Kankakee High School - Kankakeean Yearbook (Kankakee, IL)
- Class of 1930
Page 1 of 166
Cover
Pages 6 - 7
Pages 10 - 11
Pages 14 - 15
Pages 8 - 9
Pages 12 - 13
Pages 16 - 17
Text from Pages 1 - 166 of the 1930 volume:
“
X5 1 P- if , P! T H E MCMXXX A T11-3 :Hi-Q9 f .rv -.5-, 54? hm., 2 ., xx 4 ygygm, -15, 'N ' x :Fa 3'3 --9gs.,?f32??vi?1. 1' Y Q, ya iz? -1.- , . lx! A K A ., .M A34 NA . R.: wifi?-fm. 1 X X- Q--, W I fm F . W X iz 4- 5: 'f gf? T71 ,lx y,,Lf4'E ' ' V V Tp, 1 Qffi1'gYfQ ff - 11 jf- va if ,124 l rl 'lfffjz x W7 ' 'I FW if Q! 1 P a It S fff ' ,qifziff If N if X 5X1 M X?3, ',1 , xy rw J , bn, X ' ' xii ,N Q-wLiy.vv. k c--X 'X THE KANKAKEEAN 'Published by THE SENICR CLASS OF 1930 KANKAKEE HIGH SCHGOL KANKAKEE, ILLINOIS f X J ' M21 f X S-.iii K ' Q-f '3 f fxx 2 X! FL ,J V X W f ' - 9X ' - 5 -i G 4 ' WH' ,. Q T X 3 41kt :x x k y .X f Q X J Q 5 N bw- 3 N5 'X v V 4 X X X N Q Tl 1M QV X'?wxxw1 V V A-X L' W Q72 Q 'X if X A 8 'X'-125 , y lfibky X L '11 kv X JM f H X XX AX XYV ' I NV Q If ,, X X X I I 'lv' ,?n N' X Nrtxu x ' '41 ' E:. '5-wwf' X Z 4 - X. A xi, My JLQIB 'K wai M -A ,, Q + o k g, lf W XM I , , 5. UU X .1 W ix if , ,N Mm, XX Ml m y .1 ' if ET if N JRHEXL TP - , gig ig' X i '11, In 1 XX lf W fmfqf -fi , is, ' b ,af , ' . Vs f A Qx aww ' MII 1 Q 44 hir K HARRY L. TOPPING, 'President of dllumni dlssociati n.. X H ' go . by E. xi ixfyyfif 1 M, ld? , Jae iowa li JR fix ff? X iv A ,. ? Fl 2 h il if -4 JJ i - Mui - M77 J ! 1 f -h V h'i Q i w-lfsvgl-i'iil W X I J fu KJ' Ia, N. 1 1 f Y -ls -:L ?- Exif ' 'P W--kvxl--Q 'XX T0 THE MEMBERS ofthe ALUMNI ASSCCIATION EDM ZBECAUSE of their zeal and untiring eff forts to make our every venture a success, we the senior class of Kankakee high school dedicate the 1930 KANKAKEEAN. Q 9 W? i Yfkffff' J X t. X-Q t Xb- , X X it If iff l' Y lx 'lr W ll l X, 1 FQ' l f V i V1' l- Xi X A ' ,- 5' a il FOREWORD HE pleasant hours spent and the honors attained are forthwith set down in this book with a thought for the future when pleasant memories may be re- vived. In connection with these events we link the two thousandth anniversary of the birth of the Roman poet, Virgil. N M 3 -xx WX C-N ,V N, -!' !47 I ' 1 3 A 5 1 MX I 1 4 I up ff My W A N A W Xlfflff, U1 AA , T flfa 1M CCCCC 'wiv CONTENTS BOOK I ........ SCHOOL BOOK II ....... ACTIVITIES BOOK III ....... ATHLETICS BOOK IV . CALENDAR AND FEATURE BOOK V . . ..... ADVERTISING n ' If I 4 1' xmqy x KX xx! Nm N w itlm x f f X M1 1 j' x Q mx H FW I 4 ff aw W W HX b j is X Q-A ' W VN n f' xy I' NX 1 . J 01 lx, ff W 1 1 MMA' Af' xg vii ' X ' W W X XX n U'fwP Q X 4 wp 'L ' V Ef f' - gf f' Q4 ' I' I X X ,fr ,jl i l -r v + . w x . 4171- U K I X XNSJXNV 1, X: mf' X ? I A i ll 'ffm' V1 V -A X nu Q SQ lm v 1 WH ' P, L' ' . W H Lg x I is TR 1 I5 V E X :XY 4 f X . X NJ N xx !!'i'l1jM, 2 ff , I A MMF H filx ' ' I ' min , 'h A x SCHQQL Q3 +++ AS the Three Fates of old spent their time in deciding human destiny, so have we, the faculty, inherited that as our favorite indoor sport. Like them, we color, lengthen, and end your high school days-and are always xnterested in you. 531- M 1 W N ? E lk . 'X X 1- , :NW Rx f Q.. -' R ,X f Y 5' N I in xl r A X A.l: K g HW 'I X . S, X, FACULTY lf X Z! ff X N J M K max jy fill rp to L e-fpwff 344V ix:-' f-2-,bv W A. P. JOHNSON Superintendent lllinois State Normal University University of Chicago University of lllinois , A ,' K ,X 5 . v ,, . .,7-x...f7-,...7l11,,, FOl1!'lZ6E!1 ' , .,. , rj w' , ,X X, U J J! X 1 i N X. ai i R. Y. ALLISON i 1 Principal qi' , wabnh College, B. A. V University of Chicago, M. A. . xx I4 'QF :Ll--14' j.j ffX'.',fV ., i i Q 1.ixs:T l' 4 Xa? xg , li xi, A Fifteen V-4, Alf YLL. N! i-iixv MARY K. REEVES English Dean of Girls Inlliunn University, A. R. Cnlumliin. I'xiix'orsity fl .-11-Pii , , C, Fl I ,uf . n. I I-'J 'K,'c'1A sfK FOWLER MCKINLEYY- ' l Q Manual Training i University of Illinois, B. E. i I x f -1-.-ii I f Y OLIVE HUMPHREY I Glee Clubs f -lllll:'l'll'illl Conservzitory of Music li i ...- I J RUEL HALL Social Science X Coaching V ' Iinstern Illinois 'l State Te-:wlier's College B. E. I tl. ,I t --.- Iy Tw 4' , X? INEZ MORROW wil X X-,X Q-init ff- .WX French fgxill I In ii ringish i P-'fri iw-. A B Nl ' -' . Sf 'ii gi ,iii . ., ie1..af:.31 ' i It 1 i ff, TXXNQZ! F1 I ix iii! iii K . i if 'iffy 45 'ft ff M I -few. RUTH BEAUVAIS Typing Commercial Arithmetic Illinois Struts Normal University M-.li AVIS MOFFETT Latin English Monmouth College. A. B. University of Illinois MMOM1- MRS. H. DAPRON Art Mechanical Drawing Illinois State Normal Yniversity. B li. Art Institute 1-10.1-11 PAULINE CHANGNON Physical Education Yuiversity of Illinois. B. ..gi1 FRANK WELLER Chemistry General Science lll'nois State Normal University, B. 14 Seventeen L. FREYERMUTH Engllsh Iowa State University, A.B. l.1- MARIE BEARDSLEE' Latin Northwestern University. A. B. University of Illinois l. J ESSIE GREELY Secretary to Mr. Johnson Illinois State Normal V University Nntonnl Elementary College l. EDITH CARMODY Stenography Comme cial Law Illinois Stvte Normal University, B. E. 1--.11 EDWARD CURRY Mathematics Illinois State Normal University, B.E. SHIRLEY J EFFERS Ancient History Knox College, B. S. University of Wisconsin University of Chicago .l GEORGE SHIIVIER 'l is XM Physics General Science 3 l James Millikin University, I A,B. , University of Illinois I i Tiql l l l l coals SCOVILLE ' Librarian 1-1-. I CELESTA FRUIN Secretary to Mr. Allison Gallagher Business College i'T ENN Misty 1 ' y LOLA EMERY W . ag X 7 Ay f lx ' TYPIHK ,ef f Illinois State Nor X Y, Y I . x ff lTw lSi X31 W li Unive ity j 9 X il l l l lil tx Ki ll 4 f I l I v ll fl ...,.,,,-, , N WWA ,,,, ,.,,,, A fl -, AI...lI.s,,.e,.,e IIWWH . X . k I 7 FRIEDA WEHMHOFF English University of Wisconsin A. B. 1-.-.111 'N xl' BERLE JENKINS Bookkeeping , Commercial Law Illinois State Normal University, B. li, Northwestern University ff l2Jw'4' .1-1 I MARION WAGGONER English University of Illinois, A. B. l-Q Q-- X , J ENNIE WEBB Biology ' University of Illinois A. B. M :qi -+- All XL! M xl LYDIA MUSSMAN ffk tl- it - t rf-X, l ' U' f M-X Foods XML gfzk afeteria. A Graf., Qt! sP.tz1,,.1:., . ':,.:g.::?.. Htl J ti Illinois, I L f N fi lr! ,- MRS. C. E. JANNSEN Geometry University of VVisconsin, B. S. CMath. Group! -:1. KATHRYN LAMBERT United States History Modern History University of Illinois, B. S. 41-51- LOUDENE ANDERSON Journalism English University of Illinois, A. B. 1-1.- PEARL SCAGGS General Science University of Illinois, A. B. University of Wisconsin University of Kentucky University of Cliivngo - EUCLID LAMBERT Manual Training Hinckley Manual Training School J l . fav 'tl .fy E -gig: fix - ss- in Qifixfsss - K, Eighteen Nineteen HELEN ARNETT Science Algebra VVestern Illinois State Te-zic'her's College B.E. P- ,- JOE JOHNSON Band, Orchestra Commercial Geography ' Milton College. B.A, Southern Illinois Normal University . ELSIE FRIETAG Commercial Arithmetic Geography Whitewater College, Wisconsin, B. E. , CHARLES HARRISON Physical Education Coaching Illinois State Normal - University University of Illinois, B.S l. GRACE COULTER Home Economics University of Illinois, B. S. DOROTHY MCGINNIS Modern and Ancient History University of Illinoi , A. B. . , , I l HELEN WILKEN 1 Home Economics University of Illinois. B. S. l i Columbia University l i 1 l 1 l -. M tk 1 PAULINE TULL K L rmgusn I rubnc Speaking ill Hanover College, A.B. ' Indiana University, M. A. University of Iowa 0 1,1 if GWENDOLEN INGLI l Geometry KN l River Falls Normal l University of Wisconsin, A.B. il' University of Chicago l N WJ N 'M K 'y ti, .vi wlyxtfli K f' ' ' Wi , wx I Xl' fi. I. Miz M. MONTGOMERY,k7f' 'f VU ' , , I, C Algebra 'NX Illi Zgs Knox c0i16iX, R , .ff r' ' 1 X University of Illi , , iS. Vfff 1 g - MM X l ' ' ...XW4 dnl, Q l ff' ' X W , in lili Q l ls lu W if .li 4 ,904 l Zi 1, wil , v ...Z ,. 1 ,h . '- 0 -' -- ' ' if 9. Y f F' f , HX' , 5 i r' 6 35' Q X X S' 'i Y' r W 5 Z1 t A Q, 5 W 3 i . ' 'fur Q, 1 , iw? -vi K' W V f9f PA f 'N. 4692- - 'a5f3aQWif., ' zfiisfw ' W fa- , V - rf. 4, RLKSQ - 3' xx A 'X' K ,W .wg L, -J .L+ ... :tx .Lf, A - - T Q 'n,'9 ck- ,f D -'H LVL. ' 'V' 1,1 s -Xa 'Y . '12 W Nl -, 'lnfqxk :ini will sms le AS the Father Tiber goes on year after year on its stately course, now sluggslh, now turbulent. embracing all lands and Tribes, so the senior class runs year after year and welcomes the sticks, stones and moss of the other classes. With these materials of nature, the Father Tiber builds its foundation so that it may continue always to carry the glory of Rome on high, while similar impedi- menta furnish material for the Senior class to carry on the glory of Kankakee high school. Twenty one sf W XX1-A ,af-T' -- K J rj , -s e- as ,Es fi S-mg ,j W1 . nate ' WI swf- ?1T s Y 4 , as-if X N --fl-C' ' f - Q ..- A lg-V X5 f SENIOR CLASS fl x gl W, X X 1 S N 2 ' l , 4 Sly n X yt Oy .1 if ' fin-'elm M W 4yX1 Fl MJL flkx efjffxtyf k X iw? it l f N 153 'P SEIQOR CLASS CHANGNON BOLI.. MURRAY OFFICERS President ............. ................... ........... F r eclerick Boll Vice-President ...... ........ L loyd Changnon Secretary-Treasurer . ....... Burdell Murray 1-11.1-1 SPONSORS Miss Louclene Anderson Miss Marion Waggener Mr. Frank Weller Tweflty- two ,f , I . J! GLEN W. ABNEY Toll conquers all things -Virgil General Course Football' 1. 2. 3, 43 Track 1, 3. . R. J. ANDERSON I amuse myself. -Horace General Course liilllkil-K9j'll1lf9 33 Commervinl Club Il, 4. tiki LYLE ASHER Polished with due care. -Horace Commerm-inl Course Commercial Club ll, 4. -1., T. J. BEREOLOS A sound mind in a. sound body. -Juvenal College Prep Course l'rotbnll 2, Il, 4: Basketball 1. 2. 3. 4, Truck 4. lioli JOSEPH A. BIRES A man wlib can say he has lived happy. -I-Iorace College Prep Course Football Mgr. 3. 4. If GLADYS ALLAIN All Rome has proclaimed you happy. -Horace Commercial Course Music' Club 23 Hi-Y 2. 3, V' ' 4. 55 Commercial Club 4, o. I I I I .i. W. f I, ,II DALE ASHER . ,I I I For what he mst appears - he still must be. -Horace I I Commercial Course E Rifle Club 23 Commercial I Club Il, 4. I. X I 101 I1 . I :I I BESSIE A. BENN ,I I reject lucfous wafers. J -Horace I General Course I Entered from Cabery If high school, 1929 I .i.n I I ELWOOD J. BERNS' 'These things I resolve in I silence! '-Horace .I General Course HI, I ' Vx SSSXTIN. '-'l .. N1 I I iff I IJ .1 I Y K. F. BLACKWELQQA 'XXB ,.f f ' ' V 'impassioned let My I . ' I -'ll L Gfl X --Horscef X , If ,VMI a' lf .1 v, - A , I College Prep xlib! 5' I G. A. A. 2. ll. 45 lee uh ' IX Ill' 'i, Vice-Pres. 43 LY 2, Q, I. , . F, 45 Prep Club Zgxhlg ffl, I I NI Club 3, Pres. 4. If! 4 7 I M ' . III I I -XX J wkll I Twenty three H . -' ' 5,,.fX-,eff -PS 7 ,X 4? Mig LOIS E. BLATT All the best things are x'a.re.' '-Cicero General Course G. A. A. 2, 35 Glee Clul' l, 2. 3, Hi-Y 1, 2, 3, -1: Science Club 4, Commercial T Club 3. 4. .-it-.. 1 l M. G. BOULE Nothing is pleasant with- out love and mirth. -Horace Commercial Course i G. A. A. 2, 3, 4, HifY 1 2. 3. 43 French Club 2, 3, 4: Commercial Club 3, 4. I E 1 io- I I H, C. BUHRMESTER Seldom bothers common vlctuals.' '-Horace General Course R 11.-l HAZEL E. BUTZ l To join the parts and numbers, or divide. -Vida. College Prop Course I Band 4, 53 Orvhestra. F : Glee Club 5, Hi-Y 2, 3, -lg Frenvh Club 4. 55 Science ' Club 4. . kj at 4. it 1 'rremu'-'W''r 'r'rr-or yu -,C ......,..T fx L V ' xy X., 1 A, - , Cpqrus s. cAsP1-:R ' f t 1 -Q g 'XKf-Qhfwellibe n is half done.' 1, L1 ' f orace 13. KX -X ' ltfllil,-1 3 X Course fffl Fwnml 2, 3, 4, 13, 5, my-fx Hi-Y , 3, 4. lf-,rip-S XXX . -5 1,1 f f l V, l : l- X ' ft FREDERICK R. BOLL I came, I saw, I con- quered! '-Caesar College Prep Course Class Sery-Treas. 33 Class Pres. 43 Football 3, 43 Basketball 2, 3, Capt. 42 Hi-Y 3. Trezis. 4: Latin Club 4. o R. N. BRICKETT He loves and courts the n raptures. -Vida. College Prep Course Entered from Clifton high school, 1929 Svience Club 41 Commercial Club 4. 1 HAROLD BUNTE Better to be than to seem! '-Sallust General Course . DOLLY M. CALABRIA Often commended . . . for being modest. -Horace Commercial Course Knnknkeean 4, Commercial Club 3. Vice-Pres. and Pres. 4. -O LLOYD E. CHANGNON Fidelity is the sister of justicef '-Horace College Prep Course Entered from St. Anne high school, 1927 Class Vice Pres. 45 Foot ball Cl, 4g Basketball 2, fi. 4, Capt. 3, Hi Y 3. Pres, L Twenty fou LUC ILLE N. CLIFTON Into the midst of things. -Horace College Prep Course Quill and Scroll 4: G. A. A. 2, 3, 4: K-inkakeean -1: Kankn-Keynote 4: Or' chestra 1, 2: Glee Club 2, 3. 4: Music Club 1: Hi-Y 1, 2, 3. 4: French Club 3, 4: Prep Club 1: Dra- matic Ciub 2. 3. 4. .lQ DONALD E. COOPER- Let a man rejoice. -Horace College Prep Course Glee Club 3: Rifle Club 2. .- C. M. CRAWFORD I seem too severe. -Horace General Course Football 3. 4: Basketball 4: Track 3. 4: Hi-Y 4: French Club 3, 4. - J. WESLEY CROXEN HTIIBYB IB HOU E IIIOIIIBIIU without some duty. 1clCel'0 Colleee Prep Course Class Slec.-Treas. 1, 2: Basketball 2, 3: Track 2, 3: Kankukeean 3. 4: Band 3, 4: Orchestra 1, 2. Il, Glee Club 1, 2: Music Club 2: Hi-Y 1, 2, 3, 4: French Club 3: Prep Club 1, 2: Clarencel' 3. . M. M. DBLONG '1'inse1 trappings catch the eye. ' '-Horace Commercial Course G. A. A. 1, 2, 3: Hi-Y 1, 2: Commercial Club 3, 4: Ilrnmntie Club 1. 2. 4: Clarence 3. Twenty tive M. R. COLEMAN They can because they think they can. -Virgil Grncrnl Course Kanknkm-ean 4: Kanka-Key- mite 4: Hi-X 1. 2, 3. 4: Prep Cub 1: Science Club 4: Rifle Club 3: Commerc- 1 r ial Club 4: Dramatic l Club 3, 4. I I MQM VIRGINIA E. CRAFT ', N ' 1 I try to make my friend- l , ships eternal. -Cicero l 1 Collfge Prep Course Quill and Scroll 4: G, A. l A. 2. 55. -1: Knnkakeean 4: KJlHkllKl'j'll0t6 3. 4: Glec Cub 1. 2. 15. 4: Music Club ' li IliY 1, 2. Vice-Pres. 1 Il. Pres. 4. Science Club , 4: llrzimatic Club 4: Clarence 3. : Q l M ' 1 l E. LESLIE CROXEN A man of sincerity. l , -Horace Q I l College Prep Course l Band 3, 4: Orchestra 1, ' 4: Glen Club 1: Music Club 13 Hi-Y Il. 4. Pres, 31 Rifle Club 2: Pres. 13: Kauka-Keynote 4. 1 l l MILDRED I. DAVIS l But words, once uttered. l never can return. -Horace , General Course Cumma-rcial Club 3. Q r N, 1 M. Yay N yy , .y,:u,x X ll. fill: HOWARD J. DeI..UDE,' AN ,KX Slow to do what he fl 1-lizcbg, , wish undone. -fHoraoe 1, lj: lx' I -. ' College Prep Cljlxiell N Il ll 'll' Fnmball zz. 4, T ck 2,l3. gl xml' 4: Knnka-Keynqte 4h.f Win:-f:,. : 'I' ' l, 7 1 , X : l l N l ll l ll, ,I l , 'l YQ: X, NN B. HOWARD DENTON Fool that I am, who though to verse inclined. -Horace College Prep Course Class Pres. 2, Football 41 Bwsketbull 1, 2, 3, 45 Track 2, 3, 43 Glee Club 2 3' Hi-Y 1 2 3 4 1 v 1 1 y - .-11. 1 REMIE DIONNE Take care you do not X 'i stumble. -Horace General Course X Entered from Martinton ' high school. 1929 ,X Commercial Club 4. iigl- XX Y . MYRON DOWNING ' What will be the con- ' sequence? '-Horace General Course Commercial Club 4, 5. x --.- l Y 7 DORIS H. DURRELL l In tears this moment and smiles the next. -Vida. College Prep Course G. A. A. 2, 33 Hi-Y 2, 3, 4. N .xx N it A Leg fy, 'N lirx F. M. EMHOUSER gl-'ff' lg -W XQ-V AAX?-ghey make their own 'X ,Jn ms. -Virgil .L QL A 41,1 .2 fi- X 20- lw X7 Kfbmm cial Course I ,lx V., . .rfb Ubi Q, we X nil, ran Q u ., g om- megifih I lulb 4 C unisex 14. ff NY 1, fl el, H. B. DEUSCHLE To te'l a. clownlsh from a courtly jest. -Vida General Course Basketball 3, 43 Band 3, 4, Orchestra 2. Pl RICHARD DIX Restore unto me the pow4 er of talking pleasantly. -Horace General Course Entered from Onarga high school, 1929 Band 4. 1-1.1-1 NODINE DRAZY Let but each style enjoy its proper place. -Horace General Course Kanka-Keynote 4: Com- mercial Club 3. 4. -Q--l K. C. EDWARDS Laughing with becoming ease! '-Horace College Prep Course Football 1. 3, 43 Basketball 2, il. 43 Track 1, 2, 3. 4: Kanka-Keynote 4: Hi-Y 1. 2, 8, 4, French Club 3, 43 Prep Club 1, 23 Science Club Pres. 4. fir i0- in rx JAMES M. ENNIS The peaceful swam. . -Horace General Course Kankakeean 43 Hi-Y 2. IL. Sec. 4, Commercial Club 3, Pres. 4. ff I l c if li l 'ii 4 V 7 'lu J- lglg XX A X - W2 rxx be W- ggyxx kk Mx! Twenty slx JOYCE N. FIELD Each shall appear with dignity and grace. -Ho.ace College Prep Course Quill und Scroll 3, -lg G. A. A. 25 Kenka-Keynote 135 Hi-Y 1, 2. o A. J. GERNENZ His llnes so daring, hls words so strong. -Horace Commercial Course Glee Club 2. 35 Debating' Club 25 Commercial Club 3, 4: Clarenre 3. ..nlv M. K. GOODWIN Live and flourish in per- ennial youth. -Horace College Prep Course G. A. A. 25 Latin Club -15 Clarence 3. .a MARION R. HALL Words will freely flow. -Horace College Prep Course G. A. A. 2, 35 Music Club 1, 25 Hi-Y 1, 2, 3, 45 French Club 3, 45 Com- mercial Club 45 Prep Club 2. - .-1 RICHARD V. HAWKER Much to reserve till apt occasion calls. --Horace College Prep Course Rifle Club 2. Twenty seven MARY J. FORD ' 'Smiles contagious creepf ' -Horace College Prep Course Class Vice-Pres, 35 Quill 'nd Scroll 45 G. A. A. 25 Kf-nknkeean 45 Kanka- Keynote 45 Science Club 3. 45 Commercial Club 4. 1-lOl A. E. GERRETSE I Alas for his piety. AX, -Virgil General Course X X . M. KENT Goonwm l 'impatient of delay. -Horace X Col'ege Prep Course Basketball 45 Kunkakeean J 45 Orcnestra 1, 2, 35 Glce I Club 35 French Club 45 ,f Commercial Club 45 Drama- X tic Club 4. 7 CARL H. HANDORF Take this, leave that, and X fltly t me it all. -Horace X Commercial Course ll Rifle Cub 25 Commercial li Club 3. ' ,l ' 'bv 4 .i ,K xl D. M. HOLTMAN L XIQ l Virtue ls the best prize. I iw, -Plautus 1 14 Cnllege Prep Coursqnfctf . H L Quill and Scroll 3,103 -' ,bf Treas 4 G A A SWK le Q ' kakeean 45 Kanka eynwllaj Tl lx 3. 4, mee Club 1 N .fl ,. ll Treas ll, 45 Hi-Y , f 3, ,Ni 4, sf-mme Club , V1 .- If V. lx All Pres. 45 Commercia lub .37 ' - 'gif lr J ff Ala? J? Afgf N'Lg-, SKI 1:3 4-S Ai 2313 rl.f' - - A. - Cy la LELAND R.. HUBERT Mark the world, explore its busy strife. -Horace General Course Entered from Clifton high school, 1929 -1.-11 ll IRENE E. HUSE 'Pull of perspective bliss. -Horace Commercial Course Glee Club 3, 4, Com' mercinl Club 8, 4. . JACK F. JERICHO The brisk young spark. 1 -Horace College Prep Course Quill and Scroll Il, 4: Football 3, Basketball 2, ' Kunku-Keynote 3, 43 Hi-Y 45 Prep Club 1, 23 Science Club 2, 3g Debating Club 2: Dramatic Club 1, 2, 3. 4, Art Club 49 Cheer Leader 1, 2, 3, 4. x ---g- CHARLES JORDAN ,' He will assume new ' schemes and hopes. -Horace College Prep Course Entered from Clifton high school, 1929 F.. X Y 1 VXH! . l ., Wife, .-,.. , x . LEONARD A. KLAFTA iwxlfl ii 'Nf'And nations bless 1:1196 l..,,x'g .vgxwieh a puslg: volce. fl? VEQSR. - A fb 'L QoQleL Prep Course ' L' 71 Q' ll' nd croll 43 Foot- iiwlw,l.ll blxigssgxi nsketbnll 1, .'fN'l'.m',l ll, 45.fm,mo 1. 2, 8. 4: ffl, unkpkeennf 41 Klinka' Q- of Xl 'xl nqte 43 Hi-Y 4, Science fffl XX him-2, 3, 4, Dramatic l , 'X lub 3, 4, Latin Club 4. 1 X i lf, ll l f yi , , Y' , 4 1 x ---M-Y ---'ff A-f ff'--1-'ff-'W-1f' H'-4 lo.. l L l1F lx? X nal- , ,,,,,.g..4z,,,-..,,i -- ,ti ,. il 1. -X 1. . . LUCILLE L. HUBERT Charming is the hazardu -Horace Commercial Course Entered from Martinton high school, 1929 .1-in T. M. JENNINGS Keep a man happy. -Horace General Course G. A. A. 2, 3, 4, Kanka- keean 4 3 Home Economics Club Treas. 2, Sec. 3, 43 Commercial Club 3, 43 Dramatic Club 2, 3. .- BEATRICE L. JORDAN A poem without words. -Horace Commercial Course Quill and Scroll 32 Vice- Pres. 43 G. A. A. 2, Kau- kukeean 45 Kanka-Keynote 3, HiAY 1, 25 Commercial Club 3, 4. 11--, WILLIAM J . KARR ' 'Make haste slowly. -Augustus College Prep Course Football 2, 3, 4, Track 2. .-.-1 CLARENCE A. KRAFT His pen shall words a ready host attend. -Horace College Prep Course Quill and Scroll 3, Pres. 4, Kankakeenn 43 Kanka- Keynote 3. 4, Science Club 8, Sec.-Treas. 4. Tw J- enty-eight, HAROLD KRUEGER In the middle course you wlll go safest. -Ovid Commercial Course Trnvk Il, Band 3. 43 Or- chestra 2, 3. 43 Com- me-rvinl Club 3, 4. -l.-M.. WILLIAM M. LANE A man of merit. -I-Io-ace Commervinl Course Class Pres. Il: Football l. 41 Basket-ball 1, 2, 3, 45 Trax-k 1, 2. 3. 45 Kanka- Keynote 45 Hi-Y 1. 2. 3, 4g Glee Club 4. ..l M. E. LARSEN With friendly love her votarles let it guide. -Horace General Course Hi,Y 2, 3, 43 Commercial Club 3, 4: Art Club 4. 1-M-. LUCILLE LEZ OTTE Tardy to decide. -Horace General Course Home Economics Club 2. ...- LESLIE E. LUND Not every reader, it is true, has skl1. --Vida General Course Commercial Club 2, 3, 4. Twenty nine LORENE R. KUKUCK To thcmselves be true. --Horace College Prep Course G. A. A. 2: Hi-Y 1. 2. :L 43 French Cluh 3. 4: Prep Club l: Science Clnh 2, Zlg Commercial Club 4, 1M. I. MAXINE LANOUE fy i Simplicity, 9. virtue in our age most rare1 -Ovid College Prep Course ' G. A. A. 2. Il, Glee Club l. 2: Musif- Club l. 23 IIi'Y l, 2, Il. 45 French ' C'ub 43 Prep Club 2. 553 i Social Sl':Plll P Club fl: N Sr-in-nee Cluh 2. X M., l yu li l lk 1 R. P .LAVELLA H 'l He is us ful at home. l -Horace I General Course 1 'K qv-M JULIA F. LIBBY Energy wins the way. -Vlrg'1 i' Commervial Course Quill and Sr'ro'l 4: G, A. ,'. 22 K nk Keynote 4: l Home Economies Club 3. ' 4, Pres 2: Commercial Club 3. 4. 4 XX' if . exif' Y-Jiuxzjjgi WOODROW MATHY all ,A ffl f VK., Kilo Prompt to prnclzrm encfh 1 Q -xy movement of our mind. Viz.. 1 -Horaca .. V l 'VAX . V, V ilwvlqi T Commerf-ial,5Course, ' ,f' MMM k Entered from 'f :Y-n ihizh li ,K '-i ',f school, 929 41 UW! X ll -' w '4'lp', X-.4 iv, Ml 4 X ' ' l .l xl X ll .7 ll, ..,' .l - r i-'------- V --- in --.YN 7-Y .wer W Y. Q -5 e N X! X X vm-. -M I-C x, PNN OLIVE M. MATTOCKS It is better to suffer a wrong than to do one. --Cicero General Course Entered from Aroma Park high school, 1929 Hi-Y 2. ..l.1. 1 I X A MERLIN L. MERTEIS Alas, proud man! -Horace l College Prep Course Science Club 3, 4. iiyo-1-. X J. BURDELL MURRAY X ' Till by degrees each pol- ished labor shines. . -Horace , College Prep Course Class Vice-Pres. 2, Class v Sec.-Treus. 4, Quill and Scroll 4: G. A. A. 2, ii, 4: Kamkakeesiu 4 g Kanka- Keynote 4: Hi-Y 1, 3, 4: French Club Ci, 4: Seienv: Club 4, Dramatic Club 1. 2. 3, 4. x -o- THELMA NOENNING l .lf 'Trlendship cannot exist V cxcept between the good. X -C:cczo Commercial Course Commercial Club 3, Vice . Pres. 4. X k ll '- W .X I, l . ,W 4 -- -T ,xl .,-X .1 MCU 4 Lex ll 'N- ill- .ll I ' l -'s ARTHUR F. NORDEN . xy ,,.X g.fA, ' 'Q sing countenance is 1 gjw Ulf ' ben recommendation. , Jw K-- blius Syrus I' I, 323, ral Course ,4 ., Vi M I fl Q V I L7 . , 5 , l if lf -r i QI f'pl'l xl .Q vgbx Q5 4 .lr ROYAL MCNEIL As many men, so many minds! '-Terence General Course Football 2, Il. 4: Track 2. lvgi O. LEE MORRIS Give me your awful mys- terles to sing. -Horace General Course Glee Club 3. 43 Drumatie Club 1, Clarence -1.- JAMES W. NESMITI-I ' 'Who c'alms my tears must tlrst display his own.' '-Horace College Prep Course Basketball 4: Kanka-Kev note 3, 4: Hi-Y 1. 2, 3, 4g Science Club 4. -11,7-1 D. M. NORMANDIN nf lofty spirits, of affec- tions strong. -Horace C.xlEe,Lz,e Prep Course Quill und Sc-roll 4: G, fl. A. 2, Zig Kankakeean 4, Kankn'Ke-ynote 4: Glcu Cub 2. Il. 4: Music Club 2, Ii, Hi-Y Club Il: Dru- matiu Club 1. 2. Treas. fi, Pres. 4. ,ir-11 HAZEL C. OFFERMAN Do not speak of your happiness to 9. man. -Plutarch College Prep Course G. A. A. 2: Kunka-Keynote 4: Hi-Y 1, 2. Cl. 4: Prep Club 2: Commercial Club -4, Thirty-one LORENE E. PENDELL Nice care and shrewd adroitness is required. -Horace College Prep Course Quill und Scroll 43 Kanka- Keynote 43 Hi-Y Cl, 4: Prep Club 2: Commercial Club 4. -l.l.l WESLEY PRAULT Do not yield to misfor- tunes! '-Virgil General Course Entered from Clifton high school, 1929 Commervial Club 4. - MATHILDA PUCEK A friend in need is a friend indeed. -Ennius Commercial Course Glee Club 3. 4: Commercial Club 3, 4. ..1. M. A. RICHMOND Hap1y a cunn'ng woman. -Horace General Course Hi-Y 2. 7 F. J. RICHTER And charms the fancy while the the heart he mends.' '-Horace College Prep Course EDITH J. PIERCE A wonder lndeedl -Horace Commercial Course Quill and Scroll 3, 45 Kan- kukeean 43 Knnkn-Keynote 3. 43 Hi-Y 1, 2, 3. 42 Commervial Club 3, 4: Dramatic Club 2, 35 Music Club 2. io ETHAIJ 'im PRUET1' K UA dome of rank. xv V -Horace College Prep Course Quill and Scroll 3, 4, G A, A. 23 Knnkakeenn 41 Kaznkn-Keynote 3, 4, Hi-Y 1, 43 Sc-ienve Club 4: Commereial Club 3, 4. .lQ.- A. JOSEPH REGNIER Shrewd1y fit the manner: to the man. -Horace General Course Entered from Mnnteno high school, 1928 Glee Club Pres. 45 Hi-Y 4: Commercial Club 3, Sec.- Trens. 4. . B. C. RICHTER Nothing mortal will I s.ng. -Horace Commercial Course Commerriul Club 3, 4. . c. A. RUCKER X.. l ml He conquers v?1o,f'c6u7 75 j S qurrs himsel cef y Erubuus Sfius mf who Commercial i Football 4: Kan in-Ke ole ff! L4 4 1 ly 1 l l l E I ' x if , Xt-.,- ' H f ill l NZ fi We 5, E. W. SALTSIDER Every man requires adv.ce.' '-Plautus General Course Rifle Club 2: Commercial Club 3, 4. .-11-Q-111 ROBERT H. SCHLENZ Shfft'ng his views. riper manhood craves. -Horace College Prep Course Truck 33 Hi-Y 4. ii-.lv M. L. SCHULTZ Greet those who fear ti? swerve from duty's path. --Horace General Course Glee Club 2, 35 Music Clulu 1, Home Economics Club 2, HiAY 2. 3. 43 Com- mercial C'ub 3, 41 AN Club 4. .l-igl-1 HC WARD A. SHINE Mys'1f deserving of the l'onor.' '-Horace College Prep Course Kwik- Keynote 3. 4: Prep Cub 1. 2: Debating Club 33 Dramatic Club 4g Clarence 3. .-11.1-zu E. F. SHREFFLER i ' ii'-'lieng of arms and of a Xmanl '-V1rg'1 .X fi IX' .X eral Course , nl f 'll' ill A -Af 2, 3. 4: Band 43 I l il Ki ' fe lib 'T' fC'i 42 Hi-Y 1. 2, fl. l '45 Prep lub fly Commerc- u l X ' nk slq C .Lb 43 Dramatic Club Xi 5' ' 3. fm. N ' l P lv, l lb X ' .- H . .Q V ' L Pl X X 1 l..L, L .. .LLLL .,L.,,i,Y.3sLL...4S. .,,.l..Q,.Qg A C. L. SCHIERHOLZ What e'er is said, to say lt in due place. -Horace Commercial Course Football 1, 2, 3. Capt. 43 Basketball 1. 2g Track 2, 35 Kanka-Keynote 43 Hi-Y I, 2, 3. 43 Commercial Club 2, 3. ilk-11 WANDA M. SCHOSSER That I may have a good store of books. -Horace General Course Entered frnm Reddick high school, 1928 Home Economics Club 3, 41 Commercial Club 4. .-i--1 VERNE S. SHELLEY Make the most of today. -Horace College Prep Course Kanka-Keynote 3 3 Com- mercial Club 3. -0.-1 OLIVE E. SHOURD Explore with a watchful eye. -Vida General Course B'-skefball 1. 2, Ii, Track 35 Commercial Club ZH. l-1,11 ALICIA D. SKEET There is 5 proper measure in th.ngs. -Horace Col'ege Prep Course Entered from West Allis. VVis.. 1928 Band 43 Orchestra 3. 45 Glee Club 3. Thirty two RUTH SPIELBERGER You wish for the city, the shows. -Horace Gen eral Course G. A. A. 2. Il, 4: Knnlw- Keynote Zi: Musiv Club 1. 2, C43 Hi-Y l, 2, :lg S-'Q-mv il Club il: llebntiug Club '51 llrnmzific' Club il, 4. .:--1 FRED R. STITH, JR. B1ockheads, clear the way! '-Horace llnllvgrv Prep K'01ii'si' 0x'4'lu'str:i 2. Zi. 4: Musin- K' ub 1, 22. Il: Ili-Y 4: l l'vuvli Club ll, 43 Sm'ivm'-- l'.ub 4: lhwunutlc' Club l. 2, fl, 4. 11.-T-1 I. J. SUPRENANT He will sleep until day- light! '-Horace General Course Kzlnku-Keynote 4, 1i.1l MARY M. TUCKER To chant domestic themes? '-Horace Ccunuiervi:il Course G. A. A. 2: Hi-Y 33 Com- mercial Club 3, 4. 11.-1 E. C. VANDAGRIFT, JR. Pra.1s:d for jetty hair and sloelblack eyes. --Horace General Course Class Sec. 1: Football 2, 4: Bcsketball 33 Track 4, Glee Club 1, 45 Music Club 1. 2, Hi-Y 1, 2. 3, 4, 52 French Club 4, Prep Club 1. Thirty thx ee GLADYS STAFFORD Whether Trojan or Rum- llan shall make no differ- ence.' '-Virgil General Course G. A. A, 33 Music Club 1. 2, Il, Ili'Y 1, 2, Il, French Club 3, - ETHYL M. STRASMA I can live neither with you nor without you. -Martial Collelze Prep Course G. A. A. 2. Il, 41 Kanka- kof-nn 4: Glee Club el: Music Club l. 23 Hi-Y 1. Sec. 2. 3. 43 Prep Club 1. 2. Sl: Science Club 43 Driz- mutic Club 1, 2, 3, 4. lv-1-1 HEINZ A. TRAH Which, lf once lost, you labor long in vain. -Horace General Course Commercial Club 4. ly-, C. FRANCES TYRELL Must I run riot? --Horace f'omniervial Course Hi-Y 1, 2, 33 Commercial C ub 4, Ser.-Trezus, 51 Dramatic Club 1, 2, 3, 4. 5. 1. fr fl l f l ,XX 3 l J V l l ly w ll ll Tiff XX l .....-.T F , .. N A fy 3 ,fi LEONARD c. vo1G1'ffQl.,,,Z5,l7ll Nor does he run 111 ff'-11 -' ject oline! .Mes Nl Q or ILM. 'WI' X ill' . ' Commercia A Commerciagxfhm e QL xl , ' l AQ X .1 1, lv J l R f X I V . -1.2 l If x 1 ,ff ll 'lg N, 4 ng ini lx XX - ii oo wre '-'ro-or ve or f l K QNX ..- . -Y--....-..L7,...iM -,,. . Vg X ' c 'Z MM I Tk' l i J 1 i WK mfr l x DAVID WAGNER Give me a. thousand kisses! '-Catullus General Course Entered from Herscher high school. 1929 Basketball 4. - .T-1 EDNA M. WILKEN Laws are silent amid arms. ' '-Cicero Commercial Course U. A. A. 23 Kankukeean 43 Kanka-Keynote 43 Mus- ic Club 13 Home Econom- ics Club 1, 43 Hi-Y 1, 2, 33 French Club 2, 3, -1: Commercial Club Il, 43 Dramatic Club 4. -61.1 JACK C. WOLFE Take pleasure in remem- bering even this. -Virgil General Course Football 13 Track 43 HPV 23 Prep Club 1, 23 Com- mercial Club 3, 5. . ALAN YEATES Ripe for loose pranks and full of tipsy glee. -Horace Commercial Course Football 3, 43 Basketball 13 Track 33 Hi-Y 23 Com- mercial Club 3, 4. - Q11 3 V3 .l, .PX 4 3 , . 33, XFX 114 gl ,.., sk X Jil A giizsl MlQfff J W 'L I I2 U! M Ill-rl' 1 J if K- Aa P' x fd Ns X, jg '51, , L HIRAM WHITTEMORE Let each select some theme he can wield. -Horace General Cource Glee Club 1, 4, 53 Music Club 1, 2 .-1-101-1 LOWELL WILLIAMS Behold the school boy, frolicsome and gay. --Horace General Course Glee Club 2, 33 Hi-Y 43 Commercial Club 3, 4. . EARL E. WULFF Who does not understand the game. -Horace Commercial Course Football. Asst, Mgr. 43 Basketball 4. Asst. Mgr. 2, 33 Track, Mgr. 3, 43 Hi-Y 43 Commercial Club 4. 1-1,1-1 HERSCHEL ZIEGLE 'Tis ten to one I either laugh or doze. -Horace College Prep Course Football 2, 3, 4, Mgr. s. Basketball, Mgr. 43 Kankns Keynote 33 Glee Club 1, 23 Hi-Y 1, 2, 3, 4, 53 French Club 2, 3: Science Club 43 Rifle Club 23 The Patsy' ' 3. .-101.1 OTHAL F. ZIELKE The flames of Cupid all his breast inspire. -Vida Commercial Course Basketball 2, 3, 43 Hi-Y 3. 4. Thirty-four SENIOR CLASS WILL We, the class cf 1930, of the Kankakee High School, being of sound mind at time of this writing, do hereby make a last will and testimony in favor of our beloved friends and classmates of said high school. To the most dignified and gracious junior class, we do hereby bequeath our talents and ability to lead the social activities of the school. To the sophomore class, we do will and bequeath our ability in raising money for the junior-senior banquet. To the freshmen class, we leave the thought that they may some day be seniors like ourselves. To the faculty, last but not least, we do will and bequeath our accomplishments of , conversing fluently upon subjects we know nothing about. ,wi We, the following, do will and bequeath our personal property, abilities, and charac- 1 f teristics to members of the other three classes, as follows: 2 We, the Asher brothers, Dale and Lyle, do will and bequeath our height to Chester ,lg Stassen and Frank Allen. We, Glen Abney, David Wagner and James Nesmith do will and bequeath to Robert Evans and Len Small Jr., our quiet and studious ways in the Physics class. fx We, Lloyd Changnon and Dorothy Normandin do will and bequeath our interests in ,M Jane Topping and Louis Beckman, respectively, to Bruce McBroom and Betty Byron, f hoping they will take the best of care of them. l I, Mary Ford, do bequeath to Florence Voss my ba-shful giggle. We, Robert Brickett and Remie Dionne, do bequeath to Byron K. Coghlan Jr., our 1 alluring ways in getting the girls to ride home. I, Leorfard A. Klafta, do will and bequeath to Cecil W. Tanner my ability to get 1 X dates. We, Elwood Berns, Harry Buhrmester and Eugene Gerretse, do bequeath to Wanda J Osienglewski our bold and boisterous ways. 'I I, Clyde Schierholz, give to Bertram Sells my book on How to Argue with a Senior and Win. I, E. C. Vandagrift, do will and bequeath my Red Top to Donald Glardon, hoping he may get as much use out of it as I did in hauling his harem around. We, Ethyl Sfrasma, Doris Durell and Maxine Lanoue, do will and :bequeath our snap- shots of Decatur, Viator and Blue Island boys to Jaunita Owen, Jane Harrison and ' Violetta Menk. I, Frances Tyrrell, give to Elizabeth Godard my book on Love 'Em and Leave 'Emi' NX I, Lois Blatt, do bequeath my mirror, signs, including Bloom pennant, and gum on inside of my locker, to,Doreen White, hoping she gets as much use out of them as I did. lx b I, Herschel Ziegle, do bequeath my ability of getting in and out of trouble to Harold I A ney. We, Bessie Benn, Mildred Davis and Wanda Schosser, do bequeath to Kathryn Mann Q f K 4 Our versions on how to laugh without making any noise. 'BQPQJ We, Mildred Schultz, Margaret Larsen and Julia Libby, do will and bequeath our Ei, i 5 True Story Magazines to Eleanor St. Germain. 1 L We, Dolly Calabria, Mary Tucker and Lucille Lezotte do will and bequeath our short- U . si. hand pencils to Lilian Echt, so she will not bother her cassmates any longer. ff fgtftl' We, Olive Shourd, Clyde Crawford and Jack Jericho, do bequeath -to Maxine Bec , if f' ' helm our ability to talk on any subject at any time. fff , 9 f We, Joyce Field and Lorene Kukuck, do bequeath to Mr. Shlmer our Physlc ble A that he may use them for future reference. .Q ' fl U1 tl Stokes our special privilege of loitering in the halls We, Euphremia Shreffler and Lee Morris bestow upon Marjorie Sweeney and h 1- ,,ll,q1 ' l. ' ' K C x l PJ, All :.' W Thirty-live - -:ga 455, Fife--'ll gX:17,-:fi fs gh gg X N W' I, Nodine Drazy, do will and bequeath to Lucille Siefert my place as Miss Kankakee. I, Lorene Pendell, do will and bequeath my figure to Margaret Huckins. We, Harold Bunte and Richard Dix, do will and bequeath our height to Charles Head and John Dugan, that they may be 'seen by the teachers. We, Edith Pierce, Thelma Noennig and Lethal Pruett give to Doris Eckstrand and Edna Birr our favorite seats in bookkeeping class, room 313. I, Howard Shine, do bequeath to Ronald Gregoire my sub-concious mind. Fred Stith Jr., do will and bequeath my love for nature 'to Richard Ennis. do bequeath the dimple in my chin to Edward Johnson. do .bequeath to Lillian Robbins my lovely complexion. I, Hazel Oiferman, bestow upon Mary Longpre my ability to go hoop-a-doop, doop. I, Joe Regnier, do will and bequeath to Robert Minor the privilege of being Mr. Jenkins' chaperon. We, Howard De Lude and William Lane, :bequeath to Kenneth Carpenter and Richard Meyer our Journalistic ability. I, Lowell Williams, bequeath to Francis Micheals my ability to draw cuter silhouettes. We, Blossom Richter, Malthilda Pucek and Myrtle Richmond do will and bequeath l our serenc smiles to Doris Shidler. x I, Clarence Kraft, do bequeath my bag of Planters peanuts to Loren Davis. I, Gladys Staiiord, do bequeath to Mildred Kukuck my cosmetics. I, I, Frederick Boll, Lucille Hubert, I, X I, I, Doretta Holtman, give to Temple Rocca my glasses so she may have fthe studious ,V X ' appearance that I have. 3+ We, Millard Coleman and Myron Downing do will and bequeath om' hard earned credits to Edward Duffy. ' I I, William Karr, bestow upon Frederick Rueckert my willowy form. Af We, Kathryn Goodwin and Kent Goodwin, do will and bequeath our example of . brotherly and sisterly love to Nick and Mable Bereolos. X I. Cletus Casper, do bequeath my weekly -trips to Buckingham to Marion Richards. Y I, Howard Denton, do bequeath to John Moore, Jean Roche, that he may entertain both sisters. X We, Margaret Boule, Margaret De Long and Frances Emhouser, give to Dorothy Kammann the many rings we have accumulated during our high school career. 5 We, Kenneth Edwards, Harold Deuschle and Leslie Lund, do will and bequeath to I Howard Morris our interests in certain pepole. X We, Irene Huse and Olive Mattocks, do will and bequeath to Wilma Blake our 3 X dancing ability, that she may progress faster. I, Therese Jennings, do will and bequeath to Eleanor Born all interests in the home ll economics lab. and club. it We, Merlin Mertes, James Ennis, and Albert Gernenz, do will and bequeath our Q I Woman hating ways to Thomas Bohmker. XQEP7 I, Donald Cobper, do bequeath to Gretchen Brown my knowledge of understanding .J A clvics. I, Jack Wolfe, do will and bequeath to Bill Kurtz the title given to me by the girls, .r -,iffy og being the biggest pest in high school. We .x We, Clarence Rucker and Royal McNeil, do bequeath our friendly ways to Rivers f wn and Clarence Lane f-tax Xklazel Butz give to Irene Harris my wad of gum that she may always have some R xg Wk ucllle Clifton and Katie Blackwell do bequeath our interests in Momence ard N t t XABDQ to Lorraine Leavitt and Lois Craft V' fx Xlagdsa dA1 Capone r V, .X Y L Z' ,F , g ' y , .. Wgl slg jlkseazlffd and attested this day, May 26, 1930 A. D., before the supreme arbiter of all . 1 ' ---7 ' f ,f r l E If xv! I '4Hl1, we ri' as f, eefftfif . Kg, tl . . t X . Thirty-six CLASS PROPHECY By ANTONIUS After studying in Clarence Kraft's exclusive schcol of highway and byway journalism, I went into politics twenty years after my graduaiion. Tammy Hall lured me and soon I worked my way up to chief gazzipus. I entered a contest for the preservation of dried prunes and imagine my surprise when Robert Schlenz, the mailman, handed me a letter from the Richard Dix contest headquarters saying that I was the Winner and for my prize I was awarded a trip to Europe. Clicking my heels after the fashion of Jack Jericho, I packed my grips and made ready for the trip. I boarded the ship, Jewish, the Levy Nathan and sailed away from home and country to a new and st ange land, filled with strangers and dangers of which I knew nothing. I was walking along the deck, hanging onto the rail 'and occasionally looking over the side of the boat at the swiftly gliding waves when I chancezi to glance at a man at my side. Lo and behold! it was Raphael Anderson, salesman for the Durrell and Ennis Dishpan manufacturers. He told me that this was his first trip and that he was enjoying the water very much. We linked up in partnership and formed a new branch of the Socialist party. At dinner .that night, we sat in a dark corner of the dining room of the floating palace and listened to soft music from the orchestra of the Croxen brothers, Jazz Kings of Harlem iconsolidatedi. For supper we had lobster. We were surprised to see Clyde Crawford was om' waiter. We asked him who the captain was and he answered that the captain was Joe Regnier, the first mate was Theodore Bereolos and mismate was Robert Brickett. After the introductions, we lived like kings for the rest of the voyage. I parted company with Anderson in France, and having a yearning for some honest to goodness pre-war, went to Germany and had my fill of Pilsiner from the bar of Heinz Trah and Isadore Surprenant, Brewers. I then went to Rome to see what caused my four years of misery in high school. I saw all the old ruins and some really good looking girls. The Facisti were still in power, and as I had close connections with them, I was allowed all the privileges of the inner council. Mussolini III. QI learned afterwards! was Harold Kruger. My second day in Rome was most eventfull. There was an old fashioned augery going on and I attended. Tell me, tell me, Dago dirty, what became of the class of thirty? I asked. After I had crossed the hand of the augerer with silver, he unfolded, to my amazement, a list of the class and what they were doing. I see, he said, Dorothy Normandin standing behind a hot stove. She is disgusted with life and her marriage with Howard Denton. Loc-k, he is coming home, grimy with the grease of the Olive Shourd Garage. He is angry. He strikes her. There is a police- man, Eugene Gerretse. He is taking him away. The picture fades. In this next scene, I see a boisterous session in Congress. Senators Stith and Shine are in the midst of a heated argument for this and that. I see blows being struck. In the midst of the fray I am able to see Boll, Abney, Changnon, Casper and Edwards. It's all over. There's the bell and the fight is over. I now see a vaudeville. It's in a tank town and all the crowd is conspicuous by its absence. Margaret Boule, Margaret DeLong, Nodine Drazy, Marion Hall, Hazel Offerman, Lorene Pendell, Gladys Stafford and Frances Tyrrell are in the chorus of 'He's Mv Man! while Burdell Murray and Merlin Mertes are the feitured stars of the production. On the same bill, Irene Huse, Hazel Butz, Dale and Lyle Asher are in a juggling act. Doretta Holtman and Mary Ford have teamed up with Kent and Kathryn Goodwin and have taken the Duncan Sisters' place on the stage. Earl Wulff, Jack Wolfe and Alan Yeates, as The Magicians Three, are on the same bill. The 4-H club is now in session in Golconda, Illinois. Presiding over them is president Bessie Benn. I see Harry Burhmeister, Harold Bunte, Mildred Davis, Remie Dionne, Richard Hawker, Woodrow Mathy, Everett Saltsider and Leonard Voigt all members attending X fr fx fl 1 X aj ,R is XXX f . r, if u P v . - , , ff -f -ti 1 The 'Did-I1Ever-Tell-You-About-Mine?' club is also in session with bla Y XX 4 bib Allain leading the discussion. In the same hotel, the typist Union, XYZ is co fr X tl K a speed test. Dolly Calabria, Theresa Jennings, Beatrice Jordan, Thelma n ffl X 1 - I 1 f ,, x I Edith Pierce Lethal Pruett Mary Tucker and Edna Wi'ken are burning up th six typewriter in an attempt to wrest the title of 129 words a minute from the if champions, Millard Coleman and Verne Shelley. 1 5., fl ml, , lil LW la 1 Thirty seven - jj gggg g ,fiillf time-ir A f rj SN I-I gf? .Db X 1 li! ,K Y 'r l XXX ll X 'VJ 5 4 fx ,K M ,Gu A W W! X S-.x qt- Mit There is an indistinct image of a church-ah-I see it clearly now-Othal Zielke and Emory Vandagrift, preachers, are marrying couples in relays. There are several couples already in knots, among them, Lee Morris and Euphremia Shreffler, Hiram Whittemore and Maxine Lanoue, Joseph Bires and Lois Blatt, and Carl Handorf and Frances Emhouser. I now see an entirely new scene. It is a circus. In the main arena, surrounded by roaring lions, Katie Blackwell grins at death. In a side show which is announced as 'Ten cents, for the greatest show on earth' Leonard Klafta entices the crowds 'to see the wonders, William Karr and 'Herschel Ziegle, alive and living. In the next booth are the 'Siamese' twins, Margaret Larsen and Mildred Schultz. At the far end of the tent, for ten cents more you can see 'Uncle Tom's Cabin' as it's never been played before: Uncle Tom, Clyde Schierholzg Eva, Ethyl Strasmag Simon Legree, Lowell Williams, and the chorus of Julia Libby, Lucille Lezotte, Raymond Lavella, Arthur Norden, Alicia Skeet and Lorene Kukuck. Far away in distant Siberia, I see the caravan of Royal McNeil, Charles Jordan and Clarence Ruckert mushing away in the deep snow in search of the missing link. Harold Deuschle, Myron Downing and Albert Gernenz, now Royal Mounted Police, are close on their trail. Now I see Florida and swaying palms. Some of the noveau rich who are trying to swim are Ruth Spielberger, Donald Cooper, Wesley Prault and Wanda Schosser. The hotel proprietor, David Wagner, smokes a big black cigar as he watches the festivity. New York now unfolds itself. Here in the Woolworth Building, Bill Lane and Leslie Lund are washing windows as they listen to the singing of Virginia Craft and Elwood Berns practicing in the rooms of their teachers, the Huberts, Leland and Lucille. The Richters, Blossom and Fred, are designing a dress for Myrtle Richmond while Olive Mattocks and Matilda Pucek offer suggestions. In Kankakee, Howard DeLude is interviewing the high school coach, Lucille Clifton, for the Joyce Field Times. For more silver, I will tell you what became of the faculty, the augerer said. Say, I replied, they aren'-t worth it. By the way, your voice is familiar, who are you? James Nesmithj' the seer replied, pocketing the coins and seeking more customers for his augeries. 'Q f l ,fife- Lf! if .5 pf' -ii-51 fgfix fe 'xx ,SQ s emi Thlrty eight Eg3:,gaj,v:,:1wf.-'vf,.rf1:-M' -pw ' - o ':'7'vS 1 f.jH:1'!? xw , li 'mf' 'if'-X ' Q -' 15, wo wx --' 3'WcIa'F'pgv1fy?g,1f'VgQrfg yy' fn 1' ' h - - - , mi . f-:ak fff ,X 'Mig M .- h L Q , X xg 4 -J' f' xx :xx fx I Iulu A Cnc'-. . , Q K N? K , Li 1-Jill. 1. ? pf- Y' V . 'T A 3 , lx ff 1 ' , ' -.37-'I-I 4 i-W W ? f,f'kA:l'.E, ' U 'I f h N - .. 1 ' 7 h XX X JUNIOR CLASS Y K , . f ff X X X. N K JUST as Horatius MXYX stood on the bridge over the flowing Tiber 5 and fought back the f enemy for the glory of Rome, so do we, the .': juniors, stand as pro- -' , , tectors to the honor of X 'X A our high school. , 1,,' P ' Mu , xiii X fc M. if 4. 'v A .-,gy 49 S:' -n' Q-f,-fbi Z I VN I'i I kv . I I I I I I I Top Row: G. Kemp, M. Sterling, F. Reuckert, R. Evans, O. Berns. Second Row: F. Michaels, R. Burger, E. Johnson, A. Wickiser, B. Soiio, B. Wright, I I Z. Palmer, M. Madison. ,I Third Row: C. Stokes, R. Ennis, E. LaRoche, F. Voss, L. Kamman, E. Godard, V. Mansneld, L. Echt, K. Maisonneuve, A. Edwards, C. Stretzl, M. Nance, C. Weaver, M. Betourne. ' Fourth Row: A. Reeves, J. Speilberger, W. Kurtz, C. Rieken, M. Kukuck, M. Stevens, V. Fredericks, O. Upson, M. Skeen, E. Birr, R. Minor. Fifth Row: S. Schwahn, G. Weeks, E. Teifke, S. Stith, J. Harrison, J. Owen, L. Robbins, X E. Eckstrand, A. Hauser, C. Jonas. N JUNIOR OFFICERS President ........................ Chesley Robertson N Vice-President ....... ........... G retchen Brown X' Secretary-Treasurer ........ Eleanor St. Germain I Brown Robertson St. Germain .1 . lu., I, I J Ii fir' I A I A X, I. L1 - ,I f M' x X .f44 .,.,..4..,.,-, :O :...,J.s...Ag.....--...,I--.4,-4,, I Forty-one U i I I I I' I i N4 1 . l I 1 l . '1wl g Top Row: P. Fowler, L. Beckman, B. McBroom. l Second Row: E. Duffy, W. Fiericks, P. Engel, P. Stevens, N. Brink, K. Bennett, ' l N. Menard, J. Marnell, J. Moore, W. Chittum, M. Devine, M. Shapiro, 'E P. Schriner, D. Glardon. W Third Row: R. LaGesse, N. Bereolos, F. Foler. R. Storbeck, G. Brown, L. Failey, W. Blake, D. Poyer, R. Cornwell. 5 j Fourth Row: W. Croxen. C. Robertson, B. Sells. C. Volkman, D. Ramien, A. Neve. l , E. Seeborg, R. Harper, R. Cook, T. Hedlin, M. Malone. , Fifth Row: C. Mann, K. Carpenter, V. Revnolds. M. Betourne. D. White, H. Kraft, I. Mueller, B. LaRoche, M. Rutherford, M. Lutes, R. Ziegle. JUNIOR SPONSORS MR. GEORGE SHIMER MISS AVIS IVIOFFETT MISS PEARL SCAGGS Scaggs Shimer Moffett X1 1' N .L M fmnf.. 1 g' U3 ' f. ill 111 '13 l ,.-....-- . . N A ' 'K w N 'y I' ...' N. , N rl? L N N. T q,,, , ,X X QR . 'Two-t0o K- M.. hu sit Q AAA P bl ff m a Y 1 A 'I I X j J3UD?? 17 Nw N V ' 1 ALONE ?A9.n?L XX ' my 'xx I 1 Q f- 51 - , X '- ' ,f ' qi? s ,15z 15: Q 4 A MW A x . eg 4 X-ff, lx Vw - ez ff ' F- F' , ,H-HA L-5.55- V , r M Q A W, f 'YY 7 'X V I .-fA k , . Lfik W A, X A.. K' 97 f 59 X 1 . J gl. ug V' V1 gv f L' if - - , 251 f 1 X , T1 1, k Arran wucx-1 4-,,,,,g g l ,' X Q Xxx 1llf4N11- YX ,A J --. Tk ,-M - -A Forty-two 4.1 ,. I X V v Y 5 i 1 . L 'Ay H X A V 44-,WW Y ,,,L-g,, 1,,,,iA...ai..-1.7 d A-N f ' 3 ' 'wwf f- ' iz' Nt1,-cf '!s,w,M'.:g,y.-if- 'fgw'w' 4 . -. In My , tin, ?W T!-LF! . U 1 any X t n M fa were N, In .s 1 1 1 I mf' ..s- -' 6--. ' Largs XX -an nf' 4 Pr w' 51 1 ,I W W I X, mf' tx, -rw - v SOPHOMORE CLASS ,f Y A X f x X. N A WED by the new honors K heaped upon us by our if , fostering parent, Kankakee 'w high school, we, the soph- omores, just as did the plebes in ancient Rome, stand in V K' the Forum, see the activities ,j?2' ' LA. 4 ' and get our bearings, in gf, e fe, order that we may take our A X ' 1 places next year in the sane- ., A tum sanctorum with full f N 1 ,' Q K knowledge of affairs. ' X N :YT I L I n 4 px Forty three A Em E ,-45 AZ' Xxli N-.Q .ZX1 Y'Q:':,,,Sf-3- Ti 3 Top Row iLeft to Righti: L. Manus, M. McBroom, M. Langman, R. Lang, W. Joven, M. Schosser, M. Seedorf. Second Row. H. Sohday, A. Lockwood, H. Snow, F. Cook, Miss McGinnis, Miss Freyer- muth, E. McGraw, Mr. McKinley, K. Hartke, R. Schneider. Third Row: L. Tanner, M. Miller, P. Moore, M. Mulligan, E. Andrews, B. Cook, J. Sirois, L. Dix, V. Tanner. Fourth Row: E. Babcock, E. Wilken, V. Mehk, L. Craft, K. Luehrs, J. Agnew. V. Jones, L. Harvey, E. Born, R. Langman, P. Therieh. Bottom Row: J. Decker, M. Hoerman, L. Leavitt, J. Topping, G. Powers, A. Norris, M. Jarvis, H. Birch, G. Smiley, H. Taylor, M. Moran. SOPHOMORE OFFICERS President ................................ Herman Snow Vice-President ......... ...... W ilcox Taylor Secretary-Treasurer .............. Kathryn Luehrs Taylor Snow Lunehrs 4 Xbxu I xii, X L N xx f+.4. . QLLLL' ...,,ggf---.. ..:.L,g,. Forty-four ff IJ I 4 Top Row QI-eft, to Rightiz C. McCarl, J. Savage, M. McBroom, T. Kane, C. Stassen, 3 1 W. Hissong, R. Doerner, O. Asher. V Second Row: W. Hendrix, D. Peters, J. Green, F. Bevans, R. Kirchner. T l ll Third Row: L. Tilley, A. Bendicksen, L. Stella, T. LaGesse, J. Quigley, L. Walling, 1 1 D. Johnson, c. Prinoie, F. Morris, P. Pool. Q Four Row: E. Mellon, I. Zeilke, R. Neuman, E. Berger, M. Mullinix, V. Tanner, rg A. Robinson, S. Lane, F. Mclnturf. l Bottom Row: L. Farrar, N. Gray, L. Warren, L. Waterhouse, L. Mertes, G. Porter, fl F. Swanson, N. Richards, K. Nadin, M. Baron, O. Hertz. l SOPHOMORE. SPONSORS MR. FOWLER MCKINLEY J Miss LILLIAN FREYERMUTH Miss DOROTHY MCGINNIS 4 Freyermuth McKinley MCC-innis X f f f v l X . f ME f f Xi fl V'X 4 all iAlMbxvll', W X rl woo ,MP ,ji if . 4 ill, W , . . , ' Forty-five TW 4 'ff' ff K X! N 1 'I L-. X ' 5ffQQQ.QQ. gf U rg.. EQ- u,: qf Qfrvl-Q Z, - '-. '-x 1 -.xx x 1 Forty-six N ROMULUS and Remus were nourished by a, wolf ln the woods, then later established a great empire. Thus we, the freshmen, babes in woods, absorb the lite giving potion that Kan- kakee hlgh school offers, and in a short time we shall carry the banner of our class and school to greater heights than did the founders of Rome. X W NTS if Y X Gigi .T-fx, L, fg l L M xf - is Msfxw or f gl N' 'kzglfyrffn t' t w, JM ms? :QU '4g2A..,,,f ' Q ix f 1 ' f,.4'4l'fl t W2 'tVf5f' ' of '+,ffvgf,,f ., 'w ' N, I 5 ,gg V A X - r Q . FRESHMEN CLASS a fi rf ff I l k ff X X, lx I l Nw 'TM 1 vl- Vw K , . V 41 6 .mi 1 U 63976 TXS1 wi. c 7 X l . W Forty seven g-4, 44 w:.4uxg !xl.fk,:Tqgi'?.xv PRE, QF x 'I 'N N. N s Top Row 4Left to Rightbi F. Cooper, L. Siefert, D. White, M. Mills, H. Huntsman. Second Row: D. Kamman, A. Boner, L. Foreman, A. McBroom, D. Eckstrand, A. Faber, E. Colthurst, H. Nelson, G. Flesner. i Third Row: G. Severance, M. Stocum, E. Pendell, R. Larkins, M. Croxen, M. Schlenz, I. Quigley, H. Cornwell, A. Faber, R. Langman, M. Inkster, H. Lewis, J. Ober- lin, E. Elkin, D. Masse, F. Anderson. Bottom Row: V. Debray, N. Jennette, B. Kissel, V. Coy, F. Cohill, L. Kirkman, M. Burkitt, L. Christionson, M. Walker, F. White, D. Brinkman. i...,1,-O11 A FRESHMAN OFFICERS X President ................................ Fenton Pilotte Vice-President .................... LaVerne Powers Secretary-Treasurer ............ Barbara Volkman l ,I Powers Pilotte Volkman ' 1 f ,cj Wg l, i , X. 4 X 2 , l R4 4 l iw ' fl. ' ll onion 'W ' cw' Throw- Forty-eight L Hd X A - 2... eil, ,DQ .1e,,,j,,.,,,g,,g,g4?,,.,, Inf... .-., ,. .... . ... ....,.Q..... ' ' I -' . I Forty-nine Top Row: Miss Arnett, Miss Mussman, C. Voss, C. Smith, E. Dears, E. LaR,oque, F. Jonas. Second Row: A. Foster, M. Anderson, E. Morresitte, K. Donar, M. Bires, E. Freshwater, O. Buhrmester, A. Bergner. Third Row: F. Hightower, H. Patnude, E. Wazeka, W. Brady, F. Prindle, B. Ebeling. D. Dubois. . Bottom Row: Miss Montgomery, R. Marnell, E. Allie. M Dahn, R. Babcock, C. Ott- grayer. E. Hauert, L. Dubois, L. Horn, Miss Beardslee. iqiv F RESHMAN SPONSORS MISS MARTHA MONTGOMERY MISS HELEN ARNETT MISS MARIE BEARDSLEE MISS LYDIA MUSSMAN Mussman Arnet Montgomery Beardslee , . 1 r . eQv fl, Fi 'NV E-Aim r 1' fx' I III , f X ,W- x 'X ,XL xx' f?IQirIiliI' W-ml' I I , r wif I I r I 1 qs. ' NI R X Tp I I , YM-ill, , K .,s .1 Top Row: G. Nappier, M. Bires, R. Harris, H. Abney, D, Homberg, A. Johnson, J. Bereolos, S. Willard, C. Frazier, R. Grumish, E. Smith, D. Kraft, R. Brown, L. Cotsones, A. Bergner, F. Pilotte, H. Beedy, C. Heine, J. Guertin. Second Row: R. Darto, P. Bereolos, E. Freshwater, M. Mullinix, F. Reno, H. Hajek, M. Cook, J. Reid, P. Devine, J. Bohmker, J. Demers, C. Camfield, E. Madison Third Row: I. Bendiksen, M. Dupius, D. Shumaker, M. Holmes, M. St. John, D. Drazy, R. Marnell, D. Wadley, D. Brinkman, R. Mulholland, R. Scott, J. Calvert J. Dahling. Fourth Row: J. Inkster, J. Sieling, H. Pucek. E. Bossert, L. Davis, D. Jenkins, O. Lucier W. Goff, C. Head, G. Van Horne, A. Bates. i.-.-1 Wherever you may chance to be A straggling frosh you'1l always see: You'1l ind us in 'most every nook, Some even hide behind a book! L Q , 'xxx We're quite important 'round our school, f 4. For who else could the seniors fool? We're learning something every day Xi, Q As we go struggling on our way. A X' if 'VVS' Ima Greene Wunn f' i Nx xg. WSIS xiii ,. 7 X i J fi W v H N, X , 4 l M XF A. KH' X Q 4.- , . 1, -.-gk 1 1 Fifty ' H: f -1'?F'y' f'l r,7'! - v 1 . W1ii4.:Na'XNk . W f , ' vfllxw . xl ' 'qfffk T., : ,M if . ,f . AA '-- va , ,If y vfxy .N X xx ggxxs , R Q N y 1 Q , :X -X K If I' f ,f ' , f- GX XX 1 , H ,. x. M W Y N 'ffiqe 4 A fvk ff .ff . N A - 7' Q - yt N ' xy, M , x : Q9'+f-0' QV'-WWNQWW GWQGNKGSKQCWLGNQQMMMQMDQWDQVDQMDQV' F ACl1'IV?TIES 5332+ mi n: W 7557. , 4 . 1 1 1 1 l 1 I 1 1 X 1 l l 1 1 1 l ' I l l Top Row 4Left to Rightbz L. Williams, R. LaGesse, F. Michaels. Second Row: R. Boyd, L. Winegarner, Miss Anderson, Mrs. Dapron, Miss Wehmhoff, M. Schultz, Miss Beardslee, M. Larsen. ' Seated: J. Morris. D. Dyer, J. Ortman, F. Walker, P. Therien, M. Jarvis, B. Jannusch, E. Tait, H. Hajek, W. Hendrix. , Members not in picture: J. Regnier, M. Tallman, N. Bach. 5 ' 1K O Y N1 FRANKLIN BOOTH ART CLUB K 1? President .,...... ..... F rancis Michaels Vice-President ........... Ray LaGesse Secretary ......... ........... P hyllis Therien If Treasurer ........ . ..... Frances Lee Walker 1 Sponsor .......................... Mrs. Hattie Dapron ,Q ,xl This club, organized best fall, has continued artistically and energetically active L throughout the weekly meetings. Great has been the enjoyment of the members as '1 1 'f' they have dabbled in paints and charcoal, making scarfs, pictures, and posters which V, have added to the color and beauty of the halls. Several art students have fashioned ,C ll flqftzg posters winning prizes offered by local civic organizations, gfv f , v x, 1 4'91Q, i 1 Af YI. I ,ll 1 7,1131 X gk b S1 il, fl: will K' 41 ,Q,l,2 i x f Pl C 1 1 , Nl -2 51 T -..W W. .W . . L, ,W ,, .,,,,,,,., ,I ,N ,,sX. Fifty-one X ' r. cg. . g.3,,g,Qf . dr' 1. .lit I 'N NA' lg X. W N .L l 1 , Top Row fLeft to Righth: H. Butz, R. Kirchner, E. Charter, L. Offerman, R. Evans, L. Croxen, L. Westerhoff, E. Poyer, R. Ennis, E. Leetch, O. Lucier. X Second Row: C. Stassen, E. Walling, M. Longpre, A. Boner, E. Shreffler, A. Brummit, if C. Lane, R. Wickiser, W. Allain, L. Beckman, L. Small, E. Regnier, R. Dix. l Third Row: J. Richter, R. Kircher, A. Skeet, K. Mann, G. Brown, M. Rosenberger, l T. Broadstreet, M. Betourne, R. Pratt, G. Smiley, R. Langham, H. Krueger. 1 Fourth Row: H. Huntsman, E. Wazeka, E. Kukuck, L. Siefert, F. Mclnturf, E. Cooper, V. Janes, D. Curtiss, M. Moran, V. Harter, A. McBroom, V. Menk, L. Harvey, Y H. Skekey. Xi, Seated: D. Ashton, H. Pontious, J. Stith, J. Marnell, O. Matthison, R. Beckman, X N. Bach, M. Madison, H. Deuschle, A. Bendiksen, O. Berns, C. Tanner, X W. Croxen, R. Burger, R. Johnson. w ix N 3 T41 Y X , BAND President .............................. Wesley C1-oxen Vice-President ........................ Leslie Croxen gl Secretary and Treasurer ...... Harold Pontious kxlfgff Conductor .................... Mr. joe. E. Johnson f ,-. T 31 The Kankakee high school band was organized in September 1928, and has since that time been one of the most representative organizations of the school. It repre- ,lf 1, ,WN sents the efforts of those of a musical inclination. In the fall of 1929, a junior band 'yfms ,l was begun, to prepare newcomers for the concert band. for j The main activities of the year have been: A concert on December 13, 1929, the X' if , s of which were used to buy new instruments, playing at all home games, and ity oxgisexxt of town games of football and basketball including the district tournament, Y A X .at ther civic, community and school affairs. On April 4 the band gave an as- l 1 il, .qw 'yiseniblyxf r the high school students. liens., 1 f' fi A 1 ff 1 li W . Eliflff , af JM lxgl X ,AA-v4 ,KR jg .5 KX . ,Vw Fifty two Fifty-three l Top Row cLeft to Rightbz J. Regnier, H. Trah, A. Gernenz, A. Yeates, L. Lund, Mr. Jenkins, J. Wolfe. G. Pahnke, P. Fowler, W. Prault, K. Goodwin, R. Meyer. Second Row: L. Voight, R. Ennis. G. Kemp, M. Downing, M. Larsen, M. Schultz. Jane Devereaux, G. Thoeming, V. Holmes, C. Strutzle, J. Owen. Third Row: R. Brickett, N. Menard, K. Bennett, L. Pendell, M. Hall, D. Holtman M. Ford, H. Oiferman, D. White, L. Kammann, M. Reeves, Miss Emery Miss Beauvais. v v Fourth Row: R. Storbeck, L. Blatt, R. Dellibac, W. Schosser, L. Frederick, L. Kukuck C. Volkman, D. Ramine, A. Neve, E. Wilken, M. Stevens, J. DeCrow: Miss Carmody, E. Pierce. Fifth Row: G. Allain, M. Coleman, E. Blatt, L. Hubert, L. Echt, R. Dionne, V. Fred- erick, T. Jennings, F. Emhouser, T. Noenning, L. Pruett, L. Hubert, W Blake M. Hertz, R. Birr, R. Mirovetz, P. Gill, G. Mendel, V. Reynolds, O Hildebrand' X Seated: E. Schreffler, B. LaRoche, I.vMeu1ler, F. Tyrell, J. Ennis. UD. Calabria, i M. DeLong, E. Teifke, M. Tucker, G. Weeks. 1l. COMMERCIAL CLUB it President .......................... James Ennis, Dolly Calabria Vice-President ............ Dolly Calabria, Thelma Noenning Secretary-Treasurer ............ Francis Tyrell, joe Regnier Sponsors ........ Mr. Jenkins, Miss Emery, Miss Beauvais, Miss Freitag, Miss Carmocly. f, , ll .- f l X 'x The commercial club is over six years old. Members have published the Com- f Fw' mercial Club News, a monthly newspaper, reviewing news events, awards, and bits of F, i ly advice. Staff members during the past year, in general, have been: if Editor-in-chief ............................ James Ennis, Dolly Calabria fi iq, ,XE Associate editors .......,............ Dolly Calabria, Frances Tyrrell, ,f ,'-'QQ' Joe Regnier, Thelma Noenning , Y , Q Art editors .................................... Edith Pierce, Beatrice Jordan lg' 'VNC 5, 3f5Q Reporters, Therese Jennings, Mary Tucker, Margaret De Long, gf N f W T Margaret Boule, Frances Emhouser, Wanda Schosser 61151 ' Y' .1 51 Lil 'idx 7V'l. XKlli X .. -s:-..j x ff l 4 I f .. Q lx ll!! X, ilk I Xl 3 .X . , ..-HL x ,L . irq .-Ar, . J V . - 1 ' ' ---e ' - 1 5 xl in Q - A y X' Y, P5 4 l fl ,J ,x Top Row lLeft to Rightlz F. Michaels, M. Coleman, L. Klafta, H. Shine, F. Stith, J. Jericho. 1 Second Row: D. Jenkins, J. Oberlin, Miss Wehmhoff, Miss Tull, E. Wilken, O. Upson, R. Ennis. Third Row: M. DeLong, E. Tiefke, R. Speilberger, K. Blackwell, B. Byron, L. Clifton, L. Leavitt, A. Norris, E. Broughton, B. Volkman. Seated: G. Smiley, M. Betourne, F. Tyrell, D. Normandin, J. Topping. A. McBroom, A. Boner, E. Strasma, B. Murray. Not in picture: L. Siefert, M. Reeves, E. St. Germain, L. Robbins, J. Harrison, H. Morris, J. Stith, E. Leetch, M. Hoermann, J. Wood, R. Evans, G. Powers. w . -0- X DRAMATIC CLUB President .,........ ....... D orothy Normandin N. Vice-President ....... Francis Michaels ' if, 1. 1 Secretary ................. ........... A rclis McBroom X lf, Treasurer .. ............................ jane Topping Sponsors .... ....... M iss Tull, Miss Wehmhoff L xp ' J , Xi' Q Mifk This club, which is about eight years old, holds its regular meetings on the first 'Qt 5' Thursday of each month. The members enjoyed a club party, February 13. They MN-Y , A K ' erated with the glee clubs in presenting a Christmas cantata for the public. They y x . 1 V .Q gf :ft xQXWhere But in America before the Kankakee Woman's club and in an assembly. , 11, , wer one-act plays acted in club meetings have afforded opportunity for developing f Min L p I i talent. ,xi g ii X Q if f , 4, V, ., , Li N j l Ill, E f . W' N' ix L PH lxix X ,. N v, . ' - , wx x. - x . X 4 - 7 wwv, ,M ,g,,,, Y , g.A...A.-,,.. .L-. v--.vin 1 -x Fifty-four 1 i s l f l P l 1 5 1 V ,. l . l l A , , 7 V T l V J Top Row fLeft to Rightl: C. Crawford, K. Edwards, K. Goodwin, F. Stith. l Second Row: S. Stith, J. Harrison, M. Hall, Miss Morrow, G. Brown, E. Wilken. ' l Third Row: F. Mclnturf, K. Mann, M. Boule, E. Malone, L. Failey, H. Butz. Front Row: B. Murray, D. Normandin, L. Clifton, E. St. Germain, K. Blackwell, L. Robbins, M. Betourne, l Not in Picture: L. Kukuck, W. Osienglewski, R. Burger, M. Madison, E. Godard, ' M. Kukuck, M. Lang, M. Lanoue, L. Small, T. Rocca, M. Skeen, R. Schneider. F l l. FRENCH CLUB . 1 President ............... ...... K atie Blackwell Vice-President ......... ...... B urdell Murray Secretary-Treasurer ......... Gretchen Brown Sponsor ................... ...... M iss Inez Morrow A .N RX Regular meetings are held the fourth day of each month, in which business, games, QNX X lectures and songs are conducted in French. The purpose of the club, which is one of .L ,f the oldest in the school, is to interest people in the people and language of France. An annual dinner Christmas party was held December 16, and a picnic in June. 5' wr If le , h oe ., ' . ,fu . f X I ,X , - A Eiffgfgi Q . X. lm' X M f it-fl ll 5 ,xii Xtxll ill J 4' K, If x xp Q 4 I xx In V it -.. .- .il .NY Fifty-five 'W if C ' i gf Mr. V- t I I I 1 II' I I, . I I I I I 'VI I Top Row QL-eft to Rightbz E. Blatt, B. Sollo, L. Kammann, A. Reeves, L. Leavitt, ,' J. Top-ping, M. Reeves, D. Normandin, K. Blackwell. Second Row: L. Seifert, V. Frederick, B. Wright, R. Boyd, A. Edwards, J. DeCrow, X E. Broughton, E. Eckstrand, V. Craft. Third Row: N. Shelley, E. Swinney, N. Bach, F. Voss, K. Maisonneuve, M. Sweeney, V. Cullom, E. Godard, T. Rocca, D. White, S. Stith, D. Shidler, D. Kammann. Fourth Row: R.. Spielberger, Miss Changnon, B. Murray, E. Gallagher, F. Fisher, V. Mansfield, A. McBroom, M. Andrews, W. Ferden, G. Severance, R. Scott. Bottom Row: R. Harper, A. Norris, R.. Pratt, H. Burch, E. Schreffler, A. Boner, L. Clifton, N M. Boule, V. Menk, E. Strasma, O. Upson, E. Kukuck, V. Tanner. .1- If I GIRLS' ATHLETIC ASSOCIATION II . . I President ...................... Kathryn MBISOHHCUVC i Vice-President .................. Virginia Mansfield X A , Secretary-Treasurer ............ Elizabeth Godard X . I . . 'X' 7 KJ Sponsor .................... Miss Pauline Changnon x 1' ,, X -Q This club is three years old. Awards are given through this organization in basket- jNXLfL,' ball. swimming, diving, and other outstanding forms of gym work. II', .L 'Tig A water pageant, Showing Neptune, was given in the school pool and on the eve ,' ' ' ,I Tiopen house members of the club demonstrated tumbling, clog dancing and basketball. - X, ompeted in a hockey tournament and a basketball tournament and later gave C ifgplfjf ater pageant, The Frog Prince. Four glrls were sent to the G. A. A. Leader- ' IWIKIXN sbipga I at Old Salem. At 'the beginning of the new year the club staged an every 1, Ii ,I 'Im Igirl 'afswi mer campaign, and near the close of the second semester a mother-daughter IIII xi gfwganquet as held. I,,Z,,., A, jg! ' x 'I I I I I I I f II, I A ' . I - , . M QI It ,. slss my-six i 1 1 I I, i J 1 V Top Row 4Left to Rightl: H. DeLude, R. Doerner, M. McBroom, J. Bohmker, J. Shrefiler, i A. Bergner, J. Regnier, J, Green. ' Seccnd Row: H. Deany, L. Cotsones, M. Croxen, M .Beckhe1m, E. Pendell, L. Robbins, G. Butler, R. Babcock, L. Blatt, D. Shidler. V Third Row: M. Martin, H. Burch, F. Voss, C. Finnegan, R. Dellibac, E. St. Germain, 1 , K. Blackwell, A. Norris, M. Schultz, V. DeBray, L. Walker. i Seated: E. Babcock, M. Burrell, D. White, M. Stocum, H. Taylor, L. Siefert, M. Moran, 1 V. Menk, G. Smiley, J. IMil1er, V. Coy, M. Walker. 1 'Members Not in Picture: A. McBroom, J. Topping, I. Rogers, E. Teifke, M. Viers, M. Osienglewski, L. Forman, E. Godard, J. Decker, H. Butz, G. Powers, W. Lane, L. Manus, J. Carpenter, L. Hughes, J. Bereolos, L. Morris, A. Gernenz, M. Devine, H. Pucek, P. Stevens, E. Vandegrift, H. Whittemore, N. Menard, I E. Coldhurst, E. Duffy. R. Meyer, J. Sieling, J. Cooper, A, Lockwood. I l GLEE CLUBS 4 Girls Boys 1 I President ........ Margaret Moran joe Regnier ' Treasurer ............ Ruth Deilibac ,lack Carpenter X Secretary ,Eleanor St. Germain Howard DeLude Q. Director .............................. Miss Olive Humphrey -Mgfv, The two glee clubs are over nine years old. During the year the choruses have had several outstanding activities among which are two assembly programs. At Christmas 1 K xfx they gave a vesper service in the high school auditorium. The combined clubs had thijefegad, ' .Y church engagements. A party was held at Birds Park and was preceded, in thefallffbyf mf'-HE? , a picnic. The clubs will sing at the commencement and baccalaureate services tfhis- ff ii is Us , L5 lv ,X X 7, R X l . 'J .v x i ' Q, . X 1 BLDG A-A Fifty-seven ' ' ,F x l F . Ill Ill? :uni jr. l Top Row fLeft to Rightl: D. Poyer, C. Schierholz, T. Bohmker, K. Edwards, W. Frerichs, L. Croxen, F. Stith, W. Croxen, R. Burger. i Second Row: J. Regnier, D. Wagner, J. Spielberger, E. Vandagrift, N. Spellman, y H. Pontious, W. Lane, G. Pahnke, L. Small. Third Row: E. La Roche, M. Coleman, R. Evans, L. Klafta, G. Schneider, E. Johnston, W. Chittum. Fourth Row: K. Bunzey, W. Kurtz, C. Casper, B. McBroom, W. Croxen, B. Coghlan, Jr., F. Michaels, P. Schriner, M. Shapiro. Bottom Row: R. Ennis, J. Jericho, H. Trecker, F. Boll, M. Rickards, L. Changnon, J. Ennis, F. Rueckert, R. Ziegle, D. Glardon, R. Gregoire. Not in Picture: L. Beckman, H. Snow. l i....i-. Q Hi-Y, BOYS' ff' President ,................. .......... L loyd Changnon 4 Vice-President ..... ...... M arion Rickarcls ' Secretary .................................... James Ennis Treasurer ........................................ Fred Boll Sponsor .... I-Iarleigh B. Trecker, Y. M. C. A. 'X -I This club is probably the oldest in school. It began the year by securing Leif Larson xg V, -,7 to talk at the opening meeting. Twenty members attended the State Older Boys' Con- XXXK' X. wr ference and went to Danville, February 20, for a joint meeting and put on the Induction N,MQ5,1 Ceremony for twenty-one Danville candidates. They had a Dads' night program and Yi K-ax banquet, with Harry Topping as speaker, and later conducted a Hi-Y Rotary club meet- ilfyg .LR fling. They conducted an R, Y. Allison night in honor of the Kankakee high school kg lfxpf-ffQQiD2.1. Tommy Thompson of the Joliet Y. M. C. A. talked on What Price Glory, 5X,,,,lfH1asei n marine experiences. They put on a successful Hi-Y football banquet and Zeit., 'a,cle'ni eech campaign. The Knot Hole Gang for grade school students was organized ' I fljlfll with the help. The night of open house they put on an exhibit. Boys' I-Ii-Y played , 1 N ' ,YC 'ra bigjjpa-rt in putting over a County Young Peoples' Conference. - 4-. . 1 - 1 ,f xy: -- , l . xx 1 1 ' ,' it rgll -ri expr, XX ,X ,, if ll l X I XM lm ti V , X, if, ill ll. me H is, ff , p .Q F1flY'e19ht In X ix - XL 1 Y X T... . KL, , .-..,- -4.... . , ..,..7...i.....?1.k, rj .xi K A I ii - W v -V ,li Top Row fLeft to Righthz M. Kukuck, L. Kukuck, M. Ford, D. Holtrnan, L. C:aft. M. Hall, A. Edwards, K. Maisonneuve, N. Bach, V. Mansfield, E. Swinney, M. Rosenberger, T. Rocca, M. Sweeny. l Second Row: L. Winegarner, Miss McGinnis, Miss Holmes, M. Betourne, E. Voss, ' Miss Changnon, M. Schultz, M. Larsen, L. Harvey, V. Craft. , Third Row: M. Croxen, J. Oberlin, D. Kammann, H. Cornwell, I. Mourtzen, L. Blatt. i L. Kammann, W. Blake, A. Reeves, Mrs. Shearer, Miss Gregg, Miss Nelson, E. Godard, s. seth, M. Reeves. J Fourth Row: M. Hoerman, B. Volkman, P. Therien, B. Lane, H. Taylor, I. Mueller, l A. Norris, E. Teifke, D. Normandin, D. Shilder, J. Topping, M. Boule, ' H. Offerman, K. Blackwell, D. White, B. Beaudoin, C. Weaver, V. Tanner, fl A. Boner, A. McBroom. Fifth Row: M. Schlenz, F. Cahill, L. Robbins, E. Strasma, E. St. Germain, V. Menk, l L. Leavitt, L. Clifton, E. Shreffler, R. Cook, M. Shult, E. Kukuck. ' . Hl-Y, GIRLS' A, President .................................. Virginia Craft X Vice-President ...... Kathryn Maisonneuve ,X Secretary .......................... Mildred Hoermann i' Treasurer ...................................... Sarah Stith ' Sponsors ........ Miss Changnon, Miss McGinnis, 'Z Miss Nelson, Mrs. Shearer, Miss Montgomery yy Miss Holmes igfzifl The girls' Hi-Y club, the representative high school organization of the Y. W. C. A., l has as its main purpose to prepare girls for later life, and they have choosen as their K R sg, motto God first, others second, I am third. if QA' The club took twenty-eight girls to Camp Winona during the summer. On Thangg f -' l giving and Christmas, they distributed baskets among the needy. During the,,yea'7f ,W 5 f slumber parties, masquerades and picnic suppers were sponsored. They sent S .0025 55 1 a Belgium mission and later attended a young peoples' conference. The apesi Y, it 'N Weaver was presented in an assembly. One of the main features of the first lf er I ' was a bazaar held at the Y. W. C. A. home. X f 'N Nl X M, H J ffl 3 x ll X lil lil Fifa - 1 N - if y nne JWVM - X-YJ? g rgq, ZX? up ASX G g g A ASX ., 4v' -Q r f A -- V,-, N XJ fi J X Top Row 1Left to Rightlz M. Biers, C. Reiken, A. Edwards, Miss Wilken, T. Jennings, Miss Mussman, A. Green, I. Walker, K. Finnegan, J. D3Crow. Second Row: I. Harris, B. Sollo, B. Wright, E. Malone, W. Schosser, E. Broughton. E. Eckstrand, H. Richards. Third Row: E. Blatt, I. Schwan, E. Luehrs, K. Luehrs, J. Agnew, L. Forman, M. Hertz. Bottom Row: R. Mirovetz, T. Artman, J. Libby, C. Volkman, E. Borne, R. Newman, E. Searles, G. Richey, A. Hauser. Not in Picture: M. Milligan, S. Mirovetz, G. Weeks, E. Wilken. 1.1-.--.1 HOME ECONOMICS CLUB President ........................,. Josephine Decrow Vice-President .... ....... E velyn Eckstrand Secretary ......,... .......... T herese Jennings Treasurer ................................. Lillian Echt Sponsors ...................... Misses Helen Wilken, Lydia Mussman, Grace Coulter The home economics club is three years old. The club sponsored a song contest, giving a prize of a club pin to Evelyn Eckstrand. On September 13, they held a Wiener fry at Leuhrs' cottage. On October 17, Miss Pickett of the Public Service Company spoke to the club on the care and use of electric appliances. Six delegates were sent to the State Home Economics Convention in Chicago. On November 9 a cooked food sale was held and near Christmas a charity Christmas party was given for poor children. The 'Wnight of open house furnished a good time for 'the members of this club to display their fi iabq atory work, when they sold many delicate refreshments, with proceeds of 315. Mem- ibers. the club presented a program in an essembly. They held their annual picnic xx Xankliqfbi their annual tea during the second semester. Part of the proceeds from the I A 1 I MJX ,kk x x bbokedi od sales was used to refurnish 'the girls rest room. ,N .-.. ,. , . , .. .W V. WW.. .. X 'li 1 , 4 X XS BQ, , x.,.l ..,..Y W ,mmm .-.-,..,.,k . Sixty fl , w n if fl X tLeft to Righty: F. Michaels, B. Byron, F. Rueckert, M. Nance, E. St. Germain, E. R Malone, H. Pontious, P. Fowler, R. Evans, E. Birr, R. Burger. l I-i L., ,Q l JUNIOR PLAY , 'K Bah, a play by Mary Roberts Rinehart, was presented in the high school audi- f torium on Friday, December 6. Miss Pauline Tull, English instructor, and sponsor of If the dramatic club, coached the play and aided greatly in making it a huge success. J It was a three-act drama portraying the average life of a well-to-do family. It was filled with spicy humor, mystery as well as wonderment. , CAST OF CHARACTERS Bah .................,......,....................,.........,.................... Betty Byron NN Carter Brooks ....... ......... R ,obert Evans X Guy Grosvenor ....,.... ...........,,.. P aul Fowler ,, Clinton Beresford ....... .....,,,,.... F rancis Michaels ' Mrs. Archibald ......... .....,........... M ildred Nance Lelia Archibald ..,... ...,. E leanor St. Germain VR' Mr. Archibald ....... ........ F rederick Rueckert .-V Q Jane Raleigh ..... ....................... E dna Birr NX Eddie Perkins .... ......,. R ichard Burger Q, SX Hannah .,..,...,............,..... ,,................ ..............,....... E x 'a Malone - I William .....,,..........,.....,..,...............,............,...... Harold Pontious kj' L The procee May 22. Sixty-one ds of the play were used for the ,fx Q ,, .x annual junior-senior prom held on y My 1 . f ,NI A , 5 X 'P grill 1 iv ff if XB T' T' PX , AX ' v ' ff - I -. - 4 sv , ,If n , , , ,! X , . l X X iflmwql f w Xxx , !'Vil wr-'l,af: X..Q' ,MJ l 1 . 4 M QI X lm - I wx! kg . i ' Lufggw J 'iris Q. v fi , flux Standing fLeft to Rightlz Mrs. Dapron, D. Normandin, F. Michaels, V. Craft, J. Harrison, M. Kraft, M. Nance, E. Wilken, M. Coleman, R.- Burger, H. Shine, R. Ennis, L. Pruett, E. Pierce, K. Goodwin, L. Clifton, J. Ennis, Miss Anderson. l Seated iLeft to Rightbz B. Murray, B. Jordan, W. Croxen, C. Kraft, L. Klafta, M. Ford, ' D. Holtman, D. Calabria, T. Jennings. 7.1.11 KANKAKEEAN STAFF This, the 1930 issue of the Kankakeean, follows its predecessors in being the memory book of this school year, compiled by members of the senior class, assisted by a few l juniors. -STAFF- Clarence Kraft '30 ....... .......,.......... ..............,.... ............. E d i tor-in-chief Leonard Klafta '30 ....,.. ...,..... A ssociate Editor, Athletics Wesley Croxen '30 ...... .......,.... ......... B u siness Manager Mary Ford '30 ................. ......,. C lass Editor, Advertising Doretta Holtman '30 ....... ....,..... A ssistant Class Editor Kent Goodwin '30 .... ................,..... F acuity Editor y Lethal Pruett '30 ,....... .......................,...... A ctivity Editor ,X . '. Edith Pierce '30 ................................,..........................,........ Assistant Activity Editor kj Burdell Murray '30 ....................................... ..........,.............,.... .......,.......,.. A r t Editor ' Beatrice Jordan '30, Francis Michaels '31, Marvin Kraft '31--Art Assistants A Virginia Craft '30 .........................,..................,........................ ............, F eature Editor iw 7 YI W - ix NXMQ.: Ethyl Strasma '30, Mildred Nance '31, Howard Shine '30 Feature Assistants Edna Wilken '30, Jane Harrison '31, Juanita Owen '31 ..............., Snap Shots Lim -P Lucille Clifton 'ao ........................,................................... Girls' Athletics, Advertising K , Richard Ennis '31 .....................................,.......................... Junior Business Manager yi 34,2 illard Coleman '30, Richard Burger '31 .............,.......... Advertising Assistants kg! rothy Normandin 30 .......................,,.........................,........ .Circulation Manager R erese Jennings 30 Dolly Calabria 30 James Ennis 30 Typists tx X My s Loudene Anderson ,.... ................................... E ditorial and Business Adviser ,, 1. .C . KIT' txx ff V xx L+ rr' x, N - - l -xx Aw f V U5 Vw-X . .1 fx S X ji! , K ,f 'xx Y 1 , Y , H -.-.. f6fMN.,F,fX7Z 7 . Hattie B. Dapron ..,.................,,............,,............................................ Art Adviser l 1' X' 1, I, Q' X! K I lg x J HV l ' P , . .Y,,.1., . Sixty-two First row ileft ,to rightl: H. Richards, E. Eckstrand, M. Nance, C. Jonas, R. Storbeclt. O. Hildebrand, F. Michaels, L. Robbins, L. Small, R. Burger, J. Owen. Second row: J. Nesmith, D. Normandin, M. Reeves, L. Pruett, Miss Anderson, R. Dellibac, H. Offerman, L. Pendell, K. Edwards, M. Madison. Seated: J. Jericho, B. Murray, M. Coleman, M. Ford, C. Kraft, E. Pierce, L. Klafta, L. Clifton, H. Delude, D. Holtman. Not in picture: E. Wilken, J. Libby, K. Blackwell, V. Craft, N. Drazy, M. Richmond, H. Shine, C. Schierholz, I. Suprenant, L. Croxen, B. McBroom, R. Meyer, W. Lane, K. Carpenter, A. Schlenz. ' KANKA-KEYNOTE The Kanka-Keynote, the bi-weekly voice of Kankakee high school pupils, is tive years old, succeeding the of 1925 and 1926. It represents the laboratory efforts of the classes in journalism. Beginners in journalism learn reporting, aid in circulation, and are gradually promoted to staff positions, While advanced students care for heads, make up, copy readirrg and proof reading. Although the staff changes every few weeks. as some pupils are advanced because of good work, while other are demoted for inde- pendability, the particular staff responsibilities in general have been: Editor-in-Chief-Edith Pierce Make-up Editor-Clarence Kraft Associate Editor-Lethal Pruett, Leonard Klafta Editorials-Leonard Klafta, Burdell Murray, Mary Ford Features-Howard Shineg Burdell Murray Exchanges--Virginia Craft: Millard Coleman. VS, X Athletics-Jack Jericho: Kenneth Edwards, Millard Coleman, Lucille Clifton f, Heads and Copy-James Nesmithg Lucille Clifton, Doretta Holt-man refs! I Circulation Manager-Isadore Suprenant: Mary Ford, Juanita Owen rg, Qi Advertising Manager-Myron Madison: Howand DeLude f' L jr ', Advertising Assistants-Jack Jericho, Leonard Klaftag Len Small, ff t ie 1 I Kenneth Carpenter, Richard Meyer X 'tar re, -. XL Faculty Adviser Miss Loudene Anderson X Typists-Edna Wilken Julia Libby Ruth Storbeck Evelyn Eckstrand X L participated meritoriously in the national contests sponsored by the National chol il This year the Keynote won distinguished rating in the state journalistic c tEanq7 1 l. ' M 1 l I Press Association, Quill and Scroll, and Scholastic magazine. X59 'f 1, X W img Q. If A 7 wfi Sixty three .2 1 r 11412. . -.fQlllQ!. 1 glwj. as f if wax' F N fJ X i- Wiz, X04 L .Jax X' x J. 1 Top row ileft to rightiz O. Berns, N. Speilman, W. Hissong. Second row: L. Leavitt, M. Seedorf, Miss Beardslee, R. Rauen, K. Goodwin, Miss Moffett, E. Babcock, L. Failey. Third row: L. Seifert, F. Ticuika, G. Baron, F. Casper, D. Kammann, L. Klafta, M. Moran, G. Smiley, E. Wetmore, L. Horn. Fourth row: M. Schosser. H. Kraft. I. Schwan, M. Huckins, L. Craft, A. Norris, F. Pontious, L. Steyer, V. Tanner, B. Lane. Bottom row: H. Pucek, V. Menk, F. Mclnturf, J. Topping, H. Taylor, M. Hoermann, P. Therien, R. Babcock, C. Reicken, N. Richard, K. Nadin, D. Massa. Members not in picture: M. Bereolos, F. Boll, E. Handorf, V. Harter, J. Hudson, R. Lang, R. Langham, J. McCork1e, E. Millon, D. Peters, N. Smith, I-I. Snow, J. Stith, L. Tilley, O. Upson, R. Whittemore, L. Wiengarner, R.. Beckman. LATIN CLUB President ,,,.,,....,. ............ O rville Berns Vice-President .... ...... F rances Mclnturf Secretary ....... ......... L aura Failey Treasurer .... .,..... .......... ........ L o i s Craft Sponsors .......,.... Miss Moffett, Miss Bearclslee This club, which was organized this year, meets on the fourth Thursday of each fd 'X' Shonth. The meetings have furnished opportunity for the learning of many things W fxabdiitxgie Romans and their civilization. 1 1 f-Q ' Q A '5 VA'Rtix an banquet was the closing activity of the club this year. O. 5 ., Viv if 1 V Y. ,Y . A :HJR ilixx xx A. If ' L N -- ' ff 1, X VK i X f' Mi H -R P XV, 4-- M-Y--:P fm ef.-.A----44-.....,,..........u. X . i tx - -iii W ew-7 L ,pi Q5 4, , he 3 li 1 - -. Sixty-four L -ol N, ri H l I if X X! l N xi Standing ileft to rightlz J. Libby, Miss Anderson, L. Pendell, L. Klafta, D. Normandin, L. Clifton, V. Craft. k Seated: E. Pierce, D. Holtman, B. Jordan, C. Kraft, J. Fields, B. Murray, M. Ford, Xi L. Pruett. ' Not in picture: J. Jericho, E. Eckstrand, L. Robbins, F. Michaels, R. Burger. QUILL AND SCROLL I President ....... ...... C larence Kraft Vice-President ........ . ....... Beatrice jordan X Secretary-Treasurer ............ Doretta Holtman Sponsor .................... Miss Loudene Anderson ii, --.- 4, .1 if we f Election to Quill and Scroll, International honor society for high school journalists, 2 is one of the highest awards which may come to a senior or junior in Kankakee high school, since membership is based upon high scholarship throughout the entire high school career, personality, and journalistic achievement. 4, ' si X . 1 ylkf il X . it , As successor to the Press club, which for five years was active in furthering thai -2- tiki interests of journalism in Kankakee, Quill and Scroll fosters better publications. 21155, , 1 year it sponsored the press banquet April 24, at which Professor Lawrence W. M y i ,N ff ggi? of the University of Illinois was the main speaker. .,fH, nh I i 'Y V , X fl' it-in X J if i 2 ff Y 4 f 7 i J lv P X il. ill ..' l' ,nr f .-li ABQ Sixty-Iive ,Wg 9 sl? ff X e-'X VN ,ste M Qi affix fj the principal of the high school, the clean of girls, KIWANIS CUP This trophy, presented to Kankakee high school in June I925 by the N Kankakee Kiwanis club, stimulates greater school spirit in all types of school ' activities, emphasizing scholarship, leadership, and representation of the school. Each June the cup is awarded to the senior boy and senior girl i who have proved themselves the best all around girl and boy. The com- mittee selecting the winners consists of the president of the Kiwanis club, and a boy and girl representative from the senior class. The names of the winners are engraved on the trophy, and small individual cups are given to each. vi The following have been awarded the honor: 1925 Myra Beedy and Lee Bowlus ff v es, 1926 Charlotte DeSe1m and Glenn Merton yn M fx 1927 Velma Judy and Arthur Phelps K gwif 1928 Ethel Dean Johnson and Clermont DeSelm MXN yah 1929 Margaret Carlson and Clarence Kranz H-Hp we wx 1930 -- ? -- V 1 K eb 'X ,. - 1 .N lil 'ixgiex ill lk . r x xl it l X xl! J fyfyl H ' My A' X! K l il il! ' 4 iw j' 5156? '33 ,f -,levees 1 so it as X 1, Sixty-six ,run ' '11v rm1 -f f'T -'T 'H fi Y' , .f, 1. . .. L-jf1'u': ff - - ' -' -. my 'f AH' , .' . . - X 51- 1 , HN ,X mi s X . if , ,WX u MXX ---I WT Xx...... 1 Y ww yu! Ip rv? i Q A' ' I g ' ' , I :, Wi '1f xl uf ml in i ff ' .J Z ' 'L A -Imwiuk, ' ' q ,S-Q :fi 5 QF' W , 1 , 41 f 'MQ' ,m'1'w' I ' '-1 A-X N QQ-ef' xxmwmh ii N' I ,gi Ag 'lliibllmiq V X5 5' R W TI, .5 --f 'Y - frrk FTE- - 5 M ' o 'X G -5 ':. ' 5' E 'af - iq V I QONOBQOB c5kGNLG5k.cNL WQWQWvV' +253 ATHLETICS 5332+ A ' Q ' - ,g ,, , 1 5. -w' ,z ,pf 3, ,, n , w 1 1 i J wg l A Ml Q ,Q H lin c. B. HARRISON mm in 1 ff TO OUR COACH X Coach Harrison came to us in l927, and with his characteristic vigor and vitality, instantly endeared himself in the hearts of his men. He X has a way that is at once friendly, commanding X and awe-inspiring. His teams are examples of his foresight and patience. He is truly a molder ll of men. Well might we paraphrase Stephen IN Decatur and sayi Our coach, in his teams' inter- 'M , course with other schools, may the results always 'ig-'pi ya be victoriesg but our coach, winning or losing! gxyidihf fi Ni ' 4-Xml L1 P fd if is , TQ tw t ll E calf! ff' - A tif H , ill gllilf , -e -f Y'-P11 - ifx Sixty-Seven is ff Xi-Leif fxlfffx as sc, Tj f-QI fl xr llxi X 1 3 4 sir' if - Top row Qleft to rightbz J. O Conne11, W. Jackson, L. Jordan, J. Bires. Third row: W. Kurtz, N. Spellman, R. Sterr, P. Schriner, L. Morrical. Second row: Coach Harrison, N. Bereolos, C. Robertson, W. Gernentz, T. Bereolos, G. Abney, F. Boll, H. Ziegle. Seated: L. Changnon, C. Casper, M. Rickards, Capt. C. Schierholz, K. Edwards, W. Karr, R. McNeil. -.1-1 FOOTBALL REGULARS CAPTAINS X f A- . James O'Connell P 137 Cl d Sch hol y e Igzgler Z 1930 x :wx ' Lx x 1655 fix 3 x XX , XJ X W5 , , X , fu yr . . . ,, 1' 'X Af. ffmd wx X S I 1 'XM N ff . N X. l x J X. All Q- I :Q 5' Xl. f C M XS. r's fAf'rfW C r' 'rT'1'C'r1f - . . L p I4 X Q s MW, .,L,- ,..-4 -. Sixty-eight ll' . 'x x - W R I ff .Rf X I f WEN- XN l Back row: W. Lane, H. Goodknecht, J. Moore, N. Menard, B. McBroom, W. Beaudoin, N W. Chittum, R. Cornwall, H. Denton, G. Pahnke, J. Sanciulius. l Second 1ow: W. Eby, C. Crawford, L. Schlenz, T. LaGesse, A. Yeates, D. Shaeffer, N T. Hedlin, D. Betourne. - Seated: H. DeLude, R. LaGesse, W. Baxbee, D. Glardo-n, Captain R. Sharkey, M. Shapiro, H D. Poyer, J. Moriss, Coach Hall. J ..1l X ' .ff FOOTBALL RESERVES X LEADERS x ' x N w lil Captain R. Sharkey 1929 Sixty-nine Ruel Hall 9.'Q,.W Ass't. Coach ' ,E'.a.H . gn , f7Ei'N 4 .7 5 J n .I 'Y ,-fQif,fQ'..LQ1W'K 'IVYKH . is CLYDE SCHIERHOLZ Tackle Together with Bereolos, Captain Schierholz took care of the tackle position. His beef will be hard to replace. 1.1.1.1 ROYAL McNElL End Mac played end for the past two years. He was a good blocker and could be relied upon to take his man out on every play. Too bad, he's a senior. im..--11 NICK BEREOLOS Tackle Nick is the third of the Bereolos athletes. He played tackle for four years and with Schierholz is the only four letterman on the team. He leaves a hard place to be filled. ....-..i1 LLOYD CHANGNON End Lloyd comes from the second squad of last year, when he made a name for himself by his 'ability to snag passes. He caught ninety per cent of the passes thrown in his direction. This is his last year. nf' -KZHJT4! -Tlx HK. 59 has p R Seventy fi lei Kinja L g GLEN ABNEY 1 Quarter Cue was the surest open field tackler and the cleverest quarter Kank has had in some time. He also goes-a loss to the team. . 1.T F REDRICK BOLL Half Boll could be relied on to slip through the line for a yard or so every time and many times for many yards. He could also pass like nobody's busin-ess, and will be greatly missed. u O ROBERT STERR Half Sterr was the punter who, with his boots, always managed to get the team out of hot water. Nine semesters claim him. - THEODORE BEREOLOS Full Ted is the fellow who tore the opponents' line to shreds with his short jabs through center. He does not return. . MAXILYN DEVINE Half fNo Picture, Max can catch passes, play quarter and also kick. He returns to give the next year's team some of his talent. Seventy one JJ, ffzf Rf WI X lb ly? lf. il All l lx fl W! 21 1 AM ll it f , .N Rift '75 lll MARION RICKARDS Guard Marion has also played for two years. He plugged all holes nicely and will be back to take care of the same position next year. T-lwvx CLETUS CASPER Guard Casper leaves his Alma Mater for other pursuits, but leqves her the difficult task of replacing him with a guard as reliable and as rugged. ' linoln KENNETH EDWARDS Center Kenny was in on every play and smeared several of the oppon- ents' plans before they had a chance to get started. I-le, too, will be lost to the team. 111- 01111 JAMES O'CONNELL End Captain elect O'Connell is also a transfer from last year's seconds. I-le comes back next year to con- tinue his athletic inclinations. -1110.31 WILLIAM KARR Center QNO Picture, Bill was a man-mountain of strength to his team, and while he wouldn't go behind the line to get his opponents, nevertheless he took them as they came on the line. lli nf, 1,5-'f ,Tax jx 52 I--BENQ g ,XL Seventy two PHILIP SHRINER Full Phil substituted for Bereolos. showing by his drive and uncanny ability to keep his feet that he should be a regular when he re- turns next year. 1-1.1.1.1 WILLIAM KURTZ Half Bill was hurt at the start of the season and as a result did not play. I'Ie comes back next year and if fortune is with him, he will be in- valuable to the team. .i...-.1-..- LEONARD MORRICAL ' Tackle Morrical has played two years. He played less this year on account of the stiff competition, but should cinch a place next season. . --o-- ,N t,., ,l.' .I-7'V i Lf is LEE JORIJAN Tackle Jordan played first at tackle and again at guard. He comes back next year to Fill in one of these positions permanently. --1.- WINSTON JACKSON End fNo Picturel Jackson played in about half of the games-well. He will also be back to hold down one of the wings. Seventy three X, ,, KTA 4 0' 'sdi' Ria X X THE 1929 SEASON -11-OT-1 One of the best records ever set up by a Kankakee team was made this year when a team of veterans covered the field with the remains of their victims when they made a sweep of six wins., four ties, and one defeat. The fellows who carried the burden of the season's heavy grind were: McNeil, captain Schierholz, Rickards, Karr, Edwards, Casper, N. Bereolos, Changnon, captain-elect O'Connell, Jackson, jordan, lVlorrical, Devine, Schriner, Kurtz. Abney, Boll, T. Bereolos and Sterr. Kankakee, 21-Villa Grove, 0 Villa Grove, heralded as a team that would make the locals hit the dust in the season's opener, came to Kankakee and put up a good fight, but l-larrison's men took the game handily to win 21 to 0. Boll kicked three field goals in this game for a perfect start toward the season. Unfortunately he was unable to hit them as often afterwards. Kankakee, 19-Danville, 6 The colored flash from Danville was the first to score against the team. On a hot day, Danville couldn't cope with the defensive strength of the Maroons. A stand on the one-yard line for four downs featured the con- test. Captain Schierholz had to be removed from the fray on account of the sweltering heat. Kankakee, 6-Tilden Tech, 6 Tilden Tech thought the locals were easy and started their seconds. After the Harrisonites sliced their way through for a touchdown, they thought differently and their firsts scored only with difficulty. Changnon snatched a pass to keep the honor of the locals intact. Kankakee, 13-Calumet City, 13 Showing that they were not only a veteran team, but also a rallying eleven, the locals overcame a thirteen to nothing lead in the last quarter to tie the league champions, l3 to I3. Nick Bereolos' defense and the fight that never left the team after the fourth quarter were the bright spots in the tie. Kankakee, 14-Hoopeston, 0 The Corn Huskers were a bit louder in their bark than in their bite, for they had hardly any chance and fell easily before a classiery team, I4 to 0. Abney's tackling in the open field brought the crowd to their feet several times during the game, while Max Devine's brilliant pass snatching was also if a feature. vi?-'x ll Kankakee, 24-Bloom, 0 F 4 r . . Y 7 - om made a pitiful stab at offering resistence to Kankakee s steam Xffpixgfklrokggs o nse, with the result that the seconds had a chance to add a game lill'tl'l. A' ' , - 'i k' g N wk . ,I 1, Um ,. M75 9 eng tter Abneys seventy five yard run, lVlcNe1ls good bloc in , qitfifituplfed ith Casper and Edwards' sterling defense made the game fast af ng, even though lt was a rout. 1 f N5 df Cv, ffl' xl' f-1' -f' s' T71 V XX TTT XX L 'H- ,. - ,N . Seventy four Kankakee, 13-Streator, 7 ln the first night game even played by a Kankakee team, the locals trod the Streator Bulldogs underfoot in a thriller that saw heroic stands by both teams on the yard line for four downs. Sterr's cool-headedness under fire kept the team in the running. Podkanowicz, Streator's flash, was kept under cover after his opening run of fifty yards. Kankakee, 32-Blue lsland, 0 The Blue lsland game was turned into a track meet after the opening kick off, as the Cherry and White could not stop anyone or anything. Schriner came to the fore in the game, with a touchdown. T. Bereolos tore the opposing line to shreds with his short jabs. f Kankakee, 7-Harvey, 13 fl With a manner that bordered on over-confidence, but which was only a lack of the ability to put the extra kick into their scoring, Harvey upset the dope and put Kankakee down with their first defeat. Karr was a tower K of strength to his team, but he was handicapped by a sprained ankle. ln the fourth period, the locals made a determined effort to offset the disaster 7 with a stand on the one-yard line. They held for three downs but fell X, short of their Streator game by one down and dropped the contest. 6' Kankakee, 0-Parker, 0 Slipping and sloughing through mud ankle deep, Kankakee kept their slate clean from any more mars, when they held the strong Parker eleven to a 0 to 0 tie. Neither team was able to get any where in the paste-like mud, and the lines had to take care of the heavy work by stopping all of l the thrusts attempted. This game served only to fill in the card where an J open date had formerly been. , f Kankakee, 7-Alumni, 7 Once again the graduates held a Thanksgiving feast on the home field, X this time taking away the glory that wouldlotherwise arise from a win by nabbing a pass and taking it over for a touchdown in the waning minutes of play. Heavy hitting by the heavy Alumni was too much for the local line, and it was only because the grads fumbled that the score wasn't otherwise. The field was covered with ice and sure footing was impossible, snatching XX away at least one high school chance for a score. l l: .igi MVT! SCORES pf ., X Vina Grove ,,,.,,,,r,,... 0-Kankakee ,............. 21 Streator ......,....,........., 7-Kankakee .............. 13 ' LY, Danville .,,.,,,,,,,.,,.,,.,, 6-Kankakee ,............. 19 Blue Island .,0-Kankakee ...........,.. 32 f, ll 1431 Tilden Tech 6-Kankakee ,.....,...,... 6 Harvey ....... 13-Kankakee .............. 'f' L- l Calumet City 13-Kankakee ,..,,,..,...., 13 Parker .....,, ......... 0- Kankakee .....,... 7 -- Hoopeston .,,,,,,,,,,,,,,, 0-Kankakee ....,......... 14 Alumni ,,.,. ...,..... 7 -Kankakee ..... ..... N 4, 1 uw sf Chicago Hts. 0-Kankakee .............. 24 . y w if N1 lf T l Seventy-five Q lx Q Qi s gi .'fS5 A!! Yxlm' If fxl'-yflfi 73.-Q .51 Y ggi T. X 2 up X , Y li, N fl 'i s V i XX x X I X X in ix wi ii ff Y, Mt, 1' 'X -,X F Ml i THE RESERVES' RECORD .i1-1 Coach Hall took a group of fellows who had little or no football experience and did quite well with them. l-le turned out nineteen lettermen who will no doubt make history for Kankakee high school in the next year or so. Ever since Kankakee had football teams, all attention had been paid to the regular eleven. They had a schedule and winning the games on that schedule was the big task that confronted the mentors of the school. All pep and enthusiasm of the school was directed toward the first eleven. Two years ago, C. W. Anderson arranged a schedule for the scrubs, the cast- overs of the regulars who were too small or too inexperienced for the first team, and that was the beginning of the reserves. This year, Coach Hall, new at the coaching game in the vicinity of Kankakee high school, set out to make a name for these nameless won- ders. He carded six games, the biggest schedule the reserves have ever had. He set to work on his green material. They responded readily to his teaching and surprised the school when they took four out of the six games. They defeated Manteno to open their season. The final score was 6 to 0. Onarga fell twice to their relentless drive, 6 to 0 and 25 to 0. Then Manteno stopped them on their own field, 6 to 0. The Harvey freshmen and sophomores offered little resistence and lost Zi to 0. The crowning achievement CU of the year, and one that will bring bitter memories to the participants for many years to come, was the magnanimous defeat by Morgan Park's veteran eleven, 48 to 0. The nineteen regulars, for all were given a chance, were Morris, Barbee, Goodnecht, Poyer, McBroom, Lane, Memenga, l..aGesse, Yeates, Eby. Sanculius, Glardon, Shapiro, Hedlin, Shaeffer, Moore, Denton, Pahnke and Captain Sharkey. .', 1 ill QPF 'fix fl xii ,V 1 I 1 7 Seventy six vl K vAl !!li Lf if We ff' ffiffarf is-P Xe if bTXTs 'fp- SWHMWHNG Swimming was started on a large scale this year, ancl as a result of the fine showing rrrade by the team, inexperienced thus far in meets, the follow- ers of Neptune may, in future, vie with the other major sports in high school. The team was composed mainly of Smith, V. Bires, Westerhoff, Myers, W. Gernentz, Allen, L. Croxen, D. Ashton, McCorkle, Shriner and Beaudoin. ln addition to taking second in the South Suburban league meet at Harvey, they had two meets with Danville, two with the Y. M. C. A. and a dual with Harvey. rj The scores at the hrst of the newly formed season were very much in favor of the Kankakee team's opponents. However, as the season pro- greased, they started to pile up points, and were very much in every meet XX after the first two. ..,.. yf TRACK U X This year was a big year in track for the Kankakeeans. Many letter- men returned, as did several stars who fell short of their letters last year, I and with this material, Coach Harrison turned out the best track team ever l to carry the banner of Kankakee high school. A The locals were well represented in the long distances by Bob Schlenz, Edwards, Dionne, Sanciulius, LaGesse, Berns and Art Schlenz. Then in the lesser distances, they had Shaw, Kurtz, Shourd, and Sterr. Their hopes in the hurdles were pinned on Changnon and Michaels in the high hurdles, and Sterr and Shaw in the low hurdles. N For a long time, the locals were hard pressed for material to represent X them in the field events. This year they were fortunate in getting Bereolos, Ii Rickarcls and O'Connell to hurl the discus and shot. Changnon initiated the 1 favelin into the picture. Abney broad iumped, Beckman and Lane did the high jumping, while Boll, Burger and Peterson were the entries in the pole l vault. vs' E . ,XY Several meets were run off. Kankakee had its annual inter-class meet which the juniors won, with the aid of the cast-off seniors. in the first meet gs on the card, Donovan and St. Anne were swamped by a large score. There ffliy 14 'Q . . . Zi- '-J was the Illinois Wesleyan meet to which Kankakee sent a strong team. A571 ' 1, U the Kankakeean goes to press the remaining meets on the card are: 'T 'V 4-1 -i 3. Calumet City, Harvey and Kankakee: May IO. District meet at vf!4?Y .X0 1 f- g gf i l illlll May I7, State meet at Champaign, May 24, South Suburban meet M fp field, Chicago. ,if 'fl Mx A-4,fi', A Zh xjl f 'P X i 3 slrll gli., Aff? xrklm.- HQ yil-1751:-IT :il-fgii E N Seventy-seven X -L ix Standing: Coach Harrison, B. McBroom, J. O'Conne11, M. Shapiro, E. LaRoche. Seated: N. Bereolos, M. Rickards, L. Changnon, Captain F. Boll, W. Lane, R. Starr, P. Fowler. BASKETBALL HEAVYWEIGHTS ,L ,' ,Q if CAPTAIN FRED BOLL MX N- XA. -, A X X --H -aw 5- 'lj-+f-ffm- Seventy-eight 'L ,-.4 ' in f , Z, , Wiyf, ,A1.14..,.7,.,4i-gx- V K fu W z A K . 1 l Standing: E. Johnson, W. Gerncntz, L. Klafta, L. Beckman Coach Hall N Seated: W. Barbee, E. Wulff, F. Michaels, Captain R. Lang, M. Langrnan, D. Wagner, D. Betourne. N 5 -.l.. BASKETBALL LIGHTWEIGHTS V 4 N I F . ' x Q54-Q! J CAPTAIN ROY LANG ff.. xb y ff N ' 1 X if ' L, ',- A 'V . 'if,L..,, 1' 41 ' My A v' X Ai X ,XX 1 V. J kgdtum A .f f'7H:'Lj x 7, V X. . X 1 1 1 X M . X ,V In .- A ...n,7...n Y... --E -'X'-kg Seventy-nine X I ff iwg 'f . 'f x -.1 . V- f X- 'lf:A 'N FREDERICK BOLL Forward Freddie led his team this year to a good record, representative of Kankakee. I-Ie is graduating, and it will take a good man to replace him. 1-1101-17 WILLIAM LANE Forward Blll gave Changnon a run for high point honors. He deftly hooked the ball under the basket for a goal with remarkable precision. He will also be lost. 1-law-11 MARION RICKARDS Guard Marlon was elected to lead his team- mates next year and he returns with the promise of guarding as well If not better than he did this year. ' .....-.1.1- ' LLOYD CHANGNON Center Lloyd scored most points for the team, played a whale of a defensive game, and starred throughout the season. He leaves Coach Harrison the task of finding a man who can control the jump as he did. i-11.-3:11 NICK BEREOLOS Guard Whenever the team needed cool play- ing to get them out of a tight place, they relied on Nick. As he has played his last game for Kankakee, he will be hard to replace. .-1-1.-11 WILLIAM WARD . Guard 4No Plcturel Bill was a reliable guard until sick- ness made him unable to play. This was his last year. ff' -1-,jf lik .fx 5 G ..,-gm Eighty ROBERT STERR Forward Bob fitted into the picture of things in an emergency better than any of the others. He goes as Aa senior, and his place will leave a hole to be filled. 6 lf' PAUL FOWLER No man improved as much in one sea- son as did Fowler. He took to the hang of things right from the start and soon he had a berth with the team. M91 ,IT 9,4 Forward Q HOWARD DENT ON Guard Duke came up from the lightweights and found a place all ready for him as a regular. He kept it until the nine semester rule took him. i1. BRUCE McBROOM Center ' Although he was unable to crash a regular place on the team, he improved, and his chances for next year are a hundred to one. 1u1.l- MILTON SHAPIRO Guard Mimi returns next year to carry on with Rickards the guarding honors which they started in the grade schools. 1-i. JAMES O'CONNELL Forward l tNo Plcturel l The nine semester rule will take l Jimmie next season, but outside of that, he was up and coming and would give anyone a run for his place. Eighty-one .K -ff aff li . X fs 7 117'- Nl Rf HJ? EARL WULFF Forward Oil left his managerial duties, took on a suit and firmly established himself in the lineup as a regular. .71-.-l MELVIN LANGMAN Forward Meigs became a. regular as soon as he was declared eligible, and gave Wulff' a run for high point honors. .i1nQi-1 WALLACE GERNENTZ Center Horsie came up from last year, starved himself for weeks, made the weight, and then proceeded to hold on to the center position as a regular. . --o-- WILLIAM BARBEE. Guard Pete drove in hard for rebounds and made the enemy fear every time he went in fast. 11101-11 ROY LANG Guard Catpain Lang led his team through victory and defeat with the same cool- ness that characterized his playing. VL K XNXQ y Wax Eighty-two ,fr 5?-'Tj A -Tlx ,KMX-. .sg DONALD BETOURNE Forward The hot shot of the team for a while, Don slowed up after the Drst two games and didn't show up as expected. . DAVID WACNER Forward Wagner came from Herscher and played good ball for a time, but not good enough to crash the regulars, u LOUIS BECKMAN Center Louie didn't come through as he was expected, but with one more year, may develop. -lOl FRANCIS MICHAELS Guard Mike has a good hook pass, is a clever ball handler and is cool under fire. u LEONARD KLAFT A Forward Klafta was left over from last year's lightweights, but didn't do anything this year and Hall had him as a substitute. u EDWARD JOHNSON Forward CNo Picture, ' Johnson started the season as a for- ward. He lost his position when Lang- man returned, but was kept on the squad as a guard. Unfortunately, he was discovered ,too late. Ei8'h'by-three -fir fri Qfgijglz 1' ff I ff ! .I I lk! I ff N I ix I I - I I4 E5 'TIN . Ill? L if A-I. II f Q21 F 1- 4. ii, Lv, I 1' I -I N1 I 1 N Zim W2 x -X THE CAGE SEASON il-.11 ln view of the fact that a veteran team returned for another try at the laurel gaining for their Alma Mater, the basketball season was not as suc- cessful as it could have been. Five fellows mainly bore the brunt of a stiff grind. They were: Boll fcaptainl, Lane, Changnon, Bereolos and Rickards. They were aided and abetted by Sterr, Denton, Ward, Shapiro, Fowler, lVlcBroom and O'Connell. Kankakee, 17-Donovan, ll Once again Coach Changnon brought his Donovan five to Kankakee to inaugurate the season. They looked good, but were unable to hit on their shots. Bereolos took all the honors in this game. Kankakee, 15-Danville, 26 ln the first game with Danville, the smooth passing attack of the Dan- ville team spelled defeat right from the start. Lane tried to get his hook pass to working to save the team, but it just wasn't to be. Kankakee, 9-St. Anne, 15 For the first time in several years, Kankakee lost to St. Anne. It was mostly Parrish, giant center for the Cardinals, who caused the downfall. Kankakee, 18-Calumet City, 11 Kank opened their league schedule with a rather easy win over Calumet City. The Fractionalites had a smooth working team that sported plenty of team work, but they were unable to hit the net, and missed several set ups. Kankakee, 20-Ogden, 11 Ogden was another team that was much talked of before the game, but who failed to come through. Thev pinned most of their Cifensive drive on McGee, their center. However, Changnon held him down nicely, and the locals held the team scoreless the last quarter. Kankakee, 13-Streator, 5 Kankakee was without a doubt the hottest it ever has been on free throws when they met the Bulldogs from Streator. They also were up on their toes on the defensive portion of the same. They held Streator scoreless from the field and limited them to one free throw a quarter, except in the second Kankakee, 20-Bloom, 10 Bloom was the most awkward team in their first game with the locals at the latter met all season They didn t have the least semblance of f QA' T , work and their eve for the hamper was awful they couldn't hit 'when GX ik portumty offered itse Ns X l l I K l lf' - Mises rr r if 4-9, Qgflitxf' J , X A X X H 5 FW fic, :fix -XX 3 fs Xi x 1 Eighty four Kankakee, 18-Danville, 12 The team made up for their setback at the hands of Danville, when they easily won over them I8 to l2 on the home floor. The passing attack of Danville, that was so prominent in the first win, was somewhat dimmed. Kankakee, 16-Streator, 23 Streator, with Cain back in the lineup, made the locals swallow hard the pill they offered them in the form of a 23 to I6 loss. Aided somewhat by a home crowd and the familiarity of the home floor, they looked fan different from the team that took the first setback on the jaw. Kankakee, 25-Blue Island, 8 Blue Island had the same kind of a basketball team as the football team that represented them. They had only one man, Klein, who was any good and he was their whole team. Kankakee, 10-Harvey, 19 Harvey, league champions, took Kankakee into camp in their first game. Hodge, feared as a lightweight, was equally feared as a heavyweight. Although he didn't score, he aided materially in the victory, with his accurate passes and good floor work. V Kankakee, 21-Bloomington, 12 Kankakee took Bloomington's measure when they traveled to Kanka- kee, in a fast game that was much faster than the score indicates. Later Bloomington was runner up to Peoria Manual in the state tournament. Kankakee, 23+-University, 15 University, with its long shots, ffoved to 'be no more than a set up for Kankakee. Their offense made it easy forthe locals to take the ball off the bank board on rebounds andpwhipgit into'thei'r offense for a score. Kankakee, 27-4ca1uma city, 15. Calumet City, although greatly improved over their last meeting with the locals, could not solve Kankakee's defense and fell, another victim to the lVlaroon's relentless drive. Kankakee, 37-Dwight, 19 Dwight wasn't anything more than a practice game for the Harrionites. They couldn't stop Changnon and Lane, therefore took the middle course of a 37 to I9 defeat. Kankakee, 18-Bloom, 14 Bloom showed much improvement over their first game with Kankakee, and forced the locals into an overtime period before the Nlaroons were able to nose them out, I8 to I4. Kankakee, 16-St. Anne, 9 4 Dedicating the Cardinals new gymnasium, and playing befor KKK largest crowd ever seen in St. Anne for an athletic contest, Kankake gas'- won over the Saints, I6 to 9. Grabbing an early lead, they wer I , r headed. i l N J Eighty tive vig X Aff Yana xkg lxlzgji g X 'LQ YB Kankakee, 20-University, 13 Once again Kankakee used University as a stepping stone toward the league title, and knocked them off easily with the seconds seeing some action. Kankakee, 16-Hoopeston, 19 The Hoopeston Corn Huskers sought revenge and got it for the foot- ball win by Kank, when they caught them in an off night and smeared them in an uphill battle, I9 to I6. I Kankakee, 30-Blue Island, 15 l Once again Blue Island stepped out of the picture before a barrage of longs, shorts and intermediates. Under the guidence of Coach Hall whoi B' substituted for Coach Harrison when he was stricken with appendicitis, the team did very well. Kankakee, 11-Harvey, 13 4 X Harvey came to Kankakee to settle the possession of-the league champ- ionship and did so-conclusively. They started a last half rally that the locals could not stop. Hodge, ever the hero, took the laurel wreath when NX he dropped in the winning basket in the overtime period. 111.1-71 ll SOUTH SUBURBAN STANDINGS ' l HEAVYWEIGHTS LIGHTWEIGHTS ' Won Lost Won Lost Harvey .........r............ I0 0 Bloom ...... I0 0 X Kankakee .. 8 2 Kankakee .. 7 3 X' Bloom ........ .... 6 4 Harvey ......... .... 6 3 N University ,,.,.... .... 5 5 University ........ .... 5 5 Blue Island ......... .... I 9 Blue Island ......... .... 2 8 Calumet City ....... .... I 9 . Calumet City ..... .... 0 I0 X ,i,- I LIGHTWEIGHTS Coach Hall had charge of the lightweights this year, and from the il . . . . Rx start of the season it looked as if they were going to cop the league title, gli - however they let up somewhere and managed to take second place. Five men, as in the heavyweight division, played most of the games, but the g I 'bfi second five managed to get in their games for their letters. The First five I X 'TIN were Wulff Langman Gernentz Lang fcaptainj and Barbee. They were -I 'vi hh, X I , , , fjfiw ed somewhat by Betourne, Wagner, Beckman, Michaels and Klafta. I f Q- at . , Uiaxgzil-hey won seven and lost three. They knocked off Calumet City twice, xy N and 7 to 6, University twice, Il to 6 and I4 to 6, split with Harvey fivi wgilmiin I6 to I3 and then losing 7 to IO, losing twice to Bloom, 7 to I5 feffqfl. Nggdgwjnning from Blue Island twice, 22 to I0 and I7 to II. A I K I Q9 HX X Sw X A AB I T: 'Htl if Ei - . , X gg .,C ghty-six j,,f Q, X ,A Lx t Xt, , H ef X- TOURNAMENTS l.1l A Kankakee lost its district tournament to Bloom, thereby losing a chance for a run of four straight wins. ln the final game, after they had defeated Manteno, Calumet City and Herscherf Kankakee met Bloom and lost just as did the Bloom team two years ago. l As far as success of the tournament was concerned, it was a financial, f' if not an athletic success. f', ln the Christmas invitational tournament at Streator, Kankakee swamped Minonk 27 to 5 in their first game, then met Streator in the semi-finals and I lost to them, I6 to Zl. The Maroons fell by the wayside in the Illinois Wesleyan tournament 5 held March 20, 2l and 22. Harlem, Rockford City champions, took their I measure, 28 to 23. 4 ln the district tournament, Kankakee placed three men on the first, Boll, Kankakee Bereolos, Kankakee .,............... FEEJS 9322 Fogg 253 0 PP as D 55 5- 52 Eg? 5? o 1: :x E5 9' E5 91, 5: ri ng FY :: W 2: ' 1: H ?1rf1ZP8 9 5 ZZ fn ?5 SSM 552- -15? Swv-l TWG 009' -105 f5 0 sw 'U F' 2. 5 3 O :r' nw :1 no :1 o Q: 75 nv :J ur' sv rr' 0 O l'N S 'cl rr Q P O D Pomrehn, Bloom ' Caliene, Bloom X I K ,. .....,............ Bowers, St. Anne 595' 200 :-0 221-5 5'Q:: ?'-9. o'.I. :nw 3252 gg?-0 9:1- 293 nl'F 3:2 .H :.'. o 9, :I O 50' -.BO CI-Chg sea,-3 5,9 Sw SFU 35.5. .oP 7T' 53 fum. FPC! 55 F3575 0:97 12:21 mfffi 2-U5 9.02 on 'G 95? ml-op.. 5?- 'UUU 11:00 -1:5 F20 sei n.--E SQ- Calumet City Calumet C. 13' Manteno 13 ' r Kankakee 22 s Kankakee 18 1 X Kankakee 263 1 X' Grant Park 33s ,, f Grant Park 9' Kankakee 16 f Bradley 11 ' , ' Herscher 9 , l' Chfton 6' ' , ,, f 4 H h ' vi l Herscher 56 5 ersc er BLOOM il. . W! ' Peotono Peotone Momence 17 X' Bloom 231 I lil 14 'B1 ' , if -' Bloom 29 com Bloom 20 J fffgf, -e C, Donovan Donovan if X K Chebanse C5' f Donovan 101 Herscher 36 , ,lm s st. Anne . 1 l st. Anne 244 Donovan 233 ,df l, 1 1 f 4 Q xl .- X X' f iiyljl gdlxl WV -Ai '. 1 C xx - 1 ,QQ Eishty-seven .feet,ffiei.-i'irrs-NJ Zfslfpfngi A 11.-e NJ P X X X, 4 11. ,Xx 1.1 v , rein ,C 1, x1s.X We 1 ln 1923 the K club, an organization of former K men, presented this cup, a trophy which is awarded each spring by the club to the best all-arouncl athlete ancl sportsman. The name of the Winner is engraved on the cup. which he may keep in his possession for one year. 1 X13 px 1 x -A X. i N0 ht ff r'l 7 . . . N M 1 ll--Elf Q 1 1 1 l 1' Xlx 11 ,1 X N' X 1923 Joseph Taylor 1924 Maurice Cryer 1925 Thomas Cooley 1926 Duane Kuntz 1927 Thomas Cooley 1928 John Bereolos 1929 Sterling Rickarcls 1930 --- ? -- X 1 . L 2 Abt' lil X , an ,4,.Q,,lQg,, ,sT1.,.fL,,s 4-2642 Eighty-eight ALL-STAR TEAM The all-star team, chosen at the end of the basketball tournament consists of ileft to rightl: Lucille Clifton '30, forward and captain: Margaret Boule '30, guard: Lorraine Leavitt '33, guard: Naomi Bach '31, center: Betty Byron '31, forward: Elmae Searle '31, side-center. After the selection of the team, a game was played with a pick-up team. The all-stars won 27 to 5. - SENIOR FIRST TEAM The senior team was made up of the following girls Cleft to rightJ: Evelyn Gallagher, side-center: Ethyl Strasma, forward: Virginia Mansiield, guard: Margaret Boule, guard and captain: Vivian Frederick, center: Lucille Clifton, forward. This was the only team to go through the tournament undefeated. - JUNIOR FIRST TEAM Elmae Searle, side-center: Temple Rocca, guard: Betty Byron, forward: Doreen White, guard: Lillian Echt. guard: Naomi Bach, center: Anne Edwards, guard, composed the junior first team. - SOPHOMORE FIRST TEAM The sophomore team was as follows ileft to righth: Marjorie Sweeney, side- center: Irene Zielke, forward: Violetta Menk, guard: Izora Shourd, side-center: Jane Topping, center: Lorraine Leavitt, guard: Artemissia Robinson, center. o FRESHMAN FIRST TEAM Those who made the freshman team are fleft to rightls Lucille Siefert, guard: Ruth Larkins, side-center: Dorothy White, forward: Myrtle Jeck, forward: LaVerne Powers, guard: Dorothy Kam- mann, center. Frances Fisher, center and captain, is absent from the picture. Eighty nine prism XA, ,..-' , .-flax' Y Z 'fr ' Tyra- , vb if L4 K F! XX x I I I A X xx lx IN R -X.. Fav L14 M , wx ,, ww , I ati W I 1 x SOCCER Soccer was one of the less supported sports. Practices were held an evening after school each week. The biggest drawback was the lack of a good place to be used as a soccer fleld. -11.l1 TUMBLING At the Open House held Thursday, Februray 27, the tumbling teams put on a demonstration. The team consisted of Mable Milligan, Naomi Bach, Izora Shourd, Ruth Boyd, Mable Bereolos, Katie Malsonneuve, Melba Smith, Ruth Larkin, Dorothy White, Louise Water- house, Evelyn Gallagher, Lucille Clifton, Margaret Boule, Marjorie Sweeney and Virginia Mansfxeld. The pictures shows two of the pyramids they built for the exhibit. 1-1-nO THE OLD GRAY MARE Ardis McBroom and Jane Topping gave a special clog dance, The Old Gray Mare, Open House night, Ellen Broughton and Betty Byron also gave a special dance. :fk X, NHIBW HOCKEY Hockey was one of the spring sports this year. The picture shows Virginia Manstleld and Evelyn Gallagher playing center. A tournament was not held because some classes did not have a large enough representation for a team. .11 SHOT PUT Margaret Boule is shown doing the shot put. She won this event in the interclass track meet held October 30. The distance was thirty-four feet, three inches. . TENNIS Tennis is one of the spring sports. A tournament was held at the end of the year. The girls shown on the pic- ture are fleft to rightlz Betty Byron, Lucille Clifton, May Click fOnargaJ and Ruth Boyd. . MISS CHANGNON Miss Changnon, the physical education instructor, brought athletics to the high school girls when she came to teach in Kankakee, three years ago. Since then she has endeared herself to all the girls who have come under her directions. Ninety one hi, ff Wil. Afil...-7-v-Lf1b'x Q? WB I I I K x 5 f xx ,N N X lx I l ff 4, F, E, X . ll 5:9 l I ' 5 if cvp' l X GIRLS' ATHLETIC ASSOCIATION This is the second year of girls' athletics in Kankakee high school. The club was organized to promote interest in girls' athletics and true sports- manship. The leaders for the year were as follows: OFFICERS President ........................ Katie Maisonneuve Vice-President ...,....... . ...... Virginia Mansfield Secretary-Treasurer ................ Betty Goddard l- '-'- l HEADS OF SPORTS if Hockey .................................. Esther Swinney Field and Track .......... Naomi Bach l I-lorseshoes ...,......... .............,.. . ...Sarah Stith lx Swimming ...... ........ Marjorie Sweeney Basketball ..,,. ..........,. 1. ueille Clifton Volley Ball ...... Base Ball ..... .........Virginia Mansfield ...Temple Rocca J.-f l, Tr. ,fr X277 -is IX. 59 'fbxxis s -'-S.. M K Soccer ............... .......... D oreen White l Tennis ................ ........... B etty Byron ll Training Rules ........ Florence Voss l Walking ........... ......... A lice Norris if Hiking .......... ....... Z ylpha Palmer . Skating ..... .Evelyn Gallagher lx Bicycling ...... .......................... I-I elen Burch xnxx lx --gl 1 AWARDS li Awards were presented to girls in an assembly, january 30. The 'X second state awards were presented to Lucille Clifton and Naomi Bach. I l Three girls, Virginia Mansfield, Evelyn Gallagher and Naomi Bach, received the first state award. K's were presented to Anne Edwards, Katie Maison- I neuve, Ora Upson, Violetta Menk and Ethyl Strasma. Four girls received ll numerals. They are Helen Burch, Lorraine Leavitt, Alice Norris and Lillian XWTF Echt. T Cla Nts ...- J lu ' . TRACK MEET I the interclass track meet held October 30, the junior girls took the I' is X gk win over the seniors, making a total of 26 points. The seniors XL., Ninety-two f 'Clif'-x jlrlxt -l 4' f f kllllscnfu 4, the freshmen, 3, and the sophomores finished scoreless. l I f I X l l IV 1 2 l lvl BASKETBALL instead of an elimination tournament, the girls' tourney was played in form of a round robin tournament, in which each team must play all the others, and the second team games count just as much as a first team game- five points for each one won. The seniors and juniors tied for first, each winning four games. The sophomores and freshmen tied for third, each winning two games. The results of the games were as follows: FIRST ROUND f Senior firsts .............. ...s.. l 8 ,lunior firsts ......... 9 Sophomore firsts ........... ...... 6 Freshman firsts ...... .... 2 Sophomore seconds ..... ...... 5 Senior seconds ..... 0 junior seconds .......... ......... 7 Freshman seconds 4 SECOND ROUND Senior firsts ....... ......... 3 2 Freshman firsts l Junior firsts .......... ...... l l Sophomore firsts 4 Senior seconds ...... ...... 5 Junior seconds ....,....... ....... 3 Freshman seconds ......... 7 Sophomore seconds 6 FINAL ROUND Senior firsts .......... ......... 5 Sophomore firsts .... .....,. 2 junior Firsts ................ ......... 4 2 Freshman firsts ......... ....... 4 Freshman seconds .... ...... 7 Senior seconds ............ ....... 6 Junior seconds ...... ......... l l Sophomore seconds 8 In the annual telegraphic goal-shooting contest, Katie Maisonneuve was the winner in Kankakee high school, making the eight baskets in eighteen shots. She received a miniature gold basketball. i OPEN HOUSE il Q 1 At the exhibition given February 27, at open house, the girls' program llgll- 'fn ll in the gym consisted of a performance by the tumbling team, clog dan ' ,c ,f ,XX and basketball games. The game between the sophomores and fre mf Nl ew ended in favor of the sophomores, 3 to 2. The juniors were defe e e J ,I M A the seniors, I5 to 5. if 11, t ,l ,qi Ninety-three -X, XZ, XA- V ixlvf T NX H , v: I R- ' 'N 5- . 11? se SVS P SWIMMING An interclass swimming meet was held March ll. The freshmen ran aw'ay with the meet, having a final score of forty-three points. The juniors took second with twenty-six points, the sophomores third, with nineteen, and the seniors last with seventeen. The annual water pageant was given April 25. The pageant was in the form of a contest between the fish and the frogs, with wood nymphs as iudges. 111.11- PLAY DAY Play Day this year was held at Normal, May IO. Twelve girls were allowed to go from Kankakee. They were: Naomi Bach, Katie Blackwell, Betty Byron, Lucille Clifton, Anne Edwards, Betty Goddard, Lorraine Leavitt, Katie Maisonneuve, Virginia Mansfield, Ardis lVlcBroom, Marjorie Sweeney and Jane Topping. giqiin CAMP . This is the First year that Kankakee will have representatives at a G. A. A. camp. Eight girls can go from Kankakee. They are: Naomi Bach, Betty Byron, Lucille Clifton, Evelyn Gallagher, Katie Maisonneuve, Virginia Mansfield, Marjorie Sweeney and ,lane Topping. The camp will be held at Old Salem, june 8. .1-1. s BANQUET The banquet this year was a mothers' and daughters' banquet. The heads of sports gave a review of their various activities. Qi ill ll M f ' -A r Ninety four ,.f' x fkxx L XX-X fir X X ' R vez, .K X 'Sf-R75 F 'NN ik hx gg XX X .X NN FW -1 X -nj 1 'llh Wm 1 X X K W X A Q 75 ' ? P N r,. in ' ,Q .,,,, , wr f' illuflllul ... lm , Huw 1 HHN r 1 Hull' Huh, III' WWW 2 wig C A LE EQIP A R 5232+ g FEATURE Q Ninety- nve AS THE MONTHS PASS September brought the sunny days, l 1 Elections, greetings, smiles. t October saw football well on, K And maidens trying wiles. fl November welcomed holidays As teachers' meetings came December, with the' junior pla Brought some dramatic fame. x - xf y. X January brought new courses, 7 New friends enjoyed our fun, X As in a new semester we were plunged, X The year half done. l l February sparl-:led with parties And with crowds. l March saw district tourney loss, Ui And Allison out-both clouds. H With April came the banquets and X Assemblies-days too short, While May's gay prom with gladness Brought the senior ships near port. X As June comes on, our high school year X ls near a happy close, And often, as we read this book, we'll say, J Glad months were those. ,l xA'xe 1 Vx X 1, L VI, tl x M gl t C x X l Lf Wx hx N 11 will xl K lwll y If 'vi . N X i-!1il4717 xii.-X YA Kfx TSA Q-:XX Til 7:1 dx Z CALENDAR SEPTEMBER 3-WE RETURN. What power is this that Alma Mater has over us? I 4-Seems that the ufreshiesn mistook our building for the kindergarten. 5-Bandages and arnica are much in demand. Football practice is in T. full sway. 6-First assembly. How our band grewl IO-Seniors elect Boll, Changnon, and Burdell Murray. Yi , I I I I IX IX Q. ,X f J If I .YI I I I 1 8- 1 9- I 20- XJ 1 7 I .. ,yy 24 imap, fl - x ,I . . C ' III I I I6-At last the faculty had the much heralded hot-dog fry-in the cafeteria. I 7- -Keynote starts drive. More Patrick Henrys--more Ciceros--II I2-The juniors put their election over big, electing Chesley Robertson, Gretchen Brown, and Eleanor St. Germain. Home Economics club chooses leaders: DeCrow, E.. Eckstrand, L. Echt and T. Jennings. I3-The election fever has hit the high school. Home rooms elect presidents. First pep assembly. Why did the band hesitate? The sophs organize, choosing Herman Snow, Wilcox Taylor and Katheryn Luehrs. Much buzz in room 207. The Keynote goes to press today. - G. A. A. appoints heads of sports. Pep and more pep. Pep parade, pep assembly, peppy first edition of Keynote. 2l1Who is this Villa Grove we licked ZI-0? And what is this G. A. A. that thinks it can wake the town up at 6 bells because it's having a hike? Griest talks to us on business in general assembly. Faculty fetes in the cafeteria. And such fetesl Freshman do an AI Smith-Hoover. Elect Fenton Pilotte to pilot them, assisted by i..aVerne Powers, and Barbara Volkmann. Home Ee. gives picnic. 27-Red LaRoche and Leonard Klafta strut their stuff as cheer leaders. Kankakeean staff announcedg Clarence Kraft, editor. . H. S. downs Danville I9-6 wr got hot and had a fire drill. Ns, I I 'LI I I ydwgilxhkii 5 if ifflf 5-59' uf CA, ff' -f:'Y'Mui, .ff 'Abxxg rr Y-N., Ninety six NR if fy H ff '45 +' ' ' '..:fL. '3 iw XX 'W -rx f . I x Aviv A -L rl., an I, sl.Y'l. 10' ve-H-5. El :ucv - .g fj sm nfl I' I lg ,ji 2 :V N F Y X , 5. x U 2 fa 5 Q J l ff xx XE M Nsihwfffff g X, -:fmt- -M I S sin, lg... I Senna. ling if- ,P ' GE'ff, fx X 1300. ' .an ' ' J, 'V I V ,l ,ft wx .DNA XA 357, A ' J4-' fix x fifmllk X 'L ' s V ff f, KX MY! EfI.11. Sm' at 'Sm' 30' ll 7 1 C Q XJ, , N gm' Ninety-seven W 47 N r - w.-.QfN3 ,fxlvfii if-' Xj A X 43.55 31 -x l 51 OCTOBER l-Aha! There's rivalry in our school. Ask Katie, Lois, and Ethyl. Or maybe Wallace Gernentz. 2--Commercial club hears Mr. Beard and gets first issue of Commercial Club News. We made history today, tying Tilden Tech 6-6. 7-Mr. Dreiss captures our Miss lVlunroe and takes her to Texas. 8-Miss lngli is our new math. teacher. 9-The north study hall was really peaceful during eighth period. We had a fire drill to celebrate. Katie, Gretchen, and Burclell are lVlaclemoiselles chosen to lead the French Club. I2-Again we tie! This time with Calumet City I3-! 3. -Report cards out today. Seven boys didn't go home tonight. l6--jack Jericho has robbed the cradle again-Bernice Bertrand this time. -Girls' clogging class starts in gym. Plaster nearly falls in swimming pool. -Don Glarden's pride???? was sadly wounded today when he took a seat on the floor. -Freshmen have raided upper classes successfully. Ardis has Dick: Evelyn, Peterg Genevieve, Nlerling Doris, Nick. -Freddie Boll may have collected the slips all right, but no one wit- nessed his return. Maybe he found Alice in Wonderland's fan on his trips through the hall. 23-Junior play tryouts-Miss Tull, most popular teacher. G. A. A. puts on snappy assembly. 24-Boys' l-li-Y Banquet tonight. Good food! Good program! Good time. -Anne Edwards' and Evelyn E.ckstrand's faces register blank when asked for their excuses eighth period. Think hard, girls. Who was that we saw going to town? 26-Whooperdo! Is our team hot? Kankakee 24-Bloom 0. VQAQB--Miss Greeley takes the place of Miss Hasemeyer as the latter has f llQ!l followed cupid in wedding bells this week-end. VC 6t embly today, to work up interest in Red Cross work. il ' inter-class track meet! Juniors win by small margin. Large M ,psi dau nce composed of Clyde Schierholz. jim? -l sts are abroad! All the little freshies went to bed early. L x f ff 1 M lg - - fi ,. 'Q X, .,.. f- :QR .t Xxx ff bxxwc s ee C, Ninety eight Ninety-nine Haggis .W 7 ..- Q59 J N , F 'I ' Ons 'Lg' 5 01 EKIS V' E m LN , - 3- any ' . q' 3 0n.IZ. E N J s 7 X A a 'T' c H H f 5 ,I .:' I i, i tT.zL. '?1 QAY ' 1 ' 'N 0611. 1 4 ,. , Bmon -2 .Vs EJ- Q R 4 u WMM X 01 f Q f ' LH. V W 7 f'f.xX EVM! f!X ,,,.., -., xv Mao 00 .-.,, ir Y 7 4 + -QQVLTA in Y ! i 1 I W, N1 l, I f Y N ff f XIX XXX X! W V MJ XN' my ff' E ,am UK 'kX f,'j k','1 '65 144 51 w , , X H ,V f x f t ,X ff 514 ' 'M 1 if X NOVEMBER l-Rousing assembly. Beeeat Streeeatorl 2-We did! l3-7. 4-Science club organized-Elect Kenneth Edwards, Doretta Holtman, and Clarence Kraft. 5-Commercial club entertained in assembly: So that's the kind of stenog- raphers we're putting out. 6-Girls' basketball. Lew Clifton made I2 points to-day, regular vars- T- . Y ity showing. 7-Bill Kurtz and Lowell Williams have alternate dates with Betty Byron. N , 8-Off for Blue Island. 32-0 in our favor: seniors make whoopee with partyl A success! 1 ix l l-Armistice clay program. We celebrate with a new flag. I3-Maybe l..aVerne Powers knows why Fritz has two tickets for Aunt ' Lucia. ll l4-Miss Tull threatens to go home and let the junior play go ker-flop. l Honest, Miss Tull, we will be good. I5--Tears are shed by everyone. Harvey hands us our first football defeat .l with a score of l3-7. l l l7-Everyone happy and ready to cheer our team again. r XX l8--Does Edna Birr prefer black eyes? Well-just take a look at l'lip's. ix I9-Everybody's strong for them. Meaning, of course, the tea dances. 2l-There is an epidemic in north study. Everyone is doing it----or rather, chewing it. Who started the bubble gum fad? fl 22-Our team is red hotl Parker 0-Kankakee 0. 4 y 24-f-We've learned a secret. Maxine Princlle answeres to name of Smax. 25-Art Lockwood seems to be training his nice wavy hair. How about it, lr, Barbara Volkmann? ' X kiX Qf1!j,7 26-Tommy Bohmker is still talking about that chemistry grade. Too bad, lg' - Tommy, but teacher knows best. wk ' -Hungry for turkey? Say, we can scarcely wait until tomorrow. VA X 'TX ,F is 27 ,+ my . 5 Qs Xe ,Ai 1 2 1. 1M lr f ,ff K J ti U lvllijfv ,aft J 'fee f f ' ' 5 is ' -Ya S 'fbxi e H One Hundred Q - as , sq N' M., WKfHf'Y EET' 5fW - J 455 H353 NM' MW -f Nom. 1 WAWL ? ,Nww NNW N 1 1 Xi X , ear pg- K I xi 5 V R U . H , Q ff ' f X IN KE I 1 f : T- gag- fl ,' Nawaz. 155 Now w I H1-ff .P , r. W 1 f , Nam ff ff NW M' '1 L, fn: Nou. 27, Xl d d 0 ' +f - wg ,xii ,rf ,gfK 5v X DECEMBER 2-We're back, but what good does that do? Aw, teachersl 3-The ticket campaign is going strong. Come on, juniors. 4- Freshies avoid Christmas rush-start letters to Santa already. 5-Betty Byron makes big hit in junior play. 6-First basketball game. Beat Donovan I7-l I. 9-Whom did Wendell Frerichs fall for coming down the stairs? We Q. can't be sure, but we heard several feminine giggles. ll-Miss Carmody wants Santa Claus to bring a strong voice to Opal X 2 i..aRoche. l2-Annual Hi-Y football banquet. jimmy O'Connell elected football X li 1 3 f X i captain. We're with you, jimmy! --Full day-afternoon tea dance, band concert, lost to Danville 26-I 5. 9 I6-French club banquet a success. I7--Mr. Hall demonstrated the quick and easy method of riding home rooms of stray canine friends. Just walk to the door and send the ii puppy a come hither glance. Miss Changnon reports two volley balls 'J lost, strayed, or stolen. Ar l8-Civic students hold trial in class-Lloyd makes fine judge. Albert Gernenz seems to have become lost in city of St. Anne. Always i carry a shovel in case of snow. lj I9-Our number has diminished sadly. Snowbound seems to be more N than a poem. 20-More sad newsl St. Anne defeats us. .J 23-dOur alarm clocks have lost their six appeal. lt's vacation. X 24-All little freshies hang up their stockings-an old freshman custom. l 4 25--Merry Christmas!!! 26-Streator tournament begins. W, 31-whoopeeu Goodbye, 19291 Hello, 19301 W C' 'bu , an K Alix 545 W Q ll B A -xx bg , . bnxgfg One Hundred Two A x f r, F if Hia! 'Q ififigr .fits 1 ff? .X rx f ' 1 Lf L! lift'-fl?-T CSF A , 118 li Q ,iuarlgfbl , + me-1-::::: gg f lt X I N DM f Du. L, J IX Dec. 6? 5. -Lb I - 7 1 1. lm. - ? :'L'Q1-,gh ,' Dewi. ' ,'rDec.1z. X. 5 CAYT. al.eCT W X J 5 s. 1 , 'ng f fflg- ,f ' .151 N N f-fQ , .34 M .,. I N E ,1 L ,A V F I R 7' N. xy 9 'X Dewi. sm, I M' l, M W4 H A W DPCII. gay' ff QW Q X 3 nsxawa I. f g'AN5j-143th DW- f'w :.:::::g, 1 , TX J 'M 4 'F 'WW 1-f Decal if 5? W DQQ15 ' Q? MW Xt f xx NU X ffl AJ 4 'J jj 4 7 XJM X f gum? 1:5 ,ggi One Hundred Three , ,Y K-N, N Xi-if M , F ...gif N ' n U ,f7' '17, 'S ':'Y A ' , ?,Y,X XJ lg MI 1 K xc l x li xx. X. V, N, ll i F r V i lx X x x X T1 X 1 ! ,! ! ix V i ,Egg JANUARY 6--School again-We're all excited about the new Mrs. Hall. 7-Basketball season opens-big pep assembly! 8--No, it wasn't a fire. Merely the photographer getting hot and bothered trying to coax smiles from Quill and Scroll members. 9-Speed tests that are being made up seem to be sadly lacking in speed. !0-Junior party proves shocking! First big game-Kankakee IS, Calumet ! !. ll-We win again--Kankakee 20, Ogden ll. !3-- Every Girl a Swimmer Campaign -some spirits are willing, but the flesh is weak. !4-Kankakee I3, Streator 6. New Year's eve scenes were enacted all over again after that score. I5- Kenny Edwards is back after enjoying a spell of sickness. . !7-Kankakee 20, Bloom !0. Hi-Y girls become kiddies at party. l8-Kankakee lS, Danville !2. Five in a row! Team to get new sweat suits. 20-Exams start and worries increase. 22-Streator 23-Kankakee !6. Aw, shucks! 23-Alumni sponsor Sun Up, a fine play, but not many saw it. Sig!-is of relief and big celebration-it's all over for another semester. 24-Kankakee 25-Blue lsland 8. Everybody played except Coach Harrison. 27--New semester starts-Verdant sub-freshies in everyone's way. 28--Miss Frietag comes from Amery, Wisconsin to teach commercial arith- metic and commercial geography. Welcome! 29-40 football K's and 14 G. A. A. awards given out in a big assembly. A swimming party with mermaids and eats and everything. 30-Hi-Y club holds father and son banquet. lVlr. Topping speaks. li! 3!-Lots of the K's have changed owners. Football K's look pretty nice on ff f Yfwx girls' sweaters. Iliff' fix lfxx? N , f ., 1. . 1. llkll 'XX , f' V .Z Xffijlliglwig 1 L L! lvl ll if W 5' F9591 '49 ,fr -ffaff'WJf1:x,..1' lx 59 ffbxxi c -1, One Hundred Four 'fs .',l'.f 52 . xQ 1 s M Jnu,l.Q' ? A fx j-:If Jmlo. X 'IH JJ ' 'N MH. xg, . W J WX if mm. J U nrus rj . .. V .Q . 1 :fi Y Q' W 1, x Q C , 'S ff E f cw? F: N - ..,x1':,::j N. Jmzo. JHNJT fx ?J 5' ' Qmwqg ' Q' 2154? - - - 4? . Jmm mi 1 A Jw N XS A yr-um.. J. H X I A One Hundred Flve xv, 54' M'-f'-If zX1f,,f1- 5x 4 K X x- X FEBRUARY !-Kankakee 2l, Bloomington l2. A rip roaring game. 3-Special assembly. Mr. Noal Beilharz, character impersonator. 4-One little frosh almost got marked absent because a towering senior completely hid him. . 5-Beat University high-23-15. Played at 5 P. Nl. Everybody late for I supper. u 6-Mary Ford has offered to give her life for science-Atta girl, Mary! iii 7-Another victory-Kank 27, Calumet City I5. l I0-Big assembly--Kankakeean staff starts drive. A l l-eCupids and hearts invade our building at soph party. N l 2-No school-l..incoln's birthday. it I3--Dramatic club sponsors unique valentine party. I4-What a game! Overtime at that! Kank I8--Bloom !4. Several . exchange valentines-lovely sentiments. U f ji I7-Annual campaign about to close, say the reigning powers. Red is ll giving the freshmen a break-How about it, Ardis? ll V l8-Defeat old rivals--Kankakee !6, St. Anne 9. Dedication of new 1 St. Anne gym. 20-I-li-Y fellows leave for Danville-guests of Danville Hi-Y. Katie M., Virginia M. and Betty G. lead G. A. A. for next year. X 2!-Kankakee 20, University high l3. 22-Kankakee swallows defeat at Hoopeston, l9-!6. J 24-Band assembly! Miss !..ambert's U. S. history class seems to have 7 . . 7 organized a sniffle chorus with spring fever and colds requirements , to join. ll 25--Miss Bertha Conde, noted author and evangelist, speaks in assembly. Y 26-juniors plan for rings and pins. x Nil' 27-Open house draws 2,000 friends and parents. Student features interest ! spectators. xL 4 J -Mr. Harrison in hospital! Mr. Hall substitutes-defeat Blue Island We 2 28 7 0 XXCNX 30-15. Diff? sr. yr fs it 'ill lwifgx One Hundred Six f l M lf If wi' .fra ui t .K me C ..3. One Hundred Seven ' r :::':': Um- A m f F 359. f.f,. 8: fl z -gg'-5 A fP5so. 5 n :mra P , B -o L. 14. f we frb 13 QQ fe 'J . . QQ, ,Eg .-. , ni .sf N 1 .Eff Q M -G. H M 'yy i A fi! ' A n C' x V A ,2R3.'5f.1E.'7 5 i f,'fjff,fff,K? Hu. H I x lm Tabu. U UIIDUU f ' ig 'ml ' was M 5 f'.ZZY2II' 'SWK -+1 L -.5 5 IW A. 14 E 'GN K T . A Q :gl cuss I I lm 3 fl!! 'I I-74 .Fm I+- 3 S iv if Ulm fvlll-. 75 ' ffm- fum M n X nl' W Mf asv'-' XX 7 A' Q7 -X 'rf A 4 'I - K 7 W QM Y: Lin 1' -N1--, n X- J Q 1,53 1 x RX. x X 2 ill ,X lx, X , lr Y if Xxx l 7 .7 1 .Nw ll! 'Q , f N, fi, wifi? ,4 , xi' Ml? llljx MARCH -Kank loses to Harvey, l3-l l. 3-Hanging pictures in the art room is an art Phyllis T. has not yet mastered. -Girls' and boys' glee club entertains in an essembly. Ruth Boyd deco- rates her locker with orange blossoms! What can it mean? 6-Tournament begins! Kank 26-Manteno l3. 7-Miss Wehmhoff leaves us to travel abroad-Mrs. Atterbury takes her place. Kank IS, Calumet I3. -Tears and sobs. meet the 20-l6 score in favor of Bloom, but oh boy! what a game! l0-Kiwanis club entertains basketball players. We can put forth a brave smile as we read the tournament account. l l-Mr. Allison is ill. Freshmen win girls' interclass swimming. O-o-o-o-oh teacher! have a heart! Six weeks end. I2-Girls' glee club candy sale. Mr. Whipple talks in assembly. l3-Dr. Hamilton addresses boys' Hi-Y. Art club takes name of Franklin Booth. I4-Commercial club party in gym. Anne Edwards knows something! Did you see the M on her sweater? !8- Where But in America? -one act play presented by dramatic club in assembly. -Mr. Mead talks to Hi-Y girls at meeting. Zl-Lose in Wesleyan tournament-Harlem 28, Kankakee 23. Last game for seniors. Fritz R. has new flame-some call her June! 24-Joint Hi-Y party held in gym. -Surprise party for l..aVerne Powers. Big snow cripples school attendance. E 27-Girls' and boys' glee club party at Birds' park. Senior and junior girls tied for first place in basketball tournament. -We get excited voting in annual Keynote popularity contest. -,Z ljillgllfgifg 1 f QNXRX Lf xl ,fr ' -HQ x l-f 'll '. 'lim' o H dramm ,Liga .Lf , g. N , ne un e ig ix? K J X. S7 'Alb Qs M - 'R'- wwf! f 2 Q. .' Y -a .S- fi: ni, Q. H- ,sl 5- ui':.Cma V xxxxx ' I A fb V -4- J 3f,x..f UA I I 4, R' ' UML, ' Q -Lf' - R . N if mm as ff Jffr mhki. -5 ' K Q? gh. I ,X if L If I x W J C , E ff w X Xa as M jUEJl,l1w P f -ff ll! -WFT K W' W' 'K' s 1f,?' 53 M ggir- 'WZ gk F nu K fgffvuxg 4+ 9.1 'X ?W,w iExs, C Q Q QW, One Hundred Nine 54, Aff xf:..4-wl ,X1, vKl-k5v EEE APRIL l--Typists' nerves prove hindrance in interclass contest. Bennie Ooster- baan entertains us. 2- A feasting' we will go -Women's Professional club entertains senior girls in cafeteria. 3--'Tis rumored that the junior president refused to aid a lady in distress. 4--Band assembly-- St. Louis Blue, and everything. Juniors win track meet. 5--Thelma Noenning won't reach in front of people anymore if it's going to tip over glasses of frappe. i ' 8-Margaret Larsen and Edith Tait become artists' models. 9--!sn't it just Peanuts' luck? He had to walk two blocks for gasoline A and the girl had to walk home! !0-Alma! Miss Emery has bad dreams. !2-More fun! Where? Why, at the De Molay dance. l I4-Mr. Jenkins becomes acting principal. il. it I5-'Commercial club entries are no longer in doubt. ' 23--The seniors give the school a treat, in roaring assembly. Press banquet in cafeteria. Great time!! -We have some quite mermaid-ish girls. fTested and proved by the water pageant., 26-Exceptions there are, to all good rules. Students of the commercial ', department attend school on Saturday-the contest is on. 3 X , N . , 24.- 5 25 1.l- R MAY I-Woman's club sponsors Lucky Jade. gi 3-No wonder they're a husky gang! The G. A. A. banquet tells the tale. 7 7-Latin club banquet. l r l0-G. A. A. has play day at Normal. il I2- Charm School is presented by pupils of Miss Berle Danforth. !6-Senior stunt show. Glory to Miss Waggener, Klafta, and others! NXT' 22--juniors entertain seniors. Plenty of rocks. I ,Mai ....,... 'il' R tax .-Hx-5 'Ah i ?2gkEX . ' ccalaureate services AM U 1 rg A , in ll. g?2fQg.x e worst is here. Despair fills every heart and the mind registers 'iqts funk K fr! . if s all over now. Graduation and everything! . U l l l ,l Y!!! ,fre .y I, . .ix . ,ir ld ,KV My --.ik L Xxx jg -, XTX y up R One Hundred Ten Hdd A ff' ' 0 u I V 4'l'1,C' ., I ' 129 M W X? W3-Q4-1 TQ. f if Q, A-f',1 Arlu .I ht I-if rw 1 jrnx gill: ' it :gg F Q SM w i f A ..x aa 1 ff I F2 'ff I 241 ,Y W 5 f 1 w M 1 3 X Umlm nn I'n,lna7 1 I and f ' .. S ,rx W.. ' 1 gr -uf P .. :Q H 4' my 6-1 .67 T-Rims W NA 'X ' i ' I I I ' f I fl Af 1 . pi-46 1 ,f'.' WJWOGB PM , ffff' X5 qt ,. 1,31 11 U J Aga gggmgf W , la 1 'ww u C Vx 1 X, UF -V 'F F 2 X N X X If f I Xu W if ir I lx lf x 5 ay 4 r 'ls K, CX 5 W 4 . x ---X ' S i mfg? My W5 ll' x T0 THE WITS By A. WITT ln every line of endeavor no matter where or when we may chance to be, someone or something must keep the rest of this gray-bearded, long- faced world from. going to rack and ruin with its sombre thoughts by his witty witticism on subjects which are typically topical. To the wits, then, this page is fondly dedicated by one who has been over the cobble stoned path which all those of the cap and bells must go. Some people thirst after fame in the business world, but the wit merely keeps them in good humor while they are stepping to the heights. Kankakee high school is graced with many, many wits. Their names you ask? Why. don't ask, but merely look around and where you see a crowd gathered around a youth or even a girl, shaking with laughter, there you will find the wit. Not all who attempt it can be wits. Oh, no! It requires a certain something, a certain deftness of speech and a cheery mood. The wit's destiny is prepared for him early in life. l-le does not try to take any other course, nor does he want to change his position. He is satisfied. Once a wit, always a wit. ln this lonesome world of ours. Wits are like the gorgeous flowers. lt's not so much in what they do, Or what they say that pleases you, lt's just their manner gay. . Several wits now grace our halls, Half wits' art is on the walls. Gaily delving in their work, From duty never do they shirk, But keep their comrades gay. fi sf fx ig. +' . 1 fl 4 f his limi? cf R' r i- 9 ff fff'f ',:11s.fx, Xxk if-Nh 5 One Hundred Fwelve THE SPANKAFLEEAN The Wor1d's Greatest Nonsense Paper H'-Klafta for I Kankakee Illinois Ma. ze 1930 Kuff fo' 'DTVSHOUPE' , i y y Dog Catcher N0. 7 A Paper for People Who Think They Gan Think VOL. XYZ SHI E, MORRIS DYE READILY In uirin Re orter Students Get Revenge q 8 P K . P, For Undue Question: What effect do you think the I Einstein Theory will have on World peace 5 BOLL SAYS THEIR DYING France Emhouser: Yes. I MARKS NEW ERA Mildred Davis: I think that long skirts are Si! Kankakee, Octenber 26, 193O-tKPj-- Cheers. applause, huzzas and whatnot issued from the assembly room the Ides of March when Howard Aurelius Shine, son of his par- ents was mercifully snatched from this worlfl of strife. buffoons and speech when a group of spirited citizens covered the aforementioned here to stay. Harold Bunte: This Why of course! Clarence Rucker: The day has come when the importance of is the last straw! every American realizes Home Economics in the high school. Do you think that my Mathilda Pucek: hat fits my complexion! VV-esley Prault: What do you make of this VVatson'! If W l if: gentleman U, .With ripe red pellets whose Leland Hubert: The Cubs had the better i odor was obnoxious. team, ' Shine, clothed in his white toga, which VVoodrow Mathy: Blondes have more IT came from the Carl Handorf Toga Manufac- than most glfls- - l tures' was Snemng off his wen known but Olive Mattoeks: Why of course there is a , , H . ,. Santa Claus! ! fearfully disliked speech, Why or When, , , . 1 Vh h d, ll, , d b t Leonard Vmght: The farmer is entitled to ll ell f B llll IBYICE, T0 Ing' Ill, OH, SH ll 011 his Share of world wealth- X the nisles. groaning terribly, arose to a man, xvmda Schossert Young man are you un- X and heaved and heaved until the stage and der the influence of liquor! , fl the sole occupant were occupied with a ripe Eugene Gerretse: Impossible! red covering which resembled, and some say Harry Buhrmeister. That is what my tnnt it was' blond- mother always said. Lee ran as fast as he could, but lo and behold! thliogy galnbfgaf Fifty fhousafld dollars NWS ns he raced in second, he slipped and came 2 el Qeiqllx G. h In g in sixth. Much to the chagrin and woe of Hoya h lczfna v lge t e n Mme' everyone concerned, the togas were stained and Jong e . l?ge'. ef out!! i X spotted with the dewy redness. Lyle and AT- eZ':e A In take tfvo quarts' medmm' X Dale Asher, owners of the XVe Clean 'um Mmm Deeth CnnAy0uCIm:1aglge? f d ld nl Y yl'0n OYVDIHKZ S y G TRW UI' RBI Laundry came up and offered to clean the in his last speech' ..Acn nbedechl.. 1 white, now red togas. Robert Schlenz: Silence. They fnffied Off the NW meh Whv dyed 'Hienz Trah: The eighteenth amendment is fi for home and country and took them to the all Wet- 'Wx 4 Q '! Ennis-Sitrasma Funeral Parlors from which Mny Ford: I never did in an my mel nh, they will be taken to the Arlington Cemetery. Lois Blatt: Sir! In commenting upon their dying. President 6815231 Tgesngifhcfenz gg: 3031 ner cent Ameri- .' in of the United States Boll said, They were . p ' a ' , lm QQ the worst in the land In their , th Merlin Mertes. I could never see why he AN an ' - ' 501331 9 walked Ruth. ny- UU 5 United States Ends peace and contentment. D01-ettg, Holtmang 1 am very mn-y, I 2 Nodine Drazy. the murdered orator's wife, HIDE , B M t im mf r ,X - Gif , , - . , essie enn: y coun ry rg o , ro. L n as. well as Euphremia Shreffler. Morris moll, Lyle and Dale Asher: We Do! ff I j N ibn said. Thank Heavens! Lethal Pruett: Only on Sundays it , 5 The man who made Milwaukee foam called da53i1?,.,,uw: Hnve yon yon, lesson? I fl tt Mfg for his colleague. and henchman, Lee Morris. Students: I don't know. XX - W' V X R' Q P I A lui -- mi One Hundred Thirteen A f I, v HY .. fnff Try,-iN! 5X3 f,,.f.f ,XV 'Y' TEX 'gh ' if 'I k ' 'ZW Y Tigf -'f-x- X4 F J The Spsnkafleean-The World's Greatest Nonsense Paper SPANKAFLEEAN STAFF A Social Editor ..... ..,.........,........ K lafta Clown ........ ............. S himel' Cosmetic Editor ....... ,.Kraft CCheesel Janitor .,...,..........,............................... Ima Duster Shoffer ........................... ...... W ee Willie Karr Figure out the rest four yourself Pletforum Another We Stand for: A. Sodas at all hours-free. B. Assemblies in the morning to last all day, every day. C. Pay every day for the students and no work on pay day. qi D. More hour per minute and xtonversely. E. Free lunches. F. Pretzels und beer. Banned from the U. S. Mail because of mili- X, taristic- tendencies. Entered as mailable ma- iff terial in U. S. S. R. and Planet X, X Agitorial Spring has come once again as all good V. springs do and winter has forsaken us once mf again for what we do not know neither are we able to say. This fact stand out, however, 7 the peace conference held in Brazil rec- ', ently has done more to raise the cost of lf. prunes in Sardinia than any evil to date. 5 Congressmen everywhere are taking up the ' cry of Socialism and How to Cultivate it. I Recently there appeared is the Sunday Ex- X aminer, an article saying that in forty-five l. thousand years, the planet Mars will be a X mile nearer to the earth., Help us prevent N this by sowing your grass seeds nov md not waiting until the late winter. Thi land of ours is laboring under a great J difficulty. What are we going to do with the f fresh supply of eggs coming in every day from 5 the country? Shall we make bootleggers out ' of them or let them takeuthe other end of M corruption and become professors? Think. Run, don't walk to the nearest exit. l ll . xl Mgr . wx Harold Kruger was congratulating his new Oriental cook on a very tasty meal he had prepared. Joklngly, he remhrked, I hope it sn't a stray dog that you killed? ' No, replied the Chinaman. Dogee al- Js ready deadee when I pickee' him up. K6 most amusing guy S . ,N . Q 3 ' ought to see him slam Eileen N R And! kiss the door good-bye. J l It has been Spring for some time now, and as one looks at the budding trees and singing birds, one realizes that it is Spring. Sometimes one iigures that Spring is not always Spring. Why? That is the question and the purpose of this agitorial to prove to you that never have the Armenians proven their stand on the high tariff. Howeverl as one reads the Scriptures, one realizes that never before has the strength of the Cubs been so manifest. Twice in the World War, people were wont to say that Hungarians eat too much, but never has Spring followed Fall or even Doheny. When the years roll by and everything is peacefully and quietly moving along the West- ern Front, the thought arises, Maybe? Did you ever sponsor a feeling that delighted you when you smelled the smell of cod fish in the air? No? Well, as the world revolves on its orbit the poet paints beautiful pictures with his camera and the world realizes then really and truly the value of it. 'I' 'k 'k And Another For several years the world has been in an uproar because the price of beans and beau soup has risen to .such heights that the cost of living has become too high to live. Petitions have been brought before the tribunal of Hague at Poland to the elfect that after June 6 there will be no more school until September. The argument has been used that America for Americans has become America for Americans. What do you make of it Wat- son! Remember. at all times to refrain from spit- ting on the floor in the moovies. Never let prohibition. Always wear s smile. Always be n gentleman or act like one. Fool the people. Let Mr. Ford run his own business. And above all things, Remember the Maine! . !Too tired to flnlshj -1- bi N f' A ilqflg wa ffl, mx-X S F51 ill ik fi YA ent minded Alan Yeates , i ll ,V N: Y, , ' , K I f 'l il: Ke' M ferns fs. ff- Ni - me One Hundred Fourteen The Bpenkafleean-The World's Greatest Nonsense Paper Requiescat SHINE, Howard Aurelius. Son of his father and mother, brother to his brothers and sisters, nephew to his uncles and aunts, cousin to his cousins, but a nuisance to all who knew him. This day, May 37, 1359, passed into eternity. His life was s gl0ri0llS one and his dying a. good thing. What he did, he did big, and what he did big he doubled. As an illustration of his foresight, thrift and wonderful zeal, he once had pneu- monia. However, so enterprising was he that in a week he doubled it. Then too, a doctor once told him that he had bercolosie. On the next visit to the physician, he was in- formed that he had doubled his disease and was afflicted with two bercolosisf' His end was sudden, abrupt and to the point. He was standing-but why spoil your enjoyment of a good novel? Read the article in this Spamm- fleennf' At your druggist's in pint bottles for one and one-half prescriptions. Thus the man HJ passes away. Hats off, for it is he who wrote those famous sayings that made Brond- way. Broadway, To him, we owe the groans for giving us those jokes that have made history, as That was no lady, that was my wife and None of your beeswax. QI-Iey, who threw that tomatoll W i' 'Jr 'R MORRISY Lee Spondious. Male, age two and six-tenths at last feeding. Butter and Yegg man. Has Elk's took and black hair. Reward, 10,000 rubles for return to materfamilias in time for early fall showing. He was born at the tender age of nothing in a log cabin that he helped to build himself. He was with the world twelve months before he celebrated his first birthday. At an early age he developed an inferiority and receded to the back woods where he took his setting up exercises. He got in bad company while yet in the plastic stage and after associating with Capone, Changnon, Bugs Moran and Wagner, he took up plumbing. Hl memory faded at this time and he made s huge success st his adopted profession. He studies Art, Euphremla and public speaking. At the latter he was a wow. He swayed his audiences Bret to the right, then left, now up and finally down and to dreamland. His end was abrupt too, but being s true friend to his pals, he made it three. There were many like him before, but thank Heavens! he is the last. He--fSay, who started thisli One Hundred Fifteen Results-and Ow I! A few days ago in the Spankafleean the platform which the paper was determined tc follow was giveh for the ensuing year, It is repeated today. It met with immediate re- sponse from the gathered thousands and today the school board is cooperatirg with this paper in putting these reforms into effect. Already blue prints have been made by the Art classes and the Mechanical drawing classes to the sum of six and 'Kg which figure is as correct as the perfect thirty-six. As the plans are almost complete, the new features will be installed and will be ready for use by 19-. The plans call for a bar to be made of pine, which will be placed at the far end of each study hall. Here, students will be given free lunches to their hearts' content and will not have to pay for them. A new machine has already been made and now awaits a patent which can make white excuses only. This will go a long way and will avoid the confusion caused by those who lmve to come early to school, and whose snores keep the rest of the student body awake, Nick Brink is the inventor, and ihe sug- gestion was brought up to Miss Fruin. Mr. A. P. Johnson and Mrs. Jannsen are responsible for the institution of the Lew clocks which allow more hours per minute and conversely. The plan whereby assemblies will be held every day, lasting all day, was moved and seconded and seconded and .seconded by Conch Harrison, Mr. Hall, Miss Freyermuth, and Miss Arnett. On account of the fnct that a large be- quest leaves a large sum of money in the treasury, teachers will go without pay and the students will get it in their stead and conform with article C of the platform. will In School PM wi 1.2 ,,f ,Z fx. X f J ff X X. Il I l Teacher: Are you herel .-sv , 4 Pupil: Yee. Tx, f Teacher: Why? li, his Pupil: x is the unknown. 4 ff? Teacher: Did you or did you notl Qin Pupil: I do not choose to run. ,4 Teacher: How many were there! VH- Ji L Pupil: Two per cent. j j Teacher: Was he very ill? I I ,-, U A, Pupil: How did I miss it I'd ll to J , Bell: That's all. ,J 'gl' i N, All. Hurray. if ,Y ,Ax I1 Z' p a l slil L il. A, -, tsl- 1 ' -4e4!' NMA li .!X1' X-my-A f J 753 pkg! Y. 5 , w I, X if X X The Spankafieean-The Wor1d's Greatest Nonsense Paper Karr Wins Western Gulf Champaignship William Karr amazed a large gathering at the Hazel Butz farm when he went around the course in B. V. D.'s amidst the loud shouts from the gathering. Teeingoff in the opening chukker, he net- ted the ball twice before he could get away trom the fence and was pocketed by the other jockeys who were attempting to take the handi- cap race in the fifth at Arlington. He was up against it in the fifth, for with two men on base heh let a slow one fly and was immediately disqualified for fouling in the clinches. Undismayed, he took to the third quarter with renewed vigor and vitality and proceeded to set a record by making a pretty swan dive. This won for him the plaudits of the gathering and he accepted them. All the way around the oval he was sixth. but heaving the iron ball for a new record, he leaped over every hurdle in his path and sprinted the pole vault for a new broad jump record, The cry went up of Ducks Aiming his gun at a dark object ten yards in tho sky, imagine his embarrassment when he made a perfect hit and Robert Schlenz came down with his plane in flames. In the fourth period with the ball on the one yard line and a minute to go, he put over three strikes in a row and pulled away from the Vassar crew by seven lengths and took the Labor Day regetta. Seven thousand Frenchmen can't be wrong, therefore speaking to the waiter in French, he asked for a recount. The crowd was getting unruly and when the referee called a foul ou Karr, he was showered with pop bottles. The score was tied and he put in the free throw. Sue's Sayings There may be no music in a rubber band, but therc's considerable snap in it. 'k it 1' A low-brow is a person who likes peppy stories, girl shows and good times. A high- brow is a low-brow who won't admit it. it 'k -k The' di armament conference found a lot of food for fought. k Q' sk The trouble with most of the destructive criticsm is that it isn't so destructive after all. it -A' -k A teacher is a person who induces two men to strip for a fight and then runs off with their clothes. 1. 1. 1, It would be a good idea if we accomodatsd all radio baritone who sing Carry Me Back To Old Virginnyf' 'k i' 'k Why don't some of the profemions have peppy signs to aid their business? Maybe a chiropidst could' use this- LIMP IN-LEAP OUT! Just a suggestion. 'k 'k 'lr ' It seems that recovery from the present industrial crisis hinges on the problem of employing more men to do less. 'k 'k ik Ikyl l Take od the wall paper, ve is moving! Q 'Jr -k Never give in to your parents. It makes them insubordinate. Poultry . A woman can never make up her mind, No matter how urgent the case, But ohl how swift and sure she works, When she has to make up her facel A' it it You too, can learn to play the Hawaiian Guitarl 'k 'k i' the game ended and the count was nil to lg P23599 011 home fwngmistsl 'VIL'-1' thfivi J nothing. Another tournament was shattered Tiate,,::FnuE:?122:eg faamililespddmiivlye see when the children deftly hurled rocks through Can he well fed on fifteen bucks a week. lt the panes. w ff + 'Q A., ----i ' Be sure to remain for the After-Show f fu' A My job I quit-no longer work for hire: Au genuiseswthe lxperrs My 'lu 51 My boss he say it .save him trouble to fire: Are goofy when they get that wayg I I go to park, where write some pome, For normal persons are, per se, if X ,V But am worry when dog thing my leg is bone. The 'am' tolnorfoy 5' today' i I i -T W We l Heave for the shore. 7, Z , at r w I ' 2 , 1' Q, n He drank hair tonic, -V A 0 M 4 QCont1nued Laterj Then he died: X f .rx ' The judge pronounced it A' N kt 'KK lk Vbglgt T Herpecide. N . l N I n- -nr -x ml K -1 All join handsp circle to the right. pls 3 ff' L? f Q - ' One Hundred Sixteen lax? ff' -X254 ' RA 'fbxf X N- A A.,',,F.,:.5:..,,s.5,r ?,rv.1,.,-,.,f.,, -,. -myggqpwraqg-,qggf -- -M, of c'en1':'xbt '!'r'-'-'ivioftff-'HA t- 1', 'YW'- '?'ff'Wmf - The Bpanksfleean-The Wor1d's Greatest Nonsense Paper Missing Head Slipping, sloughing, crawling, running and swimming through the mud which covered the lleld from goal post to goal post, Nick Bere- olos led his Bone Crushers to a gloriou victory over the Dugan-Coghlan Dread- noughts 1234 to umpteen in a close game that was witnessed by a large crowd that packed the gym to the edge of the pool. On the opening kickoff, Margaret Boule took the pig skin which Shapiro offered anl carried it to within one inch of the enemy's goal. She hesitated at this point to wave to Marion Rickards and was tackled forcibly from behind by Wilcox Taylor. At this stage, Katie Blackwell took the fumble and reversing her iield, backed up into the garage and complained of tire trouble. When the doctor was amusing himself cutting a Iinwer here l and a throat there, the band played America amidst the cries and Huzzas for more, When play was resumed, Lucille Clifton, Nick Bereolos' right hand woman, took time out and refreshments were served, which con- sisted of and lamb At the presented pie, ice cream, tomatoes, tuna fish chops. end of the game, the victors were with a large brick, the token of esteem of the crowd whose wrath they had aroused. A note of explanation needs to be addcd. A committee could not select a man suitable for the honor of giving them the brick, therefore they hurled it. Leslie Croxen took it-right on the nose. Definition-Radical-one who tries to make the reactionary element react. Simile: Active as a patriotic chief of police during convention week. Bull-etins and Dope A sailor, home from the sea, prefers a blonde because he is tired of the blue ocean and wants to rest his eyes. His nerves de- mand rest in the form of softer colors-lack- ing n real, straw blonde, a strawberry type will do just as well. -Herschel Ziegle. Charm is not in what you say, but the way you say it. It is probable that few munitions makers gained much financially from their operations. Taxes paid during the war not only absorbed the entire profit of our company on powder, but in addition, wiped out all of prolit made on these powders during the preceeding twen- ty years. -Earl Wulff. Pass the baby's bank. There are now too many ways of finding out what is going on behind the business scenes to risk any other policy but that of absolute honesty. -Joseph Bires. Breathes there a man with soul so dead, who never to himself has said, Well, well, welll YVe end with the words of that illustrious American, Jack Sharkey, Foull Journalists Eat VARIED AX AMUBE SOME: OTHERS UNDECIDED Lounging around, munching candy, peanuts and olives, the workers til on the school publications had their annual banquet in the cafeteria of the high school. Festive amusements occupied the greater portion of the time. for while Clarence Kraft was busy stuffing himself with the choicest of morsels, James Nesmith played on his native instrument, the Jew's harp. At the sound of the gong when the word Alla.in was pronounced, the trio. Hazel Olferman, Virginia Craft and Lorene Pendell came out to the weird music of Loyalty .ff tl .f Y Il f 'f if W and briskly went through their number that X Always plenty of good seats after the 3,-St has made them .famous on the tage under the Q act. direction of their manager, Bruce McBroom. 'f if if Hails and loud and tumultous applause N W 1 , 1 - could not entice the three from their lair, so dol el, whats a gal wlthout pretty legs to Jack Fraker Jericho, the boy tenor 'leven 1, 4, .,, A came to the midst of the gorgeously decorated K It t h - - - stage through the efforts of Burdell Murray, , perpetlrff' ngaioreafgef, :Henhsts who discover Florist Unique, and made the audience weep Mawr l 4. t ' ,t when he tore through the heart-rending hal- M, V. .t . . . .. lad, The Prisoner's Son. fl. in our branches in all kprlncxpal cities. Doran? Holtman and Mary Ford' the Har- Lgxlpx ch '- . mony Girls, sang next, and as their song , l Buiapozs zhguitggliltiagfi,atrflmpted bribery' didn't go over so big, went into their side- :ff sh, ' - - ' ere are those s littin d nee t th co t f th l Nl' who prefer Kipling' liiioleuxigi pllayed gn bi' ttifeslizpagroizrh 0 8 'QLLN 'tiki Isadore Suprenant did his usual. act EE- U I reaq pantomine, while the quartet, Katie Black X ,' My EFL Lucille Clifton, Millard Coleman and a ,ll rs A 111550012 9 DeLude sang Sweet Adeline. ' J , , 3 Kent Goodwin started a chain pra ' , . ' 1-l'h:lLl3 Why Beatrice Joridagd Vlliillgim Lane, Dorot H K man in an it ierce answered. Fro -e .K l Her on around, the corner came Schierholz, this ' - - My knee. time and the party broke up with a groa . Ev P l E Il -.- ,. ' t 1 o H ered Se tee Q' e un ven n A40 of 31 .Xxx-7,1-A,QA55i nj F sb The Spankafleean-The Wor1d's Greatest Nonsense Paper Dabs Cuss, Discuss New Gulf Rulings At a meeting held recently in Utopia, the members of the T. N. G. A. O. A. L. A. F. A. S. S. CThe National Golfers' Association of America, Los Angles, Florida and All Sur- rounding States.7 have offered several Bug gestions for improving the right and honorable game. The first suggestion was brought up by mem- 'X ber XOIX1257 LaVella who suggested that an ll auto of his invention and manufacture be in- X cluded in a golfer's equipment. The auto will go eleven miles an hour at top speed and will keep the golfers from walking. ' Brickett, then pops up with a follow-up idea of allowing the caddies to drive the ball and cars too. These two came to blows over the controversy and fought for a solid hour. X While they were recovering, the meeting went l on. ' f ff Other suggestions were brought up, such as l allowing players to putt with takes and having Z strings attached to golf balls so that the sportsman could tow the ball from hole to l hole. i Clarence Arthur Kraft and Leonard Anth- ' ony Klafta, co-partner in crime hit the nail I on the head when they suggested that T. N, X G. A. o. A. L. A. F, A. s. s. sponsor a , notion wide campaign to have all golf greens XX made funnel shape. The government would be asked to share the cost of the improvement l which will speed up business as it permits players to hurry back to their work. One- tenth of all funds from the green fee would ,J be placed in a special fund to erect a bunga- i low in the middle of the Sahara desert for all f senators who voted dry. 4 All ideas were voted upon, accepted and or- 'R ders were given to put these changes in the 7 rule book, the volume of which would be X My is to Y and A is to Z. xl ' , Nqr Short Story Once a boy and a girl were madly in love .1 erlod he went to see her every night comma -K d one night he found another man there f' im exclamation point he had a revolver Poultry I'd like to draw and quarter QHanging's much too good! The duck who's always chirping: Oh, y-o-u w-o-u-l-dl o o o I bite my nails And blush with rage, VVhen some wren warbles, Act your agel o o o Shoot at the tires. o o o Journalist: One who is as active as a patriotic chief of police during convention week. o o o That's the old spirit that makes fOr better journalism. o o o I yearn to kick Him in the pants- The cluck who chirps, Pay in advance. o o o The urge to do something about it. 1This applies to both anti and prob Is proper and right, But our efforts seem quite Ineffective on old status quo. 0 0 0 Teacher: One as absorbed in his task as a United States senator investigating the obscene literature problem. 0 0 0 It's nice to be a juryman And sleep until your duties Demand attention to details Revealed by brazen cuties. Q I Q The main question when contemplating divorce is not so much how to get is as why. 1: vk -1 There are the Red Menace, the Yellow Peril and the Weary Blues, Hormones from our ductless glands Are something no one understands! However, homones are a fad, They make us glum or make us glad, And when some gland, in manner quaint, Decides to make us what we ain't, There's nothing we can do, in fact, But act the way our homones act. 0 0 0 A lot of people I suppose, Mu t go to motion picture shows, But why do film fans in the aisle, Stand and meditate a while? SQ' - ,X Ml l 5 ' 6' Ii ll V Q 'K taveyffivmx mma so that the police wouldn't z f 'L 5 bf Llp 61 't out of its holster comma he fired At last they start to take their seat, il e 'llinn fell dead period he ran for You stand of course, to save! your feet. - h th - 1 b h' ' f - When you stand, that is t eir cue, Q N5 S t e gn' y is slde 8' rmd to To turn and choose another pew. m pe od they were married and lxvcd o o o tif for the man he shot was her papa clamafiii point semi colon dash period. Ring down the asbestos curtain. j A wif 7 I , ,, - ff' 55 XV 6,-T4 -:ak xc, XA SQ ,,.bN K N One Hundred Eighteen W wi S- - -Y-X ' 59 , -, X, W 1 ' X 7- 1 . X if 1,2 K xxikx 5 I ,gm ' 'J Q I 1 X ,xiii 'duh-nu 1 ' z 1.213-.. +255 ADVERTISING 2332+ rf, in STUDENTS fandm TEACHERS In the following pages are listed the names of business men who, by their purchase of advertising in our year book have made its publication possible. They have thereby shown their interest in us, and their spirit of supporting our activities. Remember that your loyal duty to Kankakee high school is to patro- nize these friends rather than their competitors who have refused similar support. I 3 I I I w l 1 X 1 X A1 n X f-K ily .xi il, N, N, l I fl nf 'x lp X. A lil: I, 'il , ivxilh 'Q l My f ,lp JM is Ark 1 -W f - ,S NJ ixseffrw 1- jjjdg J 55 PQI COIVIPLIIVIENTS OF IDEAL SWEETS C0 Manufacturers of ICE CREAM x .v 1 N XX ggyx MX Nxg .xg I II Factories Nos. 3 and 4, Kankakee, Illinois KROEHLER MF G. CO. Kroehler -The best KNOWN -The best ADVERTISED --The Largest Selling Upholstered Furniture Line ln The World Factories at Kankakee, Ill., Naperville, Ill.: Chicago, Ill.: Binghamton, N. Y.: Dallas, Texasg Los Angeles, Calif., San Francisco, Calif., Cleveland, Ohio. Canadian Factories: Stratford, Ontario, Montreal. Pregressive furniture dealers throughout the United States and Canada realize the exceptional values to be had in Kroehler Living Room Furniture and distribute our merchandise. f- 1- f t , G 1, my X ,Af III Ywwodtu , A JOHNSON'S LUNCH ROOM L. Cook, Prop. Continue all summer to enjoy our Pie Sandwiches lce Cream As you and the gang did all school year Opposite High School THE ALEXANDER LUMBER CO. W. Anderson, Manager Kankakee, Illinois Phone 37 An asset of any city is the citizen who boosts his home town- Speak Well of Kankakee HARRY L. TOPPING REAL ESTATE INSURANCE X INVESTMENTS X Rx - .- 2 T 5,3 ' 4? rcgaf Bldg, Kankakee, Ill x Y L W . 77 or A im L+ A IV STOP At The New REVERA BARBER SHOP Pleases Particular People C. L. Reed, Prop. 204 S. Wildwood Ave. l l l ls' if Automotive-Raclio-Electrical Supplies AUTEX STORE Known as Bear Cat Store ISO So. East Ave. Phone Bl I BEAR BRAND HOSIERY WEARS Made in Kankakee. Sold all over the world xi f f X 1 lfrf QQ fi ll, gum One of the things to make you proud of Kankakee Q' X . 5 ww' X A ex x XIX .X 1, W 1 i i 1 fl H1 JJ! W 1 I 3 . K 1 l A14 xl XQFQJJ sg. N . N. ,.- X. X gw 3x a fp! XQ' Y H If :H w. WV I, , .I yy . AQLW' A l, J xr ful X Y E Y , 1 V , ' C 'I 'fiiw . 'H H -x --W 3-A if ...AQ , . ..,.. ' ,.il.gf,4me- 6 pfllxxl :X J-CQPENNEYFSQ -D E P R T M E N 239-249 So. Schuyler Ave. Kankakee, lllinois V. cg HAMMANN GARAGE Official Chicago Motor Club Service Mohawk Tires Raybestos Brake Service FRANKLIN MOTOR CAR SALES AND SERVICE Phone 2 l 6 756 E. Court St. Alia- -in -1 1' We wish to thank the high school students for the generous patronage they have given ' the last year. lt is our earn t desire to rencler prompt and cour- teous servlce at all times. KANKAKEE BOOK AND FURNITURE STORE OC X r - , ' 1 , tri lX'R'- NAS X i . xxx 'Q '-X x l For Good Things To Eat Stop and Shop BECKMAN'S FEDERAL BAKERY 364 East Court Sl. l VI x w. - or 'o E l A ,-fQ-,A , ' , , x.,1 s,,, . ,.,..., S ,W ...- SAVINGS Kankakee Building SL Loan Association HQME LGANS 1 U55 N rd SAFETY FIRST Our Ambulance Second B. F. HERTZ Memorial Temple Phone 41 543 E. Court St. MAJESTIC BARBER AND BEAUTY PARLORS Offering all the newer styles of hair cutting, also latest modes ancl Coiffures Joseph B. Lambert, Proprietor ST. VIATOR COLLEGE Bourbonnais, lll. Attend College ln Your own Town Courses in Arts and Letters, Philosophy, History, General and Social Sciences, Commerce ancl Finance, Pre-law, Pre-medics. For information, THE REGISTRAR Main 1263 x V I ,vNh, 1- llxxl lm? RXSL QX Mi ,KQW .. fixxl. 'J xx I x W AQ V' . , rg-- A t J A l x Y x, .rw Lf: tl-X B X , VIII Shop at lf? lf 1 I J STORES CO. OF KANKAKEE 150 l ast .Ave Kaniakee -A u f au f ' f a f f . w i And Save Money 37 Years of Faithful Service LEE'S LUNCH Jerkie, the Hamburger King, is with us Home Cooking 800 Main St., Kankakee Chicken Dinners on Sundays and Holidays When Building That' Ho-use or Garage Use BLUE RIBBON CONCRETE BLOCKS Manufacteured and sold by CAMPBELL BROS. 1191 N. Schuyler Ave. Phone 4852 'We treat you E1 the year O Quality First and Last Y--sW ' We pick our clothing with an eye to quality of the fabrics. The quality of the styling must be fault- less. For tailoring we rely on quality by KUPPENHEIMER Plant-Ikmerw Nationally Known lVlen's Wearl, , 'XX f , 1.x N 4 K H It 2 M NX J N ' X -X fin Wi H Everything in the Line of Furniture OBERLIN FURNITURE CO. 126-34 N. Schuyler Ave. Kankakee, Ill. SPEICHER BRUS. JEWELERS BIRTHDAYS, GRADUATIONS, ANNIVERSARIES Demand Gifts in Jewelry-Watches-Silverware-Leather Goods 127 So. Schuyler Ave. Phone 282 DOMESTIC LAUNDRY CO. DRY CLEANERS RUG CLEANERS Phones 902-903 X! 196 N. Dearborn Kankakee, Ill. A Alf. Ng 5 I fig A V X f Vs L A SAX' f-in 9 Ta- ,iz H, X Willys-Knight Whippet Willys Have you had a ride in the WILLYS SPORT ROADSTER? lt's a Whiz! ROBERT McKAY JR. Opposite Court House Phone 698 1 N! V AT VANDERWATER'S M Students will find Style in Clothing, l t Haberdashery, and Footwear expressed Jn ln just the manner Young Timers would have it. Dashing! Colorful! Different! Q TAIT MF G. CO. f General Machinists REPLACEMENT PARTS - CYLINDER GRINDINC1 R MOTOR RECONDITIONING x X x 417 So. Schuyler Ave. Phone 264 N THE ARCADE BARBER SHOP h! Arcade Building , in f U, Always takes a great interest in the High School and also backs all athletic events. Don't forget this shop when in need of Barber Work. ,xi fix?-ygys CLOPPER AND JACKSON 5-ff jf wifffsif, if xg- Mir' K T wig M!!!M , Y, ly , Q 1 p 4 1 N xr xr -,-e . NEC.s,w,,s--,,,,sesc fffti .Th if - Y r Z A x V A ia, A vs-, ..,,-,,-n-,,,.,r , ,V-C ,ff x, PN- D f ll To The Graduates Of Kankakee High Heartiest Congratulations and Best Wishes RONDY BOOK AND STATIONERY CO. BIG LITTLE STORE 316 E.. Court St. The Home of Monarch Goods Staple and Fancy Groceries Quality Meats T.-- KANKAKEE WATER COMPANY ADELMAN'S 132 S. Dearborn Ave. SHOE STORE Delivering at all times SAFE AND Court and East Ave. WHOLESOME ,J - SUPPLY or ff' ' WATER Wil Xlw 'lr All ' UV-. I Y. all ll ., yn T fl NTB! I ,V 1' fl 'liil lf! lx .flfaeeej r.tt. Q: tt XI XIII The Easiest Way to Home Comfort BURN GENUINE l C 0 0 Clean as then l , SunsHeat Lighter to lift--easier to handle. Responds more quickly to draft control. E l No smoke, soot or waste. Burns clean-leaving little ash. More heat with l l less stoking effort. Costs less to buy-less to burn. Enjoy this greater con- venience and economy. n Q r GUARANTEED l l We guarantee genuine Koppers Chicago Coke. If a trial order does not convince you that it is to your advantage to heat your home with this fuel, is it removed at our expense and your money refunded. KANKAKEE ICE, FEED AND FUEL co. J T. M. FOLEY ' 'QQ , 490-98 Greenwood Ave. Phones 6l and 62 zgwlljl .- A WRC 'I' ilxlryl ' -, fi 5 S - Apu if 5f.fl.flll...t f X l lu ..j .K kgs -Y . .7 .Y ,W , ,, .Adj N 'X . -. .R- i X, HN COIVIPLIIVIENTS McBROOM'S For Twenty Years Kankakees Best Restaurant 153 N. Schuyler Yards at Kankakee and Bradley KANKAKEE LUIVIBER 8z SUPPLY CO. Chas. Wertz, Prop. Building Material-Coal Phone 502 E. Court St. 81 Big 4 Tracks No. 10 M UR 0ll BARON-HUOT OIL CO. Kankakee, Ill. 'x ,F , Q -S X. 2 - Q x f Y ll ll lx it l 7 . x.. L .X .. X sf A X xl- N A. C. BEARDSLEY 8: SONS 698 N. Schuyler Ave. Tel. 749 - 750 - 751 Distributors of Beardsley's Special Flour and Happy Hour Food Products lx Yr . he me X. gi., ,W H... XIV ROMY HAMMES INC. AUTHORIZED l.if1COlI1 Fgrdggn CARS . TRUCKS . TRACTOFS Kankakee, Illinois - KOEHLER DRUG STORES fj 388 E. Court St. 815 Main St. Xf Down town South Side A' We sell merchandise that will not come back ll -to customers that will. i 1 T YZ 'I' di 'A 1 HOTEL KANKAKEE lx Kankakee's Only New and Fireproof Hotel J!! Excellent Dining and Banquet Rooms If for Private Parties SERVICE WITH A SMILE We Welcome You ll Sidney I-lerbst, Leo Langlois, ww' Pres. and Gen. Mgr. Ass't. Mgr. JI. ff? x 4 V, 'f' X Xx J,!,g74'l.lI xx Iikjl I, l l , X!! l l X lx 'Ill qg' ,ff ,J 2. i-'I XV I E :JI 'Sect ' X, Illll N w BURN ORIENT BIG LUMP COAL. More Heat Less Money LUEHRS COAL COMPANY CHlLD'S Sanitary Meat Market 247 East Court Street I A THE CHICAGO STORE 'X x,1t , fl Kankakee, Illinois Y ,X ii Quality-Service4atisfaction-Prices Vlffkxfi Four foundation pillars upon which this business stands and prospers. iffy .11 A his store is Kankakee's principal source of supply for Wearables that are .Xu ix ' fi v 1 , X a -A ,Q ,YY Bs ,, , V 4 XV . K ' ki X Lost A , up Xl' ,N serviceable and attractive. All new things are shown here First. W W M X N 4 4 tx it 9 m . ft I .1 -- fin mg WEN s Xp' ll r X I, ,,1,- x W 3, xxx We xt X . , LW 'Xi X , ,u,Wjco,,e ,-,,is-,ix ccu. 3, infects- XVI INTERNATIONAL Six-Spleeddspecial Motor Truck Built with a two-speed axle that enables it to out-pull, out-climb, out-per- form all others of similar rating under full load. All units of this truck are as good as its great tractive power. It is ideal for agricultural and commercial hauling, and will haul heavy loads in tough going. Call for a demonstration before you buy. INTERNATIONAL HARVESTER COMPANY of America flncorporatedj 480 North Schuyler Avenue, Kankakee, lll. f A , -ef' 5 . N , - , ri l L 1 l 1 l X i 1 l li w 1 l 1 it xxx Wt I A f, as We N 1 is Q Qsvll ,yovx ,ff A r df- 6'- l fxqilx 'ly , iii lillillll x ' , 'A' UW -fx,-f li 1 l f XVII we ljlxi w r X y ll -.1 Y Y ,,-,,Y,,,,, ,W , I 3 'l N i i x 1 X, r'f l X X Y, W x . r ' xrfy Q xl HX M-. M :H 'wx' Ib. in C -X , it A W .ms X, , A, M xl 'X Everything in Musical Instruments Supplies and Repairing A discount to all students D. C. LINT MUSIC SHOP 280 E.. Court St. Let's Go to WHITE BROS. Short orders and sandwiches of all kinds Soft Drinks - Candy - Cigars - lce Cream Phone 4269 348 E. Station Street COIVIPLIMENTS of ERZINGERS' Pure Food Stores uality Foods Our Prices Are Never High AX AY 'St .ff I Xe ny Zilixii N Xt 1 Ti- MXN 4 XXNXQT5 w y 4. ,XX by , 1 J ' f My L x f its li 'T l N- 1 f ffl' ll X . , Klfff' xx X ,-Q., 'Q aff, ,li,Y,i,jf T,.4,---4.k., XVIII STRAlN'S PHARMACY The Prescription Store Cut Rate Drugs Koclaks Candies Paints Varnishes Phone 46 Next to Woolworth's THE PALACE CLOTHIERS Now Located In Our New Store 178 South Schuyler Avenue l Come in and see us STYLE QUALITY SERVICE I 1 - 'l ii -'L l LET Merchants since 1859 Y SUNNY SIDE GREENHOUSES Supply Your Floral Needs Where Dependable Mer X ' 1 Henry A' Busser Mgr' chandise ls Always Low fb Phone l88l-Waldron Road Priced frr, Q Vx L X . J 41 lu -' 'v XIX e.,L,,,,.u,,Lu, p 1,3 pg ..-Y . '. . gl' xp .fj X s Y w 5 ' ' 3 IH, 5 ..-5 E ' - - 5 Evfx 'X Xi ,ly s if 371 0 N5 1,1 ie9mg,:,y1EARAg5ANr sr. 1 ,fri 1 in ' X X 15-it 1 41 H1112 'Q 1 ' A C A - Kguss arm ' i J f A complete line of Gruen, Bulova and Elgin Wrist and Strap Watches-Stop in and see them STANLEY'S CAF ETERIA Always Glad to See You 360 East Court Street Telephone Main 4210 l l E -I - 1-4 I i PHILLIPS 8z FRIDAY 148 So. Harrison Ave. E. E. Phillips Geo. L. Friday Phone 3067 HERE'S HOPING That this year's graduates may team up with prosperity. That you will be a credit to your parents, to your school and to our town. Buck the line- piay square! B. B. FERRIS fm 182 E. Court Street Svfrx ,QKX it f M 'Q 1,-up ,i x - i N ff! X 2-'A' X X f i X If XXX X ' Y XX 1 X X he - y , .rr. M-, L rt' i X fx , 4, , i--,, t,,,fg,.,.f5g, ,,,,V ,Lf,,g.g..vY--g,.. XXI David Bradley Mfg. Works Bradley, Illinois, U. S. A. 1 Manufacturers of lj ,gf Agricultural Implements X Farm Machinery Tractor Tools T Implement Repair Parts 5 Hay Machinery fj ,fi Hot Water lncubators Coal Burning Brooders S rl, Founded in l832 would mmf W fl lf, fm X l' J r Nl all lm.. FLORENCE STOVE COMPANY 1 N Q LEONARD DlVISl0N Kankakee, Illinois Manufacturers of Electric Ranges 110- Oil Stove Ranges ..,... Oil l-leaters ....,... Gas Ranges -1. Gasoline Pressure Stoves -41611 Carpet Sweepers N o xxxw. A .V 1 f . X in if VF S1 , 1 a 1 'i 4 It tw ' 'Bi-Li lT'x lliibli XRLXZ-X N A as FNXIXKS li? ' if U Oil Burning Chicken Brooders fnfsfwg,-f Air O ff aa A as if -X NX Y w r f V N V U -X A y ffl' 1 1 X 1 I KN xi gli fg ff ax rj ' Q Q514, , ' 'f , M Fm If , QQ 1 4 Q 1 Y ' ,-1f- ' X f gf K XX , L4lgu,1LWJ X J' al, Q ff 4 'N ld , w X 1 . w 1 1 In f W -211 - v X 'iiww'-' fu: -41' 2 NX ,,Y,,,-,4L ..-4v?, ,W ,X - J MA ,w NNI HUFF 81 WOLF JEWELRY CO. 280 E.. Court St. Kankakee, Illinois Diamonds, Jewelry Watches, Clocks, Silverware T , I f 'F .Xl N . lk, X, ,M W, ,X , MMM' .xl f 'X ,JIM -K, xiii You Can Always Do Better At ce .. 3TH1Wn:fW7 Q of 0 9 5 I womens wumua APPAREL j Kankakee's Foremost Women's Apparel Shop THE KANKAKEE DAILY REPUBLICAN Covers Kankakee, Bradley and Bourbonnaig 92 Per Cent CIRCULATION NSW CVER 10,000 1930 Edition of Kankakee High School Annual is a Product of Daily Republicank Commercial Printing Department. V if 2. Y X. 'fifrxl f .-'gg 9, gi I 'J 3' ' , ,I f fy I -. Q . , X K lgle Ask- '39 X 1 Xe 1 W f'T....-.Y VYVV -.AA XXIV RELIABLE CLEANERS Cleaning, Pressing and Fur Work Glenn E.. Cooper, Prop. Telephone Main 423 279 S. Schuyler Ave. ' STANDARD HARDWARE co. 'E Builder's Hardware X5 Kelvinator Quick Meal i Electric Refrigerators Ranges , AJ Ruby Warm Air Furnaces A 253 E. court st. p Phone 259 N 1 1. c. PHARMACY . ..,- f. The Rexall Store K Opposite l. C. Depot Compliments CUT RATE DRUGS of gaffjy LASSERS X cigars FURNITURE co. Local Representative: A. G. Xxx Spalding and Bros. Athletic Equip- Esisxfwxpf ment, MacGregor Golf Clubs, --o-- L, Crosley Radios, Telechron Clocks. ,T YQ , I ll Ml' Aflyijf XS ' fgi' 'K M1 Kali 7 A HW If P Xvly if li J XXV L. 4 - QTL Qi fi' JEFF ERS 8: McBROOM Distributors of Automobiles 820 Main St. Phone 220 Hardware Graham Cars Radios Cadillac and La Salle Miss Pauline Tull, instructor in public speaking, asked thf: greatest class that ever spoke the English language to report the next day with speeches on True greatness is seldom appreciated. The Unholy Three could neverafter figure why they got a zero for the day's work-their speeches were so goodll Shine told all about P. T. Barnum while Lee Morris spoke on Lon Chaney. Klafta told all about Schlitz, the man who made Milwaukee foam. BUY l o Occldent Flour For Sale By All Grocers -x X fl? Fo Go Q- X H Wx -EX Wholesale Distributors fill ' dill X. fxlrs f KH vt ri MX All! u ' N x X L mx XX X .Q f Qs iii ' -- e , M. N f' .ie , We -774. - , Yf..Q.:-.H-ffL,,....v- ,v..--.....,+,,.,,....,ae., x XXVI XXVII BAIRD-SWANNELL, Inc. Hardware Department Store Quality Sporting Goods Tennis, Golf and Baseball The Lucky Dog Kind Telephone Main S00 ln working on the annual several incidents, patheticland humorous, occured. One which will cling long in the minds of those connected with the putting out of the book was when the period was extremely trying, and it was feared that the expenses would leave a huge hole in the funds. After all were nearly gray from worry, Miss Anderson called a confab of the brains say- ing: Now, about those borders. Whereupon the inimitable Klafta rejoined, What, must we take in boarders to pay for the annual? Buy only the best milk obtainable. lt's cheapest in the long run. Buy only pasteurized milk. Raw milk is often dirty and diseased. Our Wagons Pass Your Door Before Breakfast Kankakee 'M . VN Pure Milk Compan r ycgfnxrp ,J f c- wwf if WQi7wM-iiiiifosi' ,X ,Of lf X , . v f , K 13- N l X X 1 kiwi , N , 1 -4 -4 Q ca, x Fl JN lx swf' KK TOL.SON'S Cleaners and Dyers Hat Cleaning and Blocking 1 Tolson C. C. Engle l-l. L. Rernien W lx 379 Schuyler Ave. Kankakee, Illinois I -F - - 5 I W. W. HUCKINS sz soNs I i ip Dealers in I Hard and Soft Coal Phone 229 Established ISS6 I Y i T . Graduation Day A Treasured Photograph R The youngsters may forget. But you must remember. Yours is the EK' priceless privilege of preserving forever that eager look: that beyond- I the-Alps-lies-Italy expression. Treasure those Graduation Day photo- ' graphs. iu l EI BECICS ST D10 yy' ig .. ,XXL if 'X ! ' f ' xox Iii-X9 'I WM N. Schuyler Telephone 407 J. ,I, I I I' I X , Q, u W W x . QX I . .frxs fi? I XXX f if 1 , I . . -. M 5 In X' Qqw- I J If I l 1 I I 1 .XX li! ff.,-' if. Aj , , 51,4 LW . r. -.1.ef.,.eQ5,,-.g1a,r,r-.-,., XXVIII ,. .. , ,,, At' it .vw Ai. w 4 -1,-sz' M . .W- X Q , , , , . M, . ., X ? , ' s I pf. i qi ,f lf - 1 Lf X I f . J X X N l i r t -:. -' I F- ' K K 4? 01' YC-Y f'5?'fS':-YS?-.r,S.. E35 .nw L21 YM ' ,M .Q J + .Jr -.13 -a 1 ef., ,fm f 2 EEA ui gi T3 r. My 3 1 A 'e We .gi .1 ,Q 3 3, ' -51 , ., .4 1+ 3: 4 1. if .. . if ' 'rx l? x Q w. V X 71 X 5 f'T' Q Nw WK 4 7 W 'fx N i ' 4 ,l J Ai '45 ,-f' -42 Hx y Qwn eiffemories N XV, f bf ' 1 J R 1 fx. 'SL. W N s QQ , ,. r . PK NI X I I I f A s 5 x X N Q K QV! ' :L V - . , U 1 , 4' .N xl' J ' .. H ' - .,-F-? 50 'fbiiiz A- ag P: , X '4 x f f' avi' X fl V ff, ?,1v.,v,???,l,q ,TW ,J . -.Q mt: . , V, ,,.- V, ,,.,,w.f, f 1 .. ml ,114-,,f ., in Li M' ' ' - I I Tl. 5 ,fi X 0 D f X Z iw Vx Q, 82 N W E Q : mf M5 A xy! xl If I W his I :Aff V5 ,A NK W Mm y Qwn e7b'Cemov'ies MW? tm x 'Huggy 2 N x X, . K l .' ,. Mf ' .1 M 22-1-'JK -ilx fix .SQ RX' S V'-'5. fx Pj N5 f I A . . X ff X . xx. ,N ZHTJ-V f 9 Q Q f-A af, R ,.v , T A Jw 2 44 fx:- 'qll.5.A,, gf ,Xl .7 -1,wy+! 5 Q., . f i- , A 4 A1 , , - , , . , 5 . Q. - , ' is Q . , -' K fx. ,V - g- -5 J Q 1' is 1 . X- 1 1 fy v: 5'.f'Fa -I . Y. . I K I .3 Yf -gfg.--gr' ff- Q . . A . -s nun.- . ' - . ,ew ' , A ' .3 - . . 1, V..'. V f . 14,:xL:', . , M, 1.4, bgw . -1-.' 'ww -fwsfw : ya, L- . .- ' - -Y ALw..j.Q,,f,, -AY., 26 Jg,,'.l,f.LEiy 13 ,L .j- w 4' W j 1 wwva aw ,fy ,, , Y g ,g..,,5.,14,g.i,::,.qqg:5+'Mkt - -. - M, - - 'U 7' Ji'-3 fu'i1 f f, .Ax 4 V 'ft 1 ' wr.,-1-,.-' A- HQ gg.. 1.0. - . .V x ' - ' ., -f g':'?5:1a. .-1 V.. '.a1q'fT'2 , A , .,q-,ixw 5fNj,,j15,J Intif- -f.j .Q 1 iii-VQ.Lj3:fQ,:1,, v, 1 Q4 -.fig 'Sax-ef'-2 , -M L' 4, z S. ,1 j I: A me i 3.2-'gig 5. A4 . . . ,. - ' ,ggi 'fr .yrfifqpf -K 1: .yfrf T, ' -' , R .V , ,111 '- ' -1g,?fiii?' ag - v 1 V ,P f ' xv , 1 5' wg , Y w Y w.. 1 i . ,, W Y . , , -4 fi A I , ,V ,sr - - ' , , i- 'Sn 1, t' ,S-V. , ,Av 7 , . 5. 'gt I ,gwmfgif M399 ' 'if .. 45, ff, 4 .' , 'fjr .-F-1 4 k ' - -1 fri, . VF.fs'--f:g+f5.Q3E1yafiff, V' fm - ,H ,-115 v' I, . if ,' 4 . sv X-,Qi9a:ui',fiiiff2WQ'11.'3. ' .1 W' .Km ,, U '. 1., .. 54.-'V ml.-C ARA? -,sf , Z . 3. - , W1 -, w. ff V, f 1 i.3.QL.fwf. Q .. W 4154! .1Lf'.,f.1-,!', ',4'i..g:,5f .328-fgsggf?,f' 1 ,ag . Q Q.: , W1 ' 4. 32' . -' pu,-:,m- f gg, ., '. 'gg' f'f-5,545 - 4 A fr. ,. .. 5'f1'3g: f'J'?Q'A ,. rfb 'W' - ?d'1fhq? . , - ' ,,',n.TY'f0gi4,,gQ - ,.,.g?ji'ig . V' fr '- f 1124.11 . - ' ffwiz , '- Xu . - ig-' gy .STYQAE-'14'-f?:3Q,1tf-,', .Q K , N L .Vh, A 5 ,A .4 up 25' ' ... ff' ..f -vw M 1 A .-44. .A . . ,M ,ww-.,f x -1- f:.,gvQ- f , 4 , , ,Q A , , , . , 5. -.r .4 1, 5, '45 - f1'., ,.1'j.. .fr ' , Z- -if-inf ,f N ' .f tif .ff ..f'Kj'f'yg 1 ..Q2T'f'j . 71' .-fl h ,..--,. 4..,f - K. ,- -,z' ' I wa ' 'WV' Q .LS ' fu-V' ip V : 1 . : ww .:..,! -.I .1 . 5 .pg ,g ,V . V' fwj, , Nsfffx J- Y f QE b . .. j, Ak Q . , ' , , ., if ae f if 55.1. y - ' 425 , .A ,. ,- f - wk qv- .Tm 11'-f -A ' 1, . . A '- f ' . wr . IV ' ' ...g..F.!,.!+ ..,..,v 4, , , , , . - , -...vm .,, . ,, f +1-.k ..' fJLx.,xu5,i ' 'ki vw,-,. ,L ,gp ,. .., ,, , . -, - , , Q 1 K, .,.,, .WA V . .5 , . , ,. , 1.-Mfzfi? . v
Are you trying to find old school friends, old classmates, fellow servicemen or shipmates? Do you want to see past girlfriends or boyfriends? Relive homecoming, prom, graduation, and other moments on campus captured in yearbook pictures. Revisit your fraternity or sorority and see familiar places. See members of old school clubs and relive old times. Start your search today!
Looking for old family members and relatives? Do you want to find pictures of parents or grandparents when they were in school? Want to find out what hairstyle was popular in the 1920s? E-Yearbook.com has a wealth of genealogy information spanning over a century for many schools with full text search. Use our online Genealogy Resource to uncover history quickly!
Are you planning a reunion and need assistance? E-Yearbook.com can help you with scanning and providing access to yearbook images for promotional materials and activities. We can provide you with an electronic version of your yearbook that can assist you with reunion planning. E-Yearbook.com will also publish the yearbook images online for people to share and enjoy.
