Jamestown High School - Red and Green Yearbook (Jamestown, NY)

Text from Pages 1 - 112 of the 1917 volume:

V g, 3 1. . .v ,V Fw i ? r T V t. Mx 'K f' 1 , ff V1 5 . ' . , :QQ N. '-l' 1 is ixi za YYY' im iff! M W W m .nf M! W M M M 315 li? limi 2112 mi ' WN utfitters for very gg 353 Xu Qu! 'ri' W W . LII' SZ .w gg H O W U gg m W m W ,Ill iii 6 6 7 7 im W W or W ,m M. m lx, . im . W, 11:5 M W mt W rug bd w W 'til 1331 m1 M E if lm wr DU W bd W M W W1 X J Ki? wif pn um lm rw lm srl bil fill gui W pq :xg '33 53? ina mg M M E3 H pq up D11 LX, pq 131. H S ortsmen's Su 1 Co W P PP Y - Q INCORPORATED Q lm :xi E Th' 1 s ii 5.1 1 5 ast lrc treet ,xl Ei! iii? lu! IR' M W M W M W lm UK, w M M W IR' 11:5 M V M M3KRWWEFWMWNNXWMNWNNMNHFFWWFWWHKFNWNFERHWFMFWYFWNVMWFEXNWWWW WMMMMNNFMFXXMEFENWYHFFFWXWWWXFFWWFNRKEHNNWWNEEFRWFWWYXWRWMMR u ixi ii'xx,1fiiE:xff31 Swim xg,xi'jxx,gQz'xrgxlxziiilxxxxx'ix,iix1,i'x1.xx5x.:fxx,xx,:t E iixxxkxi xiixnxt xl xilgmx-xx'x1,xx xt xiii ax' xf1xx'xx3xx,xx lm 'rx' 'ul lxfl llvil ll! ikl DQ e E5 AR'l'ONE PIANO lx: . . x For Better Music in the Home 2 Pi- . . . . . 'lx lil Rubinstein. the Great Pianist once sand ii l ' . ll! Gmc mu fl Gnorl Ijlllllfl, 111111 jf X23 I will gizu' you Guull D1u.s'iu Sl M- is SOLD M' A PRICE WITHIN 'l'l-IE REACH OF ALL lxx' --+ xx llil lil gill AHLSTROM PIANO COMPANY li gg 1xmNLrmc'1'LJlua1:s gf 5155 Fmlxr,-, im-1 I4-l us East swmll si. .mx11as'1'cxwN, N. Y. Si pg ax px in ln! 'xx pxlxrlxxlxibilliiiizblIxillxtliu'LIKTQElii,lt'lxt,DlIixxllfixiliD151cDKlxtlxliixiIlS'EEiD!.,7t,3lllx!'lxflxtQ,xUBflxi,lhxxlxi xi1xx'pCiixx,xrxf'i ii',:rlxz,sn xfgf,:1,,f!,,- ju xg gn An, iiyjilxx Vyxnxtixx xr ki: xQ,x1 71 ,xx',xL xx xx 'ggi xx ix lxixi x4 xixg Qi xx ,rx xgsx: Xxx xx xx xiiiixg xx 'xzfxl xc' xt JI lifflixx xx1xx'xz'u,x:fn' xx' ' .1 Eli, S, Qxx, xx. :ul um 75 7, 8.5 '70 95 in :lil Xi fi ul lvrl lm M Lxxl Di: 311 ,xr 3:1 x ,xii xg El all liiz fs lil The high percentage in school is made by the ,xc . . , . fi gg student with perfect httmg glasses. Consult us gf' gil about your eyes :md school work will be easier. lil ll' xi nv 1 - ii 5: DR. STANLEY, Optometrzst ln . 1 V . , . . i . 'fi QE THIRD S'lRlulu1 OPP. POSI Ol' lf ll E EQ fl 131 no x ml 1:1 PU , ., , N . ., . ,. ,,,, ,N , lxxixxmllvzlmxxiaxriimx x1,lxx!n.xx,xx mxwxc xrfxvlxx mx mixxxxxxxxliruxiixyxlxxxmcnxz :rlxxlx:,n'xxlxx-u mah: x:1x,xx'-mx x1ixi1if'xx.x:3xx'ngxx,n xox- l sg 239 uc nr Bti ,,. JU W5 rl? F pm xill ilil S141 lx! ang lil: im E W WI Il: iii ill! ww gs 311 L! 1:1 E! 5? J F51 li W ll 1:1 W DS! BK! B M R B N4 M XXI 1x1 mm mu use nm su M W vs, as ESQ IK W1 M iw gm W gl no my we PQ D? 211 Jii W xt! Ri flfWW3fT!iNlXlXTS1'liiiiX5fE:ERiiifiiyibwl ,li':ti'15Yf!llid!i!l1sIQEi3X :KEIDCilC-1579036118 K 3 REEE'EVYi5FJi1rfM3i1'1lTHEZ , 3 F , ,xl 3. .iff ,FU ,Rl E5 N 'xx' .. em. A p ,.- v ..-Q uE,--,,,,i- - , Eff QE? F ffgvif-lbw 'lid-fx-w e 4' 'Eaflff Q - X355 u 3 'Q M1 At Your Service n we px . .9 lx' Vi Our shop is equipped to do your g Ee FINE I ' xx , D i I JEWELRY VVORK QE- 352 fi ' s 5 1 . ,,-1 fx ' I U1 ! Baldwi-n,'s ,Lf Jewelry Shop s --1 ii: 'l'hi1'd Floor, Xvellman Building : lg Mamlfixcturing Jewelers 1 14:1 x X ' I ! M s-' , 55! :, I ,xr S 91, . U1 4-W ' ' 1311 .gn Jil Q9 1111 XXI fill az , , I ' XSL Y-.. -- 1 v l4 !'Y' . D 1---' f wfww '+ V I ' 1N3.:f. or ' L 5 I 1x1 :Xl :xi ji Pi' Xxx' .x xx , ..,, . ir, . , . .. , . . , , , , X Iixiilfixwxtrx x,x4ug1xJRb111ilmx.xx x:Er1.uJmwx'.xm0xlXeX.KAR350135211xfh1'ilfwf.u',l!?LKI1KQRQXYBKQITAKiTri'Si,li:l1'IlGn'1lx?ixZixt'DtW xfpi ElEllilBiliXYElElEIEilE11RIiTilE Iilf8IE'liX1Eg3 bfi ca m E Delzghlfully Damty! v i E N -that's what they say about our specially hn- M R2 ished pictures for the sweet girl graduates. So f K2 much appreciated in after years. g Pham' UI flu' ll Silling Yblluy Home Phone I3-I-I EQ! The HOLMQUIST STUDIO, opp. High School gmiaaiaeammwaiaiiaimax mmnmm aimm'mman mmaMnninzmWE ramuzziwcwrmrwvvuamazmarmaixcfaaxarmmiaavisawfmmmmamaxwmaummmmmsaxummai:iwmisncaruxziiafcalfi lil I N , I I i il lg BEALER S SHOES of QUALITY im wi 1 ,, an Not How Cheap but How Good Q is the secret of our success E il. tni bq WM. BEALER 8: SON 9 East Third Street EQ H0uy.r Silk Hosiery, None Bzller Q ul lK'I111liblliilllxllmIEWEXWEEOIYKLECEITEWEDREIiliibillftlliflliEDU535EIZIEIISIHIlM711ICl!0El1ElEliEsIYQElllRIi1JE1EllI?lUWl!lTfW!:HElEEV1jt?l DCIBQlxtllKH111341xhtmlliillliMill517EXUIDSIIUJQIIEIllxlW!Rhfliilii4EE43EIEIXTNXJZIEMEliil!willNllrdilwiiiiiiiilidfxlitlimlwkdbtllrililiuihiiiii Nl H E fi ll This bank has faith in M on - ei R E A SO ' your future and welcomes 1--ll your account though the Q QQ beginning may be small. QI That our methods are right Q E our growth proves. SI Grow with us as we continue to LE Q grow and it will later be a great satisfaction to you to be gg E associated with a bank of this caliber. QI Build for the K3 future. Begin now. LES E3 Gil W ra ml rx FARMERS 85 MECHANICS BA K wi E JAMESTOVVN, NEIV YORK E' E3 ar lwilKlJNXTEiHMR lEmHWHWRWW 'HE E DEIXXIWRIEQIWIXJIEIZIIE 'ELA Y' 'x.:2!5.J..KL!.!1..uK E' W' EEE LEASE '!.K g 5 1 5 2 2 2 2 E 'ug'-I1-va-Qu E R1 z I 3: we O 09' O L: .. QQSFTEEES 33 E51 :f2i5z5'25'2.S S: f.'2:g,1JSrQv cp sf. Sigiaigsfrgfj 5 2 fs 0 1 5 55- fn 2:J'5S'o ' E. Q5-UQOQSVJ E ga 5225352552 O'-'S E N. . :ffl-1 ' Z.33EE.9'3 E8 iqigfiirfiiismd. A GWO- M031-.. :H fn: lf ::a'Q i2 - cg, cnig... 4 , san- 1' 55,4 I-.:: 'Paw-S? HEC'-' M2ga,2+w:L 5 Q oo 'Q 3 N' L U1 'E-'3 are 2-3.25 CD C0 91 1 70 -I e UQ O' dm mm N rn --9' Ig '7k5s'a'N - 3' ies?-fSqwE:ii.iV1 5 fe oss, 92- wg, 2-2-12ss2,2',gz.-P ' ,Q ' 1 -'Fi-1: no 9' 7 a 3.93 -. WQN, E '22 2 12 .3550 :T :Q binfqlgm S I ?2E's'g71-5245595 -. .,g,:- U2 Q saw g we :fu-ar Q cn Q.. 2- .,, 1,5 -.mg fl- E ga w?Z:1:Q'f D' Z . -- eo-'4-' Q Eg-mrfifb 9: U1 2a.'f-M5295 Q '9,4'f '1UQQ 5 G mm 1 -- ' ...nm a SG-SEMO 1 mg 2-gHQS'1fE f- 53 uf ,-I ... fn MUQCDUQQS P5 mg SZ Qfiggrgggm , gg, no :r'3' f E is 5 G5 452 ri- P Q QSNEOP- CD E 195: :H .... ' H ' ua V.-0 , as wwf, Q E D N' ammo ', .92 ergo i:'::.1.4 E A - O U' QS 5 mg 4 2 2-E ze'- E Ffaw FE-5 S: Q w ME S Z 9,5-5233 ggap aim aria 5 Lx. - .J 7, -. ,r ,E -1 J 5 -4 1-s. n UQ - :Va O E 13 2 gl FEEL E Q . v 5 ,g 'Q Y' F50 0:4 3 f Sa 2 f Q X2 EI5i.1iE'5'- ,EL'ilZ1EEEZXf5?Z'ZEZAi2ZFZiE.5 052255335 EZ'EZ7ZElEE'EEEl?.EE K EEZDLZEEEEXZEZZEZIEEZ iv., 4AA--LL I A - A A A4-A4 44 A 4 A-0 A ' Ei? Nilllllllk Ilil!KllX'l!OQl11filiXillSll8lNEl5ll!lCl2dMlE'l3CElBll3il1,HSDSLE5il!5SfN1iW51fRWIllT35533132D11UF!'BTlN'DCNl1ClK3!Ti1IXfllZKfll lui xx! X. xi tt, 'xc' bfi wx' M P' 'W Xi' 31 x xi X. Zi if gy Perpetuate the luendships of schooldays gig with photopfraplms. A E mx ' E WX . 13 We have received some new and ex- 3? cluslvc mountings. Ei .ni 5 lx ' J uf ww gg Would be pleased to show them to you. gg -1:1 M 'xx 5:9 bd . ax! lm Pti li The CAMP ART CO., Photographers lf D5 em MAIN STRI-EET .lAm:s1'owN, N. Y. gg 5:1 1 n 1 allInmm'1:mfnywmntm9Xm:s9x3mmLzclmxnmwwffmQmfnsmfonniuminixcriiIzmxsxzmcmragmn:fmMax:inaislluisrfiaezwmiarmirrflh :I'1cfx1mgwwniMSsWx2Q1es95f:uwrzaSr'Naxfmimrszflmmlnawxlsirisig :KimmnweMmummmmmlmlmixxzlrnrmzmfifcawning' W . iz? it ill Q2 v E lg. Ge a dak gg vii ' Bi 'xv t Q 5 a 3 rs s , E2 gg : gg Ki Let the kodak Bunk Help 21:3 gs! if 'F 3,3 Sim: 20 dimes for in No. 9 Brownie N Save S0 dimcs for an No. QA Brownie Eg if 1 22' lg? Save 40 dimes lnr a No. 3 Brownie Q ..-- , - , . Q 1, -. ' '2': Q gg 35 Save 50 dimes for a No. 9 Fold. Premo eg in ' iv 'L'3f'if2-Ei ,x iff Save 60 dimes tbr in Vest Puvk. Kodak Xl V V Fave GU dimes for n No. 2 Foldgtgwnic Wm L. L L.-: L. QM-4 Q,-5 .,.... M 5 , M xi A , 1114 D9 :ai lj Appmpnme lmlhl enr llli Src Our lfimlvzv Dixplny gg me fur every on-vnslon ut ini ful ,Q prices cnnsimtent with ,Q ffi Q good quality. El El Ei 53 Swanson - Holmberg 55 FRED E, HATCH 5 , -1-1 ' . E if Shoe Conllmnb I0 Eask Third Streei 5 rl- Malin Street ga: 'X ii S4 ?f'Jf3.WMlm!5101335NFB?X35'iEl1i5i!JJfl!I22lJf!lJ3E,35i!EX! M D1Yi331D5311123'WEEEEifiiwliilikwwiiiiiiilililqxil F3195 X'l!,1lilE1fi?iTJili1'IliE!1ill1'flffYGflf3H7YlK'-1CY1Fii'i5f'1ifYWW5fBl 'bliilrfii Di rfi51'5TfEiifDi?5T15fREMIXVR53GIEDi'AiUD17iiWWWil!ZUi!Q1E xl! my ,xl x X, . . Q YQ Base Ball, Foot Ball and Tennls Supplles W . . 1 ig, Hardware Auto Supphes Sportlng Goods gf if Q? uf I I . L .Em We have the goods you F54 Q'! f' need for Summer Vaca- Q53 K, f, tIons or Camping Trips. 2? Ti if wnmus THE CARS s1'oP fi ' ' . be 5:1 .Qur line of . Jamestown gg Flshlng Tackle IS d 53 Complete df Ware 2515 and of the Best Company kg wo w. THIRD ST. Ing L, xx Ziimllxi M51 1XX'lilQX,iI'!ZV!K Ii!!tSHxiJXYEI7,ril3ibdlziilifiiiIIKIICYLQEKITBIlXC55Ri!PfEliil!l'!V1 EEEVYTEJXM39191If?fT5K'l1l'1WI!fl5i11!QCII!2WlN NLE Eftfiliibf541355Si1XWIDlfl!i!?3F!i!YkiK'5!TV1'fJil'iK'5? 'FWFiiNWlUiQlWNE5fD!iW5CIED3 IEEIDIIMNWEFMIIGUQNIF ' xl In V5 'xml .I 131 if fri ka lm , D31 aw ' B11 ii? E3 C Wy, 'W 25 I- w E iq E, a r. A I. 85 E5 ORIGINAL SEAL R3 E2 D! 531 w QI D1 W If :Xl tif - E Natlonal Chautauqua County Bank In , ' 5 Member kedeml Reserve System S Eng lui an Dr: EEEEKQQCECDIIEWIEEMMKEQEEMXAXIEEMHIKKMlZ'!5IiEIVSiD5:L!I2i!'MB'LSIliMi!IKXKIEGI1QIi!MI3iIYEEiJElGWfi5DQB?'I5SIlilE?I:IlQF FGQEMEBMMLEElEEl31lIRTlSlli3lBl?QllfJD3lELiGX!liill2iLlZllEXXiElQQ'Ei1IMH!0.1RE'ESBlEMElf6SllZK2iEllEElIR5SLl3lEDiEilf3DQlZl!llE8!Sa ul - M Ml lil li' PROUDFIT'S .xl SINCE EIGHTEEN SIXTY-SIX X ua n Wrlh belt all wound. 'Phe mg norms for you are lil I-IAVE your suit that way thesezu they Me. all style El if you wish or with a leudersg the filbl'lCS are all ln! ' . . ' ' ' . , lil half or detachable belt, or Kool ' theflfllonng 15 an gg without a belt goudg the ht I9 ull rlght. L 0 Hart sclmmrer Q nm.-X Your Satlsfactlon lil make them und they're here. guaranteed llil X an 1 M . rg: 820, 32250, 82.9, other makes S10 to 3:18. rr Fme ussortments of Hats and Furnishin s 1151 ll g Q lg PROUDFIT CLOTHING CO. F5 eos MAIN STREET lil Fil xmlanlimirmQmmanEwasfmmelmLumlmmmmwmmmmummmmmmumwmuwxumlmxmmmm gummmwuxxnzmimmcmmlzmaammmmaxmug fglxlmmgygrmmwafmxmamrxlgllmglmmfmxmvzggmicmmii , K rm LQ lil L lvl na U 5 WM. J. OLSON gg Studegts xx we 1:31 ' M U9 zwzlrr :mb li ttentlorl H Q il lvl E , FQ Q ilztlgtillltt U e carry the famous gg lm , , . , , U1 l I Kwqffel and Evscr lim! of M EE 10 MAIN S I REEI lg 5 'lIIl'l'flll7Iif'!1l drawingand lg Join our 7711112 Club and dfflfliffgi11S11'11f11w1fS lil nwu ll Diamond Ring. Ou Q Q2 Sets of Pens E2 gm the dimes und nickels you Bl EE I Sf'Un'e tS 0tllEl'WlSC would spend you 5 Slide Rules can souu be the owuer ofa Eg li scales E3 beautiful gem whlch we Lg Irregular Curves - El guarantee both as to qual- li, 'l'riHm:leS If lil l'9 1d 'ue' lQ'iifZ'l,1f'?2..rd5 gg F1111 ffllc Qf ,VlllChBS, Jtfw- Ei Thumb Tanks H! H e11'yl1'ldS'lUL 'w e E 5 Clark Hardware Co. lil EE Ifing Engrfwing' M Everything in Hnrrlwnre Eg IU!!-lll Main St. 131 ElDEET8lBlEBWEEMlEBElEME ElEEM1EEl M EEMXMEELMEBEEEMEUEEBHEENEEGEEEE Z E Z E E 2 5 5 E E IEEEXXXEZZEEZZEZZZFZEZZXXXZXZZCQZQZKZXEZZ F1 552 Q vii - gag Sign ...:f, -1 ,,Z 'isa 'FS sw o 5' O 113.2 -I :s 5 ,.. G U5 E, U 525134 H' O N PU 102 Q - ei N E4 - -' ,A : E: UQ fb 5 'J-I ,-E--'E FD n-4. 5 x 5- TCU-v Q H' 1 o : -Babe, G :' :i ' : -4 i Zi: :mi 'E Q' U5 as ' ri I.: 4 O 'Q f Q Q mr-G 3,-...-:h QE 2 '25 t lg w ' :ez gi? Pj -4 'J ' iz if QQ? J' E'fw2 S E. ' 3' E Z 5 5-E2 .. U55 U3 :F 5 Q ,.,. sr .-5: -I FW .., fb rp Q gr W- so XZiXZZEX.LfE..-.ZfEZZZEEZ'EX'EZ:-1 37523 mi E 5 E E e 2 5 E E E e E Egg .-X soldier in the English army wrote home: They put me in the hnrrucks: they took away my clothes and put me in khaki: they took :iwziy my name and made me 'No, 575': they took me to church. where I had never hecu before. and they nmcle me listen to the sermon for forty minutes. Then the pnrson said: 'No. 575. Art thou weary. art thou luuguiil?' and I got seven days i11 the guard house because I rm- swercal that I certainly was! E'lfM1Z'L5!1B!Lt!ikIR!EXEXiHE!MMXMMi8EMMMER EB EXN5NKMDIMIXZEHTE N, ni ' M 5 Students E Ii Get n piping hot dinner for 25c nt in at E The Japanese Tea Room gg Just ii step from the High School Q Lunches -:- Confectionery -:- Canned Goods E Dlrs. Emma Lacey, Prnprieior Q gg 370 Exist Third Street RTEXKEWNIEIEIIEWWWEQQZIEIEIKIRKENMMWEMIBIHE IEE NW EEIiRMWl!NMIlilNRlE Nl!!Ill9TJi l!1!ll31lN'll!'3? 'i.i?'5!7li Pl Ji xlfjllXJ!iF,3?ll?E1iiDl'3i :xii xt Qi R xi rf 'xi' if M3153 11 IOC 14 313336 li mx xfB1'Yfliiiz' lm md l 1 - 1 lg +6 ,4 54 N I-'mn mums El -t 45... w ' H'-NZ -4? mm ll.-an-ries yd 1 .6111 4153121 621411-0. . ,mm if ,W I otawracguiragv W , Fuuuluin Ml mown.-umw .4 M 1 rm lux pg j V' - 'NN ' 1 ' .1 In ffl . 1 J I 1:1-rsull UQ Q2 -1 . V mn--lws lil 'io .,,,,,...,..-cr-U M -..,1:i'iFQ:-- H 5- nw- - - fue - for rum' T1 Q - iid: '-' Y -- vm-mam- 53 X N, vw e - -f 014 Town 5 Fine Tools E . EI S Cutlery Canoes 1-Cir the El lm 'e 9, in: 4+ . OHIO irc gg lg. Curry 1- nom: Get one now and enjoy f mu-:I-2 UIRANIV' , , We me ul- ll-f 1. ' ' lil X Q, rocxm' Ksnfrz. the finest l'6Crentl0l1 qu.-rn-.-S nlr 'ning . gg . .' -- S-mf . . in .1...-mm... ggi pn '1-' SATISFACTION possible this I, E M ,. Gmini .un mn-X im.: all M 5,5 ,. , summer vnrlkss nl mzhl En, gli pn--cs. .nl if M an 5? C. A. LUNDQUIST N CO., Jil xx lui mn 3mgarplxx',rx1'xt ixillx AHRXZMMEEwxlixxllrx'.xlx:1x1i1n lrffxmilxsl 'lu lx: .- FRO M the - A news we :if E ? H. 55 ., l. ff' K . lx , U i lg 1 obtaln from lg? 555' B the Enst :mv . . ,4 , - Yil . ' Q r I 4 fi X lx xl Q' Sprung. -Q light colored if s ' ootwezu' is the thing for this gel Col-do Tan in high lil . 1:11 or low shoes tor N. Dil the men. W Copelandis' IValk-Over Boot Shop Q S03 Main Street ffl Hardware 311 ll . .. ,,.. ,. . .,. , , JJ 5301106 xrlxi-x.x.Y0x2fx'51Ilxx ml.s'm1.wrlm:.xz.xnx1n,b4.w1,EImlrx mal! iii .fills Ixlhn ltrl.zr!lxsDx1l!Qm4m.3i3fQ1QIMDX lrlhvillr f111imxr'lx,1:3x5 P9 Q54 W1 :ll Ji' 11. 955 95. .gf liil ll!! E M Q 014 Zlll lul JK' Bl If F M 54 ix' 'xl lxi D32 Bl D! H9 2731 Fil PQ F51 K! lx: H '31 sr K Ziiifxxnx lu psixiiilisiixiM'X!H'.15:r1.1x'!MIQ1xlX1xQ152x:r1'1x.xTX. liilullliflltZlX1X!lD9ll1MfElEEl33ll2i ilfl51'l?1lki0lm'lC'li'l1t lr! :BI llfllilitfill IH Pi' Wl PX' lg. LQ I . L L 1 gif The gg 1 1 s PQ 'ff 59 Toggery Shop E. El Ez Everything in , . . . , Men s logs. Sf? I'Il,Q'llESt Ill QQ lg quallty and ESE In 'rl L5 style. QQ Lowest in if QQ prlce. ,E :ns nd css g E3 D. Guxmzlrsnll E E 0. W. Ccrlvrqnist ww , xx if 112 Mann Street ff Jannestown, New York Ea Q Eli , Pl' Qi'ilEl!7N3i111i3X'l31Il!1lEEliIEE352ri.I7t1g1,l!Q1l1.PK1l1C!llX'l!!.PGN E TIIC RCCI and GICCH NINETEEN HUNDRED SEVENTEEN A VOLUME xnv Mclvlxvu PUBLISHED BY THE STUDENTS qf jAMESTOWN HIGH SCHOOL JAMESTOWN. N. Y To Milton Fletcher our friend and counselor we affectionately dedicate this volume of The Red and Green PRINCIPAL MILTON j. FLETCHER Board of Education WILSON C. PRICE, President MRS. CHARLES L. ECKMAN MRS. LENA CRISSEY MERZ ARTHUR A. AMIDON AUGUST C. ANDERSON GEORGE F. GOKEY FRED B. TINKHAM MILDRED R. FALCONER, Clerk The Faculty ROVILLUS R. ROGERS, Superintendent l MILDRED R. FALCONER, Chief Clerk ' ELLEN S. SODERUERG, Snperiniendenfs Clerk MARION L. KLOCK, Office Assistant MILTON J. F'LE'l'CI'llER, Principal, Economics CARRIE E. AIKEN, Algebra Senior Department MARY A. BARGAR, Latin and Ancient. History FANNY L. BELL, Biology and History M. MAY BRIC-GS,4Clommerclal JULIANA CLARK, English mul Expression MERTON P. CORWIN, Vice Principal, lliaihenmtics HONNY B. DEAN, English and History HARRIET L. JONES, Latin FRANCES K. DONAHUE, Commercial NELL D. FARMAN. German GRACE GIFFORD, History CARL LASALLE, French and German ELSIE E. LEET, Geometry GRACE M. MILLER, Latin ' MARY J. NELSON, Modern Languages SUSANNE A. RITENOUR, Drawing HOWARD J. STEERE, Physical Sciences LAURA I. STONE, English RETA M. TANNER. Commercial ARTHUR S. WHITE, English Junior Department GEORGE A. PERSELL, Prlncipal, Physiology and Commercial Law GUSTAVUS E. BENTLEY, Biological Sciences MARY A. BINGHAM, Commercial CLARA F. CARPENTER, Biology CALISTA A. DREAGER, Algebra, Commercial Arithmetic NELLIE R. HAND, English EARLE S. PALMER, History land Debatej AGNES M. PETERSON, French BERTHA M. SCHLOTZER, Biology FLORENCE B. TODD, English and History VESTA WILLARD, English and Commercial Geography MABEL A. WILLIAMS, Commercial GEORGE W. WINSLOW, Vice Principal, Mathematics and Science Special Departments ELIZABETH R. BEALER, Physical Training FREDERIC E. BOTSFORD, Supervisor of Vocal Music ELLA W. GREEN, Librarian S. GERTRUDE HARRINGTDN, Assistant Physical Training ESTELLE E. HAWLEY, Domestic Science MEL-VIN P. MADDOCK, Physical Director CLIFFORD B. SMXTH, Shopwork and Mechanical Drawing D. EARL STILSON, Supervisor Shopwork and Mechanical Drawing BLANCHE H. WOODFORD, Supervisor of Drawing M MEMBERS OF EDITORIAL STAFF Red and Green Editorial Staff , Editor-in-Chief, Leon Anderson Assistant Editor, LeRoy Brunstrom Business Manager, Clarence Pickard Assistant Business Manager, Leon Kofod Art Editor, Hildegarde Eldridge Exchange Editor, Archie Parker School News Editor, Charles Hall Athletic Editor, Norman Whinle Joke Editor, Helen E. Parrott Alumni Editor, Beatrice Eckberg Faculty Advisors, Mr, White Miss Todd Miss Stone fi il . --, xt it 'Y . I Cifd i 1 1 ,s , 'I For several years The Red and Green has been published in four is- sues. This year it was thought best to have one large year-book, The staff, Composed of Postgraduatcs, Seniors, juniors, Sophomores and Fresh- men, is representative of the whole student body. The editors have endeavored to produce a paper which should rank with the hest school publications. The members of the staff wish to thank all who have in :my way made possible the publication of such a paper. It is not an easy matter to bring out a large year book, which shall represent all the varied interests of the school, XYilhout the substantial aid of our loyal advertisers, the contributions from the student body, and the untiring efforts of the faculty advisers we fully realize that The Red and Green would have been an impossibility. Editor in Chief. 4 0 9 0 lt is no longer possible for even the most versatile person to know some- thing about everything, nor everything about any- Mental thing, The range of human knowledge has become so Discipline wide, and the minuteness of specialization so exact and far-reaching that one is apt to feel a sense of help- lcssness when confronted with the opportunities offered by even a high school course of study. To meet this situation Dr. Charles li. Wheelock, Assistant Conunis- sioner for Secondary liducatiou of the State Department, proposes a division of subjects for each student. Under this arrangement a student would elect a certain group of related subjects which he would pursue merely for a reading knowledge, much as a person reads a scientific hook or magazine article simply for general information: in such subjects the minimum passing mark would be accepted. Each student would be 19 required to pursue another subject, or group of subjects, intensively. ln this line he must be, to use a common school expression, A grind. ln other words, within the possible range of high school attainnients he must become a specialist and approach something like mastery of some narrow field of knowledge. To receive credit in such courses the student would be required to attain a higher standing than is now accepted as a passing mark. This plan would undoubtedly work well. lt provides a means for securing the general information which every person needs, the lack of which sometimes makes the narrow specialist ridiculous: at the same time it insures for the capable and industrious student both mental discipline and vital scholarship. There is much reason to believe that many high school students are already availing themselves of the advantages of securing only a general knowledge of their subjects. and are quite unaware of the benefits to be derived from an intensive pursuit of some single subject. Such students should learn that real study begins only after one has met the minimum requirements ot' recitaticn and examination. Rovillus R. Rogers. 0 Q Q Q The pressing need of our country today is Preparedness. Preparedness in both the army and navy. But to be fully prepared The C0untry's for war our country nmst be able to feed and care for Call her fighting men. Consider then. from whence this food nmst come. Naturally the answer is from the farms. hut unless tilled the soil will not yield abundantly, and here has loomed up a great difficulty: namely the scarcity cf farm laborers. Young men are called to the city because of higher pay and shorter working hours, and consequently the farmers are left destitute of help. One thing then is certain, farms and farmers need steady, dependable young men to help and cooperate willingly and faithfully with them, and in this way our country will he able to support, and support well our army and navy. With this situation clearly in view the liducation Department of New York State inaugurated' for the aiding of the farmers the follow- ing plan: All young men between fourteen and eighteen years of age. who are attending public- schools in the state of New York. are urged to enlist in what is known as the Farm Cadet t'orps. The purpose of this corps is to aid the farmers during the present year. All students joining this corps will receive Regents' counts in all subjects which they are now pursuing without further study or examina- tions. In order, however, to secure this credit the work of the student 20' must be so satisfactory that the Principal shall be able to recommend that the State Department allow the credit. Young men who heed this call to service on the farms are doing as noble and as patriotic a service as the soldier boys, and with their help this mighty nation, of the people. by the people, and for the people, shall not stiffer disgrace, nor defeat. but shall uphold her honor and place among the inations of the world. Morgan L. Heath, '17. 9 Q Q 0 This organization has a definite purpose-the enlargement and perma- nent improvement of the High School Campus. The Campus plan was first, announced at the ammal banquet of the Improvement J. I-l. S. Alumni Association last june. The committee Association which did the initial work was made up of representa- tives of the Board of Education, the teachers of thc city, the Alumni Association and the Board of Commerce. This committee formed a. corporation, borrowed money through the assistance of about one hundred fifty public spirited citizens as guar- antors, purchased five properties east of College Street for enlargiii the Campus, and secured through action of the Common Council a resolu- tion for closing College Street at such time as the Association might be ready to proceed with the final improvements. - The amount paid for the properties purchased with the expenses in- cidental thereto approximates S20,000.00. In addition to this, it is likely that 310,000.00 will be required to grade the entire field. fence it, erect the necessary bleachers, etc. This is a very large debt to pay through voluntary contributions and the proceeds of entertainments. It will bc all the more difficult to pay this debt under the war conditions existing at the present timeg but such a crisis was not anticipated when this enterprise was started. lt is too late to retreat. This is a community undertaking for the benefit of all. The city, and the High School in particular, are in need of this central field for athletics and community entertainments. It is therefore con- fidently expected that, in spite of adverse conditions. our students and our citizens generally will help, as opportunity offers, to carry this undertaking through. The general plan for paying the debt as worked out by the directors of the Association is as follows: The houses purchased on College Street will be rented for several years and the proceeds used to pay the interest on the debt, The ath- letic field, put in good condition for use and provided with bleachers. will be used for several years as it stands for raising revenue by means 21 of various forms of athletics and entertainments. A central committee will have charge of arranging the season's schedule of entertainments each year, and rentals will also yield some revenue. The directors have also planned a system of membership which should produce considerable revenue from animal dues. There are four kinds of membership-an honorary permanent membership on the pay- ment of S25 or moreg a sustaining membership with ammal dues of five dollarsg a senior, or active membership with dues of one dollar a yearg and a junior membership with animal dues of twenty-five cents. The junior membership is intended for minors--especially pupils in the schools. After enough of the deht has been paid to warrant such action, the houses purchased east of College Street will be removed and the final enlargement and improvement of the Campus completed. Everybody help, please! Principal Milton j. Fletcher. ' o Q 4 Q Whenever we hear anyone discussing the present World War it is usually concerning the latest French drive or tiermany's Democracy food supply. lint behind these outside facts there are and War taking place some great and far reaching changes. As a result of the present gigantic struggle new conditions are developing, which are to prove whether monarchy or democracy is to be the future government ofthe world. Now. how do these two forms of government show up under this acid test ? l can point out nothing new and startling. You, yourselves. have seen and are seeing the results of this test. You know that in a short time great changes have taken place in the most unthought of quarters, for has not Russia, that supposed stronghold of imperialism, resounded with the tread of the revolution- ists? There, democracy has now the upperhaud while monarchy lies crushed. A people, believed to be subject and bound down under the stern hand of an autocracy, have broke-n their fetters in the struggle for more liberty and more light. Under a democracy what may not this contry with all its marvelous recources accomplish? Over sixty per cent of the Russian people are illiterate and here indeed. is a tremendous task for the leaders of the new government, for the corner stone of democracy is education. But let us ask what is happening in Germany. liven in that systematized. efficient mcnarehy the people clamor for more freedom. livents are daily happening whch tend toward democracy and which seem to show that monarchy is not the most satisfactory form of govern- ment. The people there are educated. it is true, but only to the one end. militarism. Thus, out of this great conflict in Europe today, there seems to he a movement which, slowly but surely, is hostile to monarchy, and that movement is democracy. C. H. Hugo Nicholson, '18. 22 Since the summer school of our city is becoming a permanent institu- tion we feel that it merits a little space in our school The Summer paper. Up to the present time more pupils from the School grades have taken advantage of the work offered in summer school than have students from the high school. We believe, however, as the possibilities of this work become better known a much larger number of high school students will avail them- selves of this opportunity. The school is conducted fur three hours in the morning, five days a week for six weeks. This makes it possible for a student to complete eighteen weeks of regular high school work on the basis of one hour a day. The great difficulty in the past has been that pupils do not realize the difference between a summer school course and a regular high school course. ln the past they have been slow to realize that in order to se- cure a term's credit it was necessary for them to spend three times as much time per day cn a subject as in regular school work, and so have either attempted too much work or have not taken the work attempted seriously enough. ln order to meet the time requirements a student should elect but one subject and spend two hours in preparation and one hour in recitation work on that subject. Since there are no regents examinaticns at the end of the course, only term examinations being given, it is more desirable to elect the first term of a year subject and then, if credit in this is secured, complete the second term in the first half of the next school year and take the january examination in the subject. There is, however, another possibility that very few students have considered. Our school gives local credit in a subject if a pupil fails in that subject and then repeats it for one term and is able to maintain a G average for that term. In this way, then, it is possible to secure local credit for a subject in which a student has failed, by completing the required extra term in summer school. Students having such credit in mind, however, should realize that regular high school teachers are in charge of these classes and that it is no easier to secure a G stand- ing in summer school than in regular high school work. Classes are offered in any high schcol subject providing there are a sufficient number who elect that subject to make up a class, and pro- viding of course that a suitable teacher can be secured to take charge of the class. Owing to the extra time requirements for laboratory work in science these courses are not usually given but arrangements might be made if there was a sufficient demand. Classes are usually given in mathematics, history, modern and ancient languages, and English. Xllhile the sunnner school term extends through six weeks of hot sunnner weather the class rooms on the cool side of the building 23 are used and the work all completed in the morning hours, and so very little discomfort is encountered in the work. Howard Steere. 4 Q 0 Q 1 advice every one of you to provide yourself with an up-to-date dic- tionary, a first-class reference grammar, a rhetoric, and Why Read to become a regular reader of at least one weekly Magazines? magazine, such as the Outlook, or the lndependent. lf you make constant companions of your dictionary, grammar, and rhetoric, you will gradually perfect your command of language, and if you read your magazine consistently you will in a few years become informed upon nearly every subject of hmnau interest to such a degree that you can pass in almost any society as having had a fairly liberal education. It would be unfair for me, in beginning this little article, to omit this oft reiterated utterance of Mr. XVhite, the Head of our English De- partment. lt has been often heard, and probably Miss Green, our worthy Librarian, could tell us its effect has been seen, many times since Mr. Whitc's advent here last fall. In fact, I know that this one little state- ment has spurred many of us on to delving more earnestly into the vast quantities of good reading lying close at hand. The dictionary, NVebster's monumental work, has never been con- sidered a highly interesting or thrilling book, but that does not prevent it from giving us what at some time or another we have wished for, a larger vocabulary, with the correct pronunciation of each word, and with just its right shade of meaning. This our dictionary will give us for the asking,--it would be foolish not to ask. Passing the words, bricks one might call them, we should look for the methods of arranging them into the rugged foundations of our literary building. These are found in our grammar. Front it we can learn what so many people never learn,-the fundamental rules governing all speak- ing and writing, the lack of which no amount of words nor multitude of rhetcrical figures can conceal. , When we have the more solid material for our structure, we must lcok for the embellishments with which to beautify it. the pillars, cornices, cupolas, and other ornaments which are a part of the finished strength and beauty of a building. Here we use our rhetorics. To be- come thoroughly familiar with the rules of rhetoric is important. just for one example, what is more ridiculous or brings a laugh more quickly than to hear an orator bellowing, A sea of faces lay before me, thunder- ing approval to the sentiments I had expressed? No writer or speaker is as uninteresting as he who lacks the ability to use figures of speech properly. 24 XX xtlx xxx xterx xls and pl'xxxs for oxxr bxxxldxng 'xt lxxxxd xxxxl xxxtlx xt well undtr coxxstrxxxtxon to eoxxtxnlxc our xnetaplxor our next Loncnrn xx.xtxxr.xllx slxould be the xnlxzxbxtxxxts the lxxxnq brcntlxxxxg people that sxx otuxpx xt for xxlxtxt xs more deso xte .xnd useless than 'x v.xe.xxx lxoxxstb It xs xx ell xxxd good that xxe use our rlxetxonxrx studx oxxr Qr'xxxx nxzxr .xxxrl f'xxxxxh'xrxfc oxxrselxts wxtlx the rules of rlxetorxe but xt xs rzxxexng 1 buxxxtxfxxl xxx xxxsxoxx xxxtlx no one to neexxpx xt xf there 'xre no vxt'xl tlxoxxqlxts to bc expressed XX ell soxxxxdxnx., t.xrefxxllx selected words shxped xxxto lxtaxxtxlxxllx fllfllkll plxrxse lxx,,lxted up bx sxxnxlt xxxd xxxtth'x plxor 'xre xxorst tlx.xxx xxseltss xf thu do xxothxxxg bxxt reflett tlxzxt most de sertul of mlm strts .x hxxxxxzxxx xxxxnd duoxd of IQILZIS fluoxd of coherent ton strxxxtxxe thnughte Xll ot' xxhxth lxrxxxgs xxs to xx lmt Xlr XX hxte lx.x'i so ofttxx saxd xxx ex pl.xxx xtxon of lxxs xxxaxxxxx qxxotul nlxoxe xxzxxxxelx tlx.xt the eoxxsxstexxt rL.xd mg of 'x good xxx.xg.11xxxa. or xxx other xx orde the olxtzxxxxxng of xdcas nxxd xxt xl lxxxoxxlulgv. xs prxxxx.xrx xxx xxxxport mee, for wxtlxoxxt thxs the rules of gruxxxxxfxr and rlxetorxc can be of httle use The exnphnsxs then xxlxxelx lxt phees xxpoxx the xxxxportnme of readxng 1 good xxxagnzxne xs xxot sxxrprxsxnq xx hen xxx. tonsxder that the best tlxxnlxers :xxxd wrxters th'xt ue hdxx. todrxx contrxlxxxte to our wctlxlx .xxxd xxxoxxtlxlx xnagnrxxxes lxx lookxxx-f over the xxzxxxxcs of contrxbxxtors to our xxxore proxxxxnexxt lrxxxxtx Colleefx. Cuxxxlxrxdge Plxxlxp M'xrslxzxll Broxxxx Professor of Inter xx xtxoxxal I.xxv 'xt Prxmeton Uxxxxcrsxtv lxzxlxxxxclraxxxtlx fzxqore the xxorld ltxxoxx xx poet of Ixxdx.x XX C X .xxx Antxxerp Goxerxxor of the Xexx X ork S otlt Extlxange but xxlxx gm nn' 'Ilxe het coxxld be extended to xxx elude xxexrlx xll of our great xxxexx .xxxd the sxxbjeets upon xxhxeh thev xxxxte cox er exerx fxeld of hxxxxx.xxx xxxterest txxrrexxt topxts forexgxx xt' xxrs scxtnce, xxxxexxtxoxx letters, 'xrt lxxstorx, rehgxoxx fxnzxxxce ll .xre plzxeul before the one xx ho rcsolxes to read Here then, xxxtlx bxxt sxxxxll expense xs the door of 'x lxberal edxxcatxoxx opcxx to us and uexx tlxoxxvlx oxxx xxxtexxtxoxx x to go no further tlx.xxx the stopt of the lll4lQ'llll'lLN .xxxd perxodxuxls the hxre of tlxxs subject the fastxxxxtxoxx of tlx.xt xxrxters stxlx. so drxxxs one oxx tlmt :xlxxxost before oxxe rexhles xt one Q mxxxd hem been trzxxxxed x taste for further rcadxxxg has beexx tultxx ated and x xxx le lxxxoxxledqe lx.xs been gxxxxed XX xth tlxxs kxxoxvledgc ue can xxxzxltx, use of our strtxttxxre 'xxxd xf the lortxxxxes of lxfv. should xdxxxxt us to 1 lngh posx txoxx xxe gan fxxxd oxxrselxes xt ease xxxtlx ttxltxxred people fhcordxxxgly to those xxlxo xxmlx to xxxzxlxe thexr lxxts xxxost useful 'xxxd to exxjox lxfe to xts fullest measure xnv adxxee xs studx xour dxttxoxx .xrx graxxxxnxr rlxttorxe 'xnd read those xxorlts of xrt 'xxxd xxxzxsterpxtteq of lxxerfxtxxre talled magazxnes LeRoy Brunstrom, 18 25 :l:ll U' ' : ' ' x l: - ' s . ' -' t I- , If up-if x . v 1 B ' Yi' 1' v A hx h 5 . ' . ' - s :if .5 ' ,- - ' s I s A . V b -' 5 l , -1 4 S h s perxodxczxls. we fxxxd sxxelx xxaxxxes zxs. llertrzxncl Russel, lzxte fellow of s - x '. . ' ' fl I - 1 4 t ' ' - ' - : x . ' I '- s , K , I 1 . 5 'xx E , '. 1 ll ' ' ' ' . , 'X' . , '. P: - I w I 'S ' 1 1 x .'- x u fl I --. xxx 1 x ' V I - A- 1 - ' A - ' - . i 1 JL x ' . ' , I ' 'A. ' ' l ' 'I . .' ' . l l 'v I ' S up L nv 1 -'s 'ss' - 'v I- 'v . . . r 1 1 vv x I H v -s r 'xv . Night school work in the city of Jamestown began on the evening of October 9, l905, as an experiment. No one knew when The Night the night school for the city was advertised what School would result: but from the first evening the popularity of night school work in Jamestown was clearly demon- strated. As soon as the doors of the high school were opened, men and women began to stream into the corridors and soon there was barely standing room in the academic study hall: ' During the first term six hundred and sixty pupils registered. These consisted of several nationalities, Swedish, Italian, and Albanian pre- dominating. It would he difficult to estimate the influence for good which the night school has exerted during the eleven years of its existence. The value of its work to this city cannot be reckoned in dollars and cents: it can only be reckoned in terms of better citizenship and wider vision. Hundreds, yes thousands, of young people have entered the night school unable to read or speak the English language and have gone forth able to read the daily papers with a fair degree of intelligence and to enjoy the books of the public library. More than this, the night school has had a strong demoeratizing in- fluence in the community. In the early years of the school's existence the various nationalities manifested strong antipathies and objected to working together in the same class. ln later years students representing seven or more nationalities have worked side by side under the same teacher in perfect harn1ony. Coming together three nights a week in pursuit of a common object taught these aliens tolerance and respect for one another and impresed upon them Stevenson's lines: There is so much good in the worst of us. And so much bad in the best of us, l That it scarcely behooves any of us, To talk about the rest of us. Finally, the night school has always stood for patriotism. Much of the material used in teaching English is drawn from American history. The students are taught the fundamental principles of our government, and the teachers seek in every way to impress upon the men and women in their classes the desirability and the duty of becoming American citizens at the earliest opportunity. , In a word, the night school has always stood and will continue to stand for the same things which this country stands for, namely, in- telligence, democracy, and patriotism. George A. Persell. 26 Owing to the lack of room accomodations, due to the increase in number of high school pupils and the resultant increase in Arrangement number of teachers, a new plan of organization was Satisfactory put into effect last September. ln brief, this organiza- tion was arranged through three separate assemblies of the students, the elimination of school study periods for Seniors and juniors, and the lengthening of the school day by the addition of two periods. The Senior and junior classes in one unit have assembly at S210 a, ru., and complete their recitation work at 12:05 p. ni., being dismissed at that time for the remainder of the day. The Freshmen have roll call at 9:05 a. m., chapel exercises at 1:35 p. ni., and are dismissed at 4:00 p. m., having spent seven periods in school. The Sophomore class is di- vided into two units which have roll call at 9:05 a. m, and 10 135 a. in.. respectively, chapel exercises for all the classes at 1:35 p. ni., and re- main in school until 4:45 p. in., thus having two periods in the morning and four periods in the afternoon. As far as the limited sources of information available indicate, the students seem to maintain about the same average of work as has been done in previous years. The plan makes the arrangement of schedule quite difficult, and the organization of the whole school for common purposes less satisfactory. However, the greater use of the school plant, and the resulting better accommodations makes the arrangement satis- factory as long as the capacity of the building is limited. Merton P. Corwin. Q 0 Q 4 .-X very good law was recently passed in 'Albany which requires every student in the public schools of New York State to Physical take at least twenty minutes of Physical Training each Training school day. Some of the benefits derived from these exercises are: better ventilation in the school room, for the windows must be thrown open, and the student inhales the fresh air in the regular breathing exercises given: as a result of the bending and stretching of the body the blood is forced more freely into all parts: the relaxation of mind and body tends toward clearer thinking when once more the student returns to his work. The fact that many schools throughout the state report that they have enjoyed the work and have found it most beneficial is interesting. This law was largely a result of the efforts of Commissioner of Education, john H. Finley, who, because of his own love of the great Outdoors, felt that each boy and girl should have the opportunity to develop strong bodies as well as minds. I Edward Rosengren, '20. 27 NN'erc Thales, thc grcat Greek thinker. living in this age of revolution, he would feel doubly certain that mind and not matter Mind and rules the universe, Yet so easy is it to comprehend the Revolution visible, the tangible that we often fail to sense the existence of that quite invisible mental force back of all phenomena. While Revolution and War are children of the same parents, the former is not synonynins with the clash of saber, the throw- ing of bombs and the boom of cannon. These are but evidences of revolution-mere testimony of a movement full grown from seeds planted deep in the minds and hearts of mankind. Every normal individual is the rightful possessor of certain inherent tendencies, which he intuitively knows he should have the right to de- velop and express, and the nature of the forces trained upon l1is mind, particularly in youth, will determine in a large way what tendencies hc will be most desirous of expressing and developing when grown to man- hood. Individuals when grouped into communities and states, from common training, develop connnon tendencies and consequent common desires. If this development takes place within the bounds of arbitrary restraint, there is an inevitable struggle-a revolution. The more spo- radic the training, the more scattered and ineffective the struggle. The more constant, the longer and the more universal the training, within persistent arbitrary restraint, the more noble, the-more spectacular and effective the revolution. Under continued training the revolutionary forces gradually compel successive compromises on the part of .the re- straining power and such victories often continue over a long period of time. Then, if the arbitrary power dies hard and its final overthrow is illumined by the rocket's red glare, we become suddenly awakened and are conscious only of the last struggle of what has been a long revolution. The state with its individuals left free-free to develop and give expression to their innate qualities becomes republican. The three great revolutions now most vivid to us Americans were all born in the mind-results of particular training. The American revolution had its origin in the minds of our fore- fathers trained in the school, centuries old, of Anglo-Saxon principles of liberty and justice. In that school, from the ancient laws collected from Kent and Mercia, Alfred the Great had taught the principle of justice and the right of individual development. The witan, the hundred, the shiremoot, and the tumnoot, embodying the principles of representation and power emanating from the people. had all been grounded as funda- mental in the minds of our sturdy New England fathers. Their desire and determination to safeguard their inherent rights were nurtured as they saw in imagery, upon the green meadow of Runnymead, that historic gathering forcing despotism in the person of John Lackland to sign the Magna Charta. ln that article,-UNO scntage shall be levied with- out the consent of the common council of the realm, they read the princi- 28 ple of No taxation without representation . Likewise in those sacred provisions,- To no man will we sell, deny or delay right of justice, and No free man shall he taken, imprisoned, destroyed or preeeeded against save hy the legal judgment of his peers or hy the laws of the land, they saw embodied the fundamentals of habeas corpus, trial hy jury and those basic rights of all-life, liberty and property, ln the same school, our fathers learned how, four centuries after the Magna Charta, growing despotism had been beheaded and how, from its clutches, those ancient principles, as enlarged upon in the Petition of Rights, had been set free. They learned how half a century later, when the late King james did endeavor to subvert and extripate the laws and liberties of the land. despotism had been effectually overthrown and liherty and justice firmly established and recorded in the Bill of Rights, No question whatever was left in the minds of our colonial fathers as to what constitute the inviolable rights of mankind. American thought upon the principles underlying liberty and justice had been graduated from the Anglo- Saxon school. Against the arbitrary power of the French system in America, we gladly joined hands with our English brothers. The more we invested in the cause of liberty and justice, the more sacred they he- came and the more determined we were to preserve them. When again, as over our linglish brothers, arbitrary restraint in the person of a German anxious to be King began to assert itself over us too, we could do nothing' else but follow the dictates of our training. Like our lingflish brothers in 1215, 1628, and l689, we struggled with despotism for ten years to secure liberty aml justice as Englishmen. When however by 1776, we found George lll and his cohorts still very uneonipromising, we proceeded to obtain our rights as men-rights which we wrote in blood to form the Great American Charter-rights which we had learned to lc.-ve when linglislnnen in the old Anglo-Saxon school-rights which, under such great liherators as Gladstone, Balfour, .-Xsquith, and l.loyd George, have now firmly anchored themselves in the minds and hearts of our linglish brothers. The French revolution was not a sudden eruption of an unthinking populace. The fall of the Bastile only resounded the audible clash of a struggle long existing between arbitrary power and a people he- coming trained in the spirit and philosophy of liberty and free institu- tions. The French peasant, fighting under his despotie king against the English, had long since come in contact with .Xnglo-Saxon representa- tive government and Anglo-Saxon conception of individual rights. Montesquieu had been horn for a century and two generations of his French brothers had read with great interest his unstinted praise of the English system in his treatise on The Spirit of Laws. Likewise Rous- seau in his Contract Social had firmly planted in the minds of French youth, then grown to manhood, such seeds of liberty as the right of the majority to rule and the sovereignty of the people. The American revo- lution had been fought and the heroic French soldiers, who had struggled 29 and bled for American democracy, had returned to France with minds capable of thinking only in terms of liberty. XVise old Benjamin Frank- lin, radiant with democracy, had had translated and spread broadcast among the French the written constitution of America's republic. French thinking everywhere was experiencing a reformation. The mere men- tion of I..aFayette's name sent hurling in the air the cap of the French- man whether a soldier or a mere hanger-on of the saloon. Long be- fore 1789, the French had begun to think in terms of liberty and justice. During the struggle thus precipitated, Louis XVI had been compelled to compromise again and again even to the extent of summoning the old States General at LaFayette's command. XVhen the revolution had con- tinued until 1789, the hurling of bombs and the booming of cannon opened the world's eyes to the warfare despotism had long been waging against those mighty forces mobilizing for years in French minds- forces too great for even a Bonaparte or a Napoleon III to effectually destroy. XVhile -the Russian revolution is only just beginning in its more audible stage and has hardly yet started on its career of violence and bloodshed, its real birth date was red-lettered many years ago. Des- potism, still vigorous, for years has been compromising in fierce struggle with the forces of liberty and justice as they have been gradually mobi- lizing under the orders of trained thought. The sacrifice, by this uu- scrupulous monster, of the Romanoffs is only the last in a long series of compromises. The training of the Russian mind to think in terms of liberty began long ago. Nearly a century and a quarter have passed since Kosciusko, who had breathed with Washington and Laliayette tl1e same American air of liberty and democracy, carried the seeds of discontent home to Russia in his revolt of Poland. In less than another quarter of a century, in spite of all Metternich could do, the seeds of democracy had taken such deep root in the world that despotic Russia felt compelled to become a part to the Holy Alliance to wage everlasting warfare on so great a foe. As a result, the soldiers of Nicholas I were sent to crush the liberty-loving Kossuth in Hungary only to return to their homes in Russia to think more and more loudly in terms of liberty. In the nineteenth century, this thinking became nourished as never before. Face to face with unscrupulous and despotic Prussianism, Russia became the ally of Europe's two great republican nations-l2ng- land and France. Unwittingly, despotism, in thus drawing' more tightly the bonds of association about the Russian people and the Anglo-Saxon. dealt itself an effective blow. Such apostles of liberty as Leo Tolstoi now began writing:- Everything that savors of compulsion is harmful- Freedom is the only criterion. Depotism struggled hard against the onslaughts of freedom by such means as wholesale exiling, imprisonment and strict censorship of dangerous writings such as Green's English I-Iistory, Bryce's American Commonwealth, and the works of 'I'olstoi- but its struggle was in vain. Russians were reading Tolstoi by candle 30 light in dingy cellars-Russians were thinking. They assembled in the Russian-japanese war and there gave much. In return they demanded mueh and despotism was foreed to compromise with a Duma and written promises. Now throughout the country men are thinking in terms of liberty. Nilyoukuv and other exponents of the new school are coming to the front. May their training be more universal and consistent that their revolution may grow less bloody than that of the' French, and their victory more complete. Individuals within nations have demonstrated their determination and ability to develop their inherent qualities free from arbitrary re- straint. To-day, the world is in a revolution that indivdual nations may possess the same rights. In 1776, republican government was all but negligible. To-day, four fifths of the world's inhabited area and three fourths of its people are nominally under republican government. lidu- Cation, struggling under adverse conditions, has been responsible for de- moeracy's victory thus far. liducation. if loyally supported, will ulti- mately bury despotie and arbitrary government. Thales was right. Mind and not matter rules the universe. Earle S. Palmer. Thinking If you think you're beaten, you are: lf you think you dare not, you dou't: If you like to win, but yon think you can't, lt's almost a eiueh you won't. lf you think you'll lose, you're lost, N For out in the world we find Success begins with a fellow's will: lt's all the state of mind. If you think you're ontclassed, you are: You've got to think big to rise: You've got to be sure of yourself before You can ever win a prize. Life's battles don't always go To the stronger or faster man: But soon or late the man who wins Is the man who thinks he can. -Exchange. 31 X Miss Elizabetlfs Victory ll T ISS lilizaheth was not so happy as usual. True she was not WSU unhappy as she walked hriskly down the main street of the little Q-iv' S village, lint her face lacked its custoniarykhright smile, and her eyes their usual cheery look. She was thinking of Andrew, the t' only one of her school of little foreigners whose confidence and ' affection she could not gain. She could not understand why she eoulcl not reach the hoy's heart. lrler huys and girls, with the exception of Andrew, were responsive and affectionate, aml loved her with all the devotion of their warm little hearts. Now, as she neared the neatly painted white school-house, she saw the door push quickly open and two little dark clad figures came racing down the path toward her. She knew they u'cre -Ioe and Rose, the children of the Italian fruit peddler. lfloth held out to her hunehes of soiled arhutus, which they had gathered the night hefore in t'ater's woods. She well knew that these woods were a good mile from the low, dilapidated cottage, which the children called home. The flowers were wilted and broken, and the hands which held them were hot and grimy, but the eager, confident light in the eyes of joe and Rosie was not to be mistaken. She took the arhutus, greeted the children pleasant- ly, and at their urgent clamoring allowed them to carry her dinner-box hut insisted on carrying her hooks herself. XVhen she entered the schoolroom, il great cry of, Miss lless! .Xhl Miss Hess has come! greeted her. This joyous greeting hrought Il happy, wonderful light into the eyes of the young teacher, hut her smiling face clouded a hit as she noticed the sullen, scowling face of the slight dark-haired boy in the corner desk. However, she greeted him with a pleasant, Good morning, Andrew. 'Moruingf' he grnmbled. A few minutes later at the sound of a tiny hell, the tumult ceased 32 as if lly magic. The lessons proceeded, and at ten o'clnt:k, they were allowed a short playtitne. In the great sunny play yard the eighteen little foreigners asscmhled to learn the new game which Miss lless had promised to teach them. Andrew was with them hut, when Miss Eliza- heth came out, he quickly left the group and sented himself on the grass. some six yards away. Come, Andrew, play with ns, she called ottt. Don't want to, lte nntnthled in reply. .Xnd so the sullen, jealous hoy watched his playmates as they whirled gayly through that most delightful game, London llridgef' That afternoon a ntnuher of the children failed in reading and were hidden to remain until they could recite. Among them was Andrew. One hy one the children recited and were dismissed hy their weary young teacher. .Xndrew remained in his seat. .-Xre yott ready to read, 1Xndrew? she askefl. No, l shan't read, he answered sullenly. She did not reply out seated herself hy the open window. She was nearly discouraged. Only this morning a letter from home had brought the news that her heloved hahy sister. lllla, was very sick with what at first had seemed only a hard cold, hut which had now developed into pneumonia. She, herself, was the only support of her mother and the much loved twins, Iloh and lilla, and so could not leave her school and go home. Het' thoughts ran on and she forgot all about the hoy, who was watching her closely to see what she was going to do :thout his last retnark. She thought of home, of the sick hahy, of the long weeks that must elapse hefore she could again see her loved ones. A great wave of homesickness and diseonragement came over her, and suddenly her head sank upon her arms and great, violent sohs shook her frame. She could not see the justice of it, she, who had worked willingly and unceasingly for her mother and the twins,.was now visited with this great, new sorrow. Her heart was hard and hitter and she felt near the hreaking point. She would work a while longer, hut, if she lost lilla, the darling of her heart, she would indeed give np. She would-she started violently at a light touch on her arm, and, lifting her head, she gazed into Andrew's shocked face. 'l'eacher! he said in a voice that was entirely new to her, 'l'eacher, you aint cryin', is you? ls it 'hout me you feel bad, teacher? .Xt the note of sympathy in his voice her head sank again upon her arms, and into the ears of this little foreigner she poured the story of her griefs and burdens. Ah! gasped Andrew. f'.'Xh! teacher, l didn't know 'hout that little girl was sick. 'n' l'm awful sorry. Honest, l am, Miss lless, 'tl' l'll read just as good as ever 1 can for you now. 33 After the lesson was heard, she dismissed the boy with a kiss. Her heart seemed lightened of half its load, and across her mind flitted the words of that grand old song: l've found a joy in sorrow, A secret balm for pain. A beautiful to-morrow, Of sunshine after rain. l'vc found a brand of healing, Near every bitter spring, A whispered promise stealing Q'er every broken string. The next morning as she stood before her glass. the maid entered with a yellow slip in her hand. Elizabetlfs heart seemed almost to stop beating, and she grew very white. as she read the brief message: Dear lilizabeth, Urisis safely past. Letter by next mail. Love from Mother, ller heart seemed light as a feather, compared with yesterday's load of burdens and sorrows, and when, over her desk a certain little boy handed her a great white nareissus and seven pennies this entire saving, as she found out afterwardl and said in a shy but wonderfuly sweet voice, For Ella, teacher, her enp of happiness was indeed full to overflowing. Lucy Neil, '19, 0 Q 0 0 Prestige versus Honor QQ T was a warm, sunny afternoon in June. :X group of Clifton ls: wil! High School girls were wandering aimlessly about in the great Q 'fi Latin .classroonr Suddenly they stopped and started a con- , ,jf versation. illf'ltt1,, I think we all ought to ignore her, Dorothy said decidedly, elevating her dainty nose. But, protested Lucile, who was ever making a way of escape for others, no one knows that she really took it. Dorothy sniffed, Pretty good evidence when it was found in her desk, she said, and every one knows how much she desired that purse. An empty purse is a small thing, but a person who will steal that, will steal other things, too. Dou't, Lueile slmddered. Steal is such a horrid word. Not half as horrid as the aetf' Dorothy snorted. I for one do not intend to have anything more to do with her. Only a short time ago she was heard openly to admire that hand-worked purse, upon which 34 listher had put so much time and to wish she had one like it. Now. it was found in her desk-what better proof do you wish ? Well, maybe, Maxine Gilbert said, tolerantly, 1naybe she didn't intend to take it-only to borrow it. Let's not talk about it any more. 1 want to tell you a story of what happened to me one vacation. She told the story well, and a little burst of laughter accompanied and followed her departure from the room, for the girls had forgotten about the purse. Wasn't that comical? Dorothy exclaimed approvingly, But I can tell it so you will laugh harder. She repeated the story as if it had happened to herself. Dorothy had a natural gift for story telling, and the story fell merrily from her lips. The girls around her exchanged significant glances, Init no one could resist her when she was relating anything, and they all re- sponded heartily. Well, good-bye, and Dorothy suddenly jumped up and hurried au'ay. llalf-way down the walk she overtook another group of girls loiter- ing along with- their schoolbooks, They greeted her enthusiastically. and almost before she knew it, Dorothy was repeating the story just as she had related it to the girls in the classroom. No one thought to ask her whether it had actually happened to her, although Beatrice Lewis started to speak then bit her lips aml kept silent. Pleased with her success, Dorothy swung into another story, threw hits of sparkling comment into it until it fairly seintillated with fun, What a girl you are! Shirley Moore laughed. Yon are so witty, you make me feel fairly dumb and tongue-tied, It's my only 'prestige', Dorothy answered. l'm not a book- worm like yon, or a 'grind' like lletty, and l ean't sing or draw or write. Yon do everything well, and you know it, Shirley pmgggtcdt Not well enough to be remarkable. Only because you do not put your mind on it. Pooh! laughed Dorothy, and hurried away again, her eyes upon another group farther down the street. Before she reached home the had told the story no less than five times, each time as her very own. The next morning she was sitting in an alcove of the library study- ing over her history lesson. lleyond the alcove was a second one-in- deed, all of the windows had aleoves. So intent was Dorothy upon mastering a half-dozen dates which she had completely neglected the 35 evening before that she did not notice that someone had slipped into the adjoining recess. She bent over her books, lips between her teeth. Presently she heard voices and lifted her head. Maxine Gilbert and Beatrice Lewis were talking. Dorothy's first impulse was to call out a greeting, but something held her silent. l think we ought to treat her well just the same, Maxine was saying. Any person is innocent in law until proved guilty and we surely ought not to he less just than the law, I don't believe she even took the purse, there is some mistake about it. I don't believe she took it either, Beatrice said, with her charac- teristic drawl. Hardly any of the girls do. lf only Dorothy would keep still, Maxine said. She has so much influence, and she is so set against anything that even looks like stealing. Ohl is she ? Reatrice's voice quickened slightly. 'lPerhaps she is. in other people. What do you mean ? Maxine asked in surprise. licatrice was silent for a moment. HI can't see much difference be- tween taking an empty purse and stealing a story. Dorothy doesn't scruple to pick up other people's clever stories or the witty things they say and appropriate them. You know that little burlesque song she used to get off last fall about the schoolg everyone thought it was her own, but I know it came from the mind of that quiet little Lindstrom girl, for I heard her making it up. Dorothy quietly made off with it. Why! XX'hy! Maxine stanuuered, I knew she did those things, but I never thought of them as actually dishonest. Why not? A writer who takes some one else's story is not only disgraced, but liable to legal action for plagiarism. I was reading of a case just like it in the papers the other day. Stealing is stealing. and if Dorothy would look to her own 'guns' a little better, she would have less time to criticize other people. They passed out, and Dorothy sat crouched against the wall. She was stunned. It was true. She borrowed indiscriminately anything that her facile mind fancied or could twist into something entertaining, She had excused herself time after time by explaining to her conscience that it was her only way of gaining prestige, and that she really was doing the originators of her stories a favor inasmuch as she could tell them so much more cleverly than they could. But where was her prestige now? The girls thought her a thief. She shuddered at the word but faced it courageously. And wasn't it true? If she had thought up the things that she repeated, and others had calmly appropriated them, wouldn't she be furious? 36 . l L A flood of purging shame rushed through her soul. She bent her head for a moment and then lifted it. After this. she said slowly, I'll not be guilty of oral or any other kind of plagiarism. And l'1l not try for any kind of prestige but for Honor. Bernice J. Dahlin, '18. 9 Q 0 4 Aunt Betsey's Galloping Needle fp UNT Betsey was in a class by herself: she was neither fat nor fair, and she was long past forty: she had heart trouble and was C a spinster, and had twenty-five thousand dollars in the Fairport Bank and a lovely old house full of mahogany furniture and sterling-silver table ware. A sccre of nephews and nieces, near and remote, were quite devoted to Aunt Betsey. The fact that she had said that she was looking for an heir, and that she should not cut up her estate with small bequests, but whoever got any, would get it all. had made her a general favorite. Yes, her popularity was great. lf Niece Sophia sent her a tumbler of plum duff on Monday. Cousin Nathan was sure to hear of it and appear with a plump fowl and a ball of golden butter before sunset. .-Xnd often young Mary NYetlierby laden with a cream pie, arrived in time to hear second Cousin :Xrvilla saying. Here, Auntie dear. are a few raspberry tarts, and a bottle of my dande- lion wine! l f .pylltgf X-.K ...... I ,s-igl ff . :f Among themselves, however, .-Xunt l3etsey's faults were freely discussed. One of her pet whims was attendance at every quilting in the neighborhood: and, as she was a notoriously poor seamstress. it was customary to rip out her block of quilting as soon as possible. She was a rapid but very poor hand with a needle at any kind of needlework. and it had become customary in the family to excuse poor work by saying, I borrowed Aunt Betsey's Gallopin-g Needle. ln the course of time Aunt Betsey's heart trouble became chronic and serious: and. although she was still able to go about, the phy- sicians looked for a fatal termination of her illness at any time, and had advised her to make her will before it was too late. lt was well known that she had as yet chosen no heir, and her many relatives still danced attendance upon her many whims and delnged her with gifts-pies and puddings and sauces, marmalade. jams and con- serves, oyster parties, Parker House rolls, and graham pop-overs, woolen bath robes, lamb's wool night caps: and as for kimo-nos she had them in red, orange, yellow, green, blue, and violet-all with breakfast caps to match. And her clothes presses simply reeked with Comfy slippers: her bureau drawers bulged with handkerchiefs with tatted borders, and tea aprons with crocheted pockets: and still Aunt Betsey was undecided 37 in her choice of an heir. She now wavered between lllary NYetherby, her great niece, and second cousin, Thomas Wilkins, who took to farm- ing, and also took to other things unknown to Aunt Betsey. Mrs. XYetherby, lXlary's mother. decided upon a master stroke. She would have a great quilting, for Aunt Betsey had said that she wished she might attend at least one more such gathering: and Mrs. XX'etherby, knowing that Aunt Betsey had looked with favor upon lllary, hoped by this means to tip the scales still farther in llflary's favor. .-Xmong the invited guests was Rachel Smith, a niece of Aunt Betscy's, who was no favorite of that lady. To the disgust of everyone Rachel was accompanied by her nine-year-old daughter, Martha, for children were very unwelcome at quiltings in Fairport. The little boys were so apt to sneak under the quilt and bob up uuexepectedly, thus causing the quilt to hump up in the center, making spools of thread roll away, tipping over saucedishes of pins. and jabhing needles into the fingers and tlnunbs of the needle women. The little girls were so apt lo tease to quilt: and, besides, it was too umch work to have them for supper. Now, Martha was the worst ofthe lot. She always teased to quilt, and often hid under the quilt, and on one occasion she had tied Aunt Betsey herself to a chair leg with a piece of twine left over from putting the quill on the frames. It was Martha, too, who had jabbed :Xrvilla Carpenter in the calf with a darning needle. Martha had been playing that the quilt was a big pink tent in the woods, and that the feet and legs of the quilters, who formed the surrounding forest, were sugar maples. This had amused :Xunt Betsey, but the explanation was far from satisfying the outraged Arvilla. lt had been the intention of Martha's mother to leave her at home, but Martha had flung herself on the floor and kicked and screamed till she had carried her point and was allowed to go. She had promised not to tease, jab, or joggle. Martha said she just wanted to eat supper. She had paid a call the day before and sniffed around the cupboards and kitchen. She had seen fried chicken and raised biscuit, roll jelly cake, cherry pie, Dutch cheese, pear, cucumber, and sweet tomato pickles, cold slaw and great slabs of hcney, little spice cakes with great dollops of maple sugar frosting stu-ck full of butter nut meats, quite ready to be popped onto the table, and she heard a rumor that there was tapioea pudding and floating islands to he made in the morning. The quilting premised to be a very pleasant affair. Aunt Betsey, in the best of spirits, was feeling remarkably well, and told her relatives cheerfully that she was so much better she expected to live for years. .-Xbout this time, Martha, tiring of being good, demanded to be allowed to quilt one block, Not daring to refuse lest she should have another tantrum. Mrs. Smith placed the dictionary and volume Xl of the 38 History of the Great Rebellion in a chair, and seated Martha thereon with fear and trembling. After taking a few stitches, Martha, to the horror of all present, said in a loud. clear voice, Obi Look! what long crooked stitches I have made: it looks as if I had borrowed Aunt Betsey's Galloping Needle. . .A hush fell. It was broken by Aunt Betsey, XYhat do you mean by my 'galloping needle', dear? she inquired, placing her hand on the little girl's shoulder. Why, said Martha sweetly, when any one makes long, bad stitches they say they must have borrowed your 'galloping needle'. ftlary Wetherby has said it, and ina has said it. and Arvilla has said it. and Mary told ma in the kitchen that she expected to rip out all you quilted to-day. And ina said-e What ina said was never known for Martha was seized from behind, yanked from her seat, rushed to the woodshed. soundly spanked and sent home without her supper. The carriage, which conveyed Aunt Betsey home. had to pass Martha's home. Martha was sitting on the doorstep, brooding over her wrongs. Telling the driver to stop, Aunt Betsey motioned for Martha to approach. Do you love nie. child? Aunt Betsey enquired wistfully. No mom! said Martha sadly, and then added, No one does. .-Xnnt lletsey signaled for the carriage to move on. Martha ran a little way down the road. Did they have tapioea eream and cherry pie both for supper? she inquired. Aunt Betsey leaned from the carriage, and Leigh Woodford, her driver, said later that he had never seen so human an expression on her face. Yes: they had both, she called, and added, Come over to-morrow, Martha, and we will have cherry pie and tarts, I ani thinking of giving you my 'Galloping Needle. But before the next day what the doctor had predicted happened. Aunt Betsey had passed awayg but she had sent for her lawyer as soon as she reached home and had inade her will. ' The twenty-five thousand dollars, and the beautiful house and all it contained were unconditionally given to Martha, Because,,' the legal rloeunient read, She was the only one of niy relatives who had the courage to tell ine the truth. ' ' Louese Muriger, ' 18. 39 The Confession of a Freshman mn QQ! XXIXS born May 51, 1902, .-Xnno Domini, of good parentage and ltr- ef! possessed of a few good qualities and several had ones. among if which were an uncontrollable temper and good lungs, but that 'UN ,Cy did not' bother me then. ,tl- eil Of my early life I remember, naturally, little, aml so' can only rely on statements of others, which I am assured are not exceedingly complimentary to me. I was known quite well in the neighborhood, but such popularity was not greatly to my credit. Some of my early experiences were funny, while others were tragically sad. l recall how, when I was going on an errand, I suddenly found out that l could whistle. l immediately ran hack home to spread the news, en- tirely forgetting the errand. Again I remember that I impersonated Reyuard hy going to a neighbor's chicken coop and chasing the hens off the nest. I took the eggs and enjoyed myself iu smashing them against the building. The results of the latter episode were not to he anticipated with joy. ' lt was not long before I entered the most important era of my history-the era of school, You all know the experiences: tagging along behind mother, embarrassing introduction to the teacher and getting acquainted. From that time on life was pretty tiresome. but I made up for it after school. l had fairly good teachers: hut in the fourth grade I liked the teacher so well that I had to spend two years with her. ln the grade above mentioned we took up our first natural history work. You can imagine my amazement in watching the development of toad's eggs from little balls encased in a slimy, jelly-like material to animate objects. From that moment I was a Confirmed naturalist and had jars full of tadpoles, crabs, frogs and nearly everything except snakes. If my mother had not possessed the ordinary traits of a woman, I might have had them also in my collection. Itly whole school life passed with- out much excitement. l gradually passed the grades till l reached the high school, where I am now. As for my personal appearance, if l relied on the exaggerated de- scription of others, this planet would hardly sustain me: hut after deep consideration I am convinced that I am quite tall and slightly rotuud. I am naturally cheerful, until my temper is aroused. llaviug always been assured that, like Oliver Twist, l should be hung, I have not planned anything for the future: but on entering High School I-find myself placed among a multitude of good things and told to choose. I intend, however, to continue my education through college and then do what I am best fitted for-if I can find what that may be, J. F. A. R. 40 An Itching Paw HIE day was warm aml sultry. In fact I think it was Dog Days or thereabouts. Such a day is ideal for lying in the shade and taking a snooze: at least so dogs think, and Sam was a 'QMS real a dog as ever lived in this ruffled world. Moreover, he l- t tf was known throughout the whole dog world for his peaceable- ness and his prosperity. lf you should happen by his kennel some day and see it all painted white, quite like the Great VVhite House in which dwelt his master, with a Dove of Peace carved over the door, you might be more impressed when 1 say that he was extremely peaceable. Sam had a neighbor in the next yard, who, I am sorry to say, could not claim the same peaceable characteristics. On the contrary, he was an aggressive Daschund: and, as you would soon guess by his fierce looking eyes and something that resembled a very sharply-pointed moustache, he was a most important dog, in his own eyes at least. Au extremely peculiar thing about this same Wilhelm was the fact that even in these advanced days of civilization he still believed in the Divine Right of Dogs, to secure all the bones he could, no matter to what other dog they belonged. .Ns l have said before, Sam enjoyed some prosperity, brought on, no doubt by his peaceableuess: XYilhelm, however, was already in a state of battle over a bone of contention with john, an immense Bull dog. who lived across the river and who could swim like a fish, conse- quently claiming his dogship's sovereignty of the waters. lt was also known that Wilhelm had even tried his prowess on a Big Hear, a species from the liastern part of Europe. Then too. XYilhelm in an attempt to raid the kennel of Raymond, a dog of the decided French type, so as to secure more bones, had utterly ruined the prospects of Albert, a small but very independent terrier. XYilhelm's great friend and ally in all this turmoil was Franz, a dog of somewhat slow temper aml abso- lutely led around by the tail by the agressive Wilhelm: while the Rig Bull dog' championed the cause of little Albert. But, as I started to say, Sam's prosperity was brought on by his peaceableness. He had wisely collected all the meaty bones which the other dogs had neglected to hunt on account of their being so busily engaged in the pursuit of dog-battle. One day, while Sam was lying by his door, NYilhehu put his head through the fence. During his rough and growling proclamation to Sam, he claimed the right to take any of Sam's bones that he wished and also mapped out certain limits to Sam's hunting grounds. Now, you know there is a limit to everything, and Sanfs peaceable- ness had come to the end of the limit. He had sent various dog messages 41 by means of inost ingratiating dog barks, to Wilhelni: but the reply to these appeals for the welfare of dogdom in general had been a very unmannerly and insulting snarl. Sain, thinking he could stand these outrages no longer, pondered over the thought that he must now join forces with john, the llull dog, the Big Bear and all the others who were trying to down this obnoxious enemy. And at last Sam dragged his huge body to the opening in the fence where XYilhehn daily sent forth his challenge to all dogdoin exe cept his special friends. Sam did not have long to wait. however, as the aggressor soon again made reprisal on Sam's stcre of bones. Sam, a true dog pacifist, once more gave IYiiilCill1 a chance for retiring, but on mentioning the subject, the Great One snarled in Sain's face, using strong dog language and all possible means of drawing Sam into pitched battle. Sam at first had a rather hard time, receivingmany scratches and digs which he would not have received had he been prepared Neverthe- less, since the one who is in the right invariably wins, Sam soon showed IYilhelm that he was master of thc situation: and Wilhelm, presenting a sorry spectacle, crawled back through the fence, a sadder and a wiser dog. Moral: lleware of an itching paw. Margaret E. Bentley, '18. 4009 Slang Q55 NE of the liditors nailed me in the hall the other day and when llwf she was thro' with her chatter, she had me signed up to write .Q -,i a paragraph for the Red and Green cn the current topic en- titled Slang and Its Uses. NV:-ll, the joke's on the Editor. for , l' fi 'Q what I don't know about Slang would fill a 'steen volume edition of 5952 pages per volume. However, rather than disappoint an admiring public, I'll give the engineer the high sign and endeavour to put nly train of tho't in action. Do you know what Slang is? IX'ell, look it up in XYebster's Uu- abbridged. That's what the dictionary is popularly supposed to be for. tho' in most families it's used for conipany's kids to sit on at the dinner table. Now Slang is all that the dictionary says that it is and then some! It's Hinelegant, vulgar and unrefinedf' And yet, in spite of its unde- sirable traits, we have it like the financially embarrassed-always with us. Xvhy is it? Some say Slang lends virility to the language. In other words it puts kick-pep-punch-into tame expressions, XYell, ain't it the truth? Compare a word picture such as He practised deception and escaped without punishment, with He put up a bluff and got away with it. The first guy deserved it, even if he didn't get it, is the 42 opinion of the majority, while the party of the second part was a regular guy. Such is life! The bluffer gets away with it every time. Now, some people don't even know they use Slang! Thcy're a good deal like the .lane that said to a friend. who was inquiring as to the out- come of a recent romance: Oh, Charley used so much slang it got dad's goat, so l had to put the skids under him. Xthy don't people watch their talk, say for half an hour each day. lt would give them the sur- prise of their life to find how much slang they spill in the course of ordinary conversation, If they'd only get wise to the fact that slang was a handicap there'd be less money spent on comic supplements. As for myself, I used to pull a line of talk that would put Ring Lardner in the shade but since l've taken to writing for the papers I've made a care- ful study of linglish as she is spoke and have come to the conclusion that only a bouehead talks Slang when he could talk good United States, so l've decided to cut it out. Say, don't you think it would he a pretty good stunt to give the situation the once over and see if I haven't got the right idea? Get the phnney talk out of your system and come across with the real goods. Any mutt can talk slang but it takes the real thing to spout our native tongue like Shakespeare, Dickens, and Theodore Roosevelt. Put the rollers under our present day vernacular and take a slant at the future. Why! l've a moving picture of any or all of you in a theological semi- nary, slipping the hndding generation the inside dope on the story of .Ionah and the XX'hale. ' F. F. 0000 The Delicate Art of Gum Chewing HIQNIZVER, in moments of, meditation, fancy free. l sit and QQ gaze about the study hall, 1 notice that about half of ,my fellow 3 'it . students have their mouths going in a constant peculiar, rotary motion-not, however, to elucidate or to gossip, but for the Qffjfg sole purpose of forming an enormous amount of gum into hundreds of different shapes in a momeut's time. As with everything else, gum chewers have different ways of oh- taiuing pleasure out of this universal habit. Some seem to favor and follow the placid methods of the cow: others adopt the frisky move- ment of the rabbit with its fast and never-ceasing stroke, as long as any- thing remains to chew upon: some, after getting the gum into a pliable state, stretch it, like linked sweetness long drawn out,'l to arms length, tilt their heads back, and slowly allow it to recede until it is again in- visible. The latter method is usually indulged in by the younger adherents of this habit, and is seemingly an endless source of pleasure: but it has its drawbacks, for the gum is likely to land elsewhere than 43 the place desired, or to slip completely down the throat, making rather undesirable confusion in either case. There are two reasons why I dislike the gumrchewing habit. One is, that, as is your habit, upon entering a class room, you place your gum in its customary place under the desk: but, after class, upon re- turning it again to its accustomed field of action, you suddenly discover that it has an entirely different flavor from the one you placed there for safe keeping forty-five minutes before. Of course the gum cannot change its flavor any more than the leopard can change its spots.. This embarrassing mistake is probably caused by some other economical but careless gum chewer, who failed to recover his rightful property. But the most exasperating thing takes place when you are sitting near some one who has his mouth filled with a sweet-scented quid of conso- lation, obtaining much comfort therefrom, while you have none. Those who have toiled through julius C:esar have undoubtedly noticed these lines, Till then. my noble frieml, chew upon this. Can it be that Shakespeare advocated gum-chewing when he put these words into the mouth of Brutus? Can you imagine llrutns suiting thc action to the word, and handing Cassius a package of lleechnut chew- ing gum or Black hlacku? ls it possible that teachers who prohibit the use of gum are doing the students an actual wrong, in that they are preventing them from engaging in an intellectual occupation? Surely here is food for thought, I reiterate Brutus' words. Chew upon this. Paul M. Barrett, '19, +000 Fashions in Dress O doubt, we are all acquainted with Miss Primp. She frequents the streets, schools, theaters and all places where she can attract attention. There she comes. pattering along on stilts. I-ler toes are pinched, This can be proved by the expression of her face, that is, as much expression as can be dimly seen under the plaster of paint and powder. ller hair, which has been bleached, is done in the latest fashion direct from Paris, tat least she thinks it came from the renowned cityl, but it was probably first introduced by some careless girl who overslept and consequently could not spend the usual hour on dressing her hair. Moreover, if she follows the very latest fashion she may be seen promenading in front of the lVinter Garden with a very long cane to match her gown. Now, when this girl gets to school she very carefully removes her wraps, swiftly takes her powder puff from the depths of her pocket, and 44 fail behold! lovingly she pats her nose, cheeks and forehead. Very little. however, of this is displaced by the brush she gives her face with her dainty handkerchief. She turns around quickly, and how shocking is the shortness of her dress and the immotlest lowness of the neck of her waist. Nevertheless. we are all aware of the silk stockings she is sporting. She enters the Study Hall, and spies her friend: a kiss and a warm embrace follow of which all is affected. As they pass ou, arm in arm, one hears silly remarks concerning last evening, as to the smoothness of her hair, and the hang of her dress. She enters the class room. She is either unprepared in her lesson, or doesn't hear the question when called upon, simply because she is so interested in the small mirror she holds in front of her nose. The reprimands of the teacher fall on deaf ears: our friend is nearly asleep, due to the late hours she keeps. Of course we are not guilty of such freakish attire and actions. But do we need to ask why so many of our young ladies attract undue attention on the streets and in the schoolroom? , Dorothy M. Ingerson, '18, 0 4 + Q A Schoolday in Stockholm UNE is the month of light and bloom in Sweden. the month S Y Zi when night is only a mysterious, silvery veil over the countrv, , V - I . K nl and the sun hides belund the mountan tops for only a few hours, 'L .5 . . . It is the month when sleeping seems a waste of tune, and I was Jk7..'.l-. fo-i up bright and early on a certain Monday morning. By eight o'clock I had taken a stroll in the nearby forest, eaten breakfast, and was on my way to the station. to catch the train which would take me to Stockholm where I attended a school for girls. The walk was a short one, but one that I enjoyed especially in june when the cool morn- ing air was filled with fragrance from blooming lilac .hedges and wild rose bushes. My thoughts on this particular morning were busy with the nearing vacation and the excitement of the last days of school. , I usually spent the fifteen minutes, which it took to reach the city, in looking over the day's lessons. Once there, it did not take long to run dowin a few familiar streets, turn a corner-and there stood the school- house, a large, gray stone building surrounded by sand lawns and shaded by old elm trees. I entered the school through a massive swinging door and turned down a corridor to the right of the hall. I entered, what in Sweden is counted as the fifth grade. The large sunny room was already filled 45 with girls who were having' a good time chattering away, for there were no restrictions in the morning. At a quarter to nine the class passed to the assembly on the second floor. Here the school gathered each day for morning exercises. There were the three preparatory grades on benches far in front, next the eight regular grades, and last the four, which we called rings. All to- gether we were about five hundred girls. Still this was only one of about fifteen schools for girls in the city, and then, of course, there were also the boys' schools and the public schools. The exercises were short. A teacher read a chapter in the Bible. repeated the Lord's prayer, and the school sang a psalm, after which the classes left for their respective rooms to begin the work 'of the day. My first subject was Swedish and Monday was composition day. The teacher entered, wrote a few subjects from which to choose on thc board like 'Zeanne d'Arc, The Battle of I.utzen, and for the next forty-five minutes no other sound than the scratching of pens was heard. Then the bell rang for ten minutes' recreation before the next period. livery girl hurried out of doors, and games of tag and hide-and- go-seek were soon started, while those who felt too old to play walked back and forth. The next period we had Bible study, which generally meant the recitation of a long catechism lesson to a young minister, who was our teacher. This was the last of the monning periods, and as soon as the bell rang those of us who did not live in town hurried down to the dining room where we seated ourselves at a long table. If we cared for it, we were served milk or hot chocolate to drink with our sand- wiches. After dinner we went out in the garden, really an old apple orchard, adjoining and belonging to the school. Here we strolled about arm in arm, discussing school events. Among other things there was much guessing and wondering about our term marks, for there were no monthly report cards to prepare us for the best or the worst. Failing in one subject meant remaining in the same grade for another term or working hard during the summer and trying a test in the fall. It was with a heavy heart that I took my seat for the first period in the afternoon. Geometry! I wondered if any girl really liked it. The minute Mr. VVolff was inside the door everybody was at attention. His sharp eyes swept around the room noticing the slightest disorder, and his questions hit us like cannon balls, so quick and unexpected were they. If Mr. Wolff was terrible, our linglish teacher was tl1e more pleasant by contrast, and we had a good time together while we struggled through tl1e difficulty of the first term's English. The last period was divided between music and gymnastics. During the summer we usually played ball or danced folk dances out of doors, 46 but during' the winter we always took exercises in the large gymnasium, according to I.ing's method. At three o'elock the school was dismissed for the day and, as it was very warm by this time, I decided to take the boat home instead of the smoky train. It was at the last moment that 1 made my way through the crowd on the pier, boarded the little steamboat and found a seat between a good-natured old lady, and what appeared to he a business man, hidden behind his newspaper. Slowly the boat left the pier, and headed for the sea. The salty sea breezes were refreshing and a feeling of restfulness came over me as I watched the path left by the boat tugging bravely forward. Suddenly the whistle blew, the boat slowed down, and then stopped at a bridge. The gentleman at my right stepped off, still keep- ing an eye on his newspaper. We were soon on our way again, and the farther we came the more ehanging and startling became the scenery. The boat wound in and out among islands covered by woods that partly eoncealed neat little cottages. Soon came what seemed to me the most beautiful part of the trip. The boat made a graceful sweep and entered a narrow channel lined on hoth sides with willow trees that met overhead, shutting out the sunshine and throwing dark shadows over the deep blue water. The boat emerged into the daylight again, and for a moment it seemed as if it were trapped between high, formidable cliffs: but the next moment I discovered a narrow waterway between the mountains, The boat entered slowly, and as we were passing through, I could easily have touched the cliffs on either side. A few moments later I had reached my destination, only wishing that the trip had lasted longer and that there were no German, Botany and Ancient History lessons to learn for the next day. Vera Ohman, '20. 0 0 0 Q Dialogue Between L'Allegro and Il Pensoroso fAn Interpretation as Submitted in Class-Editor-Q I.P.-tXValking about in the wood in the early morning, he thinks aloudj- Ah! Here at least is a quite nook. livery where 1 ani interupted in my meditation hy some idle or curious pleasure seeker but here 1 may think. ttfoutinues walking slowly with his hands clasped behind himj L'A.-Q XValking about in the opposite direction from l. P. Both are un- aware ot their proxiinityj I-le exelainis- Truly this is a day for the 47 gods themselves! How I shall trip it and skip it the whole day long! Oh! for a companion! I simply cannot celebrate alone. tStops to pick some violets.i L'A.-tAs he hears footsteps approachingl My wish is granted, but alas! tl-lis face falls as he recognizes I, PJ I. P.-tfXroused from reveriej Some one here, and I thought myself alone. tffontinues walkingti L'A.-tCan not longer endure his solitude so detaius even l. PJ Good- morrow, sir! You-know me not ? I.P.- Indeed I do, even all your vain and fickle traits are known to me. X L'A.- 1 know of you as a poor comedian and as a source of disappoint- lueut, hut stay one moment. I. P.- XVhy stay?, What have we in common ? L'A.-Uliverytliing is ours together. For do we not each have a place in the minds of living mortals P I. P.- You-think so? 'Tis rather deep thinking for one of your type. L'A.- Your words contain both good and had criticism but 'twas you inspired that thought of mine. I. P.- Your flowers are beautiful. L'A.- It's a beautiful world. Why, this is a perfect day! Oh! do you not enjoy an early morning stroll the more for gathering some bright blossoms? I. P.- To pluck one violet is to me like taking the life of it little child. lt is best to leave them where they grew. They fade quickly even then. L'A.- I would we might be friends. I. P.- This morning we are rather friendly enemies. L'A.-- Meeting you has aroused the best that is in me. 'Tis strange we never met before. I. P.- I know the reason, for I shunned your presence. L'A.- It just occured to me what wonders we two, united might ac- complish. To all the sorrowing, heart-broken and gloomly I could give my joy. To my following'-the light-hearted, mirthful, merry. and frivolous you could give inspiration for better things. W'hat say you to my plan ? I. P.- Fools rush in where angels fear to tread, but I am tempted to take you at your word. For just this day we might experiment. L'A.- Let us try our best and make this day together worth two alonef' K. Dorothy Shirer, '17. 48 ,., , so M - ,. 1 1 iw ,ff .af I LX v 11, mn, Q N x X -N XX .' I X 1 .1 1 N wg 1 ad . X J .,,,,. THE LYCEUM Season 1916-17 OFFICERS First Term GORDON li. PJXULSON ...... President LEROY BRUNSTROM , ARTHUR LEIET . . . ERIC C. OLOFSON . . CI.,-XRIQNCIC PICK.-XRD Second GORDON li. P.-XULSON LIZROY BRUNSTRUM . PAUL IERICKSUN . , LAWRENCE IE. DAVIS CLARENCE PIUIQJXIQIJ ARCHIIQ PARKER . . 4 9 Term . Yicc President . . . Secretary . . . 'I'rcasu1'cr Business Klrmnager President President . . . Secretary . Yicc . . . Treasurer Business Manager Sergeant :mt Arxns Lyman Aiken Roy Bader Paul Barrett .-Xrthur Bergren Leroy lirunstrom Joseph Carlson Lawrence lf. Davis Ralph Donovan lYalter Eckberg Paul M. Erickson Elmer liancher Leland Gardner Carl Geser Daniel Gurney Hjalmar Gustafson Ahner l-lagherg Charles Hall Lyceum Members Herbert Hcrmanson lYortley Ingham XX'alter johnson Ralph jones Ernest Leet Hugo Nicholson Erie Olofson lYilliam Olson Archie Parker Gordon li. Paulson Clarence G. Pickard Allan Rowley Lytron Scholpp Sylvan Scholpp NYaldo Stanford Clark Torrance Loren Townsend 0 The Debates North Tonawanda, December 8th, i916 Our first debate of the season resulted in a clean victory. The visitors came forth with the good intention of putting our team to naught on the subject of universal peace, but they met with strong op- position. Jamestown upheld the affirmative of the question, Resolved: That the U. S. should join other nations in the formation of the proposed league to enforce peace on the general plan outlined by l-Iamilton Holt in the lndependent of September 28, l9l-L Villietliei' Hamilton Holt was right or wrong in his ideas of universal peace, our men presented arguments which must have convinced the visitors they were wholly wrong in their stand against the international machinery for securing the popular endorsement. The Lyceum hoys made a splendid showing and out-matched the visitors in both argument and presentation. The speakers for North Tonawanda were Archie Thompson, George Raseh, and Arthur McCormack with Gerhard Witte as alternate. Those for Jamestown were Sylvan Seholpp, LeRoy Brunstroin and Clarence 51 Pickard with Paul Erickson as alternate. The presiding officer of the evening was George IV. Gokey, member of the Board of Education. The judges were former District Attorney John K. Patterson of Dunkirk. XVilliam B. Blaisdell, Superintendent of Schools of Fredonia, and Rev. Mr. Benton, rector of the Methodist Episcopal Church of Fredonia. Kane, December 16th, 1916 Our second victory was not easily won and came on a two to one decision of the judges. The home team upheld the negative side of the same question presented the week before, when the first team defeated North Tonawanda. The Kane team, despite the fact that one of its speakers appeared in knickerbockers. was a strong contesting faction and put up a forceful defence of the proposed peace league. The Lyceum boys won on what appeared to be a preponderance of evidence and an adequate delivery. The fact that the contest was so evenly matched made it both exciting and humorous. llaving defeated North Tonawanda on the negative and Kane on the affirmative of the same question demonstrates that Jamestown won on merit rather than on any decided difference in the question. The speakers for Kane were Rolf Beck, lilisha Kane and Axel Hennell with Orhas Mcckley as alternate, Those for Jamestown were Laurence Evans, Gordon Paulson, and Eric Olofson with Lytron Scholpp as alternate. The presiding officer was Wilson C. Price, Presi- dent of the Board of Education. The judges were Norris A. White of XVarren, Pa., J. C. Junkins, Head of the Department of English of lllarren, Pa., High School, and Attorney Glenn W. XYoodin of Dunkirk. Lockport, April zoth, 1917 ln the debate at Lockport our team was defeated on a six to three point decision of the judges. Lockport won six points for argument and Jamestown was credited with the three points for presentation. Our team upheld the negative side of the question. Resolved, That the U. S. should adopt tl1e Swiss System of Compulsory Military Training. It was the deciding debate of the series for the Rush Rhees trophy and was closely contested. lt might be said that the Lockport debaters had an advantage over our men, having debated the same subject on two previous occasions. The speakers for Lockport were Clarence Keating, Theodore Far- ley, and Lyle Kinne. Those for Jamestown, Abner Hagberg, Ernest Leet, and Clarence Pickard. The judges were Attorneys Arthur Moore 52 of Fredonia, XV. T. Bushman of Buffalo. and Prof. Calvert K. Mellen of Lafayette H. S., Buffalo. Falconer, April zoth, 1917 XN'hile our first team was unsuccessful at Lockport, our second team won a two to one decision over the suburban dcbaters. Jamestown up- held the affirmative side of the same question debated at Lockport. It was the first appearance of Falconer I-ligh School debaters in Jamestown in recent years and no doubt they were bent on carrying off the honors. But the Lyceum boys were fully prepared for the contest and put up a skilful defence of the proposed plan. The speakers for Falconer were Marion Russel, Harold Anderson, and Vincent Sweet. Those for Jamestown were Lawrence IE. Davis, Loren Townsend ,and Sylvan Scholpp. George F. Gokey of the Board of Education presided at the debate. The judges were Rev. NYaltcr C. Heck of XN'arren, Pa., Principal liniory Pierce of Sinclairville, and Attorney Harlan L. Munson of Westfield. Columbia Contest at Buffalo ln the preliminaries here, LeRoy Brunstrom was chosen to represent Jamestown High School in the tryout for the Columbia Contest held at Buffalo last March. The decision was awarded a Buffalo man. 5 9 0 Q An Oratour An oratour ls he. that can or may speke or reason ln every questlon sutfleetly, elegantly and to perswade properly. oecordynge to the dygnltle ot' the tliyng that ls spoken of, the oppertunitle of tyme, and pleasure of them that be hearers. -Sir Thomas Elyot. l-lli High School Lyceum will close one of the most successful years of its career with the annual banquet in june. The carry- ing out of an extraordinary program is the significant feature of the present organization. Last fall a plan was formulated whereby regular sessions have been held once a week at which programs comprising de- narlianientary drills, declamations and extemporaneous speeches have been rendered. These weekly program meetings have afforded every member an opportunity to acquire practice in public speaking and debate. Ml if bates, I Through the Lyceum debaters, Jamestown High School has gained further distinction in debating circles of western New York and Penn- sylvania during the past season, having won three out of four debates. Separate accounts of the debates are given later. 53 On different occasions the Lyceum members were favored with addresses by several prominent men in civic affairs. Principal Milton J. Fletcher gave a vcry interesting talk pertaining to the junior Board of Commerce and urged the Lyceum members tn take an active part in its organization. Our members .now figure prominently in this new move- ment. One of our star debaters. LeRoy Brunstrom, is President of the organization and four of its directors are members of the Lyceum. We have establislierl a precedent for future members by taking an active part in civic affairs. The second speaker on our program was Mr. Robert l-I. jackson. llc spoke on the value of an early training in public speaking and debate. lt was an opportune subject and well discussed. The third speaker was Mr. G. R. l3roadberry. He favored us with an interesting discussion on the proposed commission form of govern- ment. To have such prominent men as these interested in the Lyceum, speaks well for its growing importance. ' The writer of this brief account truly believes that he expresses the sentiment of every student who has taken an active part in debate work, in paying' a tribute of respect and appreciation to our friend, Mr. liarle S. Palmer. Our success is due in no small degree to his careful and systematic coaching. y 4 9 0 9 Victima Teach me how to spirare, my dear, And teach me how to bend. lace the windows aperta wide Add a calisthenic end. Teach me how to vertere and stretch To dextram-laevam-forward face. Teach me how to levare my arms .-Xnd wiggle eos in space. Oh. teach me how to rise and sedo, And jolt me circum till You've worn the new fad out Qet mel In hoc military drill. F. M. F. B. E. E. 54 LATIN DEPARTMENT Ictus in Magistros Facultas-- Nec possnnms vohisclnn vivcrc. nec sine vihisf' Mr. Fletcher- Shut lacrimae rerum ct mcntem morlalia lIll'lglll'll.n Mr. Corwin- Venatm' fcrox et strcnnus. Miss Farman- Refer ntl scnatumf' Miss Jones- O, lucc magis clilccta nnhisf' Mr. White- Quo nsquc tandem ahutcrc nostra pnticnti:1? Miss Briggs- Dux fcmina factif' Miss Bargar, Mr. Palmer- Mulla inter sese vario scrmone SCI'Cllllllt.u Miss Nelson- O tcmpora, O mares! Mr. Steere- Valli, vitli, vici. Miss Dean- Varium ct mutabile semfcr feminaf' Miss Todd- Natal ut mlcsignat oculis acl cacdem unum qnemque nostrtnnf' Miss Gifford- Mens innnota manctf' Mr. La Salle-- Patimnr hebescere acicni auctoritatisf' Miss Bell- Ram avisf' Q Miss Ritenour- L'antus cleclcrcf' Mr. Persell- Ambr0siac comaef' Mr. Bentley- Rosen vultu refuls-it. Virgil Class- Dcfessae Aeneadaef' Ruth. M. Stemberg, '16. Beatrice E. Eckberg, '16, 0006 To a Latin Grammar To be sung to the tune of Solomon Levi Oh here is a Latin Grannnar, 'Tis a wonderful hook, you know-: lt teaches many a particle, And thc principal parts of DO. It distinguishes many a genitive, Objective, partitiveg lo It tells each separate purpose clause, ln Caesar and Cicero. Litotes, litotes tra la That's thc funniest part of it, tra la. 55 Zcugnizi, protzisis, syncope, Subject-a.ccuszitive, sure, Oli YOU can translate and paraplirase Your Latin literature. Indeed with all this help of mine In forms and syntax so, l think your lessons would he so fine, Youll never say Dunno , Mood and tense, mood and tense, tra ln, That's the hothersonic part of it, tra ln Discourse direct :und indirect, Sequence, idiom, case: Subject. adjective, predicate-noun, lixtent of time and space. . Indeed with all these principles Of prose and poetry, too, 1 wonder we ever get Excellent And so, Illll sure, do you. -Adapted froin the Videndzi. 6 13 .X X F- I 1 . x.v 5 G i ,f,w ii: ' 'i 1471133 12153 1 Ax K 1 'i nf' iv A-Xls ic h GERMAN DEPARTMENT Eine Errinerung Aus Meiner Kindheit LS meine Schwcster und ich kleine Kinder warcn, wnren wir sehr nnartig und meine nrme Mutter war oft tranrig dariiher. Sie wusste nicht was sie mil uns tim solhe. Nutiirlich hcstrufte sie uns, aber es half nicht und wir wnrcn eben so nngezogen wie zuvor. liines 'Pages als meine Mutter ein lllittzigsschliifchen hielt, kroch ich sehr leise in das Hans und stahl Strcich-hiilchen. hinausging hegegncte ich meiner Schwester nnd zusznnmen stccklen wir nnser Haus in Brand. Die Flzunmen sprangen pliitzlich auf und griffcn nm sich. Bald roch meine Mutter den Rauch und so sclmell wie miiglich lief sie hinans. Ein Nachbar welcher die 'Flannnen gesehen lmtte, liischte dieselben aus. Zur Strafe wurdcn mcine Schwcster nnrl ich in nnser Zimmer einge- sclilnsscn, zihcr es war uns einerlci, und dn. szmgen wir Lieder mit lauter Stinnne. Spiiter besnchte mcine Grossmutter uns, und als sie hiirte class wir schiinc Kirchenlieder sangen dn hat sie nnsre Mutter uns die lfreiheit wieder zn gehen. XYir miissten aber nnserer Mutter versprechen es nie wicder zu inn. Wir hahen nnscr Versprechcn gehalten. Inez Nielsen. 4 0 O 9 Die Rote Mutze RITZENS Mutter hatte ilnn eine rote Miitze gemacht, Sie war sehr schiin. Er ging yvie ein Kiinigz Elr sprach kein Wort zn , semen Frennden. Seine Mntze geflel ihm besser als Butter- kuchen und Marmalucle. Eines Tages hiess seine Mutter ihn 'f' '1 'k nach dem Laden gehen, aber er gehorchte seiner Mutter nicht gern, Er wollte mit seiner schiinen Miitze spazieren gchen. Aber als er nach dem Laden ging, dachte cr: Ich nmss sehr schnn aussehen mit dieser roten Miitze. Nun bin ich ein Herr. Nun gefilllt es Frieda, dem kleinen Miidchen mit dem lockigen Haan Indenl er damn clachte, kam ein grosser starker lVind und nahm seine Miitze mit. Er fing an zu weinen. Seine schiine llliitze war versehwnnden. Sie kam nicht wieder zuriick. Er lief so schnell er konnie, mn seine Miitze zn finden. Er lief nnd lief. Iis wurde dunkel und der Kleine war weit von seiner Mutter. Pliitzlich hlicb er stehen. Seine Miitze hing an einem Baum ln dem Garten des Kiinigs. Dann sah er einen Mann in dem Garten slehen. 57 Er rief ihm zu: Mein licbcr Herr, sagte er: Bitte, Geberi Sie mir nicine rote Miitzef' Der Mann wandtc sich dem Klcincn zu. Deinc Miitzef' hrummte er, Ich hahc dcinc Miitzc nicht. ja, Sie hahcn es. Maine Miitze hiingt an dem l.i3.lIllI,H weintc Fritz. Jn, aber mln bist ein nnartigcr 'Iunge gcwescn, dn darfst deinc Miitze nicht hzilaenf' Der Mann ging nach dem Palast. Pliitzlish kani ein sehr schiincs Mndchcn aus dem Palnst hinzxus. Karl, sprach sie, gil: ihm seinen Hut. Nun wird er ein zirtiger 'lunge sein. Dann sagte sie zu Fritz, Nun ninsst du ein nrtiger junge sein und cleiner Mutter gehorchen, damn wird cs besser gchen. Geh' helm zu deincr Mutter. Von nnn an, saglen alle. die Fritz sahen, Er ist solch ein artiger -lunge. , Anna C. Marker, 20. A N i Y Q N915 ' XMIM!! Q J. . , 58 FRENCH DEPARTMENT Un Discours Entre Deux Livres Le Tour cle lzi lfrzmee, presse sous lc pupitre rl'un eleve, pousse l,'Al1be Constantin-.Xssez la comeclie, grontle I-'.'Xhhe Constantin-Oli, :lil Le Tour de In l7i'am'e. pnrlez-vous francais? -Certninemeut. repnutl l':iutre livre, j'z1i 143 pages cle hon francais, aussi tles commentaires et un voczilmlnire.-je suis tout content de trouver quclqu'un qui pm-le frzmcnis. 'le n'zxi pus entcntlu cle francais exceptc la grnnmmire qui clit seulement- -je portc, tu poi-tes, il porte. -Telle stupiditel -Aimez-vous zi clemeurcr dams une ecole nmericziine? tlemzmcle l.e Tour de la lfrzmce poliment. -Pas du tout! s'eerie l,'Alihe Constantin. Lf'est dommage cI'etre employe comme un Iivre de elnsse. lin France ou j'etais eerit, on me lit: on me eomprencl: on nc fait pas une dissection de moi lentement et tortueusemcnt. On pleurc quand tlocteur Reynnucl est tue dans In guerre et on rit quand Bettina s'est invitec nu diner chez le cure. Mais ici-ici! Les eleves me lisent fort mal n voix lmnte comme ceci. -Mays il na trouvay rien 5 reponder le vier coore. lit aiusi cle suite. Puis un professeur dit des questions comme eeci. ' -Qui apporte de Vnrgent :mx pauvres du cure? Enfin npres cle Vliesitatiou et ales luux pas, l'eleve repontl. -Bettina et lllzulame Scott nnportent cle Vargent au coore. -je suis si interessant mais on ne pense qu'a bien reponzlrc pour ohtenir un hon point. Le Tour cle la France replique avec de la sympntliie. -Clest ngrealmle cle parler a un livre qui eomprencl. C'est exacte- ment mon tlestin. Une page tous les jours. On ne me finit jamzns. -Vai une petite place noire tlans nn pupitre qui est deja rempli. Les eleves me repousse ca et ln. -Ie suis tout n fait mis hors de service. L'.-Xbbe Constantin. -Viola 1:1 vie, mon limi clans une grande eeole. R. B., '18. 59 Jamestown, LaSalle d'litude, Le vingt-huit avril, Ma cliere annie. .le sais que ce n'est pas a moi de vous ecrire, mais puisque j'ai un peu cle temps je vous raconterai comment je passais le temps pendant les vacances cle Pacques. ll faisait lieaucoup cle pluie, nmis un lieau jour quatre ou einq cle mes amies et moi nous nous sommespromenecsa Freivs- hurg, qui est une distance d'a peu pres huit milles. Nous nous sonnnes par- ties a clix hcurs de matin et nous y sommes arrives a unc heure moins vingt. Nous avions quelque chose a manger avec nous, nous avous mange bcaueoup parceque nous avions bien faim. Apres avoir mange, nous nous sommes faites photographier. Nous avons eueilli' beaueoup Ale fleurs de Mai. Nous sommes parties pour chez nous vers quatre lieures. Quand nous etions allees a peu pres une millc, le pere 4l'une des filles est vcnu avec son automobile. Il nous a invites a monter. Nous Vavons fait, et il nous a menees chez nous, Nous nous sommes amusees tres bien ce jour-la. Le jour prochain etait tlimanche et je me suis allee a Veglise comme al'ordinaire. Lundi soir, je me suis allee at une partie cle Paeques. Nous nous y sommes amusees liien. Une soiree nous avons eu une partie pour le rlincr. Apres le diner nous sommes allees au theatre. Naintenant je ne peux penser a rien de plus a reconler rle ee, que j'ai fait ces deux semaines, mais je suis sure que je in'amusais tres liien. je n'ctais pas encore prete a retourner a Vecole et at mes, 'etutles. N'oubliez pas de repontlre a cette lettre le plus tot possible et me dire comment vous passiez le temps pendant les vaeances. -Ie suis toujours. votre amie devouee, Laura. , QKW,,. 5 ,.x,4bQ-ik! I0 esta 'S hoo t ff llli Latin pupils of the Sherman Street School, under the diree- igl tion ot' their teacher, Miss Smith, gave a very successful enter- Ifx 1 C I sh ttn ltys l l l ll l u s l X is ilyi ' ainnient on the evening of May l, The program included two , I xl! 5 ort L: 'i pays, .ucus ant etie a Vetta 'irg'i1': EXILQF, llrill, and l.atin songs. llefore each play Z1 careful synopsis was TTJ given which, with the spirited acting' enabled the audience to follow the story with little difficulty. The Vestal Virgins' llrill was given hy nine girls dressed in Greek costumes and was very beautiful in marches and postures. with the eleetrie torches used in place of lighted candles. The girls ot' the liirst-year elass sang l levit l,epus Parvelus and Gandeniaus lgiturf' :X portion ot' this program was given also at the Newland Avenue and Charles Street Schools, as well as hefore the Second Street Grammar School, and the Latin L'luh of the lligh School. On Thursday evening, April 19, in Institute l-lall, Gilbert iXlcClurg of Colorado Springs, t'olo,, delivered to the teachers of .lainestown and others interested, his illustrated lecture, To the Shining' Mountains and the Sunset Sea. The clear and finely colored views of the Great Northwest impressed those present with the heauty, the agricultural opportunities and possihilities within our own eonntry. To bring his audience to the realization of the latter is one ot' Mr. RleClurg's aims and for this purpose he has traveled extensively on this continent and abroad, gathering the information which he presents with eloquence and humor. Un Deeeniher 2.2, l0l6, the junior class had charge ot' the t'hristnias exercises which were of an entirely different type from those of former years, the entire prograni heing' given hy the juniors lheiuselres. ln- stead of the usual address. eight two-ntinute talks were given on the general tupie the C'hristnias Spirit. The music was furnished hy l.eRoy lirunstrom and llarry Stain, G1 The preliminary registration in Mechanical Drawing seems to in- dicate that many more students than usual will select that subject. In March the Sophomore girls remained at the close of the 4:45 period for the purpose of electing a cheer leader. Catherine Barrett, president of the class, presided, The vote resulted in the election of Marabelle jones. The girls practiced yells for a short time and the meeting was adjourned. This year a new plan was inaugurated for instrucion in the use of the library. Instead of being given to the Freshmen, as heretofore, the work was given to all the students in English Second Year, during the fall term each class having one appointment for a period of four weeks. Miss Green took charge of the classes as they came to the library, and gave lessons in the essentials for the use of the library. that is, the general scheme of arrangement, the use of the card catalog, the reference books, and the indexes. Thus the library work becomes a part of the regular work of the English department, and hereafter will be conducted in this way. Miss Green is assisted i-n the library this year by Miss Ebba Zetterberg, who is preparing to take a course in a library school. During the winter Miss Green was ill for a month, and Miss Zetterberg assisted bv Miss Ada Swart, a member of the Teacher's Training Class, took charge of the library in a very capable manner. The library is affiliated with the New York State Library Associa- tion, through meetings of the library institutes held annually. The meeting this year is to be held at Dunkirk on May ll. at which Miss Green will present a paper on Reference Materials and Reference XYork. Q Q 9 0 The Modem Language Department ' -if UCI-I interesting and instructive work is done in the Modern MQQJIF, Language Department. A French Club has been recently lily, organized, which meets every second Monday. Its object is to increase the interest in the French language, promote the know- lr' ledge of the country of France and its customs, and aid in con- ' versational French. The programs of the club are variedg por- tions of French classics are read by the members, French selections are played on the Victrola, and games are played which require a great many French words. One week a talk was given on the condition of Paris at the outbreak of the war. Recently, a French poem was re- cited, written by Alan Seegar, an American, who offered his services to G2 France. and was killed during the present war. One of the programs was as follows: Discussion of business matters. French game. Stereoptieon lecture. giving views of Paris, showing important public buildings, characteristic street scenes, and street trade. Marseillaise, sung in French by Club. A number of records have been purchased from the lnternational Language Phone Company of New York, as an aid in studying Spanish. Iiach record is a complete lesson in itself, and affords much interest. as well as being a great help in prommciation. In time, these records will be purchased for use in connection with all the languages. Large pictures, depicting scenes of country life, are used in the study of Modern Languages. These show a great variety of animals, birds, trees. and implements used on a farm. The pupils describe the pictures. and hence. their vocabularies are increased. Alice Clark '17, 0 6 O 9 XIONC the nianx clubs which haxe been organized in the High The Girlis Literary Society bus' ' . -' ' ' . School during the past year. the Lnrl's Debating Club, known as the Athenzeuin. and the Girl's Literary Society have been the 3 K-UQ! pioneers. being outgrowths of last year's Salmagundi Club. The 'f'i.-73' Literary Society consists ofa group of girls of the third year ling- ' ' lish classes, organized for thepurpose ofbecomingbetteracquaint- ed with the best in literature. .Xs the English work of the High School takes up the study of only one or two .Xmerican writers. and there is such an abundance of great :Xmerican literature, and so many celebrated American authors, it would seem that the course is inadequate, in that students might get the impression that American literature is unim- portant. So the work of the elub for the present year, is confined to the study of American authors. The first meeting of the club was necessarily given to the business of organization, the following officers being elected: President, Katharine Kahlcr: Vice-llresident, Beatrice Cramer: Secretary, Elsie Butts: Assist- ant Secretary, Esther Lcet: Treasurer. Ellen johnson. The club meets on alternate Thursdays of the month. The member- ship is limited to fifty, there being twenty-eight charter members. A general committee was appointed, whose duty it was to outline the work for the remainder of the year. and to select sub-committees to take charge of each program. 63 Thcre have been already presented six programs upon the following authors: james Whitconih Riley, Helen Hunt jackson. jean Webster. liugene Field, Henry XYordsworth Longfellow, Washington Irving, and james Russell Lowell. Each program consists of a biography of the author. readings and recitations selected from his writings, and, some- times, victrola selections taken also from the author's works. Roll call is responded to by quotations from the author. Each program is in charge of a committee, each member, of the clnb serving one or more times during the year. The great value of the work lies in the fact that all of the pre- paration is done by the members themselves, their programs being subject only to the approval of the teacher in charge, who is merely an advisory member. It.is hardly necessary to say that the members are loyal to the club, for, by its means, they have acquired, at least, a speaking acquaint- ance with some American authors, whose names heretofore have been only names to them, but which now have a deeper significance. There are other assets besides the knowledge of literature gained, chief among which are the ability to conduct business meetings, the knowledge of parliamentary procedure. and the gain of poise and self-confidence in speaking before an audience. Katharine Kahler, '18, 0000 The Athenaeum llY should everything be restricted to the boys in the High 1 School? This is what a few of us girls wished to know. Upon , , talking the matter over we decided to see what could be done about forming a debating society. The plan was submitted to Miss VVillard, who kindly consented to aid us, :X meeting of all girls taking Second Year English was called in the latter part of October. There was a large attendance and the girls seemed greatly in- terested. The object was explained and several committees appointed, one to draw up the constitution, and another to select a name. The Athenaeum was decided upon as a name for the society, which is a rather pretentious one, but perhaps it will inspire us, in time, to do great things. It may be interesting to note some of the programs. Each girl was asked to prepare a short theatrical, recite a poem, or take part in a dialogue. These programs were entertaining and gave the girls courage to speak before an audience. Miss Stone gave ns an interesing talk on l arliamentary Law. One meeting was devoted to an open discussion on the subject: Resolved: That a uniform dress should be worn by the lligh School girls. Our first debate was on the question: Resolved: 64 That two years of travel are more beneficial than two years of college. The affirmative was upheld by Marie Parker and Edith Dawson, and the negative by Rosamund Shepard and Lily Carlin. The negative won, but both sides were well given. It was an example of what could be done by the girls, and an inspiration to make the club a success. I-lot talks furnished another interesting program. One of thc programs we enjoyed most was the debate on the question: Resolved: That capital punishment should be abolished. Priscilla Armstrong and Maud Crouch took the affirmative, Ernestine Pulver and Velora Davis, the negative. The latter won the debate, but long and careful study by both sides was evident by the arguments presented and the manner of delivery. Our object through the year has been to learn something about Parliamentary Law, and to give the girls more knowledge of debating. Ry so doing we hoped to show what girls could do and to create more interest in this line. We have made a start and intend to show the boys something before we graduate. One thing we have already attained is less embarrassment in speaking before our classes. English is largely oral and the girls that have belonged to The Athenaeum have had a chance. to receive higher standings than the others. If anyone is in- clined to criticize, let him remember that the Lyceum has been in exist- ance for years and has this advantage over the Athenaeum. The officers for the year are as follows: lst Term 2nd Term Mary E. XVarren . . President Mary XVarren . . . President Pearl Anderson . Vice-President Lily Carlin . . Vice-President Margaret Anderson , Secretary Rhoda Thorranee . . Secretary Helen Sparks . . . Treasurer Mildred Brunstrom , Treasurer Mary E. Warren, '19. 4 4 0 0 History Department I ,',, HE great world struggle, involving, as it does, every American l,f'T7'l1 interest makes increasinglf vivid and im ortant the stud' of i . .5 3 P 3 'I' E what man has done and the problems he now faces. So keen is if N . . . . . QMS' the student interest in this field of study that five hundred and lfx f' fourteen have enrolled for work in the Department of History during this semester, while the preliminary registration for next fall totals to a still greater number. The Department embraces a broad course, Ancient, English, and American History, Economics, and Commercial Law. By the time he is graduated, the student taking this work is surprisingly well grounded in the more elementary fundamentals of the Political and Economic science. G5 A number of special features have added interest to the students' work this year. ln American History stereopticon lectures cn those periods most remote from the pupil have been given, while students in Ancient History by like means have measured with their own eyes the colossal structures of the Nile valley, the graceful temples of the :Xncient Greeks, and the real greatness of the Romans as builders. Problems and general subjects in history are singled out for debate. Recently two warm contests were held in the Ancient History classes cn the proposition: Resolved, That .lulius Caesar was a greater states- man than Augustus. The affirmative speakers in the first debate were: Miss Lucy Neil, Miss Mabel johnson, and Miss Elizabeth Blomqnist: in the second: Miss Beatrice Hoskin, Harold Sundquest, and Bailey Brown. The negative speakers in the first debate were: Carl Geser, Miss Priscilla Armstrong, and Marvin Peterson: in the second: Miss Meave Mason, Lytron Scholpp, and Ernest Leet. The judges for the first debate were Miss Schlotzer and Mr. Winslow: for the second: Miss Carpenter, Miss Dean, and Miss Peterson. In both debates the decision of the judges favored the negative, although both teams fought so well that the decision was difficult. An even broader course will probably be adopted by the Depart- ment in the near future by taking up the study of the other modern countries which are playing such an important role in world politics to-day. lt is believed that the recently appointed State History Syllabus Connnittee of five will formulate such a course as will be adaptable to every high school in the state. The High School and the Depart- ment felt especially proud and fortunate that the Educational Depart- ment at Albany has selected Principal M. nl. Fletcher as one of the members of this syllabus committee. XVe hope that within the next ten years Political and Economic science will have become recognized as so important that Charles Hughes will never again have just cause to deplore the deficiency of the average American's education along these lines-never-at least until he can say it in the VVhite House. - 9 0 5 5 The Latin Club 39' order to stimulate interest in the Latin language and to make if 'ill the work more interesting to the student, the Latin Club was ' 5 ?i formed. lt is composed of girls from the Vergil and Cicero 'Uv W. classes, and has a membership of about thirty-five. At the first ,il- fi, meeting, February 9, 1917, the following officers were elected: T 'T President, lflsie Wicander: Vice-President, Ruth Sternberg: Secretary and Treasurer, Ellen Coleman. Later Latinae Sociae was chosen as the name. To insure a good attendance and to cause a friendly rivalry between classes, a system of counts has been adopted, whereby counts, or honors, G6 Q I are given to each class for attendance at the meetings, special features of programs, and for illustrative work. The class which has the most counts will he especially honored at the close of the term. However, no counts are given for attendance unless all of the members are present. Thus, each student is held responsible for the welfare of his class. The principal feature of each meeting is the program, prepared by the students aided by one teacher. liach class has a program in turn. Seine very interesting and instructive ones have already been given, such as, Roman ll'omen, Ancient Myths in Modern Literature, and Vergil and His XYorks. The following is a proffram in full, as -fiven at the last meeting by a second term Cicero class: ii is A Plea for the Classics tliugene lfieldl . , . Janette lYiley Cicero in Maine QM. B. Dunn! .... . . . lilsa Nord A Glimpse of Cicero the Man, in His Letters . . Katharine Kahler Ave Maria ttjaruso and Iilmanj Conjurzttio -A Latin Play Dramatis Personae Catalina ........ Ruth Schenk Laeca . . . . . fflsa Nord Cethegns , . Harriet Roberts Ceparius . . Margaret Kahler Cassius . . . Janette lliiley Lentnlus . . Katharine Kahler Philander . . Ruth Ringquist America fLatinj . ............ Latinae Sociae It is hoped that the Latinae Sociaeu will be so successful that next year many more may be encouraged to join and to receive the benefits of this worthy organization. Ellen C. Coleman, '18. v Q Q 0 The Physical Science Department l Y Y HE Physical Science Department is doing its bit now as ever to i Q help J. H. S. to keep up its reputation as one of the most np- to-date schools ofthe state, In the department ot physics we are fully alive to the fact that scientific knowledge is developing I rapidly, and u'e have no intention of becoming a hack number. Our laboratory equipment, at present, compares very favorably with that of other schools of our size in the state. but we are planning to add a number of new pieces next year that will make it possible to do work which we cannot do with our present equipment. lVith the addition of this new apparatus it is planned to revise our laboratory 67 course so as to include more exercises that are more closely related to modern life. NVe are also to have a new demonstration table for our lecture room. This will not only make us look more up-to-date but will mean more demonstrations, not practicable at present, to help clarify points in the recitation work. In physiography it has been the policy for some time to emphasize the many fine examples of physiographic features within easy reach of Jamestown. The purpose of this has been two-fold. First, to give the student a chance to observe these features as they actually exist in nature, and second, to stimulate a desire on the part of the students to get out in the fields where health and vigor await them. ln this connection we are introducing a new feature in our physi- ography classes. lVe arc recording in note-hook form all types of physiographic features which we find within easy reach of the city. This material is to be collected by both teachers and pupils, and properly indexed and classified, so as to form a convenient reference for any who are interested. Thus we hope to classify, in convenient reference form, the physiography in and near Jamestown. The regular chemistry course needs no introduction. The registra- tion for next year taxes the capacity of the laboratory, and it be- gins to look as though we should have to build on an addition to this room if the classes keep ou growing. War prices have hit this course hard and have increased the cost of material in many cases fron1 3007, to 600721. The applied chemistry course has not as large a registration as it deserves. It is the more practical of the two for a student who does not expect to continue the study of chemistry. lt does not go so deeply into the theory of chemistry as does the regular course, but it covers more ground of a practical nature. The titles of some of the topics covered are evidence of this fact: lighting, water purification, food values, balanced rations, adulteration in food, textiles, and many others, It is usually a source of satisfaction to a student to be able to state from his own experiment that a certain baking powder is unhealthy and low in valueg that a certain variety of candy contains coal-tar dyesg that a certain thing should be used to remove grass stains, and so on. VVe liope that future candidates for chemistry will remember these things when they are about to register for the subject. and register for applied chemistry, unless they expect to take up chemistry in college. 9 O 6 0 The Department of Biologic Science is suffering from growing pains. The subject of Physiology has been practically removed from the High School curriculum, consequently, according to the State law, every G8 student must take Biology until hc passes it. So the Department of Biologic Science, formerly placed comfortably in room 15, has over- flowed and spread itself throughout the building, occupying places more or less ill-suited to its needs, However, it is hoped that next year, in spite of the lack of laboratory facilities, more time may be given to laboratory work. The classes may meet six times a week instead of five times, the extra period being given entirely to laboratory work. The individual students will thus be able to spend more time actually performing ex- periments, which is one cf the most important parts in Biology. 0000 School Banking HE School Savings Bank was first inaugurated in France in 1834, and was introduced in the United States in 1878 at Beloit, W'isconsin. lt has developed with indifferent success, but the verytforce of its valuc has brought it to the point this 'J F year, where five hundred thousand students have over five million dollars on deposit, or an everage cf twenty-five dollars to every student. This is a splendid example of what the careful con- servation of pennies will do. A lively interest is being manifested by Boards of Education throughout the country, and its general use will have a telling influence npcn the next generation. In Jamestown the school bank has been in operation about half a year, and already three thousand students have opened accounts and will this year have deposited nearly eight thousand dollars. The students of Jamestown have responded well to the call for thrift. The pennies saved by them this year, if stacked one on top of the other, would reach an altitude of about four thousand, one hundred and sixty-six feet, or seven times as high as the NVashington monument. The success is largely due to the efficient manner in which the teachers have handled the matter. Yes, Jamestown, is aware of the need of the conservation of the pennies. But, strange and sad to say, the high school has re- sponded poorly and can claim very little of that stack of pennies. NVhat is the matter with J. H. S.? Though most of the students have regular accounts in the local banks, they may place their small amounts in the school bank, and then deposit these sums in their regular banks. The devastation of liuropc places the burden of financial leadership upon America. XVe cannot stand an idle witness to the present world crisis. VVe must be prepared to meet the future and to safe-guard it against want. It is just as important to conserve our pennies as our gardens and farms. A nation wide preparedness means that we must be prepared in a financial way, as well as in a military way. I.et us join the volunteers, the call for thrift, and pay more attention to that Vtfednesday Banking Day! Charles E. Hall, '19, 60 The Commercial Department - ,Mo HERE are ten lnmdred and ninety-two students registered this year in the Jamestown High School under the Regents of the 5? State of New York. To register and classify this number of pupils, to keep necessary records and data in order to render il ls accurate reports to school and state authorities necessitates an immense amount of clerical work in the Principal's office. This fact makes it possible for the students of the commercial department of our school who enter the class for Office Work to gain under the direc- tion of the teacher much practical experience before trying to fill posi- tions of trust with the business men and women of Jamestown. I can only mention a few of the many kinds of work a member of this class is allowed to do. Office letters are transcribed from dicta- tion. This requires not only a knowledge of shorthand and type- writing but a thorough acquaintance with good business English, correct spelling and proper punctuation. XN'ords must be divided, when neces- sary, according to syllables: margins must be even and of the right width, and all other details of good form, carefully worked out, for as it has been well said, Trifles make perfection, but perfection is no trifle. - Copying from rough draft is work in which much experience is gained. The publishers of The Red and Green furnished us some of the material along this line. Many carbon copies are made of athletic permits, class lists, section lists, special programs and many other forms too numerous to mention. Business letters, legal papers and the like are taken from dictation directly on the typewriter. Letters are folded and the envelopes sealed and stamped. Multigraph copies are made of attendance and corridor permits, and many special forms required by pupils and teachers. The fact that we are doing actual work in this class gives us a special interest in it. XVe realize the necessity and importance of making no mistakes, and this drill alone is invaluable to one who wishes to enter business life well prepared to do good office work. J. C. C., '17. Q7 , xx x ' ij t Lv or-S 5 QA A 70 JAIIESTOHII H. S. 7 T ART DEPT to Q 1 The Display of Manual and Fine Arts ,QQ NE would hardly have recognized Institute Hall on May twenty- l fourth and twenty-fifth with its display of Manual and Fine Arts, ,L 5 -,i the work of students of the East Second St. Grammar and High Schools. The cooking department had two tables laden with - - the most appctizing outlay of viands prepared by members of the Domestic Science department. The sewing display included bags. fancy aprons, dolls' outfits, under garments and cooking uniforms. The greater part ol' the floor space was given to the exhibition of woodwork, including tahles, chairs, desks, lamps. hat racks, davenport, a dresser and innunrhcrahle small articles as trays. magazine racks, tahourcts, and medicine chests. The l-Iigh School manual training had screens covered with working, mechanical and architectural drawings. The talwle display of wood turning included candle sticks. lamps. howls, and hoxcs, and ctched metal work. The wall space and a large screen were devoted to the work from the .-Xrt department. This consisted of specimens in Elementary De- sign and Representation. Much of the work was exccutcd in color with the use of crayons, pastello and tempera water color. There werc about two hundred posters. all of different design, advertising Public Schools' Field Day . The High School Orchestra under thc direction of Mr. lircderick T1 Bottsford added to the pleasure of all by its musical selections, played throughout Thursday evening. The design class of the Art Department made a large number of posters advertising the Public Schools Field Day. These were distri- buted about the city and attracted a great deal of favorable comment. The New Century Art Club has generously given 515.00 to the Art Department for prizes to be awarded at the Commencement Exercises in the following manner: ' 555.00 each to the Advanced Design and Advanced Representation classes. 52.50 each to the Elementary Design and Elementary Representa- tion classes. A Miss Armstrong, who spent last year in the Philippines, gave Miss XYoodford a collection of at least one hundred fifty butterflies from the Islands to be used in connection with the art work, carefully mounted, placed under glass, and framed. They have served as motifs in much of the work of the year. It is expected that the Art Department will have some new equip- ment and improvements the coming year. The room will be redecorated and fitted with regular studio desks, thereby facilitating the work of the department. .iii 7 2 THE SENIOR CLASS OFFICERS Chester Nordstrom, President Helen Parrott, Vice-President Raymond Anderson, Secretary Elsie VVieander, Treasurer Eric Olofson, Historian Mildred Pratt, Keepe Motto Labor omnia vincit Colors Purple and Gold Flower Buttercup I Section Teachers Merton P. Corwin, Chairnlan Carrie E. Aiken Mary A. Bargar Nell D. Farman Harriett L. jones 73 r of Properties Class Honors Morgan L. Heath Marion F. Thompson Adeline E. Lindbeck Helen Parrott Elna A. Berg Hazel E. Gronberg Belle Vincent George A. Hahne Dudley B. Rice J. Leon Anderson Honorable Mention Miriam Gregg V. M. Elsie Wicander Viola L. C. Kling J. Harold Lagerdahl Clarence G. Pickard 6666 The Senior Class lg 4 5, S Freshman we aspired to mighty achievements and, endowed with unusual abilities for self-government, we organized in the Fall of 1913. ln compiling the history of the Senior Class, the historian finds Much Ado about Nothing. It seems that we have applied ourselves all too diligently to the peaceful pursuit V i of knowledge and have avoided anything in the way of social distinction. Yet, there are several events connected with our career which are worthy of mention in this brief review. One sad event marks our Freshman year-the death of a beloved classmate, our President Frank li. lfl'ilburg we remember him as a strong and helpful companion, highly esteemed by a wide circle of friends and acquaintances. lYhen the movement began in the Spring of 1914, for the purchase of the Hundred Acren property, we took an active part in promoting the scheme in financial and other ways. In brief, the founding of the School Park is a notable event iu our career. Definite information concerning a certain Freshman Council is lacking, If such a Council ever existed, it was not extraneous but quite extraordinary. Too modest to boast of intellectual achievements, we pass over our Sophomore year as uneventful. 74 XVith optomistie spirit in anticipation of the future, we entered upon our junior year. The first event was the election of officers: bl. Leon Anderson was chosen President. Under his able leadership, we set out to cultivate the graces of society, if we did nothing else. The Junior-Senior reception will long remain in the memory of man. On that eventful occasion, the Seniors came forth to enjoy our hospitality. They ate with us, they cheered for ns, and danced with us. Everybody was having a good time while juniors forgot the purple and gold that hung on the wall. Suddenly, the lights went out, rt warning shout was heard, then a mad rush up the gymnasium stairs leading to the street. When the lights came on again, our banner was gone! Thus, sadly ended the junior-Senior reception. The Senior banner had disappeared during the night of the Senior play, Suspicion fell upon us, etc. After much parleying and several private interviews with members of The Faculty, a peace council was held which resulted-in a mutual agreement to exchange banners. Last Fall, we embarked upon our Senior cruise which thus far has been uneventful. llut important engagements are expected in the near future and all decks are being cleared for action. The spirit of Patriotism predominates. The recent callrto-arms was answered from our ranks: several members enlisted in the farm cadet service and another member, Archie T. Hick, is now with Co. li. Eric Olofson. '17. Q o 4 0 A Senior Play, 1917 6 ,WN If to the time of the Senior Play, the Seniors have been dormant Q pertaining' to all social functions, but we hope we have done away, in part at least, with this reputation, and gained marked , distinction through the complete and brilliant success of Nephew or Uncle. The plot of the play was decidedly hu- ' ' morons and was well adapted to the varied abilities of the tal- ented memhers of our class, The staging of the production was in Paris in the early 13th Century. The costumes were entirely in keeping with that period and altogether becoming to the characters. I The plot centered about the striking resemblance between Nephew and Uncle and, as the play progressed, the situations created by this likeness he- came very ludicrous, and were appreciated by a large audience, as was shown by the hearty applause. The players are all deserving of much credit for their excellent work and no small mention shouhl be made of the added enjoyment of the evening afforded by the High School Orchestra, who gave several selections. 4 x The Seniors have expressed a wish to extend their sincere thanks to Miss luliana Clark whose unceasing efforts resulted in the social and financial-success of the Senior Play. Anne Olofson, '17. 9400 Good Work, Freshmen Two old grads passing 'the High School at 1:45 .April 30th, suddenly paused. Rah! Rah! Rah l-Rah! Rah! Rah l-Rah! Rah! Rah! Team! Team! Team! A great volume of sound rolled from their Alma Mater. Must he celebrating something in the Academic Study Hall. re- marked one. 1 hear the Base llall team trimmed Bradford Saturday, returned the other. And they started cm. Academic Study Hall! grunted a disgusted Freshy, hurrying tn escape three demerits. Where do you get that stuff? That is 'Norm' XYhittle and the Freshmen. Hear that squeek like 'Hermy' Arnson's tenor? The girls are yelling too. Sure enough it was the Freshmen and, gentle reader, let us inform you that this year the little fellows, just one year out of grammar school, are with us, not only in fact but also in spirit. QV, .1 ' Q Q 9 Q 'T' 76 THE JUNIOR CLASS OFFICERS Cecil Crcnl, President LeRoy Brnnstroni, Vice-President Ruth Baker, Secretary Viola Marie Anderson, Treasurer Lncile Anderson, Historian Katherine Copeland, Kee Motto Do todziy's duty today Colors Illnc :md Old Gold Flower Iforgct-me-not Section Teachers lrloward bl. Stecrc, Clixiirmzm Ifzuiny I.. Rell Grace Gifford Carl I.:iS:1llc Iilsie IC. Lcet Laura I. Stone 77 per of Properties THE SOPHOMORE CLASS OFFICERS Catherine llzxrrclt, President Sylvan Scholpp, Vice-President lvar Nelson, Secretary Otilia Carlson, Treasurer Pearl Anderson, Historian Robert Bonnevicr, Keeper of Properties Colors Crimson and Gray Flower Rod Rose Section Teachers Mary Nelson, Cllillflllilll M. May Briggs Bonny B. Dean Frances K. Donahue Grace M. Miller Rcla M. Tanner Arthur S. XN7l1ite 73 THE FRESHMEN CLASS OFFICERS Floyd Davison, President Mary Hunt, Vice-President Earl Bull, Secretary Lawrence Isaacson, 'Treasurer Annie Olson, Historizui William Guy, Keeper of Properties Motto Inveniemus :nit faciemns viznn 79 b Colors Dark Blue and XN'l1ite Flower XVl1ite Daisy Section Teachers George A. PCl'SCll,LCl'lZllI'l1lZlll Gustavus E. Bentley Mary A. Binghanl Clara F. Carpenter Juliana' Clark Calista A.1Dreager Nellie R. Hzgnd , Earl S. Palmer Agnes M. Peterson Susanne A. Ritenour Bertha M. Sehlotzer Florence B. Todd Vesta XN'illz1rzl Mabel A. NViI1izuns George XY. Xlfinslow mg S0 AT I cs ,l.H.S j.H.s ....,.,,,. ,,., . J.H.S .......A.A .A.,,... . .f l - 1 'A '1 f L Basket Ball, 191617 17 ffff If so 18 65 J.H.s ...,...... ,....,.. 2 2 1.11.5 ......,,.. .,...A.. 1 6 J.H.S .....A...A ........ 3 0 -I.H.S ,........1 .....,1. 6 8 1.11.5 .,,....,,, .....,.. 2 1 11.115 .,......., ,,.. . -is . . ......,... ....... . I H s 4' 382 ' Decided county qhgmpiqushiiz. A Lafayette ,,......,.,.... VVarren .................. H amlunrg ,...,...,...... SIllIl1'l1Z1llC3. , VX' arren .................. Meaclville ,...,,.,....... Dunkirk ........ Chautauqua Hutchinson VVestf1eld ........,,..... Dunkirk .................. 24 20 37 21 2 With no outdoor activities to claim o11r attention, interest 111 basket ball reached its height during the fall and winter of 1916-17 In place of the usual football season, J. H. S. lznmclled it first attempt 'it 111tr'1 In glancingover the long list of alumni, one experiences a thrill of reported for the Inter Section Basketball Series and of that number one hundred and four took part in four or more games. Immediately following Christmas Vacation, regular work for the first, second, and class teams began. The championship of the Inter Class League, made up of the four regular classes, the Postgraduates, and the Faculty, was won by the Sophomores who defeated all oppo- nents. The second team lost but one game to outside organizations and furnished the Varsity with excellent practice. On the first team, Sharp, Carlson, Kofod, and Hahne were veterans of at least one year's experience while Hiller and Rice had seen service in our Inter Class League and with outside teams. Prospects for a re- petition of last year's splendid record seemed bright but as is often the case, we were due for several surprises. Our team playing good, bad, and indifferent ball lost four of its first six games, then came to life and won four of the remaining five. Victories over Dunkirk, Chautauqua, and Westfield give us a clear title to the County Championship. The following table gives the individual record of all players taking part in first team games. Players Field Goals Fouls Total Points Kofod Cforwardj ,....,...,.,.,.,,,..... -.. ,... 70 16 156 Sharp fforwardl ,,,...,..,,, ....,...,.,,,......,., 3 9 10 88 Hiller Qcenter 8: forwardj ...., -. .,.. 30 0 60 Rice' fcenterjn ......,..........,.,, - ....... - ...... 17 0 34 Carlson Cguardj ....,,...,..., . ,....,.....,, 13 0 Z6 Hahne Cguardj ............. -- ...... -1 5 0 10 I.eet Qguardj-, .....,..,.... ,.... F .. 2 0 4 Kyle fforwardj ..,....... -. 1 0 2 Nord fcenterj ........... 1 0 2 178 26 382 Glxrsi'-9032 'G 82 I ! l l 1 J 5 ma ma V , I SEASON me 1911 INTER-CLASS BASKET BALL Class of 1917 The following is an enclosed account of the activities of the Senior Class during the past year P. S. The Senior Play was one of our later achievements and has been treated on a previous page with all due justice, as beflls its compnrntlve lm- portnnce. SE 5 + Ass LL sEA.soN ? 19 1 Z mfs UUCNJU 1 S June and Commencement draw near, there naturally come to 'Ai the minds of the alumni memories of -I. H. S. and of our own T graduation. In mind, we are again seated in the Senior Study Hall, singing How Can I Leave Thee, Dear, or, perhaps, Boholink, to the accompaniment of the old Study Hall piano, whose days of usefulness are now past, and whose place is occu- pied by a new instrument. VVe revisit the classroom, the Gym, the old XYillow-tree, and again consult the old Clock that keeps watch in the Tow'r. XYc even stop and peep in at Mr. Fletcher's office, the scene of so many struggles between us and the Demerit System. These, and other mind-pictures, must of necessity, be among the most treasured in the Memory-Hall of every graduate. In glancing over the long list of alumni, one experiences a thrill of pride, for is not each one doing his or her part in the work of life? Among the names, one finds doctors, lawyers, ministers. missionaries, teachers, professors and many others, all of whom are directly or in- directly, aiding in production and promoting human welfare, as Mr. Fletcher so often told us in Economics class. Now, more than ever, do our alumni have an opportunity of prov- ing their worth. And they are doing it gloriously! Many of our men, both in college and in business, have enlisted to fight, either the Germans, or-weeds and bugs. Others, both men and women, are waging fearless battle against the death and disease resulting from war. In response to their country's call, they have answered Present, as promptly and as eagerly as they ever did in the classrooms of old J. H. S. G . 'i .f ., 2' f 3 1 ,.,..... W .-ggi ni :gi A1820 87 Colgate University, Hamilton, N. Y., ltlay 5, 1917. To the Readers of the Red and Greeen : Your alumni editor has very kindly asked me to write something to be used in your publication, concerning incidents and experiences of my college life. So many and varied are the happenings in the life of a college student that one scarcely knows what to say. In the first place I wish to say that Colgate University is the biggest little college in the country. XVith a student body of about six hundred, we can be placed alongside of colleges several times as large in regard to scholastic standing, athletics, and debating. Our faculty is composed of men of the highest caliber, many of whom are regarded as authorities in their own departments. VVe are indeed for- tunate in having for our President such a man as Dr. E. B. Bryan. Our athletics speak for themselves. Any football enthusiast, who closely followed the college sport last fall, will know that Colgate stood at the top, In a sensational Thanksgiving Day game, Colgate -put to rout all of Brown's fond hopes for fame and championship by the over- whelming score of 28-0. It was a big day, long to be remembered by every Colgate man. Then, too, VValter Camp, the great football expert, recognized our worth by placing more of our men on his, All-American team than any other college in the country. Three of the eleven were Colgate men. As in football, other athletic teams have made distinctive records for the little college on the hill.'.' Some are led to believe that a college prominent in athletics cannot excel in other activities. This last winter Colgate lost but one debate out of eight. Unlike many colleges which support one or perhaps two teams, we debate with five or six teams. This shows that there are from twenty to twenty-five men on our debate teams. The excep- tionally strong Ohio-lkleslyan team until this year had never been defeated before its own student body. This was our big victory of the year. The Colgate-Vassar debate was an innovation in college debating. Colgate men dare do anything even to trying to out-talk the women. No decision was given however as to the .winner. ' ' I might speak of the Musical Clubs, Dramatic Club, College Publi- cations. Fraternities, and Clubs but time and space would not 'allow' it. If I told of our studies and professors you might think us all grinds, and if I told you of various social events you might think college students were too frivolous. However, we manage to have good times once in a while. You hear sometimes of college pranks and jokes, and I admit they are sometimes true. Such things as the discontinuance of a per- fectly good f?j performance of Uncle Tom's Cabin on account of an 88 over-supply-of very ripe fruit, vegetables, and eggs on the stage, are not unheard of m a college town. However, I don't want any of my friends to tlnnk I had anything to do with an affair so disgraceful. ? But Colgate haspnow lost a great many students. Many have joined the army or navy wlnle others have gone into industrial pursuits. lVhen are you leaving, is now the cry all over the campus. Over half the college has at tlus time left. Thanking you for this opportunity to tell you a little about my college, I am, Sincerely, S. Barton Burchard. Class of 1913. 0906 Oakdale, La., Iilay ll, 1917. Alumni liditor, Red and Green : You have asked me for some of my experiences, so I am going to tell you what I am doing and where I am living just now. I am auditing for a Lumber Company in Southwest Louisiana, about 175 miles northwest of New Orleans, 90 miles north from the Gulf and 50 miles east from the Texas border,-in the heart of the Long Leaf Yellow Pine Section. There are a great many big Saw Mills with- in a radius of 200 miles, whose products are shipped all over the United States, into Canada, and until war conditions became acute, to foreign countries. ' Four Lumber Companies have Mills at Oakdale. I work for thc Forest Lumber Company, whose general office is in Kansas City. The big timber, where our Company is cutting at present, is 6 or 7 miles out from the Mill. lVork out there is simplified by the use of Steam Skidders and Loaders. The logs are hauled in on flat cars over the Company's Railroad to the Itlill. From the first of the year, or longer, till the latter part of March. the Company was seriously handicapped in making shipments on account of the acute car shortage. Now, however, we are getting more empty cars each day and making heavy shipments.-from 10 to Z0 cars per day, with an average of about 25,000 feet of lumber per car. NVe have recently shipped several cars of lumber on an U, S. Govt. order, which is to be used in building Submarine Chasers. Another order of big timbers goes for the construction of a Cotton Mill up in Lowell, Mass. XYe ship a great many Paving lllock orders, ltridge Ties and Stringers, and very many large Timber orders. At present the Saw Mill is running Extra Quarters every week- S9 day, and the Planing Mill runs all night with a night shift. The war has not demoralized the lumber business yet. You have doubtless read of the big contract for lumber for ship-building for the 'Governtment which is to come to the Long Leaf Saw Mills of the Gulf States. The Forest Lumber Company's Saw Mill, Planing Mill, Office, Store, Hotel and Dwelling-houses form a little town of themselves, about a mile from Oakdale proper. The houses are 7, 6, 5, 4, and 3 room houses, painted in white, each with a good sized yard, enclosed by a fence with stout gates,-for there is no Stock Law here fnor in many small towns of the Southj, and cows, pigs, and horses wander where- ever pasturage is inviting. So it is a decided advantage to have your gates made to fasten securely. The patriotic gardening idea is beginning to talce hold here,-and we have further shown our patriotism by a Flag-raising at two of the Mills and in the town of Oakdale. Our flag was the first up, I am glad to say. With my greetings to all my Jamestown High School friends,- both in and out of High School,-especially to my '99 classmates, I am, Yours sincerely, Clara Green Skinner. -J. H. S. '99. 6000 Marion Cadwell has enlisted for service in France. Miss Dora Anderson has enlisted to go to France as a trained nurse. Miss Ruth Entwistle was recently married to Austin Sylvester, of XVellsville, Ohio. Dr. Bertha Stoneman is teaching in Huguenot College at XVelling- ton, South Africa. Prof. Gilbert Lee Harris holds the position of Professor of Geology at Cornell University. Mr. Wlilton G. Bentley has for twelve years been making storage batteries in Chicago, Ill. james Parker Hall holds the position of Dean in the Law School of the University of Chicago. Misses Minnie and Eleanor Hegerman are cataloguers in the Public Document Office at Wfashington, D. C. Webster Gokey has graduated from Boston Polytechnic School, and has accepted a position as a construction engineer in the U. S. navy. 90 I , l l l l l , l i l l l l l l l l Major Charles J. Bailey is Brigadier-General in the Philippines. Dr. Rollin A. Harris is connected with the United States Coast Survey of Washington, D. C. Mrs, Lucy Baker Miller of Boone University, XVu Chang, China, and Z1 former teacher in Jamestown High School, sailed from China with her husband and two children on june the second for America. The following have enlisted for service: Herve Moore, Barton Bnrchard, Willialll Osmer, XValter Hotchkiss, Arvid Eckhnrg, Ray VVall-Kerman, James Underword, Leslie Clark, Arthur Stoeltzing, Ellis Beck, Jesse Ogden. judge VVilliam L. Ransom has recently resigned his position as Judge of the City Court of the city of New York to accept a position as commissioner for New York State Pnhlic Service Commission of New York City District. 6040 To the Seniors Where are the Seniors of yesteryears? Out in the wide, wide world! And where go ye Seniors away from here? Into the wide, wide world. Oh, the world is full of a number of things, This wide, wide world 'tis true. And it holds in store great wealth galore, To every one of you. But all the Seniors of yesteryear Ont in the wide, wide world Have learned a fact since they went from here. Into the wide, wide world They have learned that fame is more than a game, And is not achieved by leaps, For the Seniors of then are Freshmen now In the school that Experience keeps. F F. . 91 H o' ii' The importance of the Exchange Department of a school paper can hardly be over estimated. Its value is found in the opportunities of comparison, benefits derived from criticism. the stimulation of whole- some competition, and the inspiration found in the success and honest efforts of others. XVe find before us Il very interesting list of school magazines and papers. Among this list, we think the Blue and Gold, Atlanta, Ga., The Minor, Birmingham, Ala. 1 The Stator, Corning, N. Y., and The Chevron, Albion, N. Y., are worthy of special mention. XVC acknowledge with thanks the following: T The Headlight, Richmond, lnd. Cherry and NVhite, XYillian1sport, Pa. The lVarrior, Salamanca, N. Y. Apokeepsian, Poughkeepsie, N. Y. The Item, Amsterdam, N. Y. The Spectator, Duluth, Minn. The Rambler, Cornwall-on-llndson, N. Y. The Polyteclmie, Troy, N. Y. The Statnr, Corning, N. Y. The Blue and Gold, Atlanta, Georgia. The Mirror, Birmingham, Ala. The Chevron, Albion, N. Y. 92 X gl I ' f 2, if NVell, friends and family, at lust I've registered to fight! I will not be Z1 slacker And I want to do what's right. They need me, and l'm going to go- But why this great alarm? I have enlisted, as 1 said, To work upon a farm! Tlxere's many a kind of fighting there For weeds, extermination Is necessary, if we have A healthy vegetation. And worms-there's scores of them! And twice as many slugs. There will prohahly he an army Of the worst potato hugs. So do not think grandiloqnent The phrase, ulllll going to fight. ,Tis warfare worthy of the name To keep the weeds from sight. l'1 help my nation all I can, In her defense l'll arm- W'ith hoe and rake and go to he A soldier on the farm! 93 7-He Gradualedji Mfg,-5 i She- How do you suppose they call the inmates of a deal' and dumb asylum to dinner? He- One of the attendants walks up :md down wringing his hands, of course. Miss Elder- You shouldn't smile so much, my dear. lt is dangerous. Miss Younge- Dangerous ? Miss Elder-'iYes. When a smile lights up your face it might touch off the powder! LOST-One picture of Kaiser XVilhelm from Room 31. Finder please return immediately to Herr LaSalle. XVJXNTED-:X few husky boys to work as farm cadets. Short hours. linsy work. Big pay. Apply XVinter Garden. Edna VVood- But I can't recite. I have a cough. Mr. VVhite- Oh well, remember it isn't the coughing that carries you off, it's the coffin they carry you off in. Chronic S210 Chapel exercises. Miss Ritenour freferring to our new choirb - Don't you think their voices have improved P Helen P.- NVell, maybe, but not cured! 94 ,t J Imagine Olive Betnns skipping school. Fat Mason looking pleasant. Herbert Freebnrg with a perfectly good 15c. shave. Mary Cowing with black hair. Patil Luce without a grin. Marie Holmquist flirting! tHorrors!j Louise Phillips with only one dress for coininenceinent. Leon Strandhurg in church. ' Eugene Davis thrust out into the cold, cold world. Madeline Kreiger laughing out loud. joe without Pricilla. Alton Shearnian acting human. Billy Laustcrer working. Cliff Osnier in lovc twith somebody clsej. Theo Brennan putting it across. Morgan Doolittle with the ricketts. Art Leet speaking naughty cuss words, Liz Allen without a beau. Leonard Crissey posing as Apollo. Charles Edward Wood jr. going to war. Catherine Shearnian with an inch of powder on her nose. Leo Engel with a hair cut. It Canlt be tlitl! Some Job! Cliff Oslner- I hear you're going to leave school, Charlie. C. E. NVood, Jr.-Yes, l have a position as a 'farm cadet'. Cliff- That So? NVhat doing? Q Charlie- Picking up peaches on a roof garden. Even as you and I Teacher- Define a vacuum. Fresh - Oh, I don't know how to say it, but I have it in head l -Exchange. 95 ill A New Invention For the last three or four years the warring nations of Europe have disclosed numerous new devices and ideas. They have also been forced to adopt measurese to regulate their food supplies. Thus Sweden compels its people to cook all potatoes before paring them to prevent waste. However clever all these devices may he, it must he admitted that they do not surpass Chester Nordstrom's new suggestion. He claims that potatoes can be grown in the Sahara Desert in a very profitable manner. The essentials of the plan are these: potatoes and onions are planted in alternate rows. The onions will make the potatoes' eyes water to such an extent that the desert sands will become fertile ground. Xlle hear that Mr. Nordstrom is to take an expedition there the coming summer. XVe wish him all kinds of success. Small Boy- What is meant hy the trough of the sea. pn Cruel l 21tl'lCl -uTl'lZlt,S what the ocean greyhounds drink out of. A Magazine Mixnp Life Qlessj ...........,,.......,.,......,.................... - ......... - .... - ......................... ..... The Ladies' Home journal. ......... .. The Modern Priscilla .. .,........ lZrerybody's . ....... - .... ...,........ - ...........,,..............., ......... The h'YOlllilll'S Home Companion ,,,. ....... , Popular Mechanics ...... ..,...,.. -.- ,... .......,. .... ..., . Vanity Fair ..............,,.............,......,.... ......... Country Life in America ......,,,.................. ........, The Literary tInjDigestQionj... ..,..,... The Independent ...........,.. ......... - ....... - ,.... The Century foldj ........... ' Snappy Stories ..,............... Cosmopolitan .................. Good Housekeeping ..... M ..... Review ol Reviews ....,,..... The VVorld's Work ...,..,.,.. Physical CultureW.-.-.,..-...-. -Exchange. School Spirit Mabel Lowe Priscilla Alling Demerits Leon Strandilzurg Leon Strandbnrg's car Gert Bloomquist Della Linnaberry The Red and Green Hildegard Eldridge bl. H. S. Copier Marie Hohnquist Mr. Stewart Regents The Graduates Miss Bealer Mr. XVinslow in 9:50 Geometry class- Don't make it hard because it's easvf' Mr. Corwin giving exercises- Now take the breathing exercises, using the elbows. Pupil reciting in Mr. Palmer's Ancient History class on the Olympian Games- The first prize awarded was a crown of olives. Mr. LaSalle very angry- If I send anybody ont of here for talking I'll keep you until the hell rings and then take you to Mr. Fletcher. Mr. XVhite giving exercises has his attention attracted by a dis- orderly yonng man- You come down front and do your breathing. Mr. Bently in Chemistry class, after carefully explaining about the inannfacture of ink, remarked-- Now, I believe we have an inkling of how ink is made. Mr. XYhite, reproving the -luniors and Seniors assembled in Room Z2 at 1:40- l have been expecting this thing to come for some time. Enter Miss Tanner. Mr. White in English Grammar class, attempting to bring out the absurdity of calling sitten the past of sit, remarked that kitten is the past of cat. Miss Bell'tin English History classl- XVlten was Christianity in- troduced into England ? Bert Slosberg- At the time of C:esar's invasion in 55 B. C. The Greatest Battle Song of All- How Can I Leave Thee ? You'll Find a Little Bit of Ireland liverywhere-Gidon Caslcey. Step This Xliay-The Office. You're In Love-lilizabeth Norquist. Very Good Eddie-Rosengren. The Big Show-LeRoy Brunstrom. Canary Cottage- Fannie Parrott. Betty-Hultquist. The Follies-Cutting Classes. 97 A Freshman's Dream One of our English Teachers requested :1 class in Freshman ling- lish to try to imagine the most enjoyable day they could possibly live. The following is what one of our future citizens dreamed and handed in on Oct. 26. The teacher has expressed the wish that we had more such real live boys.-Editor. On the next good frosty morning that comes, I am going to get up about half-past five and go chestnutting, and sneak school with an- other boy. 1 hope that day will happen to be on a day when we have a test. lX'e will take our dinner with us, but not eat any breakfast. XVe'll get chestnuts and steal apples all morning. We'll get chased by bulls and farmers, and by noon we'll feel sort of empty somewhere. XVe'll build a fire and fry eggs and roast beef and chestnuts, Oh yum, won't it taste good! Peanut butter, cheese, and ham sandwiches, roast beefs, eggs, milk, cake, apples and chestnuts will be just right, and if there is enough of them they will probably fill us up. After dinner we'll feel better, and lie down and go to sleep in the sunshine for about half an hour. Then we'll walk about five miles to the cider mill and fill up on cider. By that time it will be about time to start for home,-it is about a seven mile walk. We will pass through a little village and stop for an ice cream cone. We'll get home about seven 0'clock and eat our supper. The boy l am going with will stay at my house all night, and, for the next two weeks we'll eat chestnuts in school and make the teachers mad. v v .Q XY! ll! 'VW 9 s IEIEIEEEZRWIEEIEE EEElZlEllElEElXEE'kx'YtlHWWZlFJXi5flEECEEE!E1EEEIEEKl8lRlERBlE HIEEEIEJEIEEZI E3 if E Ph otograph s L Q E The girI's or the boy's graduation-the . June wedding-these are happy events gg which mark epochs 1n the lives of young E Eg people. E E Surely such important events are worthy ' of a picture. Let us make some for you. ,. K FI FRANK F. LEET STUDIO 5 Q H10 FENTON BUILDING No Stairs, Take Elevator Bell Phones, 957-J and 1075-J M, KODAK FINISHING D, . gl m MEI!!IFSQIHPXKRTIBIHCLEDSIZIEMEEEEEEBIMEPEEEEEEEEEEEUEEEEEEJMEIEWE EEBEEEEEBISJEEE IZEEEEfJliiIZllRllTiUELED3DZIEZEIEIEEl!EBlHEEIEIEEElEEIEEEJEKIEEEIEEEIEEQEIMEEEIEEEEEEIEIMEMEJQ ' r 1 PROVING UP Y W3 ' Buck in school days, there usually was a way to Q3 .1 prove up the answer to a problem. I ' S ' The proof was the thing that counted. f V . A bank account is the only way you can prove i , your industry. Get the proof ready. FIRST NATIONAL BANK JAMESTOWN, N. Y. is Capital and Surplus 8608000.00 x E E. Ginronu, President F. E. FELT, Cashier iq A. N. BROADIIEAD, Vice President G. E. Bnrrfrow, Asst. Cashier at EI lZBM'RIEEfEME IEEEEEiEElEiME EE EEfBElEEEEE lE WWE Ziv1i Z mam a iz :Illini viwril 53 E. Drugs of uali- 1 ty at Right 5 Prices Quality? Certainly. '1'hut's x one of our strongest points s nnd one of the things that 5 we guarantee nnd with il: 4 L Vi ri P1 ii E goes quantity, too. Our E prices are not only low on ' ,M patent medicines and other I! items, but are unusually reas- onable when it comes to the ff' drugs and household helps. 5 E And for the quantity we give ' the price is very little. Lt Winnberg Q Baivhcller ' j THE NXAL STORE i IIS Main Street Su A Li .. , . I uw mmmmwemmn sxmwnnmnmi 5 jaderstrom, Lzmdquist mmmmmmm A young n1nn's first saving should be in the form of Life Insurance. 5 the policies they hold in the ri A 1 1 Jamestown business men are proud of ii , . Dlulual Benefit Life Insurance Company j H. E. Glatn, Dist. Mgr. ' SPIEUIIIIAKCIIIE. A. W. Glull, Guo. Yvllllc c. n. cmnwu B! 'L' Q Olllce 4 Harrell Bldz. Hunn: Phono SOI gi PL EA' .14 -4 EEX Q5 MOB, Nu. 132 E1lSlSOP0lId Str:-cl Custom Tailoring ,Z Rendy-to-wear Clothing F. Men's Furnishing Goods . rn Two Stores 7711: Merfs Shop, 109 W. Tm,-.1 ElZlXlERE lElZEElX lZllE EIlEfELEl5ilElElKl8lRJ5ZJiil MIEW IEMIWE EEEEBIRMMMMMMBIBIERMRWHEEM RWEMIE IBI DZIIXIIEDIIE EIXIEHEIE fu , lil Q . . . . HE Bergwnll Printing Company Policy in u nutshell is expressed in the Golden Rule- some day it will be called the human'rule. E SI The renson why all our customers are our friends is because we know how to put ourselves in your place, whether you need merely some friendly ad- lj vice, stationery or a catalog. Q This book is one of our products BERGWALL PRINTING CO. JAMESTOWN,NEWYORK 5 . WEEE EEE Z4rZvr1i Z . I vii my 5241+211 ima VE. E024 1. in -Imiz4.izoia5az1rZ4 B ' i QJRERNEIWRE EERE MKWEMMEEEM EE 'U Y 2 R. N 3 G N Q 3 R. 'U W Q G N- S n G Q CS fl: Q. O S sp'-B E4 i,,,,. EE IEE You may be practical in your idegis of applying your wisdom in earning money, yet not be cau- r tious regarding your expenditures. Eliminate wastefulness and deposit your money where you can receive a safe interest rate on is your earnings. 3 BANK OF JAMESTOWN l 4 . . I! W as I E3 . Le 1. . T 1 . if '1 . .J Q . Capital Sl00,000.00 Surplus and Profits 9-300,000.00 Q IEIEXESI R'iEElRiEE EElE EIEH RHM -1 . . ga 91 fr -. I Q fn in M .. . -. '31 q s , K 2 as 0 H ,., ,.,,,.,..:.-Z Ag. -.... , w f . m I . W f.. X , E CWS O m p a n y QT. di K1 G E E1 n qi Style and Science Modern Methods 55 . ,fl B .n 'vl+:Y.o Q 1 ' I. W ll B 'ldl 5' g. UR M so x.:a:f..'a1e .,r.f.,:M H' H' ir H212 I' School I3 BlElE W E7 ud tsl rn G L L k d Headquarters eo. . OC WOO Q Trunks and Bags is , -A Q- Leather Goods Sample Cases ...L i- THREE STORES .. , uf w - A S5 7 West Third St. Both Phones Q 5 East Tlufd , 14 West Thlfd Jamestown, N. Y. 8 Mum Sheet if rifriivi Ziviflivlilitiiiiili 'Il E ,. EEE E E E E a 1 E E S5 El Q: Q E Q E if E if E E m Z1 E E E 55 E E E E1 L3 El 5 ur glial E m mmmmmmmmmmwmg . E . 31 . 1 L1 V E Fashionable Clothes P' F' Lewzs 85 Sons 5 g Hats and Furnishings HA DWA E gi E! Gas Fixtures Oils and Glnss ' E for I gl Stoves Roofing ill W Pipe Points , Men E V E 5 Oung Men 802-804 North Minn ,. A and llEl'HBfE B78llE3llBlEE!lD3l31!HRi'5lElMElYElElEQ2CllHEl lg lg Boys u1,il ' EEHMEElQKENEMMRlimiEl?Iq L 2 ' Charles Lambros? , E1 , 5 High Grade Chocolales E E iq ' and Bon Bous , cmyinu 0.1-mmm Fred H. Anderson Home Mode Ive Cremn, leer x Johnson Q5 Anderson 5 'mf' S f bf'f gl mcnnrovurrlcu 219 Main Street Cor. Main and Second ' mm w e mmnziinrgiuilm mnwieaziexi mnnmmwmemrliiiu glgE E EmE E EE EMEEElEMEEEEElEE ?Zl Q All the latest in snappy and up-to-date footwear, and you all H if know the price is right at this store. Q lj There is that new Cocoa Brown English. Walking Shoe for E men or women. The latest in Iwo tone L'0lILbi7Illfi07lS, wlzitey E! T ivory, brown, pearl grey and mwvtard yellow. Q Tennis, Yachting, Basket Ball and Gymnasium Shoes , M in gum rubber or fibre soles ,gi an 7 lVe make a specialty of a Regulation Basket Ball Shoe ' 81.98, just imagine and at these hard times , I . . . mel E Come in and let us get acquainted, we will be glad to show E E you through our stock lg E LESTER SHOE COMPANY ig E 23 EAST THIRD STREET CORNER PINE V SENSE AND NONSENSE There's a little hit of monkey still left in you and me. -Theo Brennen. How could VVashington he a married man and never never tell a lie.-Mr. Vlihite. Vvhat a lot of difference zi few drinks make.-Orville Coe. xfvllllll your eollar's No. 13 and your shoes are No. 3. --Tiininy Breekenbridge. No one hut your Dear Old Dad. -Mr. Fletcher. They're wearing 'em higher in Hawaii Qalso inxjamestownj. -Katherine Shearman. Throw me a Rose. -Arbor Day Exercises. Keep your eye on the Girlie you Love.-joe Fairbanks. Babes in the Wood. -Edna and Charlie. If I find a Girl-George Sund- qnist. QEditor: Hangonto her, Gig.J America. Here's My Boy. -Mildred Pratt. XVhat do you want to make these eyes at me for? -Mr. Pcrsell. SOPHOM ORE Mr. Corwin dismissing Sopho- mores at 4:-15: The boys may he dismissed by rows. I'll take care: of the girls. E4 riilll' I4 lk llvyllvlliilfi P14 E' OB 54114 WIA El E1 ENE! E1 EZ! !Z4'El 'Fill E4 PIUHJI1 . P- Soclal Stationery E El S Fa-Hey Bom Paper SQ Wedding I nviiafiofzs 3 44n7l0UCe7ll8ll,-S' E Sentiment Cardx 5 ' Birilzday Cards ,. Printing Q Engraving E' g Embossing E3 54 M 0 N A R C H 5 9 Statloneryoz-Paper Co E'il12lBlElZE 2lfilEElE3lEE ElilE Mason's-Jeweler E Sign of the Big St. Clock li See nur Watches, Diamonds and Silver Novelties Gifts in excellent taste for graduation H Martha Washington Candies re- ceived fresh every Saturday E Bl j EflE1 EElEE'lEElElE53lE l3JElX'iXi?iEBll7L'ElEllEEl8l y R. A. Parrott 1 J E E Hats Caps U Y Men's Furnishings .1 X ... E Q 'S , 110 MAIN STREET Ii EEIEEEMQEEEEWIEEEREIKTMEWERWK E4 iivtrnatm mlm EE Q14 as in mlm Eii'E4iF1lZ4rlivIltE! ram 524 f Get out in the Great Outdoors - LJ Q fit E3 xx xx ii E Why not spend week ends Ei in the woods-fishing, hunt- .I ing or just lonfing, as the Q il season or your inclination - may dictate. Q Come in and let us give you n demonstration on a Har- ley-Davidson or n Hender- son Four. -. X. . - '1 5 Londahl 8: Johnson 2ll East Third Street mm efiwmsHir nn1r11'rZi E E EEEl k M1 H si A s o E' Q5 '-EZ w 2 W E2 2E:.P1Y OD its :NQ Q H 54' ,,, - SC' ESWQ-5' rem Q N.: new O CBITQ z 'U Q 'fe S ENE! E21 5 m E Q E E E E sf r it tt EA E . H E 1 . fi 5 i rl H E rw rf 1 ri Mr. Corwin at dismissal: Now before you go pick up the floor. Gert B.- Don't you think he's simply wonderful? Fran P.- I think he's won- derfully simple. The Three Graces or LThc Graceful Threeb Messrs. Clifford Osmer, Alton Shcarmnn, and Mao Miss Miller' in 11:20 Caesar class during gymnastics: Clap 'hands over head, beginning with the left foot. At the Faculty-Freshman game. Referee Kofod: Fonl,! Fat Swanson: Oh! where are the feathers? Manager Fletcher: See here boy, this is at picked team. Mr. Corwin looming into class- room and finding the boards covered with please reservenl -- lt looks as though everything is reserved here, except the seats. Mr. Corwin to L. V. K. during physical exercises: Sit clown, Iet's see how you stand. E. K.- I was sitting in the dining room, watching the kitchen sink. Miss Gifford: VVhat Scott are you referring to? American History Student: Great Scott l lf XVhite Steere!d would Cor- win? He might possibly NVin-slow. BEMEMMWNEEEMEEZHEZEBHHBEEHHHEHBEE WHEREEEEZEEMEENEEEHEDHHHEU The Lure ofSummer and White Built Canoes EFEEZ NEEDED E K M2233 EEEEEQMAEE E K f 595239 5:.F'f',,,L-1 D.-2-T:-'rm 'gfmcm' bg NQEZEQF me P ' 71mg Q. Q G n J qw UEKLOFJ mm Esgw, :Era 239-:tn H229 S2529 'ii SE:-'Lb EEg.1F5HFf-c :ag-030:00-Gu N 9 -. 1 25325-fa 05.3 33 f1tEC:Q:r-4g.':'. Q O4 aixms N O Am.crQ Q g:a?fL Z E- ti hd g w :FFA 3 re .: -,F 'f: D igz :.Q'q E QU? ggu-gg SQ: :'E'U1'Z7J5' S: EJ-9 E ii 50822 5' 95:35. - .': c'u Ho , 2-no-H w 5.5 T o7::'5' pb Q reg! gsniumwsizmwzximzazmxzm EEREKF EEHEKM EEENMMWMEMEMEENMWE ENEEEENEWWMEEEEEEQ x r 9 - ' N is '-3 K A N fe 'L' . fiifii Tier rl gg pg . - Q J, H. ig f fi r-wl' - gi M l2 -3 ' fl Hlgh School . , N4o in ms, L, U en S K 3 WI IE m i Remember that FRANK M. CLARK'S DRUG X' L, 7 hi ZW M AND BOOK STORE is headquarters for the lg best in Athletic Goods, Eastman Kodaks and Sup- E plies, Swan Fountain Pens and Liggett's High Grade Candies. .Q R lf bf W 5 U .4 QEEEKEREEEEXZZ3EKEXREEXREEXREXXHXERRZEKXKEEXXEEKXEKFXEEEREZE , 4 E E E 'Zi ti E 'Zi ill Ei E '1 EE .l l 318112153 133 zuiziini m H4 El nwyiiiu any E4 rz4iiZny'r141rEaiv3veil any '34 in iii into 44424 m E4 v1uz4fiziis4.i14 it Emig- F. E. Armitage DIAMONDS 'Lt ri 4 I l A Fl it 'E in 54 in fl -1 R 806 PINE STREET JAMESTOWN, N. Y. NEE E E EE EEEEH ENiE EKE ,White Shoes and Slippers E for Graduation ' Ei - in 'E ' ei gg LINES SHOE STORE, 202 Main 5 XQBEE EEE'EZEE RN EE E EElEEEEElEElmEEElE'tEE E EBlEl El EiEllEElE The Red and Green for 1917 5 gi VERY year the completion of this bool: marlrs an epoch m the history of E the Jamestown High School. q Every year a new set of minds worlts Q out its malte up. qi This book, and the previous ones. sums up the inter- ' esting happenings of those passing through their school life, and is eagerly ' read by all the pupils as well as by the faculty. and the business men in the com- ,xi munity, some of whom are members of the Alumni. 1 S l happen to enjoy the distinction of being a member of the class of '88, but in Q those days we did not have any local school publication like the present impressive boolt. qi l am glad to have had the oppertunity of making some pictures of the IEE 32 clever students who have made this book a success and will be only too glad to 4 E assist them in any way possible. lg l have in stool: some very appropriate card mountings for school pictures. which E E l would lilre all the high school pupils to see. They are especially made for gradu- S ating pictures, having the rnnitials j. H. S. embossed on the covers. qi Trusting that 't' Q the worlrl have done and the work l may do will deserve ,the commendation and kg Ei future patronage of all those connected with the Jamestown High School, and thanlc- ' .gf . . . gi mg all those who have so generously supported me rn my chosen profession. E E2 l wish to be photographically at your service, ' X Z T. HENRY BLACK sruoro. iz E. ara sr. i i if SE 1 EEELXEEIEEEE EMEEEKEEEEDEEEEEE EEEEEEEEJE EREEEEREELEREEEEEEEILK Mr. Corwin: '-NSW, I'd like to hear you people stop talking. Student: But,' Mr. Corwin! You couldrft hear us if we stopped! Heard in Cooking Class. Elsie VV. fto a girl at the supply tablejz Beechy, what are you getting? Beechy: Fat l Mr. Fletcher fin Economics classj. , VValter. name two kinds of labor. NValter E.- Voluntary and in- voluntary. Miss Peterson Cdictatingj- NVe have a friend. Carolyn Brennen- XVhat kind of friend ? Miss Peterson-'lMasculine is preferred, is it not? Carolyn Brennen finnocentlyj - Yes, Ma'a1n. BEHIND THE FOOTLIGHTS A. E. L:-'KMiss Clark doesn't want me to talk when I'n1 speak- ing. . R. Larson- I have got the hardest part in the play. I have to stand and look at Francis F. for five whole minutes without laughing. F. Fiske- I beg to differ. I have to scold Robert L. for certain things when there are a whole lot of other things l'd rather tell him. MEEEM UH Graduation Footwear Our store isjull of the latest models, suitable for gradu- L ation and dress. 5 - J W I i 1 'l ld 4 5 'I '1 1 I l Fi v 4 W i 'J 1 W 4 Fl r 4 W Y i i r 4 . . Come zu and znspect our lines bqfbre you buy. il :Q il it m 4 H 3 E' 'I ' 1 1 ww i 'l Q 1 4 E? , 9 vi E . C. J. ANDERSON Q TWO STORES ,Y Corner Main and Third Streets n Q 108 East Second I 7710 Home qf F Q I lor.nhaim Shoes for Mun ft 'Z Cmui-ina Shim for G61-In Q 'f f. 2 MEEE EMX EEE E EEE W T. N. NELSON oc CO. . TOWN and COUNTRY 5 5 CLOTHES Q EERE W IZ El lil El P3 2 Ed E E EQ W lil E IZ E 211 bil El Kill IZ E lil E lillilgflli W V r IRNIEIELEJ IZEEFELEEEIEEQJ IEEKEEBEiiEEEEREIEEEEEKEEERi'KE ERlElEEEREERE IE f as ? 'L l S l T O S HITIUC S 5 Formerly The New Sherman 5 GE E3 l GEORGE F. H URLBU RT , gl Gnnarnl .llnnagar , . mm 51: 212 .lAMEs'rowN, NEW YORK 5 lm E in Ti. 31 ru -T so r JU ll!! x 1 lxxl ull' , W 732 QI College boy ' s headquarters E 1 in J 'xl ll Absolutely fireproof ' ur, pd gg pil xii' ual YG ljg ll Two hundred and hfty rooms , 1 Ei with baths EQ ' lx! V' Dx! 5 I 1 112 QI Strictly lnuropean plan Q bfi E D13 . ' ll Flfty large sample rooms gg Url ww E :xd 151 Lxxl ml In' lit! 1: pc li? - 'il 35 Good Thlngs to Eat :fr X ' N ,xx , gl A plenty, nt reasonable prices, in the cleanest, if most vxnnfbrlnlxle lunch room in town Q , :x rm ' ml . T E52 The New Samuels Quick Lzznvh Q Ir Opclljlvlll 5:J0 11. 111. lo I 11. ln. l X, Ji no rn. Ve lm G2 5 ' X 1: E I , Me.- W-, .- - ew-. , 'f zruimrminrriniimixmiilfzinrmiwmnumxxmrxmo:x.zQ1mmmm1nmrmEmmconmQifxixxxmmscxmg 1 P , , 1 .bn Nh,- vw- Xxi i 1 f ,NA X