Lindblom Technical High School - Eagle Yearbook (Chicago, IL)

Text from Pages 1 - 204 of the 1953 volume:

Q ni 'vw'-f ,V ---, --1 -. ,- -ff U fl ' X A I p ' .w 1 ', ,Mn W' 1 1 ' ' T9 in . 'f fe A +e:'.H? A 4 . I 51: K A 2,2-eamj -. ' . ., 5 1111.5 ag-1 V, 'A f-M , f 'l Q 4, y ' ffm ' yay, mr: I- 'I LINDBLOM TECHNICAL HIGH SCHOCL C1-11cAGo 1LLH1N o1s r , Y ,F ,Z , N X M f ff , . X l f ...,,. i l' Time-in'all its llpl varied aspects is each students monitor. .Throughsthe procession ofdays, weeks, and months that constitute the school year, each secondof Time ,aids t' the student in acquiring the skills and Values which are designed to make himgagcompetent irnlder ofladultl society. 'Wllfletherlitlis those precious minutes .that save ,him from the tardy loell or those IT1 eaningful hours that help him gain more knowledge k his-12001551f1liH3si,PlQifs,s, ttlk Qier ,lli If Q1,sliini,ihsi,susrl, Tmllivfhgllllifm ' A 1' - S . me Einally, whenqheeschetnginglyleetrsfhaveanarkedc the progress from freshman to senior, the graduate is astonished that hisfhigh school career haslpassedlso A sense of fulfillment comes to him as he re- Achievement inclasses has mental capacities participation in e o riends an interest his' pattern of living asuileei-stQL1el1yLGi-lfmiizinri activities has widened his circl 'tit ' A 7 oioi' g i s Ctndlieach hour ,ha i recorded some remembrance set on e ag e o in- clock andlenjojf RfELlVlNG lelditi oijtlgf' Emile' 'T lffii i ll A X r es Q fc HJ 'A ,L' gg 5 i rf in J N g ,li 1 ffm -N' nu I ll A D 0 R f f . E 'xx J If YZ7' I 3 -A ' RSX sg? fakkixxxsyx ,. 0' is J Q ', X M C-W. FILL THE UNFORGIVING MINUTE Eager, alert students . . . Challenging subjects . . . Helpful instructors . . . Shar- ing opinions and enthusiasrns . . . This is your invitation to learning. Classes -P N y Rozanas. G Auksi, l G d wks N 1 fn? Through T he Year MR. I-IQRRY F. YQTES . . Mr. Yates is a sympathetic counselor and friendly adminis- trator who endeavors to give Lindblomites a school of which they can be proud. I-le seeks to provide maximum educational opportunities for each student and to develop in everyone a true civic consciousness. Despite the heavy demands made upon his time as principal, he can be counted upon to applaud and en- courage Lindblom's efforts in athletic contests and extra-curricu- lar activities. During the ten years he has been at Lindblom, Mr. Yates has demonstrated his ability as a capable executive and an enthusiastic leader of youth. Page 8 Ifldfh Uur Staff IN RESIDENCE HT LINDBLOM To Miss Varian Shea, superinten- dent ot District Four, high school boys and girls are very special persons, and she is deeply concerned with the inter- ests and abilities of each one. Since her office is in our school, Miss Shea can observe Lindblom students at work and at play and become better acquainted with all aspects oi our school lite. SIRIN Page9 MR. EDGHR PHLMER Our assistant principal, Mr. Palmer, is responsible tor many essential de- tails ot school policy. His varied schedule ranges from the organization ot classes to the counseling ot students. In Whatever he does, his fine spirit of friendliness and his good sense of hu- mor are clearly in evidence. - ADMINISTRATIVE ASSISTANTS Mrs. Mabel Piademacher and Mrs. Beryldine Wilbur, administrative aids to Mr. Yates, are in charge of the new system oi student registration that be- came effective in February, l953. Scheduled For Speelel Services Miss Gladys Crisman, Ad- justment Teacher. Mr. Miles Shore and Mr. Michael Bach, Attendance Counselors. Mr. Iohn Alvir, Placement Counselor. Mrs. Gussie Atkinson, Miss Margaret l-lowatt, and Mrs. Esther Macdonald, Attend- ance Counselors. Mr. Irwin Brazill, Mrs. Ioanne Tatel, Miss Geraldine Wright, Miss Kathleen Shan- non, and Miss Gertrude Dun- leavy, Office Stott. Mrs. Ann Amthor, Matron. Page lO ENGLISH DEPARTMENT Row lfMiss Byrnina Garrity, Chairrnang Mr. Michael Spatz. Bow 2-Mrs. Harriet Brown: Miss May Clariclgey Mrs. Lydia Nisbetg Mrs Marjorie Bulep Miss Rosemary Brown. Bow 3-Mrs. Corinne Maneikisp Mrs. Alice Stanton: Miss Margaret Ander- song Miss Mary Dowdy Mrs. Genevieve Sedlackg Mrs. Grace Baker. Not pic tured: Mrs. Gussie Atkinson. SCIENCE DEPARTMENT Bow l-Miss Phoebe Goe, Chairman. Bow 2-Mr. Albert Lilelcp Miss Margaret Delaneyp Mr. George Von Bremer Miss Ianet Calkinsg Mr. George Kaup. Bow 3-Mrs. Marjorie Connollyg Mrs. Mary Schuhmanng Mr. Alfred lngle Mr. Iohn Flanigang Mr. lohn Croitsp Mrs. Ruth Tayrnor. 1 1 Facility Page ll 2 5 Q 5 OPPOSITE PAGE SOCIAL STUDIES DEPARTMENT Row 1-Mr. Edward Boucherg Mr. Edward McCullouqhg Miss Maraaret Howattg Mr. Edward Wersellsp Mr. Montefiore Goodmany Miss Helena Grovesg Mr. Philip Alorahamsong Mr. Miles Shore, Chairman. Row 2-Mr. Kenneth lakusp Mr. lason Kaplang Mr. Law- rence Sommers. ABOVE LANGUAGE DEPARTMENT Mrs. Esther Macdonaldg Miss Marita Hogang Miss Anne Altg Miss Birdie Ehrenwerthy Miss Anne Z. Moore, Chairman. ABOVE MATHEMATICS DEPARTMENT Miss Roberta Harrisg Mr. Walton Srnithg Mr. Louie Weckelp Mr. lames Williams, Chairmang Mr. Louis Swanson: Mr. Nicho- las Kushtag Mr. lsadore Solomon. Not pictured: Miss Mary Boweng Mr. Benjamin Garbow. OPPOSITE PAGE COMMERCIAL DEPARTMENT Row l-Miss Blanche Doyle, Chairmang Miss Alice Weiter- lund. Bow 2fMr. Walter Mulvaneyg Miss Helen Goldbacherg Mr. Walter lepseng Miss Edith Deterg Miss Rose Appleby: Mrs. Eltrieda Schlacksg Miss Mary Howe. Page 13 Faculty Faculty TECHNICAL DEPARTMENT Mr. Robert Thornasp Mr. Charles lohnsong Mr. George Aikeng Mr. Iohn Anderson. TECHNICAL DEPARTMENT Mr. Howard Pilditchg Mr. Walter Freese, Chairrnang Mr. Henry Moehleg Mr. Ted Hunter. BOYS' GYM DEPARTMENT Mr. Henry Smidl, Chairmang Mr. Rudolph Bohorg Mr. Gustavus Ionesp Mr. lohn Labant. Not pictured: Mr. Edward Ianousek. GIRLS' GYM DEPARTMENT Mrs. Margaret Barry, Chairrnang Miss Catherine Murphy: Miss Pauline Calleng Miss I.aVergne I-laokenlorochg Miss Ethel Murphey. R.O.T.C. OFFICERS Sgt. Robert Wilsong MfSgt. Iohn Longshore. Page 14 MUSIC DEPARTMENT Mr. Christian Lynqbyg Mr. Willard Conqreve, Chair- I many Mrs. Iosephine Dennis. HOME ARTS DEPARTMENT Mrs. Mary Hayes, Chairmang Mrs. Anna McGrath7 Miss Catherine Dalyg Miss Bridget Taheny. ART DEPARTMENT Miss Esther Rusking Miss Betty Garrison: Mr. loseph Schmitt, Chairman. LIBRARIANS Mrs. Elsie Kramerg Miss Bernice Donehueg Mrs. Lenore Calpha. Page 15 lndusfrfalflris. .. The Power offliachfhery Boys who are adept with their hands and desirous of a good occupational skill will find that training in the technical department prepares them for a large variety of jobs. ln their classes they learn how to work with various tools, how to handle different kinds of machinery, and how to design mechan- ical apparatus. Well-trained workers familiar with the basic patterns of tech- nology are an asset in our industrial society. OPPOSITE PAGE MACHINISTS OF TOMORROW . . . lntricate machinery of all types is managed efficiently by this crew of dependable young Workers. BELOW CRAFTSMEN AT WORK . . . Many and varied are the tasks done by the boys who specialize in shop classes. One of the boys inspects the band saw while Donald Manzella gets ready to use the cylindrical grinder. ln the foundry Icxmes Ruffolo and Richard Wernli pour the hot metal into the mold. The numerous screws and gadgets on the milling machine offer no problem to Robert Weiss who knows the secret of its operation. if A - Q-Smal M? Y Sw' 5 1 'frxy V ,xx wq M1353 . .H sgv,+ff-RQ . .. , .-,. M E5 3' V -5 -' 17 it 533: 3 f Qt? uf M im 3 m y f , JW-gawk 1 fi . H 2 ,, N QMA Qmgzwg Sw W 53, X - 2 A ff Mf3n?mkM3f2 , fffanswvsxw , r A .eimimi 1 3 5 , A ga. . AA-f get , J 2 mwmvxi. mn, ffw, fmwzv 2 . X2 wff: a:4g5 aM1 .i55EE,,g,:gg5fl4: ,f f-www mm- ff FST? -,-'- 5 .:. .,., ,V : ' ' ' I ,., ' gg-'-2 W1 wngmv -f -5- QQ -.,. - .,.. - .. .... . ' - ....,. W Y -- f , , Eng!! h. .. Comm unica tion of Ideas The interpretation of the printed word, the art of creative listening, the development of written expression, and the ability to speak effectively are the four aspects of language study with which our English curriculum is concerned. Adequate growth in each of these areas is the aim of every student and the goal of every class in English. The clear expression of one's own ideas and a thoughtful evaluation of the opinions of others are accomplishments which always merit admiration. OPPOSITE PAGE LIBRARY BOOK FAIR . . . A center of activity for all departments in the school is the library. During National Book Week in November Open House was held so that everyone might become acquainted with the new books on display. BELOWfleft to right LABELING THE NEWS . . . Robert Krueger and Agnes Bures are learning writing skills in the Iournalism class where the elementary principles of reporting are taught to budding journalists. LITERARY MODERNS . . . Arline Iensen, Lois lenkins, lulian Reppelt, and Armand Dusablon compare notes in a senior course in English as they discuss fascinating novels of adventure by contemporary writers. SHAKESPEARE ON RECORD . . . Many enjoyable hours are spent by students like lerry Cohen and E listening to the great classics of English literature. THE SCRIPT CALLS FOR GOOD DICTION . . . Members of the Drama class emphasize correct habits of speech and ease of performance as they rehearse an amusing situation from a one-act play they are producing. Home Arts. . . De llqn for Gracious Living ABOVE FASHIONING A NEW WARDROBE . . . These young seamstresses are busily engaged in planning and sewing clothes which they will be proud to wear. Carol Hengst, Carol Willand, Charlene Srnitt, loyce Engel, llomay Martin, Myrna Williams, OPPOSITE PAGE ABOVE IN THE COOKERY CORNER . . . Tempting aromas invite one to step into this kitchen and sample the culinary proficiency that is being displayed. BELOW DINNER ETIQUETTE FOR YOUNG HOSTESSES . . . After enjoying a nutritious meal, the guests are anticipating with delight the delectable dessert which their hostess is about to serve. Nancy Willett, Margaret Rullrnan, Ellen Reid, Kathleen Kouacich, and Elaine Barbarek. Girls find that it is a pleasant experience to Work in the spacious Home Arts rooms where, surrounded by modern equipment, they become familiar With the fundamental steps in good homemking. Their repertoire includes, among other things, the concocting of delicious cakes and the creating of lovely gowns. Home-planning methods which emphasize efficiency, economy, and good taste are introduced through actual experimentation in the Home Arts laboratories. Every girl in this department has the good fortune to acquire many splendid ideas for maintaining an attractive home. Page 20 S- 2 2 2 2 2 , Q E 5 E R 'Q 5 2 ss E 2 2 2: 5 2 2 5 5 2 2 3 3 I 5 2 2 2 5 E 5 Z Ma th ema 1705. . . Formula for Effective Thlhlcfhg Such terms as equation, theorem, radical, and isosceles are very familiar to math students. Step by step they learn to analyze problems in which these Words are used. Numerical values, mathematical symbols, and geometrical forms become meaningful as they construct angles and draw polygons with the aid ot compasses or protractors. Each one has a chance to apply his math in practical situations when he reads graphs, estimates amounts, and deter- mines distances. BELOW HIGH-SPEED MATHEMATICS . . . The slide rule proves a real attraction for these mathematical Wizards as they evaluate its usefulness in relation to problems in advanced math. Barbara Frombach, Ellen Francis, leanine Green, David Gruver, Iohn Cainski, and David Putnam. Page 22 Science...Survey of the C0 mo ABOVE HOW GREEN IS OUR GARDEN . . . Sylvia Detlaf, Gene Eggert, Williani Guhl, and Carol Hengst can identify many different plants since their work in the greenhouse brings them into clcse contact with various types ot foliage and tlora. IOURNEY TO THE STARS . . . With the help of the planetaiium model general science students study interesting phases oi astronomy. CHALLENGING THE ELEMENTS . . . Chemistry students Tony Mock, Edward lung, and Tkhomasine Smiley test the combustion of oxygen. SEEING DOUBLE . . . The mirror and lens demonstration in physics is conducted by Fran Hama f and Torn Hawks. Whether he is working in the growing room or in the laboratory, whether he is using helpful apparatus or resource units, the science student endeavors to find out more concerning the world around him. He investigates topics ranging from the anatomy of the earthworrn to the sources of atomic energy. At all levels of the science curriculum he explores the mysteries of the universe and learns to appreciate the contributions of applied science to modern living. I Page 23 1 History and Language. .. Iflhhcfo W5 on the World ABOVE FOCUS ON HISTORY . . . Movies that teach supply necessary information and add pleasure to class sessions as is evident in this photograph of S. history group. Reading and discussion are important in the study ot history, but modern inventions like the camera and television reveal a three dimensional View ot history that is unique. On the spot recording ot the historical panorama helps students keep pace with the epoch-making events ot the moment and develops an awareness ot the role of both stability and change in the growth ot nations. Familiarity with a foreign language opens the door to new interests and achievements. Learning Spanish, French, or Latin promotes good fellowship with people ot other countries and acguaints one with the culture and customs prevailing in various parts ot the world. To be able to speak or read in a toreign tongue is a very rewarding personal experience, as any language learner knows. OPPOSITE PAGE CONTINENTAL ATMOSPHERE , . , The pageantry of the past and the enchantment of travel have a special appeal for language students Marilyn Strobel, Arlene Steigal, Iames Hickey, and Tom Stoginski who are looking at articles from Mexico and France. Page 25 Music. .. Program For Enrichment The music department provides the boys and girls oi Lindblom with a chance to extend their knowledge in this field and to exhibit any aptitudes they may possess. Classes in music appreciation give an insight into the lives ot great composers and an acquaintance with diiterent forms of musical composi- tion. Through the orchestra, choir, chorus, or band the individual may partici- pate in the musical activity which appeals most to him. STRINGS CAPTURE THE RHYTHM , . . Note reading is a basic step in learning the fundamentals of music and is a necessary requirement for choral and instrumental Work. Row l4Ray Gantt, Patricia Bell, Row 2-Otto Shaden, David Controrer, Theresa Setzke l Page 26 5 5 5 1 ,....,........-..M- .ww W, W Q x Qmgff,-,,,n:z:: zgeffsr., sf h :fi g gggs yzgg Ave- fy ,K ff-1:11:11-,: 32 M WNW A sz. ' K , 'QM gi ,Z :... f Y 1 'H W I lk 'N I ' ' ,M ,, ,m iifff 35? 4 hy Q .....,. N f , ., Q, K, Q E V' 'M 1 W -f- - W 15- A 3, KW I My :--:- is 5 , W 4 M W gf! ' - '-': 1 2:25: 25 5' K V ? 12f2f : ::: ' m tw- is 5 , , iq. if W 3? S 0016! Studies. . . Pageant of Human Progress in civics classes students are instructed in the duties and responsibilities ot good citizenship. Projects such as panel discussions, debates, and the enact- ment oi political events help the iuture voters of the United States to secure a true understanding ot democracy and our American heritage. Since a tree society needs a Well-informed citizenry, students learn to keep posted on current events of national and international signiticance. Society benefits when every- one knows the essential iacts about the framework ot his government. Mo LE EX THEUKN Y IJ INTERNATIONAL VIEWPOINTS . . . These students are examining products from other lands and pointing out exact geographical locations as they consider the extent of U.S. imports and exports. CIVIC STUDENTS LEARN NEW METH- ODS OF VOTING . . . Mr. Kaplan dem- onstrates the technique of the voting machine to some members of his class. IT WAS TIME FOR A CHANGE! . , . ln conjunction with the nation-wide Register and Vote Campaign preced- ing November 4, Lindblom students are shown participating in a mcck election. Page 28 PITMAN STRATEGY ON DISPLAY . . . The girls practice short- hand exercises on the blackboard in order to gain greater pro- ficiency in learning the symbols. QUICK COMPUTING . . . The basic procedures of arithmetic are speeded up with the calculating machine. ferry Wolters knows its value in adding long columns of figures. Commerce... Key T o Economic Competence Busy fingers and alert minds strive for speed, efficiency, and accuracy in learning stenographic, calculating, and bookkeeping skills. A mastery of the Work in this field assures the student of a successful career in the business World. ln addition to the classes which stress the basic procedures of good office practice, the commercial department offers courses designed to give general information about the economic and geographical factors which affect World trade and industry. Page 29 Mr. Smith - 205B Row l Zalem: Templeton: Marlewskif Wil- kosy: Pulido: Hill. Row 2 Taylor: Mietlicki: Lavlne: Wertelka: Zihlman: Rosdil: Tucker. Row 3 Alesky: Kavooras: Sie m e n k ow s ki: Brown: Bond: Sykcra: Goelz. Row 4 Woods: Schultz: Shelhamer: Lojew ski: Rezner: Srniciklas. Mrs. Taymor - 322B Row 1 Carvel: Simmons: Lange: Wheeler: Finucchio: Preza: Platiner. Row 2 Re-nnhak: Giusti: Heisler: Crane: Belton: Peril. Row 3 Morrison: Haros: Wolfowicz: Lucas: Kisha: Krause. Row 4 Glosner: Pavlik: Plucinski: Behling. Gefffhg Acqualhfed S Page 30 Freshmen . Mrs. McGrath - 119B Row l Klingman: Potat: Cerney: Anderson Mahn: Iulkowski: Trick. Row 2 Rappelt: Sala: Fleeton: Shauqhnessy Babanicols: Danbravskas. Row 3 Rizner: Pre-uss: Steele: Daccardo Morrison: Gartner. Row 4 Johnston: Ryan: Henckei Warren Clark: Holmquist. ln A ew Freshmen . Miss Howe - 312B Row l Dcukscxs: Clymo: Konieczny: Iessie: Sopron: Szeszycki: Mesurcik, ROWZ Misic: Bradley: Pernek: Williams Genge: Riley. How 3 Wrobel: McKee: Hofbcxuer: Berqsten Siemorm: Musser. World ROW 4 Barista: Warren: Morlfxn. Page 31 Miss Moore - 206B Row 1 Ncrlewcxy: Tomctszewskcl: Polnoszek: White: Kubin: Moody: Kilinski: Wczel- chli: Ccrden. Row 2 Nowak: Weiner: McElroy: Locker- smith: Grant: Horcrites: Gruvee: Ferro. Row 3 Levigne: Setzke: Olszewski: Rwbcxsch: Mcmcejuk: I-leppeler: Aclers. Row 4 Lemezis: Smid: Gcxzdzjuk: Sioginski: Ieffries: Luxford: Mott, Mr. Wersells -129B Row l Kcmncpien: Kcxvaliqnus: Broods: Ab- bott: Burbecru: Zulfer: Gorlicki. Row 2 Stefcmski: Schumol: Kernpiak: Cumer- lcrte: Miller: Low: Supikcxs. Row 3 Wydrcr: Divincenzo: Wohlwencl: Mr. Wersells: luck: Koski: Schultz. Mr. Kushtct - 210B Row l White: Palenica: Silberman: Krueger: Craven: Taylor: Voltz. Row 2 Vilimek: Dornbos: I-Xdamore: lankow- ski: Miller: Polaki. Row 3 Thomas: Rusczyk: lones: Ulatowski: Devlin: Lanclci: Sappenfield. Row 4 Marshall: lupin: Zaruba: Preiiy: Boyd: Porzygnot: Glislc. Miss Delaney - 109B Row l Davies: Hurley: Keene: Labolle: Sol- tis: Zqlobicki. ROW 2 Lyszczasz: Korper: Tabian: Danforth: Parmelee: Buysse. Row3 Hooper: Eskildsen: Armalis: Sahr: Bambera: Siegel. Row 4 McKee: Schilling: Fessett: Callahan: Garber. Fresh !?ecru1'f5 Freshmen . Miss Daly -- 309B Row l kowski: Fix: Fare: Babka. nv Row 2 Crowley: Trauimann: Kraus: Touari: Sekero: Laniica. Row 3 Donaldson: Yound: Eckenroih: Wlo- darczyk: Miehle: Louqee: Exline. ROW4 Keene: Brumlik: Todey: Pold: Schiecke. Page 32 Sandora: O'Donnel1: Voelker: Piat- Full Uf Spirit Freshmen . Mrs. Brown - 301B Row l Scott: Lieser: Kamradt: Styczynsky, Canavan: Good: Havel. ROW Z Taller: Pacholski: Ferguson: Murray: Nowakowski: Schreihans. Row 3 Shoup: Strava: Kuehner: Skiba: De Milo. Row 4 Powers: Lillwitz: Darlington: Peterson. ,ml 'sa- Paqe 33 Mr. Schmitt - 321B Row l Pressman: Sullivan: Yates: Pratt: Griffin: Burzinski: Sorrentino: Vene- qas: Welsh. Row 2 Sowinski: Pinter: Kerrill: Lindauer: Williams: Lahr: Mulhern: Horwath. Row 3 Anderson: Schiecke, Kulikauskas, El- henicky: Sullivan: Ryan: Zion. Row 4 Cinotto: Hegener: Senkus: Czirr: Peterson: Tontsch: Glaza: Wincistrup. Miss Ehrenwerth - 203B Row l Zakes: Kremer: Iackson: Redman: Klaup: Mitchell: Oswald. Row Z Wojnarowski: Skiba: Mudra: Iedrze jak: Svoboda: Krolak: Craven. Row 3 Grzesiak: Patton: Meesit: Schalk: Valla: Simmons: l-lakala. Row 4 Aqrimonti: Betz: Matkovich: Peterson: Hong: Garrett. Row 5 Geary: Iohnson: Arbutan: Sprinqer: Wendell. Mr. Spcxtz - 122B Row l Kncxuz: Klinqrnon: Douglass: Blcztt: Checlpeske: Wctbich: Riley: Schmitt. Row 2 Dawson: Peterson: Hebert: Deplew- ski: Thompson: Kosiek: Pelvic, Row 3 Conwczy: Preston: McCowin: Cull: Harris: Kircik: Powling. Row 4 Holmes: Cctncrvczn: Ebel: Mr. Spcxtz, Hedge: Artus. Mrs. Hayes - 303B Row l Morelli: Szolkus: VctnWestriene: Ben- der: Kerzun: Fcrjsl: Tremmel. Row 2 Mroz: Dudney: Plucinski: Berryman: Levinthcrl: Prikopcr: Homuth: Luczyn- ski. Row 3 Grios: Smith: Donek: Polctc: Dawson: Stctwikowski: Mcttuszctk: Szcxioni. The Growing Years Freshmen . Mrs. Anderson - 104B Row l Wojtctnek: Antezctk: Revish: Keltner: sick. Row 2 Dombrowski: Kilinski: Mcidey: Sny- der: Torrence: Bostelmcm: Hoekstro. Row 3 Ehlermun: Wcxiberq: Samuels: Lit- vicin: Kroen: Whipple: Fronkiewicz. Row 4 Boker: Bcrrkowski: Diwcter: Hrcr- decky: Wilson. Page 34 Mctrcelles: Urbonictkp Centino: Andry- Makfhg Progress Sophomores . Miss C. Murphy - 2191-X Row l Horn: Boehm: Iordcm: Weeks: Smith: Hasenbank. Row 2 Burich: Nutley: Ietton: Bischoff: Ben- line. Row 3 Brenner: Sutcliffe: IQ nik: S c o p o s Krcrmp: Pcryrxe. Row 4 Suwinsk: Beam: Szeszycki: Pell. Mr. Williams - 2071-X Row l Grunt: Reed: Vcma: Bloom: McKin- sey: Porter: Henderson. Row 2 D e M u rn b r u rn: Williams: Whetselr Ledebuhr: Iucko: Heher. Row 3 Zcxrubcr: Plohcrr: Bcrder: Ahrehs: Re- hor: Nielsen: Scxbo. Row 4 Ehri: Bieluwu: Frcxin: Mock: Kugel. Page 35 Mr. Labcmt - 202A Row l McClcry: White: Rabiq: Kulis: Wil lcmd: Schrcrm: Bromcm. Row 2 Rose: Luccxrelli: Kubci: Pircid: Bun yung Price. Row 3 Ferst: Eqcm: Voigt: Plohcxr: Fcsick: Belden: Wctsilecuskcs. Row 4 Connelly: Pcrlctdino: Tuttle: Whitney: Urbcmcki: Lach. Mr. Kaup - 120A Row l Keeler: Nashek: Sindelar: Bayer: Hansen: Kirkland. ' Row 2 London: Andersen: Auksi: Iordan: Hall: Nixon. Row 3 Misch: Kinner: Boersi: Wenta: Hiich- cock: Horna: Axelrod. Row 4 Runsey: Bull: Erickson: Turek Hickey: Kobylecky: Craven. Mr. Crofis - 129A Row l Duncan: Annalory: Sindelar: Conkey: Sutor: Kavanaugh: Nutile. Row 2 Pradon: Jacobsen: Riqsby: Porter Zolly: Berline: Peschel: Doljanin. Row 3 Kosch: Raveriy: Kowalzyk: Randi Clark: Roqovich. Row 4 Kionka: Riese: Mr. Crofts: Slanger Grey: Hudclleston. Beyond the Confused Siege Sophomores . Miss All - 210A Row l Moore: Rego: McAllister: Rout: Olsen Morqanski: Sturrna. Row 2 Thornsoa: Smith: Richards: Williams Lipinski: O'Connell: Timrnerman. Row 3 Mayer: Noll: Deqnan: Edwards Bierowicz: Venturella: Erickson. Row 4 , Mravca: Kolodzieu: Hill: Wierus lnnis. Page 36 lnihb tion Comple fed Solohomores . Miss Wetterlund - 212A Row l Zimmelrnan: Rahn: Prodan: Paszkow ski: Centino: Henderson: Iacobs: Elliq. Row 2 Ambuehl: Schuellerz Paul: Marltila: Keiner: Kaysen: Heinrich: Sieball. Row 3 Pace: Dorus: Whalen: Mitchell: Stof- ley: Million: Galsa. Row 4 Neubeck: Hill: Stokes: Krzcrk: Lawler Miss Garrison - 325A Row l Poulos: Kubin: Virzint: Perieito: Schiei- elhein: Chaloupka: Schnitz: Melker: Lipinski. Row 2 Ronayne: Freundi: Albrecht: Fitz- patrick: Weir: Royse: Cervak: Usav- aqe: Bell: Bunneqar. Row 3 Cullen: Deplewski: Szoslak: Smith: Garrison: Precin: Aliise: Sherwin: Cox, Row 4 Debow: Warren: Powell: Klein: Win- inqs: Malik. Miss Dowd - 121A Row l Sherman: Kwiaii: Nelson: Peirson: Thom: Crolty: Vinar. Row 2 Green: Ruzicka: Wells: Medica: Krcik: Weiher: Siima: Oko. Row 3 Zawackik: Zappavigna: Hicks: Ba- sile: Dister: Kaiser: Kasotakis: Ritola. Row 4 les: Hueria: Stevens. Page 37 Wessberq: Novak: Hehl: Lewis: Nil- DDDDD D l Seeklhg the Know-How V Sogohomores . Mr. Sommers - 110A Row l Manasses: Knipfer: Ioniak: Wanner: Stroker: Brandstetter: Hanna. ROW 2 Norsic: Moore: Banks: Kress: Mal- ecek: Galbraith: Gorman. Row 3 Nimz: Sinqraber: Giraldi: Drake: Gorski: Sroka: Ceithaml. Row 4 Dasbach: Fleckenstein: Eqgert: Sala: Green: Roberts: Stile: Barnett: Barcy. Mrs. Schlacks - 312A Row l Hayward: Deiber: Gandy: Somes Doria: Doherty: Lello: Welsh: Gomez. Q Row 2 Willett: Maceyak: Gresh: Klein: Mrs Schlacks: Grubisich: Buckley: Male sich. Row 3 Szarka: Martin: Crane: MacLean, Lewis: Luth: Altschaftl: Burger. Row 4 Koronkowski: Noel: Schyltheis: Cun- nea: Hichey: Clausius: Grimm. Mr. Garbow - 204A Row l Chiarappa: Aalderks: Kadlub: DeAn qelisz Kulikowski: Clifford: Sullivan Row 2 Greenwald: lany: Mietlick: Moolin: Wals: Olson: Ruffolo. Row 3 Koldoft: Holke: Meyer: Aylward: Mr. Garbow: Malick: Mohl: Parrish. Row 4 Hofimeister: King: Folta: Isbita: Ward: Donovan. Page 38 IfM'z'h Banners Flying Sogohomores . Mr. Von Bremer - 227A Row l Debattista: Szul: Highland: Walters: Gross: Simmers: Detiaf. Row 2 Washington: Breuker: Piontek: Car- penter: Yorek: Carter: Snodgrass. Row 3 Kelly: Bianchi: Kopay: Fhiede: Lacni: Reeder. Row 4 Suich: Reagan: Breit: Sima. Page 39 Mrs. Schuhmcmn -- 3241-K Row l Frazin: Harris: Wahlgren: Finley: Williams: Goldstein: Knor: Doyle: Fleckenstein. Row 2 Godwin: Eichman: Higgins: Balge- mann: Greif: Thomas: Burzinski: Chronicky: England. Row 3 Francis: Glowacki: Broman: Waria: Mrs. Schuhmann: Schmidt: Sabatino: Urbanski: Schar. Row 4 Ullrich: Connelly: Kennedy: Sawyer: Spiegel: Marron: Fonte. Miss Harris - 203A Row l Amione: Sparacio: LaDuca: Haros: Bailey: Armato: Schuch. Row 2 Vernon: Meyers: Gierut: Novosad Olah: Hoeltzer: Rabideau. Row 3' Stala: Boscarino: Flentje: Blazek Bouton: Zegan. Row 4 Weyde: Manak: Mahoney: Gleim Agnew. I Mrs. Dennis - 206A Row l Pinelli: Clark: Santo: Roskos: Gru- hike: Wcllenty: Scott. Row Z Golbisch: Koleski: Suk: Rodclutz: Muqerstcredt: Sobey: Vojtesok. Row 3 Rctjewskiy Lange: Bonnevier: Kclscxk: Vytlotcil: Hillebold: Pcrzcrn. Row 4 Kutrewok: Pee-ry: Moore: Ieiiries: Lentini. K Miss E. Murphey - 226A Row l DeViito: Folsom: Horvcxih: MICIZ: Iunq mon: Cranston: Hengsi: Spcirotcio. Row 2 Smith: Poini: McGovern: Carter: Ol- son: Ritchie: Taylor. Row 3 Vieccx: Prell: Strom: Yerkovich: Sloon: Huriy: Kerrill. Row 4 Iohnson: Suior: French: Smith: Min nick: Thomas: Norris. Folio wing the Pa th Sophomores . Mr. Kaplan - 112A Row l Dcmizer: Weissenhofer: Boiiin: Kelly: Werner: Ferry: Kubin. Row 2 Rcznclich: Zyckowski: Eder: Nizick: Thiele: Gronkowski: Knight: Iurus. Row 3 Morsovillo: Slcxrncr: Ccrson: Mr. Kup- lcrn: McFarland: Pcrvicr. Row 4 Long: Furlong: Bullard: Morstodti Scrdlis. Page 40 To High er A ffafhmen is Sophomores . Mrs. Newman - 118A Row l Turco: Masiowski: Winings: Osis, Smaltz: Vicich: Conlon. Bow 2 Ienninqs: Beckman: Gopoian: Chibe Wagner: Doyle: Sweeney. Row 3 Burke: Ambroze: Kaup: Deist: Ulh- towski: Sochacki: Graf: Hirtz. Page 4l Miss Ruskin - 320A Row l Schmidt: Zakaria: Kovarci: Smilh: Vxfellsg Lazo: Murray: Bender, Row 2 Vanecko: Pruim: VanDyke: Hoyne: Mills: Burke: Kolar: Crites. Row 3 Macley: Iaworski: Caclitz: Spitzke: Ierfries: Goldman: Weaver: Row 4 Shipanik: Miller: l-laych: Hiniz. DIVISION ABSENTEES Row 1 Halaqan: Casey: Ienninqs: Paschke: Burke: Fitzhugh: Boehm: Giqlio. RCW 2 Kearns: Mazar: Morgan: Krause: Gor- man: Hcfer: Madsen: Lanc. Row 3 Sweeney: Lundy: Boness: Grabow- ski: Petersen: Peterson: Shodeen. RCW 4 Proctor: Virvcr: Wolniak: Rich: Letour- neaux: Bohnstenqel: Bisgrove. The Pace ls Fast SECONDS THAT COUNT With the opening of the second semester in February, Lindblom students were introduced to a new schedule ot classes. A readjustment of the school program abolished A and B divisions. Under the new system all home room groups meet at the same time, and everyone enjoys a regular forty minute lunch period. From all viewpoints the division session is a very significant part of the day. Important matters relating to school policy and pupil welfare are com- municated to the entire student body during division. For the high school boy or girl the division session is a clearing house for activities and an opportunity for socialization. The success of all school undertakings depends upon the support received in the home room. Whether it is a football game, a subscrip- tion to the school newspaper, an I.C.C. project, or an assembly program, the efforts of both the administration and the student body are co-ordinated at division. The division period is also a time for personal counseling and encourage- ment by home room teachers, those very special persons who are our guides for the four years of our high school career. Each division helps to build school morale: together, they all symbolize the spirit of Lindblom. luniors Miss Howcrtt - 106B Row 1 Ianicki: Hofsteadter: Anderson: Vestal: Walsp Gerber: lhauiauli. Row 2 Frank: Williams: Sefcik: Basner: Win- iarski: Greene: Vaccarella: Frombach. F ' Row 3 Se-nkpielg Orszullap Sirnkusg Rachfordg : Camlic: Krajewski: Bans- ford. Miss Shallenberger - 223B Row 1 Lewis: Sopko: gshighgg' Davidson: Iohnson: Hardy.: Row Z Linql: Mazurkiewicz: Parra: Wagner: Reid: Fowler: Sweeten. Row 3 Zekios: Putnam: Monreal: lohnsg Probst: Bogden. Page 42 Busy Schedule luniors . Mr. Lyngby - 123B Row l Armstrong: Arbetan: Narcarti: Berna, Cczinski: Milligan. Row 2 Granzow: Greene: Bogner: Cameron Shanahan: Robinson: Pells. Row 3 Sweeney: Dalescmclro: Breyer: Berch man: Thomas. Row 4 Manning: Kroll: Mr. Lyngby: An- tonelli. Page 43 Miss Bowen - 208B Row l Noble: Brya: Fleck: Alclerson: Blatt: Wisner: Oswald. ' Row 2 Owen: Burton: Pederson: Harris: Piefier: Milleg Paluck. ' Row 3 Best: Hudson: Hunt: Hendricks: Guhl Miss Claridge - 302B Row l Kernica: Kosler: Angelos: Hanson: Sawyer: Morris: Linnecrr. Row 2 Pyburn: Feeley: Kunter: Scheune mann: lohnson: Toma. iii Row 3 Pinkowski: Walschloger: Alesky: Korbakis: Keating. Row 4 Leolebuhr: McClain: F e i c h t in g e r: Havelka. Next ln Line Mr. Solomon - 127A Row l Silon: Graniz: Gwozcz: Voss: gusset. Row 2 Sais: Xbounq: Vaisvil: Martin: Brzoski: Kelly. L Row 3 Bonorno: Underwood: Elch: Betts: Pieroq: Pasalevich: Condon. Row 4 Gantt: Kot: Rott: English. luniors . Mr. Abrahamson -- 112B Axelstrorn: Strernpler. Row 3 Slivkag Marino. Row 4 DeLeqqe: Voltz: Nutley: Tuttle. Miss Ccrllen -- 219B Row l czrris: Hansen: Porter. Row 2 Pastorello: Kovacich: Schlake: Burg chardt: Neel: Howell: Geiser. Row 3 Orszula: Karnradt: Morano: Alba monte: Melcher. Row 4 Gruver: Wallbruch: Peterson: Hruby: Albrecht: Kerwin. Page 44 Nt Row 1 Fra 's' Hannan: Rullrnan: Fuchs: 'Eusselh Barbarek: Winn. Row 2 Donnelly: Petrowski: Mitchell: Yates: Linql: Swanson: Mr. Abraharnson, Mil ' Stearns: Hatala: Bertsos: IXWII7 Heads Held High Iuniors . Mr. McCullough - 106A Plow l Dziedzici Cull: Evanow: Zarernba: Blakeman: Nihill. Row 2 Urban: Trlak: Putz: Iermolowica: An- derson: Wojnarowski. Row 3 Skow: McKinsey: Fahlbusch: Schoen- hardt: Pendola. Row 4 Bonasera: Ransay: Samuels: Barker, Brown: Palider, Page 45 Mr. Flcmigcm - 301A Row l Bee - Szalkus: Davey: Yanik: Glover: oe-ski: Starr: Lojewski. Row 2 Sobieski: Cole: Campbell: Howe: Pold: Krumpoch: Kiphuth: Maurer. Row 3 Patton: Parzyqnat: Murphy: Neu mann: Snyder: Rirnmele. Row 4 Williams: Markel: Walus: Burke: Aders: Bailey: Holoubek. Miss Appleby - 230A Row l Payne: Ruzevick: Fanslow: Smith: Stearns: Babock. Row 2 Scales: Bell: Martens: Schultz: Bauer: Skly: Klaub. Row 3 Kaqel: Lasko: Friecllander: Greninq: Gurney. Row 4 Swartz: Breicha: Bukowski: Ledman: Thompson. 7 heir Goa! ln Sight Mr. Shore - 104A Row 1 Bures: Wysocki: Sheppard: Manke: Kaiser: Schramm: Hudacek. Row 2 Busse: Tribe: Tassel'f:,EnoEE: Zaruba: McGregor: Smiley ' Row 3 Volkema: Warnik: Cross: Bauer: Ratoike: Prosika: Iones: Baumgariner. Row 4 Pitts: Smale: Nelson: Zyckowski: Blank: Gardner: Minnick: Parker. Mr. Moehle - 303A Row l Kappeler: Schar: Stefanski: Sroboda: Sheridan: Rainbow: Mobley. Row 2 Feller: Caruer: Remperi: Polk: Tieiz: Leslie: Brougham. Row 3 Krueger: Rosenberg: Felincxak: Iiskra: Halama: Masterson: Ventur- ella: Hartmann. Row 4 Ruffold: Varanauski: S C z e I3 a n s k i: Selhke: Yara. luniors . Mr. Weckel - 2081-X Row l Willhoiie: Ponschke: Porter: Gallo Utsch: Iones: Tiius: Crvich. .T-nz ROW 2 l Sichman: Stekles: Morgan: Wilcox. Row 3 Douglas: Kavois: Nelson. Row 4 Schweikeri: Openlander: Schultz. Page 46 Skiba: Huiter: Theecle: Schroeder: Ruhl: Timrnermann: Haller: Dohse: Spiegel: Kubilius: Baucevic: Hazen: ln T X713 Merry Whir! luniors . Miss Calkins - 231A Row l Scholvin: Heston: Lockwood: Dolan -lrioighkg Rozanas: Coffey: Babka. Row 2 Ellefesen: Lally: Robertson: Thomas Schmeister: lust: Garrett. Row 3 Peters: Ryan: Shields: Strelec: Roach: Sukey. Row 4 Little: Litniak: Werner: Jacobsen: Briley. Page 47 Miss Goe - 109A Row l Neis: Ruzicka: aelody: Ronayne: Schmidt: Letourneau: c neider. Row 2 Lencrneyer: Garnauf: Ambroz: Ander- son: Trein: Erickson: ,te. Row 3 G Schaffer: Williams: Trevillian: Barry: Carlson: Connely. Row 4 Hill: Cernak: Bain: Larnoureaux: Skapek: Phelan: Hooper. Miss Hogan -- 122A Row l Wertz: Breyer: Durnell: Porter: Rob bins: Richison: Cappas: Rzeszut. Row 2 Cook: Milanowski: Shlensky: Hart ley: Nelson: Klemens: Pells: Wilmes Row 3 Kenney: Foltz: Porernbski: Eifert: Klat man: Bufka: Urban: Pecka. Row 4 ' Bednar: Zawetski: Kuznicki: Kuta: Gentleman: Gibbons: Iessels. Miss R. Brown - 319A Row l LKalamaras: Murlasiis: Kisz- kan,f'Sleir1: Reid: Gruhlke. Row Z Noble: Bahr: Mottys: Canda: Rucker: Wodrich: Grady. : Row 3 Kcsman: Silberman: Grindler: Alex: Booker. Row 4 ' ,' Vander Waqerl: Tremmerl: Scaper- dine: Billings. Mrs. Nisbit - 302A Row l Schultheis: Florian: Kilarski: Maqeras: Osirowski: Are-an. Row Z Brandi: Ketchum: Wesel: Yehlirie: Vana: Wallow. Row 3 Schobert: Domenk: Kufta: Fleck: Bosiik: Manasses. Row 4 Polo: Quirk: Gizowski: Palmer: Bud- revicius. The Tempe Change luniors . Mr. Goodman - 108A Row 1 Gallas: Thomas: Knor: Hazzard: Mc Lean: Carlson. Page 48 Row Z O'Cormor: Nance: Hubbard: Dapkus: Anderson: Warner: Wimpenny. Row 3 Ambroz: Klancher' Minasian: Paw lowslci: S. awrence: Kestas. Row 4 Motel: Wienke: Zacoviich: Kaiser: Kabica: Vosaika: Kuristrnan. Second To one Seniors . Mr. Mulvcmey - 226B Row 1 Stiqberq: Anzilotti: Rank: Sieczkarski: Pitiel. Row 2 Mack: Thomas: Piklor: Turner: Gardner. Row 3 Berger: Rhodie: Sobieski: Szeilin: Baukus. Page 49 Mr. Icrkus - 108B Row l Cerino: Layo: Walters: Mackoff: Krencik: Klemens. Row 2 Kitchen: McLaughlin: Fontana: Eozd: Setzke: Kockalka. Row 3 Kelly: Kornba: Mr. Iakus: Vivada: Sanders: Rappelt. A Mrs. Connolly - 127B Row l Hanson- Peters: Fox: Hu - Lcnghom Row 2 Dean: q: Gabbert: Smith: Siam bulis: Harder. Row 3 Putzler: Slansky: Watson: Strasser: Earle. Row 4 Stotts: Scoichmur: Riesland: Lamacki: Scheulin. Mr. Hunter - 319B Row 1 Kuvcxles: Wojcik: Gill: Coffey: Knopik: Nelson: Mr. Hunter. Row 2 DelGiuc1ice: Schoell: Gallagher: Mor- vis: Motlesic: Seitler. Row 3 Ierfries: Lcxzctricp Cervinkct: Summers: Lemmert. Row 4 Roberts: Wiedow: Mcmzellcr: Bender. Miss Hackenbroch - 207B Row 1 Pusstelnik: Ehryogkg Wheeler: Mac- ciocchi: Host vcr. Row 2 Behling: Hourd: Schnier: Petitte: Horuk. Row 3 Sokol: Pieloer: Rach: E s k i l cl s e ri: Krueger. Row 4 Rcnsiord: Griffin: Kocbalkg: Clark. Mission Accompli hed Page 50 Seniors . Miss Garrity - 120B Row l Heher: White: Amirgnte: Brctcisch Pohrebny: Rouen: Romey. Row 2 Sweet: Gubel: Noel: Stumbulis: Kin ney: Freckelton: Hull. Row 3 Grikg: KCIZdC1lj Treml: Hill: McGinley Rochford: Voltz. ln Memoriam Mr. Paul I Rupprecht On May 21, l952, Mr. Paul l. Rupprecht, a member of Lind- blom's faculty for twenty-seven years, passed away. For the last fourteen years he had served as placement counselor. A native Chicagoan, he received his education in this city. Lindblom remembers with gratitude the long, able service of Paul Rupprecht. For many years, as counselor and teacher, he exerted a constructive influence 'upon the lives oi numerous students. His broad sympathy, courageous manhood, high sense of personal responsibility, and generous spirit of self-sacrifice endeared him to thousands, and in their idealism and character he weaves himself into eternity. Page 51 ! p ly' 'X '1 if T A. V Q.. ,xiii , . 44 '- ' x N 1 . J f fvf , Q Jlfjt Q V257 I :gf ig f . fa i ' A f f fm 'Q fggj . ff 'NST ' 5 fWz V 5 I Z uiqvg, X , .I ' iff! X . Lf? 1 . C f- vgsf' 4 i 3 fr 'f' jf' s- ff' ' Q 1' ' 19' xg t 1 f, -I, ,',i' ,' - 1, 1 ff' '.', jd -1.-wgff-m1,f ff ' ful T pi Qlllzfffyl ffl' f ll 1, f,'5fl,. fxfv V- - . Zfffff' X gul f t I 711, I' ' X I f'7jfQff ',- T I I - 11,4 I ' z' j Cff,2Q7l'f 54515, A 79 It Witt ' I .0 'ilifjgfff ' T I K Q 1 I 'L , X ubwzt 34 'f' H midi' I T CW IIHEHEII MOMENTS THAT SIGNIFY Acquiring new friends . . . Working to- gether . . . Choosing inoiivioiugi interests . . . Plgnning new projects . . . This is your trgining-ground for iegdership. Page 52 T cti ities 1 -r Iim Carlson Dorothy Ambroz Ed Iiskro leon Angelos 2 14 A W 14 2 Y 4 V 23 ii El Q A 1 A if 'Z17ce MOUHflhQ Larks, To the New MUFHIWQ Smgf' With a song for every season and music to match every mood the A Cappella Choir contributes greatly to the enjoy- ment of life at Lindblom. This group, one of Lindb1om's most active organizations, sings for many assemblies, give elaborate productions at Christmas and the Spring Festival, and makes personal appearances for club and civic groups throughout Chicago. The choir has brought fourteen shields to the Walls of Keeler Hall, including an won in the spring of l952. A memorable event of the year was Metrical Madness, a merry musicale Which Was presented in November. A variety show, it featured typical Americana medleys, including Ranch Rhythms, a fraternity singing scene, and a circus extrava- ganza. The proceeds of this performance were used to buy new robes for the choir. One of the finest honors a choir member can receive is an invitation from Mr. 'Willard I. Congreve, the director, to join the Madrigals, a choral group which numbers sixteen beautiful voices. This selective group sings for special performances. MH. WILLARD I. CONGREVE Choir Director A CAPPELLA CHOIR Y A Row 1- Row Z7 Row 3 Row 4 Row 5 Row 6 Maierczyk, Chiarappa, Doria, Mollis, Wat- son, Hubbard, Sieger. Nizich, Rempert, Boehnke, Rezut, Hale, Gialamas, Lundin. -Irion, Harnach, Marting, Dadas, Dedic, Canada, Cervinka. Kovalcik, Angelos, Young, Smith, Yerko- vitch, Forbes, Kaysen. -Sutko, Kelly, Bellis, Burkin, Carpenter, Sopko, Dasher. -Abdul, McFarland, Keating, Rach, Bie- lowa, Kuvales, Rio, Peterson. Row 7--Kulikauskas, Mitchell, Cervinka, Putnam, Row 8 vllalesandro, Markel, Kulikauskas, Sutko McKendrick, Smowton. Smith, Tre-ml, Barker, Stevens. I MADRIGALS Row lfM. Sutko, Abdul, Kovaicilc Sopko, Gialamas, Smith, Rio. Row 2fCervinka, Lundin, Sieger, Young Boehnke, Mitchell, Rach, Row 3--l. Sutko, Streml. Page 54 5 .M M., A 5 - A , af V 91 at gf ' .,..2 '-22' Q ,. I , 2. wh , J -V -::.: 2-fs ,,.,.-, : -. --,- 1 .sf AA., vw as 3 -my 'gf' ,jf 6. if V. ,..,., 2 at 2 A ,., T J . , px 9 ., 7 fa x KV Q Q im E, QQ , izzi' i A:f fl? .,,, Q -W , - - -Y--vf --- A- --- Y ----- 'HA ' ' A ' ' .. 1 1 V W , f ' '2:2 1 . ' . v'A.-f C 2- 'f '. f if W f 55: 2 -:-:-- -42 -f-' if 'M 5 S ' 2-ff' .N Q a:f .X 4 .:. ,...v, M u Y 5 v':v ,A E fi wi l r . 1 'Q' af A ' f ..:, ' L E A g f xg I -, as 5 5 'sji .g I ' 4, M M X Q 5 W fi f 5' 2: if , 5 fy. af 5 2, ,S I 5 X 5 , ,ei X fi A Musica! Parade of Melody 'L.T.H.S .... Hold that line! While the stands cheer, the Lindblorn Concert Band re- sponds With the stirring strains of the Loyalty March, and, as the music echoes over the foot- ball field, all Lindblomites are inspired to root with greater zest for the team. Resplendent in their uniforms of maroon and qold and bran- dishing their shining instruments, the members of the Concert Band lend a dashing note to all school festivities. Band personnel was increased this year with the introduction of a drurn ma- jorette and two baton twirlers Who provide animated leadership for our music-makers. A football qarne Would seem incomplete Without the enthusiastic support of the Concert Band, ' assemblies always as- sures the audience of good entertainment. Mr. Christian Lynqby is their musical mentor. BAND PERSONNEL Director-Mr. Lynqby. Majorettes-Williams, Mazur, Cerney. Drums-Wessburq, Kenney, Dorus, Gabel. Trumpets and Horns Row l-Melody. Row 2-Sabatino, Kersten, Porembski. ROW 3--Kroll, Person, Paluszek, Ruzicka, lsbitz, Maulsby. Trombones and Tuba Row l-Shodeen, Caditz, Kacor, Cason. Row 2-Kelly, Sulcey, Doyle. Saxophonesflflanning, Ponte, Booker, Rank, Meyer. Clarinets, Flutes, Oboes Row lfl-lintz, Gresh, Gull, Ruhl, Row 2-Porter, Sefcik, Du Pere, Milligan, Narcarti. Row 3-Greene, O'Connor, Nimbs, Anderson, Glover. Row 4fKazlcluslci, Kroll, Pold, Kuzweil, Cameron. Page 56 'ins 2, LLV. SQ Y ,.,f 'M gr- e ,f '+. 3 . w f 'sX f' vkw, t Aw . ,, If .. ,,.: u V . OL, ,Q G, Q-X ,,.,..,--.,,, f' .WMUMDKW UTM - 9 W i f.. M i I Q,- 'C M fs 2 5 X. af funuuvuwmi if L .,, , fr' 6. awww ff. :,,,fbE.,..,..:.m. 4, , ,L , :Ed bit' Img :g ' ,gf j:: ' 6f w- .... '. ' M . ,mx W . ? , 1 . nz BK nv X P1 Sw 'F'm, 5 1 Q M . W , Y' Q' 1 '1 ' , Q K j L-: ig jg I I .,.: .:. , xr Z' ,fH0n..,M wmmw :asm . gf 1 , Y ,Q Q if 213' V413 W f CT l Versa 1779 Voices Crea te Jo yous Harmony Row 1- Titus, Lello, Longhouser, McLean, Hatala, Hanna, Snodgrass, Ponschke, Sieczkarski, Hesek, Dernato. Row 2fProchot, Be-rna, Hunt, Rank, Trlak, McGovern, Kasak, Stillwell, Fontana, Davies. ROW 3-Burgchardt, Highland, Kapustianyk, Silon, Hansen, Pastorello, Ruzevick, Robbins, Szasa, Breuker, Ketchum, Mrs. Dennis. Row 44Wolfe, Antelek, Ambroz, Smith, Teitz, Usavage, Adams, Cunnea, Klancher, De Kovic, Morvis, Fischer. Each day during third period strains of melody can be heard ccming from room 2l3 Where the Girls' Chorus, under the direction of Mrs. Dennis, is ardent- i ly practicing. This choral group has been recognized for years by its White skirts and blouses which are enhanced by maroon and gold bibs embossed with a G clef. In the spring of 1952 the Girls' Chorus Won an S rating in choral competition with other Chicago high schools. Lindblomites who enjoyed the Thanksgiving program of the chorus and performances at school assem- blies throughout the year can appreciate the significance of this award. The fine spirit of the chorus is manifest in the desire of the girls to share their love of music with Various groups outside school for whom they often sing. Under the auspices of the American Red Cross a section of the chorus entertains at hospitals throughout Chicagoland and brings happiness to others through the magic of their melodies. Page 58 ln the Wonderland of Seng Row l-Stambulis, Siieqal, Horaiies, Fox, Gil, Fox, Valchar, Wahlqren, Alderson Willhoiie Row 21Poleski, Krumpoch, Greene, Busse, Carlson, Chaloupka, Carter, Beriucci Iohnson Hanson Row 3-Bauqher, Smaltz, Axelsirom, Sobey, Cullen, Thom, Rout, Gross, Kosman ROW 4- Mills, Adams, Koleski, Garland, Binqham, Iohnson, Miller, Thom, Leslie Pomi CHORUS ASSISTANTS Seated- Morvis, Wardrobe Mar., Fox, Accompanist. Standinqf Alderson, Librarian. Snodgrass, Librarian. Page 59 D9fllQh tful Syncopa tion ln Concert Style Tschaikowsky to Anderson . . . Strauss to Foster . . . All music is equally Well mastered by the Concert Orchestra under the direction of Mr. Christian Lyngby. The repertoire of the orchestra contains music of every type and music to suit every taste. The members of this group not only learn to play various instruments, but they also learn to appreciate the great classics of musical literature. Each member of the Concert Orchestra has the pleasure of sharing a love of good music with his fellow performers. Together the strings and the Winds blend in unison to produce the rhythms of the masters. The music of the Concert Orchestra provides a fitting climax to each graduation ceremony in Keeler Hall. ORCHESTRA Row l-Contorer, Gasner, Gresh, Hintz, Bnley Setzke Row 24Gantt, Schilling, Sieaman, Musser W Kroll Schaden Pold Bisgrove Michelson, Heher, Lach, Spitzke Row 3-Ross, Billups, Lane, Pusstelnik. Row 4-Kosch, Bures, Bell, Caditz, M. Kroll Homa Skuby Director Lyngby Wessberq. Page 60 Behfhd the Scenes lflifh Uur P 0,0 Men Cooperation is the keyword among the Stage Crew boys, for whether they are turning the spotlight on the orchestra or adjust- ing bulbs tor dramatic lighting, they operate at high speed eiii- ciency. Although they receive little public acknowledgment, these boys are the backbone ot Lindblom's shows and assemblies. Among their many jobs are seeing that the iootlights are working, knowing the time for cues, sound etfects, and special spotlights, and making certain that all stage props are in their proper places. The members oi the Stage Crew, under the leadership oi Mr. Iohnson, can always be relied upon for help in school productions. Right-Tremrnel, Clausius, Douglas. Middle-Barkstrorn, Dabisch, Karlson, Drigoi, Alberts. Below-Ravewski, Fleck, V. Minnick, R. Mirmick. Turning the Spotlight Un the Events of the Year The members of the yearbook staff can be seen in the initial stages of planning the l953 Eagle. But this is only the beginning. All through the year the literary staff continues to search for interesting suggestions and to develop varied techniques that will capture the highlights of each season at Lindblom. Hour after hour is spent in assembling facts about our school, in creating new ideas for pictures, in writing and editing copy, in proof reading, and in other essential details. To the business staff is entrusted the very important day-to- day assignment of managing all matters of finance. On a happy day in May, however, when it is time for the Eagle to appear, the climax of all annual activities is reached. This year s staff has worked under the direction of Miss Hogan, literary sponsor, Mr. Swanson, business adviser, and Mr. Mulvaney, advertising man- ager. The staff hopes that each Lindblomite who, through its purchase, has contributed to the success of the 1953 Eagle will enjoy sharing with them in this adventure of telescoping time. Upper center-The assistant editors are examining an interesting layout. With the aid of the business manager they are able to determine the cost of the paging, Kennedy, Literary Editor, Sopko, Girls' Sports Editor: Engel, Business Manager: lensen, Managing Editor. Upper right--lt is the typists who are entrusted with putting all the data in shape for the printer. Gabel, Sieben. Top center-Comparing notes on type size and length of captions helps the senior literary staff to determine the amount of copy they will need for their articles. , Altman, Walsh, Garland, Paluszek, Leonhardt. Middle center-Selecting pictures and establishing identifications keep the junior literary staff very busy. Young, Deplewski, Moore, Albrecht, Schneider, Ledman, Craven. Lower center4Members of the business staff are checking accounts and tallying receipts. lay, Underwood, Broniarczyk, Kenney, Randonis, Krueger. Lower left-Carole Winther puts the finishing touches on one of her sketches for the Eagle. Lower right-The very special tasks of scheduling pictures with the photog- rapher, making staff assignments, and meeting deadlines with the engraver are the responsibilities of the co-editors-in-chief, Bennie Nierman and Tom Stoginski. tl Page 62 w i? v FUNK -A. , zq'1,gQK' Affzz'-, ff . N' 1 A4 fu ,ff-sv 5? 09 A,fY1fCf3i?5':A -K:-af' . ' , y V if Go Lwmibbm n , ff ? y Sect Dani:-cu' '1mK g irl' f 34.15 K 1 at f, on 'xv K -9 in-I ' . :,fff,pv-fP W'v1fQK'W K' 7' ff J xx mr un pw ww 1f '3 ff:,.fA:-pwnt,-1 if A f K---115 sys. --.- Umewm vases '44 ' K ' 141 WWA await mum, A www wwvv K wr A, mn-wAA2f1wXa Casvpw' ' A Sxsbimv CBE? mf vAA E ,yawn www ,X v Umwlm flixwf-11 KYQWW, 1, is gsm mfgiisw hisxhugh ' 4 153.226, Embsm iww kiwwtww F63-M31 H-3119 35511 WF xi-isfcw 6f1r:1X:SrmwA M1 Im-was, Sem-M annum, n YIEYSAWXAYA Vitkhfri 16309 ,vga Xwif, Bwigw Maeva' mmf 922311, G91 Hifi' 92,5553 Kinda' vu , -vw iw: smsxaw, ,Ap wwf- msg mn Kam? MA vA:fwA wwf' vsmvim W A wma, sw 1, f xww V I Af Amwnfxfg ?anw1iXi1:Y,71Mf.Yiw1X - :v,AA,wAfygA wwf! swawm A ,,A,L.,,, 9w,.gAKyA mmx,Sm.w , M.-Apr, w,wQxA sums L 'icwcwv awgmd'-Aim 'mam mf,-xx Jw ,,,Mx,,,me1xxs A mem-:B xxwsx-gm :ww WAMAMQ sms-ms wvwi, my-za.: ww wzrsqns, aw'- us .Aw -A mx, A www mm L HAM swam www-A -A14-wwf gs we mmf saw! :ff ax www-ze Mm. Que? wax- 3msff9wvm:,'riYAsic1s 'W A A. A A, rfwm ' fa mms v,fALA,4, M, PQ wx A, NA 'iizf-vi 9345? 4 -N' ff WM awwmy W Girls' Chorus to 'Tour tfgffigagfflf? 1 - V1 mf, vw aww: veterans Hogpsxuxs ,Q 'kLAx5vf,. '1r nAfkb Y AA , , , . AA, :AA f:mAAn,xf 2 as MMA mmm ' A 'u im-vii ' fm wg XA. iam . X AW, 1' um , Q v., sx1.1:m ix ma , A .MN ,A x.,, Un, H21 P , -I . nu PM K rl, A ' N0 A :A A 5 an N '1m,A,M W . iii D Mfr. , I T 1 Am , W A I it ..,, 1 I , 4 . 3: xg-A ff f r s A --A ' :-wtMA.f.4 5 b K I A -gj.,'Q .Q +13 fwggf-, ,M Kuifff A . k , , A N -' can Y HW R A . , A Q g 5 , . W .Q . A A A . A, IL y I , 1 Q 5:-. ,. 1, , W' ifAC'Jf:fi1'7 W, F 5 3' .' 5 ' ' 6. I Lifif11,,1:'.A,,y:f1 K r-.Nl 5 . Aa- 5 IAA., I I fA,,Mi 4 T A'jg,A,A . Q K V A, 7 f 'LMwLinDwh. .Q-6331 K 'L A K ,W NMA ,A em A... A AAI.: ,..., . A f. 7 L Ik W ' v Jcenwhwx K ' T A V . , W gr! ' L , km K. ,L 'fEI7Ia'ZA. K W Wwwmw m A mmf WWMww fy 1 A-. K f f ' A 'L V ff, A 7' f,f,YL'K: W mf -1' ,ff A,Af' If ' fu Q 1:1 W 5 X Qwm-w,,m,mw f AAKA,f, Amr Ay A fn A Vi Q, Nb' J V v ' I nib ' K'q . 'WL LJ xx . f,,jf'fr ,Q ww, any AY :Q , '1-.AAA fl, ,T AAA, H' Q LMI 'Mft 'fm MW 1 'MJ wg AFM: 'fl' ww, fm-,f ' Sw-,g'f'K'x,,h1 IAA, A A, 'Kavnm A K ' V Af Y UL gh Y Us mn f K -W1 PM Q ' M- Q f! My z 1Ai,,,y s M Wfuf na, fly , fm- A em., nm, K -WA f A A Sgunfrzfm ng I M4 A 4,1 ' YK UQ' ' J mf K iq. AA if M.. , - :f.A ,, A y I 'nm fl, my 11AAy A K Kw,ghQ . ,:V- A.,. MLS gh, . AL J' AW U 'runw hu , -'N A '-AAN KwA:MAA ' A+ vcswxwmf MMM' M M 'MW .L ,,!,,A,,,,,,.,-- 'M ig-Q ,- Chsss-if? ,,A,'gm5iI,Qf rA,m ' 1 X x. -an xmxm ' VW' Y5u'5ex Nmwnqbmh .A-Axxzm Q it sp , 1 K A . Q 4 1 A Agl,Q4n..Ay -5A,A,X W- mum, 1 --M - K A , . 'I :Ay ' xmfj A ,mg :Aw Q-Aw-Axw 1,1 - K . ,Aw PLM ,Again NAA 5415 wwf :.wwxA,v,1-2 ' L X' KK A ,mf vAAf,gfA,:AAA,, A- A X: 5 H. ww ' K ' h aw -v ww Q, A-. I my fm- 1 fx mn- no wma ak QA mfs. 4,11 A M XA gy, Anvfiryrigflg 'fwfr' :mf s,xx.AvAwfw: Aww 4 '54 Kiff Q N 'wil X, K Lx- -L LE M KEL S swf- ,s www 'A Aj' T l I H A m, 4, , R .1,,' N' 'Y-rm ' v ' -.A ' Qu, x W A , 3 A I 'S ,.,F ww , A, A, ,U F T,Qgn,v U A A lux,-hh 2:1-1iF,: JYMAV ks Do UCC! P 1 1 'L E R 1 A vsvxxrvf mv J UQXITAQ' Rm -K trim W. mini GIA -.AA-unnw ok M vm,-g-ffm a-sm A K ,sm fro ix was xx. A my sims ay Hx M. f an K v x x Q. QW at rv? .- ' masora za sow 3 mu :rank U. xnxx. - m-mmmg. rwxma ,,,,f' Yom ...un r ZQKMNA 15, 'Florists-' 1 . 1544 W, cha sms: 3 2 ufu1..kw-Ax r, ww 2 snug Y 0-nu..--......-....n uh K AA A.A,.,A,,,A,,,,1 .ml 'N-x. A kj?1:,Av ILA.. M f Ag- M Aim ,R mf' fffjw, 'j 'A PGQQ54 Wm ,Tim -A, xx A ww A lm Di IAf,,fQ1f'fV 55,134 A 5.5 33 1, - Breaking ln to Prim' IfM'z'h OPPOSITE PAGE Upper PAGE Upper COPY Lower STAFF Lower EDITORS REP ORTERS ews About Llhdblcm Behind every page of the Lindblom Weekly is a story of journalistic activity, lively inter- est, and real effort by each member of the staff. With newsy items and vital statistics on every page, the Weekly keeps the readers posted on life at Lindblom. Page one unfolds all the important happenings of the school, while the second page features editorial comment along with the popular Spotlite, which gives portrayals of outstanding seniors. Eager readers find page three bulging with information about individuals, clubs, and activities, but for sport scores, a play-by-play description of the latest game, and athletic events everyone turns to the last page. Searching for interesting facts around which to weave a good story occupies every min- ute of the day for the busy reporters, while the page editors and their assistants work around the clock selecting and editing the best material available for each column. A capable corps of artists, photographers, and typists are always on call to prepare attractive sketches and readable copy. Headed by loyce Buhai and sponsored by Mrs. Harriet Brown, the entire edi- torial staff of the Weekly can be relied upon to make each issue informative and stimulating. Business manager, Ioan Hansen, Mr. Solomon, the business adviser, and their entire staff do a splendid job of getting the subscriptions in and the papers out on schedule. left-Ioyce Buhai, Editor-in-Chiefy Mrs. Brown, Sponsor. right-Stambulis, Zacovitch, Klancher, Keating, Rhodie, Zinkus. AND ASSISTANT EDITORS left-Kochalka, Caditz, Gopian, Howe, Nelson, Hesek. right4Row lfReed, Maceyak, Florek, Stambulis, Ruzevick, Dadas, Zaloudek. Row 2-Jacobsen, Iones, Erickson, Cullen, Carpenter, Pittel, Wright, Klatrnan. Row 3-Alex, Bailey, Rosenberg. BELOW CARTOONISTS AND PHOTOGRAPHERS Upper left-Grika, Bingham, Winther, Melcher, Wilson. CIRCULATION STAFF Upper right-Bow l-Danbrauskas, Scales. Bow Z-Mazur, Branstetter, Freundt, Raddatz, Bufka. Row 3-Bisgrove, Cervinka, Lougee, Hurley, Trernl. BUSINESS STAFF Lower left-Ruzevick, Adv. Mgr.: Krueger, Adv. Mgr.: Mr. Solomon, Sponsor: Briley, Finance Mgr.: Hansen, Bus. Mgr. TYPISTS Lower right-Iones, Kiphuth, Cull, Hesek, Musser. Page 65 Campaigning for Good Press !?e!az7'0n5 ' WEEKLY SALESMEN Row l-Harris, Schram, Bell, Erickson, Raddatz, Fruendt, Thom, Young, Kenney. Row 2-Knight, Wals, Klein, Hansen, Greene, Schroeder, Anderson, Harnach, Burich, McAllister. Row 34Krzak, Kionka, Clark, Wells, McGovern, Osis. Row' 4-Zegizer, lack, Hockersmith, Shaughnessy, Chapman, Sawyer, Pederson, lackson, Manasses Row 5-Kazlauski, Florek, Iankowski, Macley, Kerzan, Hoinacki, Bos, Watson, Boness, Hurley. Row 6-Molis, Morley, Fricka, Glaza, Fredrick, Soltis, Sopko, Carpenter, Nizich, Banas, Randich. loin up! Subscribe to the Weeklyl ' . . Your second Eagle payment is due. EAGLE Mr. Louis Swanson, Sponsor SALESMEN Row l--Bader, Genge, Dedic, Pold, Silberman, Bogner, Kasak, Rank Row Zelennings, Titus, G1-uke, Garland Ambroz, Anderson, Silon, Iany Sutor, Bischoff, Knight, Bill, Smith, Parkey. Row 3-Paluszelf Cappas, Craven, Parmelee, Gabel, Setzke, Willett, Baugher, Schram, Noble, Hazzard. Row 4-Khernak, Madey, Krueger, Miller, Hitchcock, Heqener, Rocklin, Yara, Mitchell, Scheunernann, Frornbach, Carpenter, Drigot, Wright, Shodeen, Strava, Stoginski, Stefanski, Ebel, Brumlik, Wilson, Thorn, lay. These are familiar phrases overheard at division time when the Weekly and Eagle salesmen try to sell and collect tor their respective publications. The sales forces work diligently to put their publications across to their prospective customers. No matter how good a publication is, it it is not made available to the public its value cannot be appreciated. The salesmen wear out a path to their respective oitices before the semester ends. Finally the happy day arrives when they hear those wonderful words: Your audit is complete. Everything balances. ' Mr. Solomon is in charge ot the Weekly sales stait, and Mr. Swanson supervises the Eagle corps. With a iine sense ot responsibility and integrity, each salesman performs an invaluable service tor Lindblom and at the same time adds to his own business experience. Page 66 Llhdblom P omofers EAGLE AD CLUB Row l- Hanson, Hofer, Borisy, Monette, C. LaDuca, Mr. W. Mulvaney, Wells. Row 2- Francis, Hartley, Wilson, Hartmann Kenney, P. LaDuca. Ledebuhr, Miller. Row 3- Ziska, Mack, Alex. DANCE COMMITTEE Row l- Hutter, Arnbroz, Crvich. Row 2- Steiper, Miss Garrison, Ambroz, Hood, Majerczyk. Row 3- Egan, Mcliindrick, Antelek, Trick, Brown, Angeles, Altman, Trlak, Stiegal, Boyd, Halagan, Bruno, Dumas. EAGLE AD CLUB An essential part of the Lindblom Eagle is the Advertising Club. These ambitious students, who sell space to merchants of our community, help in part to finance the cost of our annual. ln his first year as sponsor of the group, Mr. Walter Mulvaney with his corps of super-salesmen has done an outstand- ing job. With these fine publicity agents to represent us in the community, our project is assured of a courteous reception. ln turn, the members of the group gain personal experience that is most helpful to them. DANCE COMMITTEE With an active group in charge of the social center dances, which are held every other Friday at Lindblom, everyone who attends is guaranteed a good time. Our student committee, under the supervision of Miss Garrison, works diligently to make these affairs successful. They decide on a name for each dance, publicize the coming event, help with the dancing instruction, and decorate the gym. The group enjoys acting as hosts and Wants the guests to share their pleasure. You're not in the social swim at Lindblom if you failed to attend Blue Violins or Cupid's Arrow, two very successful dances of the current year. Page 67 The friendship circle of the Senior Girls' Council binds the members in spirit and in song. G l l 1 ll P Az' Lfhdblomk Social Hours Twinkling tapers, gleaming silver, and a fine array of china, all are part of the pleasing atmosphere that pervades the Girls' Social Boom during those festive periods when the senior Coun- cilors entertain faculty, friends, or classmates at a tea. ln addition to serving as hostesses at social events, the Councilors learn the manners, niceties, and social graces that help provide a rich, full life for every girl. ln working together and helping each other, many true and fast friendships are made and many hours of fun are experienced. Each member of the Council, who is elected to the position by her classmates and teachers, does her best to uphold the ideals of loyalty and honor long associated with this group of girls. The twenty-four senior Councilors, who are under the guid- ance of Mrs. Rule, are easily recognized at Lindblorn, not only by their bright red jackets, white skirts, and owl insignia, but by their fine sense of dependability, high scholastic ratings, and enthu- siastic participation in school affairs. The Girls' Social Room and the Council have a very special place in the affections of every Lindblomite. A beautiful new rug purchased this year testifies to the fact that the students always support Council projects. Page 68 Point, Leonhardt, Zaloudek, --9 Florek, Bellis, Smiley, Dadas. Row l-Morley, Boehnke, Gialamas, Deiber, Mueller. Row 2-Lundin, Molis, lrion. Row l-Franich, Engel, Fox, Cox, Smicikles. Row 2-Hale, Winther, Witt. .1 U5 KWM ln Praise of Pfhlc Jackets Row l-Yanik, Zekios, Reid. Row 2-Goss, Starr, Shlensky. Row l-Bertsos, Cunnect, Funke. Row 2-Merkin, Winiarski. OFFICERS . . .Borisy, Vice-Pres.: Bertucci, Sect.: Witt, Pres.: Stone, Treas. lackets at Lindblom, no matter the color, signify girls of high caliber. True to form, the Pink lacket girls are a select group of young ladies from the Mail Service organization. Lindblom is especially indebted to them for their splendid cooperation in matters of school routine. ln the midst ot their many duties the girls find time for festivities too. Each semester they entertain at an induction and farewell tea. On these occasions they welcome new members and bid adieu to those who are graduating. Members of the Mail Service Cabinet are girls who have learned the value oi promptness, accuracy, and speed in doing each assignment Which has been entrusted to them. Page 70 Row l- Silberman. ROW 2- Bischoff, Robbins, Ruzevick, Benline, Sutor, Sopron. Row 3- Buysse, Sullivan, lessie, Heisler, Kubin, lulkowski. Row 4- Whetsel, Sinclelar, Bayer, Schnier. Row 5- Douglas, Sohu, Marryman, Carpenter, Peirson. Row 6- Wolclowing, Wright, Klancher. Row l- Schmitt, Lipinski, Klingrnan, Kavanaugh, Pressman, Paluszek. Row 2- Klingrnan, Stroker, Cappas, Marcelles, Horvath, Iones, Pietras, Nelson. Row 3- Nance, l-lofer, Klernens, Hansen Klein, Richison, Trein, Malecek Row 4- Mahn, Cerino, Hartmann, Howe Madey, Burke, Burich, Hoeltzer i Paging MISS Lindblom One of the most important aspects of high school organization is the main- tenance of an efficient system of clerical assistance. Girls who belong to the Mail Service group are the core of a training program which supplies both the faculty and the office staff With necessary help. They perform many essential tasks such as delivering messages, collecting absent slips, and filing. This group, which is sponsored by Mrs. Atkinson, is one of Lindblorn's busiest organizations. The girls receive training which helps them to form good habits of Work and to understand the importance of clerical detail. Page 71 Coffey, Caclen, Carvell, Voltz, 1 ln a Class By Them elve HONOR SOCIETY OFFICERS Killoren, Point, Samuels, Starnbulis. S CERTIFICATE WINNERS Standing-Point, Miss Groves, Sponsor. Row 1-Karnas, Whyte, Nelson, Greene, Alderson, Paluszek, Pusstelnik, Fitzhugh, Cox, Cullen, Altman, Harnach, Maceyak, Bures, Wright, Iensen. Row 2-Ruzicka, Broniarczyk, Roskos, Chaloupka, Bielawa, Knapp, Craven, Dadas, Bull, Zaloudek, Baugher, Schiecke, Keiner, Silberman, Sindelar, Bischoff. Row 3-Spiewak, Dabisch, Knight, Moore, Ledman, Bantz, Briley, Minnick, Klancher, Sanders, Kelly, Balgemann, Lach, Fitzgerald, Albrecht, Hudson. With a justified flourish the owner of an S certificate displays his award, symbol ot many hours of superior performance in scholastic pursuits. ln acquiring this certificate he has achieved an S average in all his majors and not less than E ' in his minors. The thrill ot accomplishment comes to each member ot the group when he realizes that he has done his best to be true to his own standards and those of the school. Students thus honored receive one point toward their Golden Eagle, the emblem which every Lindblomite hopes to possess before he graduates. A large proportion oi the S certificate group qualities tor this special award, which suggests what every student knows, that the 'top bracket of our l-lonor Society contributes outstanding citizens to Lindblom. The ofticers of the Honor Society, who are upper classmen, are responsible tor many details connected with this organization. They assist Miss Groves, the sponsor of the society, in making arrangements for the special assembly at which members are honored, and they preside at the ceremony of induction when pins and certificates are awarded by Mr. Yates and Mr. Palmer. The officers ot the group may be trom either the Honor Society or the S certifi- Cate group. Page 72 A Galaxy of Stars Row l-Valchar, Witt, Hatala, Pletzke. Row Z-Stone, Price, Pratscher. Row 3-lrion, Boehnke, Franich, Gialamas, Morley, Smiciklas. Row 4-Strobel, Sieqer, Blaha, Molis, Miller. Row 5-Parello, Nizich, Walsh, Killcrcn, Curtin, Row 6-Klootwyk, Stieper, Driqot. Row 1 Row 2 Row 3 How 4 Row 5 glories, Buhai, Zekios, Fox, Funke, lay. --Garland, Cozzo, Hesek, Kirkpatrick, Monette. -Witt, Hansen, Fojtik, Nierman, Stoqinski. -Hale, Bellis, Smiley, Bunce, Dadcs, Mega, Point, Gopcian. -Kamm, Stiegal, Winther, Florek, Zaloudek, Fiedler, Rocklin Schroeder, Roberts, Duscrblon. Row 6fSopko, Carpenter, Demato, Young. Row 7 Row 8 -Engel, Fabry, Zinkus, Pasquinelli, Evonovich. -Srnaqur, Kennedy, Keating, Roberts, Fabry. Row 9-Karlsen, Bond. Row 1-Pirard, Nutley, Sindelar, Hansen. Row ZfSn'1ith, lettcn, Benline. Row 3 Row 4 -Ianik, Wenta, Scopos, Keiss. -Benline, Homo, Kionka, Hickey. Row l-Axelsirom, Schroeder, Pold, Young, Cull, Tasseii, Trlak, Yehline. Row 2 Row 3- -Hotchkin, Erickson, Glover, Wysocki, Schneider, Musxer, Bufka Ruzevick. Skly, Bohr, Robbins, Rees, Voss, Rucker, Ostrowski, Awards Be to wed in Steady and conscientious ei-tort directed toward one's studies is rewarded With membership in the Honor Society. The proud wearer of an Honor Society pin can point to an average ot or above in his majors with no minor less than Lindblom bestows recognition upon the mem- bers ot this group at a special assembly which occurs at the beginning ot each semester. This is an event which everyone looks torward to because it is a public acknowl- edgment ot the efforts ot those Who have gained admission to the group and a source ct encouragement tor those who are striving toward the same goal. Not only good scholarship, but high ideals ot service toward Lindblom and an interest in many varied activities distinguish the members ot the Honor Society. Row 1- across-Marting, Hosteva, Wheeler. Row 2--Melody, Layo, Smith, Shryock. Row 3-De Kovic, Stigberg, Arnirante, Mackoft. Row 4-Carlson, Stefanski, Heher. Row 5-Minasian, Kalarski, R. Krueger, V. Starnbulis. Row 6- A. Krueger, Budrevicious, Gantt, Bailey, Rosenberg, I. Stambulis. Row 7-Ruffolo, Srhlke, Bisgrove, Skaper. StandingfStrelec, Samuels, Pasalevich, Underwood. Row l-Rutiolo, Norsic, Sherman, Turco, Hatala, Barbarek, Francis. Row 2 -Mraz, Clifford, Schmidt, Chiarappa, Snodgrass, Gross, lohnson, Horvath. Row 3-Carter, Taylor, Kress, Coltrnan. Row 4 Row 5 Row 6 Row 7 -Rozanas, Grubisich, Brandstetter, Aalderks, Raddatz, Detiai, Zyckowski, Frombach, Schlake, Royse. -Gronkowski, Iohnson, Caditz, Sadlis, Banks, Basner, Melcher, Kunter, Willett. -Gopoian, Vanllyke, Ruzicka, Minnick, Gruver, Kccian, Lange. -Mills, Novosad, Yerkovich, Moolin, Wallbruch, Rajewski, Dep- lewsk. S if sr , Page 74 Pursuit of Learning C elebra 1777 g He fa H7779 ln the Spanish Tra0'1'z7'0n Whether it is singing Spanish songs, breaking the pinata, or preparing baskets of food for needy families at Christmas, the Spanish clubs combine fun, learning, and service in the per- formance of these varied activities. Clubs are formed in advanced Spanish classes to present South American customs to our students. Pertinent films are often shown, holidays are cele- brated as they might be in the country of the language, and the business of the meeting is car- ried on in the native tongue. ' Dressed in costumes, some of the members create a true Spanish at- mosphere with their gay sombreros and serapes. At one meeting of Las Mes- clados a mock Mexican bullfight was staged. Lind- blom's sport cheers were translated into Spanish and demonstrated by some of our cheerleaders. Both pleasure and conversa- tional skills are gained through such enjoyable club sessions. Mueller, Stambulis, Valchar. LAS MESCLADOS Row lf Nierman, Treas.: Altman, Vice-Pres.: Stiegal, Pres.: Muller, Valchar. Row 2- Stigberg, Secty.p Pittel, Raney, Mackoff, Cozzo, Carpenter, Royse, Mazurkiewicz, Layo, Stambulis, Miss Ehrenwerth, Sponsor. Row 3- Skala, Hansen, Kirkpatrick, Morvis, Baron, Merkin, Shanahan, Miller. EL CIRCULO ESPANOL Row l- Martens, Secty.p Kearns, Ketchum, Nelson. Row 2- Rucker, Vice-Pres.: Schley, Pold. Ambroz, Treasq Shlensky, Pres.: . Miss Moore, Sponsor: i Erickson, Cull, Peterson, Sheridan, Rio, Letviak, Dyrda. Page 75 ' .X f y f' Schramm, Knopp, Wysocki, Row 3-- 5 Qufrife Presen is : If e o 99 Mapping the World with Cae ar l t Standingflireuger, Kochalka, Row 2 Ellefsen, Pusstelnik, Anderson, Heher, Heard. Row l- -Statkus, Sweet, Voltz, Wojcik, Frornbach, Rocklin, Treasq Oswald, Pres., Schneider, Vice- Pres.g Senkpiel, Getautas, Lencyrneyer. Row 3-Mills, Pastorello, Schmiecher, l-lunt, Shields, Gruver, Bogden, Melcher, McClain, Bell. Row l-Clark, Gross, Oko, DeVitto, Hoyne, Eder, Del-Xngelis, Treas.g Wals, sect. Row Z-Malecek, Aalderks, Fruendt, Sherman, Williams, Klein, Vice-Pres., Harris. Row 3 --Kelly, Ullrich, Nimz, Cunnea, leffries, Vlfagner, Deplewski, Burzinski, Lange, Zyckowski, Sabatino, Hickey, Pres.: Weir. At each meeting of the Latin Club informative and amusing entertainment is presented by the members. The work of organization is carried on by com- mittees who are in charge of each program. Early in the semester Quirites was chosen as the name for all the Latin Clubs and a constitution was adopted which was modeled on the Roman idea of government. During the club meet- ings programs are offered which show the Roman Way of life and which acquaint the students with different aspects of Rome's civilization. The Romans were fond of the drama, particularly comedy, and club members like to imitate their style when they present amateur dramatics at their meetings. Many are the parodies on serious subjects, such as Caesar crossing the Rubicon or Aeneas bidding farewell to Dido. Club meetings give the students an opportunity to enjoy Latin in action. Page 76 Booked For Tre vel' En France We LATIN CLUB Row l-Knight, Sect., Albrecht, Pres.: Powell, Vice-Pres.: Cason, Treas. Row Zfl-lighland, Pletzke, Folsom, Knor, Anderson. Row 3-Vytlacil, Gierut, Gopicrn, Brandstetter, Flentje. Row 4-Fischer, Paul, Kwiatt, lany, Cox, Barcy. Row 5-Stevens, Manak, Meyer, Olson, Shocleen, Moore. Row 6U-Novak, Kennedy, Sehlke, Lelourneaux. FRENCH CLUB Row lfCappas, Miss Moore, sponsor, Scheunemann, Hosteva, Smith, Robinson, Dapkus, Greene Treas.: Feeley, Krumpoch, Kunter. Row 2-Silberrncrn, Dean, Stoginski, Pres.f Skly, Wirnpenny, Bisgrove, Burton, Probst, Orszula, Reid, Polk, lones, Sect.:Porter. LATIN CLUB ln the spring of each year the classical students of Illinois celebrate Latin Week. Tours of museums in the Chicago area and special lectures are on the agenda. Students gain a firsthand knowledge of classical antiquities located in our city and meet other students who are interested in the same field of study. The observance of Latin Week is a special project which all members of Quirites participate in together. FRENCH CLUB Members of the French Club are doing more than dreaming about a trip to France, they are already embarked on the first leg of their journey. Each one gets a clearer picture of the people of France through the meetings and pro- grams of the club group. French songs are often sung and French plays are drarnatized. Sight-seeing tours are organized through pictures and posters. These activities enable the students of French to get a better understanding of the picturesque country and its people. Page 77 Home Armbands and Wes Sllqnify Councilors V Shackel, Polansky, Parrello, Whitney, Mitchell, Weise, Khoeler, Steiper, Plohar, Ruzicka, Miller. Fabry, Plociennik, Kocimski, Gessler, Parris, Bond, Keating, Stoginski, Kennedy. The lads with the white shirts, ties, and armbands, Whom one sees in the corridors of Lindblom each Thursday, are members of the Senior Boys' Council. They hold a formal council meeting weekly at which they discuss plans and exchange ideas which are for the mutual benefit ofall Lindblomites. Although they are concerned with school welfare in general, one of the special projects they sponsor is the publication of the annual Pep Book. This helpful hand- book gives a preview of events for the current year and presents an over-all picture of our high school organizations. Since it includes the lineup of the fall football squad and pertinent information about all the clubs at Lindblom, it is of interest to both old and new students. ln addition to writing the Pep Book, the boys are responsible for the maintenance of the Boys' Social Room, which is the center of their activities. The Council, consisting of twenty senior boys, is directed by Mr. Ianousek and Mr. Boucher. A boy is elected to membership in the Council by his classmates and teachers. Page 78 The XC C Issue A Progress Report Row l Row 3 Row 5 Row l Row 2 Row 3 Row 4 Row 5 Row 2 Row 4 I OFFICERS Row l-Sopko, Recd. Sect.: Zordani Treas.: Weise, Pres.: Scheune mann, Att. Sect.: Blaha, Vice Pres.: Miss Harris, Sponsor. -Peters, Gruhlke, Hedacek, Ambroz, Hutter. -Snodgrass, Rzeszut, Boehnke, Gresh, Gialarnas, Rozanas, Rees, Waterman. fLedebuhr, Baeuker, Eder, Rempert, I-loew, Reed. vPlohar, Silberman, Mitchell, Vvfalsh, Angeles, Duffin. -Whitney, Ledman, Cervinka, Lamoureaux, Sherwin, Shodeen, Iohnson, Miller. -Stambulis, Huebner, Sopko, Frederick, Cullen. Morvis, Pittel, Angeles, Arnbroz, Steigal, Kamm, Dadus, Point. Amirante, Hunt, Cerino, Hatala, Pastorello, Oswald, Haering, Garland. Geary, Berryman, Lindauer, Putnam. Sutko, Glaza, Lixford, Siemenkowski, Ryan. Every Lindblom student benefits from the Work done by the Inter-Cabinet Council. The projects of the Council include participating in school citizenship campaigns, keeping the lunch room and corridors clean, sponsoring two dances a year, and improving student morale. Delegates are chosen for the council from the various clubs, organizations, and divisions in Lindblom. The delegates relay decisions and plans made at the meetings to the groups they represent. Conversely, ideas from the student body can be suggested to the council representa- tive. This organization aims to function as a democratic unit and to make all Lindblomites aware ot their role in student government. Page '79 Table Tollc: ew Models Un Exhibition Row l-Spiewak, Weiss, Kovacich, Mr. Hunter, Sponsor. Row 2-White, Pape, Hooper, Kovanda, Breyer, Snyder, Neumann, Douglas. Row 3-Suchy, Morrison, Randonis, Kubilius, Gallagher, Bender, Seitler, Fehr. Row' 4-Nitz, Kamba, Haller, Fleck, Knoeble, Coners. Row 5-Sturek, MacKenzie, Maley, Beres, Summers, Prokaski, Turek. Row 6-Vlosak, Schultz, Hallas, Schaefer. The Architects' Club, under the guidance of Mr. Hunter, has been organized to stimulate an interest in architectural drawing. The officers of this large and rapidly expanding organization are: Robert White, president, Stanley Spiewak, Vice-president: Leon Pirofalo, secretaryg and Elmer Dabish, treasurer. Members of the club receive special in- struction Which Will be invaluable if they Wish to continue their archi- tectural interests. Participation in a group such as this often leads to the development of Worthwhile hobbies and pursuits. As a first step toward. building a career in architecture, the boys discuss sketches and models with Mr. Hunter. This is a field which offers unlimited opportu- nities for advancement. lnstead oi dreaming about 'The House of Tomorrow, the members are acquiring information and skills which will turn dreams into reality. Page 80 IfM'fh Ea el and Brush 0 0 . 0 T hey Iflhn Distinction Row l-Piontek, Mr. Schmitt, Sponsor: Sutcliffe. Row 2-Bingham, Morley, Winther, Cascone, Schiefelbein, Pirard, Nutley, Morgan. Row 3-St. Lawrence, Lokay, Duncan, Adams, Hart, Boftin, Evanow, Fahlbusch, Reid, Antlek, Peschel, Iankovich. Row 4-Mock, Kozlowski, Bull, Moore, Pekloski, Smith, Dumas, Baugher, Amirante. Row le-Mr. Schmitt, Sponsor: Cole, Bauer, Woods, Cervak. Row 2-Riley, Pratscher, Te-llotson, Krencik, Blaha. Row 3-Yates, Schultheis, Douglas, I-lavel, Gerulis. Grika, Brownfield, Kochalka, Scotchmur, Kost, Hofer, Winther, Morley, Norsic, Crites, Scholtes. Row 4- T l ted students who are studying art as a major comprise the member- a en ship ot the Lindblom Art League. This group, which is under the supervision ' ' ' ' ' ' ' h h t Mr Schmitt is organized primarily to encourage artistic ability. Whet er t e 0 . , individual is training tor a professional career in art or pursuing it as a hobby, f thers his Work in the League contributes immeasurably to the happiness o o and brings great personal satisfaction to the artist himself. The members ot ' ' ' d ' to Lind- this group give generously of their time and talent to ren er service blom. Their attractive posters publicize many school activities, and their deco- ' ' ' t ' 't' . Art League rative designs provide glamor for dances and special estivi res students have succeeded, not only in brightening Lindblom s corridors, but also d d cholarships. in adding luster to her name by Winning many awar s an s Page 81 2 3 2 2 E 3, 2 2? Q 5 Q 32 it ,, EE in E 5 1 3 2 5 t 2 it 5 2 3 5 l E 3 3 5 Accent Un Accuracy TOP TO BOTTOM Row l-Svoboda, Niemiec, Drawert, Skiba, Breyer, Brown, Schnier. Row 2-Payton, Caliendo, Anzilotti, Lazaric, Bertsos, Ogden, Kersten. Row 3-Bruno, Iaros, Sadowski, Brown, Hines, Haering, Mercier. Row 44Geary, Wolf, Regal, Gillin, Lanc, Wolters. Row 5-Goss, Dawson, Fischer, Korper, Abdo. Row 6-Lawrence, Kramer, Costanzol, Hanson. Row 7-Bol, Prostka, Zekios, Loibl, Prochot. The demands of modern business require that speedy methods be used in turning out sta- tistics for immediate use. Members of the Comptometry Club are prepared to meet the chal- lenge, because a course in this subject enables one to handle columns oi figures with the greatest of ease and accuracy. Anyone who is planning an office career or who wishes to specialize in accounting will find the ability to operate a comptometer an invaluable asset. It takes one semester to learn the skills necessary for operating a calculating machine. The course is taught by Miss Appleby of the Commercial Department. Page 82 T 3 21 Miss Appleby Seated- Terlak, Prokop, Wilson. Standing- Chaprnan, Thomas, Rigby. Calculating 777779 Un A Radio Show RADIO GUILD Row lm Morvis, Springer, Starnbulis, Curtin, Parris, Miller, Merkin, Waterman, Hale, Walters, Wessberg. Row 2- Zaloudek, Point, Dickson, Antonacci, Pavlik, Messinger, Mehmet, Lovett, Rosato, Hoeflinger, Whitney, Valchar, Fontana, Mitchell, To gain experience in radio techniques is the purpose of the Radio Guild. At their Weekly meeting in the Girls' Social Room the members present original scripts, written, directed, and acted by themselves. The students in this organ- ization not only obtain valuable experience through their endeavors, but they also enjoy combining Work with pleasure. The programs of the Guild follow the pattern of a regular radio show as accurately as possible. Using the facili- ties available they produce ingenious sound effects to coincide with the re- quirements of the script. In fact, some of their productions are so unique that television talent scouts could profitably recruit new stars from this group. Page 83 A lflhhning C0mbl77az'i0n: Pleasure agjd ervice t s STUDENT GUILD Row l-Schneider. Gabel. Row Z-Erickson, jones, Marting, Mr. Palmer, Sponsor: Greene, Ruzevick, Winiarski, Krueger, He-her. Row 3-Curtin, Minnick, Howe, Kunter, Bures, Wright, Robbins, Klancher, Kenney. PROIECTION CLUB Row l-Creighton, Kramp, Schweikert, Douglas, Minniclc, Wright, Dorman. Row Z-Mr. A. Lilek, Sponsor: Treml, McGinley, Openlander, Kubilius, Mr. L. Weckel, Sponsory Polansky. Row 3-Schiecke, Putnam, Bull, Turek, Valentine. THE STUDENT GUILD The Student Guild is one of the unique organizations at Lindblom. There are no oiiicers and the meetings are kept on an informal basis. The goals of the Guild are many and varied. They include stimulating the desire to learn, teaching cooperation With others, showing that learning is fun, and illustrating that pleasure is seli-made. Students in ZA or above are eligible for membership. With Mr. Edgar Palmer to inspire the Guild, interesting projects are always afoot. PHOIECTION CLUB Classes really appreciate the services of this group of movie-makers. ln forty minutes they can take us to Afghanistan or to the moon. The members ot the Projection Club enjoy their Work too, for they receive training that will make them popular in amateur movie circles. Our squad of student operators learns how to run film through the projector, how to adjust tone Control, and how to master all the mechanical gadgets connected with the operation of the movie machine. Mr. Weckel and Mr. Lilek are in charge of the training required for membership in this organization. Page 84 T he Be 1' Uf References The Lindblom Library Club strives to make its members and the school more library conscious. Under the leadership of Mrs. Kramer the group plans many activities such as field trips, faculty open house, and a semester awards party. The members assist in the library during their free periods by checking books, delivering study hall slips, shelving, and preparing attractive displays. Pins and certificates are awarded at the end of the semester for service to the school. Among the books is offered the opportunity to serve Lindblom and to gain personal experience that is profitable and enjoyable. Seated Centino, Nowakowski, Taylor, Scott, Reid, Walenty, Thom, lankowski, Lorett. Standing Parmelee, l-lockersmith, Crotty, Svoboda, Piatkowski, Maurer, Smith, Ceithaml, Mitchell, Chaloupka, Good, Modka, Wells, Williams. Left Porter, Schnitz, M. Harris, G. Harris, Moore, Hoard. Right Morgan, Thomas, Somes, Zalem, Sect.: Hansen, Vice-Pres.: Klein, Pres.: Taylor, Treas.5 Mraz, Clifford, Casey. Row l- Moore, Vernon, leffries, Deiber, Bufka, Greene, Kunter, Hoyne, Rees, Schneider. Row 2- Hornuth, Hurley, Reiss, Peterson, Wlodarczyk, Anderson Lyszczasz, Armalis, Young, Klancher. Standing Zihlman, White, Kubilius, Hong. page 85 'Wanfa D ive A HTQ Truck? Co-chiefs among the marshals receive an explanation about various gadgets on the engine from two members of the Chicago Fire Department. Prokaski, Pirotalo, Nitz, Miller, W'eise, Mr. Freese. Row l-Feller, Pirotalo, Kennedy, Zinkus, Iiskra, Sweet, Stoginski, Dvorak, Hall, Curtin, Row Z-Mr. Freese, Sponsor: Openlander, Poremski, Robertson, Silberman, Popik, Broniarczyk, Minnick, Lally, Duttin, Blaha, Hatala, Prokaski, Keating, Brown, Lamoureaux, Fitzgerald, Bonasera. Row 3-lung, Maurer, Snyder, Treml, Markel, Creighton, Weise, Miller, Rosenberg, Ioniak, Alex, Voltz, Gardner, Rachtorcl, Rach. Row 4-Suchy, Randonis, McGinley, Yara, Nitz, Mitchell, Drigot, Kilinski, Whitney, DeBenedetto. Row 5-Miller, Cervinka, Plohar, Zordani. Every boy likes to dream about climbing behind the wheel of a fire truck, but tire marshals at Lindblom were lucky enough to have such an opportunity during National Fire Prevention Week in October. The boys had a chance to examine tire-fighting equipment and to get pointers on tire control from mem- bers ot the Chicago Fire Department. Lindblom's tire marshals do their part throughout the year to make tire prevention a reality. Whenever tire bells break the regularity ot a class period, the boys are at the exits and street crossings to assure tast but orderly evacua- tion ot all students from the building. Other marshals see that the building is empty and that the necessary equipment for fighting tires is in good condition. With the support and guidance ot an organization like the tire marshals, the chance ot disaster by tire can be eliminated. The group responsible for these serious duties is under the direction ot Mr. Freese. Page 86 A Pass T 0 Good Cl'flZGl7Shl,U Row lgMr. Iepsen, Huebner, Iacobsen, Knor, Gopoian, Godwin, Hengst, Dziedzic, Utsch, Nihill, Supervisor, Beiber, lurgensrnier, Sedivy, Rosenberg. Row 2-Gardner, Keating, Hahn, Karamagianis, Doljanin, Clark, Carlson, Parker, Alex, Mock, Silloerrnan, Openlander, Szeflin, Niemiec. Row 3-Orszula, Francis, Iermolowicz, Randich, Cox, Erickson, Boehm, Bremer, Hendrix, Petrowski, Sleichert, Riker, Iarnes, Prostka, Burkin. Row l+Cervinka, Bailey, Bonasera, Noel, Soden, Racay, Seitler, Schoell. Row 2-Rosdil, George, Gallas, Wilkosz, Creighton, Parker, Skapek, Stoginski. Row 3-Mr. Iepsen, Gandy, Capt.: Trlak, Capt.: Dumas, Lieut.7 Pacholski, Levinthal, Schweikert, Wisse, liskra, Kionka, Bonorno, Probst, Cooper, Roach, Smith. Row 4-Spiewak, White. Keeping posted on corridor conditions is the task which is entrusted to Mr. Iepsen's staff of hall guards. Everyone at Lindblom knows how important are the duties they perform. Ever watchful, our sentries serve the school by maintaining order in the halls, guarding the lockers, and keeping the corridors free of debris. Their famous query, Where's your pass? is an assurance that our school will be without unwelcome visitors and loitering students. The work of the hall guards is a two-way assignment. They perform a duty that boosts school morale and contributes to good citizenship, and each student endorses the service when he freely shows his pass and cooperates with our vigilantes. Page 87 Exclusively Yours F e hmen and Sophomores Row 1 Row 2 Row 3 Row 4 -Ferg uson, Skiba, Venegas, Anderson, Wosnarowski, Roberts, Carvell, Weiner. -Peterson, Lahr, Krueger, Craven, Cerney, Crowley, Skopick, Bender. -McElroy, Vlahmik, Murry, Fletan, Liser. eltflitchell, Klaub, Fix, Hill, Mahn, Armalis, Lange. Officers-Mitchell, Pres.: La Duca, Pro- gram Chairman, Vestal, Social Chairman: Hansen, Sect. Row l-Barryman, Douglas, Genge, Guisti, Voltz, Gandy. Row 2-Sahr, Frombach, Schmitt. Row 3-Jackson, Szeszycki, Bambera, Row 4- Sopron, I-lockersrnith, Canavan, Whetsel, Davies, Heisler. Greene, Kunter, Petrowski, Krause. A Halloween atmosphere pervades the halls of Linclblom twice a year when the Sub Debs have their initiation ceremony. The freshies dress in a mix and match style that otten pro- duces hilarious effects. Books are carried in buckets, and the girls hold baby dolls in their arms. At the instigation of the sophomores the girls go through this initiation in order to be- come members of the Sub Debs, an organization which is made up of freshmen and sophomore girls. During the year the club offers special programs, celebrity teas, fashion shows, plays, and parties. The girls enjoy working together to make these activities successful. With such a wide range of events to choose from, the Sub Debs have a busy season from September to Iune. Miss Calkins is in charge of this enterprising group. Page 88 They A1777 fe Please USHERS' CLUB Mr. Crofts, Sponsor: Curtin, Row lf Iacobsen, Stoginski, Kufta, Maurer. Silberman, Pressman, Market, Melcher, liskra, Gopoian, Ceithaml, Stoffey, lones. Zinkus, Caditz, Kabica, Keating, Brejcha, Rosenberg, Dvorak. , Blazek, Varanauski, Skapek, Ledrnan. Lamoureaux, Ledebuhr, Cervinka, Gardner, Voltz, Kionka, Burke, Aders, Beclnar. Row 6-Yara, Kubilius, McGinley, Treml, Srnowton, lanik, Hall, Sutcliffe, Openlander. Smith, Suchy, Putnam, Miller, lones, Antonacci, Plohar. Row 2- Row 3- 4-Stieper, Friedlander Row Row 5- Row 7- All is quiet. The last strains of the overture are gently fading away. Suddenly, in wanders a freshie! lt is his first assembly. Nervously he looks for a seat, but none can be found. As he vainly wanders around, he is approached by a neatly dressed young man Wearing a white shirt. Quietly, to his relief, the late-comer is conducted to a seat by the older student. He and many other boys, under the guidance of Mr. Crofts, the sponsor, direct their energies toward the service of our school. They are on duty at assemblies and many evening performances, ' ' ' f rteous and efficient help at all times. thereby assuring all Lrndblomites o cou CAFETE THE WOMEN IN TH Mrs. Bockelod, Page 89 Mrs. Strom, Mrs. Blaha, Mrs. RIA STAFF E LUNCHROOM OFFER SERVICE WITH A SMILE K tin , Miss Lucy, Mrs. O'Rourke, Mrs. Stalf, Mrs. ea g Mrs. Gunderson, Mrs. Aurenz. Kintz, Mgr. Mrs. Blaha, Mrs. Toppett, Mrs Strom, Mrs. Traeger, Mrs. Kintz, Mgr. 4...4.,..1........a,,.a.i.s. fs n , x I xy 60255 ' A T 5 T Summerz o S P Vlll J 356 Sports 'ily LST' 1 Tix 'f If ,L .l 41, Hx X K I Q V? f Wu... f ,f 16x 'N ff K X' ,ff gf X f r l X 'NG F'-w ??'f4 T fx ,A X 4 X Q T MINT ' Q 5 X xx 5 , s - y 'f ef i h N cb 'ff' fs . QW. TO EVERYTHING THERE IS A SEASON Young dihleies . . . developing physical skill cmd coordination . . . Win or lose . . . Good sportsmanship . . . li's the spirit thot counts . . . This is your qool. P QU -r L is Gessler, Mock, ,vwwwnmwnmxwfgww-2-Wmmwmmm All fye On the Squad VARSITY Row l--Eggert, Casey, Turner, Manasses, Del Giudice, Boscarino, Zappavigna, Antonelli, Miller, Mgr., Stieper, Head Mgr., Furlong. Row 2-Sehlke, Penczek, Gibbons, Shackel, Ambroz, Kocimski, Conners, Kozlowski, Abdul, Knoebel, Czarnecki, Shipanik, Slomski, Madden, Prokaski. Row 3-Skuby, Wienke, Fabry, Marines, Gessler, Sais, Albrecht, Zordani, Mehmel, Parello, Kazlauski, Goelz, Plociennik. Row 4-Bickel, Kestas, Ruffolo, Quirk, Smith, Doljanin, Rich, Wilson, Iacobsen, Ruzicka, Griffin, Statla, Iopek, Ransford. FROSH-SOPH TEAM Row lvlirajewski, Nolan, Rachford, Wallbruch, Smid, Voltz, Parrish, Erickson, Edinqton, Feichtinger, Hickey, Hillebold. Row 2fTuttle, Hitchcock, Iurus, Frain, Kuinius, Payne, Mahl, Sabatino, Klein, Giraldi, Dedkowski, Kasotakis. Row 3-Deplewski, Cullen, Pell, Shade, Gorski, Graham, Connelly, Kosch, Koshen, Jeffries, Agnew. Beginning in the spring and continuing throughout early fall, Coach Dutch Von Bremer drills his grid men until he is ready to present them for their fans to see and their opponents to regret. The squad remaining at the termination of his cutting and scrimmaging is unfailingly a hardened group of able and agile pigskin experts. As far as the boys are concerned, playing the regular season is reward enough for the training grind. They are eager to work and play for Dutch, who has a fine record as a football coach. ln his five years as head mentor the Eagles have added two city championship shields to the walls of Lindblom. Fundamental knowledge and initial experience for future varsity endeavor is gained in daily teamwork by the frosh-soph squad. Under the tutoring of Coach Iohn Labant, they de- velop skill and team play in competition with other frosh-soph elevens. Precision in blocking, tackling, and ball-handling are but a few of the techniques acquired by the squad as they practice the tactics of good football strategy. Many hours are spent by the boys on the gridiron until each member learns to perform his particular duties efficiently and to function smoothly in whatever position the needs of the game demand. Eager, anxious soph recruits are gradual- ly transformed into expert linemen and shifty backs. The soph team has a chance to test its ability against that of the varsity in post-season practice games. Page 92 The first game of the season against Eenger saw the varsity gaining experi- ence against a tough foe. ln the picture at the top of the page a breakaway through the line results in a first down for Lindblom. With the fans watching in the background our boys execute a pass play that really clicks. Coach Von Bremer and Reggie Abdul, in the picture below, seem grim when a plunge for a first down is stopped. Con- ners involuntarily shows the needed distance. A Eenger back, in the lower left hand picture, rips through the line into our secondary. The Maroon eno' Golo' Take to the Helo' Even though the varsity encounter- ed stiff opposition from the opening kickoff with Fenger until the final con- test with C.V.S., it was an exhilarating experience to be part of the football crowd when the Eagles were perform- ing this fall. Every time the band march- ed out on the field or the girls led the cheering section Lindblornites gave out with their best applause and rallied to the defense of our team. Those on the side-lines played their part in support- ing our boys, and when the strains of the Loyalty March resounded over the gridiron the varsity knew they had the wholehearted backing of their school- mates. This same spirit of interest and loy- alty prevailed throughout the season, as was shown by the attendance. All the faithful fans who turned out for the squad's games weren't disappointed. The team's spirit, sportsmanship, and play kept the crowd excited and proud to be Lindblomites. As succeeding au- tumns roll around, the same atmosphere will prevail: only the participants will change. No matter what the scoreboard reads, Come on, team, You're doing fine, is a perennial cry that floats over the gridiron as the Lindblom varsity performs. Page 93 -igl... .,m,,.W iiW, WM We . -W ,,,i,..u. .. ..-. ........... W Pig km Portrait Left-Knoe-bel tries to elude enemy tackles as he drives around end. Lower left-The crowd leaps up as the Eagles jump for a pass. Centerfl-X delayed buck drives the ball closer to the enemy goal line as Del Guidice and Marines approach the pile up. Action was the keynote of the l952 football season as the Eagles were pitted against a rugged schedule of outstanding teams. Scenes, such as those shown above of the Fenger game, were typical of many which thrilled Lindblom fans throughout the season. Opening against our traditional pre-season rival, Fenger, a green Lindblom squad received its first taste of bitter competition in losing 33-O. This practice game was followed by the first Central Section game versus Gage Park. The Eagles, still not sure of themselves but gaining confidence as the game progressed, were downed by the spirited Owls, 25-6. Lindblorn then found itself, stiffened its defense, and registered two consecutive tie games, the Eagles battled Hirsch and Phillips to scores of 6-6 and 7-7. Playing perhaps their best game of the year against the Blue Devils Lindblom fought from behind, inspired by the playing of co-captains Ralph Knoeble and Reggie Abdul, to come within two points ot whipping a highly-touted Tilden eleven, l4-12. Page 94 of the 79 Eagle Top-A jarring desperation tackle stopped this run, but our man held on to the ball. Bottom-Uncounted hours on the field practicing blocking and tackling built the team into a co-ordinated unit. The second meeting with Fenger was a testimonial to the team's improvement during the season. Although Lindblom lost 32-25, the score contrasted sharply with the first game of the year, played against the same outfit. The dauntless spirit of our lads professed itself fre- quently throughout the season, but especially in this game. A play-off berth'hung in the balance as our last game approached. The Eagles battled Valiantly but came out on the short end of a 33-6 score with C.V.S. The season's record of two ties and five losses belied the ardor and effort displayed by the maroon and gold on the gridiron. The Eagles at the finish of the year were a far superior squad to that fielded by Coach Dutch Von Bremer in early September. The tremendous degree of advancement was a credit to the team, its coach, and the school. Experience obtained in 1952 will be a great help on the football field when the pigskin parade starts again in '53, since enough varsity men are returning to stimulate optimism from the players and students. Page 95 FOOTBALL SCORES Opponent Lindblom FENGER 33 0 GAGE PARK 25 6 HIRSCH 6 5 PHILLIPS 7 7 TILDEN 14 12 FENGER 32 25 C. V. S. 33 6 Lfndblom Cagers Ro!! Up the Score SQUAD Row 1- Samrnons, Sczepanski, Devereux, Coach lones, l-lajost, Wallace, Bond. Row 2- Fabry, Pasquinelli, DelGuidice, Kurtz, Roberts, letton, Vanecko. Row 3f Soltis, Mgr., Heard, Cernak, Bain, . Little, Miller, Mgr. SOPHOMORE Row lg Voltz, Lange, Rogovich, Powell, Tuttle. Row 24 Homa, Martin, Stokes, Burgess, Kuinius. ball. Despite a slow start yielding just three victories in eight practice games, Lindblom's Senior Cagers showed abundant promise and ability in their pre-season schedule. Highly creditable scores, such as a 67-62 loss to C.V.S., which finished fourth in the city, and a 64-57 defeat by a strong De Paul quintet, exhibited an indication of the excellent grade of basketball to come. The annual l.l.T. Christmas Tourney issued further warning of Lindblom's potentialities as the Eagles streaked by Morgan Park and Steinmetz, triumphing 71-56 and 62-53, respec- tively, to gain the quarter-finals. ln a heartbreaking double-overtime Lane's lndians edged by our squad, 7l-70. Facing a powerhouse of opponents in Central Section play, Lindblom lost two of its first three games. A 67-56 victory over Englewood was sandwiched between losses to Tilden, 58-54, and Du Sable, 67-64, in fiercely contested games. Lindblom then began a three-game winning streak, defeating Phillips, Farragut, and Harrison. A defeat by Gage Park, 58-5l, was promptly followed by a victory over Kelly, 76-56. The Eagles qualified for the playoffs by romping Dunbar in a crucial game, 64-4l. Chances in the playoffs diminished and died as our first opponent, Sullivan, acquired a big lead and won going away, 90-66. Co-captains of the squad were lim Sammons, graduated at mid-year, and Ron Wallace, junior guard, who led the team in scoring. Two other regulars, Leon Sczepanski, six foot six center, and Ioe l-lajost, forward, are returning next year, along with new material from the frosh-soph team, to make Lindblom a definite threat for the city title. Page 96 VARSITY BASKETBALL BASKETBALL SQUAD REBOUND STRUGGLE A Fenger man tries to out reach loe Hajost for the 1952-1953 BASKETBALL RECORD I.I.T. Tourney tSeniorsJ Opp. Lind. or an Pk 50 71 M g . Steinrnetz 53 62 Lane 71 70 Central Section League Frosh-Soph Opp. Lind. Tilden 28 30 Englewood Du Sable Phillips Farragut Harrison Gage Park Kelly 40 51 22 39 47 40 42 Dunbar 49 29 38 38 30 43 28 41 43 Seniors Opp. Tilden 58 Englewood Du Sable Phillips Farragut Harrison Gage Park ll 56 67 65 52 46 58 Ke Y 50 Dunbar 41 Play-offs lSeniorsl Opp. Lin Sullivan 90 Play-offs tFx-osh-Soph Opp. Lane 35 Tilden 31 Schurz 33 McKinley 37 Winalsl Lind. 54 67 64 68 57 51 51 70 64 Lin 4 d. 66 J d 8 33 36 29 In the Baskets season's record ear are 'Sh 1' fm innovating the new basketball system in grand style, Lindblom's Frcsh-Soph Eagles amassed a of ll-2 to gain second place in the city playoffs. The frosh-soph system, in which boys of first and second y eligible to play, was initiated this season and replaces the junior teams which were for boys of limited height. Building the team around his captain, guard Bill Martin, Coach Gus lcnes assembled a spirited quintet that captured six of nine pre-season practice games. Central Section play was initiated in a hotly contested, see-saw battle with Tilden. The Eagles triumphed, 30-28. A total of eight victories against one defeat gained the Central Section title for Lindblom. The single defeat was at the hands of Wendell Phillips when the Eagles were downed by a score of 38-22. ' ' ' the city playoffs, Lindblom met and vanquished Lane, 48-35. Two more successive victories d 'n Tilden and Schurz by scores of 33-31 and 36-33, respec- ' inst a powerful, undefeated Having qualified for l found our sophs e gi g ' ' h our team was pitted aga ' ' ' ' d lace in the city. in the quarter-finals and semi tina s tively. These victories brought Lindblom into the city finals w ere outfit from McKinley. The Eagles played a fast game but were rubbed out 37-29, finishing in secon p lt was a grand season of sport for Lindblorrfs basketball team and her fans. Page 97 t This Team Ra tes Top B17!lT1g Row lfWeiss, Lazaric, Patten, Iiskra, Hardy, Samuels, Young, Stoginski, Crites, Coach Smidl. Row 2-Brown, Cermak, McKendrick, Kaiser, Babiar, Schultz, Kelly, Ramsay. Row 3-Harris, Rossberg, Parmelee, Pasalevich, Kilinski, Ambroz, Slusarczyk, Blazek, lurus. Row l-Stoginslci, Kabica, Shodeen, Simkus, Craven, Soderbe-rg, Kosnar, Fleckenstein, Coach Srnidl. Row 2-Woods, Zekios, Sutcliffe, Mayer, Underwood, Briley, Ceithaml, Robertson. Row 3fConnelly, Roach, Matyska, Morano, lohnson, Peschel, Dasbach. Row 4-Schar, Behling, Kunstrnann, Ianik, lnnis, York. Those who have seen the gymnasts perform at the Boys' Achievement Assembly or at any of their meets have witnessed a thrilling combination of talent in which skill, grace, and endurance are combined. When lim Samuels demonstrates his ability on the parallel bars, one sees a performance which a professional acrobat would envy. Each boy on the squad is proud ot the enviable reputation enjoyed by the gymnastic team at Lindblom, for our school has made a steady practice of collecting all the honors in this field. The boys spend much time, after as Well as during school hours, mastering the parallel bars, horizontal bar, side horse, and long horse on which they compete. ' The team holds several meets each year with other high schools. The most important con- tests are the City Championship and the Central A.A.U. meet in April, the outcome of which determines the best team in the city and midwest. One of the mainstays on this year's team is lvory Hardy who took first place in each of the events last year. Under the guidance of Coach Smidl and Captain Lauren Young, the gymnastic team hopes to keep its long-standing record of gymnastic city champion intact when the April meets begin. Page 98 2 if 302 Q . .E 3 W y Style Specialists Dive for Honors IUNIOR SWIMMING TEAM Row l-Szabo, Kinner, Aqrimonti, Scott Iennings, Casey, Zegan, Goblisch, Clark, Kerwin. Row 2-Coach Bohor, Thiede, Brumlik, Malicki, Sherwin, Giralcli, Wernli, Dorus, Strom. Row 3-Windstrup, Urbanski, Soderberg Ledebuhr, Voltz, Sochacki, Putnam, Lewis, Stokes. SENIOR SWIMMING TEAM Row l-Oneil, Sokol, R. Kazlauski, Turczynski, Remmele, Sais, Paluck. Row 2-Wessberg, Markel, Scheulin, Eggert, Mehmel, Plociennik, Capt., Parris, Capt.: Coach Bohor. Row 3-Brownfield, Kinner, Yara, Roberts, Szeflin, Iilek, Schroeder The Lindblom Sharks captured the Central Section title this year by winning six of their seven meets. They outscored their foes in both diving and racing events. The Sharks have fast men in every swimming event including the one hundred yard back-stroke and the four man relay. Our co-captains have both scored high individual honors: Dave Parris has never been defeated in the free-style event, and Paul Plociennik is one of the fastest back-stroke men in the city. Under the watchful eye of Coach Bohor the boys train diligently, and in future competi- tion the team is hoping to continue its good record. To add to the interest and excitement of aquatic sport, an intramural marathon is being held this year to determine Lindblom's cham- pion swimmer on each team. As the race moves into its final weeks each boy is striving to perfect his style so that he may qualify for the title. Page lCO Meyer, Zaruba, Glaza, Iohnson, Fas! Action on the Diamond Clockwise- Del Guidice is Winding up for a fast ball. That's Gessler connecting for a base hit. As he stretches for a low peg, Fabry looks mighty pleased. Looking over the lineup, Coach Ianousek seems con- fident about the ability of his boys. Warming up in the bull pen, Czarnecki gets ready for some good pitching. BASEBALL Row l- Del Guidice, Fehr, Czarnecki. Row 2- Feller, Mgr.: Fabry, Parello, Gessler, Urbanski, Hruby, Mgr. Row 3- Stotts, Dabisch, Mgr.: Pertile. Who's on first? is a familiar cry heard on the baseball diamond each spring during eighth and ninth periods as the team gets set for a new season. Coach Ianousek starts training early in the year so the boys will be in good condition when the season gets under way. Each member of the squad Works hard to develop good timing and coordination. Batting practice is held every day to Warm up the team and to develop good baseball skills. Our bushers aim to perfect those curve balls and to give out with the kind of ball playing which Will help them win new laurels. The 1952 baseball team had a good record, but was defeated in the semi-finals by our arch-rival, Tilclen. With a strong team picked from the fall tryouts, Coach Ianousek and his boys are making a bid for a successful season. Page 101 IIS All in the Form Golf and tennis, recently resumed at Lindblom, are capturing the interests of many young athletes. So many boys Want to make the teams that elimina- tion tournaments must he held. The players are taught the fundamental rules of the games and all the fine points of swinging a club and making overhead smashes. Both teams compete against other schools. ln the spring of 1952 the golf team finished third and the tennis team fourth in the Central Section. Golf and tennis are difficult sports to gain an L in for the player must win one-half of his matches. But Whether or not he triumphs in competition, he still gains abil- ity Which he can use for enjoyment or relaxation at any time during his life. The golf team is coached by Mr. Hunter and the tennis team by Mr. Weckel. GOLF CLUB Row 1- Goelz, Stukus, Capt.: Kenney, Miehle, Reiss, Skow, Randonis, Openlander, Row 24 Coach Hunter, Haller, Kennedy, Fiedler, Arhetan, Morano, Hruhy, Ziska. TENNIS TEAM Row l- Iiskra, Kubilius, l-lallas, Plociennik, Gopoian, Miller. Row 2- Mr. Weckel, Craven, Rusczyk, Stoginski, Wlodarczyk, Blazelc, Shodeen, Krueger, Ziska Page 102 A5 Free A5 the Breeze Coach Von Bremer The Lindblom Skating Club did its share this year to keep Lindblom at the top. The Skating Team scored points in every major ice meet in which they participated, including three out-oi-town contests. ln lanuary, l953, l..indblorn's team came in second in the city meet with co-captain Ralph Knoebel distin- guishing himself as individual city champion. Other outstanding skaters were Toni Mock, Bill Smale, and co-captain Chuck Zordani, all oi Whom scored high in many events. Members of the team practice at city parks and arenas to gain the necessary stamina and skill which it takes to become a good skater. In addition to coaching the Skating Team, Mr. Von Bremer also sponsors the Skating Club which includes both girls and boys who like to cut fancy capers on the ice. Whirling, gliding, and spinning across an ice-skating rink is sheer tun for these skaters, who put on a line exhibition as they execute intri- cate steps on the ice. Upper lett- liskra, Mock. Middle- Sommers, Smagur. Lower lefte Bansford, Reid, Wilcox, Peirson, Hartley, Parkey, Gardner. Bottom- Co-Capts. Zordani, Knoebel. Page 103 Tenpfh Topplers Trip the Ember SCORING NEW TRIUMPHS IN BOWLING Row l-Lockwood, Eitert. Row 2-Mitchell, Pres.: Flentje, Vice-Pres.: Evanow, Treas.g Pold, Stigberg, Sect.g Mr. Smith, Sponsor. Kennedy, Pres.: Rosenberg, Treas.7 Mr. Smith, Sponsorg Fehr, Sect.: Hoppe, Vice-Pres. Rivalry, noise, and excitement are in the atmosphere each week at Queens as members of the Lindblom Bowling League set to downing the pins. Both boys and girls come out en masse to exhibit and improve their skill on the lanes, some tor the fun of the game and others to establish new records in bowling. Our bowlers have been kept very busy in tournament competition trying to surpass last season's array ot trophies. ln a nation-wide tournament in the spring ot l952 the Pros of the girls league placed fourth ot all teams entered. Nancy Eitert blasted a 532 scratch series to capture second place tor the indi- vidual honors. The 'Eagles of the boys' league took titth place in their section. The National American Bowling Congress Tournament, held in Chicago this spring, organized a junior tourney for Chicago prep students. After qualifying at a city-wide elimination contest, tour girls and one boy from Lindblom won the right to enter the A.B.C. tourney. At the end ot the season intramural bowling patches are awarded by Mr. Smith, bowling co-ordinator, to the members with high scores including handicap in competition. Page lO4 GIRLS' BOWLING LEAGUE Come on, lris, keep your eye on the king pin. Row l Row 2 Row 3 4Wright, Kirpatrick, McGovern, Wells, Kaysen, Point. -Hatala, Loible, Wilson, Dadas, Oswald, I-losteva, Blaha, Macciocchi, Hauc. -Erickson, Drawert, Boyd, Raney, Giuttre, Walsh, Pittel, Angeles, Stambulis. Row 4-Kamm, Point, Meesit, Mudra, Bayer, Simmons, Klaub, Fruendt, Raddatz, Albrecht, Vytlacil. Row 5-Cozzo, Meyers, Fahlbusch, Garland, Torrence, Pointek. Row l-Lipinski, Fleck, Barbarek, Sawyer, Petrowski, Hunt, Amirante, Smith, Rank. Row 2-Taylor, Slanalan, Schmiecher, Krause, Scheunemann, Vestal, Pastorello, Hutter, liskra. Row 3+Chaloypka, Vinar, Gronkowski, Greif, Senkpiel, Angelos, Morvis, Cerino, Fox, Peters. BOYS' BOWLING LEAGUE Row leSkonicki, Kennedy, Racay, Randonis, Petersen, Masterson, Wlodarczyk, Gartner. Row 2-Pirolalo, Frcka, Kelly, Feller, Row 3- Thiede, Parker, Gopoian, Kenney. KellY, loniak, liskra, Muzik, , Mr. Smith, Sponsor, VCITGDGUSKI Pecka, Rosenberg. That's our boy, Tom, burning the ball down the alley. Row lflfrancis, Schweikert, Douglas, Row 2e- Row 3- Row 4- Minnick. Yara, Brown, Barker, Fiedler, Porembski, Szetlin, Foltz, Markel. Holoubek, Hartmann, Hruby, Matyska, Morano, Kionka, Fleck, Carnlic. Kamradt, Smith, Cole, Rajenwski, Bouton, Deplewski, Springer, Lacni, Antolik. ZS 'RJ --43.- , O Q Q Q l Theyre Mighty Hne...Beh1n0' the Line Left- OUR CHEERLEADERS-THE COMPLETE LINEUP Row l-Walsh, Steigal, Starnbulis. Row 2-Waterman, Angeles, Mrs. Barry, Sponsorp Valchar, Sopko. Row 3-Rozanas, Silon, Crvich, Spokes, Hood. Row 4-Morgan, Hutter, Stetanski, Wahlgren, Iiskra. Upper right- OUR FIRST GOLD IACKET GIRLS Row l-Hood, Sopko. Row 2-Rozanas, Steigal, Co-Capt.: Mrs. Barry, Sponsor: Waterman, Capt.: Walsh. Row 3-Valchar, Starnbulis, Angeles. Lower right- THE GIRLS IN ACTION Valchar, Walsh, Stambulis, Stiegal, Waterman, I-lood, Ptozanas, Sopko, Angelos. Who are the nicest gals you know With sparkling cheers that scare our foe? Who fill the stands with pep and steam Inspiring Lindblom's mighty team? Who are these girls in jackets gay So full of pep and vim each day? That's righte-our squad With cheers so bright Who help our boys to Win the tight. Come rain or snow they're on the go With happy ians in every row. Oh girls, you make such merry noise You really get behind our boys! Page 106 We D0 lf This Way'f..!n the GAA. Voss, Cullen, Berryman, Garland, Jones, Amirante, Stambulis, Bingham, Layo, Carlson, Carpenter, fstandingl. Vv'alsh, Vice-Pres., Rank, Treas., Cozzo, Sect., Blaha, Pres. Row l-Bantz, Sieger, Miss l-lackenbrock, Wright. Row 2-Hatala, Stigberg, Angeles. Have you ever wondered why there is such excitement among the girls when the new Cf.A.A. Board and Cabinet members are announced? The tact is that the blue jacket, the coveted emblem which every active member of the G.A.A. cherishes, symbolizes achievement in athletics won through hard work in the girls' gym. Athletic ability, a pleasing personality, and good scholarship are the qualities taken into consideration when the gym start and the G.A.A. Board and Cabinet choose new members. The climax ot G.A.A. activities is reached at the semi-annual Girls' Assembly when awards are made and the worthy recipients publicly honored. Since the Girls' Athletic Association has a large membership and a long list of activities, the wearers of the blue jacket have many special responsi- bilities. Each board member is entrusted with specific tasks which keep the complex machinery ot the G.A.A. running smoothly. These duties must be performed capably and conscientiously to make the work ot the entire organ- ization a success. Page lO7 Q. Row l- Gruhlke, Schlake, Hatala, Greene, Oswald, Berksos, Manasses. Row 2- Fuchs, Shanahan, Voss, Stefanski, Vaisvil, Carlson, Gronkowski. Row 3- Titus, Schroeder, Axelstrcm. Chiarappa, Raddatz, Coltman, Cole. Row 4- Silon, Reed, Noble, Fahibusch, Evanow, Leech, Rucker, Row 5fWells, Hutter, Ambroz, Ketchum, Royse, Rzeszut, Fleck, Barbarek, Angelos, Wagner, Vestal, Pastorello, Mitchell, Petrowski, Scheunemann. Row 1- Berryman, Hesek, Cullen, Sopko, Pres.: Frederick, lanes. Row 2- Erickson, Ambroz, Carpenter, Abdul, Caliendo, Huebner, Brown, Soltis, Rosdil, Vice-Pres.: Royse, Sect.: Bingham. Row 3- Sieben, Hartmann, Kirkpatrick, Stigberg, Wright, Cozzo, Garland, Haering, Brown. Row 4- Gill, Cerino, Smith, Hunt, Morbid, Layo, Regal, Hoyer, Marting, Sieczkarski. Their Dream 13 Lette eo' ln Maroon and Colo' L.D. is a term which has a very special meaning for all Lindblom girls. lt indicates an exclusive club sponsored by the G.A.A., but one which is open to every ambitious girl. The Lindblorn Five Hundred Club is an organization to which girls who have accumulated tive hundred G.A.A. points may belong. One thousand points are needed tor an L but after achieving the hali-way goal the girls are privileged to join the L.D. group. There is a traditional initiation ceremony in which all the members participate at the beginning of each semester. Strange costumes are worn to school by the new members, and the day oi fun is clirnaxed by the time-honored hike to Cantigny Woods. The girls plan parties, outdoor hikes, and various gymnastic activities as they all work together toward their common objective, the additional points they are earning for that coveted L, Page 108 T he Gym I Their Domain Girls active in gyrn and having a good scholastic average are eligible to join the Gym Leaders. These White jacket girls of the gym uphold the true Lindblorn tradition ot voluntary service. The members ot this group serve three periods Weekly in the gym by ret- ereeing games, supervising pro- ficiency tests, and assisting the teachers. This service is in addi- tion to their regular gym class. These are the girls Who have a genuine love tor sports and help to interest others in athletic com- petition. One very special social function of this group is the 'Lead- ers tea at the end of the semester at which the girls take time out tor fun and enjoyment. Top picture Row l-Stroker, Sawyer, Klaub, Whyte, Titus, Mills. Row 2-Rank, Trlak, Scheunemann, Nelson, Valchar, Wright, Taylor. Row 3-Stambulis, Pittel, Horaites, Sheridan, Martens, Peters, Stigberg, Sherman. Row 4-Vaisvil, Stetanski, Sieger, Cozzo, Soltis, Sopko. Middle picture Front-Amirante. Row l-Iiskra, Schlake, Hartmann, Centino Folsom, Donnelly, Anqelos, Coltman, Chaloupka. Row 2-Berryman, Basner, Brown, l-loyer, Bertsos, Angelos, Blaha, Barbarek, Cullen, Hatala. Row 3-YBantz, Morvis, Aalderks, Bufka, Albrecht, Betts, Maceyak, Brandstetter, Horvath, Higgins. Bottom picture FrontYVcss Row l-Noble, Manasses, Kirkpatrick, Carpenter, Sieben, Iones, Kwiatt, Paul, Novosad. Row 2-Mills, Oswald, Crvich, Mackoft, Fleck, Smith, Shanahan, Royse, Minasian. Row 3YChiarappa, Hatala, Fox, Layo, Haney, Hutter, Smiley, Ketchum, Erickson. Page 109 Dolphins of the Deep DOLPHINS Row l-Tasseit, Fredericks, Nihill, Prokop, Arnbroz, Weissenhcter. Row Z4Rout, Evanow, Barry, Madsen, Spokes, Rozanas. Row 3-Dean, Petrowski, Ruzicka, Geary, Bingham, Garland. SENIOR LIFESAVERS Row l-Wanner, Kasak, Raddatz, Vytlacil, Ruzicka, Bingham. Row 2-B. Hansen, Ross, Huebner, Highland, Cole, Dapkus. IUNIOR LIFESAVERS Row l-Herriault, Wells, Rucker, I, Hansen, Van Dyke, Hunt, Fahlbusch, Meyers, Yanik, Royse, Mazur, Alderson. Swimming is a vigorous form of exercise and yet allows time for fun and frolic. The swim leaders are an active group of top-notch mermaids who have that extra bit ot drive and ambition which it takes to develop new skills and techniques. Hour after hour is spent down in the deep blue waters ot our pool by these water babies under the supervision of Miss Hackenbroch. Besides their own swim periods these aquatic lassies assist the gym teachers in coach- ing other classes. At the end of each semester swimming tests are given to determine eligibility for life-saving and dolphin awards. Page llO K een Cempehtion Produces All-A round Athlete BADMINTON Row 1-Berna, Walsh, Axelstrom, Sieben, Gerino, Du Pere, Schroeder, Ferry, Hoyer, Rosdil, Haering, Bantz. Row Z-Angelos, Pittel, Morvis, Stigberg, Hesek, Wright, Sopko, Walenty, Novosad, Mills, Regal, Garland, Cullen. Row 3-Royse, Voss, Fink, Stefanski, Breuker, Vana, Wagner, Bingham, Berryman, Geary, Rank, Gandy, Laduca, Cozzo. Row 4-Lockwood, Domermuth, Chiarappa, Marting, Fleckenstein, Frederick, Hatala. PING PONG Front-Stambulis Row l-Stigberg, Tietz, Wright, Angeles, Pittel, Folsom, Pastorello, Klaub, Iones, Coltman, Valchar, Horaites. Row 2-Kesler, Layo, Blaha, Morvis, Turco, Trein, Iordctn, Rozanas, Erickson, Berna, Walsh, Axelstrom, Sieben, Cerino, Su Pere, Schroeder, Kamm, Hanson, Granzow, Smith, McGovern, Wells, Kaysen, Horaites, Brandsetter. Row 3-Marting, Whyte, Royse, Kunter, Vana, Bertsos, Hatalcr, Schlake, Stefanski, Oswald, Kirkpatrick, Hunt, Halagan, Burton, Maceyak, Paul, Kwiatt, Knight, Senkpiel, Mitchell, Manasses. Quick maneuvers, fast-flying movements, and good Wrist action are often seen during sessions ot table tennis in the girls' gym. Table tennis is a very fast and enjoyable sport played on ping pong tables equipped with nets. Girls who are just learning the game may join a beginner's class where they are taughthow tofhandle the paddle and ball, how to keep score, and how to develop various backhand shots and other tennis techniques. Badminton is a popular, exciting game which is played With a small racket resembling that used in tennis and a birdie. The birdie is a light-Weight object that is much harder to hit than one might imagine. Keeping the birdie in flight is the object of this fast-moving sport. Once the girls have learned the basic steps of either game, tournaments are played which give the members experience in competition. The winners receive G.A.A. bars, and every girl who participates gains twenty-five points toward her letter. Under the supervision of a gym teacher and a G.A.A. Board member these extra-curricular activities may be enjoyed by any athletically- inclined lassie. Page lll Tournaments Are Fun for Active Girls Two extra-curricular activities which the G.A.A. sponsors and which our girls enjoy tremendously are team games and fencing. Cooperative effort and experience in team work are deciding factors in the Team Games classes. The girls who are enrolled in these groups choose teams and play a series of games in whatever sport is in season, as baseball, basketball, or volleyball. Members of the winning team are awarded G-.A.A. bars. The best individual athletes are voted upon to make up an l-lonor Team of All-Stars. Intramural competition of this sort is exciting and keeps the girls on their toes all semester. Whether or not a girl is on the winning team, she has had a chance to enjoy the seasonal sports and to learn the rules of fair play. The clashing sounds of foils are heard distinctly as one walks by the fencing class in Room 315. Members of this group are learning the fine art of fencing as well as earning points toward their school letter. The girls, after they have acquired sufficient skill in handling the foil, compete in a fencing tournament, and each semester a champion is selected on the basis of numer- ous contests. This sport, which is lots of fun, is quite popular with the Lindblom girls because it develops grace and poise. FENCING Row l-Iones, Reed, Hatala, Blaha, Rank, Stigberg, Setzke, Fontana, Vaisvil, Wright, Cozzo. Row 24Voss, Oswald, Mackoff, Peters, Cullen, Kosler, Layo, Klaub, Smith, Erickson, Morvis, Garland. Row leBerryman, Santo, Burton, Mitchell, Hockersrnith, Smith, Wals, Kosiek, Knight, Howell, Pastorello, Kamradt, Piatkowsk. Row 2-Dornbos, Torrence, Stefanski, Reid, Burich, Harris, Prikopa, Hardy. Page 112 Paul, Brown, Kunter, Piontek, Williams, SM! Plus Gooo' Sportsmanship Equals A Vlhhnlhg Team Row 2 Row 3 Row 4 Row l Row 2 TEAM GAMES Left Front-Layo. Row l-Washington, Rozanas, Dawson, Fink, Voss, Horaites, Moody, lackson, Barryman. -Babanicols, Gantt, Smith, Iordan, Stefanski, Carvell, Kosiek, Cole, Bell, Folsom. -Rucker, Knight, Walenty, Lange, Miller, Iones, Hartmann, Burich, Maceyak, Paul, Zalem, Durnbus. -Fahlbusch, Hockersmith, Shaughnessy, Clymo, Hunt, Regal, McAllister, Vana, Crane, Schnelber. Middle left . FronteLayo. -Kirkpatrick, Crvich, Chiarappa, Fox, Stigberg, Sawyer, Hatala, Peters. -Valchar, Kwiatt, Angelos, Hutter, Smiley, Chaloupka, Ostrowski, Cozzo, Brandstetter, Sherman. Row 3-Mackoit, Horaites, Novosacl, Centino, Ketchum, Ambroz, Bantz, Albrecht, Morvis, Trlak, Yehling, Cullen, Rank. Row 4-Smith, Aalderks, Buika, Klaub, Scheunemann, Taylor, Fleck, Iones, Martens, Coltman. Middle Page 1 13 right- Row l-Wright, Manasses, Turco, Annalory, Hojnacki, Gruhlke, Reed, Barbarek, Schlake, Oswald. Row 2-Hatala, Royse, Deiber, Betts, Mills, Haering, Garland, Royse, Ambroz, Blaha, Maier. Row 3-Brown, Abdo, Rosdil, Wells, Knipfer, Madsen, Kaysen, Willand, Hansen, Egan, Antelek, Demato, Hesek. Row 4-Carter, McGovern, Kress, Schroeder, Axelstrom, Berna, Tietz, Bingham, Geary, Rosdil, Frederilk. Bottom- Row l-Mitchell, Halagan, Higgins, Gandy, Laduca, Broman, Stroker, Ruzevick, Wright. Row 2-Kosler, Burton, Szeszycki, Parmelee, Ruzicka, Ledebuhr, Erickson, Sopko, Evanow. Row 3-Iancik, Flentje, Meyers, Loibl, Wilson, Breuker, Wagner, Petrowski, Kasak, Therrault, Lockwood. Row 4'-Walsh, Stambulis, Pittel, Angelos, Berryman, Steben, Brown, Duffin, Kdvacich, Pastorello, Alderson. Lei the D ums Bea! For the Ifwhnihg Plame PICKED PLATOON Frontfflnd Lt. Bell, Znd Lt. Parker. Row l-Barkstrorn, Statkus, Scotchmur, Hudson, Mack, Skapek, Grindler, Lingl, Orszulcx, Jeffries. Row 2-Sandgren, Hill, Aders, Spiegel, Schmidt, Clark, Fleck, Felinczak, Olson, Lingl. Row 3-Drigot, Hill, Unser, Baukus, Dragonetti, Spiegel, Heitz, Heher, Schultz, Orszula, Sgt. Parker DRUM AND BUGLE CORPS ROW l-Billings, Bradley, Szarka, Alesky, Porembski, Kordell, Reese, Kamradt. Row 2-Beiz, Alesky, Wilke, Prell, Krist, Daccardo, Hazen. Row 3-Kelly, Simmons, Schultz, Aylward, Wrobel, Sukey, Dornbrowski, Brejcha. Page 114 Ha is Off To Uur M17ifary Men COLOR GUARD AND STAFF Row l-Pinkowski, Capt. Sandgren, Capt. Drigot, Hehl, Motel, Cinotte, Crane, Mai. Killoren, Capt Barkstrom, 2nd Lt. Hill. OFFICERS AND NONCOMS Row l-Capt. Sandgren, Capt. Drigot, Maj. Killoren, Capt. Barkstrom, Znd Lt. Hill, Lt. Morrison. Row 2-Mack, Dragonetti, Sukey, Billings, Brejcha, Unser, Scotchrnur, lst Lt. Parker, Baukus Rieslancl, Neal, Motel, Bohnstengel, Oriel, Hazen, Aders, Znd Lt. Bell, Hall, Statkus, Manak Kuvales, Prieskop, Burgess. Row 3-Kelly, Orszula, Iacobsen, Grindler, Skapek, Wilkie, Pinkowski, Schmidt, Hudson, Kionka, Kamarade, Rio, Hehr, Heitz, Olson, Lingo, Orszula, Parker. The Picked Platoon, crack unit of the Lindblom R.O.T.C., has triumphed in city competition again this year, making a total of six consecutive champion- ships. This record never has been equaled and probably Won't be for a long time to come. As the boys go through their paces all heads are turned, for the clock-like precision of the platoon is unbelievable. Under the supervision ot Sgt. Longshore, the boys drill long hours to perfect their military tactics. Their efforts, however, have not gone unrewarded. The trophies they have Won are symbols of their unremitting perseverance and diligence. Lindblom has always been very proud of the Picked Platoon, and this year's unit has continued to uphold the finest traditions oi both our school and the R.O.T.C. Page 115 1 Our Officers Se! the Pace The officers and men ot the Reserve Officers' Training Corps have made the Lindblom unit one ot the finest ot its kind in the city. The meaning and importance of cooperation, discipline, and responsibility are constantly emphasized in instructing the cadets. The NRO. wing of the building is the setting for marching formations and military maneuvers in which the cadets can be observed snapping to attention at the command of their superiors. The officers, moreover, get results. The steady improvement of the green cadets is a well-de- served reward for their hard work and patience. Upper left-Capt. Barkstrom and lst Lt. Parker set the example for the cadets with well-polished shoes and neat uniforms. Lower left- You've got a lot to learn, young fellow, Statkus warns Ruse. Keep up our traditions. Upper right-Sukey gives a demonstration in assembling the automatic ritle to Wilke, Bradley, and Billings. Lower right-Officers of the Picked Platoon admire their latest trophy. Collecting awards is a hobby with these fellows. Row l-Capt. Barkstrorn, lst Lt. Bell, Captain Sandgren, MlSgt. Parker. Row 24MfSgt. Hill, Capt. Drigot, lst Lt. Parker. Page ll6 ---.., '-A-...x MQW. xx N-w-x,,,,-.gNs'x .W MM,-sqvnx -e.g.,w w-'t.f.,..,.,xn f-,Mug W ,.,,,-5 .. N 'N'-xix-Q .W-'invafhxu A WfiQV . an 580 nv .WM W-Q ,agp-f-M Cadets learn Army Routine There are many activities in which a gualiiied cadet can specialize in Lower left-On the tiring line with the target in position the cadets blast the R.O.T.C. Among them are the monkey squad, the rifle team, and the away at their objective. drum and bugle corps. Working together in unison, the looys enjoy these activities and learn the value of both good cornradeship and organized routine. lf a cadet works hard, he will some day be rewarded by becoming an officer. The boys receive training which will serve as a iirm foundation Middle right-They can put this together blindfolded. for whatever fields of endeavor they may select in the future. HCIZGUI Druqonetti. MCIF1Oikf WTObGl- Upper rightf We still have the best unit! This is the opinion of Hill and Schultz Who are in a position to know. Upper left-The brass plots an attack. Sandgren is mapping the strategy Lower riqhlkpxsk any military mum about lhe bugle Corps' his every for Dragonetti, Barkstrom, Hazen, and Manak. Soldier S nemesis' Middle left-Poised for action! Our small bore sharpshooters get ready to ROW 1gHUZe1'1f Wfobelf DUCCGTJO- tire. Row 2-Krist, Sukey, Kamradt. Page l 17 Perfeer Performance Rrghz' De wn the Lrhe 2nd PLATOON, COMPANY A Row l-Morrison, Manak. Row 24Grind1er, Neal, Simmons, Kapustka, Betz, Berla, Iones, Iacobsen, Timmerman. Row 341-lall, Huerta, Sze-szycki, Szypulski, Litviak, Wlodarczyk, lohns, Unger. Row 4-Burgess, Moore, Rosa, Dombrowski, Slarna, Van Westrienen, Cull, Sweeten. lst PLATOON, COMPANY C Row l-Bohnsiengle, Slatkus. Row 2-Kuvales, Rio, Wencel, Baker, Peterson, Ryan, Rusczyk, Sowinski. Row 3-Oertel, Prieskop, Rehor, Venturella, Gallagher, Louqee. Row 4-Brejcha, Kioka, Johnson, Holt, Kordell, Ritola, Glasner, Kelly. 2nd PLATOON, COMPANY C Row 1-Statkus, Bohnstenqel. Row Z-Unser, Gallagher, Billa, Warren, McCowin, McGreal, D. Alesky, Wrobel. Row 3-B. Alesky, Ryan, Ahrens, Kolodziej, Aylward, l-lakala, Reese. Row 4-Cdl. M. Sgt. Riesland, Donovan, Rossborouqh, Schil'inq, Podlasek, Walczak, Keene. Page 118 rg. , K- ,, ,, 'Q , fs ff A,,., 1 ...- '1' is , 1. 1? f x 5 1 3 if ., R E V, itil fl, 2 ,g if is 'flgf z L 1 .I It 1 1 ff ffl AT SH!! 'f 1 1 ' g l JV 'fm ,I . wwiiigiggzgf gi ,.-f- g if -'W' . .4 , 'Q' 1 it Q ff-551 5 ..,,.,. -1 ft .I Q g Ei- Ty '4 , f if .4 5 ' 'af' ...... 1 T' ., 1 X61 X 4 G 1? 1 .f?1t'l ','IPfffQ,y ll ':'' Q-: A-A-' M . J y ' .,,, T ' - 4'Qf'?'?'f'f0 'lf'v?' if 'rr .,,, 3yfbj5.i'fg5f?,fg5.g1 '1t i1w'Qi ,M .- ' A 19 l1 .6 1 if' 1 '45 - ' - - -' ,- I : 0 s .. ' 1 ff'e 'o'0 'f ?: X t. - 'r f 2'-f'I'fZ'53'51Q5'45'3'35 ' f--- -5 . -vt - -:,:1-sr: I 45115065 O OV I -:-- 1, it ,V ,g,'ag,j?.f','tg,f3:,'1,l3 at I . 1 fYFt5: s?c?81ff0,'I'? ' Pi . 1 aw ' .. if' .,.. 1 'so'vs1 0 'J Q. ' 4 -'-'H' fri .1 ll, E H W - .-' 51:7 - E' : a51.,qp,h. 3,1 ' V: ,J .:,g5.ggEjs, 31. . ...,.5'.. -- - :- . I ' ' -- . A- , . V V 'W ,. ,Aww 1 M I ' x at 5177! Gro wlhg 177 A ihle fic Sta ture mbols of Embossed in silver and gold, countless beautiful trophies, sy Lindblom's athletic achievements through the years, find a fitting setting in the show cases in the main corridor of the school. A new trophy case, a gift from ' ' ' ' f h1 t' the graduating class of Iune, 1952, indicates the continuing trend o at e ic honors. Lindblomites can often be seen stopping to admire these cherished tokens, which represent every field of competition. Undoubtedly, sport enthu- d siasts have frequently felt compelled to emulate the same feats as they pause t ze at the exciting cups on display. As all Lindbiomites are aware, the o ga winning of laurels by our championship teams and the R.O.T.C. stems from the efforts of ambitious students who work strenuously in competition to acquire athletic emblems. Inspired by the members of the coaching staff they spend many extra hours in perfecting individual skills and in developing cooperative team action. To bring honor and glory to our school such students willingly relinquish leisure time and personal pleasures. Symbolizing the fine esprit de cor s of Lindblom s teams and platoons, the awards in the trophy cases serve I3 as a lasting reminder of athletic triumphs, past and present. Page 119 Wt '1 1 X t Q t ,C' Knut M 3 v, A EJ' N K f 1 I Nh A ww -HMM y t X I 3 t 5 7 t f , Gradua es : 52x O Xl9j! Mutt V if X t X., ,, , A P CIT? ' V.. S Siho ff,ig 7 S 5 t It 1 qgilfc ix? I N O Ch 'loc l'ARSHlP iomaggl? yn Nad SS' ef cw- IN TODAY ALREADY WALKS TOMORROW Lookina torwart to the future . . . Con- templatina new careers . . . Returnina in memory to yesterday . . . Now Yours is the Earth .... This is your leaacy. P 120 -r D n Alberts R b Aitman I V, 1 z I I ww f W? E E 5 5 Q S Z Q E I Q ION DICKSON IEAN ANG President Vice-President ELOS AURA LEE IRION GAYLORD WHITNEY Secretary Treasurer Class of January 7953 Page 122 HARRY AMBROZ Dance Committee, Club, Hall Guard. IEAN ANGELOS Vice-President of 4A Class, G.A.A. Board and Cabinet, Cheer- leaders Vice-President ot Honor Society, l.C.C. Attendance Sec- retary,,Golden Eagle, L f3 Chevrons, A Cappella Choir, Valedictorian. ADOLPH ANTONACCI Cheerleaders, Usher, Fire Marshal, Hall Guard, Radio Guild, No Tardiness. L Club, Football Team, Gymnastics, Spanish RUTH BADER G.A.A., Sub Debs, Eagle Salesman, No Tardiness, Hall Guard. MARILYN BANTZ 3 S Certificates, Honor Society, G.A.A. Board and Cabinet, L -3 Chevrons, L.D. Club, Gym Leaders, Golden Eagle, Badminton. CARL BARKSTROM Stage Crew, Light Brigade, Honor Society, R.O.T.C. L Club, Picked Platoon, No Tardiness, Golden Eagle. PEGGY BAUGHER S Certificate, Honor Society 4 semesters, Girls' Chorus, Mail Service, Hall Guard, Locker Guard, Art League, G.A.A. GERALD BERG Spanish Club, Hall Guard, Intramural Basketball. BARBARA BILLUPS l.C.C. G.A.A., Team Games, Fencing, Concert Orchestra, Soloist for Erotherhood Week Assembly, Sing Committee, Library Assistant. ROBERT BITTERLIN Ice Skating. NANCY BLAHA President ot G.A.A. Board and Cabinet, Vice-President of I.C.C., L -3 Chevrons, Honor Society 4 semesters, Treasurer ot Girls' Chorus. ZBENE BOEHNKE A Cappella Choir, Madrigals, Senior Girls' Council, I.C.C., Honor Society 6 semesters, Mail Service, G.A.A., Drama Club. DE WAYNE BONESS Intramural Basketball, Hall Guard, Usher. CAROL BORISY Vice4President of Mail Service Cabinet, Hall Guard Captain, L , Mail Service, Sub Debs, Girls' Chorus, G.A.A., Office Registrar. NICK BRAGA Weekly Salesman, Gymnastics, Intramural Basketball, Usher, Honor Society, Hall Guard, Tennis. RUTH BROWN L -4 Chevrons, G.A.A., Girls' Chorus, Team Games, Hall Guard, No Tardiness, Class Sing Committee. EDWARD BULL Intramural Basketball, President of Spanish Club, Art League, I.C.C., Sing Committee, Hall Guard Captain. LUTHER CADE Intramural Basketball. IERROLD COHEN Projection Club, Hall Guard, Bowling Team, Intramural Basket- ball. DAVID CONTORER Bowling Team, Baseball Team, Eagle Salesman, Concert Or- chestra, Spanish Club Treasurer, L Club, Hall Guard, Tennis Team. MARGE CUNNEA President of Girls' Chorus, President ot Mail Service Cabinet, Secretary of Mail Service Cabinet, G.A.A., Drama Club, Class Sing Committee, Radio Guild, Hall Guard. FRANCIS CURTIN Concert Band, Honor Society, Student Guild, Captain of Ushers, Fire Marshal, Weekly Staff, Eagle Salesman. . ' ' ' ' usiness Manager ot Weekly, French Club, G.A.A., L -2 Chevrons, Sub Debs, L.D. Club, Girls' Chorus. WASH IEAN DENMAN G.A.A., Team Games, Hall Guard, Gym Assistant, Badminton. RON DEVEREUX Basketball Team, Baseball Team, L Club, 4 l..'s , I.C.C., Hall Guard, Fire Marshal, Co-Captain of Basketball Team. ION DICKSON 4A Class President, Fire Marshal, Intramural Basketball, Hall Guard. ANGELO DOMINIQUE Drama Club, Gym Office Assistant. ROBERT DORMAN Projection Club, No Tardiness. HUGH DOYLE Band, Usher, Eagle Ad Club, Intramural Basketball, 3 Band Lyres, Latin Club. MARTIN DOYLE Usher, Projection Club. Page 123 Page 124 RICHARD DRIGOT Fire Marshal, Stage Crew, Light Brigade, Weekly Stati, Honor Society, R.O.T.C., L Club, Picked Platoon, I.C.C. Eagle Sales- IHCIH. CAROLYN DUFFIN l.C.C,, Gym Leaders, Program Registrar, Weekly Start, Honor Society, G.A.A., Student Guild, Spanish Club. IYIILDRED Senior Girls' Council, Honor Society, Weekly Salesman, G.A.A., No Tardiness, Perfect Attendance, S Certificate, Hall Guard, Fencing. DORIS FULKERSON G.A.A., Gym Leaders, Fencing, Honor Society 4 semesters, Sub Debs, Hall Guard, Dance Committee, No Tardiness. EARL GASNER Concert Orchestra, Honor Society, No Tardiness. RON GENGE Hall Guard, Soph Football, Usher. PENNY GI S , A Cappella Choir, Madrigals, Honor So- ciety, 4A Prom Committee, l.C.C., Vice-President ot Spanish Club, Student Guild. GLORIA GUILBAULT G.A.A., L.D. Club, Team Games, Teachers' Assistant, Weekly Staff, Badminton, Fencing, Bowling. LUDALPH HARRIS l.C.C., Football, Honor Society l semester, Latin Club, No Tar- diness. LOUETTE HARTMANN Honor Society, Office Registrar, Office Assistant, Student Guild, Gym Leaders, G.A.A., Sub Debs, L -3 Chevrons, ELAINE HATALA G.A.A. Board and Cabinet, L -4 Chevrons, Honor Society, Gym Leaders, L.D. Club, Spanish Club, Weekly Salesman, Girls' Chorus. IANET HILLIARD Gym Leaders, Student Guild, Hall Guard, Eagle Salesman, Library Assistant, G.A.A., Fencing, Team Games. STANLEY HOARD Basketball Team, Intramural Basketball. HERBERT HOEFLINGER Radio Guild. HENRY HOPP Hall Guard, Bowling League, Vice-President of Bowling League. ALAN HUDSON A Cappella Choir, Madrigals, Honor Society 2 semesters, S Certificate, No Tardiness, Class Sing Committee, Spanish Club. DON HUENECKE Skating Team. AURA LEE IRION cretary, Senior Girls' Coup,giJ...A Cappella Choir, Honor Society 2 semesters, L -l Chevron, Secretary and President of Spanish Club, G.A.A., Team Games. DENNIS IASIK Latin Club, Hall Guard, Intramural Basketball. IOYCE IENKINS , L Honor Society 2 semesters, Prom Commit- tee, Vice-President and President of Latin Club, No Tarcliness, G.A.A. IOYCE IONES Weekly Staff, Honor Society l semester, Student Guild, Girls Chorus, French Club, l.C.C., Sub Debs, Badminton. RAY JONES Usher, Eagle AD Club, Swim Team, Hall Guard. GEORGE KAISER L Club, Basketball Team, Iunior Prom Committee, Hall Guard, Pep Book Salesman, Football Ticket Salesman, 2 L's . MARTHA KARNAS G.A.A., S Certificate 2 semesters, Honor Society 4 semesters, Weekly Salesman, Spanish Club, Finance Committee. IAMES KEMPER Hall Guard, Football Ticket Salesman, Fire Marshal. GLENN KILLOREN President of Honor Society, Battalion Commander R.O.T.C.. Picked Platoon, Spanish Club, 3 R.O.T.C. L's , No Tardiness. LEONARD KINNER Swim Team, 3 L's . DONALD KLOOTWYK Honor Society 2 semesters, Usher, Hall Guard, No Tardiness, A Cappella Choir. RALPH KNOEBEL Co-Captain of Football Team, Co-Captain of Ice Skating Team, Hall Guard Captain and Lieutenant, Weekly Salesman, Fire Marshal, l.C.C. IOHN KOEHLER Senior Boys' Council, Captain of Swim Team, Varsity Football, Soph Football Team, Intramural Sports, Hall Guard, L Club, 5 ,,L.s,.' DONNA KOENIG G.A.A. Board and Cabinet, 6 Dolphins, Swim Leaders, Life- Saving Representative, Prom Committee, A Cappella Choir, Madrigals, L -3 Chevrons, Hall Guard, l,C.C. SHIRLEY KOSMAN Girls' Skating Team, L.D. Club, L -1 Chevron, Girls' Chorus, l.C.C., Weekly Salesman, 4A Sing Committee, Sub Debs. DON KOZLOWSKI Varsity Football, Soph Football, Hall Guard, L Club. IERRY KOZLOWSKI No Tardiness, Art League. MICHAEL KROLL A Concert Orchestra, Concert Band, Honor Society 3 semesters. HENRY KUELTZO Weekly Salesman, No Tardiness, Hall Guard. MICHAEL KUPCHEK Skating Team, Bowling Team, Hall Guard, Projection Club, Library Assistant, Cheerleaders. IAMES LA BEAU Honor Society, Soph Football, Spanish Club, Hall Guard, Intra- mural Basketball, No Tardiness. CONSTANCE LA DUCA Girls' Chorus, G.A.A., Mail Service, Teachers' Assistant, Eagle Ad Club, Weekly Staff, French Club, Hall Guard. FLORENCE LISZKA G.A.A., L.D. Club, Bowling League, Weekly Salesman, Gym Office Assistant, Hall Guard, lce Skating Team, Team Games. MARY LOU LOIACONA L , L.D. Club, Perfect Attendance, No Tardiness, Girls' Chorus, Weekly Salesman, Gym Office Assistant, lce Skating Club, Team Games. DONALD LOSCAR Rifle Team, Picked Platoon, 2 L's . Page 125 Page 126 DELORIS LOVETT Library Assistant, Fencing, Radio Guild, G.A.A., Team Games, Library Club, No Tardiness. Senigg Qu' ls' Council, A Cappella Choir, Madrigals, Honor Society, L , G.A.A., Team Games, Sing Committee. ED MCMAHON Hall Guard, Bowling Team, Drama Club. IOAN MERKIN Mail Service Cabinet, Eagle Salesman, Drama Club, Radio Guild, No Tardiness, Weekly Staft, Spanish Club, Assembly Participant. EDWARD MILLER Golden Eagle, Weekly Sports Editor, Honor Society 6 semesters, Football and Basketball Manager, Tennis Team, Perfect Attend- ance and No Tardiness, L Club. RONALD MILLER Hall Guards, Usher. BILL MITCHELL Senior Boys' Council, A Cappella Choir, Madrigals, Honor So- ciety, Soph Football, Class Speaker, Class Sing Committee, I.C.C. IESSIE MOLIS Senior Girls' Council A Cappella Choir, Madrigals, Honor Society, L , G.A.A., Sing Committee, Weekly Salesman. LORRAINE MORLE irs Counci L -2 Chevrons, Honor Seciety, Art League, Bowling League, Gym Leaders, Eagle and Weekly Salesman, Hall Guard, G.A.A. ROBERT MORRISON Hall Guard, Architects' Club, No Tardiness, R.O.T.C. Company Commander. RON MOUSEL Hall Guard, French Club. F 3 ' ' ' ' nor Society 5 semesters, Secretary oi Spanish Club, L -l Chevron, No Tardiness, G.A.A., Circula- tion Manager of Weekly, Gym Leaders. VALERIE NIZICH G.A.A., Weekly Stat-t, No Tardiness, Student Guild, Art League, A Cappella Choir, Sing Committee, Madrigals, Honor Society 3 semesters. DANIEL NOLAN Varsity Football, Swimming Team. MILO PARELLO Varsity Football, Baseball Team, Swim Team, L Club, Captain of Soph Football Team, President of Spanish Club, A Cappella Choir. IANET PARHAD Mail Service, Honor Society l semester, Team Games, Spanish Club, Sub Debs, G.A.A., No Tardiness. BILL PARKER Ft.O.T.C. Picked Platoon, Color Guard, Monkey Team, Hall Guard, 4 R.O.T.C. L's . BERNADINE PETRAITIS Honor Society, Bowling Team, G.A.A., Perfect Attendance, Hiking and Proficiency Bar. ELAINE PLETZKE Honor Society 2 semesters, G.A.A., Latin Club, Hall Guard, No Tardiness. ROBERT PLOHAR Weekly Staff, Honor Society 2 semesters, Fire Marshal, Usher, Hall Guard, Weekly and Eagle Salesman. ROBERT POETZINGER Hall Guard, Hall Guard Supervisor. SHAYLE POLANSKY Secretary of Senior Boys' Council, Honor Society 2 semesters, Intramural Basketball, Senior Finance Committee, Projection Club, Perfect Attendance, No Tardiness. CHARLES POPIK Honor Society 2 semesters, Weekly, Fire Marshal. ROSEMARY PRATSCHER Honor Society 3 semesters, G.A.A., Art League, Eagle Salesman, No Tardiness. ELAINE PRICE Honor Society 2 semesters, G.A.A., Latin Club, No Tardiness. GEORGE PRICE Hall Guard, Weekly Salesman, Projection Club, Usher, l.C.C. RAMON PROKASKI Chief of Fire Marshals, L Club, Baseball Team, Swim Team, Bowling Team, 2 L's , Hall Guard, Latin Club. MARY PROKOP 2 Dolphins, Swim Leaders, L.D. Club, Team Games, Girls' Chorus, G.A.A., Weekly Salesman. DONNA PULIDO G.A.A., l.C.C., Weekly Salesman, Mail Service, Perfect Attend- ance, No Tardiness. FRANK RADZIENDA Ice Skating Team, lntramural Skating, Hall Guard, UL . KAY REX G.A.A., Spanish Club, Sub Debs, Hall Guard, Girls' Chorus, Team Games. RAYMOND RODONIS Honor Society, Spanish Club, Hall Guard, Intramural Basketball. ROBERT RUEGER 'U' 'T' ALBERT RUZICKA Senior Boys' Council, A Cappella Choir, Prom Committee, Var- sity Football, Soph Football, Hall Guard Captain, lntraniural Basketball, No Tardiness. THOMAS RUZICKA y Gymnastic Team, 2 L's , Fire Marshal, Latin Club, No Tardi- ness, Prom Committee, BILL SALELA Drama Club, Hall Guard. IAMES SAMMONS Co-Captain of Basketball Team, Swim Team, Hall Guard, Intra- mural Basketball, 3 I.'s . BILL SANDGREN Picked Platoon, Captain of Rifle Team, L Club, R.O.T.C. Staff. GAIL SARNO G.A.A., Girls' Bowling Team, Mail Service, Weekly Typist. ROSEMARY SAVAGLIO G.A.A., Hall Guard. WALTER SAWYER Football Manager, 2 Manager L's , Swim Team, Hall Guard, No Tardiness. ROBERT SCHOENHOFEN Baseball Team, Intramural Basketball, Ushers, Fire Marshals, Hall Guard. Page 127 Page 128 GREG SHACKEL Varsity Football, L Club, Senior Boys' Council, Weekly Staff, Hall Guard, Soph Football Team, Weekly Salesman, Class Sing, 2 L's WAYNE SIEBERT Captain of Hall Guards, Basketball, lntramural Basketball, Dra- matic Club, Fire Marshal. PEARL SIEGER G.A.A. Board and Cabinet, Maclrigals, A Cappella Choir, Honor Society, Iunior and Senior Prom Committees, Faculty Speaker, Secretary of Latin Club, L -2 Chevrons. IOAN SIMONSIS Team Games, Fencing, Sub Debs, Library Assistant, G.A.A., Weekly Typist, Perfect Attendance. ROBERT SKALA Basketball Team, Baseball Team, L Club, 4 L's , Hall Guard, Fire Marshal, Weekly Salesman, Co4Captain of Basketball Team. VIVIAN SLOAN G.A.A., Team Games. nior Girls' Council, L -l Chevron, Honor Society, Girls Chorus, Gym Leader, all Guard, L.D. , Team Games. MARILYN SMITH G.A.A., Hall Guard, No Tardiness, Weekly Salesman, IOI-IN STIEPER Golden Eagle, Honor Society, Associate Editor of the Weekly, Co-Chairman of Social Center Dances, Head Football Manager, Usher, Fire Marshal, Hall Guard. CA ROL STIGBERG l.C.C., G.A.A., Secretary of Girls' Chorus, Hall Guard, Mail Service, No Tardiness, Eagle Salesman. IUDY STONE Treasurer ot Mail Service Cabinet, Honor Society 3 semesters, Hall Guard, Girls' Chorus, Sub Debs, Assembly Participant, G.A.A. S,an,jQg Girls' Council Golden Eagle, L -3 Chevrons, No Tardi- ness, Perfect Attendance, Honor Society 5 semesters, Gym Lead- er, Class Sing Committee, Program Registrar. RICHARD STUKUS Golf Team, Soph Football Team, Weekly Staff, Honor Society, Hall Guard, Latin Club, lntramural Basketball, Ticket Salesman. IOHN SUTKO A Cappella Choir, Madrigals, Latin Club, Soph Football. VIRGINIA SVENTEK Mail Service Cabinet, Honor Society 2 semesters, Latin Club, Secretary of Latin Club, G.A.A., Weekly Salesman, Girls' Chorus, No Tardiness. DIANE SZASZ Spanish Club, Girls' Chorus, Eagle Salesman, No Tardiness, Class Sing Committee. IEANIE TRICK l.C.C. Attendance Secretary, Mail Service, Team Games, Hall Guard, Weekly Start, Weekly and Eagle Salesman, G.A.A., Spanish Club. IOE TUREK A Cappella Choir, Madrigals, Weekly Salesman, Hall Guard, Soph Football. CLARICE VALCHAR Cheerleaders, L -4 Chevrons, Honor Society 5 semesters, Gym Leaders, Vice-President of Girls' Chorus, Hall Guard, Spanish Club, Vice-President and Secretary of Spanish Club, Office Assistant. PAUL VALENTINE Soph Football, Projection Club, Spanish Club, Library Assistant. GLEN VAN BEVEREN 3 R.O.T.C. L's , Hall Guard, l.C.C., lntramural Basketball. HAROLD VANCOEVORDEN Soph Football, Hall Guard, lntramural Basketball. RAY VILUTIS CASIM!R WALKER No Tardiness. DOROTHY WALSH Achievement L Cup, L -4 Chevrons, Vice-President of G.A.A. Board and Cabinet, 2 Golden Eagles, Cheerleaders, Secretary of Honor Society, S Certificate, Treasurer of Girls' Chorus, Vice-President of L.D. Club, Class Salutatorian. IOAN WATERMAN Cheereladers Captain, Cheerleaders L , L , G.A.A., l.C.C., Prom Committee, Hall Guard, Office Assistant. DONALD WEISE l.C.C. President, Chairman of Senior Boys' Council, Treasurer of Honor Society, Chief of Fire Marshals, Hall Guard Super- intendent. IOEL WESSBERG Swim Team, 3 L's , L Club, A Cappella Choir, Madrigals, Soph Football, Hall Guard, Prom Committee. GAYLORD WHITNEY 4A Class Treasurer, Treasurer of l.C.C., Basketball Team, Senior Boys' Council, A Cappella Choir, Fire Marshal, Eagle Salesman. LORRAINE WITT President and Secretary of Mail Service Cabinet, Honor Society 3 semesters, G.A.A., Student Guild, No Tardiness, L +3 Chev- rons, L,D. Club, Gym Leaders. RONALD ZELGIEWICZ Honor Society, Gymnastics. GERALDINE ZERBIAN G.A.A., Nurse's Assistant. CHUCK ZORDANI Co-Captain of Skating Team, Treasurer of LC.C., Captain of Cheerleaders, Hall Guard Captain, Fire Marshal, A Cappella Choir, L Club, Prom Committee. KEN MEHMEL Varsity Football, Soph Football, Swim Team, L Club, Captain of Swim Team, 4 L's . EVENING OF ENCHANTMENT . . . Unforgettable was the evening of Ianuary 16, l953, as girls in their billowy gowns and boys in their formal attire danced to the music of lack Holbrook and his Stardusters at the Senior Prom in the Windermere Hotel. in 7, , mv.ait,-6, MM- W, JAMES KENNEDY PAUL PLOCIENNIK IOYCE ENGEL LAUREN YOUNG President Vice-President Secretary Treasurer Class of June 7953 Page 130 ROSE ABDO Sub Debs, G.A.A., L.D. Club, Team Games, Hall Guard, No Tardiness. REIEP ABDUL A Cappella Choir, Madrigals, Co-Captain of Football Team, L Club. NANCY ADAMS l.C.C., Secretary of Sub Debs, Mail Service, Team Games, Hall Guard, Girls' Chorus, G.A.A., Honor Society. DON ALBERTS Stage Crew, l.C.C., lntramural Basketball, No Tardiness, Honor Society 2 semesters. FRED ALBRECHT Varsity Football, lce Skating Team, Bowling League, L Club, Spanish Club, Fire Marshal, Hall Guard, Soph Football. LAWRENCE R. ALLEN l.C.C., President of Spanish Club, Hall Guard Captain, Weekly Salesman. ROBERTA ALTMAN Golden Eagle, Honor Society 6 semesters, S Certificate, L - 3 Chevrons, Eagle Staff, lunior Prom Committee, Dance Com- mittee, Perfect Attendance. DOROTHY AMBROZ Honor Society, Office Registrar, Girls' Chorus, L -2 Chevrons, Dance Committee Chairman, lunior Prom Chairman, L.D. Club, l.C.C. SHIRLEY ANTELEK Iunior Prom Committee, Spanish Club, Girls' Chorus, Team Games, Dance Committee, Mail Service, G.A.A., Badminton. it's probably because their thoughts are dwelling on all the juicy mis- adventures about to befall the Na- tion's foremost bumbling school- teacher, TV's Robinson Peepers, who resumes work like all good teachers' early in September. Mr. Peepers' well-established Hair for incompetence has already made him something of a beloved char- acter, though he's been on TV only about 15 months. The major reason: the casting of a life-size Mr. Peepers, Wally Cox, in the lead role. Schooling Shaped Character 'Wally is probably the most non- aggressive man in show business. Searching for an angle on a story about Peepers, feature writers almost invariably end up with the usual idea about the bul1's-eye type-casting of Wally in the Peepers part. Almost overlooked is the large part that his own schooling has played in the shaping of the pleasant, offbeat char- acter of Wally himself. As a youngster, Wally was con- stantly being transferred from one school to another by his mother, a writer whose job kept her on the move. Wally, an unusually bright stu- dent, suifered from this endless switching of schools as it prevented him from developing lasting friend- ships with any of his schoolmates. Short on friends, Wally still des- perately wanted his classmates to like him. He was afraid he'd be un- popular if he got all the answers in class. He was also afraid not to get good grades. So his creative mind hit upon the idea of couching his an- swers in humorous terms so that the teacher would mark him correct and the kids would like him for being funny. Wally thus ended up with the twin roles of class genius and class clown. In doing so, he established the famous Cox delivery, a sentence full of pauses that almost invariably pops out with a humorous twist. Took Aptitude Test Despite a fine mind, Wally found himself a lost soul back in 1942. He'd been discharged from the Army be- cause of an alarming penchant for collapsing every time he went on a long march. Although he had put in a p s His first TV kiss: Wally shyly busses Potricio Benoit, his show sweetheortp psychiatrist is curing.his'reol shyness. couple of years at the City College of New York, he decided to take an aptitude test and find where his tal- ents lay. He shelled out 20 dollars at one of those testing clinics. For his money, they told him that he had no creative ability, should absolutely stay out of the creative field and should work with his hands, prefer- ably building miniature furniture. Dutifully, Wally enrolled in a handicraft course, bent on becoming a silversmith. In 1946, he set up shop in his cold water flat making cuff links, tiepins and tie clasps with in- tentions of selling his work to lead- ing Manhattan haberdashers. By fol- lowing the guidance of the testing clinic, he soon found that his income had soared to S40 a week. But things weren't all bleak. About this time, another memento from his school days, Actor Marlon Brando, came to New York. Brando brought Wally to Greenwich Village where people were charmed with Wally and his wistful little stories. He was en- F Dr Gallup ever sent hxs po strs out among the Nations schoolgomg set xt's a cxnch hed find agreement on at least one matter That would be that the calendar provxdes no holiday wxth grxmmer aspects than Labor Day And the reason as obvxous For shortiy thereafter such xtems as C856 Chaplain Louis King of Chicago's Bridewell Prison tossed a neat word salad recently when he addressed the Moody Bible Institute. Speaking of our favorite subject, television, the good chaplain asserted that programs cause a fever of the mind, tubercu- losis of the heart and cancer of the soul . . . and are more dangerous to youth than the atomic bomb. This rather complete diagnosis puts Chaplain King one up on the or- thodontist who alleged that TV might be responsible for dental malocclu- sion among children who cradle their jaws in their hands while watching shows. It also puts him ahead of the osteopath who worried about TV keeping children indoors and paving the way for bad body mechanics. All things considered, the chaplain is this year's champion. in the art of How to hate television and get your name in the papers. Since he speaks of fever, tubercu- losis and cancer, the Chaplain might be accused of practicing medicine on the body of television without a li- cense. His references to the atomic bomb could be classed as revealing military secrets. But we'1l not pursue those matters. It should not be necessary to list for Chaplain Kingis benefit the noted clergymen who have enlisted the in- timacy and effectiveness of television to carry their religious messages to millions of homes. Nor should we be prompted by his vitriol to explain what a mind-stimulating, heart- warming, 'soul-stirring gift television has been not only to the masses of American people, but to shut-ins and the aged. With all of its faults, and there are plenty of them, television doesn't de- serve to be the victim of every strange theorist with access to the public's ear.-M. P. fLf'i,'.. 9:17 2 'g l.ss LII' COMPLETE PROGRAMS Week of September 4-I0 --- See Index Facing Page I2 TELETYPE ' i CLOSE-UP New York . . . .... 3 Lilli Palmer . . . . . I7 Hollywood . . . .... 4. V ARTICLES Mirror Theater . .. .... 'I3 Back To School With Mr. Peepers .... 5 MedUlli0H Theater . -..- I4 Moxie: Life Of A Female Stooge ...... 8 SPORTS Viewers, Too, Can Be Violent ........ I2 Red Smnh Reporfs . .23 Do Youngsters Have The Answers? .... I5 There's No Accounting WOMEN 'N TV For TV Taye, .,,,,,, , , ,20 Edith Head's Fashions . . . . . .22 PICTURE STORY COLUMNS How They Become 'Glumor Girls' ...... I0 Fine Tuning ...... .... 7 Walter H. Annenberg, Editor and Publisher TV GUIDE is published weekly by Triangle Publications, Inc., 333 South Broad Street, Phil: delphia 7, Pa. Kingsley 6-0807. Ente-red as second class matter at the Post Office at Philadelph' Pa. Subscription Rates: in the United States I year 55.00, 2 years 58.00, 3 years SlI.00, sm copy I5cg in Canada I year 56.00, 2 years Sl0.00, 3 years SI4.00g in Pan-American Count I year 57.00, 2 years Sl2.'00, 3 years SI7.00g in other Foreign Countries I year 58.00, 2 y SI4.00, 3 years S20.00. Copyright H53 by Triangle Publications, Inc. COMPLETE LOCAL PROGRAM LISTINGS NLP What Moxie Sees In Her Uncle Miltie t -W ,. -f '3E-- '.,-2' f-ffgusgw-fwf Q 1 Week of September 4-10 , 4 1- X W,.w'--Q. xX s...,--?....oW j f' . ..K 'P' . -V 1 R J A, Af- A, A I gg. e. . L M Wk si . , -Q3 , S bvk- L' 4 Q' L Wm N,.. W-. AL Y xixgu Ig . - Back To School S e .V fe if S L Eff S S 2 M if 3 9 'C Q Q3-we With Mr. Peepers S M, Qfeee RICHARD ANTOLIK Art League, Bowling League, Cheerleaders, Honor Society, Hall Guard, Hall Guard Supervisor, Cheerleaders' L , Intra- mural Basketball. DONALD AN ZELMO GUNNAR AUKSI DUSAN BABIAR L Club, Gymnastics Championship Team, Honor Society 4 semesters, Hall Guard Captain, Hall Guard Lieutenant, Weekly Staff, Weekly Salesman. MARILYNN BARNES G.A.A., Team Games, Gym Leaders, Mail Service, Sub Debs, Spanish Club, Football Ticket Salesman. NANCY BARON G.A.A., Honor Society, Spanish Club, No Tardiness. DAVID BATEMAN Latin Club, Hall Guard. U5 A Cappella Choir, l.C.C., Poster Committee, Honor Society 4 semesters, Senior Girls' Council, G.A.A., French Club, No Tardiness, Weekly Salesman. DOUGLAS BENSON Latin Club, CLARENCE BERGSMA Intramural Basketball, Gymnastics. RICHARD BERNAS Usher, Hall Guard, Projection Club, Intramural Basketball, l.C.C., Student Guild, Spanish Club. PATRICIA BERRYMAN G.A.A. Board and Cabinet, Honor Society 4 semesters, L -A 4 Chevrons, Vice-President of L.D. Club, Gym Leaders, Team Games, Weekly Staff, Fencing. KANELA BERTSOS Honor Society 4 semesters, Mail Service Cabinet, G.A.A., Fenc- ing, Badminton, Team Games, L.D. Club, Perfect Attendance. THERESA BERTUCCI Mail Service Cabinet, Girls' Chorus, G.A.A., Spanish Club, l.C.C., Sub Debs. IUDY BINGHAM G.A.A. Board and Cabinet, Honor Society 3 semesters, L - 3 Chevrons, l.C.C., Weekly Staff, Girls' Chorus, L.D. Club Treasurer, Swim Leader. ALVIN BISCH Hall Guard, Drafting Club. ALFRED BOETSCHER Stage Crew, Architects' Club, Hall Guard, Intramural Basketball Champions. ' ' GILBERT BOND Senior Boys' Council, Honor Society, Basketball Team, Golf Team, Intramural Basketball Champions, Drafting Club, Hall Guard. THOMAS BOYD Hall Guard. ROBERT BRONIARCZYK Fire Marshal, Bowling Team, Honor Society 2 semesters, S Certificate, Eagle Staff, No Tardiness. DONALD BROUSIL Bowling League, Hall Guard. l 1 l Page 131 Page l32 IEAN MARY BROWN Honor Society, No Tardiness, L -2 Chevrons, I.C.C., Teachers' Assistant, L.D. Club, Gym Leaders, Team Games. IOAN BROWN L.D. Club, G.A.A., Gym Leaders, Team Games, L -2 Chev- rons, Badminton, Skating Club, Eagle Salesman. KEN BROWN Gymnastic Team, Weekly, Honor Society, L Club, Dance Committee, Prom Committee. LEONA BRUNO L -3 Chevrons, Girls' Chorus, Hall Guard, Mail Service, Honor Society, Dance Committee, Iunior Prom Committee, Gym Leaders. IEROME BUDIAC Intramural Basketball, No Tardiness. LORRAINE BUGAISKY G.A.A., No Tardiness. IOYCE BUHAI Honor Society 5 semesters, Editor-in-Chief of Weekly, Weekly Staff, Spanish Club, Girls' Chorus, G.A.A. RITA BULICH Sub Debs, Bowling Team, G.A.A., No Tardiness. CORA LEE BUNCE Honor Society 2 semesters, Latin Club, G.A.A., Perfect Attend- ance, Teachers' Assistant. DIONE BURKIN A Cappella Choir, Swim Leader, Captain of Champion Ball Team, L.D. Club, Honor Society, Weekly Staff, Dramatic Club, Ice Skating Club. BARBARA CADEN G.A.A., Library Assistant, Mail Service, Badminton, Sub Debs, Girls' Chorus. MARGIE CALIENDO Honor Society 2 semesters, G.A.A., L.D. Club, Gym Lead- ers, R.O.T.C. Typist, Perfect Attendance, No Tardiness. NYELA CARPENTER G.A.A. Board and Cabinet, L -2 Chevrons, A Cappella Choir, Madrigals, Honor Society, S Certificates, I.C.C., Vice- President of Spanish Club. Q JAMES CASEY Varsity Football, Swim Team. CHARLES CASSI ROBERT CASTKA A Cappella Choir, Gymnastic Team, Skating Team. ROBERT CECICH Varsity Football, Hall Guard, L . WAYNE CERMAK Gymnastic Team, Fire Marshal, Gymnastic L , Iunior Prom Committee, Weekly Salesman. GENE CERNEY Hall Guard, Intramural Basketball, Fire Marshal. BILL CERVENCIK Concert Band, Hall Guard, Intramural Basketball, Baseball. NANCY CERVINKA G.A.A., Sub Debs, Mail Service, Hall Guard, Weekly Salesman, A Cappella Choir, Concert Band. DORIS CHAPMAN G.A.A., Sub Debs, Weekly Salesman, Team Games. IOHN CHICOINE Eagle Salesman, No Tardiness. CLYDE COLE Projection Club, l.C.C., Hall Guard Captain, Bowling Team, Football Manager, Soph Football, Latin Club. FRED CONERS Varsity Football, Hall Guard. CHARLES COOMER JACK COOPER Hall Guard. MARGUERITE COSTANZO G.A.A., Spanish Club, No Tardiness. M ' ' s' Council S Certificate, Honor Society 6 semesters, Mail Service, , Spanish Club, Gym Leaders, No Tardiness. ANTOINETTE COZZO President of G.A.A. Board and Cabinet, Golden Eagle, Honor Society, S Certificate, L Cup, Gym Leaders, L.D. Club, Team Games. THOMAS CREIGHTON Projection Club, Fire Marshal, Hall Guard, Football Manager, Weekly Salesman, Football Ticket Salesman. I-'AY CULLEN G.A.A. Board and Cabinet, L -3 Chevrons, S Certificate, Honor Society 7 semesters, L.D. Club Secretary, l.C.C. Com- mittee Chairrnan, Weekly Staff. RON CZARNECKI Soph Football, Varsity Football, Baseball Team, 4 L's , Hall Guard. ELMER DABISCH Honor Society 6 semesters, S Certificate, Stage Crew, l.C.C., Weekly Salesman, Baseball Manager, Prom Committee. H Golden Eagle, L -4 Chevrons, nio ' ' ' A Cap- pella Choir, S Certificate, Honor Society, l.C.C., Program Registrar. RAE DANEEN DASHER Library Assistant, G.A.A,, Hall Guard, Madrigals, A Cappella Choir, Eagle Ad Salesman, Teachers' Assistant, French Club. GLORIA DAVIES G.A.A., Sub Debs, Locker Guard, Badminton, Team Games, French Club, Girls' Chorus. IACK DAVIS A Cappella Choir. ERCYLENE DAWSON Team Games, Badminton, G.A.A., French Club. PEARLENE DAWSON G.A.A., Team Games, Spanish Club. NANCY DEDIC A Cappella Choir, Girls' Chorus, Spanish Club, Eagle Salesman, Library Assistant, G.A.A., Hall Guard. DANNETTE DE MATO Honor Society 2 semesters, L el Chevron, G.A.A. L.D. Club, Gym Leaders, Girls' Chorus, Pep Assembly Participant, No Tardiness. Page l33 S 2 l Page 134 ALBERT DIBENEDETTO Gymnastics, I.C.C., Hall Guard, Fire Marshal, Usher. IAMES DOLIANIN Hall Guard, Usher, Intramural Basketball, Varsity Football. RON DONALDSON Hcnor Scciety, Bowling League. MATT DOYLE IOHN DRAGONETTI Picked Platoon, Latin Club, R.O.T.C. L , Drum and Bugle Corps. SHIRLEY DRAWERT G.A.A., Hall Guard, Fencing, Team Games, Mail Service, Eagle Salesman, L.D. Club, Honor Society. MARLENE DUMAS French Club, Art League, Iunior Prom Committee, Chairman Dance Committee, Hall Guards, Eagle Salesman, G.A.A. IOAN DU PERE Honor Society, French Club, Hall Guard, Team Games, Gym Office Assistant, L.D. Club, Badminton, Concert Band. ARMAND DUSABLON Honor Society, Hall Guard, Basketball Reserves, Intramural Basketball. THOMAS DVORAK Bowling Team, Honor Society 5 semesters, Fire Marshal, Usher, Hall Guard, Math Review Class, Intramural Basketball, Skat- ing Team. EDMUND DYRDA A Cappella Choir, Spanish Club, Usher, Fire Marshal. PATRICIA EGAN Honor Society, Dance Committee, G.A.A., Team Games, L - 4 Chevrons, Gym Leaders, Perfect Attendance, No Tardiness. SHIRLEY ELLIG G.A.A., No Tardiness. OYCE ENGEL ecre ary o 4A Class, e 'or Girls' Council, Honor Society 2 semesters, Business Manager o , ent Guild, Eagle Staff, Latin Club, G.A.A. HELEN ERICKSON Honor Society, Student Guild, L -2 Chevrons, Team Games, Gym Leaders, Bowling League, Weekly Staff, Spanish Club. MARILYN ERICKSON Mail Service, G.A.A., Gym Office Assistant, Weekly Salesman, Eagle Ad Salesman, No Tardiness. WAYNE EWING Hall Guard, Bowling Team, Intramural Basketball, I.C.C., Stu- dent Guild. ROY FABRY L Club, Varsity Football, Baseball Team, Basketball Team, Honor Society 3 semesters, 7 L's , Hall Guard, I.C.C. ALLAN FIEDLER Honor Society, Usher, Bowling League, Fire Marshal, Hall Guard, Football Manager, Intramural Basketball, Projection Club. DOLORES FISCHER G.A.A., Girls' Chorus, Hall Guard, Gym Leaders, Mail Service, Spanish Club, Latin Club, Team Games. IOSEPH FITZGERALD Drama Club, Fire Marshal, Honor Society, No Tardiness, Eagle Salesman, Hall Guard. LORETTA FITZHUGH Honor Society, S Certificate, G.A.A., Sub Debs, Team Games, Hall Guard, Weekly Salesman, Eagle Salesman. ROSEMARY FLOREK Honor Society, S Certificate, Senior Girls' Council, Concert Orchestra, G.A.A., Gym Leaders, Team Games, Weekly Staff. MARIAN FOITIK G.A.A., Team Games, Program Registrar, Bowling League, Sub Debs, Spanish Club, Honor Society. AUDREY FORBES G.A.A., Madrigals, A Cappella Choir, Treasurer ot Latin Club, Sub Debs. C ' ' ' ' Honor Society, Shorthand and Typing Awards, G.A.A., Spanish Club, Accompanist for Girls' Chorus, I.C.C., Prom Committee. BARBARA FREDERICK L -4 Chevrons, 3 Dolphins, L.D. Treasurer, Swim Leaders, I.C.C., Weekly Salesman, Gym Leaders, Honor Captain Ball Team. LAWRENCE FUIA Drafting Club, No Tardiness. BARBARA FUNKE Honor Society, Mail Service Cabinet, Hall Guard, G.A.A., Treas- urer oi Latin Club, l.C.C., Mail Service. EDWIN GADECKI Intramural Basketball, Honor Society 5 semesters, Hall Guard, Circulation Manager of Weekly. IRIS GARLAND Secretary of G.A.A. Board and Cabinet, L ,-4 Chevrons, Honor Society, 3 S Certificates, President of Girls' Chorus, Golden Eagle, Eagle Staff, Dolphins and Livesaving. ROBERT PETER GAUDEN Hall Guard. FRANCES GEARY G.A.A., L.D. Club, L , Swim Leaders, Lifesaving and Dol- phins, Skating Club, Team Games, Hall Guard. CATHERYN GEORGE G.A.A., Sub Debs, Hall Guard, l.C.C. ARLENE GERNENZ l.C.C., Sub Debs, G.A.A., Library Club, Library Assistant, L.D. Club, No Tarcliness. LEWIS GESSLER Co-Captain of Baseball Team, Swimming Team, Varsity Football, Senior Boys' Council, Honor Society, Intramural Basketball. ELLEN GILICH G.A.A., Teachers' Assistant, Team Games, Fencing, Hall Guard, I.C.C. IOAN GILLEN G.A.A. HARRY GOELZ Hall Guard, Ice Skating Team, Varsity Football, L Club, Y Intramural Basketball. L RICHARD GOLLER A Cappella Choir, Latin Club, Hall Guard, Gym Office Assistant. HARRY GOPOIAN Honor Society 6 semesters, S Certificate, Weekly Staff, Tennis 7 Team L , R.O.'l'.C. L , Usher, Latin Club, Fire Marshal. ADELE GOSS Mail Service Cabinet, Sub Debs, G.A.A., Hall Guard, Weekly Salesman, Spanish Club. Page 135 Page 136 SHARLENE GRAEFEN G.A.A,, Sub Debs, Hall Guard, Bowling League, No Tardiness. INA GRAYNOR Honor Society, G.A.A., Spanish Club, Weekly Typist. BARBARA GREIF G.A.A., Hall Guard, Sub Debs, Spanish Club. CONRAD HAARTH CAROL HAERING Honor Society, G.A.A. Board and Cabinet, L -4 Chevrons, l.C.C., L.D. Club, Gym Leaders, Library Assistant, Team Games. HARRIETT HAILEY Fencing, Teachers' Assistant, Library Assistant, Team Games, G.A.A., Hall Guard, Sub Debs. DON HAINEY Dance Committee, Intramural Basketball, Hall Guard, Fire Mar- shal, Soph Football. DONNA HAL enior ' ' ncil, A Cappella Choir, L , Honor Society Z semesters, l.C.C., Hall Guard, Program Registrar, Spanish Club. RONALD HALLAS Co-Captain of Tennis Team, L , L Club, Architects' Club, Intramural Basketball, Intramural Gymnastics. ROBERT HAM Usher. BARBARA HANSEN Swim Leaders, Latin Club, G.A,A., l.C.C., No Tardiness. JOAN HANSEN Honor Society, Weekly Stait, Hall Guard, Spanish Club, Fencing. IVORY HARDY Gymnastic Team, Latin Club, Central State Gymnastic Champion. ROBERT HARRIS Gymnastic Team, Weekly Staff, L , IEAN HART Sub Debs, l.C.C., G.A.A., Art League, Team Games, Hall Guard, No Tardiness. GRACE HAYES G.A.A. Latin Club, Sub Debs, Mail Service, Hall Guard, Team Games. TOM HAWKS Soph Football, Varsity Football, No Tardiness, Usher, Hall Guard, Spanish Club. IEAN HEMZACEK Honor Society, G.A.A., Bowling League, Spanish Club, No Tardiness. SHIRLEY HENDRIX Hall Guard, G.A.A., Library Assistant, Rest Room Assistant, Girls' Chorus, Eagle Salesman, l.C.C., Sub Debs. WILLIAM HENRY Projection Club, Usher, Fire Marshal, Hall Guard. LOUISE HESEK Honor Society, 2 S Certificates, French Club, Girls' Chorus, Gym Leaders, L -2 Chevrons, Team Games, Weekly Staff. lAMES HICKEY Skating Club, Intramural Basketball, President of Latin Club, Bowling League, Eagle Salesman, Hall Guard, Usher, Fire Marshal. MARGARET HINES G.A.A., Team Games, Hall Guard, Training Choir, No Tardiness. MARILYN HINTZ Concert Orchestra, Concert Band, Girls' Chorus Accompanist, G.A.A., Weekly Staff, Eagle Salesman, Honor Society, Spanish Club. NADENE HOOD L.D. Club, A Cappella Choir, Madrigals, Cheerleaders, Hall Guard, Mail Service, Dance Committee, Team Games. HELEN HORAITES Gym Leaders, G.A.A., Girls' Chorus, Team Games, Badminton, No Tardiness, Mail Service, Hall Guard. MARIAN HOYER Honor Society, Program Registrar, G.A.A., Gym Leaders, French Club, Team Games, Badminton, L.D. Club. RITA HUEBNER I.C.C., Concert Orchestra, Dramatic Club, Mail Service, Hall Guard, Iunior Prom Committee, Bowling League, LD, Club. MARION HUGHES G.A.A., Hall Guard, Honor Society, Mail Service. DEMETRIUS IACKSON Hall Guard, LILLIAN IAMES Honor Society, French Club, G.A.A., Hall Guard, Mail Service. RITA IAROS G.A.A., Hall Guard Captain, Weekly Salesman, No Tardiness. ELIZABETH IAY Honor Society, Eagle Staff, G.A.A., Hall Guard, Eagle Salesman, Bowling League, Team Games. ARLINE JENSEN Managing Editor ot Eagle, 6 S Certificates, I.C.C., President of Latin Club, Library Assistant, Hall Guard, Gym Leaders, Oliice Registrar. RONALD IETTON Basketball Team, Hall Guard, Intramural Basketball Champions, French Club. AMOS IILEK Skating Team, Swimming Team, Honor Society. ED IISKRA Gymnastics Team, Co-Captain of Tennis Team, Ice Skating Team, Usher, Hall Guard, Fire Marshal, Honor Society, L's . BETTY IOHNSON G.A.A., Team Games, Badminton, Fencing. CLYDE IOHNSON Hall Guard, Soph Football, No Tardiness, LILLIE IONES G,A.A. Board and Cabinet, Honor Society, L -3 Chevrons, Student Guild, Perfect Attendance, Gym Leaders, l.C.C., Pro- gram Registrar. 1 RONALD IONIAK 5 Bowling Team, Fire Marshal, Honor Society, Intramural Basket- I ball. KARL IOSS Page 137 1 t Page 138 EDWARD IUNG Hall Guard, Fire Marshal, Latin Club, No Tardiness, Perfect Attendance. FRANK IUNGMAN DOROTHY IURGENSMIER G.A.A., Team Games, Hall Guard. MICHAEL KABALA City Bowling Champs, Soph Football, Varsity Football, Bowling Team Captain, 5 L's , Skating Team, Intramural Basketball Champions, Fire Marshal. RAYMOND KACOR Concert Band, Concert Orchestra, intramural Basketball, No Tardiness. ROSALIE KAGAN Mail Service, G.A.A., Team Games, Hall Guard. RONALD KAMBA Hall Guard, Soph Football, Architects' Club. IOAN KAMM Vice-President of Spanish Club, G.A.A., l.C.C., Honor Society, Gym Leaders, Girls' Chorus, Program Registrar, Bowling Team. VIRGINIA KAPUSTIANYK Girls' Chorus, Library Assistant, G.A.A., Hall Guard, Team Games, Prom Committee. ARTHUR KARAMAGIANIS French Club, Hall Guard, Pep Book Salesman, Ticket Salesman, Fire Marshal. CALLETTE KARAMAGIANIS Honor Society, L , G.A.A., Hall Guard, Teachers' Assistant, French Club, Library Assistant, Mail Service. IAMES KARLSON l.C.C., Stage Crew, Spanish Club, Intramural Basketball, No Tardiness. KENNETH KARLSON Honor Society Z semesters, Hall Guard, No Tardiness, Weekly Salesman. ROBERT KAZLAUSKI Honor Society 3 semesters, Football Team, Swim Team, 3 L's , Senior Boys' Council, Band, Latin Club, Weekly Salesman. IAMES KEANE Hall Guard, Perfect Attendance. IACK KEATING Sports Editor of Weekly, Golden Eagle, A Cappella Choir, Madri- gals, Usher, Honor Society, Fire Marshal, Swim Team Manager. EILEEN KEEI-'E Sub Debs, Weekly Salesman, G.A.A., Team Games, Hall Guard, 4 Spanish Club. MARCIA KEMP G.A.A., Spanish Club. JAMES KENNEDY 4A Class President, Senior Boys' Council, 4 S Certificates, Honor Society Secretary and Treasurer, A Cappella Choir, L , Golden Eagle, Literary Editor of Eagle. ARLENE KERSTEN Sub Debs, Hall Guard, Mail Service, l.C.C., G.A.A., Concert Band, Band Lyre, No Tardiness. DON KILINSKI Gymnastic Team, Fire Marshal, Bowling League, Hall Guard. GORDON KIRK Intramural Basketball, Hall Guard. FLORENCE KIRKPATRICK Honor Society 5 semesters, L -2 Chevrons, Weekly Staff, Gym Leaders, LD, Club, Hall Guard, Bowling League, Spanish Club. DONNA KNUTSON G.A.A., Hall Guard, Dramatic Club, Teachers' Assistant, Fencing, Eagle Salesman, Weekly Salesman. TONY KOCIMSKI Soph Football, Varsity Football, 2 L's , Eagle Stati, Football Ticket Salesman, Swim Team. IERRY KORPER G.A,A., Sub Debs. IAMES KOST R.O.T.C., French Club. GEORGE KOVACICH Gymnastic Team, L Club, Secretary of Architects' Club, Hall Guard. IO ANN KOVALCIK G.A.A., Hall Guard, Madrigals, A Cappella Choir, S Certifi- cate, Honor Society 3 semesters. FRANK KOVANDA Soph Football, Architects' Club, l.C.C. ALEKSONDRAS KULIKAUSKAS A Cappella Choir, Skating Club, Skating Team, French Club, Usher. WILLIAM KURTZ Basketball Team, Baseball Team, L Club, Hall Guard, Intra- mural Basketball. WILLIAM LAVEZZI Fire Marshal, Hall Guard. MARILYN LAWRENCE G.A.A., No Tardiness, Hall Guard. LORRAINE LEAVITT G.A.A,, A Cappella Choir, Glee Club, Office Assistant. ARLENE LE V irls' ' Eagle Staff, Program Registrar, Latin Club, Library Club, Student Guild, Honor Society, S Certificate. IOE LEVIGNE BARBARA LEVY Team Games, G.A.A., Weekly Salesman, Mail Service, Bowling League. IACK LE VOY Soph Football, Intramural Basketball, Hall Gucrd. IEANNE LLOYD G.A.A., Badminton, Concert Band. THERESA LOIBL L -2 Chevrons, G.A.A., L.D. Club, Spanish Club, Team Games, Fencing, Badminton. SHIRLEY LOKAY G.A.A., Latin Club, No Tardiness. Page l39 Page l40 TONI LUSZCZEK G.A.A., Weekly Staff, Team Games, Teachers' Assistant. ANTON MACAK RONALD MacKENZIE Hall Guard, Architects' Club, No Tardiness. IOE MADDEN Soph Football, Varsity Football, Hall Guard, Weekly Salesman, Football Ticket Salesman, Intramural Basketball, L Club. ROSE MARIE MAIERCZYK Vice-President ot French Club, A Cappella Choir, Madrigals, Dance Committee, lunior Prom Committee, Dramatic Club, Team Games, Teachers' Assistant. IAMES MALEY Hall Guard, Architects' Club, No Tardiness. MARGARET MALUS G.A.A. DON MANAHAN JAMES MARINES S Certificate, Varsity Football, Basketball Team, L Club, Hall Guard, Intramural Basketball Champions, Senior Boys' Council, Spanish Club. DAN MARKOWSKI MARIORIE MARTENSEN G.A.A,, Library Assistant, Sub Debs, Mail Service, Hall Guard, Program Registrar, Teachers' Assistant, Weekly Salesman. CHRISTINE MASE G.A.A., Latin Club, Hall Guard, No Tardiness, Mail Service, Team Games, Sub Debs. DENNIS MAULSBY Concert Band, R.O.T.C. Drum G Bugle Corps. RITA MAZURKIEWICZ G.A.A., Sub Debs, Spanish Club, Teachers' Assistant. VIRGINIA MCELROY A Cappella Choir, Dramatic Club, Tumbling, Hall Guard, G.A.A,, Mail Service, Spanish Club. PHIL McKENDRICK Intramural Basketball, L Club, Gymnastic Team, Madrigals, A Cappella Choir, Dance Committee, Prom Committee. IOHN McMAI-ION Hall Guard, Fire Marshal, Intramural Basketball. HELEN MEGA Sub Debs, Mail Service, G.A.A., Honor Society, Teachers Assistant. BARBARA MERCIER Sub Debs, Spanish Club, Teachers' Assistant, G.A.A., No Tarcli ness, Team Games. LESTER MESSINGER Weekly Stait, Hall Guard. DOROTHY MILLER G.A.A., Spanish Club, No Tardiness. IACK MILLER Intramural Basketball, Eagle Salesman, l.C.C., Architects' Club Usher, Fire Marshal, Ticket Salesman, Weekly Staff. IOHN MILLER No Tardiness. MELVIN MISUP TONI MOCK I.C.C., Swim Team, Skating Team, L Club, 3 L's , Latin Club, Skating Club. IOYCE MONETTE Honor Society, Perfect Attendance, Hall Guard, Eagle Salesman, G.A.A., Teachers' Assistant, l.C.C. IOHN MOONEY Hall Guard. IAMES MUZIK Hall Guard, Gymnastics, Treasurer of Drafting Club. PI-IYLLIS NIEIVIIEC G.A.A., Hall Guard, Teachers' Assistant. BONNIE NIERMAN CaEditor'in-Chief of Eagle, Honor Society 6 semesters, Weekly Szalesman, No Tardiness, Treasurer of Spanish Club, G.A.A., Library Assistant, Teachers' Assistant, Prom Committee. FRED NITZ Chief of Fire Marshals, Drafting Club, Gymnastics, Perfect Attendance. IAMES NOBLE HENRY NOFFKE GLORIA OCCHIUZZO G.A.A., Sub Debs, Latin Club. SYLVIA OGDEN G.A.A., Badminton, Sub Debs, Library Assistant, Teachers' Assistant, Spanish Club. ROSE MARIE ONESTO G.A.A., Team Games, Badminton, Hall Guard, Weekly Typist, No Tardiness. ANN OSINSKI G.A.A., Mail Service, Teachers' Assistant, Bowling League, Hall Guard, Sub Debs. givmcx PAGE r Bowling Team, Football Ticket Salesman. KAY PARKEY G.A.A., l.C.C. Representative, Hall Guard, Gym Leaders, Teachers' Assistant, Iunior Prom Committee, A Cappella Choir, No Tardiness. ROBERT PARMELEE Honor Society, Gymnastic Team, Intramural Gymnastics, Soph Football, L , No Tardiness. DAVID PARRIS Co-Capt. of Swim Team, A Cappella Choir, Madrigals, Honor Society l semester, Latin Club, L Club, Radio Guild, Senior Boys' Council, l.C.C., Hall Guard. IIM PASQUINELLI Basketball Team, L Club, Honor Society 6 semesters, S Cer- tificate, Vice-President of Latin Club, Hall Guard, Dance Com- mittee. 1 Page 141 x Page 142 MARTIN PAVLIK Drafting Club, Hall Guard. IOAN PAYTON G.A.A., Hall Guard, Sub Debs, Team Games. RON PENCZEK Latin Club, Varsity Football, Soph Football, Intramural Basket- ball, L Club, Swim Team. DENNIS PERSON Concert Band, Concert Orchestra, Weekly Staff, Hall Guard, Weekly Salesman. DONN PETERSON Hall Guard, I.C.C., Fire Marshal, No Tardiness. MIKE PETRICH Football, Gymnastics, Hall Guard. SHIRLEY PHILLIPS G.A.A., Team Games, Badminton, Fencing. BARBARA PIECZYNSKI French Club, G.A.A., Sub Debs, Team Games, Badminton, Hall Guard, Teachers' Assistant, No Tardiness. LEON PIROFALO Secretary of Architects' Club, Usher, Co-Chief of Fire Marshals, Intramural Basketball, No Tardiness, Bowling Team. PAUL PLOCIENNIK Honor Society Z semesters, Senior Boys' Council, Co-Capt. ot Swim Team, Tennis Team, Varsity Football, 7 L's , L Cup, ViceAPresident of 4A Class. E-L1llE3-QINJ' nior ' ' ' Honor Society 6 semesters, S Certificate 2 semesters, Sub Debs, Bowling League, I.C.C., Vice-President of Honor Society, No Tardiness. JANET PROCHOT Honor Society 2 semesters, G.A.A., Swim Leaders, Girls' Chorus, Eagle Salesman, Sub Debs, Team Games. RICHARD PROSKEY A Cappella Choir, Madrigals, Intramural Basketball, Usher, Hall Guard, No Tardiness, Latin Club, Pep Book Salesman. WILMA PROSTKA Hall Guard, G.A.A., Teachers' Assistant, l.C,C., Team Games, Bowling Team. ROBERT RACAY Bowling Team, Hall Guard, Architects' Club, l.C.C. RAY RADIMECKY Hall Guard, Honor Society 2 semesters, Projection Club, Arch- itects' Club. RONALD RANDICH Hall Guard, Weekly Salesman. ROBERT RANDONIS Golf Team, Soph Football, Fire Marshal, Honor Society, Eagle Statt, Bowling League, L Club. IULIAN RAPPELT Soph Football, Hall Guards. BETTYLOU REGAL L , Sub Debs, G.A.A., L.D. , Secretary of Latin Club, Gym Leaders, Team Games, No Tardiness. BARBARA REYNOLDS G.A.A., AUDREY RIGBY G.A.A., Sub Debs, Team Games, Mail Service, Girls' Rifle Team. LOUISE RIKER Sub Debs, Team Games, G.A.A., Hall Guard, Teachers' As- sistant, Bowling League. DONALD ROBERTS Hall Guard. JAMES ROBERTS Basketball Team, Swim Team, Latin Club, Honor Society 6 semesters, S Certificate, Usher, Intramural Basketball, A Cappella Choir. MILTON ROCKLIN Honor Society 3 semesters, President and Treasurer of Latin Club, Hall Guard, No Tardiness, Eagle Salesman. TONY ROGUL Gymnastics. DON ROMAN R.O.T.C., Hall Guard, No Tarcliness. YOLANDA ROSATO L.D. Club, Badminton, Volleyball Team, Basketball Team, No Tardiness, Latin Club, Girls' Chorus, Honor Society 2 semesters. PAT ROSDIL Vice-President of L.D. Club, Gym Leaders, Swin Leaders, Honor Captain Ball Team, L and Dolphin, A Cappella Choir, Hall Guard, No Tardiness, CAROL ROSS Y W President of Sub Debs, Concert Orchestra, G.A.A., Swim Leaders, Assembly Participant, l.C.C., Spanish Club, Teachers' Assistant. REVA ROYSE L.D. Club Secretary, Badminton, Team Games, No Tardiness, Vice-President, of Spanish Club, L -1 Chevron, Swim Leaders, G.A,A. CAROL RUSSELL Honor Society 3 semesters, Girls' Chorus, Champion Volleyball Team, Hall Guard, Mail Service, Weekly Salesman, Sub Debs, Latin Club. BILL RYAN Intramural Basketball. IRENE SADOWSKI G.A.A., Spanish Club, No Tardiness, Teachers' Assistant. VIVIAN SAMULSKI G.A.A., Girls' Chorus, Sub Debs, Team Games. BARBARA SANAZARO G.A.A., Hall Guard, Fencing, Team Games, Mail Service. KAREN SCHIECKE G.A.A., Honor Society 4-semesters, S Certificate, Perfect Attendance, No Tardiness, Teachers' Assistant. CAROLE SCHINKER G.A.A., Eagle Typist, Weekly Stat-t, Hall Guard, Secretary of World History Club, Teachers' Assistant, No Tardiness, HELEN SCHNEIDER G.A.A., Team Games, Ping Pong, Teachers' Assistant. GEORGEAN SCHOPP G.A.A., Hall Guard, Sub Debs, Mail Service, Team Games. BOB SCHROEDER Honor Society 4 semesters, Swim Team, Concert Band, Pep Book Salesman, Secretary of Spanish Club. Page 143 Page 144 SAMUEL SCHULTZ R.O.T.C., Architects' Club, No Tardiness, Hall Guard. IOAN SEDIVY G.A.A., Mail Service, Gym Assistant, Hall Guard, Team Games, Mail Service Cabinet. ROBERT SEITLER Usher, Hall Guard. NANCY SHANAHAN G.A.A., Perfect Attendance, No Tardiness, Spanish Club, Gym Leaders, L.D. Club, Sub Debs, KAY SHELTON G.A.A., Hall Guard, Sub Debs, Mail Service, Team Games. ROY SHIELDS L Club, Varsity Football, Skating Team, Soph Football Team, Bowling League, Intramural Basketball, Fire Marshal, Hall Guard. IEROME SHIPANIK Art League, Bowling League, l.C.C. BARBARA SHUTT G.A.A., No Tardiness, Teachers' Assistant. CAROL SIEBEN Honor Society 3 semesters, L -4 Chevrons, Library Assistant, G.A.A. Board Gt Cabinet, Sub Debs, L.D. Club, Drama Club, Eagle Typist. 1 IOSEPH SIEDLIMSKI Gymnastic Team. I THOMAS SKONICKI Treasurer of Bowling Team, President 61 Secretary of Spanish Club, Hall Guard, I.C.C., L Club. VIOLET SLEICHERT Hall Guard, Honor Society 2 semesters, Library Club, G.A.A., Team Games, Fencing, Badminton, No Tardiness, RAYMOND SLOMSKI Soph Football, Varsity Football, RICHARD SMAGUR Honor Society, Skating Team, Spanish Club, Hall Guard, L Club. THOMASINE SMILEY ' o en agle, nior Girls' Council, Honor Society 7 semesters, S Certificate, L - Chevrons, Copy Editor of Weekly, Gym Leaders, G.A.A. GEORGE SMITH Usher, Bowling League. YVONNE SMITH A Cappella Choir, Madrigals, Eagle Salesman, Spanish Club, L.D. Club, Mail Service, Team Games. DOLORES SOLTIS Honor Society, Gym Leaders, L.D. Club, L , Team Games, Hall Guard, Weekly Salesman, No Tardiness. KAY SOPKO L --4 Chevrons, Cheerleaders, Golden Eagle, Honor Society, 4 S Certificates, Recording Secretary of l.C.C., A Cappella Choir, Girls' Sports Editor of Eagle. STANLEY SPIEWAK President of Architects' Club, Hall Guard, Honor Society 4 semesters, Perfect Attendance, No Tardiness, S Certificate. SUSAN SPRINGER l.C.C., Weekly Salesman, G.A.A., Sub Debs, French Club, Radio Guild. KENNETH STAIR Latin Club, Pep Book Salesman, Honor Society 2 semesters, Intra- mural Basketball, Basketball Reserves. MARY STEARNS G.A.A., Hall Guard, Team Games, No Tarcliness. MARTIN STEFECEK ARLENE STIEGAL Co-Captain of the Cheerleaders, Girls' Chorus, Swim Leaders, Dance Committee, Iunior Prom Committee, Mail Service, Library Assistant, Honor Society 6 semesters. GAYLE STILLWELI. Girls' Chorus, Mail Service, G.A.A., Nurse's Assistant. IOHN STINAUER Soph Football. TOM STOGINSKI Co-Editor-in-Chief of Eagle, Senior Boys' Council, Golden Eagle, 3 Gymnastic L's , Honor Society 7 semesters, A Cappella Choir, Usher, Fire Marshal. ROBERT STRIMEL Varsity Football, Soph Football. RICHARD STROCHIS Bowling Team. RONALD STUREK Hall Guard, Architects' Club. DON SUCHY Usher, Hall Guard, Fire Marshal, Architects' Club. GER! SVOBODA G.A.A., Sub Debs, Mail Service, Fencing, Team Games. GERALDINE TANAC Honor Society 3 semesters, Bookroom Assistant, G.A.A., Team Games, Sub Debs, French Club. DELORES THOM Bowling League, G.A.A., Mail Service, Sub Debs, Weekly Sales- man, Prom Committee, Girls' Chorus, Eagle Salesman. CARMELLA THOMAS G.A.A., Mail Service, Pep Book Salesman, Team Garnes, Sub Debs. IANET TILLOTSON Art League, Concert Orchestra, Concert Band, S Certificate, Honor Society 6 semesters, G.A.A., Weekly Staff. W WALLY TRAINAUSKAS Hall Guard, Intramural Basketball. BETTY TRLAK Gym Leaders, G.A.A., Hall Guard, Mail Service, Girls' Chorus, Student Guild, Dance Committee, Team Games. WARNER UCHISON Secretary of Drafting Club. IOAN UTESCH G.A.A., Teachers' Assistant. WILLIAM VELCHEK Spanish Club. t Page 145 Page 146 BERNARD VLOSAK Architects' Club, lntramural Basketball, Skating Team. MARY ANN VOITESAK G.A.A., Sub Debs, Mail Service Cabinet, Team Games. DAN WEBER BLANCHE WEISS G.A.A., Latin Club, No Tardiness, Teachers' Assistant. ROBERT WEISS Gymnastic Team, l.C.C., Hall Guard, Fire Mashal, Vice-President of Architects' Club, L Club, No Tardiness. IACQUELYN WHITE G.A.A., Nurse's Assistant, Hall Guard, l.C.C., lunior Prom Com- mittee, Sub Debs. ROBERT WHITE Hall Guard, President and Treasurer of Architects' Club. WILLIAM WHITE Honor Society, Lite Guard. ALMA WILLIAMS G.A.A., Fencing, Team Games. GLORIA WILLIAMS - Team Games, Fencing, Ping Pong, Badminton, G.A.A., Hall Guard, Honor Society, Gym Leader. SHIRLEY WILLIAMS G.A.A., Hall Guard, Library Assistant. IAMES WILSON Football Team, Concert Band, Weekly Salesman, Fire Marshal, No Tardiness, Perfect Attendance, Football Ticket Salesman. OLE W Honor ociety 5 semesters, n' Girls' C il President of French Club, A Cappella Choir, Art eague, L , Hall Guard, Team Games. SAM WISSE Hall Guard, Spanish Club, Honor Society, Treasurer of Spanish Club. U enior ' ' ' Weekly Staff, l.. , Honor Society 4 semesters, Girls' Chorus, Drama Club, Library Assistant, Spanish Club. ROSE MARIE WODARCZYK Librarian, Hall Guard, G.A.A., Honor Society, Nurse's Assistant, Bookroom Assistant, Girls' Chorus, French Club. CAROLE WOLF G.A.A., Girls' Chorus, Mail Service, Team Games, Hall Guard, Spanish Club. GERI WOLTERS Sub Debs, G.A.A., Team Games, Spanish Club, Weekly Sales- man, Mail Service. MARY ANN WOODS Secretary ot French Club, Gym Secretary, G.A.A. IOANNE WRIGHT 2 S Certificates, Student Guild, Golden Eagle, G.A.A. Board 51 Cabinet, L -4 Chevrons, Concert Orchestra, President ot French Club, Weekly Staff, ESTHER YACKO Hall Guard, G.A.A., French Club, Bowling League, No Tardiness. FRANK YAEGER Hall Guard, Concert Band, Intramural Basketball, Baseball Team. BOB YEHNERT Hall Guard, Intramural Basketball, Bowling Team. LAUREN YOUNG Captain of Gymnastic Team, Honor Society, 3 L's , L Club, Intramural Gymnastics, 4A Class Treasurer. IUDY ZAKOWSKI G.A.A., Team Games, Teachers' Assistant. ELAINE ZALOUDEK If enior Girls ' Eagle Salesman, 5 S Certificates, Honor Sociey semesters, Weekly Salesman, Gym Leaders, Team Games, No Tardiness. GREG ZAWASKI Hall Guard, Latin Club, Intramural Basketball. DEMETRA ZEKIOS Honor Society, Mail Service Cabinet, No Tardiness, G.A.A., L.D. Club, Gym Leader, Bowling League, Hall Guard. HAROLD ZIMMERMAN Intramural Basketball. THOMAS ZINKUS Page Editor of Weekly, Periect Attendance, No Tardiness, Honor Society, Captain of Fire Marshals, Intramural Basketball, Student Guild, Usher. June Class A Cz7'w'z7'e FINANCE COMMITTEE Chairman: Lauren Young Reggie Abdul udy Bellis Arline lensen Karen Schiecke Tom Skonicki Tom Stoginski Robert Weiss Bob White Greg Zawaski Tom Zinkus PROM COMMITTEE f of Chairman: Paul Plociennik Kenneth Brown Elmer Dabisch Carole Fox GIFT COMMITTEE Chairman: lim Kennedy Leona Bruno Cora Lee Bunce Helen Erickson Marian Fojtik Lewis Gessler Marian l-loyer George Kovacich lack Miller Karen Schiecke SING COMMITTEE Chairman: Qyge Engel Nyela Carpenter Nancy Cervinka Helen Dadas Carole Winther Carol Haerinq Bae Daneen Dasher Virginia Kapustainyk lack Davis Phil McKendrick Nancy Dedic Bonnie Nierman lack Keating Dave Parris Ioe Madden Elaine Point Kay Parkey Dolores Thom Elaine Zaloudek Sylvia Witt Page 147 1l1l1i, Turn-About fs Falk Play The law looks mighty displeased with conditions, especially the D's. Cl-las anyone seen Mr, Palmer?J Any resemblance is strictly coincidental. ls this a familiar situation? Are YOU the culprit? KYes, thats Mrs. Baker in disguise-.D Lindblom's big show of the year, the Lindblom Lark, sponsored by the school and the P.T.A., was held May 23, l952. The high school community responded with enthusiasm to Lindblom's invitation to share in a just for fun activity, which was motivated by the need for special equipment in each department. Hundreds of friends of Lindblom came and saw our school in gala carnival attire. I The auditorium was the scene of sparkling entertainment offered by the speech, drama, and music classes. 'Bailalaika, a revue which portrayed a village square in Europe, provided a transcontinental air of festivity with its gypsies and gay music climaxed with a fine rendition of The Nutcracker Suite by the A Cappella Choir. Island Paradise and T.V. Or Not T.V. afforded mutual pleasure to both audience and cast. Faculty Frolics, one of the most popular shows of the evening, caricatured certain types of student behavior and proved that teachers also have a sense of humor. Each department planned some form of fun to make the Lark a successful venture. Numerous side shows, attractive booths, an art fair, and unusual deco- rations lent a festive atmosphere to the halls of Lindblom. Rounded out by the 'l'Can Can and Gay Nineties Revue, given by the P.T.A., our carnival offered a variety of entertainment to everyone present. Page l49 ,,,-Q' f-.TEIVIRER Qzvif. ' lv' V mt. H' WEB' MON' SUN . zffv 'ON Otis? O 8. 5404, lflfflfblflflflfb 6LlfLOIf'6LWfL6L We stand behind you, our Maroon and Gold, chant the cheerleaders, as the school year gets oft to a good start. A football rally offers a preview of Saturdays game. The tearn calls the signals and the students respond with Vim and vigor. This scene speaks for itself. The first marking period is just around the corner. Mum Day brings out beaus and smiles when the red jackets conduct their initial sale of the year. On your guard, rnenl The girls are taking up target practice in the R.O. quarters. ln need of a disguise? Our artists will oblige by creating new faces for the Halloween masquerade. Page 150 ' 5'N'35:': I 1: g!':-:2Yi :'. 'f Q 5 W4 iwvwpv M, --M :-:.':5:t'a.:t :rf f ' ' Iii' WW' -V-. 2?::.fE2'.E: we w,.G'if : : wt? mit! oiwirxtzifi as o 4 t 1 . -2. A 2 t f ' 'e ' M 'iffy wgpsxlwggfzfiw it ' 4 .. f . -.....-:I-H :i:3a- 1- Qsge' :anger 'gg w. K :Emi k Q gfg,gW.t15 7 ,Q How . 225 r tiiwier 2 t E .gs 5 rigs s ' it e X, E si t. ft X 2 'I .::-i':: ff siwwttii g12wM,i'lwei,1:Zsm'1 t Z. .... 5.5. . sg ...,: ,: g.: tsg5gXQWgiwJid 'gs,,,Sswy,.,s,.,1w,,.,.,..yggy . EE E5 QQXEFSLFJQQ, q,22.vslii5U'Y32'i,2QiE-115232ff 1fr'S'3'f,lfSJ V- :-55 tfm tli Trix? 'flaw siilwti' wzifwiv ,f fiftiet- : 5332 'W tg ,ge,:M,i,,fH ,snag.ziaw5:rs9gss:s' ftffwf.sf:zt'i-,ft t it '1 N tiift swiwleistf it ,WN vm- ..11iit'SW::s14 f' it A 15- ,l Q it ':.faf -2 2.1. 2-222 zsisgggiwrggwpr 512 twat? Q.. . Q gg sgiiyxfamggawlperzitlis,.msi.t-ant.- ,Q -.L- zf'2E-iiliffz. :g- ':, ?I:'?3- sigigggiwgzi-atvglE',?if??1su1,x5fiwgitimaweit'7 'E 'fa s. :fa.a:F'f -1 M222 1222 Tiisffiitfi if Q was it . ,ff 1 'A 'M-,ibwmmww a,,,tiqXwig,,.w qbwwfwi,-i,. was it s isgtgvz 12gi gaH5wsgrs:t1ttgrt: 5 wg 1 93532: w gztzwyfiagiizsxif S, ggi .mar E ' s:,x.,e:?gv:gw:is'1 Z :Biff ff - Q kEQi2E fSiEEzslx2jyzzimsigfiiggati r sg-gg ggrggiig if iv . X ' v.wQ,1e- gexniglgff 1zz,'3D5 ztfypw ' it an QQ M soft' efgw.. smL,w,,mg,g'.,,55,f,g?WqiS,., - - ,- - -,- into H'j,Q.1f..gf' t.. .,,., I 9 4 'V 'Q . . . -.,1:-- ki' ' ' .:.,..F.:.:, 1 W - M sri J 1 -'S Qefsietgrll M Q 1, :, ,.... .. 'iii t 'H ? .-I-5:5-:g 5: :.:, , V- ..:ns.,t ,ww -.:.:t:?5.E-..: :-: 'Mil effftirv ',:,,:,.-::y:.,..s:'g: 3.2:g j..I.,,,.,,,.1. Q Q if , .wifi is WO SUN. .MON S WED . PRL SA T. 5 That class is closed, is often heard in Room l03 during programming for the spring semester. Swing your partners, all, and promenade the hall, shouts the caller to the square dancers in Metrical Madness. Initiation daze features weird make-up and strange antics. ls it worth it, girls? Lorraine and Carole add their artistic touches to the main corridor as Lindblorn gets ready to celebrate the Christmas season. L.T.H.S. has its own coronation. lt's a memorable evening tor loan, reigning as the Sno-Ball Queen, and her court, Nyela, Penny, and loan W. Can it be true? ls our stalwart senior councilor afraid of the girls? The tree of all nations in the girls' gym is adorned with decorations from many countries. Page l5l ckfogjay Judie my .... . V .Wm , Bmw.. W Q55- f N t t ffff 1 wie MON J U ft WED TUES. T. YEL 1 SR mv Mowjpfg ft? . we-001319 y SA -MMI' j'8n 5 Seniors take advantage of a career conference to learn about future opportunities. The aim of every Lindblom athlete is to Win the cherished L cup. Roy and Dotty are looking at the record of previous holders. Ushering in the Ianuary graduates puts three of Mr. Crofts's men in a jovial mood. The G.A.A. Board and Cabinet ring down the curtain at their semi-annual achievement assembly. Effort rewarded is the theme for this occasion. What goes up must come down, boys! Grab it and keep those numbers popping on the scoreboard. No secret admirer here! Arlene publicizes her valentine intentions. Eagle camera catches the clean-up squad in action. After that very special tea the Councilors gather to wash the cups and to exchange gay chatter. Our advice, Steve, is to let go. That ball will make better time without you. Page l52 YK SP5 P R NWS wp 1095 woti 939 'bw . A Q suzv. Mow, A9 CH TH U H S. PHI i 54 T, vain 6Llf' KQUQAQJQ lntroducing our own Iohnny Ray! You'll get your point across Without crying, Mike. Greg and Kay choose a tune to their liking. 'Nill it be jive or a dreamy melody for these Keen Teens? The l.C.C. contest stressing good grooming has all Lindblornites alerted. Keeping in step with the campaign Carol and Judy are being extra careful about those hem lines. ln a prelude to spring vacation Helen and Bill enjoy a taste oi freedom, Down with the books, they exclaim gaily, suiting the action to the Words. Rain doesn't dampen the spirits of Ken and Arline. Maybe they're thinking of the adage, '. . . bring May flowers. When April approaches, There's Music in the Air, at Lindblorn. All our melody-makers combine their talents to produce sweet harmony at the traditional Spring Festival. No, this is not the Easter parade. lt's merely the L.D. initiation. All this for 500 points! ls this an act that the music department rejected, Yvonne, or is it another Version of spring fever? Page l53 Z, f iifff' 'W W J. - .,.,..,.:.-M. :- MW, . 5 me -K f wb A .4 ,i . - re gk M N , Q...- .-.f,5:g,.5: W1 , ,two . jg- 1: NJ ww 'ff c M. mm: Nt ,355 .:-.,:ff:55-sei ,thy MAKE, Q -1 3 J' vffwwr ,V t semi 5' 3 gs' t M5 M V 3, gy . ,A . , l rw W Q, gi, to -' r MON- SUN' it gwwwiif is f' j.fvw1w,' ' meniftw wsrfgmw rss -Wgtwqm Q53-xgyw -1 t . 1 ..,,...,, ....... . . ,..,-,.,. .,,. , ..:., 'image 1 ff, is XM rs gwmzwif Qtxutgwigimgfiyri Z tsfgiwpg ,.,.. -:L .. ..., ,.::g:-51,31 M ' X 7 . X g . .ri up as 7 jrilggggixgyiiiimiwig MT..- wut N fc Y K me 7 '. yahvfirwgtwwib 4 my-gr my-P.. wg.-ff --,':2:.::.,..e,::.::E 1 cl .12 it UAW xii ,Wi25LZ33iEFi'g5?f?',Xi?gg Q I 3 . 'K V it f - L . fix: t . f t' ' t ' mfliuj 'X rE1.r'Savf?4g,4LE5' Mhflgmgj 5 pit . .1 ff 441 f .f me BK r , l11B'?t?'jl3- tam . M '25, wygwy ' we Y X' miie we mm 5kig,:..ggft. -ff- N 'ters wwwfm,.M-ifawftfwzffggf ,Wwi 4. UR . 1 2 ,rUw'iv,Mis-1fWaw,,swWW'sA:4 2, . :es 'YH 1 1 gint wgegiwtrEwqitzigtszzgvsiiigtri gg Q iiiiifallz ltittziswffezws . .S -ess: Dt P - :twiki 1725? f .avi A .teszitgsigsmfgijf igwtf Wir? 3.1 q2',3s-gf QF g, :?'::. E TUY35' -Nfiiii t -fmiritf, ttiigarlfri a wpriwgiizlitw ' oziisif wf . H 1 it f 1.1 Q aw .fpigwmggwzmgsgggg iizfw fgiwyii ff'JtffE5'ges4 triwfglwg N if glib 'VN Wrimssiiirtififx url X YE 3. . B -.gzbitfgiggfgg - ci Xllfliiwf szti?5iT Li Z ?i?1iiM lg , gqgi sg .im .fgil-if :ibn 'ii gs vE?1sQZ'Z My 353525 t. rrfiirzw if .. j11fiiEi5fLiZs?::i'S'fJ5ftgEiSEJi2i55gi't.s I it will Qltttaif 1 W. f . gziiffi Mew:miatazazhfsgfisgzgygfgggQ wt flea! 'TVHQY eww-HN'Ga M454 ,sf 'nf K ' MR wiivzisiiipi ,, Kim M 1 t Q 1 ,lsziirzigiff U :af wists? Qzilhmiiiw P wersigtgslQtypiixgizsgiyszmW Mander rxwmfwzsmss :awww Xesteiw-ta:g.gt'iirwzttie: 1 t sk A .iiwxififi1141-5ft's2tgsff,.'Issi3'Shii1r4 . B ' J ,Lis 1,5452 ai fgfgwqii' -i SU XR, llfosikex FY 1Mz'1tLg5i'115if1 ei, rs.. ,gtmsjrw ,ltksiitsitit f 212130 ' rx r 4 antggtzgis-ptgyigratgi.Riagg Macc i stlliifiiiziirl oA, 2. 7 pjrgsw g wigs W ' XX- T- f f sipiiiitsiiwi 1 17, Xi-X 'tisisygsz-Masai U X wgb XX 'S F M Q eloowlfowe ima lim cautions Ron and Lew to be on the field at game time. Think you'll make it, fellows? Could these girls be auditioning for a summer stock show? At any rate, such serious school topics as senior class ratings seem to be far in the background. Spring landscapes are a perfect subject for sketching classes. Looks as if these artists like their work. You, the Night, and the Music, brings senior festivities to a climax as the lune class promenades at the Edgewater Beach Hotel. Bonnie and Elmer agree that this is a night to remember. Our sweet girl graduates enjoy a last get-together before their senior year draws to a close, No tears, girls? ln a final gesture of farewell Elaine, lim, and Tom autograph Eagles for one another. As bid adieu to classmates and friends at Lindblom, th ' ' h happy years. . ey remimsce over t e experiences of Page l54. they four a 4595 6, 4 -fr T ' ..- , 'R ' 2 x 1 L 1 Q 5 l ,. ' ,QP ' Hin! ' . 5 F 4 f H sm L 1 f , A Vt., r Y N N J :U ui , inf -1 I gl . .affix-' K ww, .M HMM! W am ' H 1 'uw -' Q , xg. ggi ' Naiagaaph S' R am A Q Cy 2, 5 as S E Lb. Ln m 'A 5 5 as S1 Q 'Q O. S M S is S. CHlCAGO'S LEADING PHOTOGRAPHER 122 FOR 83 YEARS 3 2 -: E -I I 1 I I' E O TTI Z -I li -4 0 JU I'I'I JP -I l'I'I U ARTISTIC PHOTOGRAPHY Sl N EE Q. S SG is 8 I, iz. 109 NORTH WABASH AVENUE CEnfroI 6-3982 Official Photographer for the Eagle 1939-1953 :.: ALL PICTURES APPEARING IN THIS BOOK ARE AVAILABLE IN THE STUDIOS Completely equipped to serve your E EVERY BANKING NEED 3 THE CHICAGO CITY BANK and E E TRUST COMPANY HALSTED AT 63rd STREET H Member of the Federal Deposit Insurance Corporation E 12: Legal Blanks-Dennison Goods-Office Supplies pgrgsmough 7-7676 Fountain Pens-Rubber Stamps Made To Order l.EHR FUNERAL HOME IAMA STATIQNERS G. Le Roy Lehr, Director 6305-7 South Kedzie Avenue 6040 SO- PU'-ASK' ROAD Pnospecf 6-9102 chicago 29, illinois Chiwso 29, Illinois Flowers tor Every Occasion Est. 1910 MARZANO'S 70 BOWLING LANEs '-ARSON AND SCN Florists 5525 W' 63'd Snee' WEDDING and FUNERAL DESIGNS :J 3323 W. 63rd Street 1544 West 63rd Street OPEN BOWLING AT ALL TIMES Chicago 36, lllinois PRospect 6-3854-6-3315 NlERMAN'S BQQTERY RAdcIitte 3-9583 sanclqsf ons :jf Shoes Carried From AAAAAA to EEE BEGLEYS SERVICE 51'A1'lQN Womenls To Size 14 Menls lo Size 17 Batteries - Tires and Lubrication Complete Range of Suze tor Children N- E. Cor. 69th and Loomis Blvd. 3148 w. 63rd sf. PRospect 6-3011 John P. Dick Page 157 l INSURED SAVINGS HOME LOANS A' QJQIAULZ Savings and Loan Association o F c H l c A G o 6401 South Ashland Avenue CHICAGO 36 JOHN L. LEMMER Telephone Manager WAlbrook 5-9710 PETER AMBROSINO Imported Italian and Domestic Products WE SELL RETAIL AT WHOLESALE PRICES FRESH FRUIT AND VEGETABLES REpubIic 7-7435 1638 W. 69th St. WAIbrook 5-5966 VERN MEYER, Florist 3416 W. 63rd STREET Chicago 29, Illinois FIoraI Arrangements For AII Occasions Phone GRovehiII 6-8283 NATHAN'S STYLE SHOP Dresses, Coats and Suits - Lingerie 3117 W. 63rd St. Chicago 29, III Prompt Guaranteed Service on All Makes Aiax Radio 81 Television Service 2847 WEST 63rd STREET For Service Call HEmlock 4-7676 Open Mon. 81 Thur. Till 9:00 P. M. HUNT .IEWELERS DIAMONDS Class Rings HEmlock 4-6388 3106 W. 63rd St 5629 West 63rd Street POrtsmouth 7-3535 6245 So. Ashland Ave. GRovehill 6-8400 CWCAGO,HUNOB i' ALBERT J. H0 E Everything for Golf Phone PRospect 6-8749 GREAT LAKES GOLF BALL CO. . N01 inc. AI. Howe Services, Inc. Distributor and Factory Representative L. 6641 S. Western Ave. Chicago 36, Illinois if inH:innfiUTWU Wfi iNfWULUK 5 -Rv Paints, Varnishes, Wallpaper, Glass, Etc. N JOSEPH FEICHTINGER JR. lgainfing 0! .ibecorafing ESTIMATES CHEERFULLY FURNISHED NEW WORK A SPECIALTY STewar1 3-4218 7753 S. Ashland Avenue Chicago 20, Illinois zg: Phone LAfayeHe 3-7351 For The Besf Buy SEELEY DAIRY in SOUWOWH f See your Ford Dealer Q DRM SEELEWS FOR Safety Motors, Inc. if F. M. CARAWAY, President . i' 4754 South Seeley Avenue onovehall 6-oooo 2300 w. 63rd slreef 7611: 1: 1: 2. 2 as as as 9 ' Watch Repairing :fi L. ANDERSON JEWELERS . . . WATCHMAKERS I3 563I V2 West 63rd Street iii H. S. RAIKES Sc to 51.00 Store U1 Of Of I W CD 9.- Of CAD -1 O. U7 -0' -: CD CD -I' ifi Chicago 38, Illinois WEST LAWN TAILORS P Z U 0 F In P Z nl 5 U5 Telephone POrtsmouth 7-0940 4304 West 63rd St. Chicago 29, III -E Eau ...rn 'nv Y'-U Bo -:l: Om 23 -4 23 it 35 :IE 13? Ice EI 'Q ml!! II S'-'E 22' Sa. 'UQ 1-0- 8.5 gl 'Ol ln on os U1 .. 0- on 'I o. m rf 0 ET O Q no o N1 39 REpubIic 7-9754 C, EDNA'S LINGERIE SHOP WEARING APPAREL ' ACCESSORIES Also Infants' and Childrens' Wear WAIbrook 5-5543 5543 so. Damen Ave. WALLY'S coRNER cn 2 3' Q 3 Q. 2 2 0 o I FU ITI 'o C 2 5. T' so I OJ so C. Akers, R. Ph. N. Curry, R. Ph. CLEARING DRUG STORE 5607 w. 63rd sfreef POrtsmouth 7-6520 151 REINER MATERIAL COMPANY 121 Telephone PRospect 6-8000 5812 SOUTH DAMEN AVENUE gg: Face . . BRICK . . Common 571 MARY'S FOOD SHOP 5544 S. Laflin Street CHICAGO QQ 5 Your Patronage is Appreciated i.ou's HARDWARE ii Jewel Colorizer Paint in 1322 Colors Hardware - Glass PLUMBING and ELECTRICAL SUPPLIES PRospect 6-3709 5607 S. Damen II! Best Wishes HERB KARol.L MEN'S SHOP Southwest Corner :x 63rd and Keclzie 'J Phone HEmIock 4-6466 Expert Service OPEN EVENINGS - TERMS OR CASH OGDEN RADIO 8m TELEVISION CO. TELEVISION SALES Admiral - Zenith - R.C.A. Buy Here and Save Money 'I645 W. 63rd Street C. Geo. Pecho Chicago 36, III. Page 160 STATE BANK OF CLEARING modern Hanlzng yfnofcleaf fo Wed livery ganling Ween! P6 PERSONAL LOANS -AUTOMOBILE LOANS FEDERAL HOUSING AND MODERNIZATION LOANS COMMERCIAL LOANS - COLLATERAL LOANS P6 Member Federal Deposit Insurance Corporation Member Federal Reserve Bank PF Chicago 38, Illinois 5601 West 63 rd Street 10's GROCERY 81. MEAT MARKET Prop. Josephine Mrozek GRovehiIl 6-7252 6545 So. Pulaski Rd. Phone PRospect 6-4096 3 RICHARD rucl-ls PAINT stone Painter's Supplies - Wallpaper - Paints -ll Glass - Varnish 5641 SOUTH ASHLAND AVENUE Chicago 36, Illinois All Phones LAfayette 3-3110 ARTCRAFT CLEANERS - DYERS 1 'id-it 5? Personalized Service CLEANING - DYEING - COMPLETE TAILORING We Call and Deliver 1904 W. 47th Street Chicago, III. Page 161 JOHN T. ROBERTSON, R. Ph. The Pharmacy for Better Prescriptions 1425 GARFIELD BLVD. PRospect 6-4268 THE BIG STORE ON THE CORNER Wallpaper - Window Shades - Paint S. A. BERGMAN, INC. 1524 W. 63rd STREET Corner Justine Street MID WEST STORES W. E. Gclrrity GROCERY AND MARKET 5700 South Damen Street Phone PRospect 6-3100 Chicago, Illinois PETER CASSIO IMPORTED ITALIAN FOOD 'I65I-I653 W. 69th Street I TQ ander Wagon Bros. . NIAYER FLORIST PRospect 6-1134 'I7II West 63rd St. PRospect 6-I I37 5818 S. Hermitage Ave. O 4552 W. 63rd St. 3605 W. 63rd St. SUCCESS TO ALL POrtsmoutI'1 7-8020 LINDBLOMITES A FRIEND FULL GROCERY s. com cuts COMPL'MENTS of the Free DeIivery DAVIS STORE PROSWCI 6'27II 1701 West 63rd sweet We CG We Detvef SURPLUS BARGAIN MART ff MEHIS GHCI Boys' CIOI'I'lIl1g North East Corner-57th and Laflin St. Work Clomes' Shoes' Spoffsweaf I GROvehiIl 6-5731 wmbrook 5-0297 1657 W. 63rd sfreei GRoveI'1iII 6-0433 R. WieIatz, Class '29 oc-DEN BAKERY REMEMBRANCE CARD 51-'gp Edward Yonqn, Proprietor parfy Favors Mode fo Qrde, WE SPECIALIZE IN PARTY CAKES 23 Gift Wrapping a Specialty A 1: 1823 W. 63rd SL Chicago 36, Illinois GRoveI'11II 6-0848 'I5I0 W. 63rd Street .- Page 162 41. EDWARD l.. CERNOCKY 8a CO. Real Estate - Insurance Management - Loans 1753 WEST 63rd STREET Chicago 36, Illinois REpubIic 7-4341 Chrysler - Plymouth soum ASHLAND morons, lNc. Morrie Lustig 6200 SOUTH ASHLAND AVENUE Chicago 36, Illinois REpublic 7-7600 Home Appliances Parts and Services A. s. J. SALES 8. ssnvlcs 6241 S. WESTERN AVENUE 53' Chicago 36, Illinois GRovehiII 6-7545 E mp oyment ervlce E l S ' ' Office ' Technical ' Executive ' Sales ' Factory :II 1555 W. 63rd Street CCorner ot Ashland Avenuej ? WAlbrook 5-7000 11: Chicago 36, Illinois MELUIIIES LUNCH 1752 W. 63rd Street GRovehilI 6-9236 'A' Om- Wozfo Prices Always Lowest Quality Always The Best 4 Plate Lunch - Sandwiches and Ala Carte WE AIM TO PLEASE STAN 84 TESSlE'S GROCERY 5359 So. Honore Street We Call For and Deliver LA CLARE CLEANERS GRovehill 6-1651 1656 West 63rd St. COMPLETE SERVICE Imported and Domestic Delicacies For Your Table ART. LENTZEN'S Delicatessen - Wurstgeschaeft F. Koch's Homemade Sausage Weisel's 8. Usinger's Cold Meats 1721 WEST 63rd STREET Phone REpubIic 7-0568 Chicago 36, III. 2 as if as e1 as as R9 Page 163 .. ..,.. .. I. Shlensky, R. Ph. T. Shlenski, R. Ph. Regardless of Where You Live, It Will Pay to Buy at Baulcus CENTRAL DRUG STORE The Rexall Store BAUKUS SUPER MARKET PRESCRIPTIONS CAREFULLY COMPOUNDED POrtsmouth 7-6350 6332 So. Central Ave. 5600 W. 63rd Street-at Central POrtsmouth 7-6688 Chicago, Illinois We Call and Deliver McGINLEY'S TAILOR SHOP CQMPLIMENTS QF TAILORING - CLEANING - PRESSING 1651 wesiesrd street WHEEI- INN CAFE Phone PRospect 6-7277 Chicago 36, Illinois DE SOTO PLYMOUTH CENTRAL AUTO PART JOBBERS Auto Machine Shop and BURKE MOTORS' INC' Electrical Service 65th Street and Western Avenue Portsmouth 7-4383 5745 w. 63rd sf. Chicago. Illinois PRospect 6-7600 SAVE HERE WITH SAFETY . . . 3M DIVIDENDS - CUl l'el1I' Rate 3M All Savings Insured up to S'l0,000.00 LAWN SAVINGS and LUAN ASSUIIII-ITIUN WILLIAM KRUEGER, President 3525 W. 63rd Street-Chicago 29 Phone WAIbrook 5-6500 Every Man, Woman or Family Should Have A SAFE DEPOSIT BOX for SAFETY and CONVENIENCE THE FOLLOWING ITEMS SHOULD BE KEPT IN YOUR SAFE DEPOSIT BOX Savings Bonds - Stock Certificates - Insurance Policies - Mortgages Deeds - Jewelry - Contracts and Leases - Torrens Certificates Military Records - Marriage and Birth Certiticates - Title of Auto Currency should be invested or deposited in a Savings Association or Bank Account LAWN SAFE DEPOSIT CORPORATION 3525 West 63rd Street Chicago 29, Illinois WAIbrook 5-6500 Page 164 BORG INCORPORATED HEATING CONTRACTORS HEmlock 4-7800 1616 West 63rd St. JODY'S CLEANERS 6249 S. Pulaski Road REliance 5-5281 Rochkes Medical Arts Pharmacy .loe J. Rochkes, R. Ph. G. We Deliver 3213 WEST 63rd STREET WAlbrook 5-4787 Chicago 29, Ill. Now is the time for all good girls to come to the aid of their parentsp and get a job at WHITE COLLAR GIRL EMPLOYMENT WAlbrook 5-4686 5921 S. Kedzie H. Puetz F. O'Connor HAROLD'S TEXACO SERVICE ' Lubrication ' Batteries ' Tires GRovehill 6-9582 1832 W. 63rd Street SHANNON SCHOOL OF COMMERCE Business Administration Secretarial - Accounting C. P. A. Review - System Planning MODERN BUSINESS METHODS 5500 S. Damen Ave. GRovehill 6-8000 GEORGE'S ROYAL BLUE 1855 W. 63rd Street GRovehill 6-4056 QUALITY MEATS and GROCERIES Phone PRospect 6-1614-15 MCCARTHY-NELSON FLORIST Florence McCarthy Nelson 6336 SOUTH WESTERN AVENUE Chicago Congratulations To The Class of 1953 THE GIFT STUDIO 2449 w. 63rd STREET Chicago PRospect 6-1500 Tel. LAfayette 3-6420 COLON 81 COMPANY Industrial Metal Fabricators 3702 WEST 38th STREET J. C. Luehrsen Chicago 32, Illinois BAB'S DEPARTMENT STORE The Store of QuaIity 3431-33 WEST 63l'Cl STREET REpublic 7-6670 S, Bqbendir We specialize in all your beauty needs OGDEN BEAUTY SALON Moderate Prices Prevail 1613 WEST 63rd STREET REpublic 7-2400 Za . -'1 I1 ,E Page 165 fi as .- if I.- as as P6 Joseph Vacha8zSIIns jzzridfd FLOWERS TELEGRAPHED ANYWHERE Telephone LAtayette 3-6248-3-4710 4710-14 South Western Avenue CHICAGO 9, ILLINOIS P9 REpublic 7-9633 Trailer Rentals .lohnnie's Standard Service Station John .l. Madeia, Jr., Proprietor EMERGENCY TOWING 6158 South Ashland Chicago, Illinois .lOHN'S ROYAL BLUE STORE 5923 W. 63rd Street fNear Austinl POrtsmouth 7-8328 POrtsmouth 7-5735 WlLSON'S PAINT sn HARDWARE PAINTS - LADDERS - GLASS - WALL PAPER HOUSEWARES - TOOLS - BUILDING, PLUMBING AND ELECTRICAL SUPPLIES 5941-45 South Kedzie Avenue HEmIock 4-1381 Chicago 29, lll. Compliments of Your Friendly CLEARING IVIERCHANTS R 8: S APPLIANCES 5637 W. 63rd Street ALEXANDERS RECORD SHOP 5633 W. 63rd Street POrtsmouth 7-3633 L 8m W CHlLDREN'S SHOP 5622 W. 63rd Street REpublic 5-4787 H. S. RAIKES 5l1.00 STORE 5616-18 W. 63rd Street BOB SMITH FLORIST 6325 So. Central Avenue CLEARING TELEVISION 8. APPLIANCE CO. 6342 So. Central Avenue POrtsmouth 7-8292 Page 166 gl li! A GRovehilI 6-1433 MALS' MEN'S SHOP HABERDASHERY ' HATS ' SHOES 6848 S. Ashland Ave. Chicago 36, Illinois PRospect 6-1606 G. E. Canham, R. Ph. CANHAM PRESCRIPTION LABORATORY 6252 So. Western Avenue Chicago 36, Illinois Phone REpubIic 7-1861 UNEVERSAL EMPLOYMENT SERVICE 6255 SOUTH ASHLAND AVENUE Room 11 - 2nd Floor Kenneth L. Hoft Chicago 36, Illinois Q Phone POrtsmouth 7-9700 DEERE'S CATERING SERVICE 6059 SOUTH CICERO AVENUE Chicago 29, Illinois REpubIic 7-8900 DORIGAN BROS. . . . Florists 1641 WEST 63rd STREET Chicago 36, Illinois Q COMPLIMENTS of HENRY BIANCO UNITED AIR LINES has openings at airport for High School graduates Good starting salaries and excellent opportunities for advancement. Many employee benefits, including tree travel privileges. If you are interested in a career in the AIR TRANSPORTATION INDUSTRY, why don't you stop in at our Employment Oltice and discuss employment possibilities with us? Our interviewing hours are from nine until two, Mondays through Fridays, and our Employment Office is located at 5959 South Cicero Avenue HEmIock 4-3400 ERNEST GEISSLER, Realtor REAL ESTATE - INSURANCE MORTGAGE LOANS 2749 W. 63rd Street Chicago SOUTHWEST AUTO-PARTS DISTRIBUTORS ELECTRICAL AND SERVICE PARTS Machine Shop and Ignition Service 6718 S. Western Avenue Phone PRospect 6-8717-8718 Chicago, III. Phone FRontier 6-4622 PIVARONAS BAKERIES Hamburger and Hot Dog Buns For All Occasions WE DELIVER Page 167 JUNE GRADUATES There are job opportunities for you at WILSON AND CO. Traditionally we have enioyed a mutually satisfactory employment relationship with Lindblom graduates. We have interesting positions, with a secure future, for you as STENOGRAPHERS . . TYPISTS . . CLERKS WILSCN A AND CO. Ashland Avenue at 42nd Street CTA to Door Ask for Miss Freeman or Mr. Stewart Third Floor, Main Office YArds 7-4000 . . . Extension 502 or 4'I7 3006! !0l jA0lfl9Li! WHEN YOU NEED MONEY TO BUY, BUILD OR REMODEL YOUR HOME- SEE HEMLOCK SAVINGS AND LOAN We are glad to aid you to home ownership at the best mortgage terms available. MONEY AVAILABLE AT ONCE You will like our quick service PF HEMLOCK Savings and loan Association Ashland Ave. at 51st St., Chicago 9, Ill. Telephone Himlock 4-0600 TM: ON SAVINGS lCurrent Ratel We are producers of quality printing of every description and can fill every need you may have for printed matter, be it large or small. We offer a complete printing service: business forms, booklets, publications and general print- ing of all kinds. ir The Modern Franklin Co. Hinferd 'A' 725 S. WELLS STREET WAbash 2-8662 CHICAGO 7, ILLINOIS Page 168 CAMPBELL Dnues The Prescription and Cosmetic Store WE DELIVER REpublic 7-4010 2457 W. 63rd St. C5 BEST WISHES TO THE GRADUATION CLASS OF 1953 RELIANCE CANDY COMPANY 6950 South Wentworth . A JOHN E. EGAN FUNERAL HOMES 5908 So. Kedzie 3424 W. 63rd Street 2955 W. 95th Street GRovehilI 6-0090 COLONY EAT SHOPPE 3211 W. 59th Street Home Cooked Meals at Popular Prices POLK BROS. T. V. - Appliances Furniture and Carpeting 2850 N. Central 3110 W. 63rd St. 1750 W. Belmont Open Every Nite Till 10 P.M. - All Day Sunday P095 Frozen Foods-Fresh Fruits and Vegetables .IIM'S ROYAL. BLUE STORE 6001 SOUTH ASHLAND Fresh Bakery Goods Daily Free Delivery HEmlock 4-7273 Congratulations and Best Wishes To the Graduates of 1953 From ELLER'S SCHOOL STORE 6245 South Wolcott Avenue SWANK ROLLER RINK Skating Every Night Except Monday Matinee Saturday and Sunday 2-5 P. M. Wednesday Reserved for Private Parties 2345 W. 111th CEdarcrest 3-3693 ARMlSTEAD'S PASTRY SHOP lt's Good -The Taste Tells 2747 WEST 55th STREET PRospect 6-7550 PRospect 6-9691 REpublic 7-9386 John Partipilo PARTY'S PIZZA Italian Beef and Sausage Sandwiches French Fried Shrimp ' Take-Out Orders 5911 So. Kedzie Ave. Chicago 29, III. POrtsmouth 7-9604 CORALO'S DRIVE INN 6400 S. CICERO AVENUE Chicago, Illinois Beefburgers - Sodas - Ice Cream Sundaes and Malts ' F. H. HALVORSEN CO. Real Estate ' Property Management Mortgages ' Insurance . 3145 W. 63rd STREET HEmIock 4-4300 Chicago Page 169 ii T suumf cans jab Mari! Gwzcluafei gui IMJAM GYLJ sglllfe P8 Gwngrafufafiona fo GUIIIIMAN MANUFACTURING IUCUMUTIVFS IIUMPANY ' HALSTED STREET AT 48TH CHICAGO 9, ILLINOIS Builders of Underground Mining :jg and Tunneling Machinery ff cm-NNE MACHINES A Good Place To work P 170 WAlbrook 5-6400 Radios ARROW AUTO STORES, INC. Everything For Your Car 2755 WEST 63rd STREET Irving Resnick Chicago 29, Illinois 53 Congratulations and Best Wishes to Graduates of 1953 From QQ BEN's SCHOOL stone 6059 South Wolcott POrtsmouth 7-9129 Delivery Service JAKE's I. G. A. SUPERMART Quality Foods and Meats Poultry and Fish in Season 5612 w. 63rd sf. chicago ss, Illinois G. s. A. TAlLoRs and CLEANERS ' Suits made to order 22: ' Expert restyling and remodeling :gf ' Fur Coats cleaned, glazed, and relined .3 3532.50 and up wAlbr00k 5 8053 2818 west 63rd sf. COME IN AND LOOK AROUND 3: Boats - Planes Trains Race Cars ff: Crafts :Zz Magazines fff MIDWAY HOBBY SHOP 4217 W. 59th St. POrtsmouth 7-3245 7655 5? BEGEMAN for diamonds H. BEGEMAN, CREDIT JEWELER, INC. 4184 Archer Avenue 3142 West 63rd Street Phone Virginia 7-1718 Phone HEmlock 4-1225 AMITY FEDERAL SAVINGS LOAN ASSN. 6910 SOUTH HALSTED STREET Chicago 21, Illinois ABerdeen 81 4-4400 COMPLIMENTS OF GEORGE SLATER SHOES Phone SUmmit 1730 7629 W. 63rd Street Argo, Illinois COMPLIMENTS of the ZISKA FAMILY COMPLIMENTS of a FRIEND We Serve The Best To The Best MAR-KAY GRILL 1652 West 63rd RACINE MUSIC CENTERS Complete Schools of Music 6448 South Talman lMain Otticel HEmIock 4-2146 10 Other Branches aqe 171 .au CA, BE A GUARANTEED BEST WISHES I EXECUTIVE ASSISTANT if from A EIIX IJUIIEGE Graduate is a guaranteed s:::::'sir'::1i:,.2:' A A S I with a certifies check. -' AHJI: 15 .':'ff ', rf U Co-educuHonal- :5rl,f!f:TQrfq - . SUPPLY COMPANY 2.'LSSiiL?'S S ,.'A vii' 1 A.V,V,, -,1' An Associate of I. T. 8. T. Corporation rinn A If-' A'l'ii f 5 ,'.. I A 'f'i 3'L?Q9?ff .r-'t Z --VrV' I i,-.' 3-P?l'-fifj '-.-l if-Q ,. t I '-f ,' 5 '17E5353 55l '-'. :',5.5 ' .'f5: , EIS Srri 1' Sriri Manufacturers ot Telephones -AVA as ... g.. . v-', JII' '...'.:' and Communication Equipment Ask for 122 'IIA DePf- D A Goan PLACE TO WORK ST ewurt 3- 6650 S. Cicero Chicago 3, Illinois 6 79th AND HALSTED sts. .. SAVE WIT!-! SAFETY Ash Ilan Brothers, Inc. All share accounts insured up to SI0,000 by Federal Savings and Loan Insurance I Corporation Fine Rug Cleaners fi and Q33 ReHOf1irerS Tall., Esllulltz: 4E5Al!ATx,IE TNIT:3lE5 AND LoAN AssoclAtloN ' OF CHICAGO 8066 SOUTH CHICAGO AVENUE 1610 WEST 63rd STREET Phone WAlbrook 5-8121 I 4- Te ephone REgent 6000 W. A' Repo, Secrewry Page 172 'F YOUR SCHOOL LU NCH ROOM serves TASTY and DELICIOUS FOOD 'k Our Two Daily Specials GRILL SPECIAL Grilled Hamburger on Bun French Fries Salad Milk 35c HOT PLATE SPECIAL Pork Chops Whipped Potatoes Salad or Vegetables Bread and Butter Milk 35c 'A' We change our menus daily Q 1' 1 COURTESY OF CHECKER CLEANERS YOU CAN BE SURE IF YOU SHOP AT PETER KAY'S 6204 South Wolcott Avenue Chicago 36, Illinois HEmIock 4-6557 SI'IER'S JEWELRY Diamonds - Watches - Silverware CASH OR CREDIT 3I53 West 63rd Street Dick Sher, Class of 53 . Next to Marquette Theatre If: SOUTHWEST DRUG CO. INC. R. F. Uerryj Heyna, Pharmacist PRESCRIPTION EXPERTS SINCE 1923 I858 W. 63rd St. Corner Wolcott WE DELIVER REpubIic 7-2204 BISHOP SERVICE STATION Car-washing - Lubrication GRovehiII 6-9871 1420 W. 63rd Street . ,, , . , ..,,,,, C0l'Yll0Al'Yll!l'lf6 0 PIZZA- FRo coRPoRATloN Q E5 Paqe 173 3 TOmorrOw'S ,A :: :11 TodaY I 'E A. SEVENTEEN d , i I '11 A SJ . .2 S -S- ,. . l I I E Q l ,. . -.-5:3 --.-ze' -:-'-'-14-2:-'-2:-1-. IA 4 I 5 E53 5 5 'Q , as featured In Z E an . I other Ieadlng 0 magazines X Q 5 These famous brands E are your guarantee A f f I nd q Ilty I B b y T P g II Sh Skating Promotes Pep and Personality THE NEW PLANET ROLLER RINK Frank J. Moser, Mgr. '-N u by .4Ab.4 g n In f 0 sye a ua . -'-'-' ' .,-..: 1:15-1: CIE Ehj:EEcE'f:'iZee'I DUIIY 7:30 to II:00 P. M. R:?:E:Q,YEZIIgT2Ilf1, Saturday 2 to 4:30 T:Lf3'f1e':.CU'if 'if' Matinee Sunday 2 to 4:30 Sub-Teens, 8 to 123 Teens 10 to 167 Es, 9 to 15 9- P AND CHURCH GROUPS SM AWWA H . fr Pl - tj, I 7534 South Racine Avenue-Chicago hi cen r Vlncennes 6-2517 ' ' on zz nine :j: 2807 wesf 55th SI. 151 REpublic 7-9256 NIILLER-CARLSON SERVICES, INC. 1632 wesf Sixty-Third sneer B E QQ Telephone WAIbrook 5-8088 CHICAGO 36 1034 W. 59th St. Phone WAlbrook 5-0060 XT 6058 So. Halsted Ph EN I 6 4-3756 FURNISHING TO INDUSTRY one gewoo THE BEST I I YLGZEHEESEQEN CREATORS OF CHlLDREN'S CAKES . PACKERS WEDDING CAKES A SPECIALTY - SHIPPING CLERKS - MATERIAL HANDLERS DECORATED CAKES ' CAR LOADERS FOR EVERY OCCASION - FREIGHT CHECKERS - FACTORY HELP g - CLEANUP MEN .I ' YARD MEN FINEST IN BAKERY GOODS ' HANDY MEN FOR OVER 40 YEARS Ei The Best of Service Costs No More! Page 174 Decorative Painting Industrial Painting ERNEST L. KAYSEN PAINTING AND DECORATING 5636 South Wood Street Chicago 36, Illinois PRospect 6-9710 C? PETE'S LUNCH STEAK and CHOPS 1615 West 63rd Street GR. 6-9717 Chicago 36, Illinois Phone POrtsmouth 7-7213 BEATTY CLEANERS 5640 West 63rd Street PINCKARD PRESCRIPTION SHOP Jos. T. Pinckard, B.S., R.PH. PRESCRIPTION SPECIALIST 2421 West 63rd Street HEmlock 4-1500 Prescriptions picked up and delivered at no added cost Diabetic Supplies Medicines for the Home WM. A. LEWIS Where the Models Buy Their Clothes SOUTH 6420 S. Halsted NORTH SOUTHWEST 3118 N. Lincoln 4716 S. Ashland Compliments of ,3, Standard Federal Savings and Loan Association of Chicago 4192 Archer Avenue at Sacramento Chicago 32, Illinois Phone: Vlrginia 7-1141 76.2. 1. ,, The Oldest Jewelers in Englewood Established 1907 LOUIS SANDACK JEWELRY CO. Jewelers - Opticians Watches - Jewelry Phone ENglewood 4-6300 6211 S. Halsted St. Brunswick Mineralite Bowling Ball COMPLIMENTS . ' OF A FRIEND Phone GRovehill 6-0050 LYNCH NEON SIGNS Not Inc. SIGNS OF QUALITY 6540-42 South Ashland Ave. Chicago OGDEN PARK Y.M.C.A. 6052 South Racine Avenue WAlbrook 5-4475 Serving Youth That Youth May Better Serve GRovehill 6-7755 ASHLAND AUTO SUPPLY CO. Automotive Supplies - Machine Shop Service Accessories - Equipment 6059 South Ashland Avenue John Fashingbauer Chicago 36, Illinois THE DISCI'I'S 8246 South Kedzie Avenue Fountain, Ice Cream and Light Lunches Greeting Cards - Gifts - Toys School Supplies - Candy Page 175 f Cjhhxayog FINEST TUXEDOS SEE . . . then compare .,,.., W.,.,. -1, Qggi?jQ? 12: ' , - -A-- ' ' ' , V HOLLYWOOD TUXEDO RENTAL ,gr 938 W. 63rd St. WAlbrook 5-1251 GIGI.Io's FOOD MART We Deliver 5657 South Ashland GRovehill 6-3110 WEBER'S RESTAURANT H 1608 West 63rd Street Good Food For All The Family HEmlock 4-5495 GRovehiII 6-9860 SAVE REGULARLY LAWN MANOR BUILDING AND LOAN ASS'N 2700 West 59th Street Chicago, Illinois All accounts insured up to S10,000.00 as 5 THE HARRIS TRUST AND SAVINGS BANK extends Congratulations and Good Wishes to JANUARY GRADUATES of LINDBLOM TECHNICAL HIGH SCHOOL You are cordially invited to come in to talk with us about job opportunities in banking. The Personnel Department is located in Room 805 and is open for interviews weekdays 9 a.m. to 4 p.m. 115 West Monroe Street g '? GRovehill 6-8444 E CONNOLLY'S FLORAL SHOP Flowers For All Occasions fi: 3534 west 63rd street if F3 NUF SAID G E R T I la ' s 5: in NORTH west coRNER 'ii1Q, ms,,Qiff 'T-W 32 59th and Kedzie TOBIE5 BAKERY Specializing in Wedding, Birthday and Whipped Cream Cakes Phone: PRospect 6-2602 1819 West 63rd Street Page176 Marquette National Bank ? 12: 63rd and Western :I i' MbFdIDp'tI cpf M b fF d IR Sy ff . . snum S1111 cnNsn11111111n if kW'k Sams 1111101111111 SERVICE . . Pfmfmg Established 1923 JAMES H. GIBSON MEN and WOMEN EXECUTIVE SALES OFFICE ENGINEERING Phone PRospec'r 6-4707 6333 S Th A H d A 1957 E. 71 - HYde Park 3-4910 ,:, OU S an venue 2401 w. 63 - WAIbrook 5-8600 111 Chicago 36, IIIinois 2,2 V i az- as a:- as as ' - as is - Q. 177 5 I sAvlNes Account . N . . . because at Talman your savings are i. Safe, Available . . . and PROFITABLE too: ' 2 I I , A T 81F'N PM 'Q 5 ues. rl. oon to 8 . . in J V I I l Please note these llours: Mon., Wed. 8 Thurs. 9 fo 4 .QQf1f'5 Sat., no business transacted f1fi..f',f,, S n..,!e!l,lI so Feclergl S9VlQiQQ..q85.,.i-UCI! Ass n. gggjrchaneredi lQ8Q9l '1'h5 Q , United,fsihtiii-'Goyerpmeat 5-50,15 5Ifegfgig5g55ggg55:,rehicugo295 Ill: Q -,.'-. 5j.,fg1.tffie3ie1ifRE 4-13322 ,e'v'... -,,-Ve' 1--4.5114,:fzrfgiwrriiiffgffflivffF'P'fP 'ff ' PFff??ff 5 Q 1 4 - C is Compliments of ALDENS INCORPORATED 4 511 South Paulina Street Chicago 7, Illinois A GOOD PLACE TO WORK Phone PRospect 6-4055 ZIMMERMAN 8g SANDEMAN Funeral Directors 1648 West 63rd Street Clarence E. Zimmerman Robert W. Sandeman Phone PRospect 6-7925 TONY KLOECKNER FLORIST Say It With Flowers 1857 W. 63rd Street Chicago 36, Ill. Phone HEmlock 4-7776 WEBER'S BAKERY Home of Pure Whip Cream Cakes 3425 West 63rcl St. Chicago Page 178 Harmony Improvising ANTHONY BLAIR Modern Piano Instruction Telephone 6357 So. Kedzie Avenue GRovehiII 6-9655 Chicago 29, Illinois GROCERLAND 3115 West 63rd REIiance 5-5646 We Deliver BOB SMITH, Florist Floral Design - Wedding Specialist 6325 So. Central Ave. Chicago 38, III. P6 COMPLIMENTS 0111614120 SA VIZVUA' AND Q MAN ASYOUl4ll0!V P6 S'I'EVE'S SPOT LITE FOOD MART Q . 6000 South Ashland Avenue e Lcctgo Chicago 36, Illinois PRospect 6-2971 cam? 6800 Stewart Avenue, Chicago 21 Typewriter Service - Rentals, Repairs and Sales ANDCO OFFICE EQUIPMENT CO. EXTENDS SALES AND SERVICE GREETINGS AND BEST To 1515 West 63rd Street WAIbroolc 5-3546 LINDBLOM SENIORS J. W. Cudzik Chicago 36, Illinois We invite you to continue your education with us, Low Rates - Day Night and Sunday Tm 9 P M as so many Lindblom graduates have already 90 D G ' T P d S , ' ' done with great success. The Chicago Teachers ay uqmn ee on offs on ervlce College is a fully accredited, publicly supported HOMERIS TELEVISION school giving training for immediate employment SERVICE AND SALES in a fine and respected profession. 7 Years Factory and Field Trained Specialist Antenna Installation PRospect 6-9320 f. ,-, Page 179 N N Everyone Wants To Start At The TOP- AND YOU CAN By Working At Spiegels! For years and years high school graduates from all over have found SPIEGELS the place to go for iobs with opportunity galore and good pay. They've gone to work in all kinds of iobs and found success the Spiegel way. Spiegel Promotes From Within You win promotions as you earn them at Spiegels . . . and our own Spiegelites get first crack at top openings. Who could ask for anything more? PAID VACATIONS BUY AT A DISCOUNT ' EAT IN THE NON-PROFIT CAFETERIA ENJOY INSURANCE PROTECTION Come In Today And Talk To Our Job Counselors No matter what your majors - or your maior interests - there's a job for you at Spiegels. Maybe it's typing . . . office work at a desk with no typing . . . order filling . . . wrapping packages . . . doing figure work on customer accounts . . . pulling index cards . . . run- a comptometer . . . or stocking the merchandise bins. . . A Good Place To Work Page180 LESHYN FLORIST Flower Arrangements of Quality 5454 South Kedzie Avenue l00MIS Savings and Loan Association HEmIock 4-5455 - Flowers Telegraphed Anywhere YELLOW PARROT LUNCH Your Savings are Insured Up to 510,000.00 By the Federal Savings and Loan Insurance Corp. School Supplies and Light Lunches 1917WeS162nd CURRENT DIVIDEND RATE 3'Xw Assets over S5,000,000.00 1359 WEST 51st STREET Chicago 9, III. YArds 7-4763 - LAtayette 3-0423 BEST WISHES FOR CLASS OF 1953 A FRIEND SCHOOL SWEATERS . . . They are Tops in ' Color 0 Design ' Quality ENGLEWOOD KNITTING MILLS Established 1912 . 6643 S. Halsted St. WEntworth 6-5920-21 RICHARD'S CYCLE SHOP Sales and Service MOTOR SCOOTERS -:- MOTOR BIKES Distributors of Schwinn Built Bicycles HEmIock 4-3259 1408 west 63rd street chicago 36, ni. Open fill 9 PM Mon- and Thurs- :IK WOODROW WILSON JUNIOR COLLEGE BRANCH-THE CHICAGO CITY JUNIOR COLLEGE 6800 Stewart Avenue Chicago 21, Illinois ENROLL IN SOUTHTOWN'S MUNICIPAL JUNIOR COLLEGE! Fully Accredited Day and Evening Classes-Full or Part Time Programs Wide Choice of Courses-Tuition Free to Chicago Residents-Well-Trained Faculty-Excellent Facilities Accredited Eight Week Summer Session-Many Extrci-Curricular Activi- ties-Convenient Location-Collegiate Atmosphere For Further Information Address The Registrc1r's Office A COLLEGE EDUCATION IS AN INVESTMENT IN YOUR FUTURE AND THE FUTURE OF AMERICA SAFEGUARD YOUR FUTURE BY ENROLLING IN WILSON JUNIOR COLLEGE 56:53 4 s as as 45 Page 181 ii FAVIIR, Rum at cn., mc. of .lZw!M,m IQ 3 Drafting and Architectural Supplies Sculptors and Modeling Materials School Supplies and Airbrushes Sign Painters and Silk Screen Supplies Picture Framing 425 S. WABASH AVE., CHICAGO 5 HA 7-I339 KENDRIC CLEANERS FURRIER P6 Main Plant 6350-52-54 South Kedzie Avenue okovehall 6-6206 3 634 East 79th Street Vlncennes 6-2021 3IOI West 63rd Street REpublic 7-4922 5 Hour Service For Quality Service Harry F. Yates.. . Mrs Mrs Mrs. Mrs Mrs Mrs Mrs X- . . . .Honorary President James W. Ryan. . ......... President Claude T. Watson. . .... Ist Vice President Louis J. Hartmann ...... 2nd Vice President Ray L. Martens. . .... 3rd Vice President E. J. Frombach ....... Recording Secretary Fred C. Young .... Corresponding Secretary Arthur G. Lundin .............. Treasurer l-4-o-:-- JONES Located at IO7 W. Van Buren Offering the finest training positions to Chicago's young folks to get them started in the career of their choice. You may select your position from among the scores of office, technical and industrial listings. For further information and for appointment- Phone: WEbster 9-2425 YOUNG MEN ASK FOR BILL HARDIN YOUNG LADIES ASK FOR MISS KAY L-4-4-cl Page 182 PG , , Q Q39 lui J Q,QI ,, ,, ,, ?Q2' 4545 South Western Boulevard Your Neighbor Congratulates the Graduates and invites them to visit our plants when looking tor Jobs With A Future. ::: Come and see what former graduates have accomplished. If! X 'Qt :j:f F-'X fx X fe Page 183 U :M ongrafufafionfi jo UAE Qiwlmfw of 1953 If you plan to seek immediate employment after graduation we recommend that you see us for an interview. 13: if Hotpoint is a Division of the General Electric Company and is a :J leading manufacturer of maior electric appliances. We have a variety of shop and office work available for young j- men and women. Our rates of pay, benefit plans, sports programs, social functions, and promotion plan are rated tops in industry. HCTPCINT Co. 5600 West Taylor Street Assets Over S7,000,000.00 CURRENT DIVIDEND RATE 3'Ka no,4, 'I-9 ff WM THE FUTURE BELONGS I: ,g5gfgg,eg,, TO THE YOUNGSTERS jg 'f'r,,,rsY IN FDS wi-To SAVE TODAY Z vi If SUPREME Savings and Loan Association IG. SCIGALSKI, President PETER P. KEZON, Secy.-Treas. fClass of 'l92U 211 Phone YArclS 7-3895 T751 WEST 47th STREET Zi? T L22 i Page 184 WESTINGHUUSE ELECTRIC CIIRPURATIUN NEEDS YOUNG MEN TO TRAIN FOR THE FUTURE AS ri: Motor Winders and Repairmen, Sheetmetal Fabricators and Welders, ri: Switchboard Assemblers and Wiremen, Testers and Inspectors. Enioy Top Wages, Steady Employment, Excellent Working Conditions, 121 Paid Vacations and Holidays, Hospital and Group Insurance, Pension 15: Plan, and Cafeteria. For an Interview call LAfayette 3-5520 - Ext. 205 or 208 or Apply in Person at 3900 West 4I st Street. Featuring Fine Fashions for Men ...Women . .. Teeners . . . Girls . . . Boys NORTH-3400 DIVERSEY SOUTH-6638 S. HALSTED ::: Page 185 Z? PF SINCLAIR REFINING COMPANY 2540 W. Cermak Road it Bishop 7-6000 A GOOD PLACE TO WORK Office Positions Available P6 E SAVI I LIIAN MORTGAGE LOANS ON HOMES AND SMALL APARTMENTS . . ' 900 WEST 63rd STREET 0 CHICAGO 21, ILLINOIS ' Your Savings Now Earn 2Mv'Ma Per Year JUNE GRADUATES - - - 33 Learn how you can earn 33,000 a year or more in your tirst position through training at BIWGHEQSIIHEIOH C 0 l l E G IE Complete Business Training SHORTHAND fBeginning or Reviewl MACHINE SHORTHAND qsrenofypyy IBM Electric TYPEWRITING, TYPEWRITING, COMPTOMETRY, BOOKKEEPING ADULT BRUSH-UP CLASSES Too many high school graduates have taken jobs without any future. Trained students are in con- stant demand and are preferred for advancement. Phone, Write or Call for Booklet E BRYANT 81 STRATTON COLLEGE 5: I8 S. Michigan Avenue RAndoIph 6-1575 :iz THE GENERAL ELECTRIC COMPANY SMALL APPLIANCE ff SERVICE CENTER Extends CONGRATULATIONS TO THE 52: CLASS OF T953 Vzf: We have opportunities for positions for men in our small appliance repair depart- ment and for men and women as typists. A GOOD PLACE TO WORK 847 South Clinton WAbash 2-5611 - is as aa 5 -9 XI if 1.-as ' We Join the oung women at orthern Trust! it X' Y Y If 5 .43 A Ni 4 Youtll meet and make a whole new world of friends with a job at this great Chicago bank. v . The welcome mat is out for Lindblom girl graduates and we know you'1l enjoy your work. Your job will have a future and you'll be associating TYPIST with men and women on their way up! Choose the job you like! STENOGRAPHIC TRAINEE Find out about all these extra advantages your job I. B. M. KEY PUNCH TRAINEE at Northern Trust provides : Paid vacations - Northern 1, B, M, PROOF TRAINEE Lights Girls Sorority - Private Cafeteria serving meals below , , , , cost.-.Spacious Lounges - Northern Trust Mixed Chorus - DICTAPHONE TRAINEE Life Insurance o Hospital Insurance o Bowling and Bridge BOOKKEEPING MACHINE TRAINEE Clubs - Eight Pald Holidays - Pension Let Mr. Alvir, your faculty counselor, show you our booklet, It's the People You Meet That Count. It tells why there's a difference in a job with The Northern Trust. Better yet, stop in and see us yourself. Come to: 10 South LaSalle St. Room 410 THE NORTHERN T R ST COMPANY INTERVIEWS 9 to 5 DAILY Ask for Mrs. Albertsen 2 as as 5 as as as as as - is aegis as f Page 187 SAVE at PROSPECT Your savings here are insured up to 510,000.00 by the Federal Savings cmd Loan Insurance Corporation and addi- tionally protected by large reserves. Dividends as high as MM: per annum. PF PROSPECT FEDERAL SAVINGS AND LOAN ASSOCIATION or CHICAGO T707 W. 47th St. near Paulina St. FRANCIS F. LUKAS, Secretary-Manager BUSINESS CAREERS Since 1904 young men and women have increased their earning capacity through MacCormac Business Training. COURSES Accounting Typewriting Shorthand Comptometry fGregg or Pitmanj Dictaphone Business English Bus. Administration Prepare for a High Paying Job Write for FREE Brochure MacCORMAC SCHOOL OF COMMERCE H70 E. 63rd St. Phone BU 8-6363 CONGRATULATIONS GRADUATES! SUBSCRIBE TO THE Before Deciding on a Job LINDBLONL WEEKLY See Us For All The Latest GI 0 Sports PRUDENTIIIES 0 Gossip ' Interviews NEW Recd It AH In The Weekly CHICAGO INSURANCE OFFICE 'I65 N. Canal Street is 'id Page 188 NJWMWM ,awww A A Cappella Choir ........ Administrative Assistants Advertisements .......... Architects' Club ........ Art League ........... Assistant Principal ...... B Badminton .... ..... Baseball .... . . . Basketball ...... Bowling ........... Boys Swimming . . . . . . C Cafeteria Staff ..... ..... Calendar Section . . . . . . Cheerleaders ...... Comptometry ..... Concert Band ........ Concert Orchestra ....... D Dance Committee ....... Departments ....... . . . Art ........... Commercial .... English ........ History .......... Household Arts . . . Language ...... Library ....... Mathematics . . . Music ........ Science .......... Social Studies ...... Technical ........... District Superintendent . . . Division Page lActivitiesD . Division Page lAth1eticsD . Division Page CGraduationD Division Page lClasses1 .. E Eagle Ad Club .... ..... Eagle Salesmen .... A . . . Eagle Staff ........ F Faculty m. . LL. .Jn ng. Fencing ........ Fire Marshals . . . Football .......... French Club ....... Freshmen Divisions . . . G G.A.A. Board ...... . . . Girls' Chorus ...... Girls' Swimming .... Golf .............. Gym Leaders . . . Gymnastics . . . Index 54-55 10 156-189 80 81 9 111 101 96-97 104-105 100 89 150-154 106 82-83 56-57 60 67 16-29 27 29 19 25 20-21 24 18 22 26 23 28 16-17 9 52-53 90-91 120-121 6-7 67 66 62-63 10:15.51 112 86 92-95 77 30-34 107 58-59 110 102 109 98-99 H Hall Guards .... ....... Honor Society . . . . . . I lnter-Cabinet Council ....... I lanuary Graduates ......... lune Graduates ...... . . . lunior Divisions . . . . . . L Lark ..... . .... ...... . Latin Clubs . . . . . . L.D. Club ....... Library Club .... . . . M Mail Service .... ....... O Otlice Staff ........ ....... Opening Section .... . . . P Ping Pong ........ ....... Projection Club .... . . . R R.O.T.C. ....................... . . Rupprecht, Paul Cln Memoriam? S Senior Boys' Council ....... Senior Divisions .......... Senior Girls Council . .. Skating Club ......... Sophomore Divisions .... Spanish Clubs ......... Stage Crew ......... Student Guild . . . Sub Debs ..... T Team Games . . . . . . Tennis -1 . . . . . . Trophy Case .... . . . U Ushers... W Weekly Salesmen . . . . . . Weekly Start ...... . . . 1 Y Yates, Harry F. 87 72-74 79 122-129 130-147 42-47 148-149 76-77 108 85 70-71 10 1-5 111 84 Radio Guild .................. . . 83 . 114-118 51 78 48-50 68-69 103 35-41 75 61 84 88 112-113 - - -1-02 119 89 66 64-65 8