: ,, I.. ,V W 1. A I 155-1134 , L5 f.,.,0.n,w, sg! M Lf1,,k V: -hi . ,. 4,6552 J. .Q-1-11. .., . gr -. fy' , - 5413 V ,, -wg, :gr -,wail :fig V-1,',.i,E H , 3.2.1, he 1. 2 - -. Eg.-E--31 1 '1v..f. 'fn-: 533- -' 3-1' - '- .Q 4?-if fi' 45 .1 .fgmes ,-- 'Egg-9.15, Mg 152111 f ',tB?f'f?1'i1,'j--41'-il A -f-- W1-S , .- ' Ve -' ff -1 -,ii '- -L ,Sag T '-fltf'- ff ,' , ,11Sggw ay- '. ,M 'lgi'-':1,CQ,,-'Vi--- - 1. wg- .. -gg!-:M-55' , ,gn :ki -- ,Q . -'Jie ,-I-1 .,f., 1,'4yfjf- -51, 51 ,23 ,X ,-, N Uyfj-5?:4 f,i.7-, g.i4q1.,.',j.,j,+. :LI 53,-f ' -ITF ,gt-14 ,gf -'QQ -'E4g1.,1'UP5 ,J ., JJ. -,Q Q J-15551 43, 5 ., 4,35 : niggaz Q, g,j'. 'qz - 415.1 1 1 -1 1 1 . - 11 1,,,,,,- 35131. ' :-.,g1,g.1,..j - Lig:y Ew,rLM,fE,E , 3-Zh 34 S' K-iil'- jf , 11 -. - y-1 11113., , 1-:1 .5 3 ., 31, Q .,-,,.,f,,,,- -1 -2 9. .141 -- f 7 'L' ,j 5' ,- '-,B 4, 9 f,-P1-4 , A ,f-aj , -1,-1-,Q ZV1, 47,2-2-1, 1 ,, ,' 11 , 1, V iw, , l'K 3'f':'- 'EAT'-+77 1:-i' 5-:LW ?5 '-731QH'--i- '-'Sim-' Q.-iff '- -27. 1 -15 f-351' -i-'W - V - iw 1.5.1-5.-. f , ,, :g5,5,v?Q-.,. -rrf. 1. .Q? ?g1,gY-I 2 1 1 a ff- ., ' 1 ' 14 JJ. 1 Ie: --Q 1'-E Q- -1 ' 1 , 'ip f if --2iF,s':l'-1g11j, 1, i, 251 j'f'+j,11- -3' 77 1'--, y -. ,'. -'g gb,-, Eu -fri , 1, 5'.f aga1, 1 511-51511, - f.lL,jP' 51-Jw. ' - - -1 ' 1 ,X-' Qfigsnfii bfifq f xg- 31 - T . Lg Ez :--15156 ' ff' 1- .XX -L 35111, 5,-:ff.11,,,. sf! higllfl-:Lix'- -.-i..? 1- ' -33651-1-511 ---'QL-2fFWi251f,' ,xifh-C3 'j1:g:Q - 1 , 'f 11-f ii--54 E 1 '. Xx 'T ef 1 Sl . 1 .-1622:-P-1. 1 . 11 . W -l,4?.'-f4.if- 11Q14+g-,.'.- '11.-QE-1-1:r'g1.,g'5-11 -Q-.'Y1Fg r4:. -.sim fi-Wg... . -., -ff Siff ff f' - ' -.12 11.5.23 ---511' .4 - ' 'Eiff? 'fS -JBW-' li A' ' 7 ' Rf-1. '31'534'1i i-1- If 'Emi-: S'4?g -ll-'TE' 9131511771 ' 1-fi5'Ly'Z?-4-'-- ' L1-vx-lz'9.,'1'2 j'WI1 F-2 vfiyfr, 45 1411? 51 ' Q. 1 .-1 ,gXi'Q -5 '?WF,5 ?-1.2 5 .S f' 7.151 957 '1'2g1ff?f1l -1 .ff Q, 1111 -1g:.g,3 g11v,F.'4,Ll5.gi2 Min.,5i.Qf4g,1.1s,g1m...f',,-15-1,-1,-291 -Egg. '- 33.55.15 -' - ----5- 4 5 1.-15 1 1.1 15-r La: f 1j1.,,.1,:y '-x.,51,.-a1 ' 'Q--:.tfu-'34-Q5 -1- as mga y1.,, 55,15 11:5 1- 11117, gg, 1, ,,ym.1f1p-f- vi5F' .-fs- ,rf-dgiif. 1535-. 'e..:,.2,- Q--,' , EHR, -- 5-.'-W4 ,1 S'-111 1 an 'I+' I.-,gffI:q4.,g g 5 ' - 'w ,,,jg,,-yq ,1vg1,,,, yr. f ,,1f.11.,. .. 2,4,W,. r ,- ,1 Wx.,-21, , EU.. ,- X wp 3. , 4 , Q- ...,- -,Y -,E 5 W. . . ,fqgffsgy , , ,,, ,.,f ,,: .,11-1bE,ql,i .!,, ,,.-1 '! 5 3,0 F,!g1y,71,jj,f-y3f9.5Eff1' 155, 1- 'ig 'Q v,1,5,,f.,,:,4QQ1?, :?: ,, 315- 21' Qliggfs.. 1 ,+ 'g-Q-1.1. -JJ eg-, galil -fkifg gff - Q 1. j51,r ,1 '. 3,, ..5g 1Q W ..-5 .,-11g11E?gf,J 311,11 .Q 1.-'.f,H:,Sg.',.g?,- . 'MM-..,sfv5:'-g.11E, 1,351-3 1 ,. - ' fi ,eqqfw- --.1- rg 511- ,Q 1 - . gffj,-41x 74 1-,:1 51-,1 ' 1 ai, ,L J' -S 15.13. 5-as .WMC ,H ,,:1 A. V ,nv qi-15,,FUg4fk4iiSLg,w, N 1 .:,A1M,X1 , ,er .35:,3A,yV,l, qY,.,f,1.! -, -:. 1.13, , .W . ,,-,FSI ,tg-514: 1 ,551 .,,,- -,sph q5.f,j:g:.-iL21g111w-,fi igfamgggfbd 31351515 11,1-. .,,. , -Iggys,-.pn X-1.52-1, ,515 14- 5.3 ' y' ff' -493 .11-1 ,Q-Mc 1-1-pg 95 -,gh !'1i : .f.5l -fysg .2 ff- -51, M -3.-1'2 -f MiWiC:'1-'-:T:.1gEgff-.- f Z iz--AW' .0 Y., L 'Q f' J 2-'N L '-1..!y1'i'-m W ' ' -'lpn' ,- I- ' 15,955 14- K A W C. -23 0 daf11 '1'f'4- T11 L 1 ' 111113, 2-1 . wwf. .,i',g1'1rf3if 1--V.. .5-'fr 1: - mg x -'11-1:-1 - ,ng 1-. w, mf , , 111 f fs I- I ? 5 - , ' WMI T55-'gg Q -,'i.,'.' ' U- I ,Q Til -if' ' 1 1 -:A' I J'- 'U I-23' 'Q in f. f .I 7' ,Q-'. 'fQq. :1 'Ea' ,, ig Y. 'j f'I'if 4. ,1 ,'fj j - - Q vig? 'fix f, -H231 Q - 'p' ,1'f,--D' -19.1 13.6 V f, .X -LEU, ff: -1 '- 155 ' . RLVE4 ' 1 - gffffiif' M951 '1 ?'i '-gg 'Glgv fgf'-'-' 2': f1 1fi-w 7- rW'S 'aff - , ' ' ' .'1 .U x' :. 'few 1' - ' f 1- - 1.' ,W ' ii' 1 3-1:2 '-- ?u C , -Q ,ii '. J, '-B'-E. ., 41.1 T- ' -- f . 1 11. .-,mg ,-,, -L-111., f .1 ,, ,.. -, ,, -J, ...A vw -I , -. , 5- ,1 '- , 1--. 1 ' 2 '- '44 11 'f:3:':5'.1--5521. ,. refs- 1- ' . iffy.-5-y-,eff 1' if. '- fi-1 gg 'ff Qfn-151- 1 1.-' Hs?--,1,.'11fsggT'- 1g 11 Q51 311 in- -A '.----:4l5g3gf3g1 ,j1 j'i---1. 415 ,g L '51, .1 -'Q Q' .H-, 115.3 71 - 2 1- . .- ' -?' 41' f .Z.i'f11i1a3f ' -f -1 'T 51 f 1 '--1- .1 . Jw . 1- 1- 45 1 5 1 . - ,,z,.A . , ,J 1, f , W ,N ., +55 wwf: , M A W '4Y 1 if - f--2121 Q 12. 1'3'a. -'1 ew .ii 1 . '- 51 1' Fur -11x 1-11 ' SP Y - -.nfawg xv 11- ,,- , - Q ' ,fag :- - ,-LQ ., ' -rfb .. i' . 2 ig !-'. jr-3 .. ., --1 . 17,-, -,-1 -,W i - A -.. -3 Wx- 5531 ei 'ltd 'i f V ,ji ' -ggms. :f. w.j 4V --':,,- gg'15, J- :ML-'f 'I-wi L1 -1 2.-l gfflafid' 1 1 'd,'gx 'Sj.- f k'ffT 'F 41 31? ' r. ff- S 1 ' '54 . .'.-,gm , 11. 2'- '.f-:gif ' - ' ' 1.3 251 ' '7 '1 -111-51 up 51: ' .lf .,r1-W -5 1 5-gm 51 , 5 jg, 5 11'1.LT:, F1-V' I kiw i AQ .11 q THE TATTLER , i C F - -1 F 1 K XY- I F Q f lll4HlHll - 1 3',g.f 5 5 ,563 ,f f- L. ' Cff eul 31:51 g -' ' fgt' 3:34 ' ll fj - E 8 1 Y-'M + 15 -.. Q 21.4 1 f w .. 1.-..g Z ' X KW X Eiga - 9. NE xx X W . EIN W 3- , Lu? f Seniors 1wwwnuwmwnu11wwrmwwwwnuwwwwwnuwwxxvmxxxnun1xxummulllmmlnm 1 um mmlum TNI! I lI 'I'FIl'IN. I THE .'1',,e4 , Tl' ...A li ERN C ass Officers EUGENE BENDER President ROBERT DRISCOLL LOUISE MURPHY Vice-President Secretary-Treasu1'e1' CLASS COLORS-Green and White CLASS FLOWER-White Carnation. uwwwumwwnuwwwunuuunuqmullqunguu umwwmmwumiyjimwwvilgnummwwvnuwnumniilimulmunnux PAGE SIXTEEN 0 EE THF T-XTTLFR 1 A 1 iliilllunilllnulllllluullnullllilullllluulllllllllllllullllllullllllullllllullllllrnlllllnullllnnlllllmllllllullllllwlllllmllllllulllll1lllllulllllwillllllinllllll:llllllll,llllll-lllwlll lm, mil, ,ml ulllvllllllllllllll- llllllmlllllllxlllllll-llllllvlellllll lllllllllllllllllllllllllmmuw lv will lull ull will llllll ll lull ull ll will llllllllllll lllllrllllll llllrnullwllmlllulllllll ,llllwillllilll...ll....lll.lllllllllwilllllilllmllllwillwillllllillllilllilllwlwlwllwwill llwlllllllllllllll.wll..wlll,lllll.lull, ul ll ll fl l l will ,,,, Wmlll 1 1 , V - , . 1 . T PAGL bIuXElNlE,l'.lN. lwl,,llllll.lll iw will 'l'llIiIJIX GIHI-' 'l'hehn:1, has the kind ol' huii that poets wrile lllllllll. It is like 11 mass ol' spun gold, und the effoct when she ties il blue rib- hon around it is enough to de- light the eye ol' aiu artist. None of the L. H. S. boys ullruel her us she is interested in one of our foriner athletes. -Bess l':1t Club l, 2, 3. 4. Viee Pres. Bess Pall Club 4. Latin l'lull l. 2. DEAN l 0X lt was by his loot hull uluy- illl-! in his senior year that Hog- won his Ill'0lllll1QllC'E' in L. ll. S. His unUez11':1liee in the wood- shon is not an uneonnnon thing :ind his future lrude will nrolm- lily be along ihis line ol' work. HORNY is never in :l hurry. hut. he is ulwzws where he is needed. His jufzpzling is zi sight worlh seeing- lfootbull 4. DIARY l,0l'lSI'I 'I'Rl'NIXN XV-h9llf'Y6l' we think ol' hezlulv- contest, enndidziles. our selection is not il diffieult matter. Al- Illllllgll it is said that hezuity and lll'1lll1S do not :zo lolxetlier, here is one exception to the rule. for she has heen ll hrilliunt student. Heres to hor. ai jolly good eom- raule. and an true friend. -l'heu1- istry l'luh 4. .l.H'li l!ll00lWII'1YI'Ill .luck is one ol' those hovs ezm- zihle ol' niakinlr hiinsell' known ut ull tilues. He eau alwzlvs he found in eoiiumny with Merril hoostine' l'or some L. H. S. uetiv- ity. .luck slurted business as ll draft clerk at his l'uther's hunk -. he opened und shut, the doors. ol' the lll'0ll1l- L. H. S loses one est grins it has ever possessed. -l'hemistry Club 4. lIXl!'l'II.K l,l'X Nlartha is one seniors. She has ol' our quiet been :l diligent worker in :ill ol' her studies and moreover is one of the most ut- lractivo and ll0lllll1ll' Eirls. It is ai sad hut Certain fuel that Kokomo. not L. H. S.. hroup.:ht her hack to us froin C'zllil'ornizL. IDONXLII Yll'kl-IRS Don is the boy with tho big: grin on his fave. He is always ilfllllillg or PIll0l'fill1llllR il crowd with his wil. As ll side line lo school work, Don einnloys him- self in the grocery husiuess. - Chemistry l'luh 4. l lim ul l ll lllllll ll ill mul l llumlmul lmllllrluwm lmnllllllulllllll llunnmmlnvlmm mm K1 lim lull l-lulmlllllwwlllvwa E' S l e 5 E S 5 S 3 THE TATVTLER miriiiiiiwi ui ii mm uriiiwi ii iii ii iii iii iii ii iwwiiiwiii,-iiiziiiiiii i:iiii,1iiiwiiii:mul,limi-mm',iiiiii.iiiiw-iiii1i'11iiiirliiiiiimiiiimlviiiininiiiiiiniiineiiiiiiiimiiiiiiiiiiii iiiirmiii riimxmi iiimiiiiiuminii i iivimi iimmiliiirlliiiilwiullwrmmlwil4iiiillwilllmllllwlllli i E 1 i wmlwii liiiiilmii ui un i BOY Il KEN IM lil. Note l1is horn-rimmed spec- tacles. They give him a look of owl-like S0i9llll1lf.Y but his con- stant iiow of jokes and bright. sayings belies his looks. These same glasses were a severe handicap to Body in his basket- ball work. but when most boys would have been discouraged, he kept on trying and made of himself il valuable acquisition to the I.. H. S. net crew.--Baskeb hull -l. Vhemistry Vlub 4. I!I l'H GliIflSH.Ul Of all af the students of l.. H. S., Ruth is one of the most retirins. This does not mean that she is not accomplished, for she is very well informed along commercial lines. She special- izes on week-end trips to Flori- da,-- Commercial Vlub 3. 4. l'.tl'I. IMYIS Paul is an example of great intellectual power in a small body. Despite his hesitatinii manner. he seldom failed to have the correct answer ready and was generally amon,-z those pre- sent on the honor roll. lSI'IRNll'I'I KHSTI-IR. The class of 1925 has been blessed with a bevy of girls who were brilliant and industrious enough to earn their required credits in three and one-half years, and Bernice is by far not the least of them.iChemistry Club 4. Latin Club 1. 2. 3 .4. IIAIROLID SHINN He is a boy who, by his unas- suming and quiet industry. has earned a name for himself as one of the first class students of I.. H. S. lt is not easy to pene- trate his shyness: but it is worth while to do so, for he is a very likeable fellow.--Vocational Club n 'J . MARY MHDLANID Mary is a girl of artistic tem- perament. This accounts for her great amount of musical talent. She is a prominent member of the Music League. the co-author of our school song, and one oi' the leading pianists ol' l.. H. S,-Latin Club 1. 2. 3. Vice Pres. of .I. M. l.. 3. Magpie 3, 4. Junior Music League 1, 2, 3, 4. Pres. Junior Music League 4. it 1 umnmmmuuuuuuuwumuun PAGE l'l I G HTEEN imllt. un iii st E, ' T A T T I E R H In A ue' xuiiumnu iliiimmnwuvumm: all uiimvmitxiiiiuuwi ituiiinmitmmmimlmiummimmtmmmwuummmnminuiiiinniiiiiimiiiiiruiiiiirrtuiiiinuuuvxmuwmwmum iiiiiiixi1iiii1:1iiiiiiniiiiiiruiiiiitutttiiiuiiiiiiiuiiiiiiiiiiiiitviiiiiiiiiiiiiiiilliiiiiitiliiiiitiiiiiiiniiiiiitiittiitviiiiiuuimmiiiivtwwtiiiiiuitiiiniiiiiimliiittniiiittulitiiiniiiiiiuiiwtmmtmmmuuiiiiunmumiwumatt llt til gllltt tg ,zz ,:. Ei ,2. Ei E. ig. iuuummunummumimmttnummumtmumtttttttttttgttittiittnitttttttwwtwin4iititttitttttttgwtitiwiivtluttiiiirmwmvaw1itt wit t tw i t will vi PAGE NINl'I'l'I41l'JN. it annum Iflilllb IVORY 'l'o look at hilu one would not think that hz- had tln- slixhtvst suusv ot' humor. but hv has. lt is not such at small amount either. Fred would lwyo made- us a good joke editor had it not ht-on that he is onv ot' tho host typists in our school. Frost is quiet. stvaily and hard workinE. - Boss Pal l. 12. Il. l. 'l'attlQr Staft' -l. ll .K It lil I'I'I' Id I'1'I I'I'1 I! DI .t N Harrivt's lmskvthall ability made' he-1' one ot' tho mainstays on the Senior girls' tvani. Her wit and graivty have won for her a reginwut ol' friends. Harriet not only tiki-s to l1ilYG good times hut she has thenr- Girls' Baskvthall Team -l. Ql'lNt'Y I'0Il'I'I'lli Q. P. is the real livwpic ot' our class. His rontapgious grin l1as wrought him hosts ot' triennls. Quinry has such km-n svuso ot' humor --a joke lived IIOVQI' he lalwlvd t'o1' him. His loyalty to I.. H. S. van readily ho se-en. for ho has liven a, daily commutor to our school for four yvars.- 'l'oonvrville T ro l l vy t'luh l, 2, 3, -l. t'hvmist.ry t'lulm -l. Latin r'luh 3. ICRXI-IS'l' IKICXIDI-Iltlt'K Mevt, Nic-lx , Mr. liurke's star history student and tho svhool clown. llow uuivt and u9acot'ul the halls will seein without him! Nick is one ol' the most faith- tul lll6lIlll9l'S ot' that ct-lelwatotl 'l'hru0 AlllSkl'El90l'S organiza- tion. as well as one ol' our most lltllllllill' students. - Vocational Club 2, lt. UODlll1t'l'Cltll Club 4. liI'lRN.KIDlNI4I WXISNI-IR Thu following may wvll set forth llornadil1e's Dl'lllClD1t'!SI Not for glory., not tor self. not to lw surv. to ole-use myst-lf, not for any meaner 0ndsfAl- ways hy rvquvst ot' frivndsf' - Latin t'luh l. ZZ. Prom. Vommit- tee 3. Magpie Sl, tt. Girl Reserve Il, 4. t'heinistry Vluh -4. NIAIHXN IPl'NN Vlever! 'l'hat's our Dunny! 'l'lierv is nothing she rant or won't do for you. and it will he done just a little better than anyono olse- could do it. Marian talks i11 italics. has ll llare tor writiugx, and quita a talent t'or art.-Prom. 'l'om. 3. tliri RG- serves 3, it. Magpie Il, st. Vhem. Vluh -1. 'l'at.1lor Staff. num mniiimuiiimuiiiiiIniiiiivmiiiiiuiiiiiinuiiiiiruiiiiiimiiiiimiiiimuiiiiiIniiiiismiiiinuiiiiiniiiinmiiiuitiiiumuiiirliiiiinimiiiili rf: 5. .il 'Q' fi 5 t -it 22. .Si Ei El E, Ei El E t iii liirllliiim l I mm 1 1 T H In T A T T L In R Inu llwlruwnl mlxiwl ii numu i umm i ima ui u ii lwuiiiiif iiiiff53iiiIff'3iiiif Yliiiffu ilffiiifflliiffw iifmliii1ll1iIii153Qiii71'iiiJiX333Qrii'li'iriiiliiiiilillliiviiillliiiiiiliiviiltiiiiilllliriil n umm n i v u M is iw iliiviiiiiiliiliil iniiiniliiiiiillilliiiiiiniilllliiiiilhilliiixiiiiiiuiiiiviiiiiiixiiiiiiluniimiliiiuiiiiimiliiiuiiiiilliiiiiniiiiiumuullwulllmllliiilululllul tiHR'l'R.l'Dl-I HYAXS If you want to have a. good time. just get introduced to Ger- trude. She is a Denny. lovable, little girl who can make at com- edy out of at tragedy. If you are angry, one Elance ut her smile- wreathed face will dispel from your mind all thoughts of tem- per.-Chemistry Club 4. Glee Club 4. CI.ll l-'0RlD 'l'I-ZRRY Zeb is the faculty member ol' our class. When the Riley Junior High felt the need of a printing instructor, they enlist- ed Cliff's services and he at once became Professor Terry. Clif- ford never let anything or any- body interfere with his basket- ball training: and as a result of this, he attained such perfection in this sport as few L. H. S. graduates can boast.-Basket Ball 3, 4. l'rintin,fr Instructor 4. Athletic Board 4. Prom Commit- tee Il. IREIQNICE ROCK!-I Bernice, our literary genius, is attractive, vivacious. and full of fun. She came to L. H. S. from Michigan in 1922. Her pep and good fellowship have made her one of the most poDlllPU' girls of our class.---Magpie 3. 4. R0lll4Ilt'l' l.l'l I'Ll'I He smiles. and smiles. and smiles. Slow and easy going are terms descriptive of Bob. He has a drawl all his own, and he uses it very effectively when givin? comic readings and singing fun- ny songs.--Band l. 2. 3. 4. Or- chestra l. 2. 3. 4. NIA H McCl.0SliY Mae looks mighty nice in this picture. but she is even prettier in her horn rimmed glasses. Un- like some people, she wears them because she studied too much. Because of her mild manners and gentle voice. her brilliant recitations are a source of JOY instead of envy to all who hear them.4Girl Reserves 2. 3. 4. Sec. Latin Club 3. Music League l, 2. 3. 4. ROB!-Ili'l' ERB Bob proves a tireless and conscientious in everything that he attempts. and he has attempt- ed many things. His witty say- ings have made him one of the most interesting members of the class.--Track Team 3. 4. Mag- pie Staff 3. Sec.-Trees. Chemis- try Club 4. Tattler Staff 4. Latin Club 1. 2. iiiiuniiimliiiluiiiiuiiiiiuitiiiwilliiuiiiiiiiuuvgfiiuiiji :itililumixiiigulfiniliinulllniiiiiuiiiilgiiiiilliitgllggiitggli!!!33willyggqiilgggiilggiglliii iilnlllml PAGE 'FWENTY 5 1 1 1 l l l PA T H E T A 'I' 'F L E R 111111111111111111111111111111111ia111111.a.1111111a111111111111111111111511111111111111aa1111111ia11111111111111111.1111111111111aga1111111aa1111111111111111111111111aa111111a111111.11111.111.1111111.11111111111111111111111111.111111.1111111.1111111.11111.1.1..1111.. l 111111111111111111441111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 111 111111111 11 11 111 1111 11 111111111111 11 1 11 G IC 'l' W E N 'l' Y - U N E 11111111 i111l111111111i11111111111111liii1111iiilll11lilil11R911lll1iii1111llillll1111111lll111111l1liui1111llulii1111111111111iiiil111liiii111liii111111111111111111111111111111111111111111111111111 .ll'Nl0R l'l..Vl l' A st1111111'l1. lflylll senior. llis 111111.liiy of p.11'11y Ill2l1l0l' a111l his 11l1ililyto11s11 il lillllllgllt l1i111 sum'- c'11ssl'11lly llll'UllQ'll l'0lll' Yl'lll'S ol' 1lil'l'iC11lt sl111li1-s 111111 0tlll'l' oh- sticles. H11 111-11-1' takes 1111 11111ch SIHICG, l111t we 11lw:1ys know Wllllll l1c's ill'OllIlll. l,11ti11 i'l11l1 l, 2. 12. .I UII-IS IDIGXX .li111111i1- ,HIS lu-1-11 one ol' our l1'z1c'k illflll. Iillilllg sevoull ill thc- high h111'1ll1's 111 the S0l'Illlllill nmol last. Y0lll'. llc was Ollll ol' the 1'c1J1 os1111l11,livos from l,, ll. S. in tho H1211 Sl.11tv Swillllllillg lllC9t.. .li111111i11 illl0lllldS i11 Irish wit: co11so11111-11lly 1111 like l1i111. 'l'1'a0li llllllll 2, 25, -4. Pros. ol' 11110111 4'l11l1 Al. Amlv. Mgr. Nl11a1111- l. 'l'11ttl1-1' Stull' 4. R,l l'II ll' .K ll NI l'l0l I Ruth was Dlll' livelv .l111111111'y 2l'2lllll1lIt' who llSll1lllX' 111111o111'v1l 111 the Class-1'oo111 with her 111'111s lozulecl with books. She is now llllI'SlllllH il h11si11oss 02ll'E'l'l'. illlll 1111less so1111-1l1i111: l1111111o11s, will 111'ol111bly 11111k11 Zlll exvvllm-111 lmookkeeiwiz Wo 01111 V0lll'll for the l'11.ct H1111 ihore is 111, lens! one 11erso11 wl1o will sw that lhis somotliiiigz l1111111e11s. .l0SlfII'lI VIVIAN .lov is om- ol' the 111ost siustic' radio l'2lllS that has ever 1111111111-vml. H1- 11tl1letiC-lookiiix fellow 111011 of l1l111'l1, wavy hair. Roari- ers of lust x'o:11 s 'l'11ttle1 ' may C'l'lli'kl'll. lu- om-0 1111tl111- l,. ll. S. IS ll lull. with il 210011891 .lov ol' he-ing lllll il wus only hecause 11111119 into 111111111111 witli ll 111111111 while l1liU'lllpI lmskot 111111. .l0Sl'1l'lllNli M.N'lH'l'I'll She is not 11, 1loc11I1d1111l 'ol' Sl111kes1Ju11.1'11's lXl11cl:ctl1. lhililw this f2llll0llH l?0l'S0llllfI6', .lose- ohine has il. vooy lovz1.l1le1 1lis11o- sition. I'lVUl'y 115111 fm' fOlll' Yl'ill'S i11 l'l'0lll tho 0111111- sfooml svhool work. liz1111e1' ure svlclo111 Girls' Reserva-s 21, she has 11111111- trv and 1lo11v She and Alim- fo1111cl r11111rt, 4. Latili K'l11l1 l, 2. NIUCIIMII ROONS The girl with lhv il111111- 1-olo1'- 1-1l hair who zoos sc1111111v1'i11g th1'o11,f:h the l111lls 11lw11ys illI0llI HP1' 1111011 l111si11vss is Nlz11'il1z1l1. highly dovoloiwml sense of lllllllill' made hor i111lis11e11s11.l1le on tho M11.1.r11ie Stull' 11s ll joke erliior. l111ti11 Cl11l1 'l, 2. .I1111ior Ari lion- :I1111 2. G11-o l'l11l1 2. .l111'1ior M11- sic l,e11g:11o l, Cl. Girls' Rosm-1'v11s 2, 3. Blllilllltl Sl11.I'I' 23, 4. 1111111111111 1111111111111111111111111111111-11111111111111111111111 11111111111111111111111111111111111111111111111111111111111111111111 1111 111111111111111111111111111111111111 THE T.f5TTI:ER www .1illuvl1llllwmwiuwnmuu ww um 1lllmvlllrvrwllrlullllllulll1luwlllwillwanllllumllmmllxunuumu.ummnm E E i 2 2 5 I-IS'l'HI'Zlt Rl-INN Though she is less noisy than most of us Esther is heard in the class 1'oom. Her answers show an intimate acquaintance with the text books. What will they do at Girl Reserve meet- ings next year with out Esther? She has always been there with smiling willingness to help.- Commercial Club 2. 3. 4. DORIS BARN!-IS The Pyramids, King Tut's Tomb, and the Taj Mahal-Doris has seen all. for she is our pro- fessional glohe trotter. Although the misfortune of a broken limb will keep her in school an extra semester, we insist upon claim- ing her as a member of the class of '25. Our class spirit has been greatly contributed to by her un- limited fun and enthusiasm.- Art League 2, 3. IMIJAS NIINXICK He is not well known for school activities. but he is an industrious student. After school-hours and at nights he trails the theatre aisles tempting our appetites with popcorn and peanuts. An ever present smile and a helping hand are his out- standing characteristics. MARIAN BAADE Among the notables of the class of '25. is Marian Baade. the first girl student to receive an HL sweater. When we say student, we are not using: idle words- Buddy is all of that! Prom Committee 3. Girl Reserve 3. 4. Tennis Vlub 3. 4. Chemistry Club 4. Magpie 3.4. Ed-in-Chief Magpie 4. Girls' Singles Tennis Champion 4. Vlass Play Commit- tee 4. HAROLD BARR This is the boy who has been able to gratify his desire for travel. He now regales us with tales of cowboys. Indians and the picturesque half-breeds. De- spite his contact with the world, he still has the grace to blush beautifully while reciting. Rl l'H NEWFODIB She is not very noisy. but in class she can zive a recitation that makes the teachers sit up and take notice. Ruth's person- ality is the personification of good nature and friendliness. -- Chemistry Club 4. FEE!!!FII!!!1!!!!lll!!!!!!lY!!!!!!!!!!!!!!?!!!!!!!. I!11U!!!!!'!!!! ?!!!!!l'!!!T1 !!!!l 4 '! '! 'l l l f'e PAGE TWENTY-TWO ' 'j'+aia ia.'s.maim..tgg,amgtagaj......,.'Vj one ol' the honor roll girls. Much THE TATTLER gunmunmluunulrumlimuiinumiinumiimmiimmiilun:iiitumiiiumiiinmiiimuiiiiuniiiiiuniiiiumiiiiumiiiiiuniiiinniiiiluniiiiiiiiiiiiliiiiiiiiitiiiiiiiiliiiiiiluiiiuniiiiRiniiii1in1iiiiiSiuiiiwiiiiii-itiiiiiliiiiiilitiiiiiumiiiiin1iiiiiiiiiiiiii:iiiiiiiiiiiiuiniiiimwww-mmiuiiiiiiwiiiii mm um omni i iw wmumiimimuviwiuuwi viiiiiniiiilluwimmimnunimmmmlmnnmmnw 3 E 2 5 ,. . , , - r . . - 2 -V ' f- - WIXIH IIHHIM-lull E 2 We all know Mary she is I ol' this honor is due to hor excel- l lent cooking: in the czifeteria.. 3 . hlie is now serving: the Golden ij l Rule as a sales-larlv. E . lg 1 2? NMHII HX RIIY -' gg The honor roll has often Car- L E2 lied the name ol' Naomi Hardjf. 1 gg She intends to matriculate at De- . - 1 l A 2 s: Pauw. and later educate future IE l 1.. 1-1. s. sfmumts in the little F 5 E known art. ot' cooking:-lfloine l ltlconomics t'luli 2, 3, 4. Girl Re- l l 3 serves 3. 4. llatin Club l. 2. .. Nl li LYI N Ii I'l'l l'l'I R NI .K X Melvin is the light haired fel- E low who has silent most of his 5 3 time in the vocational denart- Ei .si ment. He is rather quiet on A ii' E .3 , E3 most. subjects. but. loves to talk l-, . about the radio. We expect, to E2 see Melvin unions: the graduates l from Purdue in l!l2!l.f Vocation- Q ul Uluh 3. 4. .norm Nnrr XYork. haul work. and nlenty g sg of it is John's creed. ln school E 1 and out. this motto has func- .. gg tioned. .Iohn's nosition as a drug clerk has decided his l'llllll1'G ca- ESE reel' for him. it 55 I'1V.KNtllfIlilNl'l l4Zl,l'I'ZRS -1 A . . N lCvan5.rel1ne is quiet and very ai' studious. Sho has graced our .2 gi honor roll almost everv renort p sinee she entered hizh svhool. , E: She is an artist. and a musivian. Ei l.. H. S. will renlelnlwr her as E one of the rwomoosers of its I school sonar- Latin Club 1. 2. 3, g fl. Tennis Club Il. 4. Soc. Tennis 1 Uluh 3. Junior Music lieazlle l. 2. Si tl. 4. if 4 .:. XLIAN MOSS .gg Peter ont- of our best football ' Eg veterans for the last two vears. 5 .:- mov easilv he defined as the , E2 EI tifrhtinz end. lf vou don't fret X out, of the wav. l'll knock vou out. 'ls his method. Peter's l 5 most praise worthy cllziracteris- S tic it that he alwavs attends to I 2 his own business. Football fl 4. gi f Latin Vluli l. 2. t'l1emistry Vluh E: , l 4. E ff 12. PAGE 'I'Wli2N'1'Y-'l'llREE. THE TATTLER i i iiiiiiihiiiiiillltiii iiiiniiiiil iii iiiilnul ww mm wir iiiulliiii mmlmmliiiiiilumullumlimi will tw iiiiriitiiiiriiitiiillwmliiiiillmii tiiiliiiii uiirliiiiiimiiiunitiiiimimmiitlllltiiillltiiii iiiiilltiiiiluiiiiiitiiigiiiiiiigiiiii l'Al'I. SI'I'l l'I.I'INlI'lYICR Paul took more than the usual four years to reach the goal, but he stuck perseveringly to the task. After all, itfs the trying again. though once defeated. that counts. He has not been with us this semester as he has been learning the oil bnsiiiess. Who knows but what he may be our coming Rockefel1er?---Voca- tional Club 3. A M ll I i IA ll, Il l'T ll R A Very poppy girl is she, with soft brown hair and eyes. Though she played tennis 'gainst the best, she always won first prize.-Sec. Treas, of Class 3. Girl Reserves 3. 4. Pres. 3. Com- mercial Club 1. 2. 3, 4. Tennis Club 3, 4. Vice. Pres. Tennis Club 4. Latin Club 1. 2. Senior Prom. t ommittee 3.Girls' Basketball L 3. Girls' Singles Tenins Vllillllllillll L 3. Girls' Doubles Tennis t'hainpion ll 4. Mixed Doubles Tennis Champion Ii 4. ARIN IGTTA M A RURUM The class of '25 is to be con- gratulated in that Arinetta. af- ter hei' two years at Lebanon, came to I.. H. S. She is an ex- cellent student. Her pleasing personality has won her the friendship of the entire school. 4--Glee Club 13, 4. Captain Cross- bones' 3. Gorl Reserves 4. Rlilil-It'l'A ll0l,lil-IR Despite fancy fads and flims, our class still holds one of the ever popular old fashioned girls. She still clings to the l0ng-hair- ed minority, although the class ranks are overwhelmingly in fa,- vor of bobbed tresses. She plans to go to summer school and af- terwards to cast her lot with our teaching force. Hl'Il,l'IN Kll!lil'ATlilt'li For Sale. a Physics book by Helen Kirkpatrick. very cheap, tthe sooner the betteitl The contents therein had no attrac- tion for Helen. Despite her in- ability to acquire Physics, she is in every other respect a good student. Fiery red hair, Sl0W speech, and a happy smile char- acterize Helen. 'WA Y N IG R08 Il RTSON Wayne is noted for his earnest application to Work. He can give an Al recitation. a flood public speech. a fine jig. or effective service as guard on a football team. He is the heavy weight of our class.-Football 4. I3PE!!!1I1K!!3I33P!!!333FE!!!11FE! lll 'i111F!!!3333F!!!333F!!!313'ET11U!!!11!!!!'ll'!!'1ll'! 'l'!!'413F!!!33I!!!13YT!!!I3?!!! 3?!!!!131!!!'ii '31F!!!!!!!!!1!!!!!!!?!!!!!! ll R 'I' XV IC N 'l' Y - I 0 IT R GILIXIDYS R.l'IYIlllR,N .sz 'Fhere are two reasons wlll' 2 gs. Gladys likos to laugh so wcll. is 1 W 1 V i 1 THB 'lA'1lLluR AlmullltumllnumlnunlllunllmmllllnziillluiiitlllnumlnullllnmllmulllllumllmmllmmllmrlimllnumlmmlllnulllllmlllllviiilllviiillllliiilwilluhmllnmllmulllmllllmllllltulllllitllllllVllllllinlllllitllllllilllllin-1llmlmummlmlmilllllmlllllnllllllullllllinllliliii:lllwwllmullmmlmlmuwmlmlmmlmmllmulllllmlllllinlllllmlllmlmmlminuummlmltumlmmlllmlmtmwulmmnuuf l,0l'ISl'I lIl'Iil'llY N Louise has cycs that. snan with g lite. and hair ol' raven huc. Shc makes many fricnds wherc c'rc , she gocs: Shsfs Irish through I and through. .lunior Music lma- 1 gue l, 2, 23. t. Vlass ScC'y Il. 4. ' Sec'y Vhcm, Vinh t. Sec'y Junior 2 Music Leaguc Sl, 4. Latin t'luh l, ' 2. Sl, -4. 'l'attlcr Statt 4. t'lass Play 4. IMYIII IIl'llSON A The cunning cluh is about. thc 5 Ei only High School organization in which David has not, tzikun an ' if active part. His credentials placc -. E him high among who is who in E gg li. H. S. und his industry has 22 put him equally high on thc hon- K 2' or roll.- lioostcrs' Club 2, Il, 4, E Pres. Boostcrs' t'luh -l. Idditor I 'Fattler -l. tli-Y Club 4. Prom. 5- t om. 3. NX ig tk Mask 3. Adv. Mgr. is Magpie 3. liitlc t'lulm il. -l. llrcs 3 t'hem. Clnll -l, t'lass Play Al. E ll0INl'l'lIY lil!l'lil-I 5 There ncrcr could have lice n a girl, who was so swect and charming. Hcr winning ways, 1 her winsomo smilo. Are both dis- 'Q a.rming.n Prom. Coin. 3, Girl Ro- ' serves' 4. .lunior Art, lieaguc Il. 2 Latin Club I. 2. l'Ilit4I'1Nl'I IlI'INl'l.UYl E Eugenc has worked stcadily j with us t'or I'our years and has many zlchicvcmcnts to his crcdit. It's All t'or hnsincss with lflu- gcne. as is shown hy thc I'act g 2 that hc is onc ot' our honor roll 2 E students. Yicc-Pres. Latin t'lnlv E 2 l, 2. Bus. Nlgr. Magpie 3. Prcs. 2 . Vhcm. Cluh l, .lunior Music l.ca- gue 4. Senior litlitor 'l'attlcr l. Hi-Y l'luln -t. Vlass Play' Com. -l. . Drum Corps l,1l. Vlass Play sl. mm mm First. hecausc shc has that kind 5? oi' disposition. and second he- MQ cause shc has such nrcttv tccth. 5 The Art dunartincnt is to hc ' - , congratulatcd as Gladys is a. product ot' it. Glec l'luh l. 22. 22, . -4. Sec. Latin t'luh Il. .Iunior Alu- sic Lvaguc. El'tiI-INR IH'INlbIiR lflugcnc llcndcr has lu-vii a 2 V most energctic and willing stu- 5 dent. Any organization could al- '? g ways rely on him to support 5 any nrojoct, it started. 'Ho is :H good exanmlo ol' what constant E striving toward a goal can ac- t comnlisli. Latin t'luh 2, 3. Vicc- Z Pres. Class Il. Vlass Prcs. -t. Boosters' Vinh -l. Hi-Y Ulull -l. 2 .lunior lllusic licaguv SI. 4. IlllllllllllllltllllllllllllllllllllllttlllllltlllllltlllllltlllllllllllIIIlllllIllllllllllllllllllllllllllllllllllllllllllllllllllIllllllllllllllllllllllllIlllllllIllllllllllllllllIllllllllttllllllllllllllllllllllllll llll ll lll ll llll llll llll llll llll llll llll llll llllu-lllllllitllllllllllllllillllllllllllllrlllllllllillllllIlllllllIllllllllllllllnlllllllllllllllllllllllltllllllllllllllllllllttllllllltllllllllll lllllttlllIltlllltlllllltlllllttlllll PAK-lu IXNEINIX-ltlllu. THF TATFLER QQLHNN RIGID Skinny has at real tluzil per- sonality. ln every day life, W is a D2l.I'1l.3JQOI1 ol' politeness and aicntleniunly conduct: but on t hurdwooel court he is metamor- phosed into a fighting demon with absolutely no re,'.rz1rd fo anyone. In spite ol' this, he plays sduare :mtl is an all round fel- low.-Busketbuli 21. 4. 'NI A MM li.ll'I' lleHAVl'1N Niargaret has served our high school for four years thronzh her efticiency us at member of the orchestra. She possesses unusual musical ability and is planning to take up an extensive study of the violin and voice in illfii2l1'12llD0iiS next fall. Her friends. the whole school. wish her SllCCPSS.7Ol'l'll4?StI'i1 l. 2. 3. 4. Junior Music League 4. TIIONIXS 'YRINOSKY Tommy, get your gun, need not be suili twice to this mem- ber of our class. Hunting: is his iztvorite sport. l-le can ulwzivs rind companionship on his outl ings as he is at very friendly fel- low.-Rifle t'lub 23. HIDNX MAH IllRS'l' lier pleasing personalitv and shining brown eyes attract your attention at once. Because she is lalwdys on thei spot when there is anything.: to be done. she lius become one of our lead- PVS. Rlt'lI.tliIP Ql'lLl.l'IN Dick will probzibty make at good Senutor some day because oi' his propensity for cujoling people into doing what he wztnts them to tlo. Despite the iact that he haul numerous interests which kept him out of sehol on vurious occasions. Dick made enough credits to be among those present in the clas I' '25, N OILMA ti ll0 R11 ll Norma is just brimming over with enthusiasm. She may al- ways be depended upon to shoulder responsibility whether Work or play. A g1'eait many of our Y parties owe their suc- cess to Normnn's initiative. her work. and her lSZLdG1'ShlD.f'- Latin Vlub 2. 3. 4. Junior Music Lea- gue 3. 4. Secretary Junior Mu- sic' League 4. Girl Reserves 4. imlmiumi11lmiimmllmmllmm11mmiiumiimmimlmunlmmuumnumimuiiumiinmiiiuniiiinniiiuniiiiuniiiiuniiimmimmimmimlniuunum:mu:muilnuunlumnumuHiii1IniiinmiiiiluiiiiiniiiiiIniiiiIniiiiimliiiuniiimullum1lHuniiiiiuiliiiiiiiiiiiiiillliiiiiuiiniiiiiiuililiuuiiiililiiinumnumnumnumimminiiiuniiinuiiillllwilnwiiliiiiiixwilliiiiiiiiriiiiliiiiiiiiiiiiii , , 4 V v 1 r w 1 v V IAGII l'VNlC1NlX-SIX v 1 THE TATFLPAR fgliliiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiliiiiiiliiiiiiiiliiiliiiiiiiiililiiiiiillnmliliiiililliiiilllliiiilliiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiliiiiiilllllliilliliiiiiliiiiiiiiliiiitillllilriillliiiiiliiiiiiliiiiiFilliiiililiiiliiiiiiiiiiiiiliilviiiliiiiiiiiilililiiiliiiiiiiiiiliiliiiiiiiiiiiiiiiiiiiiiiiiiiliiiliiiliiiiiiiiiiiiliiiiriniiinmiiinniilllmlllnullllnulliilmiiinuiiiiumilliimiillinllllllinlllminliinmiiinmiilimiillilluimlmiimillllumlllliiiiiiiiiiiiiim ggi 111,,4-1'1,,,,.411'1-..'-----....,-,,,,. ,,,.,..,,,,,,..,...,.,..,....... ,,,.....,,,.. .... ,,,.. 1 V 1 1 1. ,,... .,,.. .. . . . . . .. . W Es N 2 Ei E? Q55 i5f :Es N1.tINi.Kl!I'I'I' IIISIIOI' Pez is one- ol' the livliest mt-nihers ot' our rluss. ller artis- tic' dancing wus one ol' the sne- cizil feziiures which made our Vuudevillu such at sensation. We are Certainly Droud to have her wear our '25 Din.-Girl Reserves 3 Rl1'Il.Hlll IIl'lil-IIC'l'Z Good old Dick! Thz1t's what we'll say when in future days we look over this book V -und not without reason. either. Quiet and easy going, every ready to ussist, perpetually working for tho school that is Dick. Mighty hzird would it he to find someone like him. -Latin lflub 1. 2. Ciwin- isirry Chill 3, 4. Footlvull fl, -4. Track 3. 4. !l.HH'l.K ICIQIIINGRR Although Blau-izt is :1 lady of fashion, she is one ol' the best. high school SWillllllG'l'S in the stzile :ind wields st wicked len- nis racket. Sho has finished the I.. H. S. curse in three :ind one- hall' yeurs.fGlee Club 4. Music League 4. Latin Vlub IZ, Art lma- guo 3. l'hein. Cluh 4. 'Penins Uluh 4. Girls' Basketball 4. ROIiI'IlR'l' lblilSl'0Iil. Red haired Irislnnen :ire coin- inon: but ones like lloh are vc-ry rure- in fzwt. as fair as we are C011Ct:ll'1l9t'l. he is the one und only. Warm licurted, generous, and with ai slow druwlim: speecli he is the direct antithesis to the fiery' teiniwred llihernizin ol' llct- ion.f Fha-in. 1'ulh 4. l'1ll0lSl'I IlI'l l'I'lll As the ut,t,i'zu'live dauii.rl1ter ol' the nrillvinail ol' the .lunior High, Eloise hats vertaiinly kent un the fainily renutzition for learning. N0 Sllllievt was ever too hard for her: and what is more, she tin- ished her course in seven semes- ters. illlmzgnie -1. ALVIN l'l'I'l l'l'l' Yes, this is Al. hut one has to know hini well in order to fully zippreciute his unique und rv- frosliing lnnnor, us well us his stzmunch loyalty us at friend. Al has at state wide renutution :is it basketball huckguzird, and he earned it hy his ailniost sunerhu- man athletic' ability and faithful training. He st.u,x'x'etl, too, in football und t1'z1.c'k.--'l'i':1ok 2. 3. .4 lizlskethull 2, Cl, 4. lloostors' Clulr 4. Football 2. IZ. Athletic Board 2. 'l':ittler Stuff -l. E Q s 5 2 il 1. Qi ls 2 5? 2 3 2 Z 2 Er 2 -S 5 il 2 3 ii, 2? E? is 3 5 s 5 5 E .iiwvmmnunummuumn-mmll.hll.wmmw-ww1wmwinuun ll l mini ll ll l ll iw ll ll hun l lfonmm l i 1 umm PAGE 'FVVICNTY-Sl'IVEN. lllwlll llllulm lmllmrmwlll l l l fl ul l litllllullrllmlmm:illlllmulllwluul mumlmwml lmllmmllllllrllllllll mm mlllllmlllmu ml mu llllll ill lulmm mu ll ll llinlllllliilllllillllllinlllmirllluiillllnllllllwilllllinnlllmillllliillllliiilllliliillllllilllllliiilllHillllliiilllllunllmnlllliiulllwiuuulluuiulumiumwlllllmmmullull lluml lu l ll lilllil ml l ll Ill lllllmllllnllll 3l.UiII'I IH'1Nl0l'0l'l,0S When at girl comes from ucross the ocean to join 11. high school. you muy be sure that she is go- ing to make the best of her chances. and Marie has done just that. She is at very charm- ing little lady, and we all like her.-Junior Music Leuglle ll. -1. Girl Reserves' 3. 4. GORVIPON FATICS We will long remember Gor- don for his ability to play a vio- lin. Nero. himself, Could have done no better. Judging from his knowledge of Civics and his propensity for 2l,l'Hlli1'lR', Gordon will become 0116 of our leading lawyers. ANNA Dl'ZNl0l'0l'l,0S Whitt is said of one can he truthfully said ol' the other, for they :ire iiiseomable. Sho and Marie liked our country well enough to become naturalized citizens last February. although they were citizens in snirit long before that.-Junior Music lieu- gue 3, 4. Girl Reserves 3. 4. l.l't'Y I-ITNII-IR Lucy is noted for her happy smile and sunny disposition. Whenever the rest of us are Don- dering over a hard question, Lu- cy always nous up wQth the right answer. She is often called Mme Lucille because she looks so like a French girl. but she is American clear through.- 'Latin Club 2. 3, 4. G LEN 'M A'l'Hl+lR. Glen may be light headed, but he most certainly is not light headed. On the contrary. hi is very studious, quiet. and unas- suming. No girl has ever elic- ited more than the most casual notice from Glen. but the one who does is to be conmatiiluted. -Chem. Club 4. Latin Club 1, 2. KA'l'Hl'IRINl'l K.UIMl'lRI-Ill. lint-Kaul is one of our se- niors fwho has gone tlrrougli High School in three anal 0110- half years. She is at most accom- plished musician. often nlaying for the Senior Music League. Her smile and kindly person' ality have nmrle her ,fzrezttly be- loved. 'AGE 'FW lCN'l'Y-ICIG H1 All lullllllll mllllml mu l mul lu lm mm uullllllllllllnnlnlnlul ll E 1 THE TATTLER J1111111111111111111111111111t11111111111r111111111111111111111111 1 11 1 1111111111111111111111111111111111111111111111111111t11111111111111111111111111111111111111111111111111111111111111111111111111u11111111111111111111111 111111111111 111 11111 111 1111 11111 111111111111 111111 111111 11111 1111111111.11111111111111 111111 11111 111111111111111111 11111 11111 111111 11111 111111 111111 1111111111111 1111111111111 111111111111111111111111111111 11111 'nn111111111111111111111111111111111111111111mu11111111111111111111111111111111111111 111111111411111114111nut1111111111111111111111111111111111111111111111111141111nn1111111111111114111111111111111111111111111111111111111111111 AGIC TXYI-INTY-NINE. 11111111111111111111111111111111111111111111111111111111111111111111111 111111111111111 1 11111 11111-111,1 1 1 1 1 1111 1,1111 1 .IOSI'll'IllNI'I FXNN When it eoines to lreingr ll so- eiul st11t'. l1'ene t'11stle has no- thing on .lo. 'l'h1'o11gh Olll her entire high school l'ill'99l'. she has always had one ot' more de- voted swains naiying eo111't to her. It is llll estahlislied t'z1et that t 1 lllilll she t11:11'1'ies will ll0I he il seientist. JANE WINl lI'lI1Il We'll always think ol' June :is one who never lost llel' noise: us one who nluuxs was in style and liked hy ull the hoys. .lane did t'on1' yours' work i11 three and one-hztlt' ye:11's. :tn zieeoino- lishntent ot' whieh to he Dl'0lld.ff Glee Vinh 2133, I.:1tin Vlllll 2. Girl Reserve Seeietzlrv 3. Girl Re- serve Vice-Pres. -l. liR1l't'I'I QYKICNICY Bt'l1c'e is 11 big: lntslty fellow :ind is always ready to use his st1'en1.:th Wl10l'GYt'l' it is needed. Not only 01111 he imlny hitsketliull. hut he ean also run so fast that l1is 1-'1 '111e11ts think that they are I'Zlf'll1,'-I with lightning. The only time Ilrnee did not went' il smile was when he had the llllllTlIlS.'f-BHSIKO1llilll -l. 'l'1':1ek -t. HXZIGI, YORK The very fact that llztzel tin- ished sehool ill three :ind one- hatlf veins is Zlllllllll proof ot' hel' intellilxeneeg hilt it' any 11 'e is needed. there :ire het' ::g1'1ule . 'Fhev atlwztvt- were high. Al- IIIOIH-ill history wats her hohhy. she was energetic and sineere i11 eve1'yt,l111i1:q she utteinntetl. She wats Ollll of the most efficient Nlavnie l'GIl0l'f9l'S. NANVY IHIXNI-Ill People who really know de- l1llll'6 Nanev 111'e llllld in their nruise ot' her zthilitv to learn uw recite her lessons. They ' that she is at very' sweet uirl :ind that she is very good eoitinzuty. t'H.llll1l'ZSt1llR.H Charlie, one ol' ov' ' -H1 ven- tlemen. can always he dewetidf- 1111011 to nnhold the disrnitv ol the Seniors. Every student of 11, H. S. considers hi111 his 11e1'4 sonal t'1'iend. He is 11lw11vs o the joh with his studies. 'X'oe:1- tional Club 2. 3. llliiililllllilillllrrilillilltilllllmilllir1111ll11111ll111tl111111111111111111111111111111111fl1ll111111l1111lll1ttllll11111lll1 1ll11111111111111llttlllllllrltlllillltt mlm THF TATTLFR J A llunxwlxllllllruwln ul mu l um un l lluu nuu ll l l' l muitlllnlllmyliiill'ililIlflliillll W5 'itIfililY1hid?1lmi?23'-lHilllilfiuliiiiiflillilflfillliiiiillilliil11Millliii111Hilti1lM3llllfilllllf-lillililllUlmlumlllmwllwtllmelllnmllmnlmmtmlslwwlwfulumlnmlllrvrmurzllllvrII44a11IllmelAlullmllllllliiillulmumm' V it llrlmuunm nl l r ll rnuuu ul ln l wllllullllllmvllllwlllllllllll 3l.tltl.tN SMITH Smitty is one of the few neo- ple who see and anbreciate all of the worthwhile things. One cannot know her without feeling that he has missed something by not having known her long- er.- -Latin Club l. 2. Prom. Com. 3. lvlagnie Stal? 3. Gi1'l Reserves 3. 4. Com. Club il. 4. Girl Reserve Council Al. Girls Boosters' Club 4. Tattler Stall' Al. l!I'1R'l'll.K Gl'S'l' Bertha. Gust. What a host of memories this name will always recall! Her famous smile. her ever present spirit of helnful- ness. her never failing neo, her ability as at leader-all these and many lll0l'G will come crowding to our minds at the mere thouzht ol' Bertha.-Latin Club l. ZZ. Girl Reserve Council 4. l'.ll'li HI-INNI'l'l l' Unlike most I.. H. S. students, Paul is alreadv marked to be a man of wealth. He is a blumb- er bv trade. There is no mistak- ing: Paul as he takes his quiet wav through the halls. His name has been constantly on the hon- or roll.-Magrnie Staff 3. Latin Club l. 2. Chem. Club 4. French Club 3. l'ILE.tN0lt, WILlil.UISON Eleanor is one ofthe quiet. un- obtrusive 'kleune lilies of the academic department. Because of her sweet voice. and French accent. She was Chosen as the leading lady in the Boomerang.'. ---Class Plav. Al'lDRI'IY AYRICS We are mighty glad we have had Audrey with us to edit our oaner. conduct our class affairs. and cheer us W ith her wittv say- ings. 'We certainly feel sorry for the coming classes because thev have no Audrev to act as their zuiding licht.-Prom. Committee 3. Pres. of Girl Reserves 4. Ed- itor-in-Chief Masrnie 3. 4. Chem. Club 4. Boosters' Club 4. Cass County Sec. T, I-l. 9. P. A. DIARY lR.KRNH'l l' She moves as a goddess and she looks a. queen. lsn't that a frranhic description of Marv? Talk Purdue to Mary and 3'ou'll never lack conversa- tion. Her success isn't. all de- nendent unou her :ood looks. or her Hood times at the hops, for she is known as an exnert chicken fancier. too. she has won manv nrizes for cooking and canning-Cannin,9', Club 2. 3. 4. Girl Reserves 4. PAGE TIIIR ' ''' itil11iiiiil11W11M1iiiiiiliiiiii1iiihl1lHillililitiiiiviiiviiilnto lm nm mlmumun ul nIn11slnu1llnniiliiiiiiiiiltmnllmuu TY E s Q52 eg- sig .s. :ii E52 i 5 1 5 THE TATTLER ggniiiinmnuiulmwuiiiimuminuminumiiruminuniiimmiiiiiiiliiiiiiiliiiiiiilliiiiiiiiiiiiiilliiiiiiiiiiiiiliiiiiiiiiiuilniiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiuiiliiiiiiiiiiiiii:iiiiiiiiliiiiiiiiiiinliiiiFil1iiiiiiiiliiiii1iiii1il1iiiiimRiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiGiniiiiimiiiriiiiiiiilimiiiuiiiiinniiinmiiiiiniiiiiniiiimliiiimiiiiiuniiiimiiiinnlimiiiiiiiniiiiimiiiiiiiiiiiiiiiiiitiiiiiiimimi immiiuiiiuuuiuiiiiiiimigQ ,,,., . ,. ,. ,,,, .. ,,,.., . . ... ,. .. I, l E E 5 5 E E. Ei 2. it E. 5: si E. 5 S, s 2 S 21 5: Si fs 1 el fi e-I -i 5 SlnnimmniimimwuniimniiilmminumiiuniinumiiumiiiiiimiiiiiiiliiiI4iimulimumiinuminumiiinmiiiiuniiiimmiiunitiimmiiiimmimuliiwuiiiiiiuiiiiwii1iiiuniiiiiiiniiiiimiiiiwiimwiiiiiiriiiiw iiiiu iiimii imuiiiir iiiiimiiiiwliii w r w r i w PAGE IHIRIY-ONIL. l'll.HtLl'IS WICSICR Wlienerer time xroes slowly. set Vharlie in motion and you will be highly entertained by his unfailing fount ol' stories and comic anecdotes. His ans- wers to questions reveal little acquaintance with the text. but shows clear thinkinief. N EVA l'I.0'l'N ICR Neva is not only an acconm- lished tennis player, but also ranks high as a journalist: in fact., one of our dailv papers eni- nloyed her on its staff when she was but a Junior. Tennis Flub Il. 4. Athletic Board Zi. Girl Reserve 3. 4. Music League 2. Art Lea- gue Pres. Tennis t'lub 4. Pres. Chemistry i'lub 4. Magpie Staff 3. 4. Latin Club l, 2. 3. 4. Senior Prom. Foininittee 3. Tennis Dou- bles L 4. Member of State Pen- tathlon Team Ci, Tattler Staff 4. MARY .U,lt'I-I SHYISOLID Living in the country did not handicap Mary in the least. for her face was seen regularly in the halls of L. H. S. Denture un- assuming, and hard working is Mary. 1-IICOIHGIG HXZIGI. Foach Wells says of George. He has been very faithful in his basketball work: and if he had started sooner. would have made an excellent nlayer. He is Quiet. a Hood student, and does all of his work well. The boys all like him. --Latin Club l. 2. t'heinistry t'lub 4. Hi-Y Club 4. Vice- Pres. Hi-Y t'luh 4. Boost- ers' l'lub 4. Basketball 4. GLEN ROSS Glen is our country gentle- man. Every' morning for four Vears he has motored nine miles to school and has an almost nerfect. attendance record. He is interested in all of our school activities, and his generous and good natured disposition have won for him a host of friends.- llagnie Staff Il. Track Team 3. 4. Uheni. Club 4. Tennis Flub 3. Boosters' Club 4. .lunior Music league 2. 3. 4. Latin Club 1. 2. 3. Senior Pi-one fY0DllT1iffP9 3. IRICNIS RIGHNI' In her four vears at L. H. S. Irene has established a. verv en- viable record of denendabilitv. ouiet. studiousncss, and fricndlv eo-oneration. Her commercial ability- is recognized by- various Loxansnort firms. Com. t'lub 1. Z. 3. 4. Magpie 3. 4. ii iiiiiwuiiiimiiiimuliinuniimlmiirilmiiiirimiiwliiiiiirliiiiiirlliiiiiumiiinuniimlminmiiimmimlmiinmiiinumnummnlimnu nnilmu VE lgs is I. g-. iii ,EI Ei i l ! l 2 I i Q ii if i i I l i ll il 1 Ei 'e i l 1 Ei :Ez :Sl Eg El is: EE? !E! 'Ei EE! vez 'Ei vga EE 552 SEE IE? 1HF TATTIE RA V orrvlm in tu in in iuu lu im ii i 'mum u iiwwi-wwmiiii -iiiimiitmyiiitimiiiniiinniiiuniiiuniiivmiiiiniiiiiniiiiuniiiimiiiimiiiiviulimuumullwllvwvuullllm lulumiii 1 t ' ' vi 1 1 , lllxliluh Niall HHR is Quiet and self possessed, Hel- on has gone steadily through the 2 four years of her high school ca- reer. Now. in looking back over this time, she can congratulate E herself in being at all times a source of service and pleasure to her friends.-Canning Club 1, 2, 3. 4. Home Economics 3. La- tin Club l. 2. 1-illI'INN.t KNARR. Isu't she pretty and demure Q looking? There is proof enough that she is pretty, but demure? That. is where looks deceiveg for Glenna certainly has a Dosi- i tive way of asserting herself. Her sparkling eyes indicate that she is always ready for a good tilne. 1 LINVS OLSON Linus is the musical virtuoso - of I.. H. S. He has been very generous with his talents. His singing and cornet playing have charmed many L. H. S. audi- ences. Even if he did not nos- sess these abilities. we should like him just the same.-Latin Club 1. 2. Pres. Music League 3. Junior Music League 2, 3, 4. Band and Orchestra 1. 2. 3. 4. l Rl'1Il UA R.'l'l'1R 5 Every time L. H. S. needed an electrician. capable stage man, 5 or poster decorater. Fred was in I 5 i demand. Each year the Fresh- ies thought that Fred was the 2 school's traveling salesman. with i I his little satchel. No doubt in E the future we will hear of Fred as photographing distant parts l i of the world. or painting scenery for the Passion P1ay. f-Voca- tional Ulub 2. 3. Art League 3. 3 Prom. Committee 3. FLORl'INl'l'I WIFKERSHAM i Florence is a rather diminu- i tive member of our class who is capable of making her presence felt in a pleasant. gentle way. l As well as being quite effecient in any line of Home Economics. she has gained the reputation for being a jolly good sport and an ardent basketball fan.- Home Vconoiiiics Club 1. 2. 3. 4. - 1'L.tR.t 'MEI-IbFI Il'l Dependability. thy name is is Vlara. Her willingness to work is equaled only by her propen- sity for being in style. Clara was always on hand at all of the 1 games to cheer the team on to 5 I victory.-Chemistry Club 4. Pres. I: Girls' Booster Club 4. Girl Re- serve 3. 4. Prom Committee 3. G. R. Council 4. ,, i r i iii i ui v im iui miiw ii nimumwsiiiiwmiwimiinmummmumunuwuumminuniwitummum:ummnwmmiIIIIvvi1iIIIitilunnumniilwnmminlimnmlimnnlllmi5 PAGE THIRTY-TWO 5 E E tag THE TATTLER giimniiuiiinmiiiiiiniiiiimiiitmiiniiiiiiiiimmiii1 n i iiiimimiii iinwim mmitwuiiiiiniiiv iiiiiiimiiiiiisiii umii iiliiimitiiiiisailiiiiinuiiiiiittiizmviimiiiiiiii. i vi.aaunc:.immmwiimarmirmimbiititniitumiiiiituiiiiiuiuiuliiiiititiimixtiiiiiiiimiiuiiuiiiimiimuiineiiiiiiiilwuitiiiimtiiwmiitiiiimiiiumiuitluiiimtiumiiiiwtuimiimiiiiidiiiiwuiiiuuuiu i l:t i : i i 5 E. 2. E: E! E: EI E 2 E ge E. 5 S E E S E a 5: E . si 5 i i i i i i i IN-l .tl'N Milililt. Behold the rarity- long hair! In Delf'aun's case we really can't blame hei'. as it's mighty pretty hair. She is quiet and special- izes in basketball frames. 'l'liere's a reason.wCheni. Club 4. Home Economics Vlub 1. 2. DON WISSICNQ-ililt Don is the bashful senior. As a class. we indorse Al Pettit's praise of him: He is imrizlit. loyal. stronfz and true. with .lu inexhaustible will power. By his whole heartedness and earn- est endeavor. he has become the best basketball center Lopzaus- port has ever had. For any fur- ther recommendation see De- Faun,--Football2. 3. Basketball 1, 2.3.4. Track 2.3.4. t'hem. Club -4. l.aYON NIC t'lt0t'lil'Z'l l' LaVonne is that tall and blond haired girl who edited our art. She's niiglity friendly in her ways, and always does her bart. She excels in all thinzs artis- tic. If Robert Burns could have seen her. he would have writ- len another noem about to know her is to love her. -ACliem. Club 4. Art League ll. 'Fattler 4. Girl Reserves 4. Latin Club 1. WAliliM'I'l lll7t'IlAN.tN Why Marion High School ever allowed such a Hood student and booster to leave them is :L mys- tery to us: but they did. and we have been benefitted by their oversight. He is a keen sighted. clear thinkin: felldw: and al- though we have known him for only one semester. we have learned to like him exceedingly well.- -Hi-Y l'luh 4. Chem Club 4 lil'1S'l'l'IR. COLLINS Lester is another donation from Marion. He arrived in his Junior year and at once won fame on the second basketball team. A case of annendicitis kent him from narticioating in athletics in his senior year. He too, is a boy who finds the thea- ter an attractive blace to work. ROBI-Zlt'l' KR l'll'Zlil'lllGl41R No matter how low our sniriis ebbed. the mere sight of Bob in his red and black uniform was enough to bring us t.o our feet, cheering wildly for the team. Bob has been a yell leader su- preme. He's bemw. he's wittY- and he's Bobby.-Yell leader 3. 4. Boosters' Clrb 3. Chem. Club 4' Latin Vlub l. 2. 3. EI , miriiiiniuiilimiumt mi iu1ummummitimiuimuimimmmiiiimiiiiimmimuuiiinuniimlminumiinumiimmiiimniiinuniiiumiiimmiiiiiiiiiiiiiiiiuiwiiiiiirilminiiiiiiimmin tiiriuinntiiiiiv iiinrmiii uimu iiimmiinumiinunimiminumiimmiiimlmimmiiirumiirliimiiiiiiiiimiii1inumimlmiimlniinumiminiwlliuwillmnllitnrlmiriil1inlunuillimiiiiiiiiiiwri PAGE THIRTY-THR imma l T H E T A T 1' L E R iiiiiuniiiimiiiiiiliuiiiiluiiwiww mlm muiw mm mm mwui iw iw ii mr i mv rw --iiii1imu1ili-5fi1iiIS?11i1inii1iiwilliinniilliniiiiiliiiiiilliiiiilllliiuilllxiiilllinnillllhiillllliiiilllliiiilllllinillimulilliiniiliilxiiimlmimuniiiiiiniiiiuniiiilmiiinuiiimvmuivuuuuiniiimmimwiimuiviiiiiuiiiiiluiiiiiIniiiiiitiiiinuiiinuiiirmiiiiuiiimnumuumiium milliruiniilmuuuluvmllluiww mm viilllunmlirmumuvmm uuuuimuuw wmnumlmlwmm umu muum will minmu illmrumullmliwwummuiviii1lnvmuwmruliiiiillumm immmu mn ii Fllltltlil-IS W.K'l l'S ll' everyone worked for the school as Vharles has worked. there would be nothing: left un- done. When in need, call on Charles. has been a maxim of L. H. S.. and Charles has always responded nobly. I-le's not only a worker in sehool activities. but also a very flood student, fVoca- tional Club 2. 3. l'IS'l'Hlilt lllfIlNlLlt'H Instead of studying in L. H. S. this year Esther has been taking the nurses training ,at Robert IC. Loaf: Hospital, at In- dianapolis. Although Esther beat us hy getting her dinloma last summer, we are :lad to have her numbered with our class. t'H.lRl,HS S'l'l'IW.llt'l' Charles belongs to the ll. S. N. Rf -He may be easily recognized afar off. He comes swinging along with a rythmic stride, his eyes pinned on the horizon. In his last two years he has dis- tineqnished himself by his lit- erary ability. Charles has a smile fo revervone.- -Track Team 2, 3. Football 4. Prom Co. IS. ICIDITH lllilflli Edith is a reticent and nn- ilSSll'lHll15l'lgi1'l who has bden ever true and faithful to her class and school. Althoush she never sneaks to us about her future plans, we are sure. what- ever they are. she will make good. IGIPWARID t'.lSHlNDliIAR The Inquiring Reporter for the lvlasnie once asked Eddie what he desired for f'hl'iStlHf1S. and he renlied. lIanv Friends. In our estimation. his wish will al- ways be eraiited. We all think him a niighty fine fellow. His earliest endeavor is shown hy his working until the wee small hours. resnondinsr to. Taxi! Taxi! -f-Vocational Club 2. 3, 4. I-IVA SXNIDIGRS That reticent. even tempered little Miss always seen with Mary Zolt. is Eva. She is an outdoor girl. tor her favorite snort is hiking. L. H. S. will miss her bright, nleasinat ways. wi mlmim .i. ui ii .ri u it in it uituri wmv iirf..,4a,il4.41 rv lwzmuunmili nulllllilllllilnlliillm PAGE 'l'HlR'l'Y-FOUR l l , ,..u,,l.,......., .ll l l l ll ll. ll..,ll....... l..ll,.a..W.lll.ulml......l.l....,...,..,l.l.l. .ll.ll..ll,...,.....ll.., lll..ll.l..l.,...lm.,.......l.........,. lll'IliI'lN .IOIINSON Evidently Helen has solved the sevret of intense concentration. That alone accounts for her Hood grades. The teavhers and the students have the highest re- spevt for her mental attain- ments. l4Il't-IICNH NELSON Because ot' l'Iugene's untailinl.: good humor and willingness we have learned to Call unon him whenever there is anything to he done. His reeord of varied achievements while in l.. PLS. shows his versatilitiy. Besides heing active in our Class affairs, he will he remembered as a mile runner ol' state-wide fame. the author of many love lyrirs, and the nusher of the broom at bas- ketball ganws.--Proin. Coin. 3. Latin Club l, 2. 23. Chem. Club 4. Vlass Pres. 1. 2. Boosters' Cluh -3. 4. Editor ol' the Masnie 3. Bus. Mgr. The 'l'attler 4. Hi-Y Club 4. Track 2. 3. 4. Cant. ol' Track team 3. 4. State Pentath- lou Champion 3. Snort Story Award 4. t'.-VI'Hl'1IiINlC FONIHII Although Vatherine is usually very quiet. she is a good arguer and has a nositive wav ol' as- sertiuit hersell'. For tour years she has studied hard and has been a real booster for I.. ll. S. ICNIMX Nlfllfl' Emma is one of the members of the ,'Z'illl5I.u In merely looking at her nicture. one would never know what a wealth ot' rollick- inzr fun she can show. She is very silent excent when c-allt-rl noon to rec-ite and then she de- monstrates that sho not oulv can talk. but knows whereof she sneaks. HI-ZS'I'l'IR lllGll'l' Hester is unusuallv sfood nw- tured and stndious. She and her grirl friend. Bertha are sel- dom smart. and are alwavs in for a. good time after school. Hester has chosen nursing as her nrofession: and if vlieerful- ness. c-anahility. and willinzness to work mean anvthinz. she is already at the ton of her uro- fession. .U.It'I+1 K R 'UI li R. Alice is a non-hob a snet-ios :dn-ost extinct. She was hrisht enouzfh with one nair of eves and when she enlisted the aid of another pair. her hrilliaury was doubled. f'llt'lll. Vlub 4, wmlim' ii lmilllllmiaPmlllnumllmumlllnmwiuullmumllunnwuumtwumlllummmmnnunilllriimmimuwliiimmnii' mluulmlnmm. THE 'rA'rf1jLER 1ll1nmlllnmwiuummumullmmwwnmm wwmmmwummu mu ummm ml ml ummm lllllwItlluvrumuzruwmullw1tvlwllmlmmvmumum 1lllllifwllwlwmwmwmvinmllmvllllnmuwulvwmllmuu l l l l l mmmu mmHllunmmumuilwmwma mmlmu mu mlrlmmvnwnum nmmmw 1lllumlllmumumnumlmmlmmlmulltumllvlmmlumlmnlllu FLOYD VERNON The miahtiest hunter since Nimrod, or possibly before! His favorite diversion is hunting and hiking, and as he lives in tl1 country, he can enjoy himself to the utmost. NIXRIIC Wll'liI'IRSll.UI People like Marie are very rare in L. H. S.-She succeeds in getting good grades with very little work. That she is persc- vering is shown by her craze for crossword puzzles. Nothing can ever induce her to relinfluish a przzle until it is solved. lHIX'l'ItIt'lC FUR!! Bee is a horn comedienne . She is the successful manager of L. I-I. S. Girls' minstrel. She is a very capable girl: moreover she is every ready to take the initiative.-Glee Vlub 2. 3, 4. Fanning: Fluh 2, 32. Girl Reserves 3, 4. Nl A RIOX SHVMAN Marion is the comedian of the Class ot' '25, Jokes and witty re- marks flow incessantly from his tonzue. We predict that he will soon have a contract in a vaude- ville circuit. He looks like Ru- dolph Valentino's double.fClasS Play Com. 4. Boosters' Club 4. lt.ll,l'Il HHINRIFH Ralph is a student of many vocations. He was at one time a member of Phase Boy Vhoir and showed great talent as a singer. He has spent a large part of his school time in the drafting room. for he has now decided to become an architect. While waiting for this time, he is working at the theatre, a pop- ular place for students to earn money.--Vocational Club 2, 3. 'l'Hl+1RIiSA SIHYI-IRS She took the irrevocable step of marriage before graduating, but returned to school and lin- ished her course just the same. Theresa's name is synomyous with rapid talking and thinking for she certainly surpassed all other L. H. S. girls in the nim- bleness of her tongue. rg' E5 E E s 5 E get 2:5 sas s El SE Sl El is it nmmumlggggllllllillif3llllllllgllllilgglgllfllgllll33willwill33lil!!!333all333llgvlllllnlljllllullilll umm wlmwuullvu vllllwnllllwwmlllinit33all31Wt3latinltgirllilinllllimlllnmllnmlllumlnumlmnlllnunlnummuitlnmllwumlwmulnumwwmmllwunllmmmmyiiniwwillwltraillinuxnumlngayimmlnmw+InmlIanygiiuvvluqiwvggguuliiiiltl1iilligliyflilliililllxiinllllilimilfillgfllllllfllilalillllliilllllillllH PAGE , 'VHIRTY-S IX is E E5 E: 2 PE T H E T A T T L E R suiiuulumuziiivilluimmiiiiiuiinum mm wmuimixixmirimiiinmimiuw ui riiiiiriiimuimum mm miiiuimiiimiii14uiiniiiiiimimniiimmitmuiiivmiimmiiimuivuniiiiuniiiiiumiiiumiiiimiiiiwuiliiimmiliniliiiiunllilriniiiiruuliiirimimmiiiiuiiiiinniiiinniiiuniiiiumiiiumiiinmiimmmiilliiumiimnumlmliiimniiinmiiimuiiinuniimuminiiiniuiiimml s gi s z 1 E E J A M ICS l'l' l'l'l I' Three cheers for Jim. our foot- ball hero! He fuirly covers him- self with glory by his skill in this snort, :ind he zilwaiys main- tains the quiet dignity befitting u Senior. We certainly are nroud to have such il stood fellow in our class- Football Il. 4. t'llAlt.l.ES l'.K'l l'HliSON Put is noted for his quiet- ness and sincerity in disposition. It is very seldom that he has gone to Class with an unprepar- ed lesson. He has Ruined brom- inence bv his nvut almearunce. RIXILY ZOI.'I' Mary is the lianny-t':icvd indivi- dual who always cheers us up on gloomy dziys. If her work on the Magpie is any iudiczitiou of future events. Marx' will be ll first-class journalist. in at few years.fMag'nie 3. Glee Club ZZ. 3. Girl Reserves 3. Latin t'lub l. 2. Home Evonomics Club Cl. IIAROLD WR.ltilI'I' E. 'iStub has chosen the class of 5 l!i25 to make his debut into the E world. We might say that Stubs 5 hobbies were dancing: und talk- in ing. His grentlomunly manners E have niude him mum' friends. E' Hl'2Rlll'1R'l' Wll,l.l.UlS 3 Benny had a lot of hard I luck in his school career, but E has ut last reached the cherish- ? ed goal, an L. H. S. diploma. In E 1923 he participated in his only S. truck meet. und by his sell'-saw 5. ritice helped ll. H. S. to win the E mile run.-Latin t'lub l. 2. if E 1 4 ' Gln jlivxnurmin glltixiglns 05I'D5l!EIli! 2 1'5lL1Y-15125 -f P AGE 'l'llIR'l'Y-SICVFIN. Class Prophecq ,, , .I Vol. 169 Logansport, Indiana, June 1, 1935. No. 13 Those classiest of ballet dancers James Uimmyj Puett and Miss Norma George both of Logansport have created al sensa- tion in little old New York. Three times a The. Logansport Senior High School has enlisted the services of Miss Glenna Ixnarr as a teacher ,in the history department. Miss DANCERS TAKE NEW YORK BY STORM I NEIV TEACHER ON SUHQQL FQFRCE day for six months have they performed before jammed houses, and still the people flock to see them. It is interesting to note that Puett received his first athletic train- ing at the local High School. Glen Reid, owner of the West Side Green House, has received a special shipment of white lilies in preparation for the June rush. The County Hospital has added three new and valuable members to its staff. Misses Knarr, in addition to having graduated from the local institution. has also taken several high degrees in both ancient and modern history and should make an excellent in- structor. S s Mary Barnett, local poultry fancier, has E again received first prize for the best dis- play of chickens. It is rumored by certain defeated contestants that Miss Barnett's grandmother raised the chickens and en- tered them under Mary's name, but there Hester Hight and Catherine Conrad are en- Sgemg to be lime proof of Such an asser- gaged as nurses and Eleanor Williamson tion' as special dleucian' Our local librarian. Miss Bertha Gust. lde- . . . . . - - E UTM Great Momem' the latest book by ieiliinniliieflffittii'nEifbSF2?FE5iLZ3t Eggllfgeggiigipers ls entermg upon its SIX ing list. Her snappy posters and articles in ' the Squawk have done much towards in- Lucy Emier has just had the Doctor of teresting the people in good reading. Philosophy degree conferred upon her by the 5 University of Chicago. Miss Etneir attained CONTRACT LET the degree in Latin- The contract for the building of Uncle l -L.-.... Roy's new Cafeteria. and Lunch Room has 5 Misses Mary Medland and Gladys Reyburii been awarded to Melvin Ketterman. Ket- Will appear in a two piano concert at the terman tonk a four years' course in building 1 Civic Hall this evening. The players are and architecture at Purdue College and has just returned from a series of concerts giv- had Dractical experience in brick laying- en in Europe, Both musicians are waduates so there is every reason to expect that he of the Logaiispoi-i High Sqhoolh will succeed in this venture. 1 Miss Marcia Redinger, representative of Miss Gertrdue Evans. the vivacious Dro- the Ward-Belmont College, was in the city prietor of the Marcelllne Beauty Shoppe. has Q yesterday. recently installed a new contrivance for the 5 -l--- removal of frowns, wrinkles. and other kin- l Robert Erb, mane-fer-leader of the Ritz- dred diseases. Carlton Ballroom orchestra has signed a --L ' contract to take his players to London, Eng- Quite the biggest social event of the sea- ' land, where he will play for all the enter- son. was the dinner-dance held at the home tainments at the opening of the St. James of Mr. and Mrs. David Murphy-Hudson ves- Court. terday evening. The ball was given in hou- lg-. or of Mr. and Mrs. Franklin Hiuis. Mrs. Q All those who desire to improve their Hillis. before her recent marriage. was Miss ' talents as public speakers would do well to Jane Winfield. E join the class in elocution which is soon to ------ be started by Miss Katherine Kammerer. MR. AND MRS. MOSS ENTERTAIN Her ability, not only as a teacher, but also Mr, and Mrs. Allan Moss were hosts to 1 as a practical elocutionist, can hardly be a number of guests at their new home on 2 exagerated. Her fame has traveled far and the Everbreeze Estate west of the city. wide. The couple have just recently moved to their -- home. The guests presented the hostess Miss Helen Kirkpatrick is substituting at with many practical and pretty gifts. The the High School this Week in the absence newly-Weds have a legion of friends. Mrs. l of Mr. J. P. Hochhalter. Moss was formerly Miss Clara Mehaffie. 2 MT iff ' ' w 1f 1I 'u .,.....,,......,,....,..,...,., - ..,.,...........,.. ....., . ..,. PAGE THIRTY-EIGHT W -H, A 1e'x5,grv.1, 'giv'fgwpg9f15E 'vt-wr-y T H E T A T T L E R , . I Q 5 Class Prophecq l f THE LOGA SPORT DAILY QUA ,Vol. 169. T U S M Logansport, Indiana, June 1,i9s5.- No- 13 LOCAL PHARMACIST ATTAINS BANK PRESIDENT UELEBRATES V Th ' A YERY HIGH P081 PIQW I Mr. Jack Brookmeyer today celebratednhis E . e United States Pharmeceticai Assocla- fifth anniversary as president of the United tion has elected John Neff of this city as States Consolidated Bank. In an interesting 1 . delegate .to the international meeting of interview with our charming special re- Q Pharmacists which will be held in Berlin, porter, Miss 'Bernice Rocke. he stated that ' Germany, this summer. It will be remem- he began his bank work as a draft clerk S bered that Neff first started his work as a and has won his present position by con- f' pharmacist in Ebert's Drug Store, while yet stant effort. ' in his Senior year of high school, l--- The bill to be shown at the Luna Theatre La X'0nne Croekette formerly of mis ony, this week will include one of Logansport's now of New York. has been awarded the f0FII1Gi' residents. Deane Fox. who is now i G1-and Prix for her oil painting, Hpownfg traveling with the Keith Vaudeville Circuit which was entered in the Paris Salon this 215 2- Juggler extraordinary. i spring. l-l E ' - NEW DRUG STORE T0 BE OPENED a C. Graf. CXD9I't m6Ch3-l1iC2ll dI'9-l1ghiSmHl1.1 The new palatial drug store which is soon ' just ,C0mD1e!6d P13115 fOr 9- DSW machine ' to be opened is the outcome of years of work for taking the straws out of Sf,l'RWb6I'I l6S. i on the part of that enterprising young man, i This device IS expected to save much time Eugene Denham. gtai-ting as a clerk in 3 5 and energy- soda fountain, he has risen to the enviable --1 -L position of sole owner of this rising busi- E Editions of the new comic weekly, Hi ness. 1 Life in Hi Schools, edited by Miss Marian L?-- 1 Dunn, are now on sale at the news stands. Miss Dorothy Gi-ube' who resided in this , - -, city some years ago, has just been named . HONOR REQPQRTIUR K Miss America in the international beauty f ' The National Joufnallstlc Press Of Amefl' contest held in Paris. Miss Grube won first i ca has presented a beautiful silver lovinglpi-izel cup to Miss Neva Plotner, starlreporter Of' ..... - the ph1ia'g3hTm1i1ne.1n feq9qv1t1g,gI,ig her Those attractive ads for men's clothing 1 Service 0 e en We Numa 15 lc ' which our prominent merchant. George Ha- 7 This month's edition of Film Facts con- gggtliasegefvirleuggggg rg? ggrcgggfee f2'i,2ff!? tains a picture of Miss Margaret Bishop, Patterson' oeee of this eitv ' ' the latest sensation among the starsl ef ' moviedom. The edition also has a comp e e , , , story of Miss Bishop's sudden and meteoric , G' Mathef' anfi J- Vivian- those mdefat' riee te fame. iguable radio wlzards, have announced the perfection of a huge sending and receiving Mies Hazel York' noted lecturer en the set wiitliewhichithey expect to establish com- Redpath Chatauqua Circuit is in town for mu? ca 1011 with M3-TS and perhaps even a few days, vacation. 1 Jupiter and Saturn. The pi Bennett plumbing Cgmpany has Robert Little, prominent local -surgeon, l established an entirely new record among W3-S arrested YSSIGIGRY f0l' SDGBGIHS- H15 plumbers. In the five years of its existence, fiefelise WZLS that hlslgasoiinelwas low and not one of its employees has ever forgot- he W9.S hllfrylng to his Datlellt S home S0 he ten his tools or overcharged a customer. imllli get there bef0I'G the SUDDIY WHS GX- ..lT.. aus e . LOGANSPORT SCORES IN OLYMPICS ' '11-'L' l Logansport was well represented in the A new Sl'0Ce1'Y store vto be owned and Olympic games in the om-Song, of Misses managed by Don Vickers, will soon be open- Amelia, Renter, Neva Plotner and Marian ed. The store is to occupy the former Char- Baade. all of whom won honors in tennis and les Stewart Dry Goods Emporium. as Mr. also by Him Digan' who get 3, new high Stewart is planning on establishing a chain hurdle record and placed second in the of clothing store throughout the middle i hundred yard swim. West- , 'fffn .. PAGE THIRTY-NINE. '7'7' 'F 'IHQRF H 5 . 2 1 ,. i r i , E 3 ! 5 E i i 35 if ai if :MW9i7'7 l'1'E'3'E lf1'7..-..-,... I .. 4A,, ,,,,,,,,,1Ziifw'fT'T 1Z Qj12f jj' L'j M 'm'aaaa1aaaima .M SEZ im- mu-Wm ' 3551+ - -- .... -. .... 4 cf'-2225525 S-fi? iffma-'E asm? Sasxan 5-'ips H-f ssc-fsawar 2 Ve 5:2091-3'-' U-my ... CD N04-gr-1 In Q Ev-5 Q 9' Q- Q CDG mmm:-+!A!'b 5 -1 2533.2- UE:,E'm: igmqg gag DE E-'2T',':S cp EQ-Nw? ggtfg 'gg prgnjffmsge 2!' 2226: 'Q w WP- ----, fu Hoa-f 0 w wr- B fx -F' W up -- I 32,55-: 'SQ.C- Ewf.E'i,,, gagging SUSQSE 2fgO,,EQ.v przfo' gg: 55555256 E53 S' grzncrqggfaif 5-:Stagg gg QSC- Sggmgg g.g, 9,3Q'2 525:23 gg-Q 5'E,gD g5'5 S Q i 525 H055-Q U QMS - o.C55 m ..-.,., awe: DH mmf:-n U. rn N ...nq Q iagpgf-fmp cn ,.,o Q., co mmm- gp mmmow--'U m- ... ,U mmm A h 252f ::SD 1Uo4 'C1 pcnfffbi Um Ur: 0-Zm is-:mo no Q' 'DG' 'TUG -:mar :spill J, O p0 006 .5 Q.Q.-,.s e-+ rv- S gnmmw Om,1,-390-5 D-94 ,rr 979711 oD.,...gB D-H fi EEF' Uhvpig' 9' Q.. D'v+m f1 OCYO U1 v-n P' 'lcmgff W4 tn C! A! oem ,U mi'-' -::i,...5'1 mg-QW c--,,....,wg 11 g -am mum-. Q 'UO rlogfvc- :Q --magma 2 g-SP: Q ...,-0 wocopw mf' -mph ws-as-h 0 rj Off 4 V -1: EVSMWQQ PQ mffiqd 0 H--:N w z: 9 '59, 1 f w 'a0 40-1 WEUSQIJU Z! 52 Q. 'Q-QQ 52'm- 040205 Efxofwdi 'D O56 of 'S SPH- 3 5-1 3: n I gg ipenmg QS ':f no 592 B0 U -'-2:,,'12 ,UQSQQ P053-+ 52 Q.---H2535 zz o .-+5 -fb a: O sv., ww: N :N . - Ez: 5E,5 F5 Uwmi' S5'o::rm 5'-'ifggpz-' 25?-rv'-'FAO w-:SEQ 252 Eomvg gi P175 22 :egg 4--sf-E ',..:f:2 Saga-,Q -fc.-:...fDg 555,39 -. -1-1 QQ:-' aww'-Em: OT' ng,-DEQ mg gs,-QCD ,M - fmysim Ha-pb' ,fgo.g,-Q K+.-, 3-:W--Qpmv P P : Qfnfgo' -fb N0 ' no '-fm N' --vm: 'Dru M . WZ 55 N Q'-'SD QQ Omfll M 'U CD 515 U1 QUIIJD' ,-, gm Q no U.-U v- hr, N 946. mc p-bgpm. ,.,qDU' ME: O-5 Q D-'f H, . v-5 4-+ ' P- com Ugg ?wg,rQ5Ega F-322355 22252 Zwzgwi 255.2-215 2. 52 55 mifgfigsw 5 ,Q , - iii P'-fr -QNW :Saws -aE,E3 DP'9wim 29m '-w vivo ,'.g-- ww-Q QSWE- M fn I sis 55552 ,O :ff--sf-H1 ffm--,,-+ z:-E15 w Hrfsgn- rsffgg, Q53 a'.2.1 9 'SmQ' 'E E I 5225212-ms ww 6222.8 asm: 2 Hfsxfui' 'iw ga Shiga-as : 5 '-U cu Q iii Q-Qo....ow o:,.m52, gm ci' Q ww Og Q. .:.,,, 9' our:-gg : -s O SVSU 5 ! 'Q rD ro- S 5890? '1 H mm 'im mOCDpmn U N 9 ' fiisia-M55 gs!-S 5952? 331552 F5555 E22-EEE 95 f g,,NgU52 ' F' 5' I EEE P' O92 . -- O- H' 053.2 ' 52525-555 S3158 5135353 S2325 5:33555 SSE: '55 1555255 E E' Z ' :H mm. v-va -.-new 4109- mwlmi-I um-Wbsllv-1 m?'T 4vf+ 0-9006? -SP-if Q-4Um! m1 'J E1 'U 5 '+G V1 5-0 Q'-' '-'- '-',.Q v-n gg rw- -. 1-vw H- Q I1 gaagmm gsm :Sage ago g-3559230 5:5559 553-ge asm 550, 22526 Q F 3,3 'i --- H- cm -2 Q.. , mm mf- - ss2'f5:'UsmST Rpm iw- inc E- F 539-0525 at 259: Ego Lf ...Q WSG -.-Q w- F 5 -3- 5 ,,.: 9mgw ,eggs ....n.g,..g ggi 5 055-tv ogsamag Qdggm 99:34 352 an-ggffb E - CD F' -. .. .... ,.. - P- : in-25-25-2: 2-2 swag 5-as SWF MSM 2 -we we F 3 Q5-WE' Q Q O Q, ::r OCD 599- mcbdw ff' n Q- gd N WD- 0' 0 D' 5 0'-s 2: m P-E is OG QQE3 CD54 an H- md W9-'S'-s g '4-5 W 1 'v-1 5 Q D' N-nf-o ,-4 ' LZ ,'jN T Cb ,-. B970 fb D' 455,09 25. v- x-14fD,.. Q0 ,hw Q- -4 fo 5 gsm D' ,101 S- D' -'PJ 1-n. .... Q ow -..ff Q mm -- fbsaam as ., 148221452-'Q :H ff? ff GQ wh EF' SO sw :Q 5 L-. D v-HH.-gomai Farm Em DU EC, O FOG U' H: '1 UQ HH C :S W 5 1- QQ EE: -L. Zum fun 0 ..,,l-Dm . b Emgqgggg Emi 3,302 E057 3-Sggggg 535,255 ,mga E39 E-E. 29,2155 3 Y' 0 we Q1-w-'f sv Q. O ... s: O : nuff' Q FQ QSOOQSSM 522: fwvvw mis Swrnwii waves f-9:5 5992 'qw :fn Q :J 1 iE39'EQ ofD,.,E ,CDW 2,-hmcbfb ,f. fo z:1'2 c:E23g:f-4 :1 'rn 1 fL:r' 5'V'om 6552. '-'95 -'-ff-'-nga. , ragga can :g'v1E'u: V2 2352525 '-,125-me 3353 mf EU 555:12 gf g Ei5'o ow. :rf-h 'N'-' mi- 't om 5 ww: ....o Q fp OUV av wg.-f::xcn-+ ' ii 'icq' ge -Bw 00 ' 0'- 5 5'-EW w -WND UN... :zu Nm '-'-4-,oo -'Y :E Q o awww Emo 0.'- cm nm' wma' -:QU o ...O .-+-I ' lrsnizoe V2,.,,.. Bm---E.-+ ......,-D :::-1 S, Om .. -sp-n .., sv ,M-,O 49, muon. Q , s l'E'g,-LQ cv'-Tw E. gnc- EFS P35 Ee gpg 0 wgmm -:sg fp: 'ga H: ii :-5-Snug. QW ogzsom U-2 ----sg ge cf-Jil.-f '-,Ng 'ps '1:s 'D Q 2 We! I ,...mo Q V. :aio 14 S.,..,- H,-,Q -rm 4-o-mr-4 M3009 gn B DQ EH,-.pgs .Hi 9--1 Pai ace gg Es ww ..fe.-cgofq -fp:-15: :EM QE- as gpg -1 EQ ..i rv- P fb O- IN I5 . wifi'--Bw 512 EE-522 ESB 25W-.WE wear sg-W Hs Q5 06223 1521 1 - - - 4 cn 1 ae -an m:1 'mg.P-5 gpw S5 cs '50s: n' .-+ 'fluent' SH- 'ff QBQO Q1-1 EE: N PM-+ O B U 'CD 5 fb .... an Q' me asf -100 'D P4 'rs' cb l:rg:r ' 02:92 UOEITU -v. ... a-4 9-'U U3 4 on f O -191 I, Dev- .-- U -+C! - 1-fmfv N. U Rigger' gf-h at-Emo :Sign 595' v-UU W,..?,3E- co-32.5 992 QE g 322 S: 2 flmfglfg W, Sang 5295 W a-:gm mgg H :am-Q fd, 5,-W 9.5 5 -1 Q . '- 3'eu'4H,... mb' 5'-'t' ' H E'E'5,SD 'Q OE' 9' Q Ecu ' -h f E ' 5010101 :cn NWS? 3? UQcbnF? FEE-qw TTS.: rf? mera? 'CJ' 5 I E55 ' PAGE FORTY. -f---- ---- W f .V--.VQWF . ' THE' TATTLER Qig!iiiii1liiiiiiiiiiiiiiiiiiiiiii iiiiiiiiliiiiililiiiiiiiiiiiiiil3EiiiiiiliiiiiiiiiiiiiiiliiiiiiliiiiiiiliiiiilEiiiiiilEEiii1liiiiiiiiEEiiiiliiEiiiiiiEEiiiiE1iiiiiiliEiiiiiiiliiiiiiilEiiiiii1iEiiiiEiEEiEiiiliiiiiiiliiiiiiiliiiiiiiiii! I l -i gs xii Fi Last win and Cfesiament of the C ass of 1925 2 5 1 i EEE .m .mfs We, the students of the class of 1925 of the Logansport Senior High 255 School, being possessed of many great and unexcelled virtues and attain- E ments, do hereby will and bequeath the following to the person or persons ri named herein, hoping that they may be benefitted thereby. The witness- S ig? es of our soundness of mind and capability of judging right from left have is! I affixed their names hereunto. C. Mem, Ima Nut, Al K. Hall, E, Artie Choke, Lotta Cheek, Gay Ann Giddy, Ben Zene. iii I. We, as a class bequeath the followingg 5 l i Q I 1. Our quietness in the halls to the Juniors fthey need ith. 5 2. Our cheerful expressions or report card days to the Sophomores. 1 2 ' 3. Our colors to the Freshmen. 5 4. Our good behavior in the aduitorium to the Junior High. 5. Our unwillingness to bluff to the students for the next ten 2 generations. 6. Our love of Chemistry and Physics exams to all future scientists iii i, 12 ofL.H.S. F5 if .E 7. Our pep and yelling at games to all loyal fans. 8. Our ability to write bogus excuses to all coming skippers. II. We, as individuals, bequeath the following: 1. Robert Kreutzberger's ability as a yell leader to anyone who has nerve enough to use it. Z 2 2. Jack Brookmeyer's grin to all unfortunates on report card day. E F 5 There is sufficient for all. 3. Glen Reid's perfect manners to Ancil Shader. 2-l 4. Wayne Robertson's superflous avordupois to Egbert Campbell. 5 .5 . Marian Smith's gentle voice to Robert David. 6. David Hudson's rubber-soled shoes to Lawrence Brenner. Ville 7. Dean Fox's juggling skill to anyone who wants a job in vaude- 8. Don Wissinger's smile to Harold Zanger. 5 9. Maribah Koons' hair to anyone who is cold. 10. Marian fBaade's tennis ability to all future-stars. 2 11. Charles Stewart's walk to Eddie Monahan. 12. Al Pettit's size to Tick Williams. 13. Fred Carter's painting abilities to Miss Gilbert's classes. PAGE FORTY-ONE. 1111111111111111111111111!111111ii111iiiiii11iiiii!51iiii!!111111iii!! 1iiiiiii11iiii!!i1ii!!!!f1!!!1!!1!!!1!!!11!!iiiiiiiiiiiiiiiiiii1iiiiiii1EEiiiiiiiiiiiiiiii11iiiiiiiiiiEiiEiiiiiii!iiEiiii?iii1i1ifiiiiiiiiiiiiiiiii!iEEiEiiiiiifiiliitiiiiiii!iiiiiiiiiiiiEiiQiiiiiiiiii!iii1E155ii5iiiiiiiiiQ!!iiiiiiiiiEiill!EiiiiiiiEiiiiiiiiiiiiiiiiiliiiii1111111we1111111111111!11ee!1!!iiiiiiiiiiiiiii1iiiiiEiiiiiiiEiiiiiiiiEiiiiiiEiiUiii!iiiiEliii!i5iiii!1!1111i111!! 14. Eugene Nelson's control of the hearts of Women to all bash- ful Juniors. 15. Bernice Rocke's pep to Nelly Mae Masten. 16. Nick Braderick's ability to talk about fishing tackle to Miss Adams. 17. Louise Murphy's eyes to Annie MacDowell. 18. George Hazel's height to Johnny Bell. 19. Neva Plotner's grades to Mary Kistler. 20. Bruce Carney's athletic ability to Mr. Burke. 21. Audrey Ayres' journalistic ability to Robert Dotterer. 22. Don Vickers' willingness to argue to future L. H. S. orators. 23. Wallace Buchanan's Black Death to anyone leaving town in a hurry. 24. Charles Patterson's neatness to John Frazer. 25. Amelia Reuter's chewing gum to the coming typists. 26. Pete Moss' Ford to Whoever needs it. 27. Dorothy Grube's marcels to the Snell twins. Signed, THE CLASS OF '25. 1 iiiiiililliliiiiiiiiill1111iliiliiiliiiii111111113321111111 1'Ti'Zj Q lg Four Hear Honor Roll 4 gg I I Eugene Nelson-92.6. 1 1 11 '1 1 '1 1 1 l 1 1 V 1 1 f1 11 1' 1' Eugene Bender-92. A David Hudson-91.3. Eugene Denham-90. May McCloskey-92. 11 1:1: tl ll 11 1 1 1 1 V Mary Medland-91.5 Glenna Knarr-90.8. Evangeline Elpers-90.7. Hazel York-90.5. ' Marian Baade-90. 1: Helen Johnson-90. lg 13 Eleanor Williamson-90. QI ig 12 Hug gggg gggg A 1 ,,,,,,, ---ui 1 1 PAGE FORTY-TWO PAC I ' W TA'l'T LE R y ' mx mn ulmuwumi1uwi1imml1Ayiiiwufillwuunmuuhim1im-muunuummmmuwlng ' wuhwwwrwwww1wxriN4wx1Wu1WNumm111xxHIQwwuuhwumuuw111wiiwu1NNN11wrvw1wwwww1vwwwN1w1wHwwwxxxwuwwxxN1wnu1mwwmm:1muwuuwnmm mm,wwwwww-wwmmm1ww1W1X,,X1ww111-11111XwHW11w1mwmmmuumuuwww1nuwwwwwnwwwwwwlin1111wwuuuiuiuiiiwinim11wwwmw1wwwInummm-mm ww u mmmmmmm 1 1 4 - a t-,.. L1 4wnummumnumwwnumwuruwwwwwuwuu1w1mnuuumumwm mmmnvmmmmmmwmmmwu J rjfx5 gf L2 ' P 1 v ,ELr5m5 iligg Jumors wuwwwmuwwwum1wmmmwwuwrfwwwunnnnuunmmmvmmmwwmwmvmnwvw mmuwmm m w ,mm umm fx wx w w M 1 m wr 1 w v r w w w ,P I'OlxlX lIlRIuR. mum ur 4 rw uw www W w 4 w nm N 'I H In L In ' ' T T ' R Quvlnmwuuwrxuuuwwwwwunmrrnuumuwuwmmuuwmw mmmmwmwmm-mmm:.wwwwu ummumwmuw,-uw, Wzeulwr,w111ww,.4ww1wrnwwww1flwww1w.1wwwwwX.Nwwwww.wwuxxwwuuuuuuHuuuuuumwwwwiimmmuuwuuxH' ,,upH,W.WW,,...,,W.,,,,,,.,,.,,,.H,,,,,,.,,,,,,..,,,,H...,,,...,,,,,.,.,,mm,,,.,,,,U..,,,,,W,W,,,,.,,,,,...m,,,,,,,N.,,,.,.,.,..H.,...sw..H.....,,.,.,,,.M,,,...,,,H.,,,,nnW..,,,,...W, E' iv in E, 5: Q : E- 7 iv E E1 1 annumnuwwmmwwwmmwwnumnnwwmmuwwwwnwww1unw11vNuwwwuwwmvuwwwwumwwwwumwwwmwwwXn1wwwwwwwwwwwwmuw1wmmwwH1wwmmw1wum11wwmmwwunmwwm1wimwwwnmwwwmmwwnfwwwunwwmn1wwwmu11wwInwnnwwummwwmumwnumwmmmiiihumumwnumuuminwwnumwunwunimwumnwwwwumwwnuwuwwnwwumnwwummuummwHumwwnuummwuwumwwhmwnuwumnwwmumwunwwmmwiiinmmmmmunmi PAGE I ORTY-I OI'R. . rg. 232 sig fir EEE EEE E25 ESE E52 iii lsl iii f . . i I 3 l if? Z l I 5 THE TATTQLER 1 ' ?lEiiiililiiii9EiiI '11 HH 'HHHWiiii?iiiiiiii?iiiiii??iiiiiiiEiiiiilEEiiiiii5i!i l+ ii3iiiiiiiliiiiiiliiiiiiiilllii5iiiiiiiiiiiiiiiiiiiiiiiiEiEiiii5iEiiiiliEiiiiiliiiiliiiiiliiiiiiiliiEiiliiiPTE?iiiiiiEmillMiliiiiiiiiiiiiiiliiiiiiiiiiiiiii5 i'i' '1 ' + f 'v' ' Wm '' ' ' 1 il il , . . 12-B C ass E . l 3 4 ' A Arrick. John- I 1 Berry. Clarence 5 Carter. Fred EQ Castaldi. Lawrence Clark. Lester 'ii David, Robert Ei Davis. Paul :El Dixon. Iran 'Ei Fawcett. Marion lil Fraser. John FQ. Gerton. John - ' Helton. Vernon 1 . Hetzner, Dwizht .-, Holmes. Charles . . Huntsinfrer. Harry A - Kniesly. Othal - . Kreutzberzer. Robert 1 I Lovell. Alfred Malone. Quintus A ' Myers. Willard Pnett. James Shafer. Ancil 5 Slieth. Maurice E 5 Smith. Leland Eg Trickey. Samuel ggi Zanxzer. Harold E5 - - Alber. DeFa.un 1 Barzerhuff, Lillian i i Barnes. Doris Brinley. Mary Q Closson. Jean if Cooner. Felma is DeHaven. Margaret 1 z Eckstein. Adele E Farnsley. Alice 1 Gotshall. June 5 Graf. Thelma i Hammontree. Ruth I Harrison. Merle L 5 Heldt. Loraine f' Herliman, Virginia ggi Masten. Nellymae ig Minnick. Dorothy E H Nicholas. Thelma 1 Q Pomeroy, Kathryn 3 Powlen. Beth Qgf Rice. Marjorie 5- Robinson. Velma Schell. Helen - . Skelton. Margaret 1 I Soncarty. Florence i Thomas. Lucille f Tidrlck. Doris 2 Walters. Romaine i 1 . 1 L' ' ' QIIHMMMWMM1IILTLIIIIIiIIIlI!iQivmMmMMIIZI1fII.1'QIIQIII21 A.GE FORTY-FIVE. P. THE TTLER um1wwwiiifwwwriiii111iiiil1111iiijjwwwwinwmwwiiinwwwwnuwwwwnumwwwwruwwwwwmwwwwwrg:wwwmruwwwwwwulwwwwnummmmummu,wwwruwwwwwwnwwwwww1wmwwwwmwwwwwmuwmnummmnwwwwx11wwwwxuuIwwwxxuuwwuxuuuwiuiiuuvuiiixiwnuuuiwiiiixiiiiiiiiliiiiiiilwiixiiiliixuiiiiliiiiiiilliiiiiiliuuiiiiiiiiiiiiuiliwwiiilwwwwiinlwwuFiliiiiwiiiiiiuruwwxuuunwxmuwwvummxuw 1 vw:lil1iiwli:xliw1mwWHwrnwwHull11ifiiill1fxii:wwwwivilxixwiiiiiiiiriiiiiililiiixxinxiiriiiiiiiiilixiiiiii vuwumu.,,,,u:-vm., ,m,1,,w., H ,W ,,,1, ,w.,ww, H , ,H N , , , 11 1 1. H H, 1 1 1 H 1 m nm uw uw ww www ,mmm W WH w -N Y W YH M H ,1-ww.. wh.111WNwwfuuww. ww.,-.wwmmm-:w.,mu- H,.,YH+,1w,1M1111WM,11xxx,J,,WWmvww11--111ww111m.1-uw-wuuvwwx,X.w.wv-www wwmmu.mmm Emmy l V mwwwwwnlnmsxnuuur 'AGE FORTY-SIX F!? 1 ff-9 1Tf'Q Y . ,F 1' '?'ll ' T .,. . , 4, THE TATTLER ll'-A C ass Allen. Wesley Baker. Harold Baker. Seward Bauman. Clifford Beale. Russell William. Becker Beety. John Bell. Donald Brenner. Lawrence Brown. Herbert Campbell. Egbert Wayne. Carson Connors. Paul Boyner. Ben Demerly. Wilbur Derby. Joe Dotterer. Robert Fields. Russell Gill. Merrill Gust. Harold Hoffman. Bernard Hilkert. Trent Keitzer. Walter Behr. :Kathryn Barr. Mary Blizard. Elizabeth .Bur1ey. ggzmpta Byerly. iritinia Campbell. lleleni Davis. Ruth. ' Dietrich. Minnie Ferree. Clara Forgy. Alice Gibson. Violet Grube, Gladys Harvey. Florence Hunter. Margaret Kline Louise Lahr. Grace Marsh. Lois Mills. Geneva Murphy. Dorothy Nazle. Helen Neff. Ilo Kloepher, Rudolnh Klumpn, Fred Klumpn, John Koons. Ralph McKinley. Harold McNutt. Ernest Mahoney. Lowell Miller. Merril O'Brian. James Parker. Donald Porter. Charles Ratcliffe. Carl Rice. Gerald Robertson. Earl Rosentrader. Louis Routh. Jack Schmidt. Donald Sharn. Robert Strahlem. Richard Tubertv. Harold Winquist. James Wolfe. Henry Wortley., Randolnh Norzinskay. Sharlot Pendry. Marjorie Pershing. Maxine 'f Porter. Lucille .Q P1jice.Via,1ma QL Pritchard. Sylvia. W Ross. Hattie Ross. Ruby Scales. Dorothy May Sellers. Cleora Shaw. Helen Snell. Daisy Snell. Rose Stewart. Ethel Szelessty, Olga Tam. Adelaide Walker. Eugenia Walsh. Geneva Whallon. Laura Williams. Eleanore Wissinlzer Vada H''I'H'M'II'M''M'Iml?liiiEW!ililiEiEMiilfiffiwllifiiiwiliiiiiiilil! EVMliliifiilijllliliilillimi?EiiiWEiiEi55E56PMMMiiillilliliiiWEiiiEl'N'H'IM1'HH'H 'M 'Mwl'W W 'mWW PAGE FORTY-SEVENL THE TATTLER QIIQQEQQQQQHQIQQQQQQQQII1ggiig!!4giQMiiQ1j1limMngllmnmw11ug!!M114QI!!!1Wwgg!!1W11rllgwggg11wwnljgyQglugwwwnuwwriiiigjwwfxquwwwH1444wwnlwwwwwlmwfiiguwwgjgiwrfvgnwHnywwripiwwivfgilwwwrgyuwwmywwwvymwwwuIQWQQQ11HQQQQ4xLWxriiiillxiiiiiiliiiliinMx3xQigixxxxuigixxWxxrigwxxxlipxxN:glxxunixxupmupxxxupuxxunuxHmgxvggguu1ruxNxnmmuy!xxmmNunmyxxmyxxiiiuxuliiyxiliijwugiivlliiiniiiilxugiiifaggg EE? 1 EEE E3 . . Ei !,i PE! as 151 1 EE Q21 , .EE Ei EEL K Q Q 1 EEE E 1 525 EE 15 IE' ii! Ei El - EE EE' T 'S' E 3 ' Ei IE .QF :E 'E' SS! E Ei 1 1 f 1 EE' :ii IE? i E E! I 1 5 I EQ 2 EE -5- Ei Ei 'sa E I 1 . 1 i I i i EE . :SQ SV 1 E 1-i i 2-2 i Q 3 . , ,,.. .. . .... .,.., . , 'E' illmlnfnvliiiiixmuilihrillsvrdinxllumvIuIInwIllvmqllxaallg!mg!gngul!uvx1uululuvnngnggggglgxvwgxlgnyxuuunuxvuluxugggpggqgvyuxugnnunumuumuWmurrxggyrvllnaxauunnxumunmuqmslgnqslmun uwwmm1QQWQI411wwnuggpgllpwwnuqsxgg!!14rgglmwwwuvwwwmmwmw1wgvgqmmmgmwwmu,mnaAuwwul1wwnnga!mwjunwwnwwwxxnwluwwWlggvxxnmxxlll1lurluq4rgywgygWg41nlg!p1g4lg!Mrllgljl!!gg!qmg!glqnlynF PAGE FORTY-EIGHT. THE TATTLER H 1 H ,Jw whilrllahmmm., , . 1 151 V. Z Z, Q BIT rn Y QNYHlllYYVIII!HUVl!fH!!!!wH!NWIINWIHHWI WK HW!-Q H WP'-H U H W W NH! N W H U W W v W1 NWN N WW UW H Aman HH N HHN,1NNxNMNNNWiiiHHHIUHHIHHW1 HH H U P W H H N H H Hi 1 N ll il ll PAGE I-'OR'l'Y-NIXIC. THE TTLER , , 1 1 .,,1,,,.1.1, , l 'a i , ..,,,,, ..,,,,,,.,,, , ,...,,,,...,,,,,,.,,,,,,..,,,,,,..,., , , ,..., ...,,,,,..,,, ,,.,,,,,,..,,,,,,..,,,,,.,,,,,.., . ,,,,. . . ,,,,,.,,,,,,,,,,,..,,,,,,..,,,,,...,,, ,..,, ,, .,,,,,..,,,,.,,, .,,,,, ,,,,,,,. ..,,,,.... , , , ....,, ..., , , ,,,,., , ,,,,..,,,, ,,,,. . , ...,,, , ,,,.. ,... . ,,,.,, ,,,,.,,,,.,,,- 1 xxx--- -4-x11--- 4111 -111x 1111'-4'-x -4'x 1 1 - 1 1 1'''N!!!'I3!!!!4331I!!!II1H!!!3FH!!!IEH!!!3333!!!!11333F!!3333UN333''H''1Wli!!!11I'E!!'F''Z!!11331E!!13311'!!333F3P!33E13U!!!33''E!'''3''!''''''FW''''F!!'33''E!!!313P!!!3133FE!!!333E!!3333E!!!3331HT!33''E''''''El''''I! '''I!!!!!!!!!!3!!!!!!!!!?!!!!!!?!!!f11FE!!!11IEE''3l!!!3333E!!3133I!!!II3H!!!3I3fi!3333'YE13331I!13I33IE!'333'E!3333'11'''3'E!3I33'P!333'EE'3'3'''3I3'' I33 E'3ii11!!333!1E! W''''''5''''''V''I''31'II'''W''TE!!!33'U!!!3'''4133'EUI333E!!3333Fl?133E!!133?!!11!!E5!!!U3!!!1!!E!::..,- I' A G IC F I I T Y . we-.Y N -- --war - in r r - e .. 2.1 9 N ax , ir. , L, G4 .Z .1 s ...- 5 l z if Q1 4 , ,T 'E T AT 'r-L:E'1t mlnmlnmallllInnIIImiIIIInnIIumIlllllnlllllllmlllmrulllmllnlnnrlllll1nllllllmu!gg!!lrLi mmm ur m mlm in unul ,i-f 517f 2 Q all 5? ' . H l Q.. . S ' Q' E ,Y V 1145 C ass Barnes. Charles Leedy. Robert ' Benson, Joy Lenon. -Winfield Brown. Rondo, Lyon. Urvin Bucholtz. Karl McCall. Harry . Dickerson. Leslie McDowell. Harry Eichensehr. Charles McElheny, Joseph Ensfield. Walter Moore. Everett Fitch. Everett A Procter., Rush Garrison. Neil Rehm. Herbert - Gibson. Galead. Rehm. Walter Goodale. George Reighter. Harry I Goss, Richard Graf. Abraham. Grisley, Harry Grover. Fred Hahn. Paul Hight. Keithf. Hines. Harold'- Huff. Franklin Huston. Max Jasorka. Edgar Johnson. Robert Jones. Howard A Klinck. Dwight Lahr. Ernest Angle. Esther Bauer. Bertha Behmer Dorothy Brown. Hazel Bucholtz. Genetta Buck. Mary Brukett. Emma Cree. Jeanette Cl11l11111g1f1,B.1T1. Florence Deane. Helen Deane. Thelma Ezgert. Dorothy Enyart. Marie Estabrook, Glennie Evans. Irma. Flanezin, Irene Garrison. Ruth Goble. Lillian Georgia. Gray Hanger. ,Dorothy Harrier. Flossie Harvey. Gail Hayes. Neoma Root. Clyde Rumell. Carl Schugowski. Fritz Shields. Robert Shull. Keith Slusser. James SIQLIIIDBT, CIHY Thomas. George Tribn, Paul Ulrich. Warren Urnbarger. Donald Vernon. Floyed Wince. Othello Winters. James Henerson. Dorothy Herr. Edna Hillls.,f Elizabeth . Hunta Kathleen Kistler. Mary Louise Kruck. Dorothy Love. Mary Lyons. Alice McKeever. Ruth Moore. Mattie Munger. Margaret Newberry. Monell Rumell. Amelia Sonearty. Edna Swartzlander. Pauline Swindler. Elizabeth Tam. Franklyn Taylor. Ruth Thomnson. Mabel Waite. Evelyn , Wilson. Amber Williams. Irma Yund. Helen Zech. Lillian MHHHI Imulllnull umn In1mnimiEiiiiiliiiiiiiiiiiiIImmImmIlllnlnlllllmlmlifliiiiiiiiiiiiiEiWMiMEiWWWiMm GE FIFTY-ONE. THEM TATMTLEVB 4 u mu ww H H H mm uw ummmwmwmuuzuwuwm,mmnlmwmmmwumumumwwmmnuunmumnmmumuuInmuuornwummm'wumwwu--uw.mm mu ww uw, ,U ww wwmwwummf'wwwww:4w11w111wwwwwin1111u111wul1uwvvwwvrlmwx-wwH ummm mm mmumu uwvmwmm mu mm mu mm um mm mm mm mu mm www um ummm mmmmuwwwwwwrwwwwwwnl1wwwwwrwwwwwwuwwwwwwuwwwwwluwwwwInwwwwWllwwwwwnzwwwwrnw111nnwwwruwxxunxxxxnuxxxruxxxnuxxxxnvxxxuwxxxxmxxxwuvuuuuvvuwivmuuwmwuwmumwvmu mumummmnvuwmmunmmmw wwHwnwwwwHulwWWumwWwnwHwwruwHwsuwwHnwH11uwxuxuwxxmuwlllmnlumllnm : mmm G IC I-' I F 'I' Y - 'I' W O Atkinson. Carl Barnes. John Bott. Robert - Bozer, Morton Brown. Francis Castle. J. M. Coleman: Harold Crook, Dwight Crolwer. John Dingledine, Lester Dyer. Fred Erbaugh, Hudson Fettig. Herman Fischel. Richard Gohl. Richard Hall. Emerson Jamison. Walter Julian. John Kummer. James Barnes, Marjorie Bashore. Thelma Beatty, Marjorie Britton. Mary Chesser. Helen Clancy. Lucille Clay. Charlotte Clem. Catherine Clemans. Helen Cramer. Helen Dittman. Elsie Driscoll. Ruth Elliott. Iena. Erb. Francis Fettig. Rosella. Gable. Helen Galloway. Blanche Garver. Ruth Geyer. Margaret Gingrich. Gladys' Gordon. Mary Graf. Marv ' Halderman. Ruth Hall. Carolyn Hassett. Mary Ilonple. Thelma James. Einx-1 Kirkpatrick. Thelma Koontz. Mildred Liminrz. Francis l.imin22. Svlvia Linton. Carrie Love. Glendoia Luetzow. Herman Lyons. Albert Messerly. Charles Minx. Paul Monahan. Edwin Myers, Martin Newman. Lawrence Perrone. John Pickklow. Mike Reed. Raymond Shields. John Temple. Harry Tucker. Ralnh Uhl. William UlreY. Norman Vernon. Cleo Watson. Robert Williams. James Williams, Leo McCoy Alyce McDonald. Marjorie McDowell. Annie McDowell. Mildred McElheny, Juanita McNought. Marjorie Macklin. Georgia Morris. Margaret Mull. Virginia Murray. Francis Musser. Marjorie Parsons. Parilee Pittman. Louise Ray. Francis Rhodes. Irene Rocke. Celeste Samnle. Floy Schafer. Marjorie Schwartz. Mary Skinner. Estelle Spencer, Amy Spencer. Mildred Snohn. Dorothy Stamoer. Vada Stanley. Mary Steuhm. Ruth Van Arsdai. Kathryn Vesh. Evangeline Wamhoff. Lillian Walker. Mary Webster. Vera Williams. Gladys Zolt. Kathryn PAGE FIFTY-THREE. T H E T A T T L E R W , , 1 wx. ,, ,,Mm,f.w U 1 1 'LW wzwunslm-:sm M, , ww mm uumxxwx wwu.ww,:1,x,z11f1 PAGE IUIFTY FO 'il' 42- -Q 4, -FY' J THE TATTLER W Vllll W A Bailey. Edwin Benner. Herman Berndt. Carl Bird. Clark Burks. Paul ' Chesterton. Clarence Chunn, Joe Conrad. William Delon. Joe Fulton. Robert Grandstnff. Cecil Gusez. Arthur Hill. Elmer Hockman. Donald Hondlefv. Robert King, James A Ayers, Dorothy Bolen. Louise Brumbaugla. Edna layburn. Ruby ' vis. Florence eret. Louise Fdltinger. Everill Hammond. Madreth Hendrick. Helen Honnhan. Marguerite Kasch. Bernice Lybrook. Mildred Martin. Florence Mathews. Mary Melrose. Golda. Miller. Maude 10'-B C ass Morocco. William Muckenlfuss. Henry Parker. Roger Perrone. William Porter. James Porter. Herbert Pottmeyers. Fred Powell. James Skinner. Harold Smallwoufl. Ralnh Stone. Robert Strecker. George Talbot. Clarence 'I inner, Marvin Trout. Doine Waisner. Elmo Murphy, Eleanor Overdeer. Helen Parmeter. Ethel Rice. Ruby Richardson. Carmine Roy. Isabel Shaffer. Florence Sinnle. Florence Speitel, Mildred Staley. Ma1'.lo1'ie Sturken, Marguerite Szelesty. Elsie Thomas. Cleo Wilson. Lucille, Wyatt, Margaret GE FIFTY-FIVE. i-. THE TTLER 5maz.aa.m......,...m5a....m,Hm,.....,w,ama,a.11Wm..,,,,, , , w,.,,,,,,..,.,,w-:W,,w,,,,,..,,,,,...H,Kam1....,m....,,..,n,a..f,,.,Qu.,,....,,.m,,hnm,.i..,,................aa...,f..m....maa..m isa -- a i-, .- Fa 22: BE: ,-. Sf if 1: gg i S5 Ei :Z W, Ez az: EE Ei Si i 5? E4 25 1 EE :, as 4 EEE 22 E! avm..m....mm...mm.-.1mllm,.....4Ww1nuX,N.WX...N.Ulm-W..H..,.1,W WW,,1w.mm.,. Ww,...1,, W. ,,,,.W,f ww- ,Q .M ,w,w1,.wm,f,,,..m,,:, ,,w,,,,,,. U,,,,.,,,,,,,,...1w.,,1,,,m,.4,XXummmnum,mmNVH.mm.1..m.n,,..wm.mmnm.H. PAGE FIFTY-SIX. Z 1 1.4.15 4 , 41' L' U1 A 3 AEE, V. '- . ,,,':,F 5.3: rv: gif? 5 A - Q wwf, : Ima H314 f W UI ' L, : . L' I W 'X ' a ,4 PM e V, - N- , 51 il L 1 .4 A x HH, v ' VM I ?l'ff4Q ?' . W'g'E?k 92L 'QW-Ja, v wa 1:11 ,N 11 W J x, bl, y M rf, . , A f ' 'if i ,. 5 my W3 ,Vi ,4 5 V A .. W. f Q 1 , ,32:f.,: t,1: , 95 QE? lfiafirli. , . Un mf, , 4 Y , ,xvim n,.lf'kM' N fi . - fs-wx -. ,J Y 72 ' L- '1 .ng ffl - A Q51 -4 2' fx W. ,??v - M -vi? W' XV 'fs w! Aga. E85 EV' F' Wa. f!,n5! N ,, g, MESA ,Ag , - ,. .i1.,5A.-k.,.tg. in pil,-.x ,,5,, -5511 . :Hz-pf in ' 5 'iQx5FP'y'q V'-M1 1 r',g,ig'4Sm, L-V J N12 A.. 447 qi 'el i I An, .. .144 Q H V-'M H. up .J M 5, 13f ,: f,aWv+ fq f 1 ' iv e qw. W. f , J , aku if Q H mi' w W fu SQ? - : - ' A-if 1 '32 .Z 'QI . if, Q 'lf' 1' X' , :,,.-,h x i 12 , PW, wP '5'l f:'1 H7 1, FQ' W' n' ,54lr1,,mf'5'QV Y A f1g. 'jmQ: if YU E312 VQQ3j '!v 15' MwwWw+ '- , ' 1:- 12 rg- ' ff l ,M Seq 4 A , -.1 ,ff 5+ Euk dv :J f1:A1,,N,w W? 1. it , Vw W 1 . 1 Q ix Ti W r 5 My 3295.9 -arty - 7 A, rw I m ,TRW 1 ,, ww-q ,H Nf.. ' wx 5 ',1.. Wg1,n li'5T,'f1: 5:-niwg... f , , ,1 'WM if K, H. gf '- N A -, an wx .' .1.L:v1 - ' - -',. W, 1 .,,- , ,rw 1. ,H -1 J N f :,v-STEM , . .' ' agp, iff, -'54 . 1 4 f if wwwswvwmsss ' 5 :gg ii , i ' j ','1 mfg W K Mi' ydm , f . ,, Af,wK,wghH kv , Q , , I 1' K ,., , ETfwmwwww f M5 'R 'V' ,QF ,,.,. Q31 A , .1 . WEWWF .A 11+ h FQ .Pm-15' H' W if 4 feng' gli? 5f:!t.L1'uh 25 51. E' H i?,,MW fm ,L -7' .ff K .. , ' dir ' mv w J 1 v WW 31- f2 'f , f f Q- rs ,-4, ,, ff . 2 Q12 112 :45 WW 1 '5 ',l ,w .',, Y- 5 'Wi 'J f L Qf- i rf ..'v3p'f 3252 . 'WR' if iw 1' ' 4 1 -iff 1 Mk if , f.,W :gf iw 'M EXW: ' ' Em W5 5 MN www 4 -I Sh , Elf? 5 , ,E Lf. - V, V 1- 9-, - ,Y M . 'W'6'f1' 5- ., , P. 1, A w N PVS wi 4 X Mp , ,3' w'Qgi + f w ' R' 6 H .-'G' hs Q '. :Ffh al NJ , + f H .f, K aw ,, Q .W EQ, ., gir '21 gi .41 ja- I 'bn guild 541 132 ,I .Ji ' B rm., if ' W L mf Wir MLL ,,+ 45 -QR ' f Pl7'v My fm ' 13' b- v , . !lM :gqi,1FG, Jn3g5ghl9.wf. 1.2 -it f ff fi '. v 1, ., w .Q qw! W if-H Wm iii W V '94 vf'-rl' I x , V, ., W mu, V 350.11- ' 91 ' 4, a' ?w m' Vw' MH .aw , JA Y , sggasg, an sr 7 A Y' 13 we 'Nl ' fr JVM ,A nw J 5 .HA is Q ,, . , ,ff wf - E gg, 42 + 5. hi ugk vr -1 1 'MW Mmm ff 'Z' 'L V v 'fm ,T , N ' uf ,, ,, M. V V I w f I w 4 m mm fs if 4 , u Q fig-l3i'r. E .X 's i-'if' 1 'c ,G ff ' W 4 J Q 1 '95 J M f ' ri-'1-5 V , '-srurv--f . 1 hm r. , S, ! iff. .':i9Y?:1Z L 2, ,. . f , . M,W,,,A.,9, R ,mf , 1 fi 1121 fx -a ' -.+rfQ., L ,M M , mu' .,g.,,- , 1 X -'V W? Q-X: 't figflll V ,wk iq. Hai ,,, -v!..n lifis v um! I wwwgwmwgggg l v fa... wr 'if i LV .-V, -5. if ' Tr 4 ' 'Vu' '53 5 M ' fl In 4 1 MMQQSEWHQ1 m QW, Qg?4f3EflM15iw V1-,- gm 1 'f+'5.'., was ,fW.,i5 ',,',f ,, Q,-t 513.4157 : . 1 ' V T MW -ffl-- :L l'fff ifif :wi gf 71271. M . , D- !-VA 4v1frfV.1ks W5 ffl ' A--E 81 f' rf ,1 J my ,F 4 wWf1 ' .Qf. 4 , . fx ,k T-gait wmwwQ?iwg .if f T13 ff ' + 2 5 T 'J M Wg ? ji, .ff ,Y1. ' ' ', N-, . A M 1 v W M 1- , '.- V f. I V .4-' - '- 2. 5 , ,I 9 M- N,. g L a ' 1:-nl. ff f GQ L -' F :-- .... - 2 ,X :Qi :AY v m . Q 3 ,w f 1 1' .f N? 5 7- H H .fm .. + J 1 M1 'P?8m 'W :'1' , - 2 W4 4 M wnfk 1 5,95 9? if-'fi 1 ii: EPA L K wnifhtf' ,rg I QE P ,vwffl Pl. 5 if W A w WM WL wh! nv MG' QM-fi + f- ,M JW 1 s V' WL k fr AWJ m . 4 mu l Y' ' fs f 5,-S 1 1 i s wif- WBA! 1 I1-, -Er-M if-as - LX 2'5?9? i75f, , -, u av -nf? r: W 371 V , ::.seS' ,- 'L li - 7'3- ' Jul 325, ,X ' ,.',.f1'1 32 f V N f' ' 7 ' . j51Q'. 5 :V i . , ' Q I' ,Q jL,.' .g,, 5 -' , -. f .+i:A Q.-sas . - A ff , gf W, . , .,,',1,1 'SMH u l 2 Ev V. MWMWMMMW , A l , wr 1 G iwwwwg I 315, 1 ' L, 1 v ' Hw'.,i1 f W Nlwglm is LJ' I 31541. .f f' '1,. M?5Hp . ggi., ,A LF fl' 7 if-'V4'-Z-jj' ft Qi: fhjiiji. 'f-5, .. 1' 35- ,lf f , ' ,w M r, ' uw' ' 'W -V wp ,ww lg ,, 2 r1yf,ufifA,' W' ,,flUw, if A 13, W fi'-+f.7f- ?'f2?P9a - ' - fu: :Hg - 1. 2 ', 1-f 1 inf, s ww .f12L3'5i' .. f xiif '.Q?f'g! - 5V3igS,fbi2i YE1,.'P'5 U iWfL'7'.W 1, 11-31 1 .ww V 61-'sin' H M , A ., MA, -in ,wk , , fw v ,- - 6-. ,MNH ,Y-.W f ,lux - -gag Qc 45 ' v fr 53 ,3 Jw ,rmzw A 1,1 :N M, wt?' ,W: 5-W. ,SH'254v?iqF'ff 1ff'1': , M N' MMWMhKW w 4 4 iv ' 'A , , ff, ,, , V ww uwbns-ml Wm Q W , .: ,:L L.ax2 -H MPM-fg1a'r Lm..'4Ak 4 '35 1' 1 ' 5' -TIEQ' -ff' '- 'L 4 :R 'i.'!1 13 '-1,- - 1 X- f'1a'?ff'3..?H41' Q. ,fr G R ,1l'i.-e.-:- ,. v: ,. 4 51 ' ,mal li WS. NN my 1 V ., ,!:.vl1'rw, 'Ll' N: .e1'f3,11 ,E,1W' f H 1 LH' Nj, V - XI! Lf E29 ,-rink ? :.' ffl-1-I s fi Q .nu .f JL?-FL-' 5 ,W -, ,. ,V M, V1 1.5 Us 1 J , W1 ,Y C .f ,. 1 A 'L- Q 'Sf ,ned Y. 4- 4? 1 -L wut W1 . 1,- wm' N.W,,N hw M , .N ,P I , .11 , 1 lu WM- ,mn L' X 51,-' 1 h ,,,. 1 .ff 1, ' A ,qgfff 3 ., . ,Q K fy' , w ey:-L 33 'Q w , k,5,.: ' . Eg -.' V. iii, , :A-W. ,-,F .11 U? 'fn-955 ,gg. s' .- 1 u --1 K 1 2: fd' Sf -' M l' M1 . ,' A ', QE' V' if N' QV, Q N ' ' --'- 3-. .1-' 5 11 2 'Hd' A '-1 R Jn Q av S qw., :H 5, , 3' 'gg 77' V 'V Wy 1 M N 1 wif , W R fc: f an r J' 4 W1 H . f' ' - 1' Q1 'ia' -PS! fic.. ., 2.32 x,,.,nw ., - ff 5 - 1 4 ' f?f'T .r-M' x 2 4s Ui xl at w if? HMM, ' W K T1 35 ',!, 1' B X nf: .gi 'A , Liffi - ,,' -ff ' A 1 Yi ' ,S 1: 4 ' -FF fltdfvgz fxdfiivauifff f --g 1 35, f,.3'1-ws - mm Mg,- ' N' 2' 'f' H-1 115:-GW .21 A - ' Ma, Q . rw mwwm ,, ',,:mw -M l 5? in-ei Q ,',' '- My my 1 wi, '4WM wx H, Q' ,X W Wm W,h n ,v aw 1' J ,J , 1 -1 gl, 2v'J,,,-,4',N3.' ' fJi.-' Wim , .., V, , v ..'-.,.',N iw 4-.14 .ff -5 1 ' 'f - pf. ..-gg.: I' ,Q N , ,Q uit, U Z i., 1.-,F ,, ,, ,ig L2 A 1. 1,1 -,--J, 1 4 , v mv xv- -- - 1 :,: A- -Yiy- 'I , ei ff ,. if Jur y 1 f 5. b WTAE? ' mf, f M x + TS 3 r I X F' 3 v Q, A WW' ,11 1 M 5 L ,. 511, 'fmxifwfsi 'A if 2'- W :J- 'w' Nw-'fm 'z '-gg. - 1 - fx V. L V .M kt.-1, :M 1, 5 , - IM. WL '4.q,Nx!pws ,jfiv j.m3q1.f ,f vim, I 'M -,-NJN! , gt 1 w :- f Q f NM W-. 1 Q-N I nr .HQ 12 H? 1 'fy-17' V'- -iff? if 7' M , W 'wf'5 A ' ni' + w W b w,JN'w,.ffMA 1 X. f WIM U WTI I F 1 1 I . r 9. 21 f ?,,,,N - X1 2 Tv, ,. , -,W-1 3 -:ik h i ' , 1' fx P . Wm E ' , '35, l ffl 1, Ya :N ff M M x 7 f ,, - M X MW, vi HM fb? L 1 N, H: 'Fx-M ' me QAM ' J 'SEX 'X 2 ',P-1!: Xyg Wf'Mf v u v ,1 Wa Six e 'UPA A r bk' A ---' r '1 , W W: ,M 4, M V M M M 4 'L QM! MH Y I5 I x 1,3 , I 1 ' A '1 ,. YQ! 3 51 rg3.,.1 ,- an ' 'GM' NV , ,W ' ' 41' S f 1 s 1 f -1, ' A A ,,. -11 1 -- - ,. ,.-., in V . V fx 5 5 UQWSQ wma we ii i' ' , 1' I . A, ,. W , , ,, . 5. .lg --1 ,- '1 5 . ,. H . 1 -1 Q- ? K W I. VI ly .. .,,.v an l,,v ?3fxJg,pq, M Qfivrfs' WN 1 as if bb ' H- 'N 'F' H '- ' .4 ' ': ' -'- ' . --.' - ' ' X ' -, . 1 ew. .1- ,lfu ggi,-Q 1 V.. gjv -I N g, egg, Q59 2 . 2. 1- rt , - gyaf. 5 4, 1 .Z 5 3 ,N N FQ-r - . '.'fAf:1x,j:.-Efgfgfl W Q 'W Q - - . P l J i QW- 4'21 ' ?' 'f ' xqUiIfl.K l I +'r4i'Yf'f 4 ,', '31Ti 'T',2I3f r '3rfW Q v ii , :1uff Sl'Jf wi Mi - ,X ' V M , ,. ,M wiv-w.1,':g,'.QW' wx' 'WxI1,f'Lqw 4, w,w':F4N- 312 ml wr 3-'wwf-Fw 'J 'i'I+'jx,'r',wf lfwwkf V. wi' 'dx S1-L .'vf2Q.:'f?1fm w'iq.FF'.,' 4- J, -qw hw, 'L '4:,,,. .aw.e my Ju- 11 x av' ,M',.,W ,X ,Y A H 1, 'WM-N-,,:sf. 'w'w11.mw wwfl,-we',w,f':+,:Lwr,151' a':,w'W-ug , ww w w L 'W' u :fm 'H H ,1 +- WW W WW ' ' ki ' 2' 'gvf' ' 'L4'?z,,,2 -,-f1f4,?'a!f,','. ' ,. - e,,-,gg .,'?,'1L.Q.!, -. J: nfxs fa I' cfg 4 ,f. A . .f,. v. , f-ff-' ,f. 1--- .,--' .Q-P f'-lf 12' , .- fs! . -'wa ':s-.-' - 'Q 'Q' 1 71,33 J - - - u -If ax- -- W . f - K-. nz - efgff- -fmt ff , I, , . A ,- 7, -ff h f, . -1 - ,, .. -Lx. .f !v::Ge,, ,V g . , - ff. 5 ,,. . rg, - , 5.7: .r- :fx ,g ',,, 3-. .- ,.Z,g:m.j, 4, ,- 1 ,':,, .T Y: y 7 --g L 'v-, ,f - YW: , .V .P h pf 331.5 . U 4- Y A., ,U - A ,v I 5 R- ,, I Ei'-?'E'3T:s Xifzkgf-: ':4:N!i:.,E5-:Vx !f.xk.A:, '2J.-5.-. -g,, i1':,55Tzt'mn Wx- Hrgw--:JL,V m,g 5.1 7.7 1, .ix -I Q-gl, I 'HF .F . , . . . ' fi-,1.-5 Eff- - j ,Q ffl: 1 ga-A Q' , 2 'QW -P N-,-in y.- H:-1.4 'n',f,'1f , 35- ,W ,- vi fsj- mm .' E1 Q J- 1 I :IV 5 U , ,MQ 1. 7 5ffV'A ,5l9?1s3f2 1-if'31-4,'M'F72l7'-'I Y '!.gw f'fZ'5?'757 fi war' E-555 ' 11 J f-Q Wwq W.-,fm M11 nm, 0 M, .pwg54:fu13ww ff:-' , mg' H mg- -Qrwfufwgr' ,M . -- '- lm ff- mie bk qj ' 1 fm, -N EEEWSWQTKHF-'V wwwpyjrrg mff-1,1-W -w W-lN2,'!Lww5'QEf W Q5 p:gW,2,Ngg -w,s'. :2:121'q1,,,9:1f'..WLiii wb WZ. EF- 1 T-Qi'-MEFF Wm. 5'v'.IG'4'JS?y'1i73 p U1 T' .17 ,Wkx'f 'lf-.qg,5ii-- 'Q-wb '- h' iv.1 H' - .w W ' 'Aff iw' ff' 'IZ',l': '1j'y W 'ffmh - .x,,gy1.,f.1q,r Liliflif ,, !s 'be,'gT my 'M vw w,f1,,,f,g ,g'?',,FM'f :wi ,',,5-,.1:y1'Wvji56, ,E ,w W - ,, Q,aE 'Q1Qg', j H 'QIM wQfg1f1'ME. Ma -Q h ugbgwsiw gi ' W'WW29Efl1f' A Nm? ff , 'fr .,qw2E' f4bS.lgn,,M , :mfaZJi3f3'E J,2, 1 g,fv,5i ,, I qw, gv,g,,5Q!'-A A f M yg,jf 5f wvfff ny f P-1-4,1 1- 1'-.3 ,' , 5 V. ' ,1- my -. L . 4 J .1-:z - 1' ' . - :f 1' 5 :: f. , X1 9' L ,. 4 1- ',Ljv, -MZ: 'Lx 1- k , 2 ,1 ? ' 2 T. ' -arf, -Lu., , J Jin in-,, ,nw-f-93 f- , , 'S - . ng. . i 11-a'1, Y . y1 ,Mr -ru g .-14 .' 134 :J 1. ,,- 3 igx - U F Ai . 353, Nf 5x::,.lf15i' -jg , Sin- ' ig' jr 'Z 1 , , za-j H 4- ' -: f Eli 1. 'Q'-M5 ' 'J ' ' QQ iffqf. H 'E Q: . ::HL' i.1L-- ,gm 51 ii' . 3, .5 9.51 . 1, ji 31-,,,:afg, f5 54:1 : . . ,fx-V'-'..-5, i.,.v53'i :Q j..- ihiizqi ft- is I. icfn- Y 'E 4 ii' my .1: .- fi? 'A ey' es fs + we! .Q--,1 12+ ' 1 - 225' nf-QA ,. , 8 1 - ' EP 4 H 4' X ' g 5 f bv . HF 311. Q 2135- H? 'fffif ?T V'f', 35.1.21 ' YQ' - ' ffff' -' ,Q ,. A., iq i 'wg , ww x If V , :E NJ, ,L M,-3. -w- 1' W . fggfw -Wg.:-, .uw b?ii,1,Egs ligvejy--1, ,bw!,f.s, 'gf in ,fag ., fy, -1 :K ,gf -. qjx v' .5 I H VL. H .' - - 'f-'H'-:121 -' J?-, ,, L 'ff : ,f wi ,', '-'li .f ,N-'f .4'v ,, V'-5. ,rf J .- -.V -:Vw ,. ,,,- 24 - pf, W up H , sr W mw. N HL , ,,am gL '+w' 2 'WSL' xii-'Q 132324,-' f 'sry 'I?a1','v 4'?'1,?13,,,k U ,gm ,,,:,pmf1, 5, J-- f. ' 'N -w ' vuff k.: 31 my N-1 w:Uf4Ej ,M UW 'Jag' yu Y kk W ,H M Ewwmkpl N ,mx ' ,-,V , xi .Qu W HE' , 1,2 1 ,N pg, 3:5 ,W5,,x,,',!'i-W7 Wg, 1,3 V .EEA -fwzvyg' Rm, 1 'fV m'ki :-'5',1'Gv. 'FM 5, 1 FH ' ,. .. . , ,,,,. , X , , X ,. .,, ,v ,, Q: my up , Am gg ' A wr e wr-faq ,X X g,,,,.-N -f ' .LN-,gqfy g J fi' U4 m. Hfwrw f w .+ it www iw M M11 umm --W ?.. ,m r ,f m A W Jw, ,lm gwrf W w ww y A 111. , 119 , it NT, is ,Jw .Rf ,D M. , ,.a'lsw'. gf M.. ig' :.3, -mf, Q f , WY .-'fw w ww 1w1.'f f-M., mf , I13. 1'w, f L 'J 1 K - 1 1 2551: '- .vg '42 vwwif' in -1 -' .-1?-V22-. ' .-5 ,si -- 'fr '. ' ,-- ' if' 2'-is TLB- fn? f ff' Tw, 1,-'N 7 X ' bf F fkig - 'F .1 -D: Av f VE5'1i T V ' '-L f fiai' ' WW4'- '- 71? dui. 1 sl ..-is ' 'F 375 ff' ' '- f' f, 2- vafr'!?, V :T ' .GQ rl - U -' Z. . . , ., W 4-..4,a ws: -1, fgffwtw .-'Sgt -' -fx -.., ff, ' . -1 2. 2 -' . ' 433- x gui, 1 F' . 'nf' 4 'n'? B 4' 2 7' ' 4' 'SW' if' ' f 9 ' 'J. ,Q,-A21 :Va I it fx rl ga Q M: ,gl n E5 4 ' 9 'N .Tn H gina wjP1iX . -I ' . 4- .Q-1.1 1. W ,- SL I l 1, viii , ,gig ft W wi Q1-mggmq -agv-:,4:1n3sg15:.V5 1-. gg Z:L'v 1H!q,g 1. 'agp - . AH -a g, Y' A: ,wfffgy ff xp , a 1, A Jw., W ,xy-V 'I ,5m.5'.w. Q.. cg -,'!Fg!,:, , Wm : f-.J X MUTE 3 - -.,v ww- ,V ., -,-A Q ..:v- Qin? 'fggsq -w fi! ,SMI Q, M' Y W Qmw Sufi Hin? it ' 'fg1wmg,1f WW X571 fi l,fgl,,M. W 3vv15?ywagN! 1,? wQ. 1W: f'l'UL15f '2g '.:'1w'm'Q'g,.fj5 :J W',f,!+f' 1 v Y -0- -' ,,v. 1 w ww ,w X, -X V .W -M H. W1 1 M u,m,1: wwf, X 1 N X M. fw- ,ww ,M '- ,w -. 1 r X- wi--V, -,g wx 1, 1 411 'wwf AWWA ' ,1 wat wgivwgv G 4 Y, Hfiwgk uf A fm3,gI,:m: k 1' .LA QQ, 1.wwq Mt2g,3miMJ alf hijf' H51 iw ! f!w1l- AuV,gQQ !,?fr 3511 Qu MN!! 4 1 , ,, 7 ' Y og 5: :D 35- ' Q- ,gk jg 'Qi' -:L g .1 k,g,i'A'L.: 'Wim 3 ,W ',k ,.'A.QQ.i mf' ,, 4 ff, 5 ' PX ASL' r ' 2' 'E V-,w f . ff gif' .fi 4' fk.,,,-i f '- lil -51.1 ' 'f A511 1. ws . B, I, ,27,1:xg. '-mv, 1.-117.- .-fm Q ', : Fw ' ' -N ,- ,V J., -Q LL.. ,,'-5 1 1 ,a,iA, , g :.fa7,g-153:11 EQ,-,,, ,-.c w -if V '-Af iz- - ,4?'i- .Rr -1 v. -'1 .. 4, Hg 5- 5-54-1 154:-5-5 , 1-it xl' 1 1 4 , ' f' , F5 .W ,K .V--5 T , X af -if ,-1, ., S: ,- 2:tff f11 - ?:,'?I'i. .vas i 11' H. -if.: jI','1-2 ' R r 5 9 ' 'T' WT' ' 1 an ' :L fit? -i a' 1,41 jr-'U in . :Lb :ff-0 E: ' fr. N f- ' :vi J- ,'l'v':f' 'J -I ,- , ., V- , .. , 4-J A .1 - -gf -f-. 3: 1 f . L . 'G'4v..1' , ,f 95 XX XXX 1 ff w, , YS. X 21, 1, , -v . r-1, n X 1, .r,,,.:v.5f ,,1 lr X, Lg ! 1,-, L... 4. .gl . 'T' gl ,Ima ,gy tv 5, ,.,.,,,.glJ ,ij 4 kijF,Q'5 ww. hw 3, jg , ' fm Gsm M .Tp3ffeiWE: W ,' 21l:fwen r.1N L' 'v:g, , 3 ? X ' 1 1 w W X ww X W X , '-aw N,,,Hiw ':m gfjw, 'zw fv fem I m x ' w,',.,'n5f.'.1,',1Y g,,fff+ .mg -w w' M gm.,'1,'a '.:1fr'v V1 1 N 5 Wx W 5 ' ,X 'jj W1 W HE? Wg, Jf',nf ,'m.'1.+i,3.1 y gg jlw lydfz'-Q25 'KW J w ' . N ylgafiaif, WJW IMF' wi ,?Ui rQQw1i-1',,'?i,q-QIJN-MQ -ag J '1WPgMmP' X LM?-m,:',-NHL?-N ', NM H.Q!,fm:'vC:W-5jmg, 'iQf',',Q1 . JQUQQJ ! 5.-4 , va ' K' it LE . ,itiuif Q 1' 4. , .wg T ,5 W M. wL,w n1uf : .1 ,v wif, N Q sw lw:,?Mf'Hw .p m cL,A 117,:?YEfU, 'gy 5, w 'Wig ,Lgycy'.LtfQ'!l.,gW,Wqm'f' M, . - . ' . 3 .-2.2 ,ii . ,'1rf:g g,e,, ,A , -' iam B 1' E X ' xp if , EE.-I : 1:-ix ', 'ff :fix ,L -gr Qggfffd -Y n 7jyf , :L1gg jr? ,, Y' f , H '- : - -- ff -2 V if Ii,'- ff,-1 'f ' 4 5 ,iz-'V' 145: ' ' , ',,-' ' pi- 2-11- + A 4. Q7 ,' -.5 4. -uh ' 3-, r- 'T :Q- ,,.w1g'e--I ' , ' ur 5 , .,,, Sh, -' sg! ,JR f r.,.f- N'-s Pu V 1- H' 4 1 .v 5 5 f gif ' '- '-'53:,s.:g'4 5 '- -:.,Y,C?.f' s' E ' il HE' ! , ,Y . .ri 2' 1 -T, -:FN H ' .X 595, 4 .Q fy 1' - 1 1 r, ' .zap fv-9--f-f 1 wif --J f. gL,.,1rg,f' ' . w N, L- w . 319 -f L: 1 ' ve ,- 4 1' 1 E ' 'Mn ,H 5' 'Jw-E' WFP- ' - W :'f--fi' Y '7 e. Lb, 1 f Q 757' f f? E, -1-: ii'- , . 111' ' : W: Z T X. WL L ,Nix M 1 W X -,qv 102,13 X QL :yi :A nf l V, Hii,5n'l wiuqgel u Miami 1,0 5 Qs! ,,ygQ,'E,f1L-4: ,Er J: :Pi ii 4 .Z I, QT- . 7 W 'f H wg ' E ' ' ' J H X f iw uk pw 'I X XX iv .1 'fir ..j'Wf'w M W-rx 32: '-1.N'I-flhihw vlwfr X :M '- mv -1, Ea 51 1.1 Rf HSI, F1-,,Q1 2f'..4 l M 1, gm ,V Q 'J' 'U HQ, H X 'A Lu M, 'N fp , , pw Gln ' ' iw , ' um, ,, ,, ,, iw,,,y,,,. 35,11 MMIQQ41 n 1N,,!q-,gjpww m1 v.p.5-H ,p,:w wq:l,1zM :'f,,, '-,-,,,g,w,,qN6M , .W , m X av 1 1 M fu 'Wy 1 X X ' X X vi ax M1 ' WM My R: ,:' Wwrwjw, .1 ,W gg, Xu, 'pf wr w gX.wg, w yy , gm tw-y w, 2, ' Q-M 'N .3 I, ,jf Vw yu X M 'ff 'U' wifi! fi 'W X 'MW L f w w N w : ff iw ,ws f: wS i R Y X , , ls J, 4 , ag-15 4 , , Q-24, i f , , 1, f :gg ' 'feisg 'fi' rf: 1 XL , 1,5 fy f ' 4 A. i 1 , . - , I-'g' f,f'5353.5g':g,- b ig, , H - f 1 A :' ,: A, ' 1'y4gf?5'f' 1 ' -' sf- . 1 1 i , 11 3 5 - -1 Ld-gt-W A XJ an ,il A A-, 1 Ex K 3 'Ev' Qg ir c vgf frzsgtfj. x-dk -H? ', :Af a , gf ggi im-E ' 1 a f 1 ,f V , A i b Li ' H ,fgy ff -, -'W-,.' E-:'2 f,!. '. rf 4: .. Thi- Q: :avi T 1L, l,!', 3-52,24 Lg ' 5 X M X 3' ' li 4- 7' if ' -1- f'1? 7f V, e-5. - 1'. 2, 2 TE? -' L.f'3 fm MS 'H W K 4 'J f 7: QM 'A Fm M N? W ' 1 'wg J ' X W :J , VT ' e Mfff f?'3i6W':'1i f E? '? '54 1'f'lf iq A ,E 'H' 'Nm W fy Ww JH Q 'jk MTH YLZW W Qu W nd. 3 W X , w wf WJ ' wg 716 ww' M 'g ,4QMQ'fZ'ffQg3,-M' wi ,l ,ym wg!jw,1,'f1, 5f' btw ' ww Lj:W, 4g'1ff?,, ,, mm mf? W., 1 '54, MW 'ms Q pw 1' X ,M XX 'gm ' ,hw ' ww M. W K nw W W-wgp1.g.'-X .J 1,,1WYwWj q,., .gxiw ' 5.,,1pw: W,1.,w fg f 'Y M g,3'1, 'yah W W4 I u , v SJ' N xl-'J' 1. P! N my-1y',zv A Wy- r.!,.,' -as 'kiwi , urn X XX X -Q6 w.'QJw :h. 'L ,ml ,,,uma'u:J X , M1 w1q,, '.xHp M Q 1. rm , , ., gd , 4 l lg ' 3: Q, Q . f Jn, mf, ., ., X L 1 , 2 ,Ti X. ' ' f - 1 2 1 - , x 7 .-1 f fi-1, flkli' 7.211 5 324- '51 -'i' '3 ..'i ?f'-' 1.Y27 1'vfAff ., ff, ,z lk 1 Q, 1: f 5- Nl I + , 5 8-.gg if-3 sx v. J?l if . :QI ,ff hi., ,rf 1, 'I ig: In 1 L A A ' .nm ' nf 1 ,' H ' L f V vc in ,Q +5 1 it iw my X ,, F if T M H A K V na: 1 ii, 3 ,L A 1 A v jqvr fb i- vii: ,iff -H H' ,uf hww, . - -F N NV 1. yn 1A jr: 11. 1 - f f K' ' ' ' ' 'J -, .. L , H T- X- :A :fir , in.-A , '1 ew :M L ft-, J fx ia,-'+F,,. - af 55' 1 fm mf w if QV H L ' Mr, . wing -' I 3 . AwFa:r'vgf i 'S-f' S mf rl X ww 1 nJ, +1 .pf .Y 1 ,,v x4 ,n ,n ,w.,,rr. . gi., -. W,-ATM, N, f.. .,,- Q ' bw WW M- 'iqfwwfg-,w, HW 'HM 'gy X yn wfiwgffjf ff Nw . , .vw iinwq ffvl -A -4 -W 'Jw -,.u17?e,,,wqfVs,, w w .. WH AM, ---m-- -1-W K 'Q xr, r ' w' A 1, , WM., ,, X X , , H, XX + X' glfqffw v. Wm ,J ,gm H+ W , Vmyw 1, iv 'M g'- , N, l5f,j.:' u ,,,.1 1.u, ig- ww- j ,hw -y gmv-5'p:f.yg, an - J, U11w,.,, Q7 9:1-W ,,AgQ,., 1f,,4j-xg ,,g,h3,:.N,1g'-q'3! w,,g!yn. H + 5 g I K N f - ..:,1E-ri-51-'+' 1 --,Q ,,.rQ-:Y 1, ,:. j ,- lf-1 Lf' .f le Ly: -5:5 'qi 5 gg. tg ' lx' :F 'gf gi v i' L '41 'gf x, f T va' 1:-- -b . 3g'1X,if' 1.1-3-Qi' 3 +' N T'FP'- '17 6 A , 4 r' g Q ' - , 4152- I , ' ' 1 f-A- ft J -.X Y . . I- A-' -UF-. ii, 7' Q ' J' 5 fr f A 'Q n a rv v?f' x A- -V 1, , . A gn W 'U V 31.2 af f. vx .--L 4.f., ' 1, - ' tix :ci Q I3 b l L fr , +5 b g 4 F :Dirt 'P '15 I! x. KJ I - .. Tir? 5 'Tiff 1' A ' A W A A f f M - 1. H . 1 wx. , as-Q L2 if g -mf Qsgfge r x, W .T gf. iw Sf' H 'S5 ' Q 1' SX iw Q 5 fff-,,-4 L. wsff??f4wf f1 T5-f - KW ,w ww M aw W M MW ' ww 31 'fn W' . i ' 'W ' - ' ,H A- W 5 w-f1w ' gSY7fff f Mf' ' '1 'ff+m' ', ?,vz3f14 ,I W w M ,X IN ,J ,,,w.W' N, 1 iw' ,WN 0 W ,J ve! 7. H 1 1' r .ww wiv W I , .F Wg' I W 'iq V J W PM, wr in 'MQW w'lH,3,NQU! 531.173 fi! '4f!T.3:!-N' W-Lg,-Ha W, n vwwwmwmwwwwwwmmwwwmwwwMmwwmmmwwwwwmmmwmmww 4 ,M v + f . , Q, ' F , , 4, ' L gy. u,,, 'g m 1:5 Q fd' ., PM I ' ' da? ' . Q 1 1 ' ' 5 is '15 i is 5 1- - , L. , we J , ' L I a x , .,,. 4: . j:51v:jv515,g' 'g ' ,gl -, ' 31' ATL, - 1 fl uf 1 f -H .. 34 I . - -b L, we 1 M Q Yi w 5 Y 2.5 'H f, .fi Y -'L fi 'X' Q 5:42 - 'aff 4 1 ' wg' -g hif i R, Ja Us Hz- . 1 4 s , n, .yj , - 19 W Q 1 1-, 1-A z lr r- -: ..,,, . L ,Af.1i. -ug + 4 iz 1 - 4, -. t . .,, 1, 1 .1 gk., Q., -rs ,, . -. 1 5, - , fl. JE ' , gp? N391 Na T Y 4. W ff .L . H3 T K2 M 'W ,g '- fi. 1 '55 V . 'yn gg 'g if' Qu ., A, H- 7 My 'WL Q 1 Eli 'ff-pk, 'W ,JSM 159 nr, Jag. ' dy 'ML J I n Ng , M -Jgidgigf e.?u5::,.A5.',, 51.5 UufM.,ff.le,?s ' A Q: 'uw .,j. . Mdh l W A,-yas' '- mai wr w ' nr w K ' W W ' w W , L JH u 'Y fl 'fl f WL H H 1 'L ww v W H1 M' H 'J'g F1'f'r'fX jl '49 iv W' V ,' ff, , 1,j,Ae xifb 1 Wi-AT! Q- ' Wzlff,-'fl ,Lh ffm 3,:,511:. JL W'iLgWfYPW y: H,mp fW,gm5? x A'Q,aQy H?'W ?EW : pp L, 'p ib.' V ', , ,1Ugn4a ,, w' Qgmyw 9 ' fLf5,5gH 23,1 ,T m f ggi , 5iHQ lf1xj,,wT,,'1 J?-Iy+1f ,gMC mm- Lwn w , ,f G 1 1 W ' ' if - I ' ' 1 4 1 ' Ly '-1 f-if, ', -. ,rl 33- ,m3 ,.-7' . 11' W ,2'f2,g.+,,'fx'. 'W-.fi 'Q-UD' ' gui C' N 931 W 5 5. r , 4 ,, J K 4 . -. - x ,,, nv, '?,J4',,.i.L 3 ry- J ,, , , -:E H P J' '? '35 Q - Q ' ' , H. if 'fi A is.. fa girl 5 gf E' 'g Vlg L51 ,j,jm:.- ,i ,A if Q F fr iz if 1 XA U ! lg G I 2 ,N 31 , 1 . gg, , 'iris tgljgf-11 -if 2- - -5 -'3,gp5,h3::2! . ' - 2 - V 1:'..:' ' :Q , , ff ' - 7 . , 1534? H- ' ii' ,r 1 f ff I v,-T A Q 'ill .. :5 'FI -if f ?1f'5,ti25 f2: 2' iff.. 1.1 1 , ., I :K k 1 ,v , 1 X f .V - - ,rn Y - ' Lf' tv. k wa. my. '2 A .q kgfc, .5 'I .1 ' rf L ? , U ,fm . -. S, , sua W A , J M li ,nf ,-.:,:-,wx fw yf- W . i , Q, ,lg--1: Egg ,Hv,,,,1 gkbgifww. m fk fqh JV, A Ezrflk my WRX 41 2 Hy, 'L f r'15w1 WE Raw' NW: fv w g,,gN w 7 'W W W' ' ' rf' 1 A V' W N A J 1 ' pm V ' 1 Lf ' V' W IFE H531-A'1: -Y A I Mfg vw' W' 7 f ' WN' 1'.7:f ! MU1f'7! 'PVNJMT 'Fifi JZ 'X -' V X ' Jk 'Ww5Niff f 5 , Y W 'WL 2,iW. ' wfL5 J Wiw Nz H 'W-M UW 'WW'F' m,1' P341 ' 'wiiw lf Vw? w ' 1'- , M.ifw 'QWF w3v1 ' f 2w 5 i 11 wM WL ,V w l x F L M w 11 1 m H J' v wx M144 lx Nei- H-1 M M,-.1x.uu' Y L fi my w ,U mm. .vu L, ,Hwy 0 4 A ,J 'An . if 1 ug , qw' wha, , 1 , -1 Y f, i . , f y ,M -fy, eg'.jw1A,.NQfxN,.!-L. ,up my-w J. ' N: gyxw.-fm.. May, Wej, ii v A J-yfr' X' 5 ! ' 1. f 1-if YM J QL S -A ' Q r 4 4l,rfL 'Z e, 51 :IW if U -zu' 'FIC-2Y3h'3 I i I 'f R 3- ,Q ..-xv: :-,--:N 1 ' 1, lf- -1- -, ' PY-Q., ' G V: gr ' ' -' ig f Q - -if F' 1. -L 'X A 'Sri : 3'L. 5.f4gQ- 'P X 't ,. f- 1Aa '7' -f -' , , J 4-.gf x ka w f J, Im. -:L ,, S5 LS ral? ' ', g. gf Q i Q ,f .Qgfgy .i' 1jf2.fQ3g-3 'T'- :gi 'V E 4 A ' mf , wg . A f ' 1.1 M TQ , J S , ' - 1 1 new-9 Af:.fiQa-'Q H 41 - l L4f:: , . , , f 1. gg Hg!! f ., A , w . ,F v r U, .5 W 5, ,WH-X,, T . 3,1 M L- 'K H faq, V ,rx 11 My ,mi'?n, n' WW 'W l x Li rm : Ljyiiivw iggnf. EH ?5ra5E,:,L 3 1 mf X N aj' ?iiH!V?'x gif .1191 Hifi I? Iii ,iff 4 .L 'Pj: 1Fa7 A 1? f ,, X X uw v w 4 u V w 1. 'Z ., . ,, N , 3 ,, gg- 1 '.4Yl1!,' ' it ,, , f','g,w-i.f -VE? 1 'W A' 1 may Y 3' H Im Av 1'4 5f! F ' 'H ' H '11 'E 'TWP 1 Us RU M 25+ W fx G JH ,uri 'V V vg. ,1z-f' - fm' W' -A 31. k uH'f' W' U MM' f 1 H W 1 f' H M 1 w H 'rw 1 f W Lu 4 M -A -.N Wm. www-1 ww.-1-ff mb T 1 ww. lu w wx ,N w U fujf vw, ,Q My M +4 :MW Ny V1 ,N L ,Mo hw, N NY ,, M y, ,L My. . ,,.,t'., 1J1 M, W , , X an 1 4 H 1 r L Q1 L MQ' 1 M m -iv 1 ,M vw ,n W 1 ,Lf Ifijiyw : w 4 , MLW rahlxl MA MM Mwijmwxxqh M dd mm m' jg NA vgLLELW5:,L IN! ww2. M 511!w,w 3 q , L ,4f x g S r J , X Q x ? 1 il. yy T: :L .,L, 1 I gal il 1.-,g m 1, 1.1 K,, M . . M xE,Nr,5 L 1.33.-I. :1 . 4 L. I 'jf' jg Ji- I 1-3 5 V 2 Nz: H W' 'E'1I sfif' E. V if + kg , n 2 A W QL B C , K . ,. 51. M Z. 5 jg ,1::l : iY AAg,,i, M ,f 'YQ 'HH ' , ,-'iq A .M:'- ,- ,fb I M, N ' A ' ' M v r sw 1 W 'VJ ' ' '1 wpMMwwWwwHQMW-MwmJMwwmw LW: 1 ix -ff rum-X I -5?'lf uhi:fJ5m?Mvf1 w ,1 M J 14f 'M ' ,W w ?W' 'lv m ae ww f ,mmf LM .Zf , W fl-,1,WfA7, www Q-Q, W wh bfh Muu,W,y'-'-1 'Q W ' 'A 2 P'HN1N u..J w mm ' MEM: ?W3M:i1?531159335 Army' Q Fili, ' NE 'az , ,w , M543 ' 'NLE S, 5? s X if JA ' A Eg r 1 1 Y u frifwwtf' QW' M54 ,ph Wal 'qw 3,1 gp HW! uw 'R 1 V! M 'giiijf1ffjlglfjwiiiQQuvnl41x+wrmm um U um X 1 1 1 1 ' 'IHE TAT7lLIaR NlIl4mul4mrmmslmmlmmlmullmmlnmlllmw:umm1w1wwiiifliiiiiiiiliii1iiiiii11wiili111iiiii11iiIiilliiUiiiliiiiiiliiiiiiliiiiiiiiiiM12iiiiiiiiiiixillliiiiiillliiiiiiiiiiiiiliiiiiiiiiiiifiiiliii1iiiliiiiiiiliiiixiniiiiiiiidiiiiiiniiii' w w mx wunwu mu uw um mum wx 4 r H n mu w I Q S 'L 'Q PAGE fy f ff king in .ta ww Qrqanizations F'II l'l'Y-SIGVICN. I U 4 ' E So dlitas Latina Of all the organizations in the school, the Sodalitas Latina is prob- ably the most interesting. The purpose of the club is both social and ed- ucational. The meetings are held monthly at the schooi. The program deals with the life and customs of great Romans. In commemoration of the birthday of Virgil, the first program of the year was presented by the students of the Virgil class. Each meeting thereafter centered around some prominent man in ancient Rome or some historical event. In March the Sodalitas Latina members enjoyed their annual party in the L. H. S. cafeteria. The feature of the evening was a mock trial prepared and presented by the members of the club. So interesting and enjoyable did the party prove to be, that a similar one Was planned for the last meeting to be held in May. The officers of the Club are: President, Mary Clancyg Vice Presi- dent, Carl Ratcliffeg Secretary, May McCloskeyg Treasurer, Mary Gorden. ,,,,,,1,,i' ,, ,,,, ,g,,,,,,, M., ,,.....,,,...,. ,,,...,, ,... L, Ummm,H.-WuWu..i.m..1.H m.w...4u mm-mmm-ummm.mm-mV.i-wmvim1V1-mm,W-nmnuui.iumm..mi PAGE FIFTY-EIGHT vumsnuunnmummmmuiuimninmimmmmmnnnmm mm: . ,. E .. LT AT T L Junior music Lea ue The Junior Music League was organized at the High School in 1921, as an auxiliary to the Senior League with the aim of furthering among the students an interest and appreciation of music. Since its beginning this organization has steadily broadened its scope. This year the League en- joyed a study of the folk music of different count1'ies. Among the most interesting programs were those devoted to the music of Spain and Russia. For the first time, this year the Junior Music League materially as- sisted the Senior League. The Juniors had the Whole responsibility for the matinee performance of Tony Sarg's Marionettes. The League has a membership of about forty members. Its meet- ings have occurred on the second Thursday of each month. This year's officers were as follows: Mary Medland, presidentg Norma George, secretaryg Rudolph Kloep- fer, treasurer. Miss Howe and Mrs. Kreuzberger were the counsels from the Senior League. PAGE FIFTY-NINE. in r i 1 -ni muuaxiviiiuuimiinli lgwnmmmmvmnmgujyllllnnl. Qir Reserve Counci The Girl Reserve Council is composed of the President, the chair- men of each of the standing committees, and the faculty advisor. The Council meetings are held on the first Wednesday of each month. Aurdey Ayres, president, presides. Reports of each of the committees are heard and then problems are discussed. All problems are sanctioned by the Council before being submitted to the girls for approval. Members are Ruth Hammontree, Finance Committee, Marian Smith, Program Committeeg Clara Farree, Membership, Committeeg Dorothy Por- ter, Publication Committeeg Jane Winfield, Social Committee: and Clara Mehaffie, BO0St91 S Club. 51 PAGE SIXTY le? tl E, T H E T A T T L E R wvnmimlimuiliniililliiiilinwuiinmrlun ' ' ihimummvunimiiiinmuiiinmMmiiizIIInvnuuuuiuuvnummvvIimiI1inimrinnunIiIiuIviIIIininIiiiiinivuvuiiizvuuinlivuuilmmumnlnimlllululuuu 5 W. a. .,,.. .- .. . . . .. W., ,,,.,. El 5 E El . Hiflj Clu 3 , E l El Ei l Ei Ei El Ex El The Ili-Y Club made its debut in the L. H. S. social circle the Hrst part of the school year. Although it has been short lived, it has already developed into a well organized, strong, and active institution. Perhaps the if two things which most insure the success of Hi-Y are its purpose and slo- gan. Its slogan it Clean Sports, Clean Furpose, Clean Speech and Clean 5 Scholarship. Its purpose, To create, maintain, and extend throughout at the school and community, high standards in Christian character. 14 Ei The candidates for membership must meet the following require- E1 ments: A general average of 80 in school workg a record of good conductg and he must possess a sterling character. E. The adult advisers are: Elder Eberhardtg D. W. horiong Coach Ig Clifford Wellsg The Reverend J. S. Corkey, D. D.g and Laban Fisher. The officers of the club are: President, Wesley Alleng Vice Presi- dent, George Hazelg Secretary, Walter Rehmg Treasurer, Robert Johnson. 'Ei PAGE SIXTY-ONE. 'Si 5, 522 E. Isa ig: EE 15 li EEEEEM Qlillii.. .iii lliiiiliiiiiiiiiiiiiiiiiimiiiiiiihii niii M nil S- , , .... ,... .. , ...., , . I l I 1 ll l i.liwlwiriiiiwirnwwwwsv-1iw1wrnwwiiHwwwwwivwiiiiiuwwwiwiiiwwwrmil1uvwwwwnlwwwwWmwwwnuwwi1xrmllllrmlllmlmlum1llullHllmll1llummmnuullnmum Qir s' Booster Clu The Girls' Booster Club is an organization of the Girl Reserves for the purpose of promoting good will, creating an interest in all high school activities and encouraging athletics. The central committee is elected by the Reserves. Four girls are chosen from each class. The club has done much worth while Work this year. They main- tained the check room at basketball games in the gym. The L. H .S. carn- paign for the Tornado sufferers fund was sponsored by the club. They helped make the basketball banquet a huge success. Senior members are: Clara Mehaffie, Ma1'ian Smith, Norma George and Bernice Rocke. Junior members: Ethel Stewart, Virginia Byerly, Alice Fransley and Doris Tidrick. Sophomore members: Irene Flanegan, Annie McDowell, Charlotte Clay and Floy Sample. The officers are: President, Clara Mehaffieg Secretary-Treasurer, Charlotte Clay. inwwmmwwnummitnnirinumnuunummwiw umwluwnmmuwmnunnmumumnvmlmunn ummlmunllmlllmnll PAGE SIXTY-TWO W 1 1 THL TAT'1LluR E!333till33iiiiii33iiiiiii3Eiii!!!33iiiiiii33iii!3E3Eiii!!ll3iiiiil333EiiilEiiiiil3iiil3itil!l3illEiiiiiilEiiiil3iiiiii1EFill13iiil3iiriiilE33iiiil33EFill33Eiiiililiiliiiiiiiiliiiiiiiiliii iiliiiiil Bo 's Booster Clu The old Boosters' Club was disbanded at the beginning of the fall term and a new organization consisting entirely of boys was formed. Mr. Mitchell, Mr. Cox, and Mr. Burke, took over the responsibilities of supe1'- vising the activities, and the members were elected by the various classes. -,The new club carried on the work of the old one. Any project which WZIS .started by the school relied upon the Boosters' Club to support it to the extent of its abilty, and no one was ever disappointed in the work of the members. The club has bought blankets for all the graduating letter men, who have lived up to certain standards. It presented a silver cup to the best orator, to the best student-athlete, and to the most valuable player on the second basket-ball team. The club has also taken charge of the ticket sales for various affairs. All this work that the club has done, has been made possible by the persistent efforts of its members. The money for the blankets and trophies was raised by selling Eskimo Pies. The Boosters' Club symbolizes all that is best in the school. The members are: Walter Ens- field, John Ba1'nes, Eugene Bender, Robert Sharp, Marion Shuman, Eugene Nelson, George Hazel, Harry Huntsinger, Robert David, David Hudson, Alvin Pettit, Glen Ross and Wesley Allen. Robert Kreutzberger, as yell leader, is an honorary member. 1ww11'lmr w 'r' 1H Hi Hifii'Hill'lui!!11Ie!!!111r'I!'+i1 r!!111' Q!!!filu!!!11!f!!!!1wif!!!1tries'1!r'!!!1111 l!!111r ! www' PAGE SIXTY-THREE. THE TATTLER . JimiwillRim.1ii11miie.irlliillmmu5mMuuvi-wifEmwmfiT1inmnnuiiiuiiuiinnmuniEirEMMmnHmTmiiiivFuiinumum in liiwilvi-wivnmlmmi-iiia ' Y mbifuiiismm 12'-Ji C emistru Club The 12-A Chemistry Club was composed of members who had al- ready had one term of Chemistry and therefore the programs dealt with more advanced Work than those of the other clubs. The meetings were held every two weeks, during class hours. Miss Adams acted as supervisor, offering her assistance in the selection and preparation of topics. The pur- pose of the club was to give the students a broader View of the field science, to keep abreast of the latest discoveries and to entertain. There is no doubt but that the organization has fulfilled all these aims. The officers Were: President, David Hudsong Vice-President, Au- drey Ayresg Secretary-Treasurer, Marcia Redinger. kilniwwvinilwwwuiiii11iiuuiiiiiiniiiiiiwniilwili hull1iiinliiimi1riim1numuillumimmliuiliiiiliiiiiiiihiiliiniiiiiuimiiiillwiiiiuiiiil PAGE SIXTY-I-'OUR 4 THE TATTLFR ' ivimiimmmvvimiiwmmiiiiiimuuwviriiinmwv-iii111vi-iiiwnfiiw-wwii.iwii1ilumiiiuwimimiiivm11iiiilumiinmwiiwuiiilmuf ' 1245 C cmistrq The 12-B Chemistry Club was composed of the two sections of stu- dents studying' 12-I3 Chemistry. In form, it was the same as the organi- zation of the advanced pupils, and the meetings were held regularly on every second Friday. Many interesting' and instructive talks were deliver-- ed during the school year, a few of which were Craters on the Moon, by Don Wissingerg The Pearl lndustry, by Mary Louise Trumang The Manufacture of Explosives, by Glen Matherg and Telling Time Through the Ages, by Eugene Nelson. The officers were: 12-B 1 Section-I'resi- dent, Neva Plotnerg Vice-President, Eugene Denhamg Secretary-Treasurer, Francis Murphy. 12-B 2 Section-President, James Digang Vice-President, Lawrence Brennerg Secretary-Treasurer, Robert Erb. iivi.u,mu.m,.v,,i .11iiiiiiiiiiiimuiiii- mm ini riimmix nu ii mum num w PXGE SIXTY-FIVII. U r ivii'fillKilliiiiiuniiiiiviiniiiiiuliifilliviifl.1iiiiiiilliiii-liIil1i1iriiiiriiiiiuliiiiililPhill1iiiiniiliiiiiiiliiiiiillviiiiIlLliiiiilliiiiiiiiliiiiiiiliiiiiiiiiliiiiliiiiiiiiiiliiiiiliuwlxwvllmmuu Huw mi I ll in i ii il ii illmnlmllwllvu mimi: El Commercial Clu Si 2 5 is is ,E EE aa Ei 5: ga EE EE 23 gi for organizing: To study the improvements of the department, to be rep- resented on the Magpie staff, and to form a social club. Only students in the Commercial Department are eligible. The department includes Book- keeping, English, Stenography, Salesmanship, Penmanship, Arithmetic, and Typewriting. Last year the organization was known as the Bess-Pat E in Club. The social activities and work of the club members are published in E the Magpie every week. E Officers of the Club are as follows: President, Amelia Reuterg Sec- E 1'etary-Treasurer, Thelma Graf. E E iwlmwlnmllnmnnurlllnmllnurllllmlmlmlln 114 umm run nl HH ulllulv HI mlm Illnrggjflrilifllfvgvgfilwmlflwlllllyrllummul1 U llwlnmlllu 'will lmluu rl H nnllu I , I ll nu H yu1vvlgljlvgvglllffgggtlggfllfjgglggfyihgjyfgllfflylgglfgyggjwfjfgynillgffffgfflf PAGE SIXTY-SIX li The Commercial Club, as it is known this year, had three purposes 3 S i ! 1- 11.:j,wi-,: 33, ' 4 T H E T A T T L E R ,,,.,. .,,,, ,.,,, ,.,,,, - ,..,......,...,.. Girls Docational Clu The Home Economics Club has been organized in the Logansport High School for about four years. All girls who are taking the Vocational course are eligible to membership. This club has accepted the National Creed which is as- follows: I believe in the training of my head for the power it will give me to think, to plan, and to reason. I believe in the training of my heart for the nobleness it will give me to become kind, sympathetic, and true. I believe in the training of my hands for the dignity it will give me to become helpful, useful, and skillful. I believe in the training of my health for the strength it will give me to enjoy life, to resist disease, and to make me efficient. The present club was re-organized at the beginning of the second semester. It is now made up entirely of Junior High School girls. The members meet each week at the fifth period. The officers are: President, Ruth Reuterg Vice-President, Jane Fanslerg Secretary-Treasurer, Thelma McKaineron. , ' ' i s 1 l l 5 1 1 , I l 4 ! l l l i l PAGE SIXTY-SEVEN. is ll : 4 . li il l i . is :ge f l Y' W T H E T A T T ... 4 VVAAAQ UUAA 'V.. '.4 V'-- V ,L,,iiq,,iiiiiiiiiiqi iilllliiiiilllliiiillliiiiillliiiiilliiiiililiiiiilliiiiiilliiiiillliiiiilliiiiiiillliiiiillliiiiiilliiiiiiiiiiiiiiliiiiiillliiiiiillliiiiillhuiillliiiiilluimwnummummnmmlnwuuumnnnmnmu ! I 1 l Cfennis Clu l I 1 lgi Judging from the increase in the membership of the Tennis Club, , one can easily see that the followers of the Tennis game are many. Even though the club is just finishing its second year of work, it has already d0I1e much to develop interest in tennis in the school. Early in September the l first meeting was held and officers were elected. The second annual tourna- ment Was held last September under the auspices of this organization. , 1 E Coach Wells and Mr. Burke act as advisors for the Club. The officers are: President, Neva Plotnerg Vice President, Amelia Reuter. I i 2. 5 E 5 E 5 E!?!'fi!!!El!!F '!!!E!!'U!'4'W'WWW !!fPW '! 1 '!PE'!'! I!- 'v1!!!f!eWsew1w!!!rf,!!!iM!!'ifi!iw!s!rif1iE 'MWeiifiiiiii?5liiii'i15iiilliii!il5diiii'iiiiii5iiiEii!re+!!sWu... ''Fi!HiiweiffiiillEi'wi'Ii!Mr!!!H'!!!!WWiWHEiisifiWli'eWw- PAGE SIXTY-EIGHT THE TATTLER iiiiiiimiiiiiiniiiiiimiiiiiiniiiiimiiiiiilliiiiiiiui iiiiniiiiiiniiiiii:iiiiiiiniiiiiiiniiiiirmiiiiimiiiiiniiiiiinniiiiiniiiiiiiimiiiiirliiiiiiiiiiiiii i i i i Rifle Clu The members of the Rifle Club are the big guns of the school. The club is composed of faculty and student members. At this time the club is celebrating its first anniversary. The lliiie Club was first organized to give recreation for a few of the school men and students who enjoy shoot- ing. The club now is affiliated with the National Rifle Association and re- ceive their equipmentg such as guns, ammunition and targets from the government. Practically all the members are expert ma1'k:r:nien and the reputation of the club has become wide-spread. lt is a credit to the high school. The meetings for practice are held every Thursday evening at the lligh School. The membership fee is one dollar per member for the year. The officers of the club are: President, J. J. Mitchellg Vice-President, Laban Fishery Secl'etary-Treasuier, J. R. Jonesg l-lan ge Warden, J. P. lloch- halterg Captain, E. llrenton. i i iii iw i i i i i iii ii i i i iiiiiiiiiiii iiiii lllll i i ii iii i i i iii ii ii iii i ii i ii ii ACPI SIXTY-NINIC. 1' 1491! , -T.1iE-,-l' !L'1f.I-.!.'l5,!E. ,,,.A. A,.AA , H -. .. ,,,,, ...,,....,. lil lil Post-Grd ualc-as S52 iii tl E! The spirit of L. H. S. is manifest in these seven girls. Each one of them has received a diploma for completing the regulation four-years' course of studyg lout unwilling to leave the congenial surroundings and the chances of learning, they returned for an extra year of instruction. Most I of them took up the Work in the commercial department in preparation for business careers. They have been a credit to our school, and L. H. S. is ei proud of them. T FIRST ROW-Velda Reed, Harriet Huff, Dorothy Po1'ter and Mary E. Porter. SECOND ROW-Dorothy Powell, Eleanor Zanger and Dorothy Ilalderman. ll 'Y Wi ' WNfI ''WWW 'm W W'1 m1 l'lf71'ill!!!'l!lf??E'WlllEV!'Y'fP!f!'!11l5!l'IK4?3YYfl!!!'il '.,..,....,.,'1llf!551l!.., ',. . ..., H . .. ' .. W , , .. ..., , tl ..., ....,. .... ...... il'AGl+l SEVENTY ..1. Q par' r. ' fv-ru-:We V. j:'q ' A ' V-'DI' ' ,,,,,A,, ,M..,,...,,,,,A,,,,,,44.,,,,,44,N,,,...,,,,,..4, ,,,,,,.,,,,,,.,, ..4 ,,...., ...H. . , ... - . .,A. ,.,.. - ,,..4,,....,, ,A.4 .AA, ....A.. ,...... ,..A . . ..... . Honors lDon u L. H. S. ORATORICAL CONTEST The United States Bar Association, in order to interest high school students in the Constitution, which is the basic law of the United States, sponsored a nation wide oratorical contest and awarded prizes to the win- ners. The topics concerned the Constitution itself and the work of var- ious statesmen in connection with it. All entrees prepared their own ora- tions and then gave them in the elimination contests. The Cass County contest was held at the Logansport High School on April 15, 1925. The participants and their topics were: Robert David- Hamilton and the Constitution. Carolyn Hall- John Marshall and the Constitution. Mable Bargerhuff-- The Constitution. Robert David and Carolyn Hall tied for first place and were each awarded a prize of 33500. Mable Bargerhufl' was second and received S530.00. Robert David represented L. H. S. in the District contest at Peru. Here he tied for third place with a contestant from Winamac. WABASH VALLEY ORATORICAL CONTEST In the annual tryoutsfor the representative to the Wabash Valley Contest, Robert Little won first place. His subject was, The Soldier Boy. This entitled him to the silver cup presented by the Boys' Boosters' Club for the best orator in the school. On Saturday, May 9, he placed second in the Wabash Valley Contest held at Peru. COMMERCIAL CONTEST In the District typing, shorthand, penmanship and bookkeeping contest held at the high school building on April 18, 1925, Logansport won first place with 47.5 points. Peru was second with 43.5 points. Ethel James won first, Martha Hitchens second, and Catherine Sip- ple third in the penmanship contest. Edna Soncarty won first, Grace Lahr second, and Florence Harvey third in the beginning typing contest. Dorothy Edwards won first in beginning shorthand. A beautiful purple and gold banner was presented to L. H. S. as a trophy. LATIN CONTEST The annual state Latin Contest sponsored by the Indiana University is divided into three divisions, the County, District, and State. The Coun- ty contest was held at Logansport High School on March 7, 1925. The winners from L. H. S. were Marie Enyart, Carl Ratcliff, May McCloskey, and Evangeline Elpers. Gold pins were awarded them. This victory en- titled them to compete in the District meet at Peru, March 28. The ex- penses of the four were paid out of the Latin Club funds. Evangeline Elp- ers won third place in the Virgil division with an average of 96.5. She Was presented with a bronze medal. ' ' iiii'umu 'mm '''uiiiiiiiiiiiiiiiiiiliiiiiidiiiiiiibiiiiiiziihiiiiiiiiiiiiiiiiiiiiiEWiiEMii' h ' ''Ianni''' 'iiioT:liiiiirPJiiiiiaiiiiiiiiiiiiii8iiiiii' .-,.........,,-.,............-....... .... .... a..... .... ......,,... - ...,.. ,W..-.......-,,...-.,..............a.....-.. ..... .....,.......-., ..... W ...... M!.'!!'!!!!.,. l'. 'lL'!'3il!!!!'l!!!!!!!!! W'l....,...,.-..,..: PAGE SEVENTY-ONE. rv, w L' , S s Q i u vl' 5 'I' H E T A T TL E R 'M L11 g:v '-- -4 A f r f i 2 i Q -,f - g W A ' Fg g V ,sl ' N 52 f, if 5 A K 1 5? Us ' that in nonlin- plfwiil il were one , M , . A !2!i.7.f'k.4,. ,,':5'i?1..,f 'E , .ann uhm 'ousghasnmiw X Gll. ' . 1 gf, ' 1 'f' . Mimi if M ., 'MQLQAA T 5 ai '- MT . w , i . ' i P - if 2 1 i -. 1 5 , X ..V 2 'E I ' 1 I Q- 4 - ' Z as PAGE SEVIGNTY-TWQ. ' l nA Lmuiis m . am, Mu, bf1fHE TA'r'r1.l+:Ic w rmumml um wmwmzvmur mu mm :mmnrumnwmuuuwunuulwuu mmm mmmuwrvmmvmu uwwHwnv1WHvw''1wHwwsvwmu11vu1xxurmmvlnuwmum wwwwwluwwwwanwww1w1'11wwwwwwIwuwwwwHwwwwwvwwwxx1wnuwxwrwxwxxxwn:uxwmuuwuuw uwwwwm, ww mu mn m w wx wx ww w wx w w w H A- Publications IXINIX-'I'IlRl'IlC. li. V 4 mu umlmr ur ui i ul in in uni1mitiiiuiuiiuiiiiiiuiuimiilmrinimuiiiiuinimiimiliiiriiiiiiiiiiiiiiiiiiiiiiiiliiiliiiriiiliiiriiiliiiiiiiluiniiiimiiiiluriiiiiiiiiiiliiiiiiiiuuiiimriiilmri I it ii num inwulm nl. DAVID HUDSON EUGENE NELSON K ' Efiitor Business Maximizer I-IVGENE DICNHANI LOUISE MURPHY ALVIN PETTIT Senior litlitol- Society Editor Athletic Editor MARIAN SMITH NEVA PLOTNER l1il,l l'iIl'Y Eiliior Organizations Editor LA VONNE CROr'lilCT'l' JAMES DIGAN Art Editor Snapshot Editor ROBERT ERB MARIAN DUNN Cizilominrian Wit :md Humor Editor FRED IVORY ANIELIA REVTER Typist Tynist r ,mimi-www'uinin i ' iminzi 1gxiiiiiiiliuiiiriimiiirilliiulliiiniluui iitiiiuiiiiiafggiiiiwviiiliiifiiiiiuiiinyriiu ---- 5 hrvlvu r,-,tj ,vtt 'tim H PAGE SEVENTX-FOUR .. l H p, THE TATTLER 5 ,...QffIfIIf1ffIIfl'flffffIfffflfffiffffllfiffffi.- ..., .....,,,,,.. 1 f1IfifIffI2I2iifdiff1iiii!iii!iiiiiiiiffIiiii?iii4il?liliii'??iF f Cl' e Cfaiiler Staff The Tattler Staff of 1925 was elected on September 25, and be- gan work at once. Their first duty was the advance sales campaign. To start this campaign properly, the Staff presented the usual Senior frolic. This show consisted of several acts, each one representing a special part of the completed Tattler. Society was represented by a dance by two of Miss Quinn's little proteges. Wayne Robertson danced a jig to the ac- companiment of Robert Erb, pianist, and Alvin Pettit, violinist. Two of the letter men of the staff, Eugene Nelson and Alvin Pettit, staged an up- roariously funny boxing match in three rounds. The feature of the pro- gram was The Overworked Tattler Staff, written by Eugene Nelson. It gave the audience a glimpse of the work of each member and also served to introduce the various officers of the staff to the school. Immediately at the close of the final act, the business manager gave a short talk on the advance sales, explaining why the price had been raised and also giving the students a general idea of the contents of the book. The sales then began in earnest, and in a few weeks amounted to practically five hundred copies. Amelia Reuter sold the highest number, totaling eighty-three books. Each Tuesday evening after school the Staff held a meeting and everyone wrote character sketches or did any work assigned him. Every two weeks, longer meetings were held at the homes of the members, at which time the various features and arrangement of articles were discuss- ed. When the engraving and photographic contracts had been let, the task of taking the group pictures was commenced. This was supervised by the editor, business manager, and under-class editor. About February the real work started. The various members be- gan submitting articles to be corrected and typed, and the editor was kept busy arranging the dummy. The printing contract was let in April, and from then on until the last moment, May 10, the Staff worked at full speed delivering copy and reading proof. Each member has worked faithfully and given the best was in him. The Tattler speaks for the Staff. PAGE SEVENTY-FIVE. THE 1 l Im l ru 1iinunmmmimniiiumiimmiiinmiiimmnumlimmimimiiHumiiilliiniiunliiiiiiiiiiuimlli:iidiiiiiiilliiiiiliiiriiiuiinillliiiiiiidiiiililiiiiliiiiriili maq ie Staff if The Magpie, the Logansport High School publication has been in existence for four years. Each year, under the supervision of Miss Bevan and her assistant, Miss Richardson, it has grown in quantity, quality and influence. The members of the staffs are chosen from the Junior and Senior English classes in accordance with their standing and ability. Last year, The Magpie became a member of the Indiana High School Press Association, and adopted its motto, Better Journalism. Since the neach edition of the paper has borne the I. H. S. P. A. seal. At the annual meeting of the association held at Franklin College last November, The Magpie sent James Digan as representative of L. H. S. Audrey Ayers was all- pointed I. H. S. P. A. chairman of Fuss County. The Magpie is entirely self-supporting and the financial end of the paper is taken care of by a business staff. Robert David was the very able business manager this year. The Lincoln and Riley Junior High Schools both contribute two very interesting columns to each edition of the paper. Miss Kinneman oi' the Lincoln Junior High, und Miss Charlotte Shultz of the Riley Junior High respectively are the faculty advisors for these columns. The paper is printed weekly in the L. H. S. print shop by the classes under the direction of Mr. Fisher. Editor-in-Chief -- News Editor .... Asst News Editop Klztzy If0ll1l'XlI1 - 4 Art ..........,,. Music -, ...... , Editor-inC'hief .... - News Editor ..... Ass't News Editor .... Business Manager T H lil STA lr' F A -- Audrey Ayres H-, Hazel York -- Alice Fogarty t'0l ,-,,,- - Meribah Koons Margaret Skelton .. - L .. Mary M edland . - Marian Baade ,-- --- Lucile Thomas -- Ethel Stewart Wit and Humor ...... Literary Editor .... Ass't Literary Editor iI'MNIS'l' Athletics --- Bess Pat .... Howling Host - B Wit and Humor ...A..,, Literary Editor A,,.. Ass't Liteiary iditor , E BUSINESS S'I'Al F ,W Robert David Advertising Manager Louis Rosentrnder - - -e Alice Farnsley , ,- --- Claire Ferree - , Robert David Thelma Nicholas and Irene Rehm .H Neva Plotner Robert Dotterer - , - , - Bernice Rocke - - Eloise Littell ,,--,- Henry 'Wolf 1 and Keith Shull illlllltlllmmllllllllllmllmIIIIlmIIlluNIllilmIII1IMllllllmmllunlllmillllwnllllIIII mllmlln I l rlllllillnllmlllimllllllmliilmlllnnilllllmlulm rlnullumllltolu wullwlllll 4444 I !,.--!W!.----..----A HilvigiyciiiiiiigiiiunlnimugirrviiiiiiiiiiriffIIiiifiIlllnulliiijliiiiiliiliiginunI un 1 PAGE SFIVENTY-SIX ,. . T H. E , T.A,.T T 1 um w w ww w w H w mx mmm H mm w m m u m 1unummnmumuwwwuwuuwmmm wwuwvwwwwuummm'wwmumumvmm-wuumuumuum4m 1 mu mu mm u w ww wu mmm wx mn s Litc-an-lrq umm H w wx H mm mmm mm u mu wx um mmmu mm uw mu um w w w w mu u wx wx I mmnm uw umnwrnmm mmmmnlvm wu um nm mu um nu wr r PXG1' blNTXlX IYIGII ,ER THE TATTLER Ladq moon EEE O Lady Moon gliding through the clear night sky, Among filmy clouds floating in air so high, Do you sail through realms unknown to man. Where fairies rule o'er a joyous band? As you travel your long and endless course, ge, Putting shadows to flight with your gleaming force Does time seem to you one eternal night, As you lighten our world in your Winged flight? get Oh Children of Earth, I sing the whole night long, That I may help the spheres in their heavenly song, I brighten the world with rays of light, I QE To chase away the pitchy gloom of night. E? E 1? - iii E2 sei 5 I'm glad that I've served the Children of Earth, Aeons before the Lord gave you birth, And yet it makes me much gladder still. To know that I Work by His own will. ---Clara Ferree '26. A if! The Desert The hot and brazen sun beats down E Q Upon the baking land, A vast expanse of wilderness And hills of rolling sand. Dune after dune they stretch away ses 'Z EE Ai Until they meet the sky. EEE Like rippled gold in massive piles On every side they lie. The camel grass is hard and gray, There is no sign of life: E . Z But here is peace, yes, peace indeed, E 5 Immunity from strife. i Great solitude envelopes all, A calm and restful quiet. No worldly noise invades this place, So far from earthly riot. And as time goes slipping by, All worries disappear: For here in this deserted land, My inmost soul I hear. -Eugene Nelson '25, ...T,,,,..,,,,,..,,,,,,., I PAGE SEVENTY-EIGHT ,annumlimllm iiiiiiiiiiiiiiiiiiiSiiiiiiiiiiiiiiiiiiiiiiiEiiiiiiiliiiiiiiiiiiiiiiiiEiiiiiiiiiiiiiiiiiiiiiiiiiiiEiiiiiE9iEiiiiiiiiiiiEEiiii!!5iiiiii5EiiiiE5iiiiiEi5iiiiE55Eiiiiii!iiliiiiiiiiiiiiiifiiiiiifiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiil ft?s:, 'f7'W'e:r:s'f' ' S -- THE TATTLER -I m,,,,-,,,,,w-',,,,,-.,,m,,,,,,,,,,,,,,,,,,-,.,..,,i.....--.....,..,,.,, n.... ....., , ,.. ,..,....,.. , .......,,....., ima-.- .,.,, ..... , ,.. . ,..,... .,,-,.. ..,..., ..,,..,,.,.................,,.. Dau Dreams Some day when I am rich From humdrum life I'll flee. I'll buy myself an areoplane And take you away with me. At first we'll sail dreamily on, Aloft in the deep blue skyg And waft a kiss to the planets there, As we glide swiftly by. Then later we will land on a tropical isle Nestled out in the midst of the sea, Where just a breath of the sunkissed breeze, Will bring bliss to you and to me. Where forests of Palm trees bear luscious Hot Dogs, The springs gurgle forth Chocolate cokes, And talkative parrots in all of the trees Will amuse us with humorous jokes. And now you have heard of this isle of my dreams. It really exists-never fret, So list' for the hum of my areoplane, 'Cause you ain't heard the half of it yet! -A. W. Ayres. Practical Economu I walked into the assembly, proudly carrying a small blue and white box bearing the inscription, DIAMOND FOUNTAIN PEN FLUID-blue black, black, blue, red, green and violet, and in larger letters, BLUE I settled myself comfortably at my desk, and after taking my usual survey of the room and its occupants, I hunted out my pen and tablets, and in a very business-like manner set about to copy several chemistry exper- iments to be handed in the next period. I carefully opened the box contain- ing my ink bottle, and after tucking the lid down inside the box so as not to soil it, I started to remove the stopper. Then trouble began. The cork refused to be removed. Not to be daunted by such a minor obstacle, I took a firmer grip upon the bottle and gave the cork a determined twist. Then it acted much in the same manner that the smaller of two boys would act upon perceiving that he was overcome--it yielded, but not without pro- test. As it slid slowly from the neck of the bottle, a shrill USQUEEEEK ! rang out through the peaceful quietude of the assembly. Instantly a rip- ple of amusement passed over the room, and several answering squeeks came from the lips of the more daring students. At she teacher arose from her desk, this amusement suddenly changed to an aspect of most pro- found concentration. But my -troubles had only begun! The voice of the ink bottle had seemingly dried up all the fountain pens in the assembly, as PAGE SEVENTY-NINE. .v ,-,,,E,, - THE TATTLER 'mnmn uiiiiiiiiiiiiiiHiiiniuiiiwiiiiiiiuuhmmwiiliiimiuiiiiiiiiiiiiiiiiiGiiiMiiiiIiuiiiiifdEuiviiuiiviMiHiiin'n'n1TM'mvnnunln 'T ' ' well as having reminded several people of their urgent need to copy themes, essays or some equally important documents. to demand-- Lemme fill m' pen, please. Surely! I responded with a polite little smile. it went across the aisle. As I put out my hand to recover it, there came a voice, Hey! Wait a minute. Back it went, hither and thither, until I had entirely lost sight of it. Once I gained a clue as to its whereabouts by the sound of a voice whispering, Here, let me have a drop. gan to think that I would be thankful for just one drop. might wait for her wandering song hoping, and expecting, but all in vain. on my desk. nowhere it had returned-empty. ed in this essay, but if you have tried building your own radio set, you will know how to sympathize with one who has worked for hours mounting in- struments and soldering a jumble of wires, and then sitting up until mid- night and not even hearing a sound. its pages. As a result you become interested. You then decide that you want one. When you see the prices your hopes ebb low until you see on another page, Build your own Radio Set and save more than half. That settles it. You will get one. and diagrams. The instructions look so simple, all written in plain English that it seems as if a child could follow them. all sorts of strange, mysterious looking instruments. All there is tn do is to put the set together. You study the directions minutely and work with nervous haste. You soon find a similarity between the wiring of your radio set and the barbed entanglements of the World War in France. put the receivers on your head expectantly, and begin turning dials. every- way. You hear nothing. You look the set over and iind that you have failed to place one of the amplifiers in its socket. Again you turn on tue power, and listen breathlessly. Not a sound! Then again you read the directions for the twentieth time and discover that you have left out the grid leak. After working for ten or fifteen minutes you eagerly adjust 1 l E ! ! 1 1 I 5 . 5 i i i i l The boy in front of me, with an annoying little j iggle, turned around T The bottle had begun its journey! From the desk in front of me , One drop, ticked the clock, One drop, one drop, one drop. I be- All period I sat there expectantly, waiting, as an anxious mother Finally as the warning bell sounded, it landed with an empty rattle Q Like an idle thought it had vanished into the nowhere, and from the 5 -Marian Dunn '25. Q i On Building Hour Own Radio Set If you are not interested in Radio you will probably not be interest- Every magazine you pick up has the wonders of Radio displayed on X The next day you find yourself in the local radio store buying parts 5 That afternoon you cover the kitchen table with papers, wires and 5 5 At last it is wired, correctly you hope, and ready for service. YOU i l l .3 UWM' ' ' ' .!!!!!'!!!!!!'l'!!!!! ! !Y?!!!!!!Il!!!!!...!!!!!..!!......!!T!!l!!!!!!l !!!!!!!!!l!!!!l!!!!??!!!!!!ll!! .... ..... PAGE EIGHTY THE TATTLER H- -H I - H -MM ...uA --W- ,,,,.,, -g ,-, ,i,,-.,..,,,,,,,,,.,,,, .,.,,,, ,,,,ii.-,., , .,., im ,.... ,.... .,,.... ...-...--..-....... 5 i ! I li the phones. Dead silence! You decide that the only thing wrong with the set is that it won't work, and that the nearest radio shop is the place for yours. You take the set and go to your dealer. He tells you what is wrong and you get the impression that he is talking Greek. I-Ie tells you to leave it and he promises to adjust it. The next day you go to get it and he tells you it will work all right, but you are doubtful. On reaching home you quickly connect the set to the aerial, ground the batteries and place the phones on your head. You turn the dials hopefully. Suddenly a shrill shriek that resembles the cry of a hungry cat, almost rends your eardrums. You turn the rheostat slowly backward and the sound diminishes in volume. Presently the noise stops entirely and your heart gives a great leap, for issuing from the phones a distinct human voice is saying, Sta- tion WLW, Cincinnati. You call in the family to hear, Silver Threads Among the Gold . Your heart beats fast over your achievement. The next day you tell your friends how easy it is to build one's own Radio, and that you never had a bit of trouble getting yours to work. -Glen Mather. Blq C1113 Experiences If you have ever visited in a big city, you probably know how im- possible it is to get around without the guiding hand of one who lives there. The immense network of streets and boulevards is very much of a puzzle, even to some people who reside there. This summer I visited my cousin Catherine in Detroit. and it seem- ed to me as if we were constantly making one wild scramble after busses and street cars. I had been accustomed to wait leisurely on the corner, star gazing perhaps, confident in the knowledge that if I did not see the car, the motorman would see me, and then when it was almost on top of me, I would walk indifferently out and get on with a bored air. In Detroit it was different. When we went anv place, the bus al- ways came along before we reached the corner. Catherine would yell, Here comes the bus , and we would make a mad dash for the corner. Amidst a scrambling, pushing, pulling crowd, we would climb aboard, panting and puffing. The bus had a fiendish habit of starting up just as I reached the turn in the steps, and of throwing me with great force against the railing which. groaned under my weight and that of five or six other fellow-suf- ferers. I usually made the rest of the ascent with my hat on one ear and my body lurching from side to side over the railing, in a wild effort to 1'9- tain my bundles and to gain my equilibrium at the same time. At last I would reach the top and stumble forward to a seat, inwardly congratu- lating myself on the achievement. Just as I became seated, however, the bus would strike a bump that would shoot me skyward and dash my head against the roof above me. Our trips to and from the city were sometimes accomplished through the kindness of some of Catherine's long suffering neighbors. One after- noon in an unfortunate moment, Catherine and I decided to take a new route to the office of Mr. Jones, who was to take us out to the lake that night. My aunt carefully expounded the ways and means of getting there and we thought we knew all about it! But the fates surely must have been PA GE EIGHTY-ONE. .... !!!!!!!l!!!!!!ll!!!!!!!lF!!!!!!lF!!!!!!11!!!!!!l3FU!!!'F '!!Il l 'll !!!!l3FFF!!!ll! !!!l f'll !ll lll 'lllU!!!333I!!!!lI!Fl!!!Il !!!llI'!'!'ll'!!! l l' !!l!!!!f!1U!!!!f43FH!!!3F5!!!!1!!!!!!!!1!!!!!!f135!!!!!34!!!!!!4I!!!!!!333FH!!!33!!!!!!13!!!!!!!1I!!!!!!!3?!!!!!fIF!!!!!1!!!!!!!!I!!!!!!!f3!!!!!!1!!!!!f3FH!!!I1!!!!!ff!!!!!!!F!!!!!l?!!!!!l3!!!!!!i!!!!!!I!!!!!!I!!!!!!l!!!!!!lf!!!!!!?l!!!!!?!!!!!1!!!!!!3!!!!!I!!!!!!l!!!!!!13!!!!!!l!!!!!f i f - '1iliur1rg ll 'w Aww' 'T 'Q against us that day. To begin with, I entered the street car by the Wrong door and the conductor snapped, If you can't board a car right, you might try staying off. The car was filled with tired looking women and men re- turning from work. Catherine and I stood swinging back and forth on straps and swaying with every movement of the car. At last we reached Linden street and with sighs of relief we stum- bled from the car. Catherine had stopped long enough to inquire of the conductor what car we were to take next. Take a Tyler, he snapped and started the car. Unlike Logansport, there is a car every few minutes in Detroit: so we waited placidly on the corner for one marked Tyler. Presently a Four- teenth Through car drew up. Nope, that's not our car, said Catherine. It goes out our way, but we're to take a Tyler . We waited patiently for another. Soon a Grand 'Bell car hove in sight followed by a Fourteenth Through, but no Tyler. One car after an- other passed us until we were dizzy watching them. There seemed a per- fect riot of cars clanging byg but still no Tyler. For sometime I had been looking at an inviting stone step behind me. Finally my feet refused to hold me longer, and I iiopped down limp as a rag, chin in hand and toes turned in. Catherine followed my example but in a few minutes she came to and rushed off to the nearest store to consult a directory in order to find out about the car. In the meantime, I decided to consult a boy whom I saw across the street. Well I couldn't say, he drawled, in answer to my question, I'm only visiting here with my cousin. ' Very much disgusted, I returned to my seat on the stone step and stared moodily down the street. Great jumping hoptoads! I thought. Will that car ever come? Katherine returned and after we had sat resting our weary bones for almost another hour. and car after car had rattled merrily by. Catherine exclaimed, I'll wait until just eight more cars pass, and if ours don't come, I'm going home I Poor wretches that we were! The eighth car jangled by accompan- ied by the toot, toot of many trucks and automobiles. If another Grand Bell or Fourteenth Through car passes, I'll scream, I cried nervously. You've got some street car system here, that makes a person wait an hour on a car. Catherine peered down the street, striving to make out the word Tyler on a Grand Bell car that was approaching. But no use. Twenty-five more cars and we go home, she snapped. As for me, I had given up all hope and was having visions of spending the night on the stone step. It was growing dark when the twenty-fifth car rumbled past, gleaming maliciously at us with its one bright eye. Catherine and I looked at each other. Our hearts sank like lead. Just at that instant a cheery voice at my side said, Haven,t you found your car yet ? We looked around and saw the same boy I had questioned earlier. His cousin who lived in the city was-by his side. G I What car do you want ? the cousin asked in response to our de- nia s. A Tyler car! Catherine growled. The boy laughed. Well I reckon there's only been about fifty passed you, he said. Didn't you see the word Tyler below the words, Fourteenth Through ? -Evangeline Elpers '25- PAGE EIGHTY-TWO '!'ulliii!!!liiiiiiiliiiiiiiliii!!!iiiiiilliiiiillliiiiiliiiiil33liiiliiii!!!3liiiilliiiiiiiiiiiiiiiliiiiiliiiiiiiiEiiiiiliiiiiillEiiiiiilliiiiiiiiliiiiiilliiiiiillil!!!3liiiiiilliiiiiliiiiiiiliiiiiii!5i!!!!!Hu!!! I Hamlet modernized Long ago there lived in Denmark a young prince by the name of Hamlet. This prince was not a happy prince who played in the garden like the princes you read of in stories, but a very sad prince, indeed. He was sad because his father, the king, had died and because he had not been made king. Instead his Uncle Claudius was rulingg and though Uncle Claudius was a very intelligent man, he was also a good politiciang so things were running very merrily along in Denmark. This prince lived very long ago, you know, a long while before Elihu Yale invented his famous locks. Since the people could not lock their doors they hired watchmen to keep burglars from entering their houses. One night as these watchmen were standing near the main en- trance to the King's Palace one of them said he saw a spook. The other watchman just laughed and told him he must have been taking too many internal applications to keep himself warm. On the next night about twelve o'clock another watchman said he saw a spook, too. It was the same on the third night and the watchmen decided they would go tell some- one about it. They went up to the Palace and told Hamlet who was still up trying to get Los Angeles on his radio. Hamlet said he'd come down the next night and see if there was anything. The next night, sure enough, Hamlet saw the ghost and the first watchman was about to turn to the rest of them and say, I told you so. Now King Hamlet, the Prince's father had been a very remarkable man, very remarkable indeed. He was remarkable because he was a Dane and yet had a Roman nose! The prince, being an observant young man noticed that the ghost also had a Roman nose. The prince also being an intelligent young man was able to put two and two together and get something be- sides twenty-two. and so he concluded that the ghost was his father's. He said Hello Dad, but the ghost only shivered and drew his sheet a little closer around him. The prince spoke again and this time the ghost beckon- ed to him and drifted off into the darkness. Hamlet followed the ghost and over in a corner of the garden it talked to him. It said in a deep sepul- chral voice. My boy, I am your father's ghost. I am come to wreak ven- gence on him who made me what I am today. That cruel creature is your uncle. One day as I lay in the orchard he, that fratricidal brother of mine. put a bug in my ear. This bug in seeking to get out chose the wrong exit and so ended my days on earth. My son, I charge you, take vengence on him who did me so foullyf' With these words the ghost shivered and went south to get thawed out. As the ghost disappeared Hamlet vowed he would do as bidden. Yea, he would dash up now and dispatch the foul creature as he lay snooz- ing. He fingered the sharp edge of his dagger and pondered. You might not think it the proper thing to want to run the family bread knife through your uncle, but consider, times have changed. As Hamlet pondered, he became like the young man who, gleefully enthusiastic on the night of his acceptance bv the only girl, has some misgivings as the wedding day ap- proaches. The more he thinks about it the more he wishes he were out of it all: all the more reasons can he see for staying single. So it was with Hamlet. He was very popular and did not want people to think of him as he thought of Uncle Claudius. They wouldn't believe the ghost story. You know how these young college fellows are anyway, apt to im- bibe a little too freely of the Howing bowl and see things. No, the ghost story wouldn't do and besides how could he kill his Uncle with all the Se- cret Service men around him all the time? He would have to wait. and Iuiduiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiimunmvuu 'iiiiiiMisiiiiiii1iiiiiiiiluiiiiiiniiiiiiiiiLiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiGiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiviiiiEMWINii5iiiiiiiiiiiiiiiiiiiiiiiiIiiiiMiiMiiiiHiifiniuiminMMMiliEiiiiiiiiiMiiiiiiiiiiiliiiiiiiIriiiiiiliiiiiiMiiiixiiEiWuiiiATiiiiiiiizu'T1ai4liiii4lhiii ' ' 8 . ' i i i l 1 : l l 1 l l 1 1 i I i I I ! l ' l PAGE EIGHTY-THREE. 'f -' 7 2' I' uslfiiiiiiiiiiifufifiiiuiiizifii11111HiiiifuiiiisiiisiiiaifaaiiiiiiIiiiiiiiieiiiffieaaiaiHeiliiiiaiisffisisiifeiss111ieii15Iisiaie5ii11IHQeeisasiiiiHHaiiisiiiiiiiitiitipsQQiHiminigiiiiiiaHiitifiriQiiiQaeiifiiraQfQQifneiQweQQwaQsgitfiiQlfflQQQifQQQQQlIQwmgffwgiifiimm.-M the more he waited the more reasons he thought of for not killing King Claudius until later. You see, although this young man was a very good young prince, he had the fault of puzzling or thinking long before doing anything. Sometimes he became so engrossed in thinking of what he had to do he forgot to do it! When he didn't forget to do a thing, he was us- ually able to think up so many good reasons for not doing it that it really seemed foolish to do it at all. While he was thinking about having to kill his uncle, he had for- gotten to call on his sweetie. She was the fair Ophelia, far more fair than her name suggests as it was only wished on her out of deference to a rich, dyspeptic aunt. It was only the returning of her engagement ring to him that aroused Hamlet. Forgotten was the thought of killing Uncle Claudius. He rushed hatless to the door of her cottage only to be met at the door hy his former, but now securely ensconced rival, who told him that the fair Ophelia was not at home-to him! The poor prince moped all day think- ing of his loss. His sleep that night was so disturbed, that he talked of her then changed over to talking about killing his Uncle. It so happened that the King was just returning form a drinking bout fwhich he had won with easel and heard Hamlet talking in his sleep. King Claudius didn't know just what to think of it but thereafter he took the precaution of wear- ing his sword while he was arranging his thoughts. For many days young Hamlet sat in a lonely corner of the great court room and fingered the keen edge of his dagger and stared thoughtfully at the king. He thought of killing himself and letting someone else avenge his father's death: and he thought too, of killing the king. There are but two things I can do, he mused, But I can't do either one of them, he added reflectively as he watched the numerous guards about the throne and imagined the sharp blade piercing his body. The young prince's agile mind soon contrived a plan, by which he could kill the King. That was by pretending insanity fwhich seemed to be the concmon thing for refused suitors to become in those daysj. By so assuming insanity he could do many things without arousing suspicions as to his real intent. But his brooding and secretiveness did not escape the eves of the guilty King. At last King Claudius became so obsessed with the fear of being run through by young Hamlet's sword that he decided to put the young prince out of the way. It so happened that an expert swords- man was visiting the court at that time and the King persuaded the Prince to challenge him to a friendlv combat. Hamlet resolved to become a hero by staging some sort of a David and Goliath combat by just using his dagger against the long rapier of Laertes, the swordsman. The Prince chanced to see the swordsman at practice in the garden one day soon after and changed his mind. The great Laertes was out there clipping petals from the daisies and as they fell exclaiming, She loves me. She loves me not. This was enough to cause the Prince to Want to use the longest sword possible and he began practicing sprinting, too. At last the dav of the combat arrived with Hamlet still trying to decide whether or not to kill the King. CA second visit from the ghost had aroused him to his unperformed dutyl. The combat was scheduled for two o'clock and it was before a packed house that the referee introduced the principals. Hamlet was wildly cheered and great bunches of flowers were presented him. Better now when I can, than later when I can't, thought Hamlet as he smelled the flowers. The King enters. After much cheering he makes a short speech and concludes by displaying the prizes. To the winner this, he said holding iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiuiliiIiiiiiiiiii1iIiiiiiiFiiiiiriiii!1fFr5ii!1f!iiiiiiiiiiiiii i!iiiEEEi!iii!EEiiiiiiiifEEiiiiiiiii5iiiEiEE!kiiiii!iiii!ii'?iiiEiiiiiii3ii!!f?iiiiii?5iW' ifiEiiiEiiiEEiiiiiEiiiiiiiifEEiiiiEiiiFLWiiiiEEiEiiEiEEiiiMEi53iiiiiEE!iEiiiEEEQFEEfiEEEPME595iiiE!!!!!!!!!!r!!!m!!!!!!!!L!!!m! PAGE EIGHTY-FOUR uiiiiiiiiWiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii!!iiiiiiiiiiiiiiiiiiiiHiiiiiilliiiiiiiiliiiiiiliiiiiiiiliiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiIliiiiiilliiiiiii!!iiiiiiiiiiiiiiiiiiil2iiiiiii2iliiiiHiiiilHilii1ilii'nu4muvan11 ' ''' 'umm1mluwm i '' iii3iiiiiiliiiiiiiiiiiiiiLLiiiiiiiiiiiiiiiliiiiiililliiiiiliiiiiiliiiiiuilliiiiiiiiiniiiiiiiiiiiiiiiiiiiiiLiiiiilliiiiiiiriiiiiiiiiiiiiiiiniiiiniliiuiiiiiiiiiiiiii!iiiiiii'nmn mwmM ' up a bottle of rarest old vintage. To the loser this, he announced dis- playing a lily of purest white. The gong sounds! the contestants leap tothe center of the floor. The ight is on! Hamlet strikes first, but is blocked by Laertes. Laertes thrusts but Hamlet easily side steps it. Again Laertes thrusts. Right, left, over, under, the silver blades Hash. Hamlet is on the defensive! A quick rush by Laertes which completely disconcerts Hamlet and he dodges behind a chair. The gong! End of round one! A brief rest for the pant- ing contestants, then clang! and they are again in the center of the ring. They strike-parry-thrust-jab. Over, under, backed into a corner! He is on the defensive! He is able to keep Laertes at sword's length. Then Laertes pauses, his sword pointed at his guard. Then Laertes pressed a button in the hilt of his sword and the blade shoots out and pierces Ham- let's body. Foul play, Hamlet cries, looking to the King appealingly. Then Hamlet notices that the King in his excitement has half emptied the first prize. This so infuriates Hamlet that he knocks the trick sword from the hand of Laertes, picks it up and points it at the King. The blade shoots out and pins the King to the back of his throne. I am justly pun- ished, cries the King and dies. Hamlet has done his duty at last! Seeing the remainder of the first prize spurs Hamlet on, and he turns to finish the combat. Discarding his sword he grapples with Laertes. and overpowers him, but the trick sword of Laertes has done its work. Ham- let falls to the floor and as he used to call Ophelia at her garden gate, he now calls her at the gate of Eternity, and dies. -Charles Stewart '25. The ll7inninq of Edilha Men and maidens admitted that Sir Pentathol of the Strong Hands was as mad cap and hare brained a youth as ever won his spurs, but they also admitted that he was exceedingly well favored. For one thing, there was the great castle of Hanglebar, bequeathed him by his father. Another was his handsome face, his loyal, generous heartg his chivalrous mind: and his equitable disposition. And quite another thing was his sinews and muscles and his skill and dexterity in the use of them. Duke Gansing of those parts gave a great tournament, and hither came the knights and ladies of the country round. Hither, too, must needs come young Sir Pentathol, mounted on his milk white steed, with arms a-glitter. Loud were the cries of joy when he appea1'ed, galloping unat- tended down the road to the great gate of Gansing Hall. Marry come up, quoth the old Duke, as he greeted his young guest. I heard the clatter of your steed and swore that it must needs be you, since no other young hot-b'ocd rides about these days by himself, at a time when the-outlaws run wild. Out laws, say you? !By'r larkin, I saw naught of them. Still , an I had, 'twould have gone right hard with them. Why stand ye here, Sir Strong Hands, boasting of what ye'd do to you caitif rogues who fight with oaken cudgels and clothyard shafts, when many a goodly knight awaits to tilt with you ? The voice was harsh and unpleasant, and as Sir Pentathol swung around upon his heel, he gazed upon a great and surly knight clad in sable armor, and knew him for Sir Jocandi, a baron of great renown and churlish habits. So, ye doubt my courage, do ye? quoth young Sir Pentathol, and ere the one on horseback could answer, leaped right nimbly astride the l l E is Q l l l inmumIunnnmuIImnunannmama:nnnuanuunua1InInuuIwiummuIuunInnummunnuInIumnIumunIInwInuumInmnunnuunuumnuuumIII:nwnuumuuuumuwrmugnuuuuuumuuumulnfgilgymnunuIanW:uwry!Mywww!lgggggH!i MggllrgMifggH 5. GE EIGHTY-FIVE. ,E IE THE TATTLER nnggggggggygg5gggI5II5mIInupgg5ggg3ygII55IivrIIIIluvnlngggggggggggglgggqgrgggmwIgnmfggg55Qvggg55ggygQ55yyg!5gmgq!!3fgm!!!5mmMm!!m! ,,,,,,,,,,,,, ., ,,,...,, ,,...,,,.,,.,......, .... ,... .-..,...., .... . ......,,.....,,... . ,,., .. ........... ,..,.. ,,,. . .,,.,,.,. l beast, seized his burly taunter around his waist, and flung him with re- sounding clash into the middle of the court yard. . For a space Sir Pentathol sat upon the overthrown warrior's steed, and laughed silently while the knights and ladies, aye, and even the old Duke himself nigh burst with merriment. Slowly Jocandi regained his feet. And had we met in the tilt-yard, methinks the results had been dif- ferent, he growled at last. The younger knight straightened in his saddle. Say ye so? he queried, and then putting spurs to his steed he charged headlong at the surly one. The scream of fright which had risen to the lips of the ladies was checked when they saw Pentathol swerve suddenly, and swinging low from his thundering horse, seize J ocandi by the belt and so drag him across the court yard into the inclosed lists, where he deposited him unharmed, though swearing dire oaths. Ho! Varlet 1 called Pentathol to a servant who had come running at the noise of entrance. Fetch us the proper tilting accoutrements and summon the knights and ladies to witness this passage of arms. This last, however, was needless, for already word had 'iiown from mouth to mouth that a joust was to take place between the madcap youth and the sullen warrior. Who here hast ever seen Sir Pentathol run a course ? queried a veteran knight of those about him, as he took a seat under a great canopy. Not I, replied his neighbor. Nor I, Nor I, Nor I, came from others, and in a short while it was noised about that although Pen- tathol's strength and skill were known to all, none present had ever seen him run a course with a spear. . And now, when the two knights were equipped with tilting lances and Sir Pentathol's own charger had been brought to opposite ends of the lists they rode, wheeled, and stood a-waiting. For a moment all was silence, the two contestants sitting upright on their horses, the sun glancing and dancing in a thousand vari-colored sparkles from their rich armor and half raised spears, and the gorgeously gowned and robed onlookers who packed the galleries leaning forward with nerves tensed and eyes strained. A silken page pealed forth a ringing blast from his silver trumpetg and as one, both knights thundered o'er the hundred yards of green sward between them. Fairly in the middle of Pentathol's shield did J ocandi's spear strike and such was the force that it burst into a shower of tiny splinters, leaving only the handle in one piece. But, as the old song says, Sir Pentathol, with wise foresight Aimed not at shield nor greave. His spear he thrust 'twixt arm and chest And heaved a mighty heave. Aye, right well did he heave upon his spear, and right well did his spear serve him that day, for the burly Jocandi was lifted clear of his saddle and once more hurled to the ground. Now at this feat of arms those about cheered lustily, for it was a clever trick and right featly done, more- so as Sir Pentathol had not even moved with the shock of the other's lance. Slowly and painfully the baron rose, for the fall had shaken his very joints. The cheers of the onlookers added to his ire: so it was with much difficulty that at length he spoke. Ye seem right well at these play tricks, Sir Boy, he growled, but still do I doubt thy ability as a swords- man. Quickly Sir Pentathol swung from his saddle and faced him with jeweled blade drawn. Have a care, Sir Jocandif' quoth he as he tossed his shield aside, for methinks another defeat is Very near ye. 'l '' 'H ''''''W ''''''l!!!!''lll'''!' ''''!ll!'''!!ll''!!!!YF!!!!!Fl'!!''''ll!!!!!?!'!'!!!!E!!!M'!Pl!!!!!!EE!!E!Elll!!!!llff!!! 4!!!!Yl !!?l!!!!!!l!!!!l!!!'!!!!lII!!!B!!!!!!!lf!!!!!l ''!li!!ME!ll!!!!!' !''''E!!!!U''''I!'fl'W'' FEli!W!!Mm!M!WW!M!M H!EMMM!H!!!EM!!HM!!M' l 2 I? ii it 'E E 5 E gs gi Iss si El gl 5 3 gl E. 5 as e 5 i i I gal E i i Z Z l i Ei el E. E! fi is EE W, PAGE EIGHTY-SIX I - - ,...... .- ..,.. - .THE TATTLEB, . .. ...,,,.. Without more ado, the pair fell to it, and soon the tilt-yard echoed to the sounds of lusty blows given and taken. Oh, it was a pretty sight to watch the two great blades whirling and flashing aloft, keening and dart- ing through the air as things alive. The knight of the sable a1'ms was a mighty swordsman, but never could he penetrate the other's baffling guard, whereas Pentathol, quick and light for all his metal casings, touched his op- ponent now here, now there, with either point or edge and with the utmost ease. Then, as though tiring of the sport, he swung his blade with such force and cleverness that Jocandi's sword was sent spinning and dancing full thirty yards away. Then did those about cheer indeed, for although many times had they witnessed bouts, never lcefore had they seen such swordsmanship. Now the sable baron took his defeat passing ill, for according to the ballad which tells this tale, 'Twas sorcery, said Jocandi, And gnashed his teeth in rage. I'd split thy sconce for this, thou rogue, Wert not for thy young age. ' At this, Sir Pentathol laughed right merrily. Quoth he, I fear thee not, thou mournful knight. But, as 1 have sufficient for my needs, I beg thee keep the horse and armor which are mine by the rules of battle. By heaven no! swore Jocandi. Take thy winnings. Thou'lt soon loose them again, for mark ye well, some day we twain will meet and only one of us shall depart from that spot. So saying, the burly knight turned on his heel and strode away in high dudgeon, nor was he seen again that day. Now the old song goes on to relate how Sir Pentathlon distinguished himself in the tournament that day, and how, although young, no man could stand against him in any contest oi skill or strength. Thus he won great honor and much fame, and many maidens looked longingly after him, but for them he had no thought. No not a single thought would Sir Penta- thol give to those maids, for he had seen one Whose queenly grace and beauty overshadowed the charms of the others as a mighty tree over shadows the ground at its base. The name of this maiden was Editha, and she was the only daughter of the Duke of Gamloorough and Rothingham. Her eyes were of a blue that was more than blueness, deep wells of dancing splendor, faultlessly lashed. Like a mass of spun sunshine was her hair, and so wondrously sweet and charming was she, withal, that scores of lords, knights and barons had wooed her, but always in vain, for the fair Editha. had dreams of her own lover-knight. Sir Pentathol, although able to emerge victorious from the tiltyard and other manly contests, was utterly unable even so much as to speak to the one of his choice, and so must needs worship her from afar for the three days of the tournament. Nathless, he was determined that in some way or other he would win her for his bride, though how he knew not. And so it happened that on the morning of the fourth day, when the guests departed from the tournament, Sir Pentathol rode south towards Gamborough and Rothingham, instead of to the north towards Hangle- bar. He kept not to the broad, well traveled highway, but rode at some distance from it in the seclusion of the green wood and in such a way that always might he see Editha. Now this was just what the wily J ocandi had thought would come to pass, and so had laid his trap whereby he might slay his enemy without en- dangering himself. It happened that Editha., not content to keep the slow PAGE EIGHTY-SEVEN. Ur' f' fr-vw --,,-....-n, ,.... ..A,.,A ,. ,, .,.,4 . ,,......... .A.,,M. -, il!! .... I.fLT..f.!'.IJE.fL-.,....,,..-- .... lmmlmwmlmllltlllmulmullmnnlnl nnnlumlllnlm mllmnmvhulumu . pace set by her father's guards, rode on briskly and was soon lost to their view around one of the many curves of the road. As she cantered briskly past a dense clump of trees, some half dozen burly and bearded outlaws leaped out upon her, seized her and dragged her from her mount. Loud did she cry for aid, and no sooner had her third scream been uttered than the gallant Pentathol came thundering down the road upon the group of ruffians, his long sword flashing light and his dark eyes flash- ing fire. Right into the middle of the cluster of outlaws he rode, hewing right and left, and ex en as he did so, a dozen of J ocandi's men-at-arms leap- ed from ambush and attacked Sir Pentathol together. The fight waxed right merry, and soon little could be seen save a great cloud of dust wherein steel flashed and men fell, for Pentathol, fight- ing for his beloved, seemed more than a man. His sword carved a circle of destruction about him as he wheeled and reared his horse to meet the at- tack from all sides, and so deadly were his blows and so fierce his mien, that soon the courage ebbed from Jocandi's retainers and they lied like leaves before a gale, leaving the knight and Editha alone. Then the victor swung from his saddle and, all covered with blood and sweat as he was, knelt before his lady who had stood flattened against the trunk of a tree, eagerly watching the outcome of the battle. My lady, quoth the knight, I hope yon scurvy rogues have not harmed ye, for if they have-, but here he stayed, for a sudden Hush suf- fused the maiden's face, making her so many times more beautiful that he was struck silent, amazed by the wonder and the splendor of her charms. Then 'ere he could regain his composure, Editha spoke, and the sound of her voice was more musical than pure silver bells heard on a frosty night. You are my dream lover come true at last, she said, as she stretched forth her hand for him to kiss. And as the old ballad so quaintly puts it, What need to tell the rest of it? In all due time they wed. And a better pair had ne're been seen, Or so those present said. -Eugene W. Nelson, '25. Jl Preachmenl The Class of 1925 has entered upon the last days of its school life. We are just beginning to realize and appreciate what the association here with teachers who have influenced us, prodded us, and if need be scolded us into giving our best, with all the good things that have been our divine heritage from the mastersg and not least, with our classmates. It all seems very precious to us these last few days. We want to cling to it, keep it forever. But we can not. So we spend our hours miserly for the treasur- ed memories of future years. If this relationship has given to us a more definite purpose, a clearer ideal. and a closer, dearer comradeship, should we not pass on to you a little of what it has meant to us so that you may begin where we end, and go onward and upward guiding old Logan High to the head of the lists? The Senior is supposed to be a model for the underclassman, and though we do not claim the shining virtues we point with pride to the ex- amples of Al Pettit whose HONOR and CLEAN SPORTSMANSHIP extends to his everyday life. mmwnumlmmlnummlmnumllnunlmmllulmnnlnxulllnmlllumlllllnumullmmlllnlnumlnunllumlmumnumummlmlmlunmunullnnmlnnulummullmmllmunlmalumnulmlluwllllmnum1numnumluiiillliiiiiiliiiiiiliiiiiiilfiiiiiiliiiiililliiiilliiiiiiliiiiiiilliiiiilfiiiiiilliiiiiiliiiillliiiiiiiiiiiiiiiiiillliiiililiiiiliiiiiilliiiiII5iiiii15iiiiilliiiiilIiiiiiiliiiillliiiillliiiili PAGE EIGHTY-EIGHT Eugene Bender who has already found an asset in his INDUSTRY. Norma George who is DEPENDABLE. When Norma puts her hand to the plow there is no turning back. The Demopoulos twins who have taught us the true meaning of Old World Charm. Glen Ross who has come to our resuce many times when we needed his willing HELPFULNESS to make an undertaking a success. Clara Mehaffie whose VIVACITY has often enlivened an otherwise boresome affair. Eugene Denham whose PERSISTEN CY at his studies should be an example for every ambitious Soph. Marian Baade whose ENTHUSIASM has put over the Magpie, making this year one of the most successful in the history of the school publication. Audrey Ayers whose EXECUTIVE ABILITY has won for her the pimsitions of President of the Girl Reserves and the Co-Editorship of the agpie. Hazel York who has been CONSCIENTIOUS at all times. Mr. Fisher still holds her example beiore Magpie workers telling how she hurried home after Class Play last year to write a front page article on time. Charles Stewart who is our GENIUS. His literary talent shows this to best advantage, but even while talking his humor impresses you. Also he is the class hero. So you see, he is quite a versatile genius. Robert Kreuzberger whose PERSONALITY has often lead us from the depths of despair to a frenzy of pep and howling. Eleanore Williamson whom we have grown to love in the short year she has been with us for her constant GOOD HUMOR. Boyd Kendall whose spicey SENSE OF HUMOR has created fun in all his classrooms. Richard Hubretz Whose SINCERITY is always formeost. Every thing he attempts he sincerely tries to bring to a successful accomplishment. Lavonne Crockette whose ARTISTIC SENSE is manifest on each page of this Tattler. And of-but why enumerate? It is impossible that even those youngsters-our underclassmen-have failed to recognize the shining light of our multiple virtues illuminating our countenances? No, not even they of few perceptions could miss so obvious a fact! Now Underclassman, don't you cry, You'll be a Senior by and bv. And if you are ever so good they will write you up in flowery lan- guage, praising you in a burst of Euphuism and call it a character sketch. In closing fahemll we wish to leave with you this text, 'Live your best and give your best each day of your life. Gracious! This has deteriorated into a regular Baccalaureate Ser- mon. So be it! Amen. 'W'''''''''WiiiiiWiiiWiiiiiiiiiiHiiWi5'HIIIfiIMI1'1'IWIII'lf'I''I'I'I''IIIW'''''!viiiiii4fiiiiiii14iiiii5iEiiiii!ii!!!i'!!!!! ...,,,.... PAGE EIGHTY-NINE. iiiiiiiiii mnulmviiiiiiliiiiiiiiiiiiiiiiimumlummummllmmllniiilliliiiiillnumlniiiiiiliiiiiiillliiiiilliiiiiiiliiiiiiilliiiiiiilliiiiiiiiiiiiiiiliiiiiiilliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiilliiiiiiiiliiiiiiliiiiiiiiiiiiiiiiliiiiiiiliiiiiiiiliiiiiilliiiiiilliiiiiillliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiikiiiiiiiiiiiiiiliiiiiillun:ll:uniiiiiiiililinnllmmiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiLiiiiiilliiiiiiiiiiiiiiiliiiiiiilliiiiiiiin r'l1l'1MHW1 ,.l A is for the Anxiety That credits have always brought. B is for the Books That we have sold and bought. C is for the Cramming D E is for Excellent Of which there were so few. Which we sometimes have to do. means just Demerits All the four years through. F is to the flunkers Who have been made so blue. G is for the Graduates Of the best class of the school. H is for the Honor Of the Golden Rule. I is for the Interest That is so manifest. I is to the janitors Who keep the school the best. K means Kimbrough's The rendez-vous of students. L stands for Logansport The leader of intelligence. M stands for Magpie - An admirable publication. N ,represents the Nobleness Upheld by education. Iiiiiiiiiiiiiiiiiiiiiiiiiiii 1 f : l Z i i E l l I 1 S i l E l s 1 i 5 i Q 5 2 l l l l 1 PAGE NINETY V--'rw f,-fr . ,,., -Y . V A THE TATTLER IS for the Others Who have graduated before 1S to the Professor Who makes us study more stands for Qu1zzes That to us have been gwen means Just some rest For whlch We have str1ven means the Sp1r1t That IS ln L H S IS to th1s Tattler Better than the rest stands for the Unlty By whlch we are unlted means our Versatlllty 1S for the hard Work That we have had to use 1S for the class Extraordmary That the school 1S gomg to lose 1S for the hearty Yells Wh1ch we always gave means the Zeal To Wh1ch we clave Now these represent the A B Of the Class of Twenty FIVE And may thlS be memorlal For all our future llves Neva Plotner o' . P7 1 y R 11 . 6 y T, 1 6 U - 1 , W' . Y' -1 1 Z 1 , PAGE NINETY-ONE 3 ESI 2! ii I 52: EE! 3 E E1 'EE Ei Ig? 55 I P? E i . is: 152 iiiiii!3iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiEiiiiiii3EiiiiiiiiiiiiiiiiiiiiiiiEiiiiiiiiiiiii3iiiiiii3iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiili3iiiiii3iiiiiiliiiiiiiiiiiiiiiiiiii333iii!!333iiii3iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiil3iii!!!iiWiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiEiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiEiiiiii33iiiiii3iiiiiii3iiiiii33iiiii3iiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiFiiiiiiiiiiiiiii!!51iiiiii1W4UiiiiiiiiiiiiiiiiiliiWEEEEEEEEiiiiii?iiiiiiiiiiiiiiii!!iiiiiiliiiiiiiiiiiiiiiiiii! !!iWfiiiiiiiiii!Wiiii5ii!!i!'iiiiiiiHuiiv'iIW ! 'f 'ii!iHii!i1''iiiiiiHiiiii!E!!! Wiii!'+1i!ii'i'M 11'iii!Wiii!iW'iiiiiiiiiii1iiiiiihffiiil'?f viii 11'iiiiWiEi1iii!'biiMiii!?!iiiiii iiiiibiiiiiifiiiiiiiiiiiWifi!iiiiiEii6!iiiiiriiiiiiiriiiiiiiiiiiiiiiiiiiiMiiiiiiiiihiiiiiiiiiiWiSWVEEEWBii?WEii6iiiiii'iiiiii''Hiii'' H'''1 'iHfiiWiiiiEl?ii9 iiiim2''iv'N FEN''rf''1N '!W i!fEiEiiiiii!!fif5'? . PAGE NINETY-'IWO. 1 I I I s s 5 Ez as s THE TATTLER N i'lTL 1, 7x .J 9-5?-if W Dramatics I' ',l' Y - 'I' ll Ii IG IG. !l!!!!lll E!!!ll!!!!!l!!!!!!!3Y!!!!!!lP!!!!!!!!!!!!lIF!!!!!ll!!!!!1?!!!!!l?l!!!!!!?!!!!!llF!!'!'!lE!!!!!!fl!!!!!!!l!!!!!!?l!!!!!!lF!!!!!ll!!!!!!''l!!!!!ll'!!!! ' ' '!!!!Yl!!!!!!ll!!!!!!V'! l l Class P au of 1924 l l The Seniors of the Class of 1924 presented the play, Under Cover, by Roi Cooper Megrue. It was given on the night of May 18, and was act- ed before a house with standing room only. The settings were as realistic as could well be imagined, and the acting was Something which the spec- tators will never be able to forget. George Grubbs fitted perfectly into his role as detective, and Helen Grube syncronized without fault. The play it- self could not have been improved upon. There was mystery, swift action, romance, and very human comedy. As the plot unfolded, the audience sat forward in their seats eagerly awaiting the climax, and when the play was concluded, left filled with a new appreciation of the drama and admir- ation for the talents of the cast. The Cast George Grubbs ....................... Stephen Denby Helen Grube ................ . ................ Ethel Velda Reed .................................. Amy Catherine Seiter ........................ - .. ..... Nora Dorothy Halderman ........N.. ................ A licia Mary A. Porter ............................... Maid Irene Martin ..... I ............. ..........-..... M aid Dorothy Propter ..........................r.. Sarah Robert Richardson ......................... Michael Fred Murphy ................. .. ............. Morthy John Geyer ................................. Taylor Dan Porter ............................ Harry Gibbs Maurice Winfield ............................ Duncan PAGE NINETY-FOUR E. THE TATTLER 1 1 1 111111111111111111111111111vi111111111111111111111111u111111111111111111111f111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 11 1 111 1 1 1 11 111 11 1 J. H. S. O CFC'ltd On Tuesday evening, March 10, the Lincoln Junior High School pre- sented the operette, Snow White, based on the will known fairy story. Q: All the parts were admirably acted and the scenic effects supplied all the background one's imagination desired. The seven little dyarfs with their ingenious acting and sweet voices, the scarf dance, and the woodland chorus all made a decided appeal. The major parts were as follows: Princess ..cc........c...c-c.c, Ruth Little Huntsman ...,......,.cW...... Carl Kinney Prince ...... .,,....cc... - cc, John Closson 2 Queen ........cr.ec... .c,.c, lv Iary Clancy in111111111111111111mu11111111111111111111111111 11111111111111111111111111111l111111111111111in111111m11111111111111 1iin11111lil111nil111111i1111111m111111 PAGE NINETY-l1'IVl'I. rr' W fi is THE TATTLER Jlll High Sc ool llite The annual musical production of the school was given in the form E 1 o'f twelve acts of high class vaudeville. Practically every organization and is department was represented in some Way or other, and in the array of tal- ent, quality of the acts, and the beauty of the settings, it was quite the big- gest production of its kind in the school history. Everyone who witnessed it was loud in his praise of the ability of those who took part. A matinee was given on the afternoon of April 23, and an evening performance on that and the following nights. All tickets were sold for fifty cents and all were reserved. The program was arranged as follows: 1. Overture-L. H. S. Orchestra. 2. Animated Cartoon and Film Fun. 3. Songs and Dances of the Various Nations-Glee Club. 4. Musical Recital--The Byerly Sisters. 5. A Taking Way -Tattler Staff. 6. Interpretative Dancing and Special Features-Dorothy Myers and the Art Classes. I 7. Dialogue-Bill Elliott and Don Docke. 8. L. H. S. Band and Riley Junior High Girls' Violin Corps. 9. Ventriloquist Act-Alvin Pettit and Eugene Nelson. 10. Ten Tumbling Tommies-Coach Wells' Athletes. 11. News Reel. 12. Exit March-L. H. S. Orchestra. 5 fi 5 E E PAGE NINETY-SIX E i x pf fic X Q, fix? Ula, N IXFI XINIIX NI X - 1-' ,qwggr fx- 4 Gir S' Glee Clu The membership of the Glee Club is made up of about twenty-nine talented soloists. This year the club has been extremely successful in all its performances. The Glee Club made its debut in October of this year, when it gave a program in Hallowe'en costume. This program was such a decided success the girls gave a minstrel a short time later, starring Bee Carr and Dorothy Powell as black faced comedians. In the All High School Night Revue the Glee Club girls made a tour of the wo1'ld, attired in native costumes of each country. The Club gave its final program in the auditorium May 6 under the management of Bee Carr. All in all, the school cannot say too much in praise of its Glee Club. The students are proud of it. The members are: Marie Demopoulos g Anna Demopoulosg Caroline Lintong Clara Ferreeg Thelma Nicholasg Ruby Rossg Bernice Rockeg Mil- dred Koontzg Alice McCoyg Lucille Porterg Ruth Steuhmg Ruth Garrisong Margaret Geatty 5 Irene Campg Caroline Hallg Helen Shawg Mary Louise Trumang Marcia Redingerg Virginia Byerlyg Arinetta Marcrumg Beatrice Carrg Romaine Waltersg Meribah Koonsg Mildred Spencerg Marguerite Sturking Edna Mae Hirstg Margaret Bishopg Juanita McElhenyg Gladys Williams. 'l'TMl!L'U!'!!'!!l !!!T! .'!'!!!'l'!! ! ' ui - ..., 'rw... 1' 'HH' vf1v 'nP15!9!'!W ! P '1P'P!4'!f:!! 'v!!',,................,....,.........- PAGE NINETY-EIGHT V T H E T A T I' L E R anatiiazamiiaammaaaaaaeaiiazmniiammaalaasaaaammaamaaiiiaansaausiaimaeaaimaiaaemsaiazaanLaalmsiasmmaaanafaaaamaalaaaaanLsiaamaiaaaaaaagaggaaanaggaaaaagigaaaaasaaat Ban f Need any pep instilled in your meeting? Then get the band! The Logansport High School Band is one of the best of its kind in Northern Indiana. Under the supervision of Mr. Anderson, music director, the band is nearnig the end of an exceptionally fine year. In both the ath- letic and social meetings of the school the band has proved a decided as- set. It aroused a general enthusiasm at all the football and basketball games. In the All High School Night program the band more than did itself justice. The personnel is: Sam Trickeyg Linus Olsong Don Youngg Walter Rehmg Hudson Erbaughg Clarence Dielg John Bellg Gordon Cates: Richard Gohlg John Frazerg Lawrence Messersmithg Pat Clearyg Holland Meinzeri Eugene Denhamg Jack Routhg William Moroccog Robert Little: Robert Sharp. wwmmummun urulIumumzlumnmlmnnuvmummmmmrnwwmuulumnxsmnnullil,mnuumlvllnwywunrn xr nl wi n mmmnvrvunwuvnnmmrmnnwnnmmumuu IAGE NINETY-NINE. 11111111411 mx HHH P1 ft! S-I fo--I :IJ U .G U L.- O YW - l 1 5.4 2 Bax SEB? -A-I .... .- C5 3 535 2:w2 5 ECL? Qkags L+ 8 4-' Q .. : O 4-w C5 5, 'L' Q E m ,U M2 O O .-4 55 ,H O V1 q..4 3 5 5,4 v-5 E CS .,-4 GJ ,Q F G C2 is Q J cv E CD qg . Q .-. S f-4 5 E 4.-a an 3 QJPO www 5 P cn 0 -- Q-4 -Q Q as O :N cv ,, O Q g rn . Q V2 pg bo O CG 3 an 3 2 jj 5 CI .C E F C5 gg H E ' . O T5 O cv LL' - CD 5 rn - :A .Q Q CS C o B 'U O - H Q .C if 22 Di bu A cf K3 U :cu O L' ,x 5 -I-P qg H U1 5 U hi U C5 C3 bo Q- ,Q gp .- CS :jj -5 my rv :-1 P1 4-9 GJ ,H 1 v-' Q, .,, 35515 2:52 cu O 4-, 'U .S 5 E 4-' S3 L' 3 cs Q' 50 O fi W ul-1 w Q SEAS CG cv U1 5 Z l Q cvs Q, U nv-I BEQSBQQMWQ 'Es53mO3-325535 :ZS .2 U 1-4 5 E 'P --- PTI v1 0 E5'E'gmm.2E3----E v, -- Easiaiwiwig 0 -4-T P 'v-4 VJ 3 Q2 CS Q -E 3 CS D1 75 3 A Z0 E 'C 'ES rn -57 -C: Z Q O 'S 5 ,C cu 9 ,P 43 O :' 5 Q css J O P' , O as P '- 3 f: 0 'S - 5' Q-' P L. cv O -C fi N Q QS cv 92 cu +P 2 3 cu m LT-1 Q, iS52+M2iw6U6 gk Q2 S-4 N Q o .. 5: Q4 ,Q O U2 4-7 O E gg :G Q ' 5 as O ' un GJ if 2 5' 3 6 -5 +3 fn Q9 CU 2 H'11111i:1111wUwvw111w11'w'WH Nw' 'W wx' WF'. iH1'wi' M11'illlliziww' Hllvwilw''3331E333331Fi1331iii33333WiE311'133E3iiiii3iE!iii1!ii!iiiiiiiE!w' 1HiiiiiiW1vii'111Wii1iiiiiiUiiiiiiiiiiii '+W wHiiiiiiiiwf' Hf H' 'HH' f f 1H'H11Eiiii1!!ii!i11!iiiii1!ii!Z11fii!!2iiiiiif1riii!111iiiwiiiiifliiiifiiiiiiiiiiI PAGE ONE HUNDRED . PHE , T42TPER 4 ,4.. , ,.4 ,.A 5 -wwwww umwwwulwwwwumwwwuuuwwwnnwwwumwwwwmuwwwnuwmlmwwwnmwwwnuwwwwwlwwwwwwumwwwwnuwwwmwwwwwumwwwmmwwwwwwwwwwwww:nwwwwwnuwwwwunwwwwwnnwwwwwwwwwwwwwwwnwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww wwwwww wwwwwww wwwww ww ww w THE TA'l'Tl.ER wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwuwwwwwwwwwwwwwwwwwwwwwwwwwwuwwwwwnuwwwwunwwwwwnuwwwwrumwwwwwwwwwwwwnwwwwwwwuwwwwwwuwwwwwwww:wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwuwwwwwwwwwwwwwwwwwwwwwv-wwwwwww-wwwwwww wwwwwwwwwwfwww w-ww www wwwww ww, www. fs Sociehg PAGE ONE HUNDRED-UNH. xl! qu llf XII H 1 N ,,, wr wff N U' fl mf 1 sf, f Xl! X ln x0 xl: H, xr www w ww wwww www www wwwwwwwwww wwwwwwww wwwww www ww wwww w wwww www ww www wwwww wwwww www wwwwwwn wwwwwwwwwww ...- ,,,... ,,.. . ..., EE' Junior'-Senior Reception The dimlylighted gymnasium, gay in its festive dress, furnished the setting for the annual Junior-Senior reception, May twenty-seventh, nineteen hundred twenty four. Streamers of every rainbow hue, gay Japanese lanterns, lattice inter- twined with vines and flowers magically changed the old basketball court into a beautiful wonderland. Bertha Gust, the class president, gave a welcoming address to the Seniors after which little children presented the charming playlet, The Quest of the Little Pink Parasol. Following the play Mae McCloskey entertained with several violin solos, Dorothy Meyers gave a Russian dance, Miss Jackson gave a whistling solo, Mr. Silberman played a Xylophone number, and Mr. Huckleberry played several songs on his musical saw. Dainty refreshments, carrying out the colors of both classes, were served at the close of the evening. This reception goes down in history as the largest and most suc- cessful L. H. S. has ever enjoyed. Heillowccn Partq In order to further the acquaintance of the girls of L. H. S. on Wed- nesday evening, October twenty-ninth, the Girl Reserves entertained with a most delightful Hallowe'en party. The party was held in the main corridor which was elaborately dec- orated in yellow and black streamers, cornstalks, and pumpkin heads. The good times which are always enjoyed at the Hallowe'en parties were not missing. The fun started with a grand march after which every- one was allowed to unmask, and enjoy the following interesting program: Prelude ............................. Mary Medland Vocal Solo .................. .- ...,. Thelma Nicholas Violin Solo ..... --- Katherine Kammerer Spanish Dance ..................... Gladys Gingrich Recitation ..........r......,.......... Mary Hassett The remainder of the evening was spent in games and fortune telling. About ten o'clock refreshments of popcorn, apples, ice cream and cakes were served, and afterwards the crowd dispersed reporting an ex- ceedingly pleasant time. Illusic Lcaquc Pariq The Junior Music League gave a Christmas party at the home of Mary Medland, Thursday evening, December eleventh. The following program consisting of Irish and Scotch Folk music was given: z 252 gi Y: S S i E , i f EE E 45 fi i t ii li l i si I S V. 5 i i t s E i E 2? 5 E i Gossiping ................................ .... , , ..... Vocal Solo Elizabeth Willey In a Country Garden ............... .- .... --- Percy Grainger Louise Hoffman Scotch and Irish Folk Music .........e.... ........., T alk Marian Dunn Si PAGE ONE HUNDRED-TWO. '-1520, -f'7Q:w'Li1lYa5 iliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii1iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii .... 1iPiiiiii11Piiiiii3iiiiiiiiEiiiiiii3EiiiiiiiEiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii3iiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiii33iiiiiiiiiiiiiii3iiiiiiiiiiiiiimi ..... ....iiiiiliiiiiiiiiiiiiii3iiiiiiiiiisiiiiiiiiiiiiiii Butterflies .................................... .......... O ISOII Katherine Kammerer Following the program games and dancing were enjoyed, and later delicious refreshments were served. lj. lfll. C. A. Jlnnual meeting The second annual membership meeting of the Y. W. C. A. was held Friday evening, January 30, 1925, in the Memorial Home. The banquet which preceeded the meeting was attended by three hundred and eighty persons. Covers were laid at long tables, each of which was centered with potted cyclomen plants and lighted pink tapers in crystal holders. The invocation was asked by the Reverend J. S. Corkey. Music was furnished during the dinner hour by an eight-piece orchestra and Miss Maxine Ferguson, violinist. A number of greetings were sung by various groups which instilled a spirit of fellowship. Following this, a group of Junior Girl Reserves gave their ceremonial program. The Senior High School Girl Reserve work was represented by several songs sung by a group of Senior girls. A report of the work accomplished in the last year by the High School girls was given by Audrey Ayers, president. Those who rep- resented the high school Girl Reserves at the banquet and meeting were Elizabeth Hillis, Norma George, Harriet Huff, Mary B. Little, Virginia Mull, Clara Mehaffie, Meribah Koons, Irene Flanegan, Margaret Beatty, Jane Winfield, and Audrey Ayers. Miss Mildred Winters, secretary of the board, then read the min- utes of the fall membership meeting. This was followed by the treasurer's report given by Mrs. Egan. The remainder of the evening was devoted to the giving of reports from various departments of the association. These were given via radio, Miss Robe, local secretary, tuning in. Latin Club Annual Partq The Latin Club of the Senior High School held their annual party in ghe Cafeteria Monday, February twenty-third, nineteen hundred twen- ty- ve. Everyone present had a gloriously good time. A mock trial was the main feature of the party. Three students, Mary Gorden, Harold Tuberty, and Egbert Campbell, who disturbed the peace by singing on the street corners were tried before Judge Henry Wolf. Hazel York, an old maid, and Helen Johnston, a business girl testified to the fact of the dis- turbance caused by the Vdiscordants. Lawrence Messersmith acted as the bailiff and Edmund Gross was the lawyer. The trio were pronounced guilty and were sentenced according: Harold Tuberty, one year in pergatoryg Egbert Campbell, three years of work in the Cafeteriag and Mary Gorden, two years of dish washing in the Cafeteria. After the trial, games and contests were enjoyed. Prizes were awarded to Vianna Price, Paul Minx, Lawrence Messersmith and Amy Spencer. Later refreshments were served. PAGE ONE HUNDRED-THREE. ll: 'fT?'! ' U W W' ' . 444 ,,,.4 .4.....,........,....4,,,. ., .. ,.1AA .11. ,...A k ..4A .A.1........41......,..... ,.... Girls Reserves and l-li.-Ll Banquet On April Fools' day the Girl Reserves and the Hi-Y Club gave a banquet for the basketball teams, Coach Wells, Coach Eberhart, and the members of the faculty. The banquet was served in the L. H. S. cafeteria. The after dinner speeches furnished great entertainment for the seventy'-two present. David Hudson acted as toastmaster. The following is the program: School Spirit ................. --- Audrey Ayres Gentle Art of Boosting .......... a---A. E. ,Burke Team ........., , .......... .- ......... Alvin Pettit The Importance of Being Seconds .,.... Bob Johnson Play Ball ....................... .... C oach Wells 'fThe Girl Reserves -- .......... --- Clara Rathfon Hi-Y ,......................... ..... W esley Allen This Group of Boosters .............. D, W. Horton Much fun was added to the class of the program by the cere- monious presentation to the team of a box containing a small aluminum cup. A Surprise Frolic The Tattler Staff enjoyed the fun of a surprise party on their busi- ness manager, Eugene Nelson, in celebration of his birthday, May 5. The evening was spent in games and dancing. Alvin Pettit's in- struction in the art of jigging gave great amusement. It also proved an appetizer for the welcome refreshments. As a reward for his work on the Tattler and in celebration of his birthday David Hudson presented him, in behalf of the Staff, a handsome sweater. A Consolation Partq The good sportsmanship of Uncle Roy Johnson and the Hornbeck Amusement Company was shown by the banquet and theater party which they jointly gave to the squad on February 7, after the Anderson game. The entire team, as well as Mr. Burke, after feasting at the Cafeteria, at- tended both the Colonial and Luna Theatres. PAGE ONE HUNDRED-FOUR A THE TATTLER dp Banquets HARRINGTON'S Mr. and Mrs. Harrington gave the varsity squad and Coach Wells the third annual banquet on March 25. The dinner was held at the Elks' cafe and immediately afterward the entire group adjourned to the Har- rington studio where a euchre contest was held. Kendall won first prize and Carney the booby prize. Ice cream and cake was then served, after which presents were given to the members of the team. Rice, Carney, Hazel, Hupp, Reid, and Kendall received Hampton watches, and Pettit, Wissinger, and Terry were presented with diamond rings. The boys all feel extremely grateful to Mr. and Mrs. Harrington. FANS' BANQUET . A number of fans including Mr. and Mrs. O. L. Harrington present- ed the members of the first and reserve teams with a banquet at Uncle Roy's Cafeteria on Monday, March 30. The meal was followed by a thea- tre party at.the Colonial. One player, Bob McCarnes, was unable to at- tend on account of illness. This is one of the many good times Mr. and Mrs. Harrington and other fans have given high school athletes. KIWANIS Tuesday, March 31, Mr. A. E. Burke, Coach Wells and the team were given a noonday luncheon by the Kiwanis Club at the Chamber of Commerce. Mrs. Pirie D. Beyea delivered an interesting talk and Coach Wells made a speech of appreciation. Music was furnished by the Chris- tian Church orchestra. BIRTHDAY PARTY Coach Wells' birthday was duly celebrated on the evening of St. Patrick's Day. The team, with Mr. and Mrs. Harrington gave Mr. Wells the pleasure of a surprise party. Furthermore they presented him with a rocking chair, desk lamp, and a desk set. The evening was spent en- joying the hospitality extended by Mr. and Mrs. Wells. GE ONE HUNDRED-FIVE. ' THE TLER Inwwrn!!!wwrrggwjgpg1fy1uggjuMQWmywrwguywwmnwwwmnwwwuwwwmwimwwmnhuwxwuwwxuh:xxxwuwumwmmummm14xxxumxxxuuiixxmuxxxumumuuunum wwwwwnwwwwfrmwwwwunwwQwwnwwiwmlwwwwwwIwwwwwwanwwiiwInwiwriuu1iiiiiiiliiHillulwlililiiliiiiliiiPHA1iiiliiiiiiiiii:1wwwwlullwiQiiniliiwnhliifull1iMiliiiimiiQQunuixxluixuuuunwxxwulxuQQrmxuuuriliixnhuuuunhuwrw414xxuhuuixiluxuniluuummuviiuxxuiuxxuiixxuuniluwwiniuiilimiiii4uliiiQl iiiiil11iliiihUiillwwwwiiilwwwwhmiwwnilwwwwInwiww1inwwiwwwnww1wwwuiwww1wrnwmm1zuwwwwwwanww1wwnwmwwwwnwwwwwwwwwwwwwwwwIwwwwwwwuwwwwwwnwwwwn1wwwwwwuwwwwmrwXwwwwwwnwwwww1-1wwwwwuwwwwwn-4wwwwnuwwwwruwwwrwnwwwwwwuwwwwwmwwwrwrmwwwnnwxwwlii4wwwmnwwxxviiiwxxxxiiwxxxnnxxxxx:inixxiiiuxxxxwiimxxiiriiiiiwwiiiiiwiiriiliiiinii1iiiiiiwwiiiiiiliiiriiiwiiiiiiwiiiixiwiiLimuiiuiliiiuiui4uuuuIwuuwiviilliiiiiiiiixiiiiiiiiiiiiiiiiiixxWwxiiiiiiiixriuxHiiixxiiiiiiiiiiiiiliiiiliiinllva PGE ONE HUNDRED-SIX ,.,..-- ...1- F1-T1-.11 -155' f--.. 3:r. ,rf-r' -41. ...-- 11:11-n 1..- ui 077' n Sf 5 5 5 E 5 35 A F E 3 T5 r 5 E 5 k' E F1 ,. r i ii P E 97 Vi m v E E1 Q W W W F I 5 H 3 ? '1 'w A 4 Zlll:B1l.yE:vhLl!.ll'f'.-Tw .I.R:J: ' - 1,6 ,2 lfrwra,'v'aI!l1i-Xi1ul',MrlUU.lA1inf..lmLfQ9l-zhiririxi ' ' g!l.-1 i1.,Q?a'-i1'5vws,.D' MA'-Q 7691 ' THE TATTLER m nu in v 1 innwwrmiiilvxiruiiiiililiniiiuixiiluiiliiiw1:viiwvrlI5iIfviiiilliiiiIIwilHiaiiiiiimiIiidiiniiiiiivMnnviliiiihlmviiiiiniliiiiiliiiiiiigiiiiilwiiiiiniiwiiiii' 'ili'1iMlu5MiifumiiiiiiliiinlllmmlmlIlmmlllmulllllouuur mllmlllnmllmllmu llrrlllllaiijiiiliifiiilliiiiijg fs 'Q Q5 EE 3 55. .55 55 'it ES, 52 ' u Cfennis L men as 3? 25' E, ig! 13 l il il is lg lg. l 53 :S ' i 35' El 5 The second annual Tennis Tournament, sponsored by the Tennis Club, was a decided success. The champions in the boys' singles and doubles, the girls' singles and doubles, and the mixed doubles events were awarded L's. In the girls' singles, Marian Baade defeated Amelia Reuter in the finals. Gerald Rice won the boys' singles championship. Neva Plotner and Amelia Reuter took the girls' doubles championship with ease. ln the mixed doubles Amelia Reuter with Gerald Rice won the event. Wayne Car- son and Gerald Rice won the boys' doubles championship. Although this was only the second year in which a tournament .E E I., was held, the competition was much greater this year than last. The Ten- Gil nis game is growing more popular each year. The recipients of L's this year were: Neva Plotnerg Amelia Reuterg Marian Baadeg 'Bob J ohnsong Wayne Carson and Gerald Rice. El E1 QE' unmmu :nm numlnmmumuuuuvnmumumnu nuulnuu num :ummullmmzuyuuulqllllllllulull ml num lm vuIII:qwllnulluvumllmmmvivmunnqiggyiivi n m I lllllnwllgglglilgllullhI GE ONE HUNDRED-SEVEN. . . . r . . .T.H.E-., , Loqansport Football Season of 1924 , . K ,v MEN W.. The Logansport High School football team, trained by Coach Eber- hart, and led by Captain Thomas, made a good showing for L. H, S. in 1924. The first game was played at Noblesville, but was later annulled as there were no certified officials in charge. Huntington 18. SEPTEMBER 27 Logansport 0. The score does not tell the tale in this game, which was not in the least one-sided. In fact, the Red and Blacks outplayed Huntington in many ways. Logansport kicked off to Huntington but soon recovered the ball, working line plays for a good many iirst downs. A forward pass was then attempted, but Huntington intercepted the pass and took it for a touchdown. By some means or other they managed to score two more touchdowns during the game. L. H. S. could play all kinds of football, but was unable to score. At two different times during the game our team were within one yard of their goal, but both times lost the ball by a fumble. The game ended with the ball in our possession on the sixty-yard line. Monticello 12. OCTOBER 4. Logansport 3. Fumbles seem to have been our greatest handicap in our game with the Monticello warriors. Even though they put up remarkable opposition, we aided them materially by our inability to hold onto the ball. We did show them however, that we could take the ball down the field a good many yards. Keitzer opened the scoring with a goal kick negotiated from a diffi- cult angle, thus marking up our first points of the season. Although our opponents scored two touchdowns against us, they really earned but one. Near the end of the game, the Red and Blacks made a grand rally and were headed for home when a Monticello man intercepted a forward pass and carried it for a touchdown. S. S. Fort Wayne 13. OCTOBER 11 Logansport 7. The game between South Side and Logan was the best one witness- lmn1illumllnu1lllrmiiiinmimm11immirm1111um1iimuiiumimm11mmii1ull11mlmmlllmrllllnirinnmllllmullllmmmrmlmlulllvwlllumlmnlllwulllmlllllunvlllmnllliililllvuilllmlllllllulllmmllmlllllliulllllnlllllmlllllmllumlllllmimlMlullmrlllwlmunlllmnuninummnimumimvimmimm11um1i1iinirummlllnmlllmw1iimmiumumnmnmnlllmr PAGE ONE HFNDRED-EIGHT I ul iiilniniillmilliimniiimmlllliiillliiiulll1iii?1l1iiiilliiQiivllliii'fi1lliiiilllllitllllWillllliiiiilRRRFillllEi1iiii5iiiiiifl1lliiwill--wmllillii.lll . HHH Coachfbakharf Cqpfann Thomas I L Brenner, Asrf 1 l'om'll Hherimrf: His first year of coaching gives promise of EL championship team in the future. All the fellows like Ebbie. He always takes great interest in what he does. t':lptnin TIIUIIIIISZ For three years George has been 11 vziluahle memher on the team. :xml it was in recognition of his services that he was elected captain. llnwrenee Ilrenner: Ella was ineligible this lust Season, hut proved that he had the interest ol' the school at heart, helping Coach Eberhurl weld at bunch of reeruits into line. llalrolll linker: Husky was all fighter who was never afraid to tackle the llisigwt men. He realized the truth ol' the saying that Hto hit 'em low and lmrcl nmlces 'em full. Walter Keiizer: Wultfs speed and expert Dlliltillll' served to plzlee him in the stellar role more than once. He is prohzxhly one of the hest hailfs L. H. S. ever had. Wayne Robertson: Fat proved the Waterloo ol' many an enterprising gridiron star. His 22125 pounds of tiesh were as solid as so much rock. und even more dil'1ieult to move. Harold e Bwdklfoo Whlfer Keafzer ' swcgync. Roberfson nn tw- we tw 1 hi it ei 'iz 1 it-1 w were it it H: 1-1 L lffeml l A .gums :limimmllllluulllllmxmlunlllwlilxmil illrf muiu in um lu lwiwlllrull H lim in I H in i le -:al the l ll I lu PXGIC ONE HUNDRED NINE. www'HiHiiH ' ''' ' '' ' ''' ''' ' iiiiiiiii3Jiiiil8iiiiliiiiiiiiFiJii'wMffvwwwwi ' ' WiiiiiiiiFiiiiiiiiii'Hmmm''''''''''7'''''W'1fif 'Ifffff' ifQfIfQfQfIfQIf'fffffffflffffffffffffffffffffffffffff'fffffffffffffffffffffffffffiiF5955iiififEiif'iiiiiiiiiiiiiiifiiliiiififiWflfiiiifilif'iii!5555iii55i5iiifiiiiiffiiiiiif!l?iF!iii5iiii??f!?il'!!!!!!!!' Ex I .....,..,....... -..- ,..... ...- .,..... ,..,..-,. ..,..........,,, -..I ,... ..... - ....,... .. -. ...,,,... ,,.... . E s ed for a long time. We led them by a score of 7 to 6 for the greater part of the game. South Side started to do battle with second-string men, but were soon forced to call out their best, and none too soon, for we pushed them very closely for the entire game. Several times during the game we were within a very few feet of the goal they were defending. Deaf and Dumb Institute flndplsj 10 OCTOBER 18. Logansport 19. Although the Dumb ones did not make a lot of noise when they came on to the field, they did not lack the necessary and in the entire first ouarter the ball was carried back and forth with almost equal advantage. In the opening of the second quarter the Deaf boys succeeded in scoring by a difficult goal kick. Although the home crowd began losing heart, the team did not. This was shown when the Rednand Black warriors scored two touchdowns in four minutes. With one point for try after goal, we led them 13 to 3 at the end of the half. Near the beginning of the fourth quarter Puett in- tercepted a pass attempted by the opponents, and aided by excellent in- terference. he took it fifty yards to chalk up six points. However, by a sudden rally the Deaf boys completed two passes and scored a touchdown, with a. point for goal kick. The game ended in continuous passing on the part of the Indiana- poils men. Loganspart 19 OCTOBER 25 Kokomo 7. L. H. S. Seconds 7. K. H. S. Seconds 0. When this day, to which everyone looked forward, finally came, the entire number of our fans were on the grounds ready for the battle. It was our homecoming game, and without doubt a great success. In a preliminary game our second team defeated the Kittens by a 7 to 0 score. providing plenty of excitement. The Wildcats then came out on the field, looking for prey. How- ever, it turned out that they were the prey themselves, for although they outweighed the Red and Black. they fell victims to our prowess. This game more than made up for others we had lost before. Wabash 14 NOVEMBER 1. Logansport 0 On November the first we packed up and went to Wabash for our last conference game. Shortly after the game had begun, we were de- prived of two first-string back-field men, Baker and Kummer. Thev were forced out by injuries received. The game was hard fought but Wabash was a little too good for our crippled team. At the end of the first half they led us 14 to 0, and there was no scoring in the second half. Logansport 16. NOVEMBER 8 Lebanon 0. During the entire first half it looked as if neither team would ever score. The ball was first in possession of one team, then the other, with- out much advantage on either side. Whatever was missing. the Red and Black found early in the second half when they scored a touchdown and a point for goal. In this quarter we also scored a safety. In the last quar- ter we scored another touchdown, leaving the final score 16 to 0. Logansport 7. NOVEMBER 15 Crawfordsville 6. We played our last game which ended in a victory over the Blue and Golds of Crawfordsville. Our score came early in the game by a touchdown and point for kick. Soon a Crawfordsville half-back slipped behind the Red and Black defense and made a long gain. From there a few line plunges netted them a touchdown, after which they missed their try for point. At the half the score was 7 to 6 in favor of L. H. S. Neither team was able to score in the second half, but at the final gun we were only two yards from the scoring line. y ' PAGE ONE HUNDRED-TEN l Illllll ll1 iiiiiiiiiii I i Enimimi THE TATTLER iittwH+fifr1'i'i 'Viiwiii of ii ani iw ni?iiiifiiiiii 'iiF'i'i 'i ''I'''iiiiii11iiiQi?I1iMlQliiQQiF1hi1IQ'QliV ,,m1Q'inr.'ni,,Hiiiiiluinwiniifiummmitiii1iiwimwiiiiiirfiiiiiiiiihiiil'F3iiiii5F1?iiiif'399li'W-'F3335'5'-'39'T333 '3l 3i.IIQ.2w: an-I--ii iwwwvi ww wvriwv Hiiii ii i'i 5i'f' HH I ' ii Diane F5x:1i iiipiflhclcy Allan 5.AHin Moss 7 llvzuie Fox: Hoggy's hnllilog tenacity and perilirftent effort won him a position as linesnian even though it was his iirst year oat. Hard work kept his plaee. Wesley itllvn: Bus is the best forward passer on the team. As t'nll-haue, Ile hit the line more than any other player on the squad. .Hlen Moss: Pete played right encl, and few men can lzoast that they grained gl'0lll1fl past him. He was a tighter from first to last, and always left the field on his teet. Rolwrt lmvitlz Bob played two years and has another season left. It is generally eonceetied that he will he Captain ot' the 1925 squad. Keith Hiurht: Keith never loses his contented smile, no matter how rough the is. Those who play against him lealn the meaning of Red Devil. t'harles Ste-ii:ll't: llis size and grit marie him an ideal man t'or his position as His experience as a flistauce runner gave him lnort- enrlurance than the 01'l1il1211'Y playing tackle. player. Reber? David ,fixeufh Hughf i Charles sfowaffix i ft I-I iiwmimvu i i i wwiwiwiw:,innnvWamannnmmumuuwauuuriniiiiiiiibuiiviiiiiiiiiiviwiiwliiiiwmiiiiiilli1iiwuiviw,,l,,iiiwwiiimmmnwmiinii-ivmmmwiinwuiimmiiiwwwnninuiiliify5iiiiiiff'lim'Winnfmmifiwiin.ml1iiiiimiliivviiviuiviwuuiuuiiiuwumummmriiiiiiiiiimiiimunImmm PA GE ONE HUNDRED-ELEVICN, ww ul 5? S2 EQ s ll vvzwnvlm lrwmnwmnuunwnuuumlfunn mlmlmulummllmmlllunlllmvlllnunllmlllmlmlllnwww1muwwlmulluunllmywlllwxiilllllilvliliiiwiwliifmfnxiuriiiurifimarlilllniiilN11111144nhlumulilmlmllnlivlluhml1uiixuilluiullHiml1mixlllumllluivlllmullllliiilllluuwlixuuhl lu v is wmv v it ln wwuwuwwwnwHnn4mHwnlllumwlwinlxHnviiwumuurumliuuui James Koomers Ancnl Shaffer p James Plletf: Our center was one of the hardest hitters on the line. It was extremely difficult to gain ground past him. James Koomerz Jim is a red haired Irishman, with more than his share of native light- ing ability. He always cheered the team with his wit and ready laugh. Allfil Shaffer: Big Boy Shaffer proved the sensation of the year. His enormous strength made it impossible for an opponent to do anything against him. Pzull Baker: For three consecutive seasons, Cannonball hit the enemy like his nick- name. That he was in the game every minute is proven by number oi' injuries received. Harry HlIIlfSill2'f'l'2 Harry did not win the coveted L , but he did euln a. reserve lett61'. V He will make one of our best ends next yar. Wilhert lbenlerle: Like Huntsinger, Dem is -a reserve letter man. He is a. good, solid , player, but is rather handicapped by his lack of size and weak eyes. Biker Hurry Huofsilnser lWberT Demerk t umminuvwmvumt11:114ai6imlliiiiiliiiiilliiiiiiliiiS9iJiiJQlEMMWIlhiiiuuIIuii445iiiiiSliPiIiiibmni1IMiiI13vIiiiiluiiiiltmeilmiilmiiuiimanisilurmmiuniliiiiiii3iiiiiiiiiiviI11iiiEiiiiiildihllhiiiilluiiiiiilliinvlllliiiiilldiiinhiiizllgQijgnloirizwuiuliniimiinnwnlwiiumwmitNvHNfi?uwuwlifw?7?fin1iitw5731:lui?lialig'mlm5ivmmiiiulllliiiiiiiiiiinilirrrgigaiigltswmfn Illtllllllillll PAGE ONE HUNDRED-TWFILVE. vm mm ul 5 H V...4 V.A -. THE TATTHER :EE 5? E asa E 9 1 EE E EE 3. 2 5 4 5 ifuhhmjyiilwwwwmuwwwumwwwwumwwwnuwwwumwwwnnwwwwunwwwwumwwwunwwwwnuwwwwunwwwwunwwwwwumwmwummwmmwwnunwwmnuwwnmwwmuwwwwunwwwnmwwwmmwwwnuwwwnnwwwmuwwmmwwnmwwwunwwwnunwwumwwumxwmmwwumwwwnumwwnunwxumwumnwwwwnuuxNumxxxmmxxwnuxxxnmxxmmxmmxj1Qiiif11QQQQQQ11EQ3Mi33iii:wwwumwwunwwwmmuunlwnunwwnmwNIQQQ1EEE1HMjQiiiiiiM1Hifi11limi1Qiifmiiiiiffiiiimiii'' PAGE ONE HUNDRED-FOURTEEN. mm: ws mm an ww ww nu w w ww,.,Iifiw. Wmmwiri1q1.Wm wi'rwumW1.Irwin1wZfnIIn1iMviiiiiiniiniviiiiimiiiiai1iIiiMiieinnnunlvniiiidiiiinmii' 1ummmummmwummmw nu num nnmuunmum fmwwwriiiiiiiiiiiiiinumiiiiqmiiuIiiEEiiiiiBunmAfiiimnnnn1iHminii7' i I 5 :E E I f . ! 5 5 E U I E E QE QE E! if iii 3 255 L EE 3 E QE! EE 5-I E .EQ Q E 2 x mv? Sport Stor Contest In order to interest more boys in athletics, Coach Wells took ad- vantage of an offer made by the Sport Story Magazine Publishing Com- pany. This offer was in the form of a contest which was arranged to de- termine the physical fitness of the American boy. Each contestant was re- quired to do the hundred yard dash, the high and broad jumps, and the bar vault. This last feat proved to be the hardest of all, as very few had ever tried it. The times and distances of all the entries were recorded, and by means of a score card arranged by the Sport Story sponsors, the indi- vidual averages were calculated. The standard for boys of the high school age was 60, and all of the twenty contestants made the required score. Al Pettit's average was 110, Don Wissinger's 100, and Bruce Carney's 95. The award was a handsome bronze lapel button, with the picture of an athlete in the starting position engraved on it. Hy means of this contest, Coach Wells uncovered some very promising track material. ...ni,i...i.ii....l... all.nalli.iaa1iisaaailia lii.iliit...liii.luii....ll...,lliitiiiiiiiiilisa.,,iiaa.aitaasii..i.. iiiitiiiiiii.li.i,.,i,ii...,,i,iall,taililliiaailwiiiwiiiiii-iiiiiiii liiiii''iiiii' 'iiiii+2iiiiiiiiiiiiiiliiiiiiiimun I ,,,,,,.4,,,,,,4,,,,,,,,44,,,,, ,,,,, 4 ,,,,,,.4,,, , ,, 4,,, , .,,,,,, ,,,,,,,,, ,.,, ,,,, , , ,,,, . .,,, , , , .,,, , , ,,,. . ,,,....., ,.... ,..,.. . ,..,.,...,,...,..,, ,. ,,.. M., .....,. PAGE ONE HUNDRED-l ll4'TPlEN., 1 T H E T A T 1' L E R iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiii L. H. S. Bas etball for l924f-25 Walton 21-L. H. S. 42. G In our first game, with Walton, we found that lack of previous ex- perience this season caused a great deal of fumbling and inaccuracy. The other team, however, did no better and we marked up our first victory. Royal Centre 16-L. H. S. 50. Our second conquest came in a rather rough battle with the Royal Centre five, in which game a great many improvements showed up in our team. This game gave promise of a good season. Young America 21-L. H. S. 24. In a fast and exciting game with the Young Americans, which was punctuated by many fouls on both sides, we kept the large side of the score for the third straight game. Here was an old foe humbled. Delphi 26-L. H. S. 58. There was some uneasiness displayed on the part of the fans just previous to the Delphi game, but this was dispelled soon after the initial whistle, for the game was on our side all of the way through. Terry rated high man, with twelve baskets to his credit. ROBERT KREUTZBERGER Sometimes during our basketball games the crowd became very low- spirited. At such times, the mo- ment Bob came out on the floor, the entire crowd gained new life. and rose at once to back the team and help them on to victory. When Bob stood out there on the floor going through his rythmic contortions, his influence was mag- netic. It was as if the spirit in him was reproduced in hundreds of re- sponsive throats, and just as a con- fidential tip, we'll say he is about the best cheer leader we know. ' lui mmmumnluvvmmmllnnIIlmIIIIIwImmmnrrIIImIIlmvmlmllllmnlmlmulmlnlmnmnllmlmlllllmlumm PAGE ONE HUNDRED-SIXTEEN .... .. ....A ,,... , ...4A....... , ,..A4,,,,A,, - ....4AAA,,.., - ....AA. -- ,. .. ,..,.,, , ...4 4,, .. M.. ,,.. - ,,,. ....A,,,, .A., ,,.A A..,. , .., ,.... . . ' ' ' HIHUIIIWIllllllIIMMI1HW!IEMIItMMMMIIIIllMMMIlllMMTMMIIllYmlllIWYlIllll'lIlIlll'I'l1IlIlllllIIlWlIIlItllllllllllllllltllllllltlllllllllllllllttQlllllllfllllllllllllllllllllllllwilllllllllllllllllllwillllllllllllill!!!llVllllllllIlllllllllllllilllllllllllllllillllllllIllllllllIIIIlllllllllllllllllllllllllllllIIII4lllllllllllllllltlillllltllllllllifllllllllllllllllll Montmorenci 16-L. H. S. 46. With the Red and Blacks showing form the game was one sided all of the time. Montmorenci was forced to take most of its shots from near the center of the floor, and registered but three points in the entire first half. North Manchester 30--L. H. S. 48. The Northmen were our most feared oppon- ents so far, since our contest with them at the state last Spring. However, they did not prove so dan- gerous after all, as I.. H. S. took the lead at the start of the game and held it the remainder of the time. The first half ended 18 to 8, with the ball traveling toward our goal all of the time. Jeif of Lafayette 35-L. H. S. 37. In a fast, hard battle with the Jeff men, we were forced to play an overtime period. At the end U IFI' ORD W' I IS, touch As '1 coach tliff Wells has few equals and certainly no superiors ln the state As a true sportsman he stands alone He woiks incessantly for the school and IS always full of new ldeas 'md plans foi its betteiment lhese qualities together with his cleanness and honesty make him an ideal leadei for younb men il WIN Pl' TTIT, 1 'lpfalll It was A1 who mide such hideous fices when he played it was Al who toxe down the flooi like an express tlaln thiough the enemies hve m tn ,defense it was Al who heaved his one hundied eighty live pounds 111 a mightv le tp undei the basket for a goal and then it was A1 who led the team to the most successful season L H S ever had His playing was llw Us blllllant and he could be COIIHIQG upon to do the right thing at the iight t11ne His name 1S synonymous all over the state tm heady playing mdominitable spirit clean sportsmanship ind all around athletic ability A l' BI RRP, Iaclllty Mtumger M1 Burke stepped into the vacancv left bv the leslg nation of M1 .Gibson He keeps accurate records of 'tll the games in 1ddlt10I1 to his other duties He IS the booster personified I ' I 1- w w v w 1 w - . ' 1 e -4 4 A T 4 , . , ' . ' I . . Q . . , , , 1 1 . , 1. . ' ' ' U v 1 1 ' , - X . 4 A 4 1 1 1 i . , ' . . ' . . . . ' v ' . - 1 1 - ' i - ' , 1 ' S . c . . . . 1 2 2 ' ' ' , . . 1. . . . ' 1 ' i 1 ' 1 w 1 Y x 1 , ' ' . . a 4- ' A f V 1 . 1 N - ' - '. . . c ' ' 1 ' ' .. x 'HH' 'HI' it!!ii!!!iiiilti!!!'ili4iiWi'Mii'iiWilwffMW''itiiiliiiilviiiiiliiiwlll1I I PAGE ONE HUNDRED-SEVENTEEN. YT' THE TATTLER mm ...lsaaaa1namiazaaazassiialmiaaaaai H ....w....w lliiiamniaaams ll...v..lumainaanaaamsaiams l...numal.s.aaaaaasiaaa1apaaaa11laaaamiasaaamana1iaaariaWgW5ggg1L.a5gpp5ggpganggm+5iiMy5gpa5gpigggppggiaasaii 'a+a',grajjjj muniliniiIniiihijiiiil5iiuiiilijiuiiii ' 'iiiiiiiiiniiiiiiiiiiiiiiiiiiiiiiiii 'i 'iii ii r. M of this period we had a tie score, but just as the gun was fired a J eff man made a basket. There was a discussion about this shot, and it was ruled that it had been made too late. Their coach, rather than wear his men out in another overtime period, took them off the floor, thus leaving us a 2 to 0 victory. Rochester 23-L. H. S. 22. Our men went to Rochester to suffer their first defeat, in a game where luck worked many strange H A tricks. This game was disappointing and was very little talked about. Rochester 28--L. H. S. 20 In a game in which a wonderful defense was shown on the part of the Rochester men, we suffered our second defeat. Although they led us 13 to 8 at , the end of the half, we threatened victory several times in the second half, the score at one time being 21 to 18. . V Nm a l'LIFl 0RD TERRY- Terrible Terry generally found himself the recipient of the close attention of the two guards: but somehow or other, he always eluded them alld rung up two or three goals. Near the end of the season he found his basket eye. and then he averaged seven or eight markers every game. He was good at' swinging the ball and keeping it away from opposing players. His name Terrible signifies his offensive playing. DONALD WISSINGEII-Big, silent Wiss will go down in school history as one of the best centers L. H. S. ever had. He was a fine, all around player, too, and his nerve and long, rainbow shots made him invaluable to the squad. Remarkably quick for his size, he played with a rythmic ease that thrilled everyone who watched him. GI'1ltALD RICE- Jerry was the smallest man on the team. This did not handi- cap him in the least, for he had such a reputation that there was generally a big, husky opponent guarding him alone. He was not only the best foul shot, but could also make field goals from all angles. There is one more year left for him, and he will probably be captain of the squad. I ' 'ww' w w1 u i H M' .2sse12!eE!Em:1'raheis!!+622sH!nl!!221!'2!:Eeli!fi122!!5i!!!!5N42!2H422!!is!!!'!!ef!!!!m!!!!! !!!!!'re!!! PAGE ONE HUNDRED-EIGHTEEN nlmmummnnnmuInmnImmmmnnsunImmammmmunmnnunnnnnnmmm an 1 l mul:wuumnIIIIvuuuvunlnInmmI1mlmnallumlwllllmnllllmlgglgylpIg5inIlIg5I13l5rnugtgmgylgllltllllltrygggggtfvgill!!llgglggllollllggglwill3ggllmllgg!lglly1yg!lll4l u mm :sw - .4.. ,,, ... . ,A44. .,.... ,... ,,...,A ..44.44,,,..4. ,,,,. ,,,,,,4 ,,,, .,...A ,. AAA, .... .4,,,.,,..... . ... .. ,. .. A , .. . p Kokomo 56-L. H. S. 22. Despite our greater ability to work the ball down the door, Kokomo won a decided victory over L. H. S. in an encounter which was uninterest- ing from the start. K. H. S. hardly ever missed two shots in succession, and at one time registered four consecutive long shots. Lebanon 26-L. H. S. 44. After the previous defeats, the Red and Black warriors came back with practically perfect offense and defense. The game was close for the first few minutes, but from then on there was no doubt about the outcome. Lebanon -I' was forced to use nearly all long shots, which -.. , , - was not very effective. Huntington 30-L. H. S. 43. In a slow game we added another to our list of the vanquished by defeating Hunt- - ' V ington. At the end of the half the outcome of the game was doubtful, the score being Y' ., a 'K 1. 5 Mt F' ' , RAYMOND HI'PP- Curly played on the so-cond team for nearly half of the sea- son. but finally earned his way onto the varsity by his exceedingly clever playing. Al- though all the players used the pivot play well, 'ACnrly was hy fm- the best ut it, He used good judgment on passing the ball and always hncked the biggest players. He has two more years to play. BRl'I'l'l FARNICY- Happy had plenty of hard luck, but he fought his way to the top and came up smiling. Hard lighting and imlH'f'gI1Hble 4l6ff6l1S9 W9l'9 l1iS UXCHCS. and he made a success out of the combination. His shooting was rather erratic, but the team missed him whenever he was absent from the lineup. GLEN REID- Skinny was a mighty good fighter, even for a Red Devil, and was a splendid defensive player. He specialized in dribbling and in sticking to 21 thing that he commenced. A knee, hurt in practice, kept him from doing much playing, but nevertheless, he was a valuable man. His mental attitude was all that could be desired. 'IWW'II'W ' W ...-.. ,... ..,.... . ., ..... ll' ...... .......,........ 3 I ..... ..!!..!.i,,...!!l',! .... l ........... ! ......... ..... . ......... .............. . ........ .... ......,,. I ' ' ' ' ' PAGE ONE HUNDRED-NINETEEN. llllll llllllwllllllll ll ll lll l lll ul ll ll ll Ill ull will l 5 .i.ii.1....i,.,...immm,1mi...mi..iiiiiiiiiiiiiiwiiiiiiliiiiiiiiiiiiiiiniiiiiimiliiiiiiliilliiliiinimnmuimiiiiiii1iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiuiiiiiliiiiglgiiii' ' N'1!'J Y .AA.A....A. A . ..... A,,,,. , ,,,,,,,,, ,,,,,, - ,A44,,,,,,,,,.,,,,,,, - , A. - M- ,,,,,,,,,,...,,. --.W T H.E--... T A T T L RB . .,,.4,,,.... - ...., J'WEEFTW'E!!!F ?4 l'l'W W W'm 'W m F!!!9YF! .- ..... .,.-,-, .,. ..... .... -,.-- ....... only 19 to 18 in our favor. In the second half Wiss was put out on four per- sonals, after which we played a stalling game to the finish. South Side, Fort Wayne 18-L. H. S. 23. This game was played on a larger iioor, necessitating longer passes and more dribbling. When there were but six minutes to go in the last half, Wiss was again put out on personals. Kendall filled his place very well and the game was saved by well-managed stalling. Crawfordsville 24-L. H. S. 44. After the first few minutes of the game, L. H. S. set a terrific pace which even Crawfordsville could not hold out against. We led at the half 26 to 12, and as Crawfordsville was unable to get their hands on the ball Very much in the second half, we stalled away the last few minutes and came out twenty points on top. Bloomington 27-L. H. S. 26. L. H. S. began the scoring by leading 5 to 0. With nobody playing at his best, the half ended with us just one point in the lead, 14 to 13. We ROBERT JOHNSON-This was Doughnuts first year at High School basketball, but he made good through his clever playing, his expert shooting, and his ample size. He jumped center and played forward, and rendered good service at both positions. He still has two more years. GEORGE HAZICL- Boob made a name for himself at the sectional by taking Wissinger's place at center and playing a good brand of basketball. Getting the ball from the back-board and shooting a short shot was his favorite play, and his long arm and unerring eye made him especially adapted for this. BOYD KENDALL-A utility man is a mighty handy person to have around and ,that is what Boyd was. His weak eyes kept him from being a heavy scorer. but he ssurely could play. When substituting as center, he drew the players close to him and smothered all the opponents' efforts, and when the ball was in motion, dropped back to a position as floor guard. Few men ever dribbled past him. PAGE ONE HUNDRED-TWENTY. U l l''''' l M !! ! !!! '! ll '!!5!!!!!!!!!!!!!!l!!!!!!!!!! !!l!!!!!!!!!!!!!'!!!!!!!l!!!!!!9!!!!!!i ...... ,........!!!!.!1.5!!!!!l!!!!!ll!!!!!lY!!..!l!!!!!!!?!!!!!l?!!!!!!!!!!!!?!!!!!!!!!!!!!!I!!!!!lf!!!!! l!.!!!!!!,!!!l!!!!!l?'.! '!!!'! ' E ss Ei Ei si 32 as E, 51 El Sl 52 use 5 5 e S. ZZ Zi s E. 5: Sl ss EE 52 Si 5. E E: E. S5 ,,M,,,,,,.,,,.,,,,,,., ,,,, , ,,,, ,. ,,,,4 1 44,,,,,..4, .,,... -1 ...44 .,...f!'.,.!.1..l5.....'!.'..f'5...'!',,'.1I..!1..l3.,.!E..... ..... 4.., - .4..... - ,... ,,... - ,..444..... -.....- n,...4 ....M .....,.,...-...... . H 1 1. , mmummmmummqmn umuuvmmnnnmmumInmm:mmmnumnuunlnmnnmmuummmmumlulurllnumnunlnmmnumun did not seem to get organized until the last few minutes of play, when we led the southern squad by one point. In the last minute of play, a Bloom- ington forward caged a short basket, ending the game. X '-!. l Columbus 39-L. H. S. 41. 1' - In a very exciting battle, the Red and Blllffk I ,. ' won from Columbus by a two-point score. We A . started out in the lead, but soon the Southerners I ' 5 y began scoring from all angles. At the end of the I I half, the score stood at 18 all. We stalled away . - i4 ffif' eight minutes, in which Columbus crept up to 39 eh.. L 'R to our 41. Two free throws were then granted to s 1 2 1.-fi 'i'1A f 1,4 our opponents, and amid tense excitement they missed them both. , I Q , X 'Q N , ,,:, .., 1, 1 Y. Anderson 42-L. H. S. 28. For the first fifteen minutes of the game the score was 10 all, but at the end of the half the Indians had gained a 17 to 10 lead. Our style of play was limited almost entirely to defense, and although we fought desperately, we suffered a fourteen point defeat. South Bend 35-L. H. S. 29. Although the Benders made a get-away and led us 10 to 2, we made a sudden rally and tled the score at 11 all with the half ending 15 to 13 in the1r favor After they had led us again by 23 to 13 we made another desperate rally and caught them at 27 all Extremely Good pl wing on the part of the Benders made them Victors Kokomo 40 L H S 44 The Kokomo Kats started out to lead the Red and Black b to 1 Coming out from behind the Red and Black pulled up and led the Kats 27 to 19 at the half When Logan had 33 points the Kokomo boys tallied a l1ke number and the game ended 33 all In the first overtime we pulled up 7 points ahead of them but they plomptlv caught up Just as the gun went off In the second overtime we caged two baskets tnen stalled until the gun South Bend 9 L H S 23 The Red and Black squad played an an tight defense against the Benders this time al lowing them only 9 points as a total The defen ww as so perfect 1n the second half that South I end scored only one field goal during that entire period On th1S last mght of the season Vthl e the first team stayed at home to defeat the South b nd team part of our second team went to Lebanon to down them by a 31 to 18 score and the rest of he second team stayed at home to conquer the Lin coln High School team with a 53 to 11 score Du the whole it was a very successful ending to a good season I . l, . . . . , c ' I . - Q' 3 . . 1' u . L. . ' a n n V A 6 . 7 a I , ' Q I 3 Q I .. . ' 1 I ' ' . , ,.. ee 'fl I ' ' A .:-, i ' 1 ' 5 2 ' - '9 1 , L . 2 I I s - . 3 , . . K . i I fff2fffffff:1... A' ''''''fZf:IffIlWWMW 'fffIIfffffIfiffE W 1fIffffiII1IiffffwwwwwwiIfffIfifffffffffiffffflfjffjllljf PAGE ONE HUNDRED-TWENTY-ONE. 'TWH' ' THE TATTLER - .. . Y ... ...,.. W.m....-.-. TRI-STATE TOURNAMENT February 13. The Tri-State Tournament was held at Cincinnati University. Any teams from Indiana, Kentucky and Ohio schools were eligible to enter. The Red and Black won their first three games as follows: 1 East Night High CCincinnatiJ S, L. H. S. 27. Waynesville, Ohio, 103 L. H. S. 35. Hughes No. 2 fCincinnatiJ 4g L. H. S. 12. The fourth game was with Bellpoint High School of '-Delaware, Ohio. This team had won the Tri-State the year before, and had won fifty-two consecutive victories of scheduled games in the last two seasons. The first half ended with L. H. S. in the lead 11 to 4. During the second half, sBellpoint pulled up and passed L. H. S. at 15 to 14. In the last few -minutes the Red and Blacks scored one field goal, then stalled to the end, winning 16 to 15. Our fifth game was with Aurora, Indiana, in the semi-finals. The Red and gBlacks were considerably tired out by the four previous games. The Aurora boys were unusually hot on baskets, and the first half ended 8 to 6 in their favor. With but a half minute to play, the Red and Blacks called time out with the score 14 to 12 in favor of Aurora. The timekeeper did not heed the whistle for time out, and ended the game a half minute later, thus keeping us from one half minute of battle for a victory. After the tournament, Don Wissinger was chosen as all Tri-State center. In the final game of the tourney, Moravia defeated Aurora, 29 to 21. SECTIONAL TOURNAMENT AT ROYAL CENTRE March 6 and 7 Galveston 23 Logansport 25 In the first half Galveston gained a lead, the score standing 10 to 9 in their favor at the half. In the second half the score was always close, and when the final gun was fired the score was 21 all. In the overtime the Red and Blacks were considerably tired out by the four previous games. their opponents. . New Waverly 23 Logansport 32 With very little better form than they had been showing, the Red and Blacks won a non-exciting victory over the small town five. New Waverly was forced to shoot long shots a great deal of the time. Near the end of the game Wiss was put out with a sprained ankle, which kept him from the two remaining games of the tournament. Walton 15. Logansport 25. Walton, the conquerors of Royal Centre, were only slightly better than New Waverly. It was a fairly fast game, but the passing was poor on both sides. The score was 15 to 8 at the half. PAGE ONE HUNDRED-TVVENTY-TWO ' 2-v-azx-.xwvg 'I 'pw-1 THE TATTLER lll ' ll 4 'll ll ' l 'l 'l l 'l '!' '!l'!'!! !l!!f'!!!!!!!H'!!!El'!!!!!!!!!!!!!l!!!!!!H!!!!!!!l!!!!!!!!F!!!!!!!!!!!!!!E!!!!!f!F!!!!!!l!U!!!!ll!!!!!!l!!!!!!!f?!!!!!!!l!!!!!!lI!!!!!!fl!!!!!!1I!!!!!!33!!!!!l!P!!!!!l3?!!!!ll?!!!!!!fHH!!!3!!!!!!!!?!!!!!l?!!!!!!!ll!!!!!ll!!!!!!!E ,.... ,, ..... !Yl?!!!!!!l!! Young America 19. Logansport 23. Our third consecutive sectional championship was gained when we defeated the Young America five in the finals by a score of 23 to 19. Don Wissinger was unable to play, but his position was filled by Hazel, who play- ed an excellent game for his experience. At the end of the half L. H. S. led by 16 to 11, due to an excellent brand of basketball, with every man on his toes and working his best, L. H. S. kept their lead and drew away to a four-point lead at the final gun. On to Kokomo! REGIONAL TOURNAMENT At Kokomo, March 14. North Manchester 20 Logansport 29. Our conquerors at the State last year' were our first opponents in the regional. North Manchester was a good tournament team, and their oppo- sition made the first half very close, it ended 14 to 13 in our favor. In the second half the Red and Blacks showed better form and, with an air-tight defense, gradually pulled into the lead. The game ended with L. H. S. nine points ahead. ' Kokomo 19. Logansport 16. The game with Kokomo was our final game of the season. It was hard fought, with each team holding the lead at different times. The half ended 12 to 7 in favor of Kokomo, but in the second half, L. H. S. once more forged ahead. By a desperate rally Kokomo finally gained the lead and held it until the gun ended the game. ef . :jf A F 'X f 'Lf ,,,,, ,,,, , ,,.. ,.,,,, , , ,,... , ,,,.., ,, ,,,,, ,, ,,,,,..,, . ..,... ...,.,..... .... . .. .,,. ... .,..... L ,,,.. .. .,.. . ,,,,.. -,.... ,.... ..,... .. ...... .. .... a...... ,..... .. ...... .. ....,,....,,,, ....... ,....... - ........ ........ . .... ................ ..,. ,... -. ..... .,,,,--.ll,---44 - ----.4l----- - 4 w ,------l--v-- 44l-4v-- ---v 4--4vl4---44- ,,--- 4 r l.---- A r ---N l,,--. . A - - . . 1 wmm11 PAGE ONE HUNDRED-TWENTY- THREE. Q! E gs 5: s- 53 E5 2:5 i is 5 E E i 1 E 5 E i i i E i e E 5s 5 ! 2 i i'E H E 3. THE TATTLER Eiiiiiiiiiiiii3iiiiii3iiiiii33Eiiii3Eiiiiii3iii!!!3iiiiili3iii!!!Eriiifl3Eiiiiii33iiili311iiiif3riiiif33iii!!33iii!!!W1iiiili1ESi!!!111iii!!33EiiiiiW3iii!!313iii!!33iii!!333iiiii31Wiiiii3iii!!!1iiiiu1fiiiiii3fiiil33iii!!3iiiiii33riiii33EiiiiiW1Wiiiii33EiiiiiEiEiiiii3iiiiiiiiiiiiiiliHiiiii5iiiiiiEEiiiiiEE3iiiiiiiWiiNiliiiiiiii1iiiiiiiiiiiii'i5fiiii5iliiiiiiFiiiiiiWi'iN1iii?i1Fiiiiii1511iiiiiiii5Piiii1WiWiii'iiiiifiiiiiWiiiiiiiiiiiii1iiiiiiiiiiiiiiiiiiiiiiViiiN1iiiiiliiiiiiiiiiiiim: 2 E 5..:e!!diiiH!!i!!i!i'fiiiiiifiiiiiu1 iiiiiii!i!i1r!ii!'lliiiii141iii!iUWH'11f!!!'13EEE!!!51!!!iiEii!iiir!!iiW!i!i+1 ! ifiiii!i+EW1EiiiimiiiiifbiiiiiiiiiiiitE5P!!Wiiii!11'iw'IDEERi!ii!!i11riiiiiiiiiiii!'!!i!i'I!!!iEEE!i!i?!!!i!iiiHEEWEQEEEHEiiii!1iEEiiiiW!!iiiWNEWW!!wi!!!1Eiiiiif1riiiii'riiiiiiiiiiiii1Wiii4fiiii!1EQiiiiiwiiiifiiiil'Wiivffiiiii' iii41i'!!!iNHHH'NN'HHN'iiiiiiiii'H1'HiiifiiiulN'ui'NNUH 'Wi'ii 4iiiiiifiiiii'iEfi!ii5'E5 PAGE ONE HUINDRED-TXVENTY-FOUR. Es E E1 E E E --n E Ex I ...T TATTLEB. . ll ll 1 nuiiiinummniiiiuniiiismiiiilmiiiimyiiiiiniiiiiluiiiimiiiiiiniiiiviniii:nwiimmiiiinuiiinwiiiuvHiiuniiiiiiliiiiiiumiiinlwulllmulmm in ll in ii ll l i l uumim ii L. H. S. Secon Team Personnel-First Row, Lyons, Evans, Coach Wells, McCarnes, Williams. Second Row, Vernon, Benson. llack Row, Johnson, Carter, Talbot, Tucker, Reid. Never has Logan High had such a record breaking second team as in the year just past. It was composed of ten players, one as good as an- other. This made them fight hard to keep their positions on the team, and consequently they improved during the season, beyond all expectation. Each of the ten boys was a good fighter and above the average in basket-shooting. It was their splendid opposition and willingness to rough it with larger and heavier players that made the first team what it Was, for the two squads played practice games together every night. ln contests with other schools the seconds beat the average first team, and was generally accorded the honor of being one of the two best reserve teams in the state. The team stands as a good example of Wells' coaching. Their record is 15 victories and 4 losses. Chief among their victims are the Lebanon and Rochester seconds, and the first teams of Onward, Deer Creek, Bringhurst, Luce1'ne, Washington Township and New Waverly. i in iiiiiniiiinruiimwuunnwu mlmnumiiuwiiiivmiiinmiiiiimiiiirinmmwmummun 1iiwwiiimi1ii1iinii11i..1111iMiiiinimuiwwnllmm wimmmu-wifuiyviinmwww lmwwvm mmuni AGE ONE HUNDRED-TNVICNTY-F.IYE. Milli- Juli: i??'1ii-wi -'iiilillillElm-i-1iiiiiiiufiiiiiiiiiiiriiiiiliiiiiiiiiini.iiiill:GilliWiliiiiiiiillIiiiiiiliiiiiiiiiilliiiiiiiiiiiiiiiiiiiliviiiiiliiiiiiii Girls' Basket all Cfeam Personell-First Row-Helen Shull and Emma Neff. Second Row- Jane Winfield, Gene Moore fCoachJ, and Harriett Ketterman. Third Row -Amelia Reuter fCaptainJ, Mary Barnett and Frances Redinger. This season has marked the third year of organized basketball for girls. The teams were formed according to the classes and practiced during gym periods. All games were played out of school hours. In the tourna- ments held, the Senior team beat both the Junior and Sophomore squads twiceg thereby winning' the championship. The girls are to receive mono- grams for their work. l 4 i i iiii,uiwunimnummunwviuiimiwmuiw nmiiiIniiiirllimlllwmllnmimmllumllluniiiiliiillliginiifilmiirunlllgli!liilying3nip:iiigilljW11lgilmriiiiiirllillrlllllllillllilllulllllvigiliililyii1lulliilllillrilijlllggllll iggi3illllliilliiliiniiilllgli PAGE ONE HUNDRED-TYVENTY-SIX ii 52' E 'uiiilt 5.1 I E 521 E. if 51 E5- if E5 :El E. El l 1 E vi KE? E . g. EE iss PP44 THE TATTLER gglviilgignllgwvynyiigli uwmmmn uw n u l mpmvugyi3irnggiiynnggwiilrnnqii3uiglivi:mpuglyiiivuxziiivvuuviiifum3immifiuunvvgivygigiiisulgiijginiggiviggliivvvlggggiiiimg!ivvmyggiviiuugiyiilgulgyiiifnwluiiimnlivn mnnimu InvggggirijvmyI1QyryiuvvgpggI3Wuygygivxgnuivggnmlgggnimnuiivnnvvgumfipmuivhilauumrg, L. H. S. Cfrac Cl'c-:am iii f-- 1 E! if The 1925 track squad was mainly composed of letter men of two years' experience. These were Captain Nelson, miles and half miles, Pettit high and broad jumper, shot putter and sprinterg Digan, hurdler and broad jumperg Wessinger, vaulter and hurdlerg and Ross, quarter miler. There were many others out who showed promise of becoming valuable 5-1 il men. The schedule follows: Fl Inter-class Meet-Seniors won 135 of 165 points. ' At F1'2ll'lkfO1't--F1'2ll'lkf01't 563 L. H. S. 43. .Ep At Rochester fQuadrangularJ Rochester 673 L. ll. S. 48. At Monticello-Monticello 49, L. H. S. 50. Wabash Valley-L. H. S. placed fifth with 6 2-7 points. ' District Meet-L. H. S. placed fourth with 19',fQ points. Nelson, Pettit and Wissinger qualified for the State Meet. Those winning lette1's are Nelson, Pettit, Wissinger, Carney, Digan, Hubretz, and Erb. Pettit was high point man with 53g Nelson second with 353 and Di- ff gan third with 28. .Ei i?GmmlliliflfQi'i,,Y ,,,, W ijQ'w , . . ,,.. . .. .. .. .... ..... ........................ .................................... ' ' ' 'iilQ.l!u..ii?l1.2irlflEHliv'rniEX1!i!!ii:i!!iuwlii1rrsi!i1ii?i!s!ffrsi!Hw l+ Il1Huw1HHHwwwwiiiiiiiiiiiiiiiiilgi PAGE ONE HUNDRED-TNVENTY-SEVEN. .-fF.Al!f-f11.k E R ...- - . E Huw 1!!! 'EE!!!!!!'!!''!Y!!!!! 1'!!!!!!!!!!!??!!U!!?!!!!!M!M!!!9W!M!!!E?l!!M!Q!!M!!M!lM!!MM!!M!M!!MM!!!!!T!!...!!!!!'!!!!!!J!!. ...,,............. .......!!!!!ff!!mYff!. ..., . ... - ...A... H gl f-1 5 1924 Trac Season INTERCLASS MEET 1 April 14 s. if ' s The first outdoor affair of the season was held at Riverside Park. r The Juniors, vaunting their colors of green and white, won every first ex- . i i E cept the high hurdles, which went to the Seniors. The scoring was as fol- 2 lows: Juniors 775 Seniors 21, Sophomores 1. From the showing made in the various events, everyone looked forward to a good track season. 5 CASS COUNTY TRACK MEET - , April 21-22 ,L. H. S. and Washington Township were the only entrants in the an- g nual County meet. The Red and Blacks emerged victorious from the two- S . day contest with 50 points to their opponent s 49. A large blue and gold 2 5 banner was awarded the victor of the meet, but the two silver cups for the 1 ! 5 mile and half-mile relays went to Washington Township. Wessinger tied 1 5 5 the pole vault record and Nelson broke the mile and half-mile records. Q ROCHESTER-LOGANSPORT 1 ' April 26 . I Coach lvey's men completely swamped the Wellsmen in the only dual E meet of the season by a score of 65-34. Logansport won only three of the i events, Pettit taking first in the low hurdles and Nelson in the mile and E half-mile. Only fair records were made, with the exception of the two long runs, the time for the 880 being one and three-fifths seconds slower than . 5 the state record. 1 E Q WABASH VALLEY MEET 5 i g May 3 5 Kokomo won the annual Valley Track meet with 46 points, and L. H. l S. was last with 5. These points were scored in the mile run which Nel- 2 son won by a scant two yards, breaking the former record a full second. All i the boys did their utmost, but were outclassed and failed to place. l f DISTRICT TRACK MEET F May 10 Owing to the fact that Logansport was placed in a district with . smaller schools than usual, seven men were able to place and so go to the 5 l 1 Ei state. L. H. S. won the pole vault, mile run, and mile relay and placed sec- ond in the meet with a total of 18 points. I E STATE MEET May 17 5 Of the seven men who went to the state, only one was able to place. 5 3 Nelson took third in his heat of the mile, winning a bronze medal and one- , point for the Red and Black thereby. Logansport tied with five other E schools for ninth place in the meet. I NELSON ELECTED CAPTAIN In recognition of his placing in every track meet of the season and f E winning a point at the state, Eugene Nelson was elected captain of the 1924 I gi 5 i Ei track squad. l . l il l ,, .,,M'v..'q W-InA-pg-up--M-.-,Q-,,-N,-,-W-gn,-,,,,,,,,,,-,,,.,,,.,,,,,,,..,- ,,,..,,,....,,,,....,,,,,..,,,..,,,,,... , ,..,., ,... - ....,..... . ........,...,.....,..... ,. ......,,... . ,.,... . ........... , ......,,....,.,,... . ,....,...... . .,,,,,,,, , ,,,,, ,,,,,,,,,,, , ,,,,,,, , ,,,,,. , ,,,,, ,,,,, ...,,,, -,,.,,,,,.,..- ,,..,.,.. , ..... , ,,,. MM..- .... ,..,. ,...,,.-.- ..... -..., ..... -..-,. .... ...L .... . ......... - ....... -..-........-..-.....-.- .... .,.- ..., -.....-...-...s....-...l PAGE ONE HUNDRED-TWENTY-EIGHT. THE TATTLER Pc-:ntat lon Contest In the annual State Pentathlon Contest, sponsored by the Indiana University, L. H. S. won all but one of the individual championships and all of the team championships. The contest is divided in groups according to weight, and the five athletic events which each entree must perform are apportioned accordingly. The scoring is based upon how well the contest- ant does each event. Alvin Pettit was the high point man in the State, and over five hundred high schools participated. The L is the highest award the school can give to its athletes. To win it, one must do more than meet the requirements of athletic abilityg he must have trained faithfully, worked hard, shown the proper mental attitude and sportsmanship in school as well as in the games, and tried his best to win at all times. It is these high standards that make a letter so valuable, and the possessor of one may well be proud to own it. The ath- letic requirements to win a letter in the three sports are as follows: FOOTBALL-To play in half of the total number of quarters. BASKETBALL-To play in half of the total number of halves. TRACK-To win eleven points in dual meets or the Wabash V alleyg to qualify for the State in a District Meetg or to be on a winning relay team in a District Meet. ' K. PAGE ONE HUNDRED-THIRTY 51 ,, M. .. ,,.,,.,,,,,,.,,,Y ...T.!11.E...Q1',5.l1'.'!..I:.E.B A.,.,.A .. M A,..AA..A ..,A W ,-.-,.immmi ,,AA .,.. - I W-M ,-44,,,,, M ,,,, -,U,1,,,,,,M,..---,..,-...,....--.,--- ...,..,,.. .......,.....M..---M v--- - ---4-,--'-4 '!v--- ------MM----------4---v---N 'W N. a. vi A Q. 1 we - K ? , s P 9 sf, 4 45111: E, I . + X 5 I ' A -A W L. GS, .L 'vgji 0, Agv-'Q ' i f O X Q Nm 0. u c e wr f K K f ' Q, 5 . E ! K ,..- i Xxojvzvx wggjgc U V' W X I Ge o. vx X I X TXDQWXOWSXVWHOY X Q , TQ ' X 1 , . g :K K 5 3 E Q fx 1? 1 1 5 E 5 7 E S S E 5-5 ? 1 Q g - Q, K J yy ' E I X f X 1 -.-K-LL9,f f f N ' X - 'f . - L ' fb' 4 'QYOS iD was xnxcv' Sxvrgyfn a.n,,'rKAov'.'Xx, . 'j F 0 VJ ll 0 Vx Q R '-'-'4 .... PAGE ONE HUNDRED-THIRTY-ONE. isa E!! 525 SE! j-i F3 ez is? li 2: 235 555 555 555 2 2 E LI QS? :gi ' 1 i 2 . E 22 Qi ii ia Q. QE! Ei E55 EEE EEE zis E E 3 2 i 5 ii! Q55 :EE 553 EE Ss! E! lie Es EE gss EE E2 aaa iz: THE TATTLER I55gg!giifiiijjfffjifffjjiiijgiiiiiffffjjjigijiiiiifjwFEQQQJiiiiiiiliiiiiiliGuild1iFiiiiiiiiiiiiiwiiiiilwwiiiiihwiiiuiwriiimuiiiidwimuwwhiiiuwwiiiiuuiiuw1wiiiiiwwniihwsiimuiiiiiiiiiiiii1iiiidiiiniiiiiiiiilliliilii11iiiiiiiiLiiiiilihiiiiidiiiiiliiiiiiiiiiiiiiiiiiiiiiiliifiiiiw1iiiiiliwwiiiilwiiiiiiliiiiiiili11Qiiiiliiiiii1iiiiiilwiiiii1iiiiiii1iiiuiiiiiimiiiiinlwiiiiiwiiiiiillriiifiiiiiiumiiiliiiiiidiiiiiiiliiiiiLiiiii1iiiiMiiiiiiiiiiiiEiiiEuiiiiiiiiiii1iiiiiKiiiiMQE I E55 :El EE EE E2 ESE E5 552 :Ss IEE EE EEE EE .gi ES S2 :SS iii Ei 5? 522 QE! iss E5 :gs .EE EE EE E2 EF1vhliiii1iiiiiiHiiiiil1wiii'11liiiiliiiiiili1l'iiii1? ii1111'iii111'wi111Wil1NW1HHilliiWi155555E11hui111Hifi33Hiiiii13wil!13iiiiiilHiiii1311!iii111ri!!!111iiiii1rftiiill11i!!!4IEiE!!i13HSE!!!11iiiifi3Mil!!!ii!!!iisiiiif1iiiil11Iii!!!1EEii!i!15iii!ii1riiiiiiliiiiiiifliiiillltiiiii1liiiiifIilEEEEE4IEiiiiillEEE!!!PHE!!!iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii5iiiiiilEEEiEMiiiiiiiiiiiiiiiiiiiiiiiiiNHiiw'iiiiiiiiiiiiiiiiiiiiiiiiilPiiii'ii5iiiiiii9iiiiiiiiiiiiiiiiiiiiiiiiiiiiiii PAGE ONE HUNDRED-THIRTY-TVVO Ti . 5x.5,,,fi,. 5 ' -511.5-Haney-51 394151 -5. ,Q - . ' ' f'-Yr 2 .L..-.L..........L.............,.-.....LL...........f1.1!!..!?.3..,,Lf..f?:..'!.'..T.!.:.!?....B..-L.-..L-....-.... Y. L ll E l i i i E 2 E , i Ha of Fame BEST ATHLETE- TYPICAL SENIOR- E 1. Clifford Terry 1. David Hudson i ' 2. Alvin Pettit 2. Eugene Nelson POPULAR BOY- SOHOOL NUISANOE-- 1. Ancil Shaffer 1. Boyd Kendall Z 2. David Hudson 2. Bob Williams 2 POPULAR GIRL- BUNK ARTIST DEGREE- Q 1. Louise Murphy 1. Marian Dunn Q 2. Clara Mehaffie 2. Anci1Shaffer BEAUTIFUL GIRL- BEST DBESSED BOY- g 1. Louise Murphy 1. Charles Patterson 2. Jane Winfield 2. Robert Johnson 1 A HANDSOME BOY- BEST DRESSED GIRL-- 1. David Hudson 1. Clara Mehaffie 2. Clifford Terry 2. Dorothy Meyer s BEST SINGER- BEST ACTOR- 1. Linus Olson 1. Charles Stewart E 2. Vernie Gray 2. Robert David i Q SERVED SCHOOL BEST- POPULAR TEACHER-- . 1. Eugene Nelson 1. A. E. Burke 2. Charles Watts 2. Baird Cox 2 - E 5 is i 5 5 PAGE ONE HUNDRED-THIRTY-THREE. - A A T 5 ET E R Jlut apfs , ..., PAGE ONE HUNDRED-THIRTY-FOUR. T H E , H , . , , - u , IN IIllllIllJIlIIHMMIIWMIIIIIMMIMIIHMMIMIIMMIIMMMMMMHMIMMWMIH L. H. S. Calen ar. 19221-1925 SEPTEMBER Monday 8-School opens today. 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 -Organization period. Friday 19-Seniors elect officers and members to the Booster Club. Saturday 20-L. H. S. loses to Noblesville 13-0. Monday 22-Seniors select can- didates for the dlifferent offices on the Tattler Staff. Tuesday 23-Juniors elect class officers and members to the Boost- ers' Club. Wednesday 24-Election of the Tattler Stai. Thursday 25-Tattler Staff holds first meeting and are assigned to duties. Friday 26-Fred Dyer given a lecture by Mr. Burke for writing notes to the girls. 'Big Pep Meeting. Saturday 27-L. H. S. loses to Huntington 18-0. Monday 29-Try outs for bas- ketball team start. Tuesday 30-Cliff Bauman is giv- en a lecture by Miss Flo Shultz for writing notes. OCTOBER Wednesday 1-Miss Adams tells her 12B Chemistry Class why they don't have their lessons, and gives illustration to show it. Mr. Hochhalter breaks up a read- ing party held in the Auditorium by Cliff Bauman, Cliff Terry, and Jerry Rice. Thursday 2-Pete Moss starts out of the window after some pa- pers that blow out, but changes his mind. g Al Pettit, Jerry Rice, and Merrill Miller are given lectures consecu- tively by Miss Rathfon in 204. Friday 3-Some one shuts the office door and Mr. Mitchell. Mr. Burke, and several students are locked in. Saturday 4-L. H. S. loses to Monticello 12-3. Sunday 5-Wayne Carson breaks his leg, but they postpone the shooting. Monday 6-Mr. Jones: fcalling the rolljz Roger Parker. R. Parker: I'm absent. Tuesday 7-Vernon Helton sent to the office from 203 for causing too much disturbance. W0dll0Sd3y 8-Miss McConnell wants to know if Melvin Ketter- man's watch is a Water Berry. . Thursday 9-E. Nelson still writ- ing love poems to Gladys G. Friday 10-Everybody interest- ed in the world series. Saturday 11-L. H. S. loses to S. S. Ft. Wayne 13-7. -Monday 13-Miss Flo Shultz gives her 203 assembly a lecture on Why there are so many fail- ures. Tuesday 14-Ella Brenner's corn crop is destroyed when some one steps on his foot. Wednesday 15-School dismissed early on account of teachers going to Indianapolis. 16-17-Vacation. Saturday 18-L. H. S. beats the Deaf and Dumb School of Indiana- polis 19-10. Monday 20-Miss Manders, in Latin class, as bell rings: Now will you boys please come up and trans- late the blackboard Y Tuesday 21-Earl Robertson kills a cat. Seven years bad luck. Wednesday 22-Tattler Staff gives frolic in Auditorium. Thursday 23-Tattler sales open. Friday 24-Big pep meeting and garade to celebrate home-coming ay. Saturday 25-L. H. S. beats Ko- komo 19-7. Monday 27-Everybody happy over Saturday's results. PAGE ONE HUNDRED-THIRTY-FIVE. .-.nz 'WWVYV 4' ! l' ''' '''HiiFiiniiiiiii' '''''' ''' F'''mmmmmm'' 'M'''' 'mm' ''''''' 'iimTiiinTiiii'mmmmm1'''' ii'mimmm ' M'' ''mmm'' iiiwTniiiiiiHWii'mmm''iNRiiiiidiiiiiiiiiiiiiiiimiiiimiiiiiiiiiii'' '''1iiilliii1iiMiiiiMHiiiMiiiEiiiiiIHEiiDiiii1IEii1iiE1iiiiiiiiiliiiiliiiiliiiilmiii Tuesday 28-Kate rBahr has ex- plosion in Chemistry with hydro- gen. Someone nearly drives us out with the fumes of burning sulphur. Wednesday 29-Girl Reserves give a Hallowe'en party in High School for the girls. Thursday 30-T h i n g s going along nicely. Friday 31-Hallowe'en. NOVEMBER Saurday 1-L. H. S. loses to Wa- bash 16-0. Monday 3-Miss Rathfon: Give a sentence using the word egotism, which means vanity. Ruth Newcomb: The girl dropped her egotism case. Tuesday 4-Everybody in Civics class votes today. Wednesday 5-Ella Brenner elected assistant yell leader. Edna M. Hurst wants to know if you study in Algebra. Al Pettit wants to know how to leave a kiss in a cup. Thursday 6-Miss Shultz fin College Algebra Classh: Is there any question about these prob- lems ? E. Denham: Yes, how do you get them? I Friday 7-Louise Murphy fin Tattler Meetingj : Oh, its going to cyclone! . Walton 4, L. H. S. 21. Saturday 8-L. H. S. 16, Leba- non O. b Monday 10-Gladys Grube fin historyl: The form of industry in the South before the Civil War was Aristocratic. Tuesday 11-College f Algebra class learns that their problems are puzzles, but they already knew that. Wednesday 12-Miss Adams fin 12B Chemistry Classl: Name some crystalline substance. Quincy Porter: Miss Adams: Everest '? Kat Bahr: In California. Pepper Where is Mt. Thursday 13-R. Fields Cin His- toryl : Rome was destroyed by an explosion of the V aticanf' Friday 14-Beat Royal Center 50-16. Saturday 15-L. H. S. beats Crawfordsville 7-6. Monday 17--First snow. L. H. S. like an ice house instead of a school house. Charlie Watts in College Alge- brajz I have been substituting all day. Tuesday 18-Quincy Porter dec- orates the Chemistry room with bone black. J. Digan says that a diagonal is the dimension from one place to an- other. Wednesday 19--Miss Flo Shultz gives D. Powell a special invitation to stop talking. Thursday 20-A new law ap- pears in 203 about putting paper in desks. Al Pettit, in chemistry, says that water is wet. Friday 21-Pete Moss has lunch on hail that came in the window in Miss Schultz's College Algebra Class. L. H. S. 24, Young America 21. Monday 24-Miss Schultz: M. Medland, what is the trouble? M. Medland: I can't see. No wonder, E. Nelson was ob- structing the view. Tuesday 25-Tagged for Thanks- giving donations. Wednesday 26-Much rejoicing and sorrow. Report cards come Ollt. L. H. S. 56, Delphi 28. Thursday 27-Thanksgiving. Friday 28-Vacation. L. H. S. 46, Montmorenci 16. DECEMBER 1' 1, 2, 3 ,4-Extended Thanksgiv- ing Vacation on account of steam pipes breaking. Friday 5-L. H. S. 48, North Manchester 30. Monday 8-Pete Moss offered special seat in front row in Col- PAGE ONE HUNDRED-THIRTY-SIX nmmmmW mml ''''iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiEliiiiiiiEiiiiiiiSiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiliiiiiiiiiiiiiiiMiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiliiiiiiilPiiiiiiGiiiiiiiiiiiiiiEiiiiiMiiiiiiiii1i3iiiiiiiiiiiiiii5iiiiillliiEWiiiiiEliiiiialiliiii1iiiiiiiiiiiiiiiiiiiiiiEiiiiiiiiiiiiiiiiiiiiEiiiiiiiiiiiiiihiiiii:iiiiiiiiiiiiiiiiiiiiiiiiilliiiiiiiiiliiiiiiiiiiiaTiiii1iiii' 'A n ' lege Algebra Class-He didn't ac- cept. School dismissed at 2:15 o'clock to attend Mrs. Mackintosh's funer- al. Tuesday 9-Pete Moss is Miss Adam's new maid, and starts in by cleaning up the table. Wednesday 10-We hear a very interesting talk in auditorium to- day. The Reverend Mr. Preston tells us about a dream that he had -a dream of two worlds. Thursday 11-M. Baade fin his- toryh 2 The Indian wars were very desecrating to the country. Friday 12-203 is entertained in the fourth period today by the yells from the Junior High's pep meet- ing held in the auditorium. Monday 15-Tickets for Roches- te game go like hot cakes today. Anybody else want one? Tuesday 16-Miss M. Schultz threatens to muzzle D. Hudson be- cause he talks too much and doesn't mean what he says. Wednesday 17--Pete Moss's of- fice hours are from 8:15 to 8:30. They went into effect today upon special request from Mr. Mitchell. Thursday 18-W. Robertson gets so interested in his College Algebra that he falls asleep and is Wakened by his book's dropping on the floor. Friday 19-School dismissed carly. T.. H. S. 22, Rochester 23. Tuesday 30-Those absent today on account of the dance last night -beware! Wednesday 31-Things running smoothly. JANUARY Thursday 1-New Year's Day. No school. Friday 2-L. Murphy tries walk- ing on one foot, but she doesn't get very far. L. H. S. 20, Rochester 28. Monday 5-D. Scales fin Eng- lishlz Holmes is a very proiii- gate and amusing Writer. Tuesday 6-Miss M. Shultz on the war path about cheap literature and cheap amusements. Wednesday 7-Notices that the Tattler sales close in one week are seen on the black boards. Thursday 8-One Week of 1925 gone! How many New Year's reso- lutions have been broken? Friday 9-This day should be christened Test Day because of the number of tests given. L. H. S. 22, Kokomo 56. Later forfeited 2-0 in our favor. Saturday 10-L. H. S. 44, Leba- non 26. Monday 12-D. Hudson is given a notice to shift his attention from the girls and erase the board in College Algebra. Tuesday 13-The Tattler Staff members canvassed the whole school for sale of Tattlers today. Wednesday 14--Tattler sales close today. Thursday 15-Pete Moss is giv- en an invitation to join the rest of the class. He has been sitting by the door looking at the class across the hall. Friday 16-Signed up in classes for the new term this afternoon. L. H. S. 43. Huntington 30. Saturday 17-L. H. S. 23, S. S. Ft. Wayne 18. .Mllllday 19-Second semester be- gms. Tuesday 20-Things going on as usual. Wednesday 21-R. Quillen, Cto Mr. Coxl : I suppose you will miss my face in your class '? Mr. Cox: Yes, and your hot air too. - Thursday 22-R. Newcomb, tin Chemistry': In the stomach starch is changed to cane sugar and cane sugar to sugar cane. Friday 23-L. H. S. 44. Craw- fordsville 24. Saturday 24-L. H. S. 26,:Bloom- ington 27. Monday 26-Miss F. Shultz takes a contract to patch the holes in the walls of 203. She received her ma- WW' W'!'F'E'WF!!P!!!!E!WL!!!!!W!F!!!!!!B!!!!!!Rl!!!!!Bl!!!!!WEME!W!M!E!M!!EWH'El!E !!E!!!!El!!!E!! J!!II!E!!!M! !!!!E!U!E!M!M!!M!MM ,,...............,,..................................................... PAGE ONE HUNDRED-THIRTY-SEVEN. HlIIIIll'IIIIIl'W'I'IIW''WII'llV'''''W'''W'''''''l''''''ll!!!!!!!!lI!!!!!!ll!!!!!lli l '''1E!!!!P!!!E!!Y!!!!!ll!!!!!!E!!!!!!!!!!!!!l!l!!!!Yl!!!!!?!!!!!!!Y!!!!!!l!!!ll!!!!!!!!!!!l'?!!!!! 1' , HE ...T A T T L E R .-.-...,...,,......-.........-...,.. terial from Abe Graff's writing tab- let. Tuesday 27-Miss Schwalm, in 12A English: Has anyone ever read a poem in which noses were described ? M. Schvvalm: Do you remem- ber the name of it ? E. Nelson: Yes, it was one I wrote myself. Wednesday 28-G. Cates Q in Eco- nomicsl : Congress is divided into civilized, half-civilized, and sav- age. Thursday 29-Miss Adams fin 12A Chemistryl : Where is a good place for a chlorine plant 7 P. Moss: By the Dead Sea. Miss Adams: Why would that be a good place '? D. Alber: Because it wouldn't kill anyone there. Friday 30-L. H. S. 41, Columbus 39. FEBRUARY Monday 2-Mr. Lieurance, the great composer of Indian songs, gives a concert in the Auditorium. Tuesday 3-M. -Medland: An interval in music is the distance on the keyboard from one piano to the next. Wednesday 4-J. Digan fin 12A Englishj : I like the familiar es- say better than the unfamiliar es- say. . Thursday 5-Teacher: What do you place after an interrogative sentence? Student: An irrigation point. Friday 6-L. H. S. 28, Anderson 42. Monday 9-Miss Ice back after a spell of sickness. Tuesday 10-I Rehm in Eco- nomics, answering a question on a test, says that Laissez Faire -is a fair held during medieval times. Wednesday 11-Mr. Burke ob- jects to the harmonious refrains of a mouth harp and takes the instru- ment as a prize. 'I'hnrsday 12-Big pep meeting fourth period to give the team a send off to the Tri-State tourna- ment at Cincinnati. Friday and Saturday 13 and 14- Team at Cincinnati in Tri-State tournament. Monday 16-L. Murphy starts a moving grocery store and already has a stock of catsup and milk. Tuesday 17-Judging by the ans- wers to questions asked them, we conclude that some civics students think quorum is a place to put fish. Wednesday 18-Picture show in auditorium. Thursday 19-Miss Adams: What is a radical ? L. Murphy: It is at the end. Friday 20-L. H. S. 29, South Bend 35. Saturday 21-L. H. S. 44: Koko- mo 40. Monday 23-When did Logans- port become a colony of Great Britain? Mr. Mitchell seems to think it has as he hung out the British fiag. Tuesday 24-L. Murphy still has to have her milk, it seems, as she is carrying a bottle of it around with her today. Wednesday 25-J. Digan gets his sweater dyed blue by a new method of dyeing. Clara Mehaffie was the inventor of the process which involves the fountain pen. Thursday 26-Alice Kramer in Englishlz Emphasis is putting more distress on one word than an- otha-r. Friday 27-D. Gresham, former track star in L. H. S. dies. L. H. S. 23, South Bend 9. MARCH Monday 2-A. Reuter's name ap- pears on the honor roll for the first time in the history of her high school career. Tuesday 3-M. Schuman says that the bow on a hat band is on the right side. Wednesday' 4- Skinny Reid came to school today with his hair marcelled. ... W .. , ,. ..,. .... ' PAGE .ONE HUNDRED-THIRTY-EIGHT i l 149- 'half - ,,,, - ,,,M W ,,,, M ,,,, M ,,,,,4 M ,,,, ,,,,,A,4,,,,,,,,4,,,,,,4,A ,,,,,,, . ,,,,,,, . ,,,,,,, 4,,4,,,,,,,,A,,,,,,n .....,,.,....4 ,.....4 - ....4.,,,....4.,,....4 . ....4. - ....44 . ,,....,,,,..,..,M,...,, ,,,.... ,.........,............4.,.....44,,,....,,. ... Thursday 5-D. Vickers says that there are not more than 2 in 100 idiots running around loose? Friday 6-D. Hudson tries to break up house keeping in Tattler meeting today when he goes over backwards in one of Miss Bevan's perfectly good- chairs. L. H. S. 25, Galveston 22. Saturday 7-L. H. S. wins sec- tional tournament at Royal Center. L. H. S. 34, N. Waverly 25. L. H. S. 25, Walton 15. L. H. S. 23, Y. America 19. Monday 9-P. Moss accounts for a bloody eye by saying the old cow switched her tail while he was milk- ing her, and hit him in the face. Tuesday 10-H. Huntsinger lin Geometryb : Things which are equal to each other are equal to any thing else. Wednesday 11--Miss Rathfon is back after being out since the first of the semester. '1'hursday 12-This space is left open for ventilation. Friday 13-E. Denham says that they raise young pearls in one bed and then transfer them to another where they grow up. Saturday 14-L. H. S. 29, N. Manchester 20. L. H. S. 16, Koko- mo 19. Monday 16-School the same as usual today. Tuesday 17-St. Patrick's day causes many clashes among the dif- ferent shades of green worn. Wednesday 18-W. Carson tries to blow up the chemistry room but the charge isn't heavy enough and so no damage is done. Thursday 19-Miss Adams says Pete Moss is in a state of equili- brium and will soon be out of the field of action. Friday 20-E. Nelson's Gladys leaves today for her home in the South. Monday 23-Let's hope no one in L. H. S. dies on 31d today. Tuesday 24-E. Nelson begins looking for letters. Wednesday 25-Senior class play tryout. Thursday 26-Seniors win bas- ket ball class tourney. Friday 27-Some skippers are caught skipping today. Monday 30-Great excitement! E. Nelson receives a card from Ten- nessee. Tuesday 31-Al Pettit says that one has to move the camera to take a blurred picture. - APRIL Wednesday 1-Banquet for bas- ket ball team given by Girl Re- serves and Hi-Y. Thursday 2-Helen Netcher fin Historyl : Mason and Dixon's line is the equator. Friday 3-E. Denham: The first meeting on this meeting we will have is the minutes of the last meeting read. What kind of lan- guage is that? 3 to 13-Vacation. M0l1day 13-W. Buchanan drinks M. Carney's milk in chemistry class today. Tuesday 14-Pete Moss and Clara Mehaffie spent the after- noon? Wednesday 15-Seniors win in- ter class meet with 134 out of 165 points. Thursday 16-C. Mehaffie wants to know if anyone ever heard a dull thud? Monday 20-G. Ross wasn't quite admitted to the senior girls' meet- ing in 109. Tuesday 21-N. Plotner attends school after everyone else has gone honee in the afternoon. Wednesday 22- All High School Night dress rehearsal. AGE ONE HUNDRED-THIRTY-NINE. 4, y 1 1 I i I 1 if 5. 91 A i F 3. Q l 3. 1 ,-Amit - ni-1 4 -1 'W' ' 'Wa M11 1555?-3f ' W ' 'NQWWTI F , ,,,,,, , ,,,,,4 ,,,,.4 , ,,. 4,4 ,M,A . ,,,A.A - ,,,,..,,, ,,,.N,,, , N,....,.....A,,... - ,.,..4 - ., .4 , ,.,. .!'..!,!..!'Q-3.,.,,u,,,,..'1,,3..f!'..,.!k...!2..!.E .n.A - ...A M. ... .A. . .. n .. .M44 .... ,... Jlc nowledqemc-:ni The Tattler Staff is deeply indebted to certain persons for the help which they have so willingly given and wishes to devote this space to them as some slight token of appreciation. t Keith Shull's whole-hearted willingness to assist .should be a stand- ard for L. H. S. students. Even though he came from Kokomo this year and was an underclassman, still he worked faithfully in the advertising line and proved to be a boy of sterling worth. - f Glen Ross and Wallace Buchanan also aided the Staff in its work. Glen not only sold advertising but also contributed quite a number of ar- ticles to be published. Wallace, another of the newcomers of this year, aid- ed materially in collecting copy for advertisements. Both of these boys were engaged in work in various other organizations at the same time, so their work for the Tattler shows their unselfish spirit. Concerning the co-operative spirit, enthusiasm, and the work of the printer, Mr. Peter T. Hendricks, too much cannot be said. The success of this volume is in a great measure due to his efforts. The Staff appreciates everything he has done. ' THE TATTLER STAFF OF 1925. PAGE ONE HUNDRED-FORTY Y YW 5 . IQ X7 A 1 N A 5 E , L! 5 s Ev . 14 a -1 I4 fl -G 2 i 5 i 'a 5 x ., Q 5 2 11 LTI'-W' 'Aff .1 , mmf I-Eswvha-'xv' ics: P!xilI41ul'AliKS :1El 1 l!.:11Ds9Zux14 .'43lLL'lW'.ALzIY T H E T A T T L E.B....- ., ., . .,--..,-l,.-- More Power More Pep Wabash Valley Uil Company SERVICE STATIONS Fifth and North Streets Sixth and Michigan Avenue The Home of Wavolene Gas and Lubricating Oil PHONE 535 More Miles Less Gas Prof.- Name a parasite. Lazy Student- Me Prof.-- Yes, but name another. J. Digan- I never Wear straw hats because they always make me sleepy. Clerk- HoW's that ? J. D.- Every time I hit the hay I fall asleep. How do bees dispose of their honey? They sell it. Best wishes for the Class of '25 from The Pllaros-Tribune Logansport's Home Newspaper Circulation of Nearly 11,000 Copies Daily The daily circulation of the Pharos-Tribune in the city of Logansport is greater than the number of homes. l ...-- .... . ..-.-. .. . .---. ....--......i.. 2 'TVIW - ' X 'W A1 J. Olson J. L. Olson Elmer F. Olson J. L. OLSON 8: SONS ' Manufacturers and Erectors of S. 16 0. Rotary Ball Bearing Ventilntors Sheet metal and Copper Work of all descriptions-Slate and Tile Roofing, Warm Air Furnaces-Hot Air Heat- ing and Ventilating 'l'elephones:814-Res. 1208 or 376-K E24 East Market Street Logansport, Ind. iii ! . 5? Compliments of THE CITY NEWS CO. 'Books, Periodicals and Magazines 303 East Market Phone 27 3 ly W i l Marian Smith- Father has never spoken a hasty Word to mother. i I Marian Baade- How's that ? Marian Smith- He stutters ! 1 1 l Mary had a swarm of bees, l 3 She nursed them tenderly And every where that Mary went ' . E ! i The bees were sure to be. A l They tho't so much of Mary I In fact they'd risk their lives I To stick right close to Mary, 4' For Mary had the hives. Evangeline E.: Dad, I wish a crimp. you Wouldn't call my permanent wave T Mr. Elpers: Beg pardon, the crimp is in my pocket book. Joe Vivian: It says here, that a person is never hungry, when he is asleep. Bud Tubbertyi Then you should never be sleepy. y 5 Loraine Helt: Only three more Weeks in which to Watch Clara jg pick lint off Bus's shoulder. Marian Baadee: Say, there is sand in this butter. l Mr. Kimbrough: Yes'm. That is to keep the butter from sliding off the bread. l I s .lenkines 81 .lenkines Lawyers i gs i is 7-el--Y-'ff '- 1 5 5-3 I EARL F. GUTHRIE Drug and Soda I 114 Burlington Ave. rum 338 ! i I WIIIUWI HU W' ' ' ' '!!!!,l!!l!!l!!!l! E!!!!!!!!!!!!!f?!!!! ..... !!!!!??H!!!...!!!.'!!!!!!!.,!'!!.,, ..... ,,,.....,,...E!!E!i!!!!H!T.!!!!!!!!!!!! , ,yy . Wvv 3-1 V 7-fr' 1- ru Logansport Oxygen Co. Manufacturers of Oxygen and Acetylene for Cutting and Welding Purposes Distilled Water Carbide for Sale PERSHING FLOWERS Prominent L.H. S.Athlete Attempts Suicide I ALLEN CPETEJ MOSS, CHEMISTRY STUDENT ATTEMPTS TO END CAREER BY USING SULPHURIC ACID. Only the Slight Mistake of Adminstering the Poison on the Back of His Neck Instead of Internally, Saves Him From an Untimely End. - The first sign of the tragedy was when Allen Moss, frantically clutch- ing'the back of his neck, rushed mad- ly into the chemistry laboratory emitting wild, blood curdling screams of Oh, Miss Adams, Miss Aduuums! I got acid down my neck! Frighten- ed out of her usual calm. Miss Adams dashed to the scene of action, and upon ascertaining the nature of the disaster, speedily gave advice as to the remedy. Wash it off, she commanded, Get cold water and wash it off. Still uttering unearthly yells and throwing his collar on the iioor, his tie in the sink, Pete turned on the tire injured member under the icy torrent. In an amazing short period of time the torturing pains had decreased, uncicil the victim could allow medical ai . Soon he had recovered to the ex-- tent that he resumed his neckwear, and retired from the scene of action. not seriously injured but badly shaken. As yet, no clue has been found as to how he got the sulphuric acid down the back of his neck, but extensive investigations are being carried on, and it is believed that soon some mo- 'tive will be determined for the vic- cold water faucet, and thrust the en- itim's action. HONESTY AND TRUTH IS POWER Our Chain Stores Have Grown Fast ii fl B Q 5 E El Ex 5 3 gl i I E E 5 Dr. D. C. Watts DENTIST Q ,L ,af rv YE B. and B. SFORE - - -- --- - ------Q '41-1 Telephone 253 417 M Broadway unusual. :lt AIS: iililj-W-Y R, -'lm ,,,,,,, v-.-i,,,l-,,..J iU1',,, .,....1m:wmv-use-Jes,....m.ruuvvuunnur.mauvmmi.fiia..umummm4nsnuuuuum I mmm-un-vmu .ts rkq is iii 5 n IIWIF Dr. C. L. NBISOII OSTEOPATH ' REMEMBER 417 I QB d A ma way If It Is For The Home Osteopathy as a profession offers WE H AV E IT an open door to the High School Graduate 418 Market St. Phone 715 1717 The foreman looked him up and down. Are you a mechanic he asked. No, Sorr, was the answer, 'Tm a McCarthy. Mrs. Noah- My dear, what can be the matter with the camel ? Noah- The poor beast has both fieesf' Now, tell us all about it. Why did you steal the purse ? Your Honor, I won't deceive you. I was ill and thought the change would do me good. Whats the matter with that ape ? He sprained his arm. A Oh, I see--a monkey wrench. . Daughter- There, father, I played it all through without the music. Father- I thought something was lacking. Teacher- You seem to be a bright little boy. I suppose you have a good place in your class? Everett Moore- Oh, yes. I sit by the stove. Glenn Ross- Here is a farmer who writes and asks us how to treat sick bees. Mr. Mitchell- Tell him he'd better treat them with respect. I EAT WE'RE FOR YOU I Paragon Candy L H S Produces Rich, Rosy Cheeks I . . . HOME INDUSTRY WM. SPRINKLE AUTO CO. '! !!!!L.!!!!.P!!!EMH!!!!!!Mfff!!!!!!f!!Hll'!!!!fi!!!!H!L.......,, !F!!E!!!EQ!!EQ!L1'i'f'L'!!!f?'El'!!!HF!!!?MM!! ! L-.- ..,.,. .ms ,,,.,,.....A,..,,,A ,...AA.,,,.AA . ,.....A . ...... ,,,AAA .,AA A ,.A. . ,.,.A.,. . .A,,, T L li ,...,, - ,... , F!'!!?Y ! ??T!'l! ! 'l ' !'''W W V '4 'll!F!!lf!!!EY!PY!E! 'll' FEEEE!!!EVE'! 'P!!Y?'i'!!ElUWPEE!!!lfEY!!!!'!ll'!!!''!!'Y!'EF!PY' Il''39P!!!!!F?Y!!!!!!!!!!!!!l'!!! 1'PE!!! f!'!'!'l '!!!!J!!!!!! ' Wm. Grace Clothing Co. Dealers in CLOTHING AND GENTS FURNISHING GOODS 316 Market Street THE CARR CARTAGE COMPANY Parcel Delivery and Baggage Furniture and Piano Moving-Autos for Quick Service-Covered Trucks for Overland Service ' WE INSURE YOUR GOODS Telephone 53 L. J. Carr HOMER C. CLOSSON Wholesale and Retail Dealers in DRUGS, PAINTS, OILS AND VARNISHES 506 Broadway Yes, We Still Have Those Good Tires BAKER SPECIALTY AND SUPPLY COMPANY 701-3-5 ERIE AVENUE Al Pettit fin Historyh- By the Salic law no woman or descendant of a woman could occupy a throne. 'Rastus- How come yo' call yo' gal 'Valspar,' Sarnbo'? Sambo- Cause all the boilin' water in the Worl' aint gwine to turn dat gal white. Mary Barnett- Peg, you sure sling an awful lingo. You should go to London and learn the King's English. Peg Bishop- Oh don't worry, Kidg I know he's English ! Manager- Stop, sir-you can't dance that way in here! Merril Miller- We aint dancing, man, Dorothy's faintedf' Van Raalte Silk Gloves Allen A. Black Cat Hosiery PETER J. DWYER 407 BROADWAY DEPENDAIBLE DRY GOODS For Quality and Service SEE CLOSSON FIRST Phone 1085 Building Lumber Supplies Rooiiing CLOSSON LUMBER C0. NINTH AND ERIE AVE. .. .... .. ....,....... ... ......,,,.... .,... .. . ....,,.... . ..,. - ,... . ,,,,,.,.. . .... .. ..... ...... . , . .....,.,.....,, - ...- ,...,....... ... .,.... ,,-...- ,......,,, .. ..,..,.,.,.. -..- ...... . .... ....,,,,...... , ...... . . ...,, , ...,,,,....,,..,...., .,.. - ............... ,.,.... ,,.,...,,,,,,...,,. , ...,,..... , , . ..., .,...,,,,,..., ,,.., . . . WiEiiIEIEiiiE!!EEiii!9EiEii3EYEiEii!!iiiiEE5IPQiiiiyiiiiiiiiiiiiiiiiiiiiiil ,,... ........ .,.. 'ii iiiiwiii Lake W That Good Servic We Earnestly Soli Your Patronage M '4 Maxinkuckee Ice Co. T H AT FA M O U S That Ice NINETEEN TWENTY-FIVE CHEM- ICAL ANALYSIS PROVES OUR ICE ABSOLUTELY FREE FROM GERMS. WITH THE SUPERIOR ARTICLE WE HARVESTED LAST WINTER WE ARE IN THE MARKET TO FUR- NISH YOU WITH THE BEST ICE TO BE HAD. cit Phone 1 75 That Refrigerate Give Us a Trial '''''M 'iiiiiiiiiEiiiiiiiiiiiilililiiiiwill1wliii3iili'iilii'! 1Ir iiIil!ill'iii1iiiiiiiiPiiiiiiiEiiiiiimiiiiiiiiiiiiiiiliiitiiliiiiiiliiiiwlEiiiiiiiliiiiiiiiliiiii?iiiiiiii N SAVINGS ACCOUNTS Our Savings Department has all the advantages of a regular sav- ings bank, with all the safeguards and restrictions of the National Banking Laws. SAVINGS ACCOUNTS SOLICITED The First National Bank OF LOGANSPORT INDIANA Oldest and Largest PHONE 1900 John M. Etnire Sc Son FURNITURE - RUGS - LINOLEUM Ferguson Block 319-321 MARKET STREET LOGANSPORT, INDIANA WANTED A man to awaken sleepers of a railway track. A hat for the head of a nail. A key to fit an elephant's trunk. A splinter from a sunbeam. A train of cars to run on a branch of a tree. The club with which an idea struck the poet. A ruler to measure narrow escapes. A hook and line with which an angler caught cold. An umbrella used in the reign of tyrants. A knot from the board a man paid fifty dollars a week for. Frazee Dry Goods Conlpany THE STORE OF QUALITY GOODS Emma C. Wefel PARAMOUNT BLOCK PHONE 320 lmlmml 'H I ,,,. ,.4. ...- ,,A,,.. ,,....4.,..... ,.,.AA.......,,. - . ,... ,,..... ...., . .,... . . . - .... ..,.. ..... . , ,.... .- T A T 1' L E R . OUR NEW SOFT WATER PLANT Softens water as soft as rain water. Logansport City wa- ter is 16 grains hardness. It is impossible to do in the laun- dry or at home, the same qual- ity of Work with hard water that can be done with soft wa- ter. CAMP3BELL'S LAUNDRY Dry Cleaning and Pressing What is cold boiled ham? l E. H. LUX Electrician and dealer in Electric Supplies. If I install your Radio Set, it will be Satisfactory 319 PEARL ST. PHONE 1874K Oh, it is just ham boiled in cold Water. ll ll On what grounds ? I'm going to divorce my Wife. i i First fioor of the Municipal Court Building. Virginia B.- I have a cold in my head. Katherine B.- Well, that's something. Alvin- I am a self-made man. Ruth- Who interrupted you? How did Abie, the pawnbroker's son, make his letter ? In hockey, I suppose. I hear your cook quit. Yep, My Swedie went away. Mr. Burke- What was the Sherman act ? ! E. Nelson- Marching through Georgia. We go to school to improve our faculties. Our instructors are our faculties. Therefore, We go to school to improve our instructors, G. Grube Un Historyj- The first concientious Congress met in Philadelphia. Compliments of Logansport Overland Sales Co. Overland and Willys Knight Fine Motor Cars 5th and High Phone 81 iiviiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiSLiQQQQQiiiljiiiiijjiiiiiiiiiirjiiiiili iiiiiiiiiiiiiiQiliiiiiiiiiiiiifiiiiiiiiiiiiiiiiiiiiiiiiiii' The Boston Store 5 Blue Front-Fourth St. Exclusive agents for Harry C. Lee Slotted Throat Ten- nis Rackets and Accessories .... THE TATTLER ..... ..fffQfQf'f' -..- COMPLIMENTS OF Charles D. Chase Flanegin Hardware Conlpany 310 MARKET ST. PHONE 111 Ford- Your engine is coughing badly again. Henry- Shouldn't wonder. I had its muffler off last night. E. Denham Cln Economicsb-The menemployed by the Gas Com- pany go round and speculate the meters. G. Grube fOn a Geometry exam.J-Parallel lines are lines that can never meet until they run together. ' Mr. Burke- What is the Mason and Dixon line ? Stub Wright- It's the equator. The meek may inherit the earth, but the government will collect the inheritance tax. The Seybold Dry Goods Co. This store joins in extending to the graduates of 1925 their sincere hopes for many prosperous years in return for the time and efforts they have expended in the Loagansport schools- Schools that a1'e a credit to our splendid city. lun iliiiiiiliiiiiiiliiiiiiiiliiiiiiiiLiiiiiiliiiiiiiiiiiiiiililiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiilliiiiiilniiiilLiiiiiiiLiiiiiliiiiiiiuiluiiiiiiiiiiiiiiiiiiiiiiLiiiiiiiliiiiiliiiiiiiiiLiiiiiiiiiiiiiillliiiiiiliiiiiiiiiLiiiiiliiiiiiiiilliiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiililiiiiiilliiiiili iiiliiiiilliiiiil Nfl? ' i ...'!I.A T T L E R ...--- .. ..... -. ,... . .. .... - N-. .,.....,..-. . ...... ,. - - r I Ray 8z Arnold M. Graffis 81 Son ! Quality FINE SHOES AND HOSIERY MILK AND BUTTER 313 Fourth Street f At Your Grocer Established 1873 i Mistress- Mary, we will have mutton with caper sauce tonight. Are there any capers in the house? Mary- No mum. Mistress- Then go and cut some. 1 I thought you said this was a double bed. - Well, you have to double up to get into it, don't you ? Harry Grisley-- I thought this was a three-ring circus. Ditto McCall- It is. They ring once to start, once for the band and ! once to quit. Do I hear music? 2 Yes, it's that little snake next door playing her scales. There was a young fellow named Slaon Who thought he could jump o'er a stone. i 'But he landed kerplunk 3 On the back of a skunk, 5 Now he talks to his friends o'er the stone. Where does this place close '? Never, I'll wait. First Golfer- Shall we play another round on Monday? i Second Golfer- Well, I was to be married on Monday, but I can put it off. O I , John Mehaffle I LCIIHOII S 5 SHEET METAL woRKs Barber 511013 Stoves, Ranges, Hardware, Window Where the L. H. S. Athletes keep - in Trim Glass, Kitchen Furniture Across from L. H. S. 217-219 Fifth St. Phone 59 L. R. LENNON, Prop. ' hiiiiii'iiiii'iiiiiii1lmmli lillilllllllllllll NiiMHXiiiiillWiMillilililiilililiiiiiiiiiillilillliliililllllllllillliliillllllllllll!lllilililllilillilllliililiilliillliliillllillillililillllliil!lllllilillflllllllilllllllllllllllilllili1l!!!!!!I!!!!!!!l!!!!!!!l?!!!!!ll!!!!!!!ll!!!!!!ll!!!!!!!l!!!!!!lll!!!!!lI!!!!!!!ll!!!!!!lP!!!!!!ll!!!!!!fll!!!!!53!!!!!! 20 Steps from Broadway For Anything Good in the Jewelry Ee Line. Also High Class Watch Work, Jewelry Repairing SERVICE DRUG STORE Diamonds and Other Stones Mount- 715 N. Third St. Telephone 64 ed at Our Store l I All Work Guaranteed Try the Drug Store First A. A' BAZLER Jeweler 302 Fifth St. A JINGLE Many, many years ago A. wilderness was here: A man with powder in his gun Went out to catch :V1 deer. But now the times have changed somewhat, Along a different plang A dear with powder on her nose Goes out to catch a man. Miss Manders, fin Latin classy Wayne what is a Latin race '? Carson: I guess it's the race between the pupil's pony and the teacher's goat. ' Mr. Hochhalter fin Physicsl : Gas is sort of vapor. We can neither see nor feel it. Harry H.: But, Oh Boy, how we can step on it ! Mr. Burke- What was the She1'man Act ? Francis M.- Marching through Georgia. We go to High School to improve our faculties. Our instructors are our faculties. Therefore we go to school to improve our instructors. 5Bob Dotterer, our remarkably accurate historian, says that any per- son of the white race may become a neutralized citizen of the United States. Leo M. Rogan Phone 33 Compliments of Citizens Coal and G Compliments of Supply Company Hotel Barnett W, L, MORRIS, Seq'y,-Mgy, Mkt. and Second Sts., Logansport ,. wmv MM M- T ii E T A T T L E R I Herbert Greensfelder Hlelvin Greunsfelder Compliments of Cfhompson Lumber Co. GFCCUSIC der BFOS. H. A. Wallace, vice-President Lumber, Lath, Shingles, Sash, Mews and Boys, Doors and Blinds. I OUTFITTERS High Class Mill work 315 MARKET STREET We Appreciate Your Patronage Phone 20 92 Sixth St. I Mr. Anderson fExplaining why he had to have his new car towed inJ g First, the engine made staccato reports, then the car changed keys, and I went on four Hats, and it ended up with a grand pause. I I A. Moss- If two parts of hydrogen and one part of oxygen unite to form water, why isn't it inflammab1e? Miss Adams- Because it's wet. Contributor- What did you think of my last joke? i D. Hudson-'Tm glad to hear it is your last. I I I I Mr. Hochhalter- Irene, give me a definition for horse power. Irene Rehm- Horse power is the distance a horse can carry a pound of water in an hour. i I Why didn't they play cards in Noah's Ark? I dunno. Why ? 'iliecause Noah stood on the deck. Dick Quillen- Have you any work here ? Manager- No, we have no work here. Dick- Could you give me a job ? Teacher- What is an engineer ? R. Erb- A man who runs an engine. Teacher- What is a pioneer ? R. Erb- A man who tunes pianos? Novelty Shoe Store R E M E M B E R Smart Styles for Young , , , Men and Women We have a full line of Spaldings , I Sportmg Goods I We Are Always at Your Service See Our Tennis Rackets and Base I ' Most Reasonable Prices Ball Goods I . SCITIDICF IIloon-Lowe-David Q , . Shoe Store Hardware ' 413 BROADWAY I 518 BROADWAY I I ...W ,, ,, Av, ..,. ,.,,h,,.,...,,,- ,W -- U' W l OWN X ri ff . ' - ,A, ,, YOUR IIIIIIII ,' 445.1 Q an a Y- L, owN it A 1 igliif ' ALL MAKES OF TYPEWRITERS SOLD ON EASY PAYMENTS Lux X Swadener Typewriter Headquarters 219 FOURTH STREET LOGANSPORT PHONE 1449 he Our Own Cross Word Definitions I, A good man in the Bible-Alias. , -- That which is mean-Ameanable. ls A man who says prayers in public-Publican. To make fun of-Irrigate. An idle person-ldolater. EES -Q One who asks questions--Equestrian. '21 Food of the gods-Ammonia. A sinner mentioned in the Bible-Rebublican. The headstone to a grave-Emolument. The state of being an acid-Assiduity. A writer of plays-Plagiarist. Ladies and Misses Exclusive Wearing Apparel COATS, SUITS, DRESSES Hosiery and Millinery THE FAHION SHOP A Delightful Place ln which to Shop Phone 1265 406 Broadway mnlmunnnluwmmxwllllmnlllllmllluulll A. A. Gearheart NEW AND USED FURNITURE 300 North St. Phone 1299 lllllllllluullllaullluxlulmnnmll 66 iiiFiiiiiifiiiiiii3iiii9E5EiiiiEi5iiiiiE5Eiiiiiii!iii5iFiiiE!iiEiiiii5Fiiiiiiiiiiiiiiiiiiiiiifiiiiiiiiiiiiiiliiiiiiiiiiiiiiiffiiiiiliiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiii!!EEiiiiiiiiiiiiiiiiiiliiiiiiiiiiiiliiiiii K I Nl B R O U G H On the High School Corner 97 ,, ..., ,,..,,,iii!ii?iiiiii ls E E Q 1 4 ! H fl E i as ff Em Guide- This desert is God's own country. Tourist- Well, He certainly did His best to discourage trespassers. ' E Bob David- I just bought a suit with two pairs of pants. ig Jim Digan- How do you like it? 3 Bob- Fine, only it is too hot wearing two pairs. Q Have you the right time '? 3 Yes, what do you want it for? 3 Bait Bait ? Q Yes. I am going to catch a train. H ff J C Manufacturing Jewelers and Engravers gg ? 1 :ii I I C E Indianapolis, lncllana 5 OFFICIAL .IEWELERS TO LOGANSPORT HIGH SCHOOL 3 N W, , H- I- .I,. -I -- is QE .E is 5 E 'U' ir' ..A. .......-.f!f..A..f!I ..,4 .,,. EB... ...,.. .,.... ..,u - ,...44 ..- .. ..4 ,. .. .......... The Golden Rule extends TO THE BOYS AND GIRLS OF THE CLASS OF 1925 Congratulations and Best Wishes There is no satisfaction quite like that which comes from the conscientiousness of growth, the reaching of ones mental faculties to do something higher, better and grander. The Golden Rule Schmitt-Kloepfer Company 409-411 Broadway They were conversing on the Darwin theory. He Just think-according to this your grandfather must have been an ape. She That doesn't worry me. He No, but I bet it might have worried your grandmother. A. E. Burke: Say, Stub, why do you always start to school S0 early anymore? ' Stub Wright: Well you see I broke my ink bottle, so I have to go by the post office to fill my fountain pen. Clara Mehaffie: Did you ever read any of Scott's works ? Miss Rathfon: Yes I've read nerly all of them. . Clara: Did you ever read Emulsion ? Ancil Schaffer: I once saw the Mississippi River so high, that you couldn't get within a mile of it. It was high on account of the snow melt- ing on the Alps mountains. Egbert Campbell: I think I am a little crazy today. Mary Virginia: Well, we won't argue about it. Mary Medland: Did you ever find out why a Pussy Willow Runs from Dogwood ? Thelma Graff : Yes, that's easy. Because a Dogwood bark. Mr. Burke: Give me one example of the feudal system. Ethel Stewart: Romeo and J uliet. l Q 2 l l ! l l 5 i l s ! i s I 5 l ! l 1 1 I l E l wi. -'vw I , ....4..... .IiiiiiiiiiiiiiiiEifiiiii5EiiiiiiiEiiiiiiiiE9iiiiiiiiiiiiiWiiii9ifiEiiiEiiiiiiHiiiiiiiiiEiiiiiiii!iiEiiiEiiiiiiiiiiiiiii!EiEliiiiiiiiEEJiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii MOVE STRAIGHT AHEAD You should go right on. Move straight ahead. Keep going until your preparation is finished and you are started successfully in the Work of your choice. If it is a business position you want, it would certainly pay you to attend an active business college. For Budget of Information and full particulars, see, write, or telephone James T. Maher, Manager. Logansport Business College Fourth Street, Between lBroadway and Market LOGANSPORT, INDIANA DeFaun- Do you still love me ? Don- Yes Now shut up and let me study. The fools aren't all dead yet. Nog and the Worst of it is that most of them aren't even sick. Employer- You say you had your last place for three years? Why did you leave? p Applicant- I was pardonedf' Any old cat can be the cat's whiskers, but it takes a Tom Cat to be the cat's paw. Bill- Hear about the honor committee kicking Jack out of college ? Will- No, how in the world did it happen? Bill- Yes, they caught him looking out of the window on the night of the astronomy exam. Ambitious youth- HOW did you become such a Wonderful orator ? Senator- I began by addressing envelopes. Advice to Freshmen- Don't cross at bridge before it is made. Don Vickers- Gosh, you're dumb. Why don't you get an encyclo- pedia 7 Bob Driscoll- The pedals hurt my feet. Manager- Stop, sir-you can't dance that way in here! Merril Miller-- We aint dancing, man, Dorothy's faintedf' I Graf K Schmidt PLUMBING AND HEATING - also - ESTIMATES FURNISHED 325 Pearl Street L0ganSn0rt, Indiana FOR MFN S CORRFCT WEAR . ..... .. , -. :ki 2:l:1:E:2:E:T:!:2:5:2g:g:g:::::::::::: .- - I--.:.1.f.:.:.5.,.y -13 -:::::f:-: . it , . ffEIElfIf1f1EIf'- 232-E-if-E-F-E5-E-E-E-5-E-E-5:5-E-5-E Z: hlnbbu H hW.:..A...A'V.'. 59 ...Ab . .,.,.i......., K' ,-:V:-:-:4:-:-:-:-:-:-:-:i:5:1:1:-:Iii:3:2:?:55:4.mrf5f:I:i:1:3:5f5E5f1E155f1.-f- ''fiE1Eif122f?52E:fiEtE2E1fIE:3:1:i, :-:1:I'?:I:I:1:1:l:f:5:1:5:5:i:C:1:1:1:3:1:PI-I':-:-I-:V:-:-:4:fc-:-5-:-34:-:Az-:-1-1.1-: ' v: : :: : zz: :: : ::':':': TRUNKS TRAVELING BAGS AND SUIT CASEQ Dewenter The Hatter and Furnieher W H Porter 81 Co The Rexall Store Cer 4th and Market Phone 697 Most Up-to-Date SHOE REPAIRING HAT CLEANING and SHINING PARLOR In Logansport E' ' H' 1 I I 1 9 N A x , 4 k i 1 1 I I- L J i 1 , i H H L . ..,. ...,,,..................,.,..,... , ,.,. 4... ,....,. . , . .. ...,.........,, . 2 235232552555252if52552sisfsisgsiziaisfzisiaisi53355Eg5gsgegsgsgagsg2s23s: 1 2 2 f 111 I:5:2:sge555252525555255555ai25535552sisiziaiaisiaisisgzgsgsg I ' i f 2 , 1 t A EEfE2E2i2iiiiESifE3:51, if I :QE 13Ef5f'l'1E-5.31fE ,,s,g55f ',5EQ555QiQiQ5i1 552, ,aiii in-rf.-1.V:E2'?? Q iiiigiiiiigiiifl 333251 z 52525E5E555E555S5E5E5E5E5E5E5E5E5E51' .35 if 322 lf :2:a:5isEzSsEz riiiiiiza ' C dr . a 535 4 94 1 N ! My 5 f E 0 o 0 ' 1? t fo g ' a 5 I 3 f ac rr ,K QR I N wi Q , wx X- Kit : I -5 t -. N1 v: S 1 fx A s 3 A K I A Q M ga, Ig , r x 5 K 2 - .3 It I o 3 . 0 Z is But , Y -, 4 a , QR n v Q 5 Q ,, K W Er I 9 sf Anflre . ws sPoR'r SUIT a i SEE ' ,A 9 31 ey S Ldgest Because Best n n :liibiimiiiibiiw''HW'' fIIIIIfIlffflfllffflllllllfffll 3Eiiiiii3iiiiiiiiiliiiiiiiiiiiiiiiiiiii Work Done While You Wait All Work Guaranteed PGEESEAE inionif 320 Fourth Street. Logansport, Ind. 11!!!!!' gi ll 'W lLMl'lW mlwum . 5 Z Bi E E Bi Si E 5 E, Ei E. g. rr! T H E T A T T I. E R Iliiifjffiiffiiiifiiff'Wiiiiiiiimiiiiiiiiiiliiii '' 'liiiWiidimiiimiimiiiiilimiliiliiiiiliiiiliiliiiiiiiiiiiiiiiiEEiiiiiiiiiiiiii?iiiiiii5EiiiiiiiiiiiiiEiiiiiiiiEiiiiiiiiiiiiiiiFiiiiiiiiiiiiiiiiiiiiliiiiiii When you thing of RED CROSS PHARMACY Books or Music Geo. H. Babcock Think of I Best Quality and Service NEFF'S l PHONE 65 ' 408 Broadway Logansport, Ind. Results of Exams. Romulus obtained the first citizens of Rome by opening a lunatic asylum. There were no Christians among the early Gauls, they were mostly lawyers. The Gorgons were three sisters that looked like women, only more horrible. Edward the Third would have been king of France if his mother had been a man. The Black Death was terrible for the laborers because they were forced to do all the work left by the thousands who died. Benjamin Franklin produced electricity by rubbing cats backwards. A deacon is the lowest kind of a Christian. Andrew Jackson was called Old Hickory because when he was 21 boy, he was a little tough. The Pharisees were good people who liked to show off their goodness by praying in synonyms. An ibex is where you look in the back part of the book when you want to find anything that is printed in the front part of the book. A hyphenated American talks in short sentences. The whole of the United States speaks English except Chicago and New York. Every Day In Every Way 208 People are finding it to their advantage to trade with E. J. VANCE GROCERY Free Delivery Fourteenth St. Phone 22 THE GIFT SHOP Gifts for all occasions Greeting Cards Dennison's Paper and Flower Ma- terial-S t a m p e d Goods-Hem- stitching. 525 Broadway Logansport. Ind. iiiii2iiiiiiiiiiiiiI1diiiEiiiiiiiiiiiiiiiI1liiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii'iiiiiiEiiiiiiiiiiiin'EiiiiiiiiiiiimTsiii5'niiiiiiiiiiiii' iiiiliiiiMiiiiiiiiiiiuiaiiiiiiiiiiiiiiiiiSiiii' 'M ' u 'i ' m m' W i ''''''''M''''''''' M 4 'M 'W' !!H!!ll'!'!!!E!!!!!!!!!!!!!!lE!!! ,,,. !!..,.!!!!!!.El.,,.!!!!!li!!!!!!!?f!!!!!!!l!!!!!'lfll!!'!l?i! THE MORNING PRESS LOANS 10,000 Circulation on Household Goods, Pianos and Just to you Live Stock Fair to all LEGAL LOAN CO. The only sports paper in the city 408W Broadway Phone 1230 A Song For Evolutionists Once in the Miocene jungle, ages and ages ago, Life went along without bungle, far from the ice and the snow: You wore a daphne mantilla and I wore a conifer cape, When you were a gay young gorilla and I was an antliropoid ape. Swinging from trees in the dawning: blissfully sleeping at noon: Withqacacia leaves for an awning: monkeyshines under the moon: We feasted on nuts and vanilla, and never knew sorrow or crapeg When you were a gay young gorilla, and I was an anthropoid ape. Mr. Angermier: Your recitation reminds me of Quebec. Merill Miller: Why so ? Mr. A.: Built on a bluff. Caustic Critic: Gee, but you have a lot of bum jokes in this issue. Editor: Oh, I don't know. I put a bunch of them in the stove and the fire just roared. Miss Ice: I take great pleasure in giving you 81 in English. E. Moore: Oh, make it a hundred and enjoy yourself. Miss F. Shultz: J. D., tell us what the liberty bell is. J. D. Porter: The Liberty Bell is the one that lets us out of class. Buddy: Did your new dress cost you much 'Z Doris: No, only a few sobs. Round Pegs In Square Holes Won't do in our business. When you need workmen to repair plumbing equin- ment, you want to know that they are capable of making repairs that will be lastingly satisfactory. It is not safe to trust the limited skill of the handy man for repairs to plumbing equipment. Call Us For Prompt and Reliable Serviec WM. WHITEHEAD AND SONS Plumbers Phone No. 669 610 Broadway OLD TRAILS Automobile Insurance Ass'n. The Strecker Realty Co. Local Agt. Agents Wanted Boys To Write Insurance Liberal Commission Phone 1740K 322lfg Broadway 5 iiiiiiifuiiiii iii1iHiiiiiiliiiiiMiiiiiiiiilliiiiiiiffiiiiiiii iiiiiiiiiiiiiiiiiiFiiiiiiiili'iiii Wi' ''iiiEliEiiiiiiiiiiiiiliieiiiiiiiriiiiifiiiiiliiiiiii!EEiii!!EEEEiiEEiiiii!Eiiiiiiiiiihiiiilliiiiii EliiiiiiiiEEilliiiiiiiiiiUiiiiEiEiiiiiiEli!iiiiiiiiiiiii!EiEiSiiiiL5iiill1?iiiiiiiiiFf'i?liii?' MEI ..'. T H E T A T T L E R ...I.,.a...,...,m,....m,,....W,......II..a.I,,,.aaI.W II..,,.,,.I, -III, .. I ,III,,..,,,,.w.,.IW ,,...,.I.,,, I .I I I..,IIIf-II.-.m,,..,..,,...I.,-WI. I E N---N -X ,:Q'W?' ff' . E A E xx sQk,,'f?,1 x ' - '42 2 Sm. w' :35 ff ,r :L Q-ibwge-'ef THE MARK Ol-' EXCELLENCE WASH DRAWINGS RETOUCHING PEN DRAWINGS COPPER HALFTONES ZINC HALFTONES ENGRAVED AND 0? gt? MIM 005 agblex ,df w'S'3f- G5 w 'I' Ii! E21 me zmc ETCHINGS coLoR ENGRAVINGS Emaossms mfs E LECTROTYPES N ICKELTYPES STATIONERY A asf . azfne ffzyravzh . FORT WAYNE ,INDIAN IE! 15 PERSONAL SERVICE f- CNVE WORK 112 0l'SOIl I I l 7' v . . 'M ,'r , 'I , II f',,7' 579 Qafqf? A W' .,1,,2, fri! f '.' 'fl ,. I I 1 fvnn' E ' 'WQELA 'N an ,4 11 ' 0734 0 1 , I. 0, , I F I' ,'l fygfab ' J I . X All Lhfgzw WITH 'rm-3. TAFF ,cg I 0. , A - uiuIIiiiiilIIi ' 'IrinilIIInnIIIunIIIIrgmIIniiuIIImglIIIInIIIIIumIIIiinIIIIIu4IIIIguwqIIIviI4IIII I IIIIIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIHII T H E T A T T L E R lliiiiiiilliiiiillliiiiilliiiiiilliiiiiiiiiiiiiiiiliiiiiiliiiiiiiliiiiiiiliiiiiiliiiiiiiiiiiiiiiiiEiiiili3Eiiiiiiiiiiiiii3liiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiliiiiiiiiiiiiii3liiiiliiiiiiii3iiiiili.,.........,....., .... Compliments from your old friend Carroll J. Nelson The 0' K' Stine CLASSY PRESS SHOP Fred L. Baker, Prop. . Cleaning Cleaner and Tailor and . Pressing k f ' ' 1 Wor Called or and Delivered L. H. S. ,ZL Phone 1166K Phone 1884 512 E. Broadway 222 Third Street Cheese: Oh! Bill and Mary are married I Crackers: No! Why I didn't know that they were even acquaint- ed. Cheese: Yes, they got caught in the revolving doors at Seybold's and started going around together. l - Ruth: A penny for your tho'ts. A' Al: I was thinking of going. . Her father fat the head of the stairsl Give him a dollar: its worth it. Curly: Who'S your cook now ? ' Bob: Della, Curly: Della who ? Bob: Della Katessanf' Judge: You are accused of stealing Swords and fencing foils from .he pawnshop-I suppose you will tell me you did it because you were hun- gry.H Accused: Yes, your honor, I'm de sword swallower at de circus. Neva: Were you hurt while on the eleven? Pete: No, while the eleven were on me. He: What is the best cure for love at first sight ? Him: Take another look. New Home of Sellers Clothing Company 412-414 Market Street MEN'S AND BOYS' FURNISHINGS CLOTHING SHOES 1 v Y , WA, ,,,, -Ar--m ., 1 .. .,.,.,...4.....-,...i....g , Star Laundry DRY CLEANING-PRESSING It's New When We're Through 258 Phones 2370 210, 212, 214 SIXTH STREET Ben Martin 8 Son JEWELERS Satisfaction Since 1887 QUALITY AND SERVICE Our New Location 325 Market Street George W. Cann 8: Co. ELECTRIC WIRING and SUPPLIES Agents for ROYAL VACUUM CLEANERS EASY VACUUM WASHERS AUTOMATIC ELECTRIC WASHERS 313 Market Street Lincoln Phone 454 FORD Over 8,000,000 In Service Today Wherever a wheel finds traction there are F ord Cars and Trucks serving and Saving LET US SHOW YOU THAT THEY WILL DO THE SAME FOR YOU CASS COUNTY MOTOR COMPANY C. A. Frey, President and Manager LOGAN SPORT Authorized Ford Dealers Fordson .M THE TATTLER Both In The Swim. Mary Kister: My father sprang from a line of peers. - P L. Murphy: That's nothing, I once jumped off a dock, myselrf' We wonder what the Flag Staff thinks when it sees: Eugene Nelson's Giant Stride. The Dragons, green neckties. Lavonne Crockett's hand painted hands. Annie McDowell's long C21 skirts. Heiney Wolfe's ballon pants. ' Evangeline Elpers' permanent The Three Musketeers bandanas and corduroys. Louis Rosentrader's cheerful grin. Eugene Denham's dignified airs. Robert Dotterer's monkey shines. DeFaun: Do you really love me? Don: Why of course ! DeFaun: Then why doesn't your chest heave up and down like the man in the movies '? An optomist is a man who wears a celluloid collar and sings Blest Be the Tie That Binds. , NOTICE-See Miss McConnell for information regarding tooth brushes selling for 10 cents each or 2 for 25 cents. Congratulations to the Class of 1925 Uleiii the future of each and euerq one of qou be crowned with success. ' CTO the Tattler Staff: L lt has been a pleasure to us to work with qou in producing this is- sue of The Tattler. The businesslike manner in which qou handled qour part showed abilitq and efficiencq. - lDe thank qou. l'len ricks Brot ers Co. Printers 519 market St Phone 1115 may ,M ,,,,, Wumw ,,,,,,,,,,,,,, ,,,,,,,,,,,,,,,, ,,,, ,.,.,,,,- 4,,,,......,..,. ,,, ,...,...,...,,....., , , .,,,.... ,...,,., .......,...... ........,.,,..,,.......n.- ....... , .....,,, ,... .....,,.... . ...... ...-,-,.......-.. .,,.... .,,,,..,. .,..... ....,... .... .......,...........,.,,.,...,-............,.,..........,.,.. '-w ' ' iilliiiiiiififfff1ffIfQIIIIIIIfI1IfIIIIIffffIIIfIIIfIIIIIIIIIIIIIIIIIfffIIIIIfIIIIIfffIIIIffIfIIffIiiiiiIiiiiiiEiiiiiEiiiiiiiEifiiiiiifFiiiiiiiiiiiiiiiiiiiiiiiiiii5EiiiiiEiiiiiiiiiiiiiEiiiiEii5iiiiiiiiiiiii5iiiiiiE5Fiiiiiliiiiii35iiiiEiiFiiiiiEiiiiiiiEiiiiiiEiiiiiiiiiiiiiiiiii!iii!iiiiiiiEiii!iEiEiiiiiiEiiiiiiiiiiflIIfffIffIQffIIIIffffIIQIfffIIIIfff1fIQfffIfIIIIIIIIffffIIIIffffIIIfffIIIIfffIIIIIfIiIfffffIIIfffIIIfffIfIffffffffffffflfiiiiiiii QUALITY MEAT MARKET S5011 and 311019 Meats and Poultry At UNCLE R0Y'S Free Delivery on the sunny side of Broadway I Pnone :Bl-Oadyvay Hansen 8z Volivia She Oh, I don't like these pictures at all-I look like a monkey. You should have thought of that before you had them taken, re- sponded the photographer. Wayne If I should kiss you, would you call your mother? Jane Do you want to kiss her, too ? Mr. Cox Why are you running? Tick Williams To stop a fight '? Mr. Cox: Who are figthing ? Tick : Ancil Schaffer and I. Anna: So he proposed to you on a post card. Did you accept ? Marie No' Do you think I d marry a man who didn t care two cents about me '7 Miss MacConnell Just think of all the people chewing gum to make Mr Spearmmt rich' Joe and Pat were lying in bed in pitch darkness Suddenly Pat got up He ht a match looked around and blew It out What did you do that for? asked Joe Oh replied Pat I forgot 1f I blew out the candle or not so I iust looked to see Miss Rathfon What does a r c h 1 t e c t u r e spell? Egg Campbell Cathedral For Cigars Candies Sodas and Sandwlcheg See HOOLEY MILLINERY KIRKPATRICK and RAMER The home of the smart dressel Poo Corner 5th and Market 322 Broadway Phone 523 ' , K C ' ! ' I . . 7 ! . . 5 I . . . . . , , . 1 . , . 6 C ' I 9 . . C I 1 7 ' K C . ' 7 ' I ' 7 1 - ' . ' , I C ' - Y 1 , , 1 4 1 9 ' Y 1 u ,sr ,-, ,4,,,..., ,,.,. , ,,,,, ,, ,,,,, ,,,,, , ., .,,,,.... ,m,.,.,,,,,,-,,m,.,,u. . .,.........,,, ,n,,.,.,,... .... ,,...... ..,.. .... . . ki -qzyr -il-.rtf-Fizvv 'K ' THE TATTLER h ..44.V?...... H uuuubvuuln W Nuutvvuulw G Vuuu W I . I LI Compliments of JOHN W. HOLLAND DR. BAKER Plumbing 410 Fourth Street 117 Fifth St. Ph0l1e -160 - L L' Trigo l Hence Loathed Trigonometry, Of Work and worst Mathematics born M In some Print Shop forlorn, 1 With horrid problems, and work, and tests unsightly, I Find out some school, well, Where only Mathematics teachers dwell. -Glen Mather. Bobby: Mamma, does the stork that brings babies come from the Zoo ? Mother: Yes, dear. , Bobby: He must have stopped at the monkey cage for ours. A a Summary of Senior's Diary COfficial Recordj I have been in High School about five years, three months and three days. I have written on 2,996 quizzes and broken 19,376 pencils. I have stepped over 394,758 stair steps in this school two at a time and walked up 6 steps in an orderly manner. All in all, at some time or other, I have been kicked out of every place except the gym. Conseqeuntly I have been in the office 4,987 times. Eating every third noon I have consumed 90,000 hamburgers-or enough to cover one-third the roof-and approximately 18,500 Weinersf' BURGMAN ELECTRIC EQUIPMENT CO. RED CROSS PHARMACY Geo. H. Babcock Distributor Prest-O-Lite Storage Battery Drugs, Soda, Cigars and Candy Gifts for all Occasions Gas Tanks-Appliances ' Phone 65 606 Broadway Phone 1287 408 Broadway Logansport J I , MmWM '0ilt !T!!!!lllimM!l!!!!!!!llME!!!!!H!!!!!!!!E!!!!!!!lE!!l!!!!!!ll!!!!!l!SF!!!!!lf!!!!!!!!!I!!!!l.!!!.!!!!!!!!!!!!!!!!!!!!!!!!!!I!!!!!!!!!!!!!!!ll!!!!!!!!l!!!! l!!!!!!ll!!!!!!!!l!!!!!!!1!!!!!!l1l!!!!!!1!!!!!!!!l!!!!!!l!!!!!!lll!!!!!ll!!!!!!l!!!!!!! 1 i 1 1 I W I lllll L , . 1 I THE y y'I:AlT1'LER liiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiFiiiiii3iiiliii3iiiiiiiiiii!!31fiiiiiiEEiiiiiliEiiiGliiiiiliffliiiiiiiiiiiiiiiiiiilliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii! !! DIOTHERS Are you sure you are using the PUREST ICE? Your sons and daughters can ascer- tain the Real Pure Ice i by asking their Chemistry teacher. Uur Ice Is Condensed Steam, Reboiled, Skimmed, Filtered and Frozen in clean covered cans. There is absolutely NO amonia. in Our Ice. DONiT HESITATE T0 VISIT OUR PLANT Help Us To Protect YOUR, Children's Health No Germs--Motor Equipment That Good Ice Made In Logansport PROMPT AND COURTEOUS SERVICE Logansport Artificial Ice Ccmpany See Us About Our Coal Phone 403 Eighth and Erie Ave l . ,. T HP T 4 T-T.L 4..,AA .4..A,,..... M, , .. , ,,..A..,,., ,., ,.....,... H ,. A ,.,A.A., , . !!!! 'W '!M!!.,.!!M! If It's Furniture, Rugs, or Draperies See ' r H. Wiler Sc Co. Q FOURTH AND BROADWAY We are for you, kids,-Go to It C. E. Beall Auto GROCERY I T I l runmln Sh 1401 East Broadway g Op Logansport, Indiana , l Herbert A. Dunn 514 North st Mr. Mitchell: Why is it that you are an hour late this morning? I Dick Quillion: I had a fall and was unconscious for an hour. i , E. :Ei ti? SEE E: Mr. M.: For pity sake. Where did you fall? Dick: I fell asleep. - The sweetest girl I ever kissed, Said gay young Malcom, Used powdered sugar on her face, Instead of talcumf' See BIRKHOLD BROS. West Side Drug Store Compliments of 300 west Market THE I FOR PEERLESS CLEANERS DRUGS, SUNDRIES, PAINTS I and OILS Everyone Knows Us Phone 930 We Delivei E 2 1 I 2 5 i i Q 1 l 5 E i i i i l Ei xl! li' :il l 1 i l 5 l I 3 il E 2 E .sg 5 is: lil 2 5 .Ei E QE x 2 2 g, .Ei I 2 l : l 2 i 2 s l Q . 2 is EE iii 1-1 EEE EE Ei! E E ' fffvem-wwf' ' T H E T A TTL E R WWFiiiWiWf7'iiiiiW'iiiiiiiiiiifiiiWiliiiiiiiii!i9il??iEliWiliiiiiiiiiiWiiWiliWiiiiiiiMiiiiiliiiiiiiiiliiiiiiiiiiiiilffiiiiffEiiiiiiiiiiiiiiiiiiiifidiiiiiiiilifiiEl'EiEiiiffi9i?iii?!Eiiii?!EiiEii'f!5?FFI'i3iifLi Compliments of Anheier and DeHaven 314 Market Street Phone 600 A Layman's Map of the World RUSSIA-Where everyone drinks vodka and is eventually mur- dered. SEBERIA-A suburb of Russia, highly popular as a winter resort. SPAIN-Where people spend all their time at bull-fights and doing Spanish dances. GREECE-A long chain of restaurants. SCOTLAND-The hunting ground of English Lords. ENGLA ND-The home of the Prince of Wales. IRELAND-The ancestral home of most American Mayors. NORWAY and SWEDEN-Where daylight saving really started. ITALY-Where everyone carries a stilletto and sings love songs in the moonlight. DENMARK-Where they raise Great Danes. FRANCE-Where Wines are cheap and chateaux many. JAPAN--The base of the kimona industry. CHINA-One great mass of laundry schools, where everyone lives on rice and tea. SWITZERLAND-The largest skating rink in the world. ROUM15 NIA-The home of that good-looking queen. , BULGARIA-A mass of many colored embroideries. TURKEY-Harems. CZECHO-SLAVIA-Where the bright colored china comes from. HOLLAND-Wi1he1m's country home. Compliments of the Packard Straube Story, Clark, and Schiller Pianos W' S' E' Co' Players and Grands, Violins, Second and Market Streets Saxopohnles, Sheet Music Etc. BUICK MOTOR CARS U' Sing? E01 L' Parts and Accessories Brunswick Phonographs, Radiolas, D. G. Wildermuth , and Records John J- 2313133 E. b. 8 FRANK H. 'BROWN MUSIC Co. ' ' lsen IS 509 Broadway Phone 1464 Eii:uiiiniviiiiiiiiiiiiiiiiiiii iniirriinimiiiiiiiiliiiiiiiiiiniuiiiiiiiiuiinniiliiiiiiiiiiiiiiiiiiiiiIviiiiiiuiiiiiiwiiiiiinwuiiiiiiiiiiiliiiiiiiii iiiiiiiiiiliiiiiiiiiiiiillIiiiiiiiiiiiiiiiiiiiRiiiM5FiiiiiiiiiMiiiHiiNiiiiiHiiiiiiiiiMMiE' 'Ti n ' nmumumi'mmuuunm V -' 'Q v I 1 miiii9iiiiiiiiiiiiiiiil?iiiiiiiiiiiiifiiiiiiE5EEiiiiiiiiiiiiiiliiiiiiil3 ...,,........... ....., . iiiiiiil3fiiiiiii3iiiiiiiiEiiiiiiilEiiEiiiiiEEEiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiEiiiiiiiiiiiiuiiiiiiEEEiiiiiiiiiiii3ii!Eiiil!Eiiiii?iiEiiiiiiiiiiiiiiiiiiiiiiiiiii3iiiiiiiiiiiiiiliiiiiiiiiiii!!! iiZil!!iiiiiiiiiiiiiiiiiliiii THE CITY , L. H. s. 1918 NATIONAL BANK . DR. W. N. KIESLING Dentist Phone 1088 The 'Bank With I Office over Logansport Loan 8a the Chimes Clock Trust Co. THE STUDIO OF Harrinqton Cl' e Cl-'c'1lICI When You Think of Photographs-Think of Us. STUDIO AT 421 FIFTH STREET PHONE 509 Giant Tires BiCYC16S l Complete Line of Complimentary to WILSON SPORTING GOODS The Graduating Class of and ' Logansport High School FISHING TACKLE Tents and Camp Equipment From the O. D. HUNTER WALTER L. CLOSSON AGENCY The Sportsmaifs Paradise gwigbu - aww' err: -slug-1 -l Ep ' Irreww' 1 THE TATTLER WiiiiiiiiFiiiMfmumn ' iiii'n1nnunnnT'm ' nmm'm75iii3iiii'nmnm 'WiiiiiiiiiiiiiifiiiiiiiiBT' '''Wiii'n'H nmmm ' 'M ''iiii 'unnnmlnlm 'iiTriiii 'm N mm' Il s V2 MOTHERS Q, 'S I l Q Q f I A growing boy or girl often needs more l i E food than a full grown man or woman. ' Let them eat between meals if they 5 2 f g want to. S EE ls Q! Give them plenty of GOOD ICE CREAM as it contains Sugar, Fats, Protein and Min- 5! eral Salts, all of which are so easily digested -the real food for growing children. s 2 E l 5 Deliciously Diiferentv i 3 For Their Sake is E! l ll ll is il 5 ' Use EEE Ei EE' Ice Cream i made E ll by 5. l ! - 2 . 5 i Q z l ,l li il Logansport Ice Cream C0 n PHONE 299 ,MWHMMIIHWIIMMWIHWMUHWHUWWWWW ..... ......,...-----...,-- .........................,.,-...., THE TATTLER COMPLIMENTS or THE BOYS' BOOSTER CLUB OF L. H. S. We Boost While Othe Roo t ij 'V' . gl Ayr T H E T A TT L E R ... ... ,...,,T...... ,.,,.,,,,,A.......... . ,,...,,..,... .,,... , . . .,,,,,.... , ,,,iiiiiiliiiiiliiisiiiFiiiiiliiiiiifiliiiiWEFiiiliiiiiliiii'iiiiEEiHiiiiiiiiiliiiiiiiiliii!i?liEiiiiiiiiiiliiiiiliiiiiilliiiiiiiiiiiliiiiEiiiiiEiiiiiiliiiiiiiiiiiliiiiiiiiliiiiiiiiiiiifiiiiiiliii 2 Any man can be a millionarie, in his dreams. Any man can be fairly well-to-do, act- ually and really All it takes is a regular program of sav- ing money Don't just dream, just do it. Open a. thrift acocunt with us today. Make your dreams come true. The Logansport LOAN AND TRUST CO. QE lv The Bank That Serves n0,D0NvT IQIREADI BI'0d3.Way and Pearl Sts. THE TRIALS OF AN EDITOR Getting out the Tattler is no picnic: If we print jokes people say we are silly. If We don't print them they say we are too serious. If we publish original matter, they say We lack yariety. If we publish things fro mother papers they say we are too lazy to write. If we stay on the job, they say we ought to be out hustling for news. If we are hustling for news, we ought to be attending to business in our department. If we don't print al contributions, we don't show proper appreciation. If we do print all contributions, the paper is filled with junk. If we Write in vernacular, we have no taste. If we write with literary fiourish, we are playing to be high brows. If we print a lot of foreign news, Who is interested in those places. If we don't- the paper is too parochial. Like as not some fellow will say we stole this. So we did. From -Brooklyn Tablet, Mar. 7, 1925. What insects live on the less food? Thats easy, the moth, it eats holes. Jack Brookmeyer: I hear you need a bright, industrious, good looking young man? i: :sf Employer: I do, whom do you suggest? We are Prepared The Old Reliable FARMERS AND MERCHANTS STATE BANK Logansport, Indiana Gen. A. Raub, Pres. Gen. s. Kisuer, v.P. Directors: I W- F- Hanley- Cashier . Vfillard Winn W. F. Hanley O. P. Erbaugh Geo. A. Raub Carl J. Horn Geo. S. Kistler H. H. Huston M. J. McGreevy u A. B. Stanton Pays Four Per Cent Interest on Time Deposits FARM MORTGAGE LOANS A SPECIALTY State Depository Telephone 1130 S E 2 El u ll u mmlIInIlmIIIIunIlmmlmmlluluullnulllunulllnml ' f -. ' F1 r'+zf a gy THE TATTLER CITIZENS LOAN and TRUST C0 Compllments of Caplcal 33100 ooo oo CENTRAL LOAN C0 Pays Foul Per Cent on O J Parker Mgr Celtlficate of Deposlt 500W Bl'08dW21y Phone '30 1 Depos1tory for School Savlngs cents By Then Words Dave Hudson Cheese md Crackers' Clala Mehaffle-That s trlckl Allen Moss-I don t knovx Eugene Denham What the hotel? ZEUUUU ZITI! Kendall A fellow just told me I looked l1ke you Hubertz Let me at h1m I ll knock hxs block off Kendall N eedn t worry I k1lled h1m Brader1ck I know where you can get a clucken dlnner for ten McCall Where '7 .: Down at the feed store Sum Poems Now I lay me down to rest Before I take that awful test. If I should d1e before I wake, Oh Joy' I'll have no test to take! Mary had a httle clam Served upon a shell She ate the shell and not the clam So we have no more to tell. E'BERT'S Drug Store R E H M B R 0 S . 19th and Broadway Men's Wear FREE DELIVERY Phone 1975 The blggest httle store ln town 323 325 Broadway H-MMM ''M'M''''A'TW'IW'''''W''WiHMI'''''''''iiiWiii'''iiiW5iiiWiiiiii5ifff1IIFilii55524iEiliiiiitiliii55324iliiiiiii?HwfwmiffIIf M 'ffIff.'f...'' ''''FMPMEliiiiiiffHEiiiiiiitiliiii?iiiiWiiiiifiiiiiiIlIiff11iifIfff1iIfIfffiififif1IIIffffffffflffffffffi1QliQfff1iffffffffffjffffffiflfffffifffffiiiitiiiiliiiill . , . . . . . , . 1 ' ' F- . . 1 l Q l 1 l . ' i - 2 . u . , . 7 v 1 , . . cc ' - ar , as - 1 - . n . ' - , . . u v - - n I . . , . . . H r. . . ' n . . ca n B if '7 W ,Wy ,,w,,E.w.W X y nlwv',m,p Wm,1,u wrWmg4WggWwlqmmmy'qmnsmiwwgzwwmvwW 'wv1'vv1H'1' 'W ' M' +11 , ' lllllvd, IWW' ll, 'Vl fll1'9'WLll W UL fl THE TATTLER 'Hfiiiilmiiiiiiiimmi1!illimmii1iii!MiQUlm!iimliiiiiiiiii51iiiiii1i9ifiii!iQQ5iiQ!iQfiiiiiiEHiiiiiif5iiiiiffHIIIIwIIIII''IIII-I'IIII-IIffiiIIiIfiiiiiH9iiiiiiliiiiEiiiiiEiiiiiHiiiiiiE4iiiii5iiiii15iiiiiFFiiiiii+5iiiii5iiiii!5iiiiiifiiiiii15iiiiiiiiiiiiiiiiiiniiiiii25iiiiiifiiiiiHiiiiiimiiiiiiiiiiilfiiiiiiw I--M-IImIIHI'IIIIIIM'IHM'ww-I-w-I---Im-mu ' HIImm-M-H--M-I--H'Ilfiiiiieiiiimiiimiiiiil' l i 5 1 l ur Aim S---l To make well-to trade fairly-to improve our opportunities, and to rear from daily work a structure which shall be known for all that's best. ' l . Rc 'V W.atts Bros. Ice Cream Co. Manufacturers of The Cream of Creams ' ...... .... .....,... .4 . x A 'E W 5 A ,-- 1-. ly' ,, ll l 5 V4 ' . l .L- THE TATTLER .saaiiaaam iiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiii1ZiiiiiiiliiiiiiiiiiQiiiiiiiiiiiiiliiiiiiiiiiiiiiiiliiiiiiQ1iiiiiiQiiQjiiiiiQQQi6fliiiQiilliiiiiitijjiiiiiliiiiiiliiiiiiiilliiiiiijiiiiiiiijjiiiiiiiiiii FINE MILL WORK 9 - Hazel S Our Specialty is Store and Bank READY.T0-WEAR Fixtures SHOP We handle a complete line of Lumber and Hardware 428W B1-gadway i Over Metropolitan 5c and 10c Store Our Service Is of the Best PARKER 8z JoHNs'roN, Inc. WS a Short Ways Up to a Long Saving 719 Spencer St. Phone 112 COMPLIMENTS OF THE Star Garage and North Street Garage I. R. REDING ER Prop. Do Not Forget To Make Logansport and Cass County A Better Place To Live In By Buying Your Hardware, Seeds, Paints and Implements At Marburger Bros. 200, 204 FIFTH STREET iiiiiiiiii iiiii5iiiiiiii9EiiiEi996EiiiiEiiiiEiiiiiiiiEE'EiiiiiiiiiiiiiiEEEiiE55iiiiEEifiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiEEEiiMiiiiiiiiiiiiliiiiiliiiiiii iiiiiii W Y ,1-- Wm W .- .L i ....,,.... ....--...--i:fQ,..fII.'IQ QI 3 is 53 Es as E5 25 ii E! es E! es ga Ei S E l 5 Ei ea ea ii --LL.-- ,, TAT E L E R W-.- r Sub Standards of REAL SILK HOSIERY Not a special event but obtainable every day in the year, in all the new shades LUNA COLCNIAL Vaudeville Best Pictures . Musical Big Organ Comedies Musical ' Big Photoplays Features GRAND Western and Action Pictures Management Hornbeck Amusement Company ' Eddie Monahan: I hear your cook left. 80c Linus Olson: Yes, my Swedie went away. Catherine B.: Well, that's something. How did Abie, the pawnbroker's son, make his letter. , In hockey, I suppose. Crystal Young: Cold boiled ham is ham boiled in cold water. Virginia B.: I have a cold in my head. ' SBLANK VERSE A Bus asked Clara ' To take A walk with him, And pick flowers But Clara's sister came along, And so- They picked flowers. Mose: Rastus, Ah've been writin' poetry. Rastus: Mose: Lives of great men oft remind us That to sin we must not stoop. Nor departin', leave behind us Let's hear it. Footprints round the chicken coop. n Meet Me At The Central LOGANSPORT'S MOST BEAUTIFUL AND UP- T0-DATE DRUG STORE Central Drug Co. Fourth and Broadway Wiler 81 Wise, Inc ' if ' ' '--24-fa:Xw X . X av E314 as so . .1 ,. X ,PX X X . X X , S ,L X. X' P. X X , Xi , ,Xfffg ,XX , , Xa- ' , 5 , , X ' Z X! XX, X 'fi Q5 V . X. ,'X X 'Q-X . Xi X X-'X -X. -' 'X -' x. -X! . - X. ' ' . . : 1 'f'- gig-,X . . 1' - .Q ' f-XXL., -z . . -. -XE ,X -- . 'J-X . . . ,M r X 'Q ' 1, ',XX5X, - X 1.1 Q, XX XXFXX XXXXXXHXXXXXX X' XX, X. X ,.X X XX A'fXl X,.b.f X,,, X XX XX X ,Q-, it 'X , X XXX ,X n ,g!X.:,j5iQ5Xf XXX .X api' A- ir - YU X ' HP 5 X 'ax.,f:,iXg1 ' A XX X .. '- , ' ,X - X . ' X 1 - V X ' J X ' I . , ,, ,X -- 'X X ,X J X , K1 4 X ..XX .XXXXX , XLXXXXW XXXXEXXXXQTQQXXX, . X XXXXX1X.X.,XX7X?XX.Xw XX X ,,X,- X X XA XX . XXX K X Qin.. ,XXX , 3,1,XXXXXiiXXEXX A XXX 1, J :gk X XX X X .M X 11,1 XXX X X ' ' I .l .' Q 'UW' t .4 - ,7 J- 'ff ' .. X . , X -L Qx22!fQ1! f -X uf H4 , X e-1.-ff X A t . X .. 1-' f ,X 1 -. iz- . 'H-ff . ':f S. - ' '- K ' ' X ,X 3-iX'XmfHgXW ' 5' XfX WV.XXi- R' 4 XX , - I V- .:X.XXqX?X,X X XX 9:31, X X , 1 -X'X X X X ww XXX - - TX Xr- X , X ,'Af.' X . 1,X y -' X A A A- X X :XL WXXM, ,A 9,133.1 XM-.X. . , .X XXX, - X. . X fy: 'N-'f'5'Q X X F11 ' - '-- ' ' A K ' X , M X ' Xa. - .X ' A - X A X : 5 r Aw X - A Y MI' . z - , . X , X . - ..,. - X , ,J . . X - ,5- XX .XXX ,X - .:. F , . I - j 'f 1'4 f X'X ,W - X' X GX W 'T-'XX Jfslfw A Xi' X f . ' X ' X ' X ' ,n I, -118,94 f,,1,,'9f - A-'XXX X' - X' X X, XX,XX MX - X X ' '. XgX!'f2L:fgg.?. X52 X . XX, HQ 'H .- X X -X nj .xv - . f1 . ..1X X X' X Ak y L X' .. '. -X X .- 'wf' - , X X 'Nfl 'v' 'T11' ' K lr- 1.153 -.X 'A B ,-4541 ffagg X X XXX-.J 4 , XJX1 X' , mp,--XX N'-- 4 .X X X ,XXX X X 2, X M ' X - X X X 4' ' ' ' X X . X X' .Xf X.. by - ..- ,J . , X, Xa - X, X . , , . . X.1XXXX X. . . Y . X XX X X ,XL i X 1 I xx' X.-737' K X. X v' , X E . X X -- ' ' X .1 LXX 'N X- ' X ,' X ' , X XXX ZSXXXLXX-maihijw,XXX-.XXXY ,X FX . , :.XXX 1 X X XX X XXXXXX .. XXXX,XXX,fXXXXXXXXXkXX X XX A X .X M144 .XX ' Xa XX ' Xa.X.?!.X Q , . ,. X -3 'Ha X gs, '61 n' Q ' XJ-' -ix' V- 3 F I -M ' YQYY ' . - 4- , -:X I X -XJ JX Xa f:-wkt -1- .X.. ' ,. . - EQ' , ,X . ,gn ., X- ' X , X J! 'Q A f1.'.' -'if ' ' ' ' ' X 'X XXXXXXX.X.X.XXXXXXfX X ,XX , Xp 'XX,,XfLf,.X,,XX ,, XXXXXXX5XMfC jXXrXgX,,XXXXX,,XjX. ,X. XX . X -X 'Xw-af XX , X: M ,. g 1. , '11 XX'1 ', .'X. ' ' X X, : X, ' . ., . X I XXX ,XXX .XX 'Q XX .XQ54,,XX.,X,?g-XXNXXXT? X , X, X X, XX XX , ': X X ' if-X 12 -' if 'W' 'ig .' X . Az 1, -LX 'X!'4X X if ' -.51 'XS - ' .jf f ' iii! '7' ai , 'H 5' L Jr? 4 11 ,4-Q.. K5 - X X -, . . 'X '- 1- ' X If-X mv . X X. 1,-5 X E-1371 1, by X Q- , XJ ' -1 'X5i X, XXV: 7 X ?XM,,' 7 f. . ' V .X X UX J 1-QXX-'XXXWXXS XXXXXXlfY X QX3.l,'vX .'X.XXX'XX- fQ!5fQXXQ50HXXX:pxX -XXXXX XXXXX,XX 'X X A X X ,XX,XX,XXXXXQXXXX1XX' XT. X, X X , X , X X , 'X ,Z .i i :w..X- 5- 'rffl Tw! X LX . Q ' XX f' XX ,X Xnir' eg, ,X-I'.1-XXX.47?X-Y V- XX. X . g1X,X,,3..XX 55.4 X- ,X , 4' 'X . ' XLJL- -'Xi' ' ,X 2:41 -- H. . 5 ' 1 -2 E ' 233 1' f . ,, 'X X 8, . . Q , .X- NX. .' Q Z ,-1 x...,,XX X' X'X X- X . . ' 'K ' 194 ' 3 ' ' 'if-5 'ia'-f 'X 'A A -12-u.g. -.,.,-I-. . ' .W QQ. -1' ', X- -fr :X ' iff 1 , . . X, Thix X'.l?Q 5'1X ' U! W f'1, XXX',:'TX'f'vXX-XX V' , XXII , . 39 X, ' , fi.. ' -X X .X X, X XXX,-X X1 . , . . X XX, X X, X. XX X, X . ,XX XX -. XX X 'HX X- . A 'XX , 'wviwdh' 'WW-1' 'i3X',M?sX-Q X XXX, XX X - 121' ' XX.. X,1X-X-f5'?rX 'f -eb X XX X XX XM- H X X L, , X X X X . .1--2 rv- ' XX X . ' . . I X X . .XXl.,XXXq? X X . X . X , . .X nie ' f 1 - -' 1 :Xa J X - , . X I f,XI'W 5f 5 if X , X 1-91 iff A' W I ' 4 ' W22XX327r-XX,X'A'Ul'm?- ,XLSSW TXXXZXW, P' XXX ' X' V, , :XX X X A X X, , X. XA X LX MX .XXXXXXX X X LXXX,XXX X XTX X , . X, XX WX, XX .. .X H. X XXX.. .X ' ' X .. X- QXXAQXXX .X ., XX X-X: ., ' ' ' .- . .A - ' X , : -all 'r,, -.XXi:X,XX+ X 2 . .lf rm Q F lv i RSE! AMX .:-X. X X v- X ' - X .lieu - .X X.: X Q X .37 ' -- 2- .X X21 fffff' - -. I ' ' 'f,9Ir, X X f MS X I-jXX'X X XXXXXX X ' , ,:1-pq ,X . XX ' - -Aff xi ., ' . , X N' X XX ' u-X-QXXXX . rw' .X XX . . ' XX ' XF X , , X X X5 ,XXXXXXXXQ X 9 .. J., J XTIX X XXX '. ' I V . LX ' . ' X 'L ' Q .X X y XX, X .. X- XA.:-.. XXX! X:F1 w ' X - . XXX,X X M .1X X.,,:.XX.,XXXXh XXX XX ,,MX,,XX,X X X' XM XX, X X W1jg,,Q, J ' 11, XQXX X1Lgf',X.ilf'Xwg X X ' 'ljxf u, .-XKTGVNZ' 'K 451' ' - lf!-X-.flEf'3' ' ' X -fi-T.ff V , ,qi X' Y A . X X' X 5: ig- QQ.. ' ff I 1 5 ' ' A f X- f A 1' -... if 'if ' I '.' ' , 13. ' ' nw -5. AJ ,X .,,, , -, ., X5 f MX 'WX f X..X X X A,nv-a'59:X'T.- 1 -gr . X '. X . X Y . . 9.9 ' X f- 4: ., - 'Q -1-. -' r ,X . - Q' -XJ' 1 5 ' L ' Y F TX' 5 1'g ,,Xs,X-A' 1 Hamlin mlm! ' , cw: muwhlll H um'.llVJ1mlw,AlnIu:1:, Milli: Q ,I cf Q. ' I.- f ,fy ! f fc! ff lf L QW fl , ' x f 1 '- + X Q , LX 7 A Ar'-A ff f , Lf gif 'j W X .f j ff iffy, N , , 1 , ff ff M!! f .,,f,, f ' I f , fi: r

”

Suggestions in the Logansport High School - Tattler Yearbook (Logansport, IN) collection:

Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1921 Edition, Page 1

1921

 Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1922 Edition, Page 1

1922

 Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1924 Edition, Page 1

1924

 Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1926 Edition, Page 1

1926

 Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1927 Edition, Page 1

1927

 Logansport High School - Tattler Yearbook (Logansport, IN) online collection, 1928 Edition, Page 1

1928

Searching for more yearbooks in Indiana?
Try looking in the e-Yearbook.com online Indiana yearbook catalog.



1985 Edition online 1970 Edition online 1972 Edition online 1965 Edition online 1983 Edition online 1983 Edition online
FIND FRIENDS AND CLASMATES GENEALOGY ARCHIVE REUNION PLANNING
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today! Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly! Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
 E-Yearbook Home  Quick Search  Advanced Search  Quick Browse